data_1W9O
# 
_entry.id   1W9O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1W9O         
PDBE  EBI-15075    
WWPDB D_1290015075 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1N99 unspecified 'CRYSTAL STRUCTURE OF THE PDZ TANDEM OF HUMAN SYNTENIN' 
PDB 1NTE unspecified 'CRYSTAL STRUCTURE ANALYSIS OF THE SECOND PDZ DOMAIN OFSYNTENIN' 
PDB 1OBX unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF PDZ2 OF SYNTENIN WITH AN INTERLEUKIN 5 RECEPTOR ALPHA PEPTIDE.' 
PDB 1OBY unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF PDZ2 OF SYNTENIN WITH AN INTERLEUKIN 5 RECEPTOR ALPHA PEPTIDE.' 
PDB 1OBZ unspecified 
'CRYSTAL STRUCTURE OF THE COMPLEX OF THE PDZ TANDEM OF SYNTENIN WITH AN INTERLEUKIN 5 RECEPTOR ALPHA PEPTIDE.' 
PDB 1R6J unspecified 'ULTRAHIGH RESOLUTION CRYSTAL STRUCTURE OF SYNTENIN PDZ2' 
PDB 1V1T unspecified 'CRYSTAL STRUCTURE OF THE PDZ TANDEM OF HUMAN SYNTENIN WITH TNEYKV PEPTIDE' 
PDB 1W9E unspecified 'CRYSTAL STRUCTURE OF THE PDZ TANDEM OF HUMAN SYNTENIN IN COMPLEX WITH TNEFYF PEPTIDE' 
PDB 1W9Q unspecified 'CRYSTAL STRUCTURE OF THE PDZ TANDEM OF HUMAN SYNTENIN IN COMPLEX WITH TNEFAF PEPTIDE' 
PDB 1YBO unspecified 'CRYSTAL STRUCTURE OF THE PDZ TANDEM OF HUMAN SYNTENIN WITHSYNDECAN PEPTIDE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1W9O 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Grembecka, J.'   1 ? 
'Cierpicki, T.'   2 ? 
'Devedjiev, Y.'   3 ? 
'Cooper, D.R.'    4 ? 
'Derewenda, U.'   5 ? 
'Derewenda, Z.S.' 6 ? 
# 
_citation.id                        primary 
_citation.title                     'The Binding of the Pdz Tandem of Syntenin to Target Proteins.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            45 
_citation.page_first                3674 
_citation.page_last                 ? 
_citation.year                      2006 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16533050 
_citation.pdbx_database_id_DOI      10.1021/BI052225Y 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Grembecka, J.'    1 ? 
primary 'Cierpicki, T.'    2 ? 
primary 'Devedjiev, Y.'    3 ? 
primary 'Derewenda, U.'    4 ? 
primary 'Kang, B.S.'       5 ? 
primary 'Bushweller, J.H.' 6 ? 
primary 'Derewenda, Z.S.'  7 ? 
# 
_cell.entry_id           1W9O 
_cell.length_a           72.134 
_cell.length_b           72.134 
_cell.length_c           126.221 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1W9O 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SYNTENIN 1'     18018.688 2   ? ? 'PDZ TANDEM, RESIDUES 113-273' ?      
2 polymer     syn 'TNEYYV PEPTIDE' 787.814   2   ? ? ?                              TNEYYV 
3 non-polymer syn 'BENZOIC ACID'   122.121   1   ? ? ?                              ?      
4 water       nat water            18.015    199 ? ? ?                              ?      
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;SYNDECAN BINDING PROTEIN 1, MELANOMA DIFFERENTIATION ASSOCIATED PROTEIN-9, MDA-9, SCAFFOLD PROTEIN PBP1, PRO-TGF-ALPHA, CYTOPLASMIC DOMAIN-INTERACTING PROTEIN 18, TACIP18
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GAMDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKIT
MTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTI
TIMPAF
;
;GAMDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKIT
MTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTI
TIMPAF
;
A,B ? 
2 'polypeptide(L)' no no TNEYYV TNEYYV S,T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ASP n 
1 5   PRO n 
1 6   ARG n 
1 7   GLU n 
1 8   VAL n 
1 9   ILE n 
1 10  LEU n 
1 11  CYS n 
1 12  LYS n 
1 13  ASP n 
1 14  GLN n 
1 15  ASP n 
1 16  GLY n 
1 17  LYS n 
1 18  ILE n 
1 19  GLY n 
1 20  LEU n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  SER n 
1 25  ILE n 
1 26  ASP n 
1 27  ASN n 
1 28  GLY n 
1 29  ILE n 
1 30  PHE n 
1 31  VAL n 
1 32  GLN n 
1 33  LEU n 
1 34  VAL n 
1 35  GLN n 
1 36  ALA n 
1 37  ASN n 
1 38  SER n 
1 39  PRO n 
1 40  ALA n 
1 41  SER n 
1 42  LEU n 
1 43  VAL n 
1 44  GLY n 
1 45  LEU n 
1 46  ARG n 
1 47  PHE n 
1 48  GLY n 
1 49  ASP n 
1 50  GLN n 
1 51  VAL n 
1 52  LEU n 
1 53  GLN n 
1 54  ILE n 
1 55  ASN n 
1 56  GLY n 
1 57  GLU n 
1 58  ASN n 
1 59  CYS n 
1 60  ALA n 
1 61  GLY n 
1 62  TRP n 
1 63  SER n 
1 64  SER n 
1 65  ASP n 
1 66  LYS n 
1 67  ALA n 
1 68  HIS n 
1 69  LYS n 
1 70  VAL n 
1 71  LEU n 
1 72  LYS n 
1 73  GLN n 
1 74  ALA n 
1 75  PHE n 
1 76  GLY n 
1 77  GLU n 
1 78  LYS n 
1 79  ILE n 
1 80  THR n 
1 81  MET n 
1 82  THR n 
1 83  ILE n 
1 84  ARG n 
1 85  ASP n 
1 86  ARG n 
1 87  PRO n 
1 88  PHE n 
1 89  GLU n 
1 90  ARG n 
1 91  THR n 
1 92  ILE n 
1 93  THR n 
1 94  MET n 
1 95  HIS n 
1 96  LYS n 
1 97  ASP n 
1 98  SER n 
1 99  THR n 
1 100 GLY n 
1 101 HIS n 
1 102 VAL n 
1 103 GLY n 
1 104 PHE n 
1 105 ILE n 
1 106 PHE n 
1 107 LYS n 
1 108 ASN n 
1 109 GLY n 
1 110 LYS n 
1 111 ILE n 
1 112 THR n 
1 113 SER n 
1 114 ILE n 
1 115 VAL n 
1 116 LYS n 
1 117 ASP n 
1 118 SER n 
1 119 SER n 
1 120 ALA n 
1 121 ALA n 
1 122 ARG n 
1 123 ASN n 
1 124 GLY n 
1 125 LEU n 
1 126 LEU n 
1 127 THR n 
1 128 GLU n 
1 129 HIS n 
1 130 ASN n 
1 131 ILE n 
1 132 CYS n 
1 133 GLU n 
1 134 ILE n 
1 135 ASN n 
1 136 GLY n 
1 137 GLN n 
1 138 ASN n 
1 139 VAL n 
1 140 ILE n 
1 141 GLY n 
1 142 LEU n 
1 143 LYS n 
1 144 ASP n 
1 145 SER n 
1 146 GLN n 
1 147 ILE n 
1 148 ALA n 
1 149 ASP n 
1 150 ILE n 
1 151 LEU n 
1 152 SER n 
1 153 THR n 
1 154 SER n 
1 155 GLY n 
1 156 THR n 
1 157 VAL n 
1 158 VAL n 
1 159 THR n 
1 160 ILE n 
1 161 THR n 
1 162 ILE n 
1 163 MET n 
1 164 PRO n 
1 165 ALA n 
1 166 PHE n 
2 1   THR n 
2 2   ASN n 
2 3   GLU n 
2 4   TYR n 
2 5   TYR n 
2 6   VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SDCBP, MDA9, SYCL' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGST-PARALLEL1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 1W9O       1 ? ? 1W9O   ? 
2 UNP SDB1_HUMAN 1 ? ? O00560 ? 
3 PDB 1W9O       2 ? ? 1W9O   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1W9O A 1 ? 5   ? 1W9O   108 ? 112 ? 108 112 
2 2 1W9O A 6 ? 166 ? O00560 113 ? 273 ? 113 273 
3 1 1W9O B 1 ? 5   ? 1W9O   108 ? 112 ? 108 112 
4 2 1W9O B 6 ? 166 ? O00560 113 ? 273 ? 113 273 
5 3 1W9O S 1 ? 6   ? 1W9O   1   ? 6   ? 1   6   
6 3 1W9O T 1 ? 6   ? 1W9O   1   ? 6   ? 1   6   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BEZ non-polymer         . 'BENZOIC ACID'  ? 'C7 H6 O2'       122.121 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1W9O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_percent_sol   49.6 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '20% PEG3350, 0.2M NH4CL, VAPOR DIFFUSION, SITTING DROP, pH 7.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2004-02-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.04020 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             1.04020 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1W9O 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.250 
_reflns.number_obs                   16413 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            0.06600 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        29.3000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.800 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.33 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.35600 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.400 
_reflns_shell.pdbx_redundancy        5.90 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1W9O 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     15024 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            2.25 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.281 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.900 
_refine.ls_number_reflns_R_free                  945 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.925 
_refine.correlation_coeff_Fo_to_Fc_free          0.869 
_refine.B_iso_mean                               29.26 
_refine.aniso_B[1][1]                            -0.43000 
_refine.aniso_B[2][2]                            -0.43000 
_refine.aniso_B[3][3]                            0.86000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1N99' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.421 
_refine.pdbx_overall_ESU_R_Free                  0.279 
_refine.overall_SU_ML                            0.202 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.102 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2590 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             199 
_refine_hist.number_atoms_total               2798 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011 0.021 ? 2632 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002 0.020 ? 2424 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.200 1.953 ? 3542 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.783 3.000 ? 5660 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.333 5.000 ? 333  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.071 0.200 ? 413  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004 0.020 ? 2911 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002 0.020 ? 488  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.192 0.200 ? 566  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.230 0.200 ? 3021 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.080 0.200 ? 1680 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.211 0.200 ? 143  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.111 0.200 ? 29   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.241 0.200 ? 74   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.198 0.200 ? 10   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.647 1.500 ? 1665 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.202 2.000 ? 2687 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.399 3.000 ? 967  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.457 4.500 ? 855  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.25 
_refine_ls_shell.d_res_low                        2.30 
_refine_ls_shell.number_reflns_R_work             1016 
_refine_ls_shell.R_factor_R_work                  0.2500 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3300 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             72 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1W9O 
_struct.title                     'Crystal structure of the PDZ tandem of human syntenin in complex with TNEYYV peptide' 
_struct.pdbx_descriptor           'SYNTENIN 1, TNEYYV PEPTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1W9O 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'CELL ADHESION, ADHESION-COMPLEX, PDZ DOMAIN, SCAFFOLDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 38  ? VAL A 43  ? SER A 145 VAL A 150 1 ? 6  
HELX_P HELX_P2 2 SER A 63  ? GLN A 73  ? SER A 170 GLN A 180 1 ? 11 
HELX_P HELX_P3 3 SER A 118 ? ASN A 123 ? SER A 225 ASN A 230 1 ? 6  
HELX_P HELX_P4 4 LYS A 143 ? THR A 153 ? LYS A 250 THR A 260 1 ? 11 
HELX_P HELX_P5 5 SER B 38  ? VAL B 43  ? SER B 145 VAL B 150 1 ? 6  
HELX_P HELX_P6 6 SER B 63  ? GLN B 73  ? SER B 170 GLN B 180 1 ? 11 
HELX_P HELX_P7 7 SER B 118 ? GLY B 124 ? SER B 225 GLY B 231 1 ? 7  
HELX_P HELX_P8 8 LYS B 143 ? THR B 153 ? LYS B 250 THR B 260 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 4 ? 
AC ? 6 ? 
AD ? 4 ? 
BA ? 4 ? 
BB ? 2 ? 
BC ? 6 ? 
BD ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AC 5 6 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BC 4 5 ? anti-parallel 
BC 5 6 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 6   ? CYS A 11  ? ARG A 113 CYS A 118 
AA 2 LYS A 78  ? ARG A 84  ? LYS A 185 ARG A 191 
AA 3 GLN A 50  ? ILE A 54  ? GLN A 157 ILE A 161 
AA 4 GLY A 28  ? VAL A 34  ? GLY A 135 VAL A 141 
AA 5 LEU A 20  ? ILE A 25  ? LEU A 127 ILE A 132 
AB 1 ARG A 6   ? CYS A 11  ? ARG A 113 CYS A 118 
AB 2 LYS A 78  ? ARG A 84  ? LYS A 185 ARG A 191 
AB 3 GLN A 50  ? ILE A 54  ? GLN A 157 ILE A 161 
AB 4 GLU A 57  ? ASN A 58  ? GLU A 164 ASN A 165 
AC 1 ARG A 90  ? HIS A 95  ? ARG A 197 HIS A 202 
AC 2 VAL A 157 ? PRO A 164 ? VAL A 264 PRO A 271 
AC 3 HIS A 129 ? ILE A 134 ? HIS A 236 ILE A 241 
AC 4 LYS A 110 ? ILE A 114 ? LYS A 217 ILE A 221 
AC 5 PHE A 104 ? LYS A 107 ? PHE A 211 LYS A 214 
AC 6 TYR D 4   ? VAL D 6   ? TYR T 4   VAL T 6   
AD 1 ARG A 90  ? HIS A 95  ? ARG A 197 HIS A 202 
AD 2 VAL A 157 ? PRO A 164 ? VAL A 264 PRO A 271 
AD 3 HIS A 129 ? ILE A 134 ? HIS A 236 ILE A 241 
AD 4 GLN A 137 ? ASN A 138 ? GLN A 244 ASN A 245 
BA 1 ARG B 6   ? CYS B 11  ? ARG B 113 CYS B 118 
BA 2 LYS B 78  ? ARG B 84  ? LYS B 185 ARG B 191 
BA 3 GLN B 50  ? ILE B 54  ? GLN B 157 ILE B 161 
BA 4 GLU B 57  ? ASN B 58  ? GLU B 164 ASN B 165 
BB 1 LEU B 20  ? ILE B 25  ? LEU B 127 ILE B 132 
BB 2 GLY B 28  ? VAL B 34  ? GLY B 135 VAL B 141 
BC 1 ARG B 90  ? HIS B 95  ? ARG B 197 HIS B 202 
BC 2 VAL B 157 ? PRO B 164 ? VAL B 264 PRO B 271 
BC 3 HIS B 129 ? ILE B 134 ? HIS B 236 ILE B 241 
BC 4 LYS B 110 ? ILE B 114 ? LYS B 217 ILE B 221 
BC 5 PHE B 104 ? LYS B 107 ? PHE B 211 LYS B 214 
BC 6 TYR C 4   ? VAL C 6   ? TYR S 4   VAL S 6   
BD 1 ARG B 90  ? HIS B 95  ? ARG B 197 HIS B 202 
BD 2 VAL B 157 ? PRO B 164 ? VAL B 264 PRO B 271 
BD 3 HIS B 129 ? ILE B 134 ? HIS B 236 ILE B 241 
BD 4 GLN B 137 ? ASN B 138 ? GLN B 244 ASN B 245 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 10  ? N LEU A 117 O ILE A 79  ? O ILE A 186 
AA 2 3 N ARG A 84  ? N ARG A 191 O GLN A 50  ? O GLN A 157 
AA 3 4 N VAL A 51  ? N VAL A 158 O ILE A 29  ? O ILE A 136 
AA 4 5 N GLN A 32  ? N GLN A 139 O ARG A 21  ? O ARG A 128 
AB 1 2 N LEU A 10  ? N LEU A 117 O ILE A 79  ? O ILE A 186 
AB 2 3 N ARG A 84  ? N ARG A 191 O GLN A 50  ? O GLN A 157 
AB 3 4 N ILE A 54  ? N ILE A 161 O GLU A 57  ? O GLU A 164 
AC 1 2 N MET A 94  ? N MET A 201 O VAL A 158 ? O VAL A 265 
AC 2 3 N MET A 163 ? N MET A 270 O ASN A 130 ? O ASN A 237 
AC 3 4 O HIS A 129 ? O HIS A 236 N ILE A 111 ? N ILE A 218 
AC 4 5 N THR A 112 ? N THR A 219 O ILE A 105 ? O ILE A 212 
AC 5 6 N PHE A 106 ? N PHE A 213 O TYR D 4   ? O TYR T 4   
AD 1 2 N MET A 94  ? N MET A 201 O VAL A 158 ? O VAL A 265 
AD 2 3 N MET A 163 ? N MET A 270 O ASN A 130 ? O ASN A 237 
AD 3 4 N ILE A 134 ? N ILE A 241 O GLN A 137 ? O GLN A 244 
BA 1 2 N LEU B 10  ? N LEU B 117 O ILE B 79  ? O ILE B 186 
BA 2 3 N ARG B 84  ? N ARG B 191 O GLN B 50  ? O GLN B 157 
BA 3 4 N ILE B 54  ? N ILE B 161 O GLU B 57  ? O GLU B 164 
BB 1 2 N ILE B 25  ? N ILE B 132 O GLY B 28  ? O GLY B 135 
BC 1 2 N MET B 94  ? N MET B 201 O VAL B 158 ? O VAL B 265 
BC 2 3 N MET B 163 ? N MET B 270 O ASN B 130 ? O ASN B 237 
BC 3 4 O HIS B 129 ? O HIS B 236 N ILE B 111 ? N ILE B 218 
BC 4 5 N THR B 112 ? N THR B 219 O ILE B 105 ? O ILE B 212 
BC 5 6 N PHE B 106 ? N PHE B 213 O TYR C 4   ? O TYR S 4   
BD 1 2 N MET B 94  ? N MET B 201 O VAL B 158 ? O VAL B 265 
BD 2 3 N MET B 163 ? N MET B 270 O ASN B 130 ? O ASN B 237 
BD 3 4 N ILE B 134 ? N ILE B 241 O GLN B 137 ? O GLN B 244 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'BINDING SITE FOR RESIDUE BEZ A 1274' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 GLN A 35  ? GLN A 142  . ? 6_555 ? 
2 AC1 8 ASN A 37  ? ASN A 144  . ? 6_555 ? 
3 AC1 8 PRO A 39  ? PRO A 146  . ? 6_555 ? 
4 AC1 8 HIS A 95  ? HIS A 202  . ? 1_555 ? 
5 AC1 8 SER A 119 ? SER A 226  . ? 1_555 ? 
6 AC1 8 ARG A 122 ? ARG A 229  . ? 1_555 ? 
7 AC1 8 ASN A 123 ? ASN A 230  . ? 1_555 ? 
8 AC1 8 HOH F .   ? HOH A 2106 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1W9O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1W9O 
_atom_sites.fract_transf_matrix[1][1]   0.013863 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013863 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007923 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 3   ? 1.015   5.482   56.781 1.00  38.39 ? 110  MET A N   1 
ATOM   2    C CA  . MET A 1 3   ? 1.636   4.268   56.159 1.00  38.26 ? 110  MET A CA  1 
ATOM   3    C C   . MET A 1 3   ? 0.778   3.030   56.443 1.00  38.60 ? 110  MET A C   1 
ATOM   4    O O   . MET A 1 3   ? 0.523   2.215   55.554 1.00  38.93 ? 110  MET A O   1 
ATOM   5    C CB  . MET A 1 3   ? 3.050   4.053   56.704 0.010 37.72 ? 110  MET A CB  1 
ATOM   6    C CG  . MET A 1 3   ? 4.038   5.155   56.343 0.010 36.07 ? 110  MET A CG  1 
ATOM   7    S SD  . MET A 1 3   ? 4.587   5.079   54.625 0.010 33.15 ? 110  MET A SD  1 
ATOM   8    C CE  . MET A 1 3   ? 5.665   3.650   54.675 0.010 31.35 ? 110  MET A CE  1 
ATOM   9    N N   . ASP A 1 4   ? 0.324   2.914   57.688 1.00  38.69 ? 111  ASP A N   1 
ATOM   10   C CA  . ASP A 1 4   ? -0.363  1.717   58.156 1.00  38.75 ? 111  ASP A CA  1 
ATOM   11   C C   . ASP A 1 4   ? -1.857  1.754   57.844 1.00  38.29 ? 111  ASP A C   1 
ATOM   12   O O   . ASP A 1 4   ? -2.442  2.828   57.642 1.00  37.84 ? 111  ASP A O   1 
ATOM   13   C CB  . ASP A 1 4   ? -0.145  1.537   59.657 1.00  39.14 ? 111  ASP A CB  1 
ATOM   14   C CG  . ASP A 1 4   ? 1.320   1.648   60.052 1.00  41.33 ? 111  ASP A CG  1 
ATOM   15   O OD1 . ASP A 1 4   ? 2.186   1.274   59.225 1.00  42.71 ? 111  ASP A OD1 1 
ATOM   16   O OD2 . ASP A 1 4   ? 1.694   2.114   61.158 1.00  43.61 ? 111  ASP A OD2 1 
ATOM   17   N N   . PRO A 1 5   ? -2.479  0.580   57.801 1.00  37.77 ? 112  PRO A N   1 
ATOM   18   C CA  . PRO A 1 5   ? -3.920  0.508   57.536 1.00  37.54 ? 112  PRO A CA  1 
ATOM   19   C C   . PRO A 1 5   ? -4.749  0.964   58.731 1.00  37.07 ? 112  PRO A C   1 
ATOM   20   O O   . PRO A 1 5   ? -4.389  0.611   59.858 1.00  36.81 ? 112  PRO A O   1 
ATOM   21   C CB  . PRO A 1 5   ? -4.175  -0.989  57.277 1.00  37.60 ? 112  PRO A CB  1 
ATOM   22   C CG  . PRO A 1 5   ? -2.825  -1.652  57.277 1.00  38.23 ? 112  PRO A CG  1 
ATOM   23   C CD  . PRO A 1 5   ? -1.882  -0.752  58.006 1.00  37.62 ? 112  PRO A CD  1 
ATOM   24   N N   . ARG A 1 6   ? -5.814  1.732   58.484 1.00  35.89 ? 113  ARG A N   1 
ATOM   25   C CA  . ARG A 1 6   ? -6.808  2.024   59.508 1.00  35.46 ? 113  ARG A CA  1 
ATOM   26   C C   . ARG A 1 6   ? -8.082  1.234   59.272 1.00  34.83 ? 113  ARG A C   1 
ATOM   27   O O   . ARG A 1 6   ? -8.363  0.800   58.160 1.00  34.93 ? 113  ARG A O   1 
ATOM   28   C CB  . ARG A 1 6   ? -7.124  3.517   59.563 1.00  35.56 ? 113  ARG A CB  1 
ATOM   29   C CG  . ARG A 1 6   ? -7.864  4.062   58.344 1.00  35.88 ? 113  ARG A CG  1 
ATOM   30   C CD  . ARG A 1 6   ? -7.765  5.555   58.211 1.00  35.20 ? 113  ARG A CD  1 
ATOM   31   N NE  . ARG A 1 6   ? -8.692  6.049   57.208 1.00  36.09 ? 113  ARG A NE  1 
ATOM   32   C CZ  . ARG A 1 6   ? -9.962  6.392   57.423 1.00  36.33 ? 113  ARG A CZ  1 
ATOM   33   N NH1 . ARG A 1 6   ? -10.519 6.312   58.634 1.00  37.28 ? 113  ARG A NH1 1 
ATOM   34   N NH2 . ARG A 1 6   ? -10.685 6.824   56.399 1.00  35.87 ? 113  ARG A NH2 1 
ATOM   35   N N   . GLU A 1 7   ? -8.841  1.036   60.340 1.00  34.20 ? 114  GLU A N   1 
ATOM   36   C CA  . GLU A 1 7   ? -10.124 0.353   60.273 1.00  33.85 ? 114  GLU A CA  1 
ATOM   37   C C   . GLU A 1 7   ? -11.245 1.364   60.304 1.00  33.13 ? 114  GLU A C   1 
ATOM   38   O O   . GLU A 1 7   ? -11.164 2.363   60.995 1.00  33.24 ? 114  GLU A O   1 
ATOM   39   C CB  . GLU A 1 7   ? -10.272 -0.590  61.449 1.00  34.08 ? 114  GLU A CB  1 
ATOM   40   C CG  . GLU A 1 7   ? -11.565 -1.375  61.467 1.00  35.02 ? 114  GLU A CG  1 
ATOM   41   C CD  . GLU A 1 7   ? -11.640 -2.269  62.681 1.00  36.61 ? 114  GLU A CD  1 
ATOM   42   O OE1 . GLU A 1 7   ? -12.537 -2.049  63.520 1.00  37.01 ? 114  GLU A OE1 1 
ATOM   43   O OE2 . GLU A 1 7   ? -10.781 -3.171  62.795 1.00  36.54 ? 114  GLU A OE2 1 
ATOM   44   N N   . VAL A 1 8   ? -12.298 1.094   59.551 1.00  32.87 ? 115  VAL A N   1 
ATOM   45   C CA  . VAL A 1 8   ? -13.480 1.933   59.570 1.00  32.67 ? 115  VAL A CA  1 
ATOM   46   C C   . VAL A 1 8   ? -14.715 1.076   59.819 1.00  33.54 ? 115  VAL A C   1 
ATOM   47   O O   . VAL A 1 8   ? -14.757 -0.112  59.460 1.00  33.43 ? 115  VAL A O   1 
ATOM   48   C CB  . VAL A 1 8   ? -13.611 2.772   58.270 1.00  32.38 ? 115  VAL A CB  1 
ATOM   49   C CG1 . VAL A 1 8   ? -12.453 3.755   58.174 1.00  31.34 ? 115  VAL A CG1 1 
ATOM   50   C CG2 . VAL A 1 8   ? -13.678 1.889   57.023 1.00  31.05 ? 115  VAL A CG2 1 
ATOM   51   N N   . ILE A 1 9   ? -15.705 1.674   60.468 1.00  34.26 ? 116  ILE A N   1 
ATOM   52   C CA  . ILE A 1 9   ? -16.973 1.014   60.707 1.00  35.27 ? 116  ILE A CA  1 
ATOM   53   C C   . ILE A 1 9   ? -18.088 1.907   60.190 1.00  35.94 ? 116  ILE A C   1 
ATOM   54   O O   . ILE A 1 9   ? -18.204 3.054   60.590 1.00  35.67 ? 116  ILE A O   1 
ATOM   55   C CB  . ILE A 1 9   ? -17.135 0.676   62.198 1.00  35.19 ? 116  ILE A CB  1 
ATOM   56   C CG1 . ILE A 1 9   ? -15.974 -0.221  62.633 1.00  35.92 ? 116  ILE A CG1 1 
ATOM   57   C CG2 . ILE A 1 9   ? -18.448 -0.036  62.433 1.00  35.17 ? 116  ILE A CG2 1 
ATOM   58   C CD1 . ILE A 1 9   ? -16.067 -0.769  64.052 1.00  36.65 ? 116  ILE A CD1 1 
ATOM   59   N N   . LEU A 1 10  ? -18.885 1.360   59.276 1.00  37.53 ? 117  LEU A N   1 
ATOM   60   C CA  . LEU A 1 10  ? -19.945 2.091   58.586 1.00  38.82 ? 117  LEU A CA  1 
ATOM   61   C C   . LEU A 1 10  ? -21.280 1.410   58.814 1.00  40.10 ? 117  LEU A C   1 
ATOM   62   O O   . LEU A 1 10  ? -21.326 0.217   59.091 1.00  40.19 ? 117  LEU A O   1 
ATOM   63   C CB  . LEU A 1 10  ? -19.708 2.097   57.072 1.00  38.74 ? 117  LEU A CB  1 
ATOM   64   C CG  . LEU A 1 10  ? -18.386 2.552   56.462 1.00  39.05 ? 117  LEU A CG  1 
ATOM   65   C CD1 . LEU A 1 10  ? -17.357 1.450   56.519 1.00  39.46 ? 117  LEU A CD1 1 
ATOM   66   C CD2 . LEU A 1 10  ? -18.600 2.974   55.012 1.00  38.83 ? 117  LEU A CD2 1 
ATOM   67   N N   . CYS A 1 11  ? -22.362 2.167   58.635 1.00  41.74 ? 118  CYS A N   1 
ATOM   68   C CA  . CYS A 1 11  ? -23.721 1.620   58.669 1.00  43.07 ? 118  CYS A CA  1 
ATOM   69   C C   . CYS A 1 11  ? -24.363 1.585   57.285 1.00  43.50 ? 118  CYS A C   1 
ATOM   70   O O   . CYS A 1 11  ? -24.158 2.484   56.486 1.00  43.47 ? 118  CYS A O   1 
ATOM   71   C CB  . CYS A 1 11  ? -24.594 2.448   59.601 1.00  43.18 ? 118  CYS A CB  1 
ATOM   72   S SG  . CYS A 1 11  ? -24.265 2.077   61.330 1.00  46.44 ? 118  CYS A SG  1 
ATOM   73   N N   . LYS A 1 12  ? -25.147 0.542   57.025 1.00  44.18 ? 119  LYS A N   1 
ATOM   74   C CA  . LYS A 1 12  ? -25.894 0.394   55.778 1.00  44.71 ? 119  LYS A CA  1 
ATOM   75   C C   . LYS A 1 12  ? -27.163 1.248   55.788 1.00  45.01 ? 119  LYS A C   1 
ATOM   76   O O   . LYS A 1 12  ? -27.659 1.640   56.849 1.00  44.90 ? 119  LYS A O   1 
ATOM   77   C CB  . LYS A 1 12  ? -26.324 -1.065  55.583 1.00  44.79 ? 119  LYS A CB  1 
ATOM   78   C CG  . LYS A 1 12  ? -25.219 -2.031  55.158 1.00  45.98 ? 119  LYS A CG  1 
ATOM   79   C CD  . LYS A 1 12  ? -25.546 -3.472  55.589 1.00  46.79 ? 119  LYS A CD  1 
ATOM   80   C CE  . LYS A 1 12  ? -24.977 -4.517  54.632 1.00  47.31 ? 119  LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 12  ? -25.993 -5.006  53.653 1.00  46.80 ? 119  LYS A NZ  1 
ATOM   82   N N   . ASP A 1 13  ? -27.686 1.520   54.598 1.00  45.37 ? 120  ASP A N   1 
ATOM   83   C CA  . ASP A 1 13  ? -29.048 2.025   54.454 1.00  45.60 ? 120  ASP A CA  1 
ATOM   84   C C   . ASP A 1 13  ? -30.002 0.811   54.407 1.00  45.91 ? 120  ASP A C   1 
ATOM   85   O O   . ASP A 1 13  ? -29.688 -0.234  54.982 1.00  46.16 ? 120  ASP A O   1 
ATOM   86   C CB  . ASP A 1 13  ? -29.172 2.956   53.236 1.00  45.48 ? 120  ASP A CB  1 
ATOM   87   C CG  . ASP A 1 13  ? -28.998 2.242   51.914 1.00  45.31 ? 120  ASP A CG  1 
ATOM   88   O OD1 . ASP A 1 13  ? -29.069 1.003   51.882 1.00  46.30 ? 120  ASP A OD1 1 
ATOM   89   O OD2 . ASP A 1 13  ? -28.798 2.842   50.846 1.00  44.16 ? 120  ASP A OD2 1 
ATOM   90   N N   . GLN A 1 14  ? -31.142 0.935   53.729 1.00  46.16 ? 121  GLN A N   1 
ATOM   91   C CA  . GLN A 1 14  ? -32.158 -0.121  53.711 1.00  46.22 ? 121  GLN A CA  1 
ATOM   92   C C   . GLN A 1 14  ? -31.836 -1.161  52.650 1.00  46.19 ? 121  GLN A C   1 
ATOM   93   O O   . GLN A 1 14  ? -31.993 -2.357  52.874 1.00  46.80 ? 121  GLN A O   1 
ATOM   94   C CB  . GLN A 1 14  ? -33.533 0.480   53.430 1.00  46.24 ? 121  GLN A CB  1 
ATOM   95   C CG  . GLN A 1 14  ? -34.693 -0.324  53.976 1.00  46.43 ? 121  GLN A CG  1 
ATOM   96   C CD  . GLN A 1 14  ? -36.033 0.297   53.643 1.00  46.05 ? 121  GLN A CD  1 
ATOM   97   O OE1 . GLN A 1 14  ? -36.825 0.583   54.546 1.00  47.37 ? 121  GLN A OE1 1 
ATOM   98   N NE2 . GLN A 1 14  ? -36.294 0.511   52.353 1.00  44.00 ? 121  GLN A NE2 1 
ATOM   99   N N   . ASP A 1 15  ? -31.394 -0.694  51.487 1.00  45.99 ? 122  ASP A N   1 
ATOM   100  C CA  . ASP A 1 15  ? -30.934 -1.579  50.420 1.00  45.95 ? 122  ASP A CA  1 
ATOM   101  C C   . ASP A 1 15  ? -29.552 -2.172  50.700 1.00  45.16 ? 122  ASP A C   1 
ATOM   102  O O   . ASP A 1 15  ? -28.972 -2.793  49.809 1.00  45.42 ? 122  ASP A O   1 
ATOM   103  C CB  . ASP A 1 15  ? -30.881 -0.830  49.084 1.00  46.16 ? 122  ASP A CB  1 
ATOM   104  C CG  . ASP A 1 15  ? -32.248 -0.327  48.626 1.00  47.68 ? 122  ASP A CG  1 
ATOM   105  O OD1 . ASP A 1 15  ? -33.217 -0.411  49.412 1.00  49.35 ? 122  ASP A OD1 1 
ATOM   106  O OD2 . ASP A 1 15  ? -32.441 0.173   47.493 1.00  48.89 ? 122  ASP A OD2 1 
ATOM   107  N N   . GLY A 1 16  ? -29.025 -1.967  51.910 1.00  44.21 ? 123  GLY A N   1 
ATOM   108  C CA  . GLY A 1 16  ? -27.703 -2.445  52.292 1.00  43.58 ? 123  GLY A CA  1 
ATOM   109  C C   . GLY A 1 16  ? -26.497 -1.717  51.701 1.00  42.77 ? 123  GLY A C   1 
ATOM   110  O O   . GLY A 1 16  ? -25.432 -2.317  51.540 1.00  43.03 ? 123  GLY A O   1 
ATOM   111  N N   . LYS A 1 17  ? -26.639 -0.425  51.413 1.00  41.65 ? 124  LYS A N   1 
ATOM   112  C CA  . LYS A 1 17  ? -25.586 0.343   50.740 1.00  40.51 ? 124  LYS A CA  1 
ATOM   113  C C   . LYS A 1 17  ? -24.871 1.302   51.684 1.00  39.13 ? 124  LYS A C   1 
ATOM   114  O O   . LYS A 1 17  ? -25.424 1.719   52.703 1.00  38.56 ? 124  LYS A O   1 
ATOM   115  C CB  . LYS A 1 17  ? -26.161 1.127   49.557 1.00  40.79 ? 124  LYS A CB  1 
ATOM   116  C CG  . LYS A 1 17  ? -27.064 0.319   48.620 1.00  42.21 ? 124  LYS A CG  1 
ATOM   117  C CD  . LYS A 1 17  ? -26.558 0.348   47.173 1.00  44.33 ? 124  LYS A CD  1 
ATOM   118  C CE  . LYS A 1 17  ? -27.427 -0.525  46.253 1.00  45.41 ? 124  LYS A CE  1 
ATOM   119  N NZ  . LYS A 1 17  ? -26.900 -0.621  44.857 1.00  45.14 ? 124  LYS A NZ  1 
ATOM   120  N N   . ILE A 1 18  ? -23.634 1.643   51.321 1.00  37.73 ? 125  ILE A N   1 
ATOM   121  C CA  . ILE A 1 18  ? -22.809 2.568   52.093 1.00  36.66 ? 125  ILE A CA  1 
ATOM   122  C C   . ILE A 1 18  ? -22.352 3.801   51.316 1.00  35.42 ? 125  ILE A C   1 
ATOM   123  O O   . ILE A 1 18  ? -21.758 4.691   51.910 1.00  35.86 ? 125  ILE A O   1 
ATOM   124  C CB  . ILE A 1 18  ? -21.568 1.835   52.699 1.00  36.72 ? 125  ILE A CB  1 
ATOM   125  C CG1 . ILE A 1 18  ? -20.734 1.155   51.610 1.00  36.12 ? 125  ILE A CG1 1 
ATOM   126  C CG2 . ILE A 1 18  ? -22.007 0.826   53.755 1.00  36.90 ? 125  ILE A CG2 1 
ATOM   127  C CD1 . ILE A 1 18  ? -19.326 0.849   52.048 1.00  35.88 ? 125  ILE A CD1 1 
ATOM   128  N N   . GLY A 1 19  ? -22.602 3.848   50.007 1.00  34.12 ? 126  GLY A N   1 
ATOM   129  C CA  . GLY A 1 19  ? -22.275 5.009   49.182 1.00  33.25 ? 126  GLY A CA  1 
ATOM   130  C C   . GLY A 1 19  ? -20.910 4.934   48.519 1.00  32.36 ? 126  GLY A C   1 
ATOM   131  O O   . GLY A 1 19  ? -20.147 5.895   48.537 1.00  31.28 ? 126  GLY A O   1 
ATOM   132  N N   . LEU A 1 20  ? -20.635 3.796   47.892 1.00  31.76 ? 127  LEU A N   1 
ATOM   133  C CA  . LEU A 1 20  ? -19.280 3.419   47.520 1.00  31.68 ? 127  LEU A CA  1 
ATOM   134  C C   . LEU A 1 20  ? -19.252 2.580   46.240 1.00  31.48 ? 127  LEU A C   1 
ATOM   135  O O   . LEU A 1 20  ? -19.911 1.546   46.154 1.00  31.48 ? 127  LEU A O   1 
ATOM   136  C CB  . LEU A 1 20  ? -18.664 2.609   48.669 1.00  31.29 ? 127  LEU A CB  1 
ATOM   137  C CG  . LEU A 1 20  ? -17.147 2.442   48.742 1.00  31.93 ? 127  LEU A CG  1 
ATOM   138  C CD1 . LEU A 1 20  ? -16.435 3.780   48.916 1.00  31.52 ? 127  LEU A CD1 1 
ATOM   139  C CD2 . LEU A 1 20  ? -16.772 1.510   49.885 1.00  32.00 ? 127  LEU A CD2 1 
ATOM   140  N N   . ARG A 1 21  ? -18.486 3.021   45.252 1.00  30.80 ? 128  ARG A N   1 
ATOM   141  C CA  . ARG A 1 21  ? -18.161 2.173   44.115 1.00  30.71 ? 128  ARG A CA  1 
ATOM   142  C C   . ARG A 1 21  ? -16.675 1.869   44.138 1.00  29.63 ? 128  ARG A C   1 
ATOM   143  O O   . ARG A 1 21  ? -15.872 2.745   44.418 1.00  29.45 ? 128  ARG A O   1 
ATOM   144  C CB  . ARG A 1 21  ? -18.526 2.857   42.810 1.00  31.21 ? 128  ARG A CB  1 
ATOM   145  C CG  . ARG A 1 21  ? -18.412 1.939   41.602 1.00  34.65 ? 128  ARG A CG  1 
ATOM   146  C CD  . ARG A 1 21  ? -18.434 2.675   40.278 1.00  37.44 ? 128  ARG A CD  1 
ATOM   147  N NE  . ARG A 1 21  ? -19.796 2.886   39.809 1.00  40.40 ? 128  ARG A NE  1 
ATOM   148  C CZ  . ARG A 1 21  ? -20.134 3.710   38.829 1.00  43.13 ? 128  ARG A CZ  1 
ATOM   149  N NH1 . ARG A 1 21  ? -19.207 4.434   38.198 1.00  44.45 ? 128  ARG A NH1 1 
ATOM   150  N NH2 . ARG A 1 21  ? -21.414 3.812   38.478 1.00  44.39 ? 128  ARG A NH2 1 
ATOM   151  N N   . LEU A 1 22  ? -16.331 0.630   43.799 1.00  28.53 ? 129  LEU A N   1 
ATOM   152  C CA  . LEU A 1 22  ? -14.982 0.102   43.909 1.00  27.85 ? 129  LEU A CA  1 
ATOM   153  C C   . LEU A 1 22  ? -14.478 -0.370  42.564 1.00  28.10 ? 129  LEU A C   1 
ATOM   154  O O   . LEU A 1 22  ? -15.266 -0.715  41.690 1.00  28.69 ? 129  LEU A O   1 
ATOM   155  C CB  . LEU A 1 22  ? -14.949 -1.081  44.864 1.00  27.26 ? 129  LEU A CB  1 
ATOM   156  C CG  . LEU A 1 22  ? -15.485 -0.818  46.262 1.00  25.41 ? 129  LEU A CG  1 
ATOM   157  C CD1 . LEU A 1 22  ? -15.537 -2.123  47.040 1.00  25.84 ? 129  LEU A CD1 1 
ATOM   158  C CD2 . LEU A 1 22  ? -14.640 0.188   46.969 1.00  23.46 ? 129  LEU A CD2 1 
ATOM   159  N N   . LYS A 1 23  ? -13.158 -0.418  42.425 1.00  27.58 ? 130  LYS A N   1 
ATOM   160  C CA  . LYS A 1 23  ? -12.525 -0.815  41.186 1.00  27.24 ? 130  LYS A CA  1 
ATOM   161  C C   . LYS A 1 23  ? -11.412 -1.781  41.476 1.00  26.59 ? 130  LYS A C   1 
ATOM   162  O O   . LYS A 1 23  ? -10.678 -1.619  42.444 1.00  25.80 ? 130  LYS A O   1 
ATOM   163  C CB  . LYS A 1 23  ? -11.935 0.401   40.482 1.00  27.58 ? 130  LYS A CB  1 
ATOM   164  C CG  . LYS A 1 23  ? -11.324 0.111   39.118 1.00  28.72 ? 130  LYS A CG  1 
ATOM   165  C CD  . LYS A 1 23  ? -11.001 1.413   38.364 1.00  29.97 ? 130  LYS A CD  1 
ATOM   166  C CE  . LYS A 1 23  ? -10.416 1.146   36.988 1.00  31.39 ? 130  LYS A CE  1 
ATOM   167  N NZ  . LYS A 1 23  ? -9.462  2.224   36.564 1.00  33.28 ? 130  LYS A NZ  1 
ATOM   168  N N   . SER A 1 24  ? -11.277 -2.760  40.587 1.00  26.21 ? 131  SER A N   1 
ATOM   169  C CA  . SER A 1 24  ? -10.168 -3.692  40.579 1.00  26.07 ? 131  SER A CA  1 
ATOM   170  C C   . SER A 1 24  ? -8.971  -3.110  39.834 1.00  26.00 ? 131  SER A C   1 
ATOM   171  O O   . SER A 1 24  ? -9.109  -2.638  38.704 1.00  26.35 ? 131  SER A O   1 
ATOM   172  C CB  . SER A 1 24  ? -10.615 -4.991  39.930 1.00  25.87 ? 131  SER A CB  1 
ATOM   173  O OG  . SER A 1 24  ? -9.689  -5.998  40.203 1.00  26.05 ? 131  SER A OG  1 
ATOM   174  N N   . ILE A 1 25  ? -7.812  -3.109  40.494 1.00  25.64 ? 132  ILE A N   1 
ATOM   175  C CA  . ILE A 1 25  ? -6.566  -2.573  39.956 1.00  25.42 ? 132  ILE A CA  1 
ATOM   176  C C   . ILE A 1 25  ? -5.394  -3.373  40.521 1.00  25.14 ? 132  ILE A C   1 
ATOM   177  O O   . ILE A 1 25  ? -5.183  -3.373  41.732 1.00  25.41 ? 132  ILE A O   1 
ATOM   178  C CB  . ILE A 1 25  ? -6.343  -1.103  40.368 1.00  25.54 ? 132  ILE A CB  1 
ATOM   179  C CG1 . ILE A 1 25  ? -7.443  -0.170  39.844 1.00  26.28 ? 132  ILE A CG1 1 
ATOM   180  C CG2 . ILE A 1 25  ? -4.972  -0.636  39.891 1.00  25.82 ? 132  ILE A CG2 1 
ATOM   181  C CD1 . ILE A 1 25  ? -7.262  1.294   40.316 1.00  26.87 ? 132  ILE A CD1 1 
ATOM   182  N N   . ASP A 1 26  ? -4.629  -4.015  39.637 1.00  24.37 ? 133  ASP A N   1 
ATOM   183  C CA  . ASP A 1 26  ? -3.440  -4.789  39.992 1.00  24.11 ? 133  ASP A CA  1 
ATOM   184  C C   . ASP A 1 26  ? -3.677  -5.794  41.122 1.00  23.37 ? 133  ASP A C   1 
ATOM   185  O O   . ASP A 1 26  ? -2.821  -6.021  41.965 1.00  22.56 ? 133  ASP A O   1 
ATOM   186  C CB  . ASP A 1 26  ? -2.291  -3.841  40.331 1.00  24.72 ? 133  ASP A CB  1 
ATOM   187  C CG  . ASP A 1 26  ? -1.838  -3.025  39.127 1.00  25.47 ? 133  ASP A CG  1 
ATOM   188  O OD1 . ASP A 1 26  ? -2.114  -3.456  37.984 1.00  28.58 ? 133  ASP A OD1 1 
ATOM   189  O OD2 . ASP A 1 26  ? -1.192  -1.962  39.226 1.00  24.69 ? 133  ASP A OD2 1 
ATOM   190  N N   . ASN A 1 27  ? -4.860  -6.386  41.096 1.00  22.77 ? 134  ASN A N   1 
ATOM   191  C CA  . ASN A 1 27  ? -5.291  -7.428  42.019 1.00  22.67 ? 134  ASN A CA  1 
ATOM   192  C C   . ASN A 1 27  ? -5.568  -6.931  43.435 1.00  21.68 ? 134  ASN A C   1 
ATOM   193  O O   . ASN A 1 27  ? -5.710  -7.709  44.358 1.00  21.18 ? 134  ASN A O   1 
ATOM   194  C CB  . ASN A 1 27  ? -4.343  -8.643  41.972 1.00  22.73 ? 134  ASN A CB  1 
ATOM   195  C CG  . ASN A 1 27  ? -4.617  -9.523  40.756 1.00  24.68 ? 134  ASN A CG  1 
ATOM   196  O OD1 . ASN A 1 27  ? -5.713  -10.085 40.619 1.00  25.06 ? 134  ASN A OD1 1 
ATOM   197  N ND2 . ASN A 1 27  ? -3.640  -9.611  39.849 1.00  24.75 ? 134  ASN A ND2 1 
ATOM   198  N N   . GLY A 1 28  ? -5.678  -5.616  43.575 1.00  20.87 ? 135  GLY A N   1 
ATOM   199  C CA  . GLY A 1 28  ? -6.276  -5.012  44.746 1.00  19.85 ? 135  GLY A CA  1 
ATOM   200  C C   . GLY A 1 28  ? -7.599  -4.375  44.374 1.00  19.29 ? 135  GLY A C   1 
ATOM   201  O O   . GLY A 1 28  ? -8.009  -4.394  43.207 1.00  18.82 ? 135  GLY A O   1 
ATOM   202  N N   . ILE A 1 29  ? -8.261  -3.821  45.385 1.00  18.59 ? 136  ILE A N   1 
ATOM   203  C CA  . ILE A 1 29  ? -9.542  -3.140  45.256 1.00  18.37 ? 136  ILE A CA  1 
ATOM   204  C C   . ILE A 1 29  ? -9.358  -1.723  45.770 1.00  18.63 ? 136  ILE A C   1 
ATOM   205  O O   . ILE A 1 29  ? -8.710  -1.514  46.792 1.00  17.70 ? 136  ILE A O   1 
ATOM   206  C CB  . ILE A 1 29  ? -10.626 -3.880  46.057 1.00  18.27 ? 136  ILE A CB  1 
ATOM   207  C CG1 . ILE A 1 29  ? -11.085 -5.138  45.300 1.00  19.59 ? 136  ILE A CG1 1 
ATOM   208  C CG2 . ILE A 1 29  ? -11.801 -2.960  46.392 1.00  18.82 ? 136  ILE A CG2 1 
ATOM   209  C CD1 . ILE A 1 29  ? -11.958 -4.884  44.034 1.00  20.42 ? 136  ILE A CD1 1 
ATOM   210  N N   . PHE A 1 30  ? -9.908  -0.763  45.030 1.00  19.23 ? 137  PHE A N   1 
ATOM   211  C CA  . PHE A 1 30  ? -9.702  0.655   45.287 1.00  20.24 ? 137  PHE A CA  1 
ATOM   212  C C   . PHE A 1 30  ? -11.021 1.372   45.247 1.00  20.80 ? 137  PHE A C   1 
ATOM   213  O O   . PHE A 1 30  ? -11.951 0.914   44.629 1.00  20.35 ? 137  PHE A O   1 
ATOM   214  C CB  . PHE A 1 30  ? -8.711  1.251   44.275 1.00  19.98 ? 137  PHE A CB  1 
ATOM   215  C CG  . PHE A 1 30  ? -7.319  0.746   44.453 1.00  20.07 ? 137  PHE A CG  1 
ATOM   216  C CD1 . PHE A 1 30  ? -6.375  1.496   45.125 1.00  20.17 ? 137  PHE A CD1 1 
ATOM   217  C CD2 . PHE A 1 30  ? -6.966  -0.508  43.997 1.00  20.83 ? 137  PHE A CD2 1 
ATOM   218  C CE1 . PHE A 1 30  ? -5.115  1.017   45.318 1.00  20.76 ? 137  PHE A CE1 1 
ATOM   219  C CE2 . PHE A 1 30  ? -5.697  -0.982  44.185 1.00  20.40 ? 137  PHE A CE2 1 
ATOM   220  C CZ  . PHE A 1 30  ? -4.776  -0.215  44.848 1.00  21.58 ? 137  PHE A CZ  1 
ATOM   221  N N   . VAL A 1 31  ? -11.104 2.486   45.952 1.00  22.49 ? 138  VAL A N   1 
ATOM   222  C CA  . VAL A 1 31  ? -12.321 3.261   46.012 1.00  24.11 ? 138  VAL A CA  1 
ATOM   223  C C   . VAL A 1 31  ? -12.328 4.115   44.758 1.00  25.22 ? 138  VAL A C   1 
ATOM   224  O O   . VAL A 1 31  ? -11.340 4.765   44.468 1.00  24.41 ? 138  VAL A O   1 
ATOM   225  C CB  . VAL A 1 31  ? -12.351 4.130   47.278 1.00  24.20 ? 138  VAL A CB  1 
ATOM   226  C CG1 . VAL A 1 31  ? -13.476 5.134   47.218 1.00  24.83 ? 138  VAL A CG1 1 
ATOM   227  C CG2 . VAL A 1 31  ? -12.479 3.237   48.520 1.00  24.55 ? 138  VAL A CG2 1 
ATOM   228  N N   . GLN A 1 32  ? -13.428 4.054   44.006 1.00  27.20 ? 139  GLN A N   1 
ATOM   229  C CA  . GLN A 1 32  ? -13.582 4.757   42.729 1.00  29.09 ? 139  GLN A CA  1 
ATOM   230  C C   . GLN A 1 32  ? -14.590 5.919   42.860 1.00  30.06 ? 139  GLN A C   1 
ATOM   231  O O   . GLN A 1 32  ? -14.384 6.987   42.308 1.00  30.60 ? 139  GLN A O   1 
ATOM   232  C CB  . GLN A 1 32  ? -14.038 3.772   41.641 1.00  29.15 ? 139  GLN A CB  1 
ATOM   233  C CG  . GLN A 1 32  ? -14.159 4.353   40.209 1.00  31.70 ? 139  GLN A CG  1 
ATOM   234  C CD  . GLN A 1 32  ? -12.812 4.717   39.569 1.00  34.00 ? 139  GLN A CD  1 
ATOM   235  O OE1 . GLN A 1 32  ? -11.749 4.353   40.082 1.00  36.54 ? 139  GLN A OE1 1 
ATOM   236  N NE2 . GLN A 1 32  ? -12.859 5.439   38.452 1.00  35.30 ? 139  GLN A NE2 1 
ATOM   237  N N   . LEU A 1 33  ? -15.683 5.706   43.579 1.00  31.39 ? 140  LEU A N   1 
ATOM   238  C CA  . LEU A 1 33  ? -16.663 6.770   43.795 1.00  32.27 ? 140  LEU A CA  1 
ATOM   239  C C   . LEU A 1 33  ? -17.189 6.725   45.222 1.00  32.58 ? 140  LEU A C   1 
ATOM   240  O O   . LEU A 1 33  ? -17.393 5.644   45.775 1.00  32.50 ? 140  LEU A O   1 
ATOM   241  C CB  . LEU A 1 33  ? -17.821 6.630   42.796 1.00  32.41 ? 140  LEU A CB  1 
ATOM   242  C CG  . LEU A 1 33  ? -18.693 7.862   42.588 1.00  33.74 ? 140  LEU A CG  1 
ATOM   243  C CD1 . LEU A 1 33  ? -17.862 9.025   42.056 1.00  34.63 ? 140  LEU A CD1 1 
ATOM   244  C CD2 . LEU A 1 33  ? -19.865 7.544   41.635 1.00  34.53 ? 140  LEU A CD2 1 
ATOM   245  N N   . VAL A 1 34  ? -17.390 7.902   45.809 1.00  33.00 ? 141  VAL A N   1 
ATOM   246  C CA  . VAL A 1 34  ? -17.977 8.030   47.137 1.00  33.69 ? 141  VAL A CA  1 
ATOM   247  C C   . VAL A 1 34  ? -19.158 9.033   47.108 1.00  34.33 ? 141  VAL A C   1 
ATOM   248  O O   . VAL A 1 34  ? -18.954 10.244  47.023 1.00  34.14 ? 141  VAL A O   1 
ATOM   249  C CB  . VAL A 1 34  ? -16.918 8.489   48.172 1.00  33.69 ? 141  VAL A CB  1 
ATOM   250  C CG1 . VAL A 1 34  ? -17.513 8.513   49.594 1.00  33.72 ? 141  VAL A CG1 1 
ATOM   251  C CG2 . VAL A 1 34  ? -15.683 7.603   48.105 1.00  33.45 ? 141  VAL A CG2 1 
ATOM   252  N N   . GLN A 1 35  ? -20.381 8.507   47.151 1.00  34.85 ? 142  GLN A N   1 
ATOM   253  C CA  . GLN A 1 35  ? -21.591 9.322   47.209 1.00  35.32 ? 142  GLN A CA  1 
ATOM   254  C C   . GLN A 1 35  ? -21.595 10.321  48.368 1.00  35.13 ? 142  GLN A C   1 
ATOM   255  O O   . GLN A 1 35  ? -21.227 9.995   49.503 1.00  34.94 ? 142  GLN A O   1 
ATOM   256  C CB  . GLN A 1 35  ? -22.835 8.436   47.339 1.00  35.97 ? 142  GLN A CB  1 
ATOM   257  C CG  . GLN A 1 35  ? -23.371 7.894   46.020 1.00  38.60 ? 142  GLN A CG  1 
ATOM   258  C CD  . GLN A 1 35  ? -24.843 8.194   45.808 1.00  41.62 ? 142  GLN A CD  1 
ATOM   259  O OE1 . GLN A 1 35  ? -25.708 7.665   46.520 1.00  43.82 ? 142  GLN A OE1 1 
ATOM   260  N NE2 . GLN A 1 35  ? -25.135 9.039   44.824 1.00  42.75 ? 142  GLN A NE2 1 
ATOM   261  N N   . ALA A 1 36  ? -22.046 11.534  48.065 1.00  34.48 ? 143  ALA A N   1 
ATOM   262  C CA  . ALA A 1 36  ? -22.186 12.582  49.062 1.00  34.05 ? 143  ALA A CA  1 
ATOM   263  C C   . ALA A 1 36  ? -23.112 12.190  50.231 1.00  33.19 ? 143  ALA A C   1 
ATOM   264  O O   . ALA A 1 36  ? -24.168 11.562  50.042 1.00  32.91 ? 143  ALA A O   1 
ATOM   265  C CB  . ALA A 1 36  ? -22.697 13.866  48.388 1.00  34.24 ? 143  ALA A CB  1 
ATOM   266  N N   . ASN A 1 37  ? -22.702 12.586  51.432 1.00  32.45 ? 144  ASN A N   1 
ATOM   267  C CA  . ASN A 1 37  ? -23.449 12.362  52.678 1.00  31.84 ? 144  ASN A CA  1 
ATOM   268  C C   . ASN A 1 37  ? -23.755 10.902  52.987 1.00  31.04 ? 144  ASN A C   1 
ATOM   269  O O   . ASN A 1 37  ? -24.742 10.588  53.678 1.00  31.07 ? 144  ASN A O   1 
ATOM   270  C CB  . ASN A 1 37  ? -24.738 13.179  52.672 1.00  32.34 ? 144  ASN A CB  1 
ATOM   271  C CG  . ASN A 1 37  ? -24.508 14.591  52.211 1.00  32.60 ? 144  ASN A CG  1 
ATOM   272  O OD1 . ASN A 1 37  ? -23.684 15.304  52.778 1.00  33.12 ? 144  ASN A OD1 1 
ATOM   273  N ND2 . ASN A 1 37  ? -25.197 14.988  51.145 1.00  33.87 ? 144  ASN A ND2 1 
ATOM   274  N N   . SER A 1 38  ? -22.901 10.019  52.475 1.00  29.56 ? 145  SER A N   1 
ATOM   275  C CA  . SER A 1 38  ? -23.023 8.590   52.708 1.00  28.19 ? 145  SER A CA  1 
ATOM   276  C C   . SER A 1 38  ? -22.232 8.223   53.969 1.00  27.65 ? 145  SER A C   1 
ATOM   277  O O   . SER A 1 38  ? -21.396 9.000   54.443 1.00  26.83 ? 145  SER A O   1 
ATOM   278  C CB  . SER A 1 38  ? -22.466 7.827   51.514 1.00  28.23 ? 145  SER A CB  1 
ATOM   279  O OG  . SER A 1 38  ? -21.086 8.104   51.318 1.00  25.75 ? 145  SER A OG  1 
ATOM   280  N N   . PRO A 1 39  ? -22.491 7.042   54.518 1.00  26.83 ? 146  PRO A N   1 
ATOM   281  C CA  . PRO A 1 39  ? -21.613 6.476   55.551 1.00  26.38 ? 146  PRO A CA  1 
ATOM   282  C C   . PRO A 1 39  ? -20.151 6.342   55.118 1.00  25.40 ? 146  PRO A C   1 
ATOM   283  O O   . PRO A 1 39  ? -19.265 6.532   55.946 1.00  25.36 ? 146  PRO A O   1 
ATOM   284  C CB  . PRO A 1 39  ? -22.232 5.104   55.806 1.00  26.22 ? 146  PRO A CB  1 
ATOM   285  C CG  . PRO A 1 39  ? -23.646 5.296   55.444 1.00  26.28 ? 146  PRO A CG  1 
ATOM   286  C CD  . PRO A 1 39  ? -23.644 6.169   54.249 1.00  26.65 ? 146  PRO A CD  1 
ATOM   287  N N   . ALA A 1 40  ? -19.903 6.031   53.853 1.00  25.15 ? 147  ALA A N   1 
ATOM   288  C CA  . ALA A 1 40  ? -18.537 5.973   53.333 1.00  25.19 ? 147  ALA A CA  1 
ATOM   289  C C   . ALA A 1 40  ? -17.862 7.327   53.461 1.00  25.30 ? 147  ALA A C   1 
ATOM   290  O O   . ALA A 1 40  ? -16.726 7.432   53.934 1.00  25.16 ? 147  ALA A O   1 
ATOM   291  C CB  . ALA A 1 40  ? -18.522 5.490   51.877 1.00  24.93 ? 147  ALA A CB  1 
ATOM   292  N N   . SER A 1 41  ? -18.584 8.362   53.053 1.00  26.16 ? 148  SER A N   1 
ATOM   293  C CA  . SER A 1 41  ? -18.095 9.740   53.099 1.00  26.67 ? 148  SER A CA  1 
ATOM   294  C C   . SER A 1 41  ? -17.752 10.140  54.529 1.00  26.52 ? 148  SER A C   1 
ATOM   295  O O   . SER A 1 41  ? -16.731 10.768  54.792 1.00  26.52 ? 148  SER A O   1 
ATOM   296  C CB  . SER A 1 41  ? -19.171 10.687  52.522 1.00  26.97 ? 148  SER A CB  1 
ATOM   297  O OG  . SER A 1 41  ? -18.776 12.049  52.615 1.00  28.48 ? 148  SER A OG  1 
ATOM   298  N N   . LEU A 1 42  ? -18.602 9.737   55.456 1.00  26.58 ? 149  LEU A N   1 
ATOM   299  C CA  . LEU A 1 42  ? -18.491 10.179  56.836 1.00  26.77 ? 149  LEU A CA  1 
ATOM   300  C C   . LEU A 1 42  ? -17.253 9.616   57.525 1.00  26.43 ? 149  LEU A C   1 
ATOM   301  O O   . LEU A 1 42  ? -16.640 10.284  58.342 1.00  26.70 ? 149  LEU A O   1 
ATOM   302  C CB  . LEU A 1 42  ? -19.760 9.787   57.605 1.00  26.86 ? 149  LEU A CB  1 
ATOM   303  C CG  . LEU A 1 42  ? -19.866 10.300  59.040 1.00  27.16 ? 149  LEU A CG  1 
ATOM   304  C CD1 . LEU A 1 42  ? -19.999 11.807  59.036 1.00  26.55 ? 149  LEU A CD1 1 
ATOM   305  C CD2 . LEU A 1 42  ? -21.020 9.638   59.787 1.00  27.33 ? 149  LEU A CD2 1 
ATOM   306  N N   . VAL A 1 43  ? -16.874 8.393   57.174 1.00  26.41 ? 150  VAL A N   1 
ATOM   307  C CA  . VAL A 1 43  ? -15.677 7.769   57.738 1.00  25.88 ? 150  VAL A CA  1 
ATOM   308  C C   . VAL A 1 43  ? -14.382 8.149   56.988 1.00  25.52 ? 150  VAL A C   1 
ATOM   309  O O   . VAL A 1 43  ? -13.309 7.656   57.325 1.00  25.48 ? 150  VAL A O   1 
ATOM   310  C CB  . VAL A 1 43  ? -15.838 6.235   57.836 1.00  26.04 ? 150  VAL A CB  1 
ATOM   311  C CG1 . VAL A 1 43  ? -17.069 5.896   58.601 1.00  26.52 ? 150  VAL A CG1 1 
ATOM   312  C CG2 . VAL A 1 43  ? -15.900 5.570   56.475 1.00  25.79 ? 150  VAL A CG2 1 
ATOM   313  N N   . GLY A 1 44  ? -14.486 9.017   55.980 1.00  25.27 ? 151  GLY A N   1 
ATOM   314  C CA  . GLY A 1 44  ? -13.318 9.602   55.322 1.00  24.93 ? 151  GLY A CA  1 
ATOM   315  C C   . GLY A 1 44  ? -12.745 8.778   54.171 1.00  24.88 ? 151  GLY A C   1 
ATOM   316  O O   . GLY A 1 44  ? -11.587 8.954   53.806 1.00  24.94 ? 151  GLY A O   1 
ATOM   317  N N   . LEU A 1 45  ? -13.541 7.880   53.596 1.00  24.60 ? 152  LEU A N   1 
ATOM   318  C CA  . LEU A 1 45  ? -13.104 7.144   52.417 1.00  24.60 ? 152  LEU A CA  1 
ATOM   319  C C   . LEU A 1 45  ? -13.069 8.079   51.212 1.00  24.75 ? 152  LEU A C   1 
ATOM   320  O O   . LEU A 1 45  ? -13.990 8.858   51.005 1.00  24.65 ? 152  LEU A O   1 
ATOM   321  C CB  . LEU A 1 45  ? -14.021 5.970   52.136 1.00  24.70 ? 152  LEU A CB  1 
ATOM   322  C CG  . LEU A 1 45  ? -13.881 4.763   53.075 1.00  24.43 ? 152  LEU A CG  1 
ATOM   323  C CD1 . LEU A 1 45  ? -15.070 3.867   52.900 1.00  23.56 ? 152  LEU A CD1 1 
ATOM   324  C CD2 . LEU A 1 45  ? -12.602 4.009   52.792 1.00  25.65 ? 152  LEU A CD2 1 
ATOM   325  N N   . ARG A 1 46  ? -11.979 8.032   50.455 1.00  24.61 ? 153  ARG A N   1 
ATOM   326  C CA  . ARG A 1 46  ? -11.866 8.795   49.221 1.00  24.89 ? 153  ARG A CA  1 
ATOM   327  C C   . ARG A 1 46  ? -11.417 7.923   48.046 1.00  23.96 ? 153  ARG A C   1 
ATOM   328  O O   . ARG A 1 46  ? -10.842 6.851   48.220 1.00  23.22 ? 153  ARG A O   1 
ATOM   329  C CB  . ARG A 1 46  ? -10.875 9.949   49.371 1.00  24.91 ? 153  ARG A CB  1 
ATOM   330  C CG  . ARG A 1 46  ? -11.152 10.917  50.514 1.00  28.09 ? 153  ARG A CG  1 
ATOM   331  C CD  . ARG A 1 46  ? -9.888  11.452  51.160 1.00  31.31 ? 153  ARG A CD  1 
ATOM   332  N NE  . ARG A 1 46  ? -8.972  10.373  51.540 1.00  34.26 ? 153  ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 46  ? -7.687  10.548  51.877 1.00  38.37 ? 153  ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 46  ? -7.144  11.767  51.908 1.00  38.32 ? 153  ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 46  ? -6.938  9.494   52.208 1.00  39.48 ? 153  ARG A NH2 1 
ATOM   336  N N   . PHE A 1 47  ? -11.720 8.425   46.857 1.00  23.22 ? 154  PHE A N   1 
ATOM   337  C CA  . PHE A 1 47  ? -11.123 8.004   45.606 1.00  23.05 ? 154  PHE A CA  1 
ATOM   338  C C   . PHE A 1 47  ? -9.640  7.709   45.760 1.00  22.67 ? 154  PHE A C   1 
ATOM   339  O O   . PHE A 1 47  ? -8.863  8.593   46.117 1.00  22.59 ? 154  PHE A O   1 
ATOM   340  C CB  . PHE A 1 47  ? -11.304 9.156   44.612 1.00  23.64 ? 154  PHE A CB  1 
ATOM   341  C CG  . PHE A 1 47  ? -10.727 8.909   43.264 1.00  24.34 ? 154  PHE A CG  1 
ATOM   342  C CD1 . PHE A 1 47  ? -11.133 7.827   42.514 1.00  24.13 ? 154  PHE A CD1 1 
ATOM   343  C CD2 . PHE A 1 47  ? -9.787  9.776   42.736 1.00  27.50 ? 154  PHE A CD2 1 
ATOM   344  C CE1 . PHE A 1 47  ? -10.620 7.610   41.260 1.00  24.54 ? 154  PHE A CE1 1 
ATOM   345  C CE2 . PHE A 1 47  ? -9.260  9.561   41.471 1.00  27.78 ? 154  PHE A CE2 1 
ATOM   346  C CZ  . PHE A 1 47  ? -9.687  8.461   40.734 1.00  26.24 ? 154  PHE A CZ  1 
ATOM   347  N N   . GLY A 1 48  ? -9.236  6.472   45.490 1.00  21.95 ? 155  GLY A N   1 
ATOM   348  C CA  . GLY A 1 48  ? -7.824  6.108   45.546 1.00  21.50 ? 155  GLY A CA  1 
ATOM   349  C C   . GLY A 1 48  ? -7.432  5.295   46.768 1.00  20.72 ? 155  GLY A C   1 
ATOM   350  O O   . GLY A 1 48  ? -6.448  4.565   46.721 1.00  21.15 ? 155  GLY A O   1 
ATOM   351  N N   . ASP A 1 49  ? -8.172  5.427   47.866 1.00  19.94 ? 156  ASP A N   1 
ATOM   352  C CA  . ASP A 1 49  ? -8.019  4.510   49.002 1.00  18.96 ? 156  ASP A CA  1 
ATOM   353  C C   . ASP A 1 49  ? -8.036  3.031   48.548 1.00  18.33 ? 156  ASP A C   1 
ATOM   354  O O   . ASP A 1 49  ? -8.845  2.630   47.713 1.00  18.22 ? 156  ASP A O   1 
ATOM   355  C CB  . ASP A 1 49  ? -9.146  4.717   50.020 1.00  18.88 ? 156  ASP A CB  1 
ATOM   356  C CG  . ASP A 1 49  ? -9.003  6.003   50.822 1.00  19.13 ? 156  ASP A CG  1 
ATOM   357  O OD1 . ASP A 1 49  ? -7.920  6.622   50.840 1.00  17.75 ? 156  ASP A OD1 1 
ATOM   358  O OD2 . ASP A 1 49  ? -9.955  6.474   51.474 1.00  19.55 ? 156  ASP A OD2 1 
ATOM   359  N N   . GLN A 1 50  ? -7.128  2.225   49.093 1.00  18.04 ? 157  GLN A N   1 
ATOM   360  C CA  . GLN A 1 50  ? -7.129  0.780   48.860 1.00  17.68 ? 157  GLN A CA  1 
ATOM   361  C C   . GLN A 1 50  ? -7.893  0.108   49.980 1.00  17.59 ? 157  GLN A C   1 
ATOM   362  O O   . GLN A 1 50  ? -7.679  0.440   51.138 1.00  17.79 ? 157  GLN A O   1 
ATOM   363  C CB  . GLN A 1 50  ? -5.704  0.243   48.832 1.00  17.48 ? 157  GLN A CB  1 
ATOM   364  C CG  . GLN A 1 50  ? -5.611  -1.226  48.453 1.00  16.93 ? 157  GLN A CG  1 
ATOM   365  C CD  . GLN A 1 50  ? -4.184  -1.698  48.358 1.00  17.17 ? 157  GLN A CD  1 
ATOM   366  O OE1 . GLN A 1 50  ? -3.266  -0.926  48.644 1.00  16.40 ? 157  GLN A OE1 1 
ATOM   367  N NE2 . GLN A 1 50  ? -3.977  -2.964  47.933 1.00  15.10 ? 157  GLN A NE2 1 
ATOM   368  N N   . VAL A 1 51  ? -8.785  -0.815  49.631 1.00  17.39 ? 158  VAL A N   1 
ATOM   369  C CA  . VAL A 1 51  ? -9.501  -1.673  50.596 1.00  17.39 ? 158  VAL A CA  1 
ATOM   370  C C   . VAL A 1 51  ? -8.835  -3.058  50.716 1.00  17.96 ? 158  VAL A C   1 
ATOM   371  O O   . VAL A 1 51  ? -8.818  -3.857  49.758 1.00  17.88 ? 158  VAL A O   1 
ATOM   372  C CB  . VAL A 1 51  ? -10.969 -1.840  50.187 1.00  16.91 ? 158  VAL A CB  1 
ATOM   373  C CG1 . VAL A 1 51  ? -11.778 -2.475  51.297 1.00  16.49 ? 158  VAL A CG1 1 
ATOM   374  C CG2 . VAL A 1 51  ? -11.557 -0.510  49.831 1.00  16.43 ? 158  VAL A CG2 1 
ATOM   375  N N   . LEU A 1 52  ? -8.241  -3.322  51.877 1.00  18.61 ? 159  LEU A N   1 
ATOM   376  C CA  . LEU A 1 52  ? -7.545  -4.586  52.099 1.00  19.26 ? 159  LEU A CA  1 
ATOM   377  C C   . LEU A 1 52  ? -8.481  -5.685  52.533 1.00  19.40 ? 159  LEU A C   1 
ATOM   378  O O   . LEU A 1 52  ? -8.300  -6.818  52.146 1.00  20.05 ? 159  LEU A O   1 
ATOM   379  C CB  . LEU A 1 52  ? -6.441  -4.443  53.139 1.00  19.37 ? 159  LEU A CB  1 
ATOM   380  C CG  . LEU A 1 52  ? -5.438  -3.351  52.882 1.00  19.34 ? 159  LEU A CG  1 
ATOM   381  C CD1 . LEU A 1 52  ? -4.327  -3.414  53.943 1.00  19.74 ? 159  LEU A CD1 1 
ATOM   382  C CD2 . LEU A 1 52  ? -4.865  -3.494  51.505 1.00  21.92 ? 159  LEU A CD2 1 
ATOM   383  N N   . GLN A 1 53  ? -9.454  -5.348  53.369 1.00  20.10 ? 160  GLN A N   1 
ATOM   384  C CA  . GLN A 1 53  ? -10.426 -6.318  53.853 1.00  20.04 ? 160  GLN A CA  1 
ATOM   385  C C   . GLN A 1 53  ? -11.796 -5.699  53.931 1.00  20.07 ? 160  GLN A C   1 
ATOM   386  O O   . GLN A 1 53  ? -11.930 -4.501  54.142 1.00  20.29 ? 160  GLN A O   1 
ATOM   387  C CB  . GLN A 1 53  ? -10.063 -6.816  55.256 1.00  20.00 ? 160  GLN A CB  1 
ATOM   388  C CG  . GLN A 1 53  ? -8.932  -7.809  55.299 1.00  20.94 ? 160  GLN A CG  1 
ATOM   389  C CD  . GLN A 1 53  ? -7.558  -7.183  55.320 1.00  20.77 ? 160  GLN A CD  1 
ATOM   390  O OE1 . GLN A 1 53  ? -7.312  -6.209  56.026 1.00  21.75 ? 160  GLN A OE1 1 
ATOM   391  N NE2 . GLN A 1 53  ? -6.644  -7.763  54.553 1.00  25.77 ? 160  GLN A NE2 1 
ATOM   392  N N   . ILE A 1 54  ? -12.807 -6.540  53.752 1.00  19.94 ? 161  ILE A N   1 
ATOM   393  C CA  . ILE A 1 54  ? -14.177 -6.224  54.108 1.00  20.79 ? 161  ILE A CA  1 
ATOM   394  C C   . ILE A 1 54  ? -14.667 -7.314  55.087 1.00  21.53 ? 161  ILE A C   1 
ATOM   395  O O   . ILE A 1 54  ? -14.707 -8.490  54.741 1.00  22.58 ? 161  ILE A O   1 
ATOM   396  C CB  . ILE A 1 54  ? -15.031 -6.135  52.824 1.00  20.45 ? 161  ILE A CB  1 
ATOM   397  C CG1 . ILE A 1 54  ? -14.490 -5.004  51.939 1.00  19.66 ? 161  ILE A CG1 1 
ATOM   398  C CG2 . ILE A 1 54  ? -16.486 -5.870  53.154 1.00  21.42 ? 161  ILE A CG2 1 
ATOM   399  C CD1 . ILE A 1 54  ? -14.974 -5.021  50.552 1.00  20.17 ? 161  ILE A CD1 1 
ATOM   400  N N   . ASN A 1 55  ? -15.003 -6.907  56.306 1.00  22.33 ? 162  ASN A N   1 
ATOM   401  C CA  . ASN A 1 55  ? -15.336 -7.807  57.415 1.00  22.73 ? 162  ASN A CA  1 
ATOM   402  C C   . ASN A 1 55  ? -14.265 -8.911  57.648 1.00  23.54 ? 162  ASN A C   1 
ATOM   403  O O   . ASN A 1 55  ? -14.585 -10.092 57.795 1.00  23.47 ? 162  ASN A O   1 
ATOM   404  C CB  . ASN A 1 55  ? -16.755 -8.382  57.225 1.00  22.73 ? 162  ASN A CB  1 
ATOM   405  C CG  . ASN A 1 55  ? -17.842 -7.320  57.400 1.00  21.29 ? 162  ASN A CG  1 
ATOM   406  O OD1 . ASN A 1 55  ? -17.728 -6.447  58.234 1.00  21.36 ? 162  ASN A OD1 1 
ATOM   407  N ND2 . ASN A 1 55  ? -18.890 -7.404  56.617 1.00  21.24 ? 162  ASN A ND2 1 
ATOM   408  N N   . GLY A 1 56  ? -12.994 -8.506  57.654 1.00  24.01 ? 163  GLY A N   1 
ATOM   409  C CA  . GLY A 1 56  ? -11.877 -9.423  57.883 1.00  24.82 ? 163  GLY A CA  1 
ATOM   410  C C   . GLY A 1 56  ? -11.475 -10.307 56.700 1.00  25.00 ? 163  GLY A C   1 
ATOM   411  O O   . GLY A 1 56  ? -10.465 -10.987 56.766 1.00  24.74 ? 163  GLY A O   1 
ATOM   412  N N   . GLU A 1 57  ? -12.245 -10.274 55.615 1.00  25.47 ? 164  GLU A N   1 
ATOM   413  C CA  . GLU A 1 57  ? -11.999 -11.115 54.433 1.00  25.89 ? 164  GLU A CA  1 
ATOM   414  C C   . GLU A 1 57  ? -11.134 -10.337 53.406 1.00  25.25 ? 164  GLU A C   1 
ATOM   415  O O   . GLU A 1 57  ? -11.450 -9.199  53.039 1.00  25.07 ? 164  GLU A O   1 
ATOM   416  C CB  . GLU A 1 57  ? -13.360 -11.525 53.852 1.00  26.36 ? 164  GLU A CB  1 
ATOM   417  C CG  . GLU A 1 57  ? -13.326 -12.514 52.695 1.00  29.94 ? 164  GLU A CG  1 
ATOM   418  C CD  . GLU A 1 57  ? -14.713 -12.921 52.192 1.00  33.12 ? 164  GLU A CD  1 
ATOM   419  O OE1 . GLU A 1 57  ? -15.723 -12.308 52.606 1.00  33.89 ? 164  GLU A OE1 1 
ATOM   420  O OE2 . GLU A 1 57  ? -14.797 -13.865 51.362 1.00  36.32 ? 164  GLU A OE2 1 
ATOM   421  N N   . ASN A 1 58  ? -10.025 -10.935 52.978 1.00  24.12 ? 165  ASN A N   1 
ATOM   422  C CA  . ASN A 1 58  ? -9.083  -10.285 52.075 1.00  23.54 ? 165  ASN A CA  1 
ATOM   423  C C   . ASN A 1 58  ? -9.681  -9.966  50.726 1.00  23.38 ? 165  ASN A C   1 
ATOM   424  O O   . ASN A 1 58  ? -10.362 -10.802 50.135 1.00  23.81 ? 165  ASN A O   1 
ATOM   425  C CB  . ASN A 1 58  ? -7.847  -11.162 51.850 1.00  23.45 ? 165  ASN A CB  1 
ATOM   426  C CG  . ASN A 1 58  ? -6.992  -11.305 53.098 1.00  22.41 ? 165  ASN A CG  1 
ATOM   427  O OD1 . ASN A 1 58  ? -6.932  -10.398 53.958 1.00  20.55 ? 165  ASN A OD1 1 
ATOM   428  N ND2 . ASN A 1 58  ? -6.312  -12.439 53.200 1.00  19.49 ? 165  ASN A ND2 1 
ATOM   429  N N   . CYS A 1 59  ? -9.395  -8.768  50.229 1.00  22.66 ? 166  CYS A N   1 
ATOM   430  C CA  . CYS A 1 59  ? -9.975  -8.309  48.979 1.00  22.77 ? 166  CYS A CA  1 
ATOM   431  C C   . CYS A 1 59  ? -9.139  -8.748  47.789 1.00  22.83 ? 166  CYS A C   1 
ATOM   432  O O   . CYS A 1 59  ? -9.580  -8.612  46.666 1.00  23.21 ? 166  CYS A O   1 
ATOM   433  C CB  . CYS A 1 59  ? -10.159 -6.785  48.975 1.00  22.49 ? 166  CYS A CB  1 
ATOM   434  S SG  . CYS A 1 59  ? -11.397 -6.174  50.144 1.00  22.21 ? 166  CYS A SG  1 
ATOM   435  N N   . ALA A 1 60  ? -7.952  -9.295  48.038 1.00  22.92 ? 167  ALA A N   1 
ATOM   436  C CA  . ALA A 1 60  ? -6.996  -9.603  46.978 1.00  23.03 ? 167  ALA A CA  1 
ATOM   437  C C   . ALA A 1 60  ? -7.555  -10.523 45.894 1.00  22.91 ? 167  ALA A C   1 
ATOM   438  O O   . ALA A 1 60  ? -8.017  -11.628 46.181 1.00  22.80 ? 167  ALA A O   1 
ATOM   439  C CB  . ALA A 1 60  ? -5.762  -10.228 47.565 1.00  23.09 ? 167  ALA A CB  1 
ATOM   440  N N   . GLY A 1 61  ? -7.480  -10.068 44.649 1.00  22.69 ? 168  GLY A N   1 
ATOM   441  C CA  . GLY A 1 61  ? -7.884  -10.864 43.502 1.00  22.34 ? 168  GLY A CA  1 
ATOM   442  C C   . GLY A 1 61  ? -9.340  -10.689 43.140 1.00  22.01 ? 168  GLY A C   1 
ATOM   443  O O   . GLY A 1 61  ? -9.799  -11.177 42.105 1.00  22.69 ? 168  GLY A O   1 
ATOM   444  N N   . TRP A 1 62  ? -10.089 -10.017 43.994 1.00  22.04 ? 169  TRP A N   1 
ATOM   445  C CA  . TRP A 1 62  ? -11.512 -9.805  43.752 1.00  22.27 ? 169  TRP A CA  1 
ATOM   446  C C   . TRP A 1 62  ? -11.756 -8.827  42.613 1.00  22.26 ? 169  TRP A C   1 
ATOM   447  O O   . TRP A 1 62  ? -11.017 -7.873  42.427 1.00  22.34 ? 169  TRP A O   1 
ATOM   448  C CB  . TRP A 1 62  ? -12.180 -9.225  44.981 1.00  22.16 ? 169  TRP A CB  1 
ATOM   449  C CG  . TRP A 1 62  ? -12.406 -10.175 46.088 1.00  22.51 ? 169  TRP A CG  1 
ATOM   450  C CD1 . TRP A 1 62  ? -12.018 -11.480 46.160 1.00  22.65 ? 169  TRP A CD1 1 
ATOM   451  C CD2 . TRP A 1 62  ? -13.059 -9.880  47.329 1.00  22.39 ? 169  TRP A CD2 1 
ATOM   452  N NE1 . TRP A 1 62  ? -12.398 -12.018 47.365 1.00  22.43 ? 169  TRP A NE1 1 
ATOM   453  C CE2 . TRP A 1 62  ? -13.040 -11.056 48.102 1.00  21.86 ? 169  TRP A CE2 1 
ATOM   454  C CE3 . TRP A 1 62  ? -13.665 -8.736  47.862 1.00  21.17 ? 169  TRP A CE3 1 
ATOM   455  C CZ2 . TRP A 1 62  ? -13.605 -11.127 49.363 1.00  21.63 ? 169  TRP A CZ2 1 
ATOM   456  C CZ3 . TRP A 1 62  ? -14.220 -8.801  49.118 1.00  21.58 ? 169  TRP A CZ3 1 
ATOM   457  C CH2 . TRP A 1 62  ? -14.199 -9.990  49.855 1.00  22.40 ? 169  TRP A CH2 1 
ATOM   458  N N   . SER A 1 63  ? -12.818 -9.062  41.863 1.00  23.11 ? 170  SER A N   1 
ATOM   459  C CA  . SER A 1 63  ? -13.284 -8.092  40.882 1.00  23.22 ? 170  SER A CA  1 
ATOM   460  C C   . SER A 1 63  ? -14.105 -7.063  41.637 1.00  23.98 ? 170  SER A C   1 
ATOM   461  O O   . SER A 1 63  ? -14.466 -7.280  42.798 1.00  24.13 ? 170  SER A O   1 
ATOM   462  C CB  . SER A 1 63  ? -14.141 -8.782  39.829 1.00  23.22 ? 170  SER A CB  1 
ATOM   463  O OG  . SER A 1 63  ? -15.340 -9.259  40.401 1.00  21.71 ? 170  SER A OG  1 
ATOM   464  N N   . SER A 1 64  ? -14.420 -5.951  40.992 1.00  24.85 ? 171  SER A N   1 
ATOM   465  C CA  . SER A 1 64  ? -15.295 -4.974  41.628 1.00  25.59 ? 171  SER A CA  1 
ATOM   466  C C   . SER A 1 64  ? -16.686 -5.544  41.818 1.00  25.82 ? 171  SER A C   1 
ATOM   467  O O   . SER A 1 64  ? -17.316 -5.239  42.817 1.00  25.95 ? 171  SER A O   1 
ATOM   468  C CB  . SER A 1 64  ? -15.354 -3.672  40.854 1.00  25.53 ? 171  SER A CB  1 
ATOM   469  O OG  . SER A 1 64  ? -15.409 -3.931  39.481 1.00  28.10 ? 171  SER A OG  1 
ATOM   470  N N   . ASP A 1 65  ? -17.161 -6.367  40.870 1.00  26.29 ? 172  ASP A N   1 
ATOM   471  C CA  . ASP A 1 65  ? -18.466 -7.036  40.985 1.00  26.38 ? 172  ASP A CA  1 
ATOM   472  C C   . ASP A 1 65  ? -18.494 -7.940  42.254 1.00  26.99 ? 172  ASP A C   1 
ATOM   473  O O   . ASP A 1 65  ? -19.477 -7.976  42.984 1.00  26.92 ? 172  ASP A O   1 
ATOM   474  C CB  . ASP A 1 65  ? -18.791 -7.867  39.718 1.00  26.57 ? 172  ASP A CB  1 
ATOM   475  C CG  . ASP A 1 65  ? -19.345 -7.021  38.515 1.00  26.33 ? 172  ASP A CG  1 
ATOM   476  O OD1 . ASP A 1 65  ? -19.742 -5.835  38.646 1.00  25.20 ? 172  ASP A OD1 1 
ATOM   477  O OD2 . ASP A 1 65  ? -19.450 -7.517  37.367 1.00  25.78 ? 172  ASP A OD2 1 
ATOM   478  N N   . LYS A 1 66  ? -17.403 -8.651  42.519 1.00  27.66 ? 173  LYS A N   1 
ATOM   479  C CA  . LYS A 1 66  ? -17.265 -9.447  43.735 1.00  28.26 ? 173  LYS A CA  1 
ATOM   480  C C   . LYS A 1 66  ? -17.204 -8.555  44.973 1.00  28.50 ? 173  LYS A C   1 
ATOM   481  O O   . LYS A 1 66  ? -17.842 -8.831  45.984 1.00  28.66 ? 173  LYS A O   1 
ATOM   482  C CB  . LYS A 1 66  ? -16.010 -10.326 43.645 1.00  28.70 ? 173  LYS A CB  1 
ATOM   483  C CG  . LYS A 1 66  ? -15.652 -11.127 44.909 1.00  29.12 ? 173  LYS A CG  1 
ATOM   484  C CD  . LYS A 1 66  ? -16.800 -12.004 45.417 1.00  30.93 ? 173  LYS A CD  1 
ATOM   485  C CE  . LYS A 1 66  ? -16.372 -12.849 46.620 1.00  31.44 ? 173  LYS A CE  1 
ATOM   486  N NZ  . LYS A 1 66  ? -17.517 -13.620 47.215 1.00  31.95 ? 173  LYS A NZ  1 
ATOM   487  N N   . ALA A 1 67  ? -16.464 -7.458  44.894 1.00  29.10 ? 174  ALA A N   1 
ATOM   488  C CA  . ALA A 1 67  ? -16.340 -6.564  46.045 1.00  28.95 ? 174  ALA A CA  1 
ATOM   489  C C   . ALA A 1 67  ? -17.701 -6.001  46.455 1.00  29.18 ? 174  ALA A C   1 
ATOM   490  O O   . ALA A 1 67  ? -18.021 -5.937  47.647 1.00  28.66 ? 174  ALA A O   1 
ATOM   491  C CB  . ALA A 1 67  ? -15.359 -5.459  45.753 1.00  28.65 ? 174  ALA A CB  1 
ATOM   492  N N   . HIS A 1 68  ? -18.513 -5.625  45.470 1.00  29.77 ? 175  HIS A N   1 
ATOM   493  C CA  . HIS A 1 68  ? -19.817 -4.997  45.739 1.00  30.51 ? 175  HIS A CA  1 
ATOM   494  C C   . HIS A 1 68  ? -20.809 -6.000  46.299 1.00  30.97 ? 175  HIS A C   1 
ATOM   495  O O   . HIS A 1 68  ? -21.459 -5.727  47.283 1.00  31.49 ? 175  HIS A O   1 
ATOM   496  C CB  . HIS A 1 68  ? -20.391 -4.372  44.475 1.00  30.44 ? 175  HIS A CB  1 
ATOM   497  C CG  . HIS A 1 68  ? -19.626 -3.182  43.995 1.00  30.83 ? 175  HIS A CG  1 
ATOM   498  N ND1 . HIS A 1 68  ? -19.450 -2.899  42.659 1.00  31.62 ? 175  HIS A ND1 1 
ATOM   499  C CD2 . HIS A 1 68  ? -18.988 -2.202  44.674 1.00  31.64 ? 175  HIS A CD2 1 
ATOM   500  C CE1 . HIS A 1 68  ? -18.734 -1.796  42.534 1.00  31.32 ? 175  HIS A CE1 1 
ATOM   501  N NE2 . HIS A 1 68  ? -18.440 -1.356  43.743 1.00  31.09 ? 175  HIS A NE2 1 
ATOM   502  N N   . LYS A 1 69  ? -20.918 -7.148  45.633 1.00  31.70 ? 176  LYS A N   1 
ATOM   503  C CA  . LYS A 1 69  ? -21.657 -8.320  46.108 1.00  32.28 ? 176  LYS A CA  1 
ATOM   504  C C   . LYS A 1 69  ? -21.386 -8.657  47.586 1.00  32.14 ? 176  LYS A C   1 
ATOM   505  O O   . LYS A 1 69  ? -22.304 -8.978  48.322 1.00  32.18 ? 176  LYS A O   1 
ATOM   506  C CB  . LYS A 1 69  ? -21.293 -9.526  45.224 1.00  32.59 ? 176  LYS A CB  1 
ATOM   507  C CG  . LYS A 1 69  ? -22.031 -10.850 45.526 1.00  34.83 ? 176  LYS A CG  1 
ATOM   508  C CD  . LYS A 1 69  ? -21.279 -12.057 44.922 1.00  35.67 ? 176  LYS A CD  1 
ATOM   509  C CE  . LYS A 1 69  ? -22.148 -12.857 43.950 1.00  37.57 ? 176  LYS A CE  1 
ATOM   510  N NZ  . LYS A 1 69  ? -21.361 -13.711 42.981 1.00  38.02 ? 176  LYS A NZ  1 
ATOM   511  N N   . VAL A 1 70  ? -20.128 -8.585  48.010 1.00  32.21 ? 177  VAL A N   1 
ATOM   512  C CA  . VAL A 1 70  ? -19.755 -8.914  49.390 1.00  31.73 ? 177  VAL A CA  1 
ATOM   513  C C   . VAL A 1 70  ? -20.300 -7.844  50.340 1.00  31.94 ? 177  VAL A C   1 
ATOM   514  O O   . VAL A 1 70  ? -20.700 -8.159  51.455 1.00  31.31 ? 177  VAL A O   1 
ATOM   515  C CB  . VAL A 1 70  ? -18.221 -9.092  49.541 1.00  31.49 ? 177  VAL A CB  1 
ATOM   516  C CG1 . VAL A 1 70  ? -17.788 -9.127  51.015 1.00  30.83 ? 177  VAL A CG1 1 
ATOM   517  C CG2 . VAL A 1 70  ? -17.768 -10.352 48.821 1.00  30.89 ? 177  VAL A CG2 1 
ATOM   518  N N   . LEU A 1 71  ? -20.338 -6.588  49.897 1.00  32.11 ? 178  LEU A N   1 
ATOM   519  C CA  . LEU A 1 71  ? -20.937 -5.527  50.712 1.00  32.83 ? 178  LEU A CA  1 
ATOM   520  C C   . LEU A 1 71  ? -22.473 -5.669  50.809 1.00  33.61 ? 178  LEU A C   1 
ATOM   521  O O   . LEU A 1 71  ? -23.055 -5.519  51.880 1.00  32.91 ? 178  LEU A O   1 
ATOM   522  C CB  . LEU A 1 71  ? -20.557 -4.139  50.185 1.00  32.39 ? 178  LEU A CB  1 
ATOM   523  C CG  . LEU A 1 71  ? -19.100 -3.699  50.365 1.00  32.07 ? 178  LEU A CG  1 
ATOM   524  C CD1 . LEU A 1 71  ? -18.798 -2.505  49.456 1.00  31.65 ? 178  LEU A CD1 1 
ATOM   525  C CD2 . LEU A 1 71  ? -18.795 -3.343  51.803 1.00  30.73 ? 178  LEU A CD2 1 
ATOM   526  N N   . LYS A 1 72  ? -23.108 -5.974  49.684 1.00  34.84 ? 179  LYS A N   1 
ATOM   527  C CA  . LYS A 1 72  ? -24.567 -6.032  49.602 1.00  36.04 ? 179  LYS A CA  1 
ATOM   528  C C   . LYS A 1 72  ? -25.091 -7.217  50.418 1.00  36.59 ? 179  LYS A C   1 
ATOM   529  O O   . LYS A 1 72  ? -26.143 -7.121  51.053 1.00  36.59 ? 179  LYS A O   1 
ATOM   530  C CB  . LYS A 1 72  ? -25.011 -6.110  48.132 1.00  36.19 ? 179  LYS A CB  1 
ATOM   531  C CG  . LYS A 1 72  ? -26.490 -6.476  47.895 1.00  37.92 ? 179  LYS A CG  1 
ATOM   532  C CD  . LYS A 1 72  ? -27.133 -5.689  46.710 1.00  39.43 ? 179  LYS A CD  1 
ATOM   533  C CE  . LYS A 1 72  ? -27.524 -6.601  45.532 1.00  40.57 ? 179  LYS A CE  1 
ATOM   534  N NZ  . LYS A 1 72  ? -27.561 -5.854  44.210 1.00  41.79 ? 179  LYS A NZ  1 
ATOM   535  N N   . GLN A 1 73  ? -24.331 -8.312  50.435 1.00  37.15 ? 180  GLN A N   1 
ATOM   536  C CA  . GLN A 1 73  ? -24.733 -9.528  51.137 1.00  37.78 ? 180  GLN A CA  1 
ATOM   537  C C   . GLN A 1 73  ? -24.157 -9.650  52.550 1.00  37.84 ? 180  GLN A C   1 
ATOM   538  O O   . GLN A 1 73  ? -24.354 -10.659 53.205 1.00  37.73 ? 180  GLN A O   1 
ATOM   539  C CB  . GLN A 1 73  ? -24.357 -10.758 50.303 1.00  38.25 ? 180  GLN A CB  1 
ATOM   540  C CG  . GLN A 1 73  ? -25.235 -10.953 49.053 1.00  39.17 ? 180  GLN A CG  1 
ATOM   541  C CD  . GLN A 1 73  ? -24.874 -12.206 48.244 1.00  40.39 ? 180  GLN A CD  1 
ATOM   542  O OE1 . GLN A 1 73  ? -24.075 -13.032 48.688 1.00  42.20 ? 180  GLN A OE1 1 
ATOM   543  N NE2 . GLN A 1 73  ? -25.460 -12.340 47.059 1.00  40.02 ? 180  GLN A NE2 1 
ATOM   544  N N   . ALA A 1 74  ? -23.451 -8.629  53.021 1.00  38.37 ? 181  ALA A N   1 
ATOM   545  C CA  . ALA A 1 74  ? -22.852 -8.664  54.356 1.00  38.99 ? 181  ALA A CA  1 
ATOM   546  C C   . ALA A 1 74  ? -23.921 -8.683  55.437 1.00  39.67 ? 181  ALA A C   1 
ATOM   547  O O   . ALA A 1 74  ? -24.917 -7.971  55.349 1.00  39.72 ? 181  ALA A O   1 
ATOM   548  C CB  . ALA A 1 74  ? -21.944 -7.480  54.569 1.00  38.83 ? 181  ALA A CB  1 
ATOM   549  N N   . PHE A 1 75  ? -23.700 -9.484  56.469 1.00  40.63 ? 182  PHE A N   1 
ATOM   550  C CA  . PHE A 1 75  ? -24.701 -9.660  57.514 1.00  41.44 ? 182  PHE A CA  1 
ATOM   551  C C   . PHE A 1 75  ? -24.650 -8.549  58.538 1.00  41.72 ? 182  PHE A C   1 
ATOM   552  O O   . PHE A 1 75  ? -23.568 -8.077  58.910 1.00  42.06 ? 182  PHE A O   1 
ATOM   553  C CB  . PHE A 1 75  ? -24.501 -10.997 58.222 1.00  41.65 ? 182  PHE A CB  1 
ATOM   554  C CG  . PHE A 1 75  ? -24.738 -12.176 57.338 1.00  43.28 ? 182  PHE A CG  1 
ATOM   555  C CD1 . PHE A 1 75  ? -26.014 -12.455 56.873 1.00  44.57 ? 182  PHE A CD1 1 
ATOM   556  C CD2 . PHE A 1 75  ? -23.684 -13.003 56.958 1.00  44.79 ? 182  PHE A CD2 1 
ATOM   557  C CE1 . PHE A 1 75  ? -26.242 -13.541 56.045 1.00  45.22 ? 182  PHE A CE1 1 
ATOM   558  C CE2 . PHE A 1 75  ? -23.904 -14.092 56.135 1.00  45.56 ? 182  PHE A CE2 1 
ATOM   559  C CZ  . PHE A 1 75  ? -25.183 -14.363 55.675 1.00  45.46 ? 182  PHE A CZ  1 
ATOM   560  N N   . GLY A 1 76  ? -25.821 -8.154  59.016 1.00  41.90 ? 183  GLY A N   1 
ATOM   561  C CA  . GLY A 1 76  ? -25.902 -7.208  60.112 1.00  42.25 ? 183  GLY A CA  1 
ATOM   562  C C   . GLY A 1 76  ? -25.996 -5.766  59.650 1.00  42.43 ? 183  GLY A C   1 
ATOM   563  O O   . GLY A 1 76  ? -26.201 -5.475  58.463 1.00  42.39 ? 183  GLY A O   1 
ATOM   564  N N   . GLU A 1 77  ? -25.839 -4.863  60.611 1.00  42.50 ? 184  GLU A N   1 
ATOM   565  C CA  . GLU A 1 77  ? -26.060 -3.437  60.390 1.00  42.46 ? 184  GLU A CA  1 
ATOM   566  C C   . GLU A 1 77  ? -24.743 -2.716  60.122 1.00  41.62 ? 184  GLU A C   1 
ATOM   567  O O   . GLU A 1 77  ? -24.716 -1.780  59.337 1.00  42.03 ? 184  GLU A O   1 
ATOM   568  C CB  . GLU A 1 77  ? -26.805 -2.822  61.594 1.00  43.06 ? 184  GLU A CB  1 
ATOM   569  C CG  . GLU A 1 77  ? -28.283 -2.501  61.346 1.00  44.49 ? 184  GLU A CG  1 
ATOM   570  C CD  . GLU A 1 77  ? -29.078 -3.653  60.735 1.00  46.05 ? 184  GLU A CD  1 
ATOM   571  O OE1 . GLU A 1 77  ? -29.822 -4.345  61.481 1.00  46.90 ? 184  GLU A OE1 1 
ATOM   572  O OE2 . GLU A 1 77  ? -28.974 -3.860  59.499 1.00  46.63 ? 184  GLU A OE2 1 
ATOM   573  N N   . LYS A 1 78  ? -23.657 -3.157  60.755 1.00  40.49 ? 185  LYS A N   1 
ATOM   574  C CA  . LYS A 1 78  ? -22.335 -2.567  60.524 1.00  39.83 ? 185  LYS A CA  1 
ATOM   575  C C   . LYS A 1 78  ? -21.497 -3.386  59.553 1.00  38.75 ? 185  LYS A C   1 
ATOM   576  O O   . LYS A 1 78  ? -21.525 -4.612  59.593 1.00  38.65 ? 185  LYS A O   1 
ATOM   577  C CB  . LYS A 1 78  ? -21.559 -2.434  61.836 1.00  39.94 ? 185  LYS A CB  1 
ATOM   578  C CG  . LYS A 1 78  ? -22.008 -1.285  62.687 1.00  41.15 ? 185  LYS A CG  1 
ATOM   579  C CD  . LYS A 1 78  ? -21.338 -1.321  64.040 1.00  43.08 ? 185  LYS A CD  1 
ATOM   580  C CE  . LYS A 1 78  ? -21.258 0.072   64.661 1.00  44.31 ? 185  LYS A CE  1 
ATOM   581  N NZ  . LYS A 1 78  ? -22.575 0.566   65.164 1.00  44.98 ? 185  LYS A NZ  1 
ATOM   582  N N   . ILE A 1 79  ? -20.760 -2.685  58.684 1.00  37.29 ? 186  ILE A N   1 
ATOM   583  C CA  . ILE A 1 79  ? -19.723 -3.271  57.851 1.00  35.87 ? 186  ILE A CA  1 
ATOM   584  C C   . ILE A 1 79  ? -18.404 -2.685  58.323 1.00  34.45 ? 186  ILE A C   1 
ATOM   585  O O   . ILE A 1 79  ? -18.282 -1.484  58.539 1.00  34.49 ? 186  ILE A O   1 
ATOM   586  C CB  . ILE A 1 79  ? -19.975 -2.967  56.336 1.00  36.18 ? 186  ILE A CB  1 
ATOM   587  C CG1 . ILE A 1 79  ? -20.623 -4.164  55.645 1.00  37.66 ? 186  ILE A CG1 1 
ATOM   588  C CG2 . ILE A 1 79  ? -18.687 -2.671  55.587 1.00  35.67 ? 186  ILE A CG2 1 
ATOM   589  C CD1 . ILE A 1 79  ? -21.460 -3.792  54.428 1.00  39.33 ? 186  ILE A CD1 1 
ATOM   590  N N   . THR A 1 80  ? -17.411 -3.542  58.493 1.00  32.60 ? 187  THR A N   1 
ATOM   591  C CA  . THR A 1 80  ? -16.070 -3.106  58.826 1.00  31.06 ? 187  THR A CA  1 
ATOM   592  C C   . THR A 1 80  ? -15.183 -3.225  57.597 1.00  28.90 ? 187  THR A C   1 
ATOM   593  O O   . THR A 1 80  ? -15.297 -4.171  56.835 1.00  28.85 ? 187  THR A O   1 
ATOM   594  C CB  . THR A 1 80  ? -15.537 -3.958  59.963 1.00  31.10 ? 187  THR A CB  1 
ATOM   595  O OG1 . THR A 1 80  ? -16.350 -3.741  61.118 1.00  32.41 ? 187  THR A OG1 1 
ATOM   596  C CG2 . THR A 1 80  ? -14.144 -3.506  60.405 1.00  31.50 ? 187  THR A CG2 1 
ATOM   597  N N   . MET A 1 81  ? -14.326 -2.245  57.384 1.00  26.94 ? 188  MET A N   1 
ATOM   598  C CA  . MET A 1 81  ? -13.327 -2.331  56.324 1.00  25.79 ? 188  MET A CA  1 
ATOM   599  C C   . MET A 1 81  ? -11.970 -1.963  56.864 1.00  24.62 ? 188  MET A C   1 
ATOM   600  O O   . MET A 1 81  ? -11.841 -1.128  57.764 1.00  23.98 ? 188  MET A O   1 
ATOM   601  C CB  . MET A 1 81  ? -13.690 -1.425  55.147 1.00  25.73 ? 188  MET A CB  1 
ATOM   602  C CG  . MET A 1 81  ? -15.028 -1.746  54.509 1.00  25.59 ? 188  MET A CG  1 
ATOM   603  S SD  . MET A 1 81  ? -15.552 -0.463  53.341 1.00  26.64 ? 188  MET A SD  1 
ATOM   604  C CE  . MET A 1 81  ? -14.735 -0.964  51.988 1.00  26.72 ? 188  MET A CE  1 
ATOM   605  N N   . THR A 1 82  ? -10.952 -2.615  56.328 1.00  24.10 ? 189  THR A N   1 
ATOM   606  C CA  . THR A 1 82  ? -9.582  -2.258  56.627 1.00  23.71 ? 189  THR A CA  1 
ATOM   607  C C   . THR A 1 82  ? -9.033  -1.554  55.401 1.00  23.43 ? 189  THR A C   1 
ATOM   608  O O   . THR A 1 82  ? -9.164  -2.048  54.271 1.00  22.89 ? 189  THR A O   1 
ATOM   609  C CB  . THR A 1 82  ? -8.789  -3.498  57.020 1.00  24.03 ? 189  THR A CB  1 
ATOM   610  O OG1 . THR A 1 82  ? -9.334  -4.031  58.237 1.00  25.36 ? 189  THR A OG1 1 
ATOM   611  C CG2 . THR A 1 82  ? -7.323  -3.145  57.364 1.00  23.74 ? 189  THR A CG2 1 
ATOM   612  N N   . ILE A 1 83  ? -8.438  -0.391  55.633 1.00  23.09 ? 190  ILE A N   1 
ATOM   613  C CA  . ILE A 1 83  ? -8.189  0.570   54.574 1.00  23.60 ? 190  ILE A CA  1 
ATOM   614  C C   . ILE A 1 83  ? -6.747  1.027   54.594 1.00  23.61 ? 190  ILE A C   1 
ATOM   615  O O   . ILE A 1 83  ? -6.185  1.251   55.665 1.00  23.96 ? 190  ILE A O   1 
ATOM   616  C CB  . ILE A 1 83  ? -9.113  1.817   54.775 1.00  23.37 ? 190  ILE A CB  1 
ATOM   617  C CG1 . ILE A 1 83  ? -10.599 1.442   54.737 1.00  23.18 ? 190  ILE A CG1 1 
ATOM   618  C CG2 . ILE A 1 83  ? -8.776  2.902   53.792 1.00  24.19 ? 190  ILE A CG2 1 
ATOM   619  C CD1 . ILE A 1 83  ? -11.071 0.824   53.475 1.00  24.02 ? 190  ILE A CD1 1 
ATOM   620  N N   . ARG A 1 84  ? -6.149  1.170   53.417 1.00  23.26 ? 191  ARG A N   1 
ATOM   621  C CA  . ARG A 1 84  ? -4.880  1.884   53.271 1.00  23.40 ? 191  ARG A CA  1 
ATOM   622  C C   . ARG A 1 84  ? -5.147  3.184   52.514 1.00  23.69 ? 191  ARG A C   1 
ATOM   623  O O   . ARG A 1 84  ? -5.631  3.152   51.376 1.00  23.06 ? 191  ARG A O   1 
ATOM   624  C CB  . ARG A 1 84  ? -3.867  1.037   52.519 1.00  23.54 ? 191  ARG A CB  1 
ATOM   625  C CG  . ARG A 1 84  ? -2.536  1.721   52.379 1.00  25.09 ? 191  ARG A CG  1 
ATOM   626  C CD  . ARG A 1 84  ? -1.492  0.897   51.729 1.00  26.91 ? 191  ARG A CD  1 
ATOM   627  N NE  . ARG A 1 84  ? -0.975  -0.119  52.642 1.00  28.13 ? 191  ARG A NE  1 
ATOM   628  C CZ  . ARG A 1 84  ? -0.997  -1.423  52.419 1.00  28.79 ? 191  ARG A CZ  1 
ATOM   629  N NH1 . ARG A 1 84  ? -1.547  -1.914  51.303 1.00  31.18 ? 191  ARG A NH1 1 
ATOM   630  N NH2 . ARG A 1 84  ? -0.469  -2.245  53.322 1.00  28.18 ? 191  ARG A NH2 1 
ATOM   631  N N   . ASP A 1 85  ? -4.880  4.318   53.164 1.00  24.01 ? 192  ASP A N   1 
ATOM   632  C CA  . ASP A 1 85  ? -5.122  5.646   52.592 1.00  24.68 ? 192  ASP A CA  1 
ATOM   633  C C   . ASP A 1 85  ? -4.307  5.869   51.324 1.00  24.55 ? 192  ASP A C   1 
ATOM   634  O O   . ASP A 1 85  ? -3.120  5.586   51.286 1.00  22.96 ? 192  ASP A O   1 
ATOM   635  C CB  . ASP A 1 85  ? -4.760  6.745   53.593 1.00  25.54 ? 192  ASP A CB  1 
ATOM   636  C CG  . ASP A 1 85  ? -5.603  6.691   54.841 1.00  27.17 ? 192  ASP A CG  1 
ATOM   637  O OD1 . ASP A 1 85  ? -6.714  6.131   54.782 1.00  26.11 ? 192  ASP A OD1 1 
ATOM   638  O OD2 . ASP A 1 85  ? -5.223  7.167   55.932 1.00  31.98 ? 192  ASP A OD2 1 
ATOM   639  N N   . ARG A 1 86  ? -4.987  6.384   50.304 1.00  25.34 ? 193  ARG A N   1 
ATOM   640  C CA  . ARG A 1 86  ? -4.448  6.581   48.953 1.00  25.84 ? 193  ARG A CA  1 
ATOM   641  C C   . ARG A 1 86  ? -2.978  6.230   48.829 1.00  25.33 ? 193  ARG A C   1 
ATOM   642  O O   . ARG A 1 86  ? -2.125  7.085   49.019 1.00  26.16 ? 193  ARG A O   1 
ATOM   643  C CB  . ARG A 1 86  ? -4.657  8.029   48.509 1.00  26.30 ? 193  ARG A CB  1 
ATOM   644  C CG  . ARG A 1 86  ? -6.097  8.414   48.258 1.00  27.80 ? 193  ARG A CG  1 
ATOM   645  C CD  . ARG A 1 86  ? -6.336  9.934   48.273 1.00  31.42 ? 193  ARG A CD  1 
ATOM   646  N NE  . ARG A 1 86  ? -7.279  10.307  47.218 1.00  33.83 ? 193  ARG A NE  1 
ATOM   647  C CZ  . ARG A 1 86  ? -7.941  11.452  47.152 1.00  34.95 ? 193  ARG A CZ  1 
ATOM   648  N NH1 . ARG A 1 86  ? -7.752  12.425  48.053 1.00  36.41 ? 193  ARG A NH1 1 
ATOM   649  N NH2 . ARG A 1 86  ? -8.783  11.636  46.147 1.00  35.72 ? 193  ARG A NH2 1 
ATOM   650  N N   . PRO A 1 87  ? -2.677  4.977   48.520 1.00  25.07 ? 194  PRO A N   1 
ATOM   651  C CA  . PRO A 1 87  ? -1.288  4.545   48.362 1.00  25.03 ? 194  PRO A CA  1 
ATOM   652  C C   . PRO A 1 87  ? -0.554  5.221   47.200 1.00  25.46 ? 194  PRO A C   1 
ATOM   653  O O   . PRO A 1 87  ? 0.670   5.335   47.245 1.00  24.79 ? 194  PRO A O   1 
ATOM   654  C CB  . PRO A 1 87  ? -1.414  3.035   48.094 1.00  25.64 ? 194  PRO A CB  1 
ATOM   655  C CG  . PRO A 1 87  ? -2.814  2.658   48.435 1.00  25.05 ? 194  PRO A CG  1 
ATOM   656  C CD  . PRO A 1 87  ? -3.638  3.878   48.323 1.00  24.55 ? 194  PRO A CD  1 
ATOM   657  N N   . PHE A 1 88  ? -1.296  5.631   46.172 1.00  25.80 ? 195  PHE A N   1 
ATOM   658  C CA  . PHE A 1 88  ? -0.729  6.239   44.969 1.00  26.57 ? 195  PHE A CA  1 
ATOM   659  C C   . PHE A 1 88  ? -0.597  7.767   45.001 1.00  26.61 ? 195  PHE A C   1 
ATOM   660  O O   . PHE A 1 88  ? -0.097  8.344   44.050 1.00  26.05 ? 195  PHE A O   1 
ATOM   661  C CB  . PHE A 1 88  ? -1.582  5.856   43.744 1.00  26.63 ? 195  PHE A CB  1 
ATOM   662  C CG  . PHE A 1 88  ? -1.543  4.394   43.421 1.00  28.16 ? 195  PHE A CG  1 
ATOM   663  C CD1 . PHE A 1 88  ? -0.351  3.799   42.998 1.00  30.01 ? 195  PHE A CD1 1 
ATOM   664  C CD2 . PHE A 1 88  ? -2.687  3.608   43.535 1.00  27.85 ? 195  PHE A CD2 1 
ATOM   665  C CE1 . PHE A 1 88  ? -0.300  2.435   42.704 1.00  30.35 ? 195  PHE A CE1 1 
ATOM   666  C CE2 . PHE A 1 88  ? -2.639  2.262   43.253 1.00  28.68 ? 195  PHE A CE2 1 
ATOM   667  C CZ  . PHE A 1 88  ? -1.442  1.672   42.828 1.00  28.96 ? 195  PHE A CZ  1 
ATOM   668  N N   . GLU A 1 89  ? -1.052  8.430   46.063 1.00  27.18 ? 196  GLU A N   1 
ATOM   669  C CA  . GLU A 1 89  ? -1.079  9.895   46.051 1.00  28.02 ? 196  GLU A CA  1 
ATOM   670  C C   . GLU A 1 89  ? 0.288   10.552  46.281 1.00  27.96 ? 196  GLU A C   1 
ATOM   671  O O   . GLU A 1 89  ? 1.070   10.111  47.117 1.00  27.82 ? 196  GLU A O   1 
ATOM   672  C CB  . GLU A 1 89  ? -2.109  10.452  47.032 1.00  28.62 ? 196  GLU A CB  1 
ATOM   673  C CG  . GLU A 1 89  ? -1.615  10.716  48.446 1.00  31.29 ? 196  GLU A CG  1 
ATOM   674  C CD  . GLU A 1 89  ? -2.447  11.763  49.175 1.00  34.09 ? 196  GLU A CD  1 
ATOM   675  O OE1 . GLU A 1 89  ? -1.877  12.418  50.075 1.00  36.07 ? 196  GLU A OE1 1 
ATOM   676  O OE2 . GLU A 1 89  ? -3.657  11.932  48.847 1.00  36.40 ? 196  GLU A OE2 1 
ATOM   677  N N   . ARG A 1 90  ? 0.565   11.595  45.500 1.00  27.67 ? 197  ARG A N   1 
ATOM   678  C CA  . ARG A 1 90  ? 1.734   12.428  45.704 1.00  27.69 ? 197  ARG A CA  1 
ATOM   679  C C   . ARG A 1 90  ? 1.270   13.874  45.804 1.00  27.19 ? 197  ARG A C   1 
ATOM   680  O O   . ARG A 1 90  ? 0.155   14.207  45.402 1.00  26.78 ? 197  ARG A O   1 
ATOM   681  C CB  . ARG A 1 90  ? 2.717   12.285  44.528 1.00  28.43 ? 197  ARG A CB  1 
ATOM   682  C CG  . ARG A 1 90  ? 3.226   10.868  44.258 1.00  28.79 ? 197  ARG A CG  1 
ATOM   683  C CD  . ARG A 1 90  ? 4.460   10.817  43.354 1.00  30.63 ? 197  ARG A CD  1 
ATOM   684  N NE  . ARG A 1 90  ? 4.302   11.622  42.140 1.00  33.00 ? 197  ARG A NE  1 
ATOM   685  C CZ  . ARG A 1 90  ? 3.604   11.257  41.057 1.00  35.62 ? 197  ARG A CZ  1 
ATOM   686  N NH1 . ARG A 1 90  ? 2.990   10.072  40.984 1.00  33.99 ? 197  ARG A NH1 1 
ATOM   687  N NH2 . ARG A 1 90  ? 3.523   12.093  40.026 1.00  38.23 ? 197  ARG A NH2 1 
ATOM   688  N N   . THR A 1 91  ? 2.142   14.725  46.328 1.00  26.44 ? 198  THR A N   1 
ATOM   689  C CA  . THR A 1 91  ? 1.875   16.143  46.480 1.00  26.41 ? 198  THR A CA  1 
ATOM   690  C C   . THR A 1 91  ? 2.927   16.941  45.728 1.00  25.92 ? 198  THR A C   1 
ATOM   691  O O   . THR A 1 91  ? 4.116   16.662  45.861 1.00  25.09 ? 198  THR A O   1 
ATOM   692  C CB  . THR A 1 91  ? 1.900   16.515  47.975 1.00  26.14 ? 198  THR A CB  1 
ATOM   693  O OG1 . THR A 1 91  ? 0.722   16.011  48.596 1.00  28.46 ? 198  THR A OG1 1 
ATOM   694  C CG2 . THR A 1 91  ? 1.784   18.012  48.194 1.00  26.15 ? 198  THR A CG2 1 
ATOM   695  N N   . ILE A 1 92  ? 2.470   17.920  44.942 1.00  25.67 ? 199  ILE A N   1 
ATOM   696  C CA  . ILE A 1 92  ? 3.341   18.872  44.257 1.00  25.66 ? 199  ILE A CA  1 
ATOM   697  C C   . ILE A 1 92  ? 2.952   20.329  44.561 1.00  25.46 ? 199  ILE A C   1 
ATOM   698  O O   . ILE A 1 92  ? 1.805   20.720  44.408 1.00  23.83 ? 199  ILE A O   1 
ATOM   699  C CB  . ILE A 1 92  ? 3.334   18.618  42.730 1.00  25.90 ? 199  ILE A CB  1 
ATOM   700  C CG1 . ILE A 1 92  ? 3.990   17.268  42.406 1.00  27.52 ? 199  ILE A CG1 1 
ATOM   701  C CG2 . ILE A 1 92  ? 4.060   19.749  41.974 1.00  25.85 ? 199  ILE A CG2 1 
ATOM   702  C CD1 . ILE A 1 92  ? 5.460   17.179  42.845 1.00  29.36 ? 199  ILE A CD1 1 
ATOM   703  N N   . THR A 1 93  ? 3.947   21.107  44.982 1.00  25.47 ? 200  THR A N   1 
ATOM   704  C CA  . THR A 1 93  ? 3.805   22.526  45.212 1.00  25.98 ? 200  THR A CA  1 
ATOM   705  C C   . THR A 1 93  ? 4.414   23.301  44.045 1.00  26.24 ? 200  THR A C   1 
ATOM   706  O O   . THR A 1 93  ? 5.560   23.059  43.654 1.00  26.44 ? 200  THR A O   1 
ATOM   707  C CB  . THR A 1 93  ? 4.494   22.933  46.528 1.00  26.09 ? 200  THR A CB  1 
ATOM   708  O OG1 . THR A 1 93  ? 3.947   22.186  47.624 1.00  26.91 ? 200  THR A OG1 1 
ATOM   709  C CG2 . THR A 1 93  ? 4.160   24.367  46.875 1.00  25.87 ? 200  THR A CG2 1 
ATOM   710  N N   . MET A 1 94  ? 3.638   24.239  43.505 1.00  26.53 ? 201  MET A N   1 
ATOM   711  C CA  . MET A 1 94  ? 4.064   25.096  42.405 1.00  26.66 ? 201  MET A CA  1 
ATOM   712  C C   . MET A 1 94  ? 3.863   26.575  42.760 1.00  27.56 ? 201  MET A C   1 
ATOM   713  O O   . MET A 1 94  ? 3.138   26.895  43.701 1.00  27.42 ? 201  MET A O   1 
ATOM   714  C CB  . MET A 1 94  ? 3.295   24.736  41.135 1.00  26.12 ? 201  MET A CB  1 
ATOM   715  C CG  . MET A 1 94  ? 3.633   23.358  40.583 1.00  24.84 ? 201  MET A CG  1 
ATOM   716  S SD  . MET A 1 94  ? 2.361   22.693  39.493 1.00  25.18 ? 201  MET A SD  1 
ATOM   717  C CE  . MET A 1 94  ? 1.061   22.383  40.696 1.00  24.01 ? 201  MET A CE  1 
ATOM   718  N N   . HIS A 1 95  ? 4.534   27.458  42.013 1.00  28.40 ? 202  HIS A N   1 
ATOM   719  C CA  . HIS A 1 95  ? 4.415   28.912  42.160 1.00  29.25 ? 202  HIS A CA  1 
ATOM   720  C C   . HIS A 1 95  ? 3.858   29.478  40.862 1.00  29.90 ? 202  HIS A C   1 
ATOM   721  O O   . HIS A 1 95  ? 4.365   29.176  39.792 1.00  29.92 ? 202  HIS A O   1 
ATOM   722  C CB  . HIS A 1 95  ? 5.785   29.553  42.447 1.00  29.21 ? 202  HIS A CB  1 
ATOM   723  C CG  . HIS A 1 95  ? 6.237   29.430  43.867 1.00  29.73 ? 202  HIS A CG  1 
ATOM   724  N ND1 . HIS A 1 95  ? 6.130   28.260  44.585 1.00  32.41 ? 202  HIS A ND1 1 
ATOM   725  C CD2 . HIS A 1 95  ? 6.812   30.326  44.703 1.00  31.10 ? 202  HIS A CD2 1 
ATOM   726  C CE1 . HIS A 1 95  ? 6.611   28.443  45.801 1.00  32.55 ? 202  HIS A CE1 1 
ATOM   727  N NE2 . HIS A 1 95  ? 7.024   29.692  45.902 1.00  31.40 ? 202  HIS A NE2 1 
ATOM   728  N N   . LYS A 1 96  ? 2.800   30.280  40.942 1.00  31.45 ? 203  LYS A N   1 
ATOM   729  C CA  . LYS A 1 96  ? 2.307   30.990  39.755 1.00  32.50 ? 203  LYS A CA  1 
ATOM   730  C C   . LYS A 1 96  ? 3.380   31.990  39.286 1.00  33.52 ? 203  LYS A C   1 
ATOM   731  O O   . LYS A 1 96  ? 4.056   32.605  40.103 1.00  33.00 ? 203  LYS A O   1 
ATOM   732  C CB  . LYS A 1 96  ? 1.027   31.764  40.065 1.00  32.45 ? 203  LYS A CB  1 
ATOM   733  C CG  . LYS A 1 96  ? -0.225  30.927  40.277 1.00  33.05 ? 203  LYS A CG  1 
ATOM   734  C CD  . LYS A 1 96  ? -1.364  31.824  40.751 1.00  32.96 ? 203  LYS A CD  1 
ATOM   735  C CE  . LYS A 1 96  ? -2.655  31.066  40.986 1.00  34.48 ? 203  LYS A CE  1 
ATOM   736  N NZ  . LYS A 1 96  ? -3.751  31.959  41.524 1.00  34.54 ? 203  LYS A NZ  1 
ATOM   737  N N   . ASP A 1 97  ? 3.524   32.158  37.982 1.00  35.27 ? 204  ASP A N   1 
ATOM   738  C CA  . ASP A 1 97  ? 4.496   33.105  37.448 1.00  37.09 ? 204  ASP A CA  1 
ATOM   739  C C   . ASP A 1 97  ? 3.872   34.507  37.421 1.00  38.60 ? 204  ASP A C   1 
ATOM   740  O O   . ASP A 1 97  ? 2.977   34.803  38.239 1.00  39.65 ? 204  ASP A O   1 
ATOM   741  C CB  . ASP A 1 97  ? 5.045   32.640  36.089 1.00  36.98 ? 204  ASP A CB  1 
ATOM   742  C CG  . ASP A 1 97  ? 3.981   32.481  35.041 1.00  38.23 ? 204  ASP A CG  1 
ATOM   743  O OD1 . ASP A 1 97  ? 2.916   33.122  35.143 1.00  40.14 ? 204  ASP A OD1 1 
ATOM   744  O OD2 . ASP A 1 97  ? 4.129   31.730  34.058 1.00  40.52 ? 204  ASP A OD2 1 
ATOM   745  N N   . SER A 1 98  ? 4.346   35.379  36.527 1.00  39.75 ? 205  SER A N   1 
ATOM   746  C CA  . SER A 1 98  ? 3.828   36.748  36.447 1.00  40.02 ? 205  SER A CA  1 
ATOM   747  C C   . SER A 1 98  ? 2.401   36.708  35.943 1.00  40.60 ? 205  SER A C   1 
ATOM   748  O O   . SER A 1 98  ? 1.525   37.327  36.528 1.00  41.38 ? 205  SER A O   1 
ATOM   749  C CB  . SER A 1 98  ? 4.705   37.642  35.544 1.00  39.95 ? 205  SER A CB  1 
ATOM   750  O OG  . SER A 1 98  ? 4.585   37.326  34.165 1.00  39.32 ? 205  SER A OG  1 
ATOM   751  N N   . THR A 1 99  ? 2.171   35.944  34.878 1.00  40.92 ? 206  THR A N   1 
ATOM   752  C CA  . THR A 1 99  ? 0.844   35.805  34.286 1.00  41.21 ? 206  THR A CA  1 
ATOM   753  C C   . THR A 1 99  ? -0.226  35.146  35.205 1.00  41.25 ? 206  THR A C   1 
ATOM   754  O O   . THR A 1 99  ? -1.409  35.147  34.861 1.00  41.79 ? 206  THR A O   1 
ATOM   755  C CB  . THR A 1 99  ? 0.930   35.044  32.923 1.00  41.54 ? 206  THR A CB  1 
ATOM   756  O OG1 . THR A 1 99  ? 1.521   33.742  33.094 1.00  42.77 ? 206  THR A OG1 1 
ATOM   757  C CG2 . THR A 1 99  ? 1.867   35.753  31.939 1.00  41.62 ? 206  THR A CG2 1 
ATOM   758  N N   . GLY A 1 100 ? 0.173   34.610  36.362 1.00  40.86 ? 207  GLY A N   1 
ATOM   759  C CA  . GLY A 1 100 ? -0.750  33.937  37.276 1.00  40.16 ? 207  GLY A CA  1 
ATOM   760  C C   . GLY A 1 100 ? -0.995  32.462  36.947 1.00  39.43 ? 207  GLY A C   1 
ATOM   761  O O   . GLY A 1 100 ? -1.992  31.879  37.389 1.00  39.37 ? 207  GLY A O   1 
ATOM   762  N N   . HIS A 1 101 ? -0.095  31.864  36.161 1.00  38.53 ? 208  HIS A N   1 
ATOM   763  C CA  . HIS A 1 101 ? -0.185  30.454  35.779 1.00  37.78 ? 208  HIS A CA  1 
ATOM   764  C C   . HIS A 1 101 ? 0.940   29.646  36.427 1.00  36.56 ? 208  HIS A C   1 
ATOM   765  O O   . HIS A 1 101 ? 2.071   30.124  36.502 1.00  35.80 ? 208  HIS A O   1 
ATOM   766  C CB  . HIS A 1 101 ? -0.051  30.296  34.269 1.00  38.10 ? 208  HIS A CB  1 
ATOM   767  C CG  . HIS A 1 101 ? -1.239  30.765  33.490 1.00  40.79 ? 208  HIS A CG  1 
ATOM   768  N ND1 . HIS A 1 101 ? -1.165  31.789  32.571 1.00  42.99 ? 208  HIS A ND1 1 
ATOM   769  C CD2 . HIS A 1 101 ? -2.519  30.327  33.460 1.00  42.41 ? 208  HIS A CD2 1 
ATOM   770  C CE1 . HIS A 1 101 ? -2.353  31.974  32.024 1.00  43.81 ? 208  HIS A CE1 1 
ATOM   771  N NE2 . HIS A 1 101 ? -3.191  31.094  32.542 1.00  43.28 ? 208  HIS A NE2 1 
ATOM   772  N N   . VAL A 1 102 ? 0.621   28.416  36.850 1.00  35.26 ? 209  VAL A N   1 
ATOM   773  C CA  . VAL A 1 102 ? 1.610   27.442  37.346 1.00  33.88 ? 209  VAL A CA  1 
ATOM   774  C C   . VAL A 1 102 ? 2.236   26.617  36.226 1.00  32.94 ? 209  VAL A C   1 
ATOM   775  O O   . VAL A 1 102 ? 3.383   26.209  36.331 1.00  32.62 ? 209  VAL A O   1 
ATOM   776  C CB  . VAL A 1 102 ? 1.023   26.462  38.394 1.00  33.68 ? 209  VAL A CB  1 
ATOM   777  C CG1 . VAL A 1 102 ? 0.524   27.212  39.608 1.00  34.25 ? 209  VAL A CG1 1 
ATOM   778  C CG2 . VAL A 1 102 ? -0.087  25.560  37.792 1.00  34.08 ? 209  VAL A CG2 1 
ATOM   779  N N   . GLY A 1 103 ? 1.467   26.331  35.180 1.00  32.24 ? 210  GLY A N   1 
ATOM   780  C CA  . GLY A 1 103 ? 2.020   25.805  33.945 1.00  31.43 ? 210  GLY A CA  1 
ATOM   781  C C   . GLY A 1 103 ? 1.605   24.421  33.507 1.00  31.11 ? 210  GLY A C   1 
ATOM   782  O O   . GLY A 1 103 ? 2.461   23.636  33.096 1.00  31.36 ? 210  GLY A O   1 
ATOM   783  N N   . PHE A 1 104 ? 0.308   24.120  33.565 1.00  30.55 ? 211  PHE A N   1 
ATOM   784  C CA  . PHE A 1 104 ? -0.207  22.869  33.005 1.00  30.04 ? 211  PHE A CA  1 
ATOM   785  C C   . PHE A 1 104 ? -1.600  23.011  32.403 1.00  30.07 ? 211  PHE A C   1 
ATOM   786  O O   . PHE A 1 104 ? -2.347  23.908  32.743 1.00  28.68 ? 211  PHE A O   1 
ATOM   787  C CB  . PHE A 1 104 ? -0.166  21.724  34.034 1.00  29.80 ? 211  PHE A CB  1 
ATOM   788  C CG  . PHE A 1 104 ? -1.143  21.873  35.187 1.00  28.28 ? 211  PHE A CG  1 
ATOM   789  C CD1 . PHE A 1 104 ? -0.755  22.481  36.376 1.00  26.39 ? 211  PHE A CD1 1 
ATOM   790  C CD2 . PHE A 1 104 ? -2.417  21.349  35.102 1.00  25.81 ? 211  PHE A CD2 1 
ATOM   791  C CE1 . PHE A 1 104 ? -1.650  22.595  37.451 1.00  26.08 ? 211  PHE A CE1 1 
ATOM   792  C CE2 . PHE A 1 104 ? -3.313  21.473  36.169 1.00  26.00 ? 211  PHE A CE2 1 
ATOM   793  C CZ  . PHE A 1 104 ? -2.928  22.098  37.336 1.00  24.67 ? 211  PHE A CZ  1 
ATOM   794  N N   . ILE A 1 105 ? -1.907  22.117  31.469 1.00  30.92 ? 212  ILE A N   1 
ATOM   795  C CA  . ILE A 1 105 ? -3.252  21.997  30.896 1.00  31.38 ? 212  ILE A CA  1 
ATOM   796  C C   . ILE A 1 105 ? -3.951  20.794  31.530 1.00  31.05 ? 212  ILE A C   1 
ATOM   797  O O   . ILE A 1 105 ? -3.336  19.745  31.710 1.00  30.83 ? 212  ILE A O   1 
ATOM   798  C CB  . ILE A 1 105 ? -3.184  21.773  29.355 1.00  31.60 ? 212  ILE A CB  1 
ATOM   799  C CG1 . ILE A 1 105 ? -2.143  22.680  28.677 1.00  32.77 ? 212  ILE A CG1 1 
ATOM   800  C CG2 . ILE A 1 105 ? -4.548  21.959  28.719 1.00  31.26 ? 212  ILE A CG2 1 
ATOM   801  C CD1 . ILE A 1 105 ? -2.340  24.133  28.900 1.00  33.09 ? 212  ILE A CD1 1 
ATOM   802  N N   . PHE A 1 106 ? -5.237  20.938  31.847 1.00  31.27 ? 213  PHE A N   1 
ATOM   803  C CA  . PHE A 1 106 ? -6.032  19.817  32.340 1.00  31.34 ? 213  PHE A CA  1 
ATOM   804  C C   . PHE A 1 106 ? -7.405  19.723  31.670 1.00  31.68 ? 213  PHE A C   1 
ATOM   805  O O   . PHE A 1 106 ? -7.912  20.692  31.124 1.00  31.53 ? 213  PHE A O   1 
ATOM   806  C CB  . PHE A 1 106 ? -6.141  19.873  33.869 1.00  31.16 ? 213  PHE A CB  1 
ATOM   807  C CG  . PHE A 1 106 ? -7.257  20.736  34.396 1.00  29.88 ? 213  PHE A CG  1 
ATOM   808  C CD1 . PHE A 1 106 ? -8.570  20.275  34.448 1.00  28.79 ? 213  PHE A CD1 1 
ATOM   809  C CD2 . PHE A 1 106 ? -6.985  21.996  34.887 1.00  28.73 ? 213  PHE A CD2 1 
ATOM   810  C CE1 . PHE A 1 106 ? -9.577  21.074  34.943 1.00  28.41 ? 213  PHE A CE1 1 
ATOM   811  C CE2 . PHE A 1 106 ? -8.004  22.798  35.396 1.00  29.19 ? 213  PHE A CE2 1 
ATOM   812  C CZ  . PHE A 1 106 ? -9.294  22.334  35.420 1.00  27.51 ? 213  PHE A CZ  1 
ATOM   813  N N   . LYS A 1 107 ? -7.964  18.526  31.688 1.00  32.05 ? 214  LYS A N   1 
ATOM   814  C CA  . LYS A 1 107 ? -9.328  18.282  31.235 1.00  33.33 ? 214  LYS A CA  1 
ATOM   815  C C   . LYS A 1 107 ? -9.880  17.082  31.990 1.00  33.10 ? 214  LYS A C   1 
ATOM   816  O O   . LYS A 1 107 ? -9.222  16.044  32.084 1.00  33.16 ? 214  LYS A O   1 
ATOM   817  C CB  . LYS A 1 107 ? -9.359  18.008  29.722 1.00  33.67 ? 214  LYS A CB  1 
ATOM   818  C CG  . LYS A 1 107 ? -10.758 17.816  29.118 1.00  36.02 ? 214  LYS A CG  1 
ATOM   819  C CD  . LYS A 1 107 ? -10.719 17.805  27.577 1.00  38.93 ? 214  LYS A CD  1 
ATOM   820  C CE  . LYS A 1 107 ? -12.100 17.542  26.956 1.00  40.82 ? 214  LYS A CE  1 
ATOM   821  N NZ  . LYS A 1 107 ? -12.000 16.883  25.603 1.00  41.74 ? 214  LYS A NZ  1 
ATOM   822  N N   . ASN A 1 108 ? -11.098 17.222  32.490 1.00  33.09 ? 215  ASN A N   1 
ATOM   823  C CA  . ASN A 1 108 ? -11.746 16.186  33.275 1.00  33.13 ? 215  ASN A CA  1 
ATOM   824  C C   . ASN A 1 108 ? -10.866 15.750  34.441 1.00  32.96 ? 215  ASN A C   1 
ATOM   825  O O   . ASN A 1 108 ? -10.640 14.566  34.651 1.00  33.48 ? 215  ASN A O   1 
ATOM   826  C CB  . ASN A 1 108 ? -12.114 14.997  32.373 1.00  32.95 ? 215  ASN A CB  1 
ATOM   827  C CG  . ASN A 1 108 ? -13.082 15.387  31.252 1.00  33.41 ? 215  ASN A CG  1 
ATOM   828  O OD1 . ASN A 1 108 ? -14.018 16.166  31.471 1.00  35.46 ? 215  ASN A OD1 1 
ATOM   829  N ND2 . ASN A 1 108 ? -12.871 14.844  30.060 1.00  31.04 ? 215  ASN A ND2 1 
ATOM   830  N N   . GLY A 1 109 ? -10.329 16.718  35.170 1.00  33.00 ? 216  GLY A N   1 
ATOM   831  C CA  . GLY A 1 109 ? -9.543  16.432  36.363 1.00  32.93 ? 216  GLY A CA  1 
ATOM   832  C C   . GLY A 1 109 ? -8.211  15.693  36.193 1.00  32.70 ? 216  GLY A C   1 
ATOM   833  O O   . GLY A 1 109 ? -7.553  15.404  37.190 1.00  32.65 ? 216  GLY A O   1 
ATOM   834  N N   . LYS A 1 110 ? -7.824  15.387  34.957 1.00  32.23 ? 217  LYS A N   1 
ATOM   835  C CA  . LYS A 1 110 ? -6.549  14.755  34.636 1.00  32.12 ? 217  LYS A CA  1 
ATOM   836  C C   . LYS A 1 110 ? -5.568  15.747  33.982 1.00  31.84 ? 217  LYS A C   1 
ATOM   837  O O   . LYS A 1 110 ? -5.963  16.519  33.112 1.00  31.72 ? 217  LYS A O   1 
ATOM   838  C CB  . LYS A 1 110 ? -6.809  13.602  33.677 1.00  32.46 ? 217  LYS A CB  1 
ATOM   839  C CG  . LYS A 1 110 ? -5.656  12.648  33.520 1.00  33.58 ? 217  LYS A CG  1 
ATOM   840  C CD  . LYS A 1 110 ? -5.982  11.536  32.559 1.00  34.94 ? 217  LYS A CD  1 
ATOM   841  C CE  . LYS A 1 110 ? -5.731  11.947  31.117 1.00  36.72 ? 217  LYS A CE  1 
ATOM   842  N NZ  . LYS A 1 110 ? -4.298  12.320  30.832 1.00  37.16 ? 217  LYS A NZ  1 
ATOM   843  N N   . ILE A 1 111 ? -4.300  15.741  34.401 1.00  30.98 ? 218  ILE A N   1 
ATOM   844  C CA  . ILE A 1 111 ? -3.302  16.613  33.789 1.00  30.08 ? 218  ILE A CA  1 
ATOM   845  C C   . ILE A 1 111 ? -2.909  16.008  32.454 1.00  30.27 ? 218  ILE A C   1 
ATOM   846  O O   . ILE A 1 111 ? -2.524  14.844  32.404 1.00  30.44 ? 218  ILE A O   1 
ATOM   847  C CB  . ILE A 1 111 ? -2.057  16.816  34.696 1.00  29.67 ? 218  ILE A CB  1 
ATOM   848  C CG1 . ILE A 1 111 ? -2.457  17.505  36.005 1.00  27.50 ? 218  ILE A CG1 1 
ATOM   849  C CG2 . ILE A 1 111 ? -0.998  17.678  33.973 1.00  28.87 ? 218  ILE A CG2 1 
ATOM   850  C CD1 . ILE A 1 111 ? -1.624  17.144  37.164 1.00  24.50 ? 218  ILE A CD1 1 
ATOM   851  N N   . THR A 1 112 ? -3.029  16.799  31.384 1.00  30.49 ? 219  THR A N   1 
ATOM   852  C CA  . THR A 1 112 ? -2.744  16.341  30.012 1.00  31.17 ? 219  THR A CA  1 
ATOM   853  C C   . THR A 1 112 ? -1.495  16.962  29.364 1.00  31.08 ? 219  THR A C   1 
ATOM   854  O O   . THR A 1 112 ? -0.902  16.340  28.486 1.00  31.55 ? 219  THR A O   1 
ATOM   855  C CB  . THR A 1 112 ? -3.958  16.584  29.092 1.00  30.99 ? 219  THR A CB  1 
ATOM   856  O OG1 . THR A 1 112 ? -4.296  17.981  29.072 1.00  31.61 ? 219  THR A OG1 1 
ATOM   857  C CG2 . THR A 1 112 ? -5.199  15.920  29.655 1.00  31.76 ? 219  THR A CG2 1 
ATOM   858  N N   . SER A 1 113 ? -1.093  18.164  29.774 1.00  31.00 ? 220  SER A N   1 
ATOM   859  C CA  . SER A 1 113 ? 0.175   18.730  29.290 1.00  31.12 ? 220  SER A CA  1 
ATOM   860  C C   . SER A 1 113 ? 0.914   19.625  30.286 1.00  30.62 ? 220  SER A C   1 
ATOM   861  O O   . SER A 1 113 ? 0.300   20.354  31.070 1.00  31.12 ? 220  SER A O   1 
ATOM   862  C CB  . SER A 1 113 ? -0.042  19.497  27.976 1.00  31.24 ? 220  SER A CB  1 
ATOM   863  O OG  . SER A 1 113 ? 1.090   19.364  27.134 1.00  33.16 ? 220  SER A OG  1 
ATOM   864  N N   . ILE A 1 114 ? 2.242   19.557  30.234 1.00  30.44 ? 221  ILE A N   1 
ATOM   865  C CA  . ILE A 1 114 ? 3.131   20.400  31.034 1.00  30.49 ? 221  ILE A CA  1 
ATOM   866  C C   . ILE A 1 114 ? 3.700   21.496  30.116 1.00  31.00 ? 221  ILE A C   1 
ATOM   867  O O   . ILE A 1 114 ? 4.214   21.192  29.042 1.00  30.65 ? 221  ILE A O   1 
ATOM   868  C CB  . ILE A 1 114 ? 4.288   19.563  31.645 1.00  30.22 ? 221  ILE A CB  1 
ATOM   869  C CG1 . ILE A 1 114 ? 3.755   18.271  32.297 1.00  30.88 ? 221  ILE A CG1 1 
ATOM   870  C CG2 . ILE A 1 114 ? 5.079   20.396  32.660 1.00  29.84 ? 221  ILE A CG2 1 
ATOM   871  C CD1 . ILE A 1 114 ? 2.603   18.491  33.312 1.00  30.60 ? 221  ILE A CD1 1 
ATOM   872  N N   . VAL A 1 115 ? 3.569   22.749  30.541 1.00  31.39 ? 222  VAL A N   1 
ATOM   873  C CA  . VAL A 1 115 ? 4.022   23.912  29.786 1.00  32.36 ? 222  VAL A CA  1 
ATOM   874  C C   . VAL A 1 115 ? 5.533   24.097  30.004 1.00  32.82 ? 222  VAL A C   1 
ATOM   875  O O   . VAL A 1 115 ? 6.059   23.822  31.091 1.00  31.98 ? 222  VAL A O   1 
ATOM   876  C CB  . VAL A 1 115 ? 3.267   25.197  30.218 1.00  32.68 ? 222  VAL A CB  1 
ATOM   877  C CG1 . VAL A 1 115 ? 3.763   26.413  29.437 1.00  33.91 ? 222  VAL A CG1 1 
ATOM   878  C CG2 . VAL A 1 115 ? 1.757   25.043  30.013 1.00  33.02 ? 222  VAL A CG2 1 
ATOM   879  N N   . LYS A 1 116 ? 6.224   24.559  28.962 1.00  33.35 ? 223  LYS A N   1 
ATOM   880  C CA  . LYS A 1 116 ? 7.681   24.571  28.953 1.00  33.78 ? 223  LYS A CA  1 
ATOM   881  C C   . LYS A 1 116 ? 8.198   25.601  29.945 1.00  33.12 ? 223  LYS A C   1 
ATOM   882  O O   . LYS A 1 116 ? 7.712   26.735  29.996 1.00  33.06 ? 223  LYS A O   1 
ATOM   883  C CB  . LYS A 1 116 ? 8.237   24.803  27.537 1.00  34.44 ? 223  LYS A CB  1 
ATOM   884  C CG  . LYS A 1 116 ? 7.973   23.603  26.585 1.00  37.15 ? 223  LYS A CG  1 
ATOM   885  C CD  . LYS A 1 116 ? 9.063   23.404  25.497 1.00  40.09 ? 223  LYS A CD  1 
ATOM   886  C CE  . LYS A 1 116 ? 9.829   22.080  25.625 1.00  40.88 ? 223  LYS A CE  1 
ATOM   887  N NZ  . LYS A 1 116 ? 11.184  22.231  26.271 1.00  41.76 ? 223  LYS A NZ  1 
ATOM   888  N N   . ASP A 1 117 ? 9.128   25.148  30.786 1.00  32.32 ? 224  ASP A N   1 
ATOM   889  C CA  . ASP A 1 117 ? 9.864   25.990  31.721 1.00  31.65 ? 224  ASP A CA  1 
ATOM   890  C C   . ASP A 1 117 ? 9.005   26.756  32.739 1.00  30.44 ? 224  ASP A C   1 
ATOM   891  O O   . ASP A 1 117 ? 9.454   27.736  33.324 1.00  30.01 ? 224  ASP A O   1 
ATOM   892  C CB  . ASP A 1 117 ? 10.800  26.917  30.939 1.00  32.23 ? 224  ASP A CB  1 
ATOM   893  C CG  . ASP A 1 117 ? 11.707  26.148  29.977 1.00  33.60 ? 224  ASP A CG  1 
ATOM   894  O OD1 . ASP A 1 117 ? 11.992  24.954  30.257 1.00  33.69 ? 224  ASP A OD1 1 
ATOM   895  O OD2 . ASP A 1 117 ? 12.169  26.655  28.919 1.00  35.38 ? 224  ASP A OD2 1 
ATOM   896  N N   . SER A 1 118 ? 7.787   26.269  32.977 1.00  29.29 ? 225  SER A N   1 
ATOM   897  C CA  . SER A 1 118 ? 6.921   26.767  34.061 1.00  28.05 ? 225  SER A CA  1 
ATOM   898  C C   . SER A 1 118 ? 7.274   26.095  35.402 1.00  26.68 ? 225  SER A C   1 
ATOM   899  O O   . SER A 1 118 ? 8.147   25.241  35.451 1.00  25.72 ? 225  SER A O   1 
ATOM   900  C CB  . SER A 1 118 ? 5.456   26.486  33.710 1.00  28.34 ? 225  SER A CB  1 
ATOM   901  O OG  . SER A 1 118 ? 5.221   25.082  33.524 1.00  27.85 ? 225  SER A OG  1 
ATOM   902  N N   . SER A 1 119 ? 6.620   26.509  36.488 1.00  25.52 ? 226  SER A N   1 
ATOM   903  C CA  . SER A 1 119 ? 6.831   25.896  37.805 1.00  24.30 ? 226  SER A CA  1 
ATOM   904  C C   . SER A 1 119 ? 6.390   24.428  37.822 1.00  24.16 ? 226  SER A C   1 
ATOM   905  O O   . SER A 1 119 ? 7.039   23.599  38.458 1.00  24.33 ? 226  SER A O   1 
ATOM   906  C CB  . SER A 1 119 ? 6.097   26.672  38.890 1.00  24.38 ? 226  SER A CB  1 
ATOM   907  O OG  . SER A 1 119 ? 6.243   26.054  40.160 1.00  22.20 ? 226  SER A OG  1 
ATOM   908  N N   . ALA A 1 120 ? 5.304   24.111  37.112 1.00  23.11 ? 227  ALA A N   1 
ATOM   909  C CA  . ALA A 1 120 ? 4.906   22.725  36.907 1.00  22.63 ? 227  ALA A CA  1 
ATOM   910  C C   . ALA A 1 120 ? 5.997   21.903  36.220 1.00  21.72 ? 227  ALA A C   1 
ATOM   911  O O   . ALA A 1 120 ? 6.167   20.719  36.533 1.00  20.53 ? 227  ALA A O   1 
ATOM   912  C CB  . ALA A 1 120 ? 3.594   22.631  36.119 1.00  22.53 ? 227  ALA A CB  1 
ATOM   913  N N   . ALA A 1 121 ? 6.713   22.511  35.274 1.00  21.12 ? 228  ALA A N   1 
ATOM   914  C CA  . ALA A 1 121 ? 7.852   21.840  34.640 1.00  20.80 ? 228  ALA A CA  1 
ATOM   915  C C   . ALA A 1 121 ? 9.019   21.656  35.588 1.00  20.32 ? 228  ALA A C   1 
ATOM   916  O O   . ALA A 1 121 ? 9.569   20.559  35.679 1.00  21.19 ? 228  ALA A O   1 
ATOM   917  C CB  . ALA A 1 121 ? 8.309   22.584  33.404 1.00  21.11 ? 228  ALA A CB  1 
ATOM   918  N N   . ARG A 1 122 ? 9.402   22.719  36.287 1.00  20.13 ? 229  ARG A N   1 
ATOM   919  C CA  . ARG A 1 122 ? 10.511  22.679  37.244 1.00  20.20 ? 229  ARG A CA  1 
ATOM   920  C C   . ARG A 1 122 ? 10.282  21.633  38.330 1.00  20.39 ? 229  ARG A C   1 
ATOM   921  O O   . ARG A 1 122 ? 11.243  20.959  38.786 1.00  20.57 ? 229  ARG A O   1 
ATOM   922  C CB  . ARG A 1 122 ? 10.724  24.040  37.909 1.00  20.09 ? 229  ARG A CB  1 
ATOM   923  C CG  . ARG A 1 122 ? 11.374  25.071  37.009 1.00  20.32 ? 229  ARG A CG  1 
ATOM   924  C CD  . ARG A 1 122 ? 11.860  26.306  37.720 1.00  19.42 ? 229  ARG A CD  1 
ATOM   925  N NE  . ARG A 1 122 ? 10.749  27.097  38.243 1.00  20.55 ? 229  ARG A NE  1 
ATOM   926  C CZ  . ARG A 1 122 ? 10.085  28.024  37.553 1.00  21.62 ? 229  ARG A CZ  1 
ATOM   927  N NH1 . ARG A 1 122 ? 10.399  28.286  36.302 1.00  20.29 ? 229  ARG A NH1 1 
ATOM   928  N NH2 . ARG A 1 122 ? 9.085   28.695  38.117 1.00  23.63 ? 229  ARG A NH2 1 
ATOM   929  N N   . ASN A 1 123 ? 9.014   21.484  38.715 1.00  19.77 ? 230  ASN A N   1 
ATOM   930  C CA  . ASN A 1 123 ? 8.610   20.588  39.792 1.00  19.64 ? 230  ASN A CA  1 
ATOM   931  C C   . ASN A 1 123 ? 8.264   19.176  39.322 1.00  19.72 ? 230  ASN A C   1 
ATOM   932  O O   . ASN A 1 123 ? 7.814   18.361  40.114 1.00  20.39 ? 230  ASN A O   1 
ATOM   933  C CB  . ASN A 1 123 ? 7.419   21.176  40.543 1.00  19.81 ? 230  ASN A CB  1 
ATOM   934  C CG  . ASN A 1 123 ? 7.835   22.201  41.587 1.00  20.40 ? 230  ASN A CG  1 
ATOM   935  O OD1 . ASN A 1 123 ? 8.064   21.850  42.745 1.00  19.38 ? 230  ASN A OD1 1 
ATOM   936  N ND2 . ASN A 1 123 ? 7.932   23.473  41.178 1.00  19.20 ? 230  ASN A ND2 1 
ATOM   937  N N   . GLY A 1 124 ? 8.446   18.892  38.039 1.00  19.58 ? 231  GLY A N   1 
ATOM   938  C CA  . GLY A 1 124 ? 8.249   17.558  37.511 1.00  19.19 ? 231  GLY A CA  1 
ATOM   939  C C   . GLY A 1 124 ? 6.844   17.025  37.628 1.00  19.19 ? 231  GLY A C   1 
ATOM   940  O O   . GLY A 1 124 ? 6.650   15.843  37.842 1.00  18.89 ? 231  GLY A O   1 
ATOM   941  N N   . LEU A 1 125 ? 5.858   17.902  37.473 1.00  19.51 ? 232  LEU A N   1 
ATOM   942  C CA  . LEU A 1 125 ? 4.469   17.487  37.371 1.00  19.17 ? 232  LEU A CA  1 
ATOM   943  C C   . LEU A 1 125 ? 4.310   16.529  36.196 1.00  20.13 ? 232  LEU A C   1 
ATOM   944  O O   . LEU A 1 125 ? 4.877   16.754  35.133 1.00  20.95 ? 232  LEU A O   1 
ATOM   945  C CB  . LEU A 1 125 ? 3.547   18.703  37.225 1.00  18.45 ? 232  LEU A CB  1 
ATOM   946  C CG  . LEU A 1 125 ? 2.059   18.444  37.405 1.00  17.24 ? 232  LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 125 ? 1.763   18.016  38.802 1.00  15.83 ? 232  LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 125 ? 1.235   19.637  37.033 1.00  17.82 ? 232  LEU A CD2 1 
ATOM   949  N N   . LEU A 1 126 ? 3.562   15.449  36.407 1.00  20.80 ? 233  LEU A N   1 
ATOM   950  C CA  . LEU A 1 126 ? 3.350   14.419  35.397 1.00  20.99 ? 233  LEU A CA  1 
ATOM   951  C C   . LEU A 1 126 ? 1.920   14.451  34.828 1.00  21.41 ? 233  LEU A C   1 
ATOM   952  O O   . LEU A 1 126 ? 0.967   14.805  35.519 1.00  20.69 ? 233  LEU A O   1 
ATOM   953  C CB  . LEU A 1 126 ? 3.631   13.052  36.000 1.00  21.01 ? 233  LEU A CB  1 
ATOM   954  C CG  . LEU A 1 126 ? 4.989   12.848  36.683 1.00  21.15 ? 233  LEU A CG  1 
ATOM   955  C CD1 . LEU A 1 126 ? 5.038   11.486  37.369 1.00  21.22 ? 233  LEU A CD1 1 
ATOM   956  C CD2 . LEU A 1 126 ? 6.135   12.969  35.695 1.00  21.30 ? 233  LEU A CD2 1 
ATOM   957  N N   . THR A 1 127 ? 1.794   14.108  33.551 1.00  22.11 ? 234  THR A N   1 
ATOM   958  C CA  . THR A 1 127 ? 0.492   14.008  32.885 1.00  22.89 ? 234  THR A CA  1 
ATOM   959  C C   . THR A 1 127 ? -0.110  12.640  33.206 1.00  23.64 ? 234  THR A C   1 
ATOM   960  O O   . THR A 1 127 ? 0.472   11.875  33.969 1.00  23.61 ? 234  THR A O   1 
ATOM   961  C CB  . THR A 1 127 ? 0.615   14.182  31.356 1.00  22.16 ? 234  THR A CB  1 
ATOM   962  O OG1 . THR A 1 127 ? 1.544   13.232  30.842 1.00  22.20 ? 234  THR A OG1 1 
ATOM   963  C CG2 . THR A 1 127 ? 1.212   15.498  30.990 1.00  23.21 ? 234  THR A CG2 1 
ATOM   964  N N   . GLU A 1 128 ? -1.267  12.331  32.621 1.00  25.05 ? 235  GLU A N   1 
ATOM   965  C CA  . GLU A 1 128 ? -2.005  11.106  32.944 1.00  26.06 ? 235  GLU A CA  1 
ATOM   966  C C   . GLU A 1 128 ? -2.157  10.900  34.472 1.00  25.90 ? 235  GLU A C   1 
ATOM   967  O O   . GLU A 1 128 ? -2.069  9.776   34.962 1.00  26.12 ? 235  GLU A O   1 
ATOM   968  C CB  . GLU A 1 128 ? -1.334  9.898   32.266 1.00  26.71 ? 235  GLU A CB  1 
ATOM   969  C CG  . GLU A 1 128 ? -1.767  9.678   30.807 1.00  29.63 ? 235  GLU A CG  1 
ATOM   970  C CD  . GLU A 1 128 ? -1.288  10.786  29.880 1.00  33.91 ? 235  GLU A CD  1 
ATOM   971  O OE1 . GLU A 1 128 ? -2.098  11.674  29.540 1.00  34.29 ? 235  GLU A OE1 1 
ATOM   972  O OE2 . GLU A 1 128 ? -0.084  10.783  29.510 1.00  39.29 ? 235  GLU A OE2 1 
ATOM   973  N N   . HIS A 1 129 ? -2.372  11.998  35.200 1.00  25.52 ? 236  HIS A N   1 
ATOM   974  C CA  . HIS A 1 129 ? -2.540  11.986  36.662 1.00  25.70 ? 236  HIS A CA  1 
ATOM   975  C C   . HIS A 1 129 ? -3.774  12.783  37.054 1.00  25.73 ? 236  HIS A C   1 
ATOM   976  O O   . HIS A 1 129 ? -3.937  13.929  36.613 1.00  25.45 ? 236  HIS A O   1 
ATOM   977  C CB  . HIS A 1 129 ? -1.330  12.634  37.340 1.00  25.37 ? 236  HIS A CB  1 
ATOM   978  C CG  . HIS A 1 129 ? -0.192  11.694  37.578 1.00  24.64 ? 236  HIS A CG  1 
ATOM   979  N ND1 . HIS A 1 129 ? 0.501   11.086  36.553 1.00  23.35 ? 236  HIS A ND1 1 
ATOM   980  C CD2 . HIS A 1 129 ? 0.374   11.260  38.726 1.00  23.70 ? 236  HIS A CD2 1 
ATOM   981  C CE1 . HIS A 1 129 ? 1.439   10.311  37.062 1.00  24.16 ? 236  HIS A CE1 1 
ATOM   982  N NE2 . HIS A 1 129 ? 1.383   10.397  38.379 1.00  23.63 ? 236  HIS A NE2 1 
ATOM   983  N N   . ASN A 1 130 ? -4.640  12.200  37.886 1.00  25.94 ? 237  ASN A N   1 
ATOM   984  C CA  . ASN A 1 130 ? -5.813  12.932  38.361 1.00  25.90 ? 237  ASN A CA  1 
ATOM   985  C C   . ASN A 1 130 ? -5.427  13.916  39.439 1.00  25.74 ? 237  ASN A C   1 
ATOM   986  O O   . ASN A 1 130 ? -4.497  13.676  40.209 1.00  26.12 ? 237  ASN A O   1 
ATOM   987  C CB  . ASN A 1 130 ? -6.898  11.994  38.884 1.00  25.96 ? 237  ASN A CB  1 
ATOM   988  C CG  . ASN A 1 130 ? -7.400  11.037  37.815 1.00  26.66 ? 237  ASN A CG  1 
ATOM   989  O OD1 . ASN A 1 130 ? -7.747  11.448  36.707 1.00  28.37 ? 237  ASN A OD1 1 
ATOM   990  N ND2 . ASN A 1 130 ? -7.406  9.755   38.133 1.00  26.72 ? 237  ASN A ND2 1 
ATOM   991  N N   . ILE A 1 131 ? -6.154  15.024  39.473 1.00  25.58 ? 238  ILE A N   1 
ATOM   992  C CA  . ILE A 1 131 ? -6.005  16.055  40.483 1.00  25.56 ? 238  ILE A CA  1 
ATOM   993  C C   . ILE A 1 131 ? -7.039  15.718  41.560 1.00  25.46 ? 238  ILE A C   1 
ATOM   994  O O   . ILE A 1 131 ? -8.207  15.595  41.250 1.00  25.05 ? 238  ILE A O   1 
ATOM   995  C CB  . ILE A 1 131 ? -6.233  17.437  39.848 1.00  25.08 ? 238  ILE A CB  1 
ATOM   996  C CG1 . ILE A 1 131 ? -5.287  17.635  38.652 1.00  25.19 ? 238  ILE A CG1 1 
ATOM   997  C CG2 . ILE A 1 131 ? -5.980  18.530  40.836 1.00  25.96 ? 238  ILE A CG2 1 
ATOM   998  C CD1 . ILE A 1 131 ? -5.824  18.589  37.585 1.00  26.19 ? 238  ILE A CD1 1 
ATOM   999  N N   . CYS A 1 132 ? -6.584  15.516  42.799 1.00  25.94 ? 239  CYS A N   1 
ATOM   1000 C CA  . CYS A 1 132 ? -7.451  15.148  43.928 1.00  26.92 ? 239  CYS A CA  1 
ATOM   1001 C C   . CYS A 1 132 ? -7.809  16.342  44.799 1.00  26.78 ? 239  CYS A C   1 
ATOM   1002 O O   . CYS A 1 132 ? -8.968  16.543  45.126 1.00  26.26 ? 239  CYS A O   1 
ATOM   1003 C CB  . CYS A 1 132 ? -6.787  14.066  44.797 1.00  26.87 ? 239  CYS A CB  1 
ATOM   1004 S SG  . CYS A 1 132 ? -6.393  12.554  43.867 1.00  31.12 ? 239  CYS A SG  1 
ATOM   1005 N N   . GLU A 1 133 ? -6.800  17.117  45.182 1.00  27.54 ? 240  GLU A N   1 
ATOM   1006 C CA  . GLU A 1 133 ? -6.971  18.265  46.054 1.00  28.34 ? 240  GLU A CA  1 
ATOM   1007 C C   . GLU A 1 133 ? -6.130  19.439  45.540 1.00  28.74 ? 240  GLU A C   1 
ATOM   1008 O O   . GLU A 1 133 ? -5.077  19.233  44.948 1.00  28.85 ? 240  GLU A O   1 
ATOM   1009 C CB  . GLU A 1 133 ? -6.554  17.925  47.504 1.00  28.53 ? 240  GLU A CB  1 
ATOM   1010 C CG  . GLU A 1 133 ? -7.093  16.615  48.060 1.00  30.30 ? 240  GLU A CG  1 
ATOM   1011 C CD  . GLU A 1 133 ? -6.506  16.259  49.422 1.00  32.82 ? 240  GLU A CD  1 
ATOM   1012 O OE1 . GLU A 1 133 ? -6.287  17.157  50.281 1.00  33.13 ? 240  GLU A OE1 1 
ATOM   1013 O OE2 . GLU A 1 133 ? -6.244  15.066  49.638 1.00  35.17 ? 240  GLU A OE2 1 
ATOM   1014 N N   . ILE A 1 134 ? -6.601  20.659  45.781 1.00  29.30 ? 241  ILE A N   1 
ATOM   1015 C CA  . ILE A 1 134 ? -5.858  21.892  45.504 1.00  30.01 ? 241  ILE A CA  1 
ATOM   1016 C C   . ILE A 1 134 ? -6.001  22.788  46.721 1.00  30.85 ? 241  ILE A C   1 
ATOM   1017 O O   . ILE A 1 134 ? -7.100  23.287  46.987 1.00  31.64 ? 241  ILE A O   1 
ATOM   1018 C CB  . ILE A 1 134 ? -6.414  22.634  44.268 1.00  29.85 ? 241  ILE A CB  1 
ATOM   1019 C CG1 . ILE A 1 134 ? -6.296  21.765  43.020 1.00  29.84 ? 241  ILE A CG1 1 
ATOM   1020 C CG2 . ILE A 1 134 ? -5.686  23.949  44.072 1.00  30.30 ? 241  ILE A CG2 1 
ATOM   1021 C CD1 . ILE A 1 134 ? -6.855  22.398  41.759 1.00  30.57 ? 241  ILE A CD1 1 
ATOM   1022 N N   . ASN A 1 135 ? -4.901  22.977  47.450 1.00  31.38 ? 242  ASN A N   1 
ATOM   1023 C CA  . ASN A 1 135 ? -4.848  23.821  48.637 1.00  32.32 ? 242  ASN A CA  1 
ATOM   1024 C C   . ASN A 1 135 ? -5.906  23.443  49.667 1.00  33.16 ? 242  ASN A C   1 
ATOM   1025 O O   . ASN A 1 135 ? -6.619  24.312  50.174 1.00  33.44 ? 242  ASN A O   1 
ATOM   1026 C CB  . ASN A 1 135 ? -5.010  25.299  48.256 1.00  32.64 ? 242  ASN A CB  1 
ATOM   1027 C CG  . ASN A 1 135 ? -3.819  25.846  47.509 1.00  32.72 ? 242  ASN A CG  1 
ATOM   1028 O OD1 . ASN A 1 135 ? -2.709  25.325  47.624 1.00  33.42 ? 242  ASN A OD1 1 
ATOM   1029 N ND2 . ASN A 1 135 ? -4.038  26.921  46.754 1.00  31.75 ? 242  ASN A ND2 1 
ATOM   1030 N N   . GLY A 1 136 ? -6.001  22.152  49.968 1.00  33.42 ? 243  GLY A N   1 
ATOM   1031 C CA  . GLY A 1 136 ? -6.970  21.660  50.924 1.00  33.82 ? 243  GLY A CA  1 
ATOM   1032 C C   . GLY A 1 136 ? -8.312  21.291  50.300 1.00  33.90 ? 243  GLY A C   1 
ATOM   1033 O O   . GLY A 1 136 ? -9.014  20.444  50.832 1.00  34.74 ? 243  GLY A O   1 
ATOM   1034 N N   . GLN A 1 137 ? -8.664  21.889  49.169 1.00  33.32 ? 244  GLN A N   1 
ATOM   1035 C CA  . GLN A 1 137 ? -9.984  21.692  48.589 1.00  33.24 ? 244  GLN A CA  1 
ATOM   1036 C C   . GLN A 1 137 ? -10.052 20.470  47.669 1.00  33.17 ? 244  GLN A C   1 
ATOM   1037 O O   . GLN A 1 137 ? -9.372  20.417  46.653 1.00  32.93 ? 244  GLN A O   1 
ATOM   1038 C CB  . GLN A 1 137 ? -10.395 22.948  47.832 1.00  33.09 ? 244  GLN A CB  1 
ATOM   1039 C CG  . GLN A 1 137 ? -10.427 24.183  48.709 1.00  34.08 ? 244  GLN A CG  1 
ATOM   1040 C CD  . GLN A 1 137 ? -10.822 25.437  47.952 1.00  36.25 ? 244  GLN A CD  1 
ATOM   1041 O OE1 . GLN A 1 137 ? -10.111 26.448  48.010 1.00  38.17 ? 244  GLN A OE1 1 
ATOM   1042 N NE2 . GLN A 1 137 ? -11.943 25.379  47.235 1.00  35.37 ? 244  GLN A NE2 1 
ATOM   1043 N N   . ASN A 1 138 ? -10.884 19.494  48.028 1.00  32.92 ? 245  ASN A N   1 
ATOM   1044 C CA  . ASN A 1 138 ? -11.102 18.315  47.195 1.00  32.70 ? 245  ASN A CA  1 
ATOM   1045 C C   . ASN A 1 138 ? -11.847 18.689  45.912 1.00  32.36 ? 245  ASN A C   1 
ATOM   1046 O O   . ASN A 1 138 ? -12.830 19.411  45.955 1.00  32.77 ? 245  ASN A O   1 
ATOM   1047 C CB  . ASN A 1 138 ? -11.875 17.236  47.963 1.00  32.79 ? 245  ASN A CB  1 
ATOM   1048 C CG  . ASN A 1 138 ? -12.271 16.069  47.080 1.00  32.90 ? 245  ASN A CG  1 
ATOM   1049 O OD1 . ASN A 1 138 ? -11.454 15.223  46.770 1.00  34.96 ? 245  ASN A OD1 1 
ATOM   1050 N ND2 . ASN A 1 138 ? -13.523 16.038  46.654 1.00  34.01 ? 245  ASN A ND2 1 
ATOM   1051 N N   . VAL A 1 139 ? -11.363 18.190  44.783 1.00  31.82 ? 246  VAL A N   1 
ATOM   1052 C CA  . VAL A 1 139 ? -11.874 18.550  43.467 1.00  31.38 ? 246  VAL A CA  1 
ATOM   1053 C C   . VAL A 1 139 ? -12.398 17.354  42.671 1.00  31.75 ? 246  VAL A C   1 
ATOM   1054 O O   . VAL A 1 139 ? -12.869 17.522  41.545 1.00  31.05 ? 246  VAL A O   1 
ATOM   1055 C CB  . VAL A 1 139 ? -10.792 19.293  42.626 1.00  31.28 ? 246  VAL A CB  1 
ATOM   1056 C CG1 . VAL A 1 139 ? -10.518 20.670  43.206 1.00  30.40 ? 246  VAL A CG1 1 
ATOM   1057 C CG2 . VAL A 1 139 ? -9.488  18.487  42.528 1.00  30.31 ? 246  VAL A CG2 1 
ATOM   1058 N N   . ILE A 1 140 ? -12.317 16.157  43.253 1.00  32.69 ? 247  ILE A N   1 
ATOM   1059 C CA  . ILE A 1 140 ? -12.916 14.950  42.672 1.00  33.43 ? 247  ILE A CA  1 
ATOM   1060 C C   . ILE A 1 140 ? -14.424 15.096  42.643 1.00  33.97 ? 247  ILE A C   1 
ATOM   1061 O O   . ILE A 1 140 ? -15.035 15.443  43.651 1.00  33.71 ? 247  ILE A O   1 
ATOM   1062 C CB  . ILE A 1 140 ? -12.530 13.673  43.493 1.00  33.44 ? 247  ILE A CB  1 
ATOM   1063 C CG1 . ILE A 1 140 ? -11.042 13.359  43.345 1.00  33.63 ? 247  ILE A CG1 1 
ATOM   1064 C CG2 . ILE A 1 140 ? -13.377 12.447  43.070 1.00  33.53 ? 247  ILE A CG2 1 
ATOM   1065 C CD1 . ILE A 1 140 ? -10.569 13.281  41.900 1.00  34.44 ? 247  ILE A CD1 1 
ATOM   1066 N N   . GLY A 1 141 ? -15.018 14.819  41.484 1.00  35.01 ? 248  GLY A N   1 
ATOM   1067 C CA  . GLY A 1 141 ? -16.446 15.006  41.287 1.00  35.69 ? 248  GLY A CA  1 
ATOM   1068 C C   . GLY A 1 141 ? -16.869 16.433  40.954 1.00  36.48 ? 248  GLY A C   1 
ATOM   1069 O O   . GLY A 1 141 ? -18.069 16.737  40.979 1.00  36.87 ? 248  GLY A O   1 
ATOM   1070 N N   . LEU A 1 142 ? -15.905 17.296  40.633 1.00  37.01 ? 249  LEU A N   1 
ATOM   1071 C CA  . LEU A 1 142 ? -16.189 18.671  40.211 1.00  37.64 ? 249  LEU A CA  1 
ATOM   1072 C C   . LEU A 1 142 ? -15.973 18.822  38.726 1.00  37.93 ? 249  LEU A C   1 
ATOM   1073 O O   . LEU A 1 142 ? -15.300 18.000  38.094 1.00  38.31 ? 249  LEU A O   1 
ATOM   1074 C CB  . LEU A 1 142 ? -15.283 19.676  40.913 1.00  37.64 ? 249  LEU A CB  1 
ATOM   1075 C CG  . LEU A 1 142 ? -15.353 19.789  42.426 1.00  37.95 ? 249  LEU A CG  1 
ATOM   1076 C CD1 . LEU A 1 142 ? -14.415 20.891  42.880 1.00  38.43 ? 249  LEU A CD1 1 
ATOM   1077 C CD2 . LEU A 1 142 ? -16.762 20.083  42.870 1.00  39.31 ? 249  LEU A CD2 1 
ATOM   1078 N N   . LYS A 1 143 ? -16.541 19.887  38.170 1.00  38.33 ? 250  LYS A N   1 
ATOM   1079 C CA  . LYS A 1 143 ? -16.379 20.192  36.753 1.00  38.48 ? 250  LYS A CA  1 
ATOM   1080 C C   . LYS A 1 143 ? -15.120 21.016  36.546 1.00  38.08 ? 250  LYS A C   1 
ATOM   1081 O O   . LYS A 1 143 ? -14.672 21.721  37.444 1.00  37.79 ? 250  LYS A O   1 
ATOM   1082 C CB  . LYS A 1 143 ? -17.599 20.941  36.225 1.00  38.98 ? 250  LYS A CB  1 
ATOM   1083 C CG  . LYS A 1 143 ? -18.859 20.072  36.144 1.00  40.03 ? 250  LYS A CG  1 
ATOM   1084 C CD  . LYS A 1 143 ? -19.444 20.037  34.723 1.00  41.16 ? 250  LYS A CD  1 
ATOM   1085 C CE  . LYS A 1 143 ? -20.197 21.317  34.374 1.00  41.12 ? 250  LYS A CE  1 
ATOM   1086 N NZ  . LYS A 1 143 ? -19.969 22.431  35.336 1.00  40.50 ? 250  LYS A NZ  1 
ATOM   1087 N N   . ASP A 1 144 ? -14.553 20.924  35.354 1.00  37.94 ? 251  ASP A N   1 
ATOM   1088 C CA  . ASP A 1 144 ? -13.307 21.599  35.055 1.00  38.04 ? 251  ASP A CA  1 
ATOM   1089 C C   . ASP A 1 144 ? -13.340 23.071  35.398 1.00  38.29 ? 251  ASP A C   1 
ATOM   1090 O O   . ASP A 1 144 ? -12.327 23.606  35.839 1.00  38.55 ? 251  ASP A O   1 
ATOM   1091 C CB  . ASP A 1 144 ? -12.946 21.435  33.582 1.00  38.29 ? 251  ASP A CB  1 
ATOM   1092 C CG  . ASP A 1 144 ? -12.675 19.999  33.201 1.00  37.64 ? 251  ASP A CG  1 
ATOM   1093 O OD1 . ASP A 1 144 ? -12.311 19.206  34.096 1.00  37.96 ? 251  ASP A OD1 1 
ATOM   1094 O OD2 . ASP A 1 144 ? -12.803 19.573  32.033 1.00  37.05 ? 251  ASP A OD2 1 
ATOM   1095 N N   . SER A 1 145 ? -14.488 23.728  35.205 1.00  38.49 ? 252  SER A N   1 
ATOM   1096 C CA  . SER A 1 145 ? -14.601 25.168  35.472 1.00  38.63 ? 252  SER A CA  1 
ATOM   1097 C C   . SER A 1 145 ? -14.438 25.522  36.944 1.00  38.33 ? 252  SER A C   1 
ATOM   1098 O O   . SER A 1 145 ? -13.821 26.530  37.279 1.00  38.78 ? 252  SER A O   1 
ATOM   1099 C CB  . SER A 1 145 ? -15.917 25.755  34.913 1.00  39.11 ? 252  SER A CB  1 
ATOM   1100 O OG  . SER A 1 145 ? -17.072 25.017  35.293 1.00  40.28 ? 252  SER A OG  1 
ATOM   1101 N N   . GLN A 1 146 ? -14.988 24.694  37.822 1.00  38.20 ? 253  GLN A N   1 
ATOM   1102 C CA  . GLN A 1 146 ? -14.843 24.882  39.269 1.00  38.17 ? 253  GLN A CA  1 
ATOM   1103 C C   . GLN A 1 146 ? -13.391 24.690  39.733 1.00  37.87 ? 253  GLN A C   1 
ATOM   1104 O O   . GLN A 1 146 ? -12.922 25.369  40.639 1.00  37.61 ? 253  GLN A O   1 
ATOM   1105 C CB  . GLN A 1 146 ? -15.762 23.911  40.015 1.00  38.53 ? 253  GLN A CB  1 
ATOM   1106 C CG  . GLN A 1 146 ? -17.254 24.030  39.662 1.00  38.81 ? 253  GLN A CG  1 
ATOM   1107 C CD  . GLN A 1 146 ? -18.126 23.151  40.542 1.00  39.77 ? 253  GLN A CD  1 
ATOM   1108 O OE1 . GLN A 1 146 ? -18.796 22.230  40.045 1.00  39.66 ? 253  GLN A OE1 1 
ATOM   1109 N NE2 . GLN A 1 146 ? -18.105 23.417  41.859 1.00  38.27 ? 253  GLN A NE2 1 
ATOM   1110 N N   . ILE A 1 147 ? -12.686 23.773  39.084 1.00  38.02 ? 254  ILE A N   1 
ATOM   1111 C CA  . ILE A 1 147 ? -11.275 23.519  39.369 1.00  38.22 ? 254  ILE A CA  1 
ATOM   1112 C C   . ILE A 1 147 ? -10.408 24.686  38.886 1.00  38.38 ? 254  ILE A C   1 
ATOM   1113 O O   . ILE A 1 147 ? -9.484  25.078  39.573 1.00  37.77 ? 254  ILE A O   1 
ATOM   1114 C CB  . ILE A 1 147 ? -10.811 22.180  38.726 1.00  38.01 ? 254  ILE A CB  1 
ATOM   1115 C CG1 . ILE A 1 147 ? -11.607 21.002  39.313 1.00  37.79 ? 254  ILE A CG1 1 
ATOM   1116 C CG2 . ILE A 1 147 ? -9.291  21.969  38.933 1.00  37.66 ? 254  ILE A CG2 1 
ATOM   1117 C CD1 . ILE A 1 147 ? -11.612 19.755  38.428 1.00  37.12 ? 254  ILE A CD1 1 
ATOM   1118 N N   . ALA A 1 148 ? -10.732 25.248  37.722 1.00  39.43 ? 255  ALA A N   1 
ATOM   1119 C CA  . ALA A 1 148 ? -9.995  26.399  37.176 1.00  40.08 ? 255  ALA A CA  1 
ATOM   1120 C C   . ALA A 1 148 ? -10.235 27.657  37.986 1.00  40.90 ? 255  ALA A C   1 
ATOM   1121 O O   . ALA A 1 148 ? -9.360  28.521  38.051 1.00  41.21 ? 255  ALA A O   1 
ATOM   1122 C CB  . ALA A 1 148 ? -10.360 26.634  35.730 1.00  40.21 ? 255  ALA A CB  1 
ATOM   1123 N N   . ASP A 1 149 ? -11.405 27.747  38.622 1.00  41.83 ? 256  ASP A N   1 
ATOM   1124 C CA  . ASP A 1 149 ? -11.740 28.891  39.467 1.00  42.67 ? 256  ASP A CA  1 
ATOM   1125 C C   . ASP A 1 149 ? -11.086 28.773  40.832 1.00  42.74 ? 256  ASP A C   1 
ATOM   1126 O O   . ASP A 1 149 ? -10.741 29.793  41.447 1.00  43.05 ? 256  ASP A O   1 
ATOM   1127 C CB  . ASP A 1 149 ? -13.264 29.058  39.627 1.00  43.16 ? 256  ASP A CB  1 
ATOM   1128 C CG  . ASP A 1 149 ? -13.899 29.852  38.478 1.00  44.84 ? 256  ASP A CG  1 
ATOM   1129 O OD1 . ASP A 1 149 ? -13.497 31.020  38.242 1.00  45.45 ? 256  ASP A OD1 1 
ATOM   1130 O OD2 . ASP A 1 149 ? -14.814 29.383  37.760 1.00  47.84 ? 256  ASP A OD2 1 
ATOM   1131 N N   . ILE A 1 150 ? -10.915 27.543  41.314 1.00  42.79 ? 257  ILE A N   1 
ATOM   1132 C CA  . ILE A 1 150 ? -10.186 27.314  42.567 1.00  42.72 ? 257  ILE A CA  1 
ATOM   1133 C C   . ILE A 1 150 ? -8.719  27.741  42.385 1.00  42.47 ? 257  ILE A C   1 
ATOM   1134 O O   . ILE A 1 150 ? -8.116  28.365  43.267 1.00  42.30 ? 257  ILE A O   1 
ATOM   1135 C CB  . ILE A 1 150 ? -10.311 25.832  43.020 1.00  42.78 ? 257  ILE A CB  1 
ATOM   1136 C CG1 . ILE A 1 150 ? -11.637 25.624  43.763 1.00  43.48 ? 257  ILE A CG1 1 
ATOM   1137 C CG2 . ILE A 1 150 ? -9.150  25.437  43.929 1.00  42.89 ? 257  ILE A CG2 1 
ATOM   1138 C CD1 . ILE A 1 150 ? -11.907 24.188  44.213 1.00  43.63 ? 257  ILE A CD1 1 
ATOM   1139 N N   . LEU A 1 151 ? -8.170  27.419  41.221 1.00  42.18 ? 258  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 151 ? -6.797  27.750  40.894 1.00  42.30 ? 258  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 151 ? -6.605  29.254  40.688 1.00  42.50 ? 258  LEU A C   1 
ATOM   1142 O O   . LEU A 1 151 ? -5.526  29.772  40.958 1.00  42.66 ? 258  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 151 ? -6.361  26.980  39.637 1.00  42.37 ? 258  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 151 ? -6.192  25.466  39.823 1.00  41.43 ? 258  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 151 ? -6.526  24.689  38.580 1.00  41.66 ? 258  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 151 ? -4.773  25.153  40.229 1.00  42.13 ? 258  LEU A CD2 1 
ATOM   1147 N N   . SER A 1 152 ? -7.654  29.949  40.237 1.00  42.83 ? 259  SER A N   1 
ATOM   1148 C CA  . SER A 1 152 ? -7.591  31.390  39.924 1.00  42.61 ? 259  SER A CA  1 
ATOM   1149 C C   . SER A 1 152 ? -7.504  32.232  41.189 1.00  42.46 ? 259  SER A C   1 
ATOM   1150 O O   . SER A 1 152 ? -6.608  33.058  41.320 1.00  42.88 ? 259  SER A O   1 
ATOM   1151 C CB  . SER A 1 152 ? -8.819  31.833  39.110 1.00  42.96 ? 259  SER A CB  1 
ATOM   1152 O OG  . SER A 1 152 ? -8.464  32.415  37.862 1.00  43.29 ? 259  SER A OG  1 
ATOM   1153 N N   . THR A 1 153 ? -8.431  32.016  42.124 1.00  41.97 ? 260  THR A N   1 
ATOM   1154 C CA  . THR A 1 153 ? -8.471  32.787  43.373 1.00  41.34 ? 260  THR A CA  1 
ATOM   1155 C C   . THR A 1 153 ? -7.406  32.314  44.334 1.00  40.60 ? 260  THR A C   1 
ATOM   1156 O O   . THR A 1 153 ? -7.232  32.896  45.406 1.00  40.63 ? 260  THR A O   1 
ATOM   1157 C CB  . THR A 1 153 ? -9.864  32.711  44.066 1.00  41.55 ? 260  THR A CB  1 
ATOM   1158 O OG1 . THR A 1 153 ? -10.093 31.398  44.599 1.00  41.64 ? 260  THR A OG1 1 
ATOM   1159 C CG2 . THR A 1 153 ? -11.008 32.925  43.066 1.00  42.34 ? 260  THR A CG2 1 
ATOM   1160 N N   . SER A 1 154 ? -6.709  31.234  43.977 1.00  39.95 ? 261  SER A N   1 
ATOM   1161 C CA  . SER A 1 154 ? -5.541  30.817  44.747 1.00  39.05 ? 261  SER A CA  1 
ATOM   1162 C C   . SER A 1 154 ? -4.504  31.932  44.742 1.00  38.19 ? 261  SER A C   1 
ATOM   1163 O O   . SER A 1 154 ? -4.302  32.593  43.727 1.00  38.17 ? 261  SER A O   1 
ATOM   1164 C CB  . SER A 1 154 ? -4.911  29.546  44.167 1.00  38.92 ? 261  SER A CB  1 
ATOM   1165 O OG  . SER A 1 154 ? -3.856  29.093  45.012 1.00  39.20 ? 261  SER A OG  1 
ATOM   1166 N N   . GLY A 1 155 ? -3.859  32.134  45.879 1.00  37.41 ? 262  GLY A N   1 
ATOM   1167 C CA  . GLY A 1 155 ? -2.624  32.892  45.929 1.00  37.14 ? 262  GLY A CA  1 
ATOM   1168 C C   . GLY A 1 155 ? -1.516  32.224  45.117 1.00  36.73 ? 262  GLY A C   1 
ATOM   1169 O O   . GLY A 1 155 ? -1.759  31.304  44.321 1.00  36.47 ? 262  GLY A O   1 
ATOM   1170 N N   . THR A 1 156 ? -0.291  32.691  45.335 1.00  36.17 ? 263  THR A N   1 
ATOM   1171 C CA  . THR A 1 156 ? 0.868   32.270  44.546 1.00  35.35 ? 263  THR A CA  1 
ATOM   1172 C C   . THR A 1 156 ? 1.207   30.775  44.701 1.00  34.40 ? 263  THR A C   1 
ATOM   1173 O O   . THR A 1 156 ? 1.323   30.065  43.708 1.00  33.07 ? 263  THR A O   1 
ATOM   1174 C CB  . THR A 1 156 ? 2.061   33.145  44.926 1.00  35.64 ? 263  THR A CB  1 
ATOM   1175 O OG1 . THR A 1 156 ? 1.828   34.481  44.444 1.00  35.92 ? 263  THR A OG1 1 
ATOM   1176 C CG2 . THR A 1 156 ? 3.358   32.682  44.229 1.00  35.80 ? 263  THR A CG2 1 
ATOM   1177 N N   . VAL A 1 157 ? 1.357   30.313  45.944 1.00  34.02 ? 264  VAL A N   1 
ATOM   1178 C CA  . VAL A 1 157 ? 1.648   28.904  46.210 1.00  33.60 ? 264  VAL A CA  1 
ATOM   1179 C C   . VAL A 1 157 ? 0.410   28.020  45.958 1.00  33.40 ? 264  VAL A C   1 
ATOM   1180 O O   . VAL A 1 157 ? -0.628  28.171  46.602 1.00  33.32 ? 264  VAL A O   1 
ATOM   1181 C CB  . VAL A 1 157 ? 2.164   28.653  47.641 1.00  33.83 ? 264  VAL A CB  1 
ATOM   1182 C CG1 . VAL A 1 157 ? 2.740   27.248  47.740 1.00  34.02 ? 264  VAL A CG1 1 
ATOM   1183 C CG2 . VAL A 1 157 ? 3.227   29.687  48.041 1.00  33.44 ? 264  VAL A CG2 1 
ATOM   1184 N N   . VAL A 1 158 ? 0.537   27.112  44.995 1.00  32.88 ? 265  VAL A N   1 
ATOM   1185 C CA  . VAL A 1 158 ? -0.511  26.169  44.651 1.00  32.30 ? 265  VAL A CA  1 
ATOM   1186 C C   . VAL A 1 158 ? -0.001  24.765  44.929 1.00  31.51 ? 265  VAL A C   1 
ATOM   1187 O O   . VAL A 1 158 ? 0.935   24.296  44.282 1.00  31.75 ? 265  VAL A O   1 
ATOM   1188 C CB  . VAL A 1 158 ? -0.908  26.295  43.174 1.00  32.06 ? 265  VAL A CB  1 
ATOM   1189 C CG1 . VAL A 1 158 ? -1.875  25.191  42.777 1.00  33.02 ? 265  VAL A CG1 1 
ATOM   1190 C CG2 . VAL A 1 158 ? -1.535  27.646  42.924 1.00  32.29 ? 265  VAL A CG2 1 
ATOM   1191 N N   . THR A 1 159 ? -0.645  24.100  45.879 1.00  30.46 ? 266  THR A N   1 
ATOM   1192 C CA  . THR A 1 159 ? -0.258  22.778  46.342 1.00  29.66 ? 266  THR A CA  1 
ATOM   1193 C C   . THR A 1 159 ? -1.331  21.765  45.948 1.00  29.20 ? 266  THR A C   1 
ATOM   1194 O O   . THR A 1 159 ? -2.426  21.758  46.538 1.00  29.52 ? 266  THR A O   1 
ATOM   1195 C CB  . THR A 1 159 ? -0.115  22.833  47.862 1.00  29.77 ? 266  THR A CB  1 
ATOM   1196 O OG1 . THR A 1 159 ? 0.909   23.769  48.208 1.00  28.91 ? 266  THR A OG1 1 
ATOM   1197 C CG2 . THR A 1 159 ? 0.364   21.507  48.440 1.00  29.96 ? 266  THR A CG2 1 
ATOM   1198 N N   . ILE A 1 160 ? -1.031  20.936  44.948 1.00  27.81 ? 267  ILE A N   1 
ATOM   1199 C CA  . ILE A 1 160 ? -1.933  19.890  44.488 1.00  26.97 ? 267  ILE A CA  1 
ATOM   1200 C C   . ILE A 1 160 ? -1.487  18.468  44.890 1.00  26.49 ? 267  ILE A C   1 
ATOM   1201 O O   . ILE A 1 160 ? -0.315  18.139  44.881 1.00  26.61 ? 267  ILE A O   1 
ATOM   1202 C CB  . ILE A 1 160 ? -2.144  19.982  42.929 1.00  27.08 ? 267  ILE A CB  1 
ATOM   1203 C CG1 . ILE A 1 160 ? -0.900  19.583  42.143 1.00  26.41 ? 267  ILE A CG1 1 
ATOM   1204 C CG2 . ILE A 1 160 ? -2.548  21.404  42.499 1.00  27.69 ? 267  ILE A CG2 1 
ATOM   1205 C CD1 . ILE A 1 160 ? -1.152  19.508  40.665 1.00  25.72 ? 267  ILE A CD1 1 
ATOM   1206 N N   . THR A 1 161 ? -2.440  17.629  45.263 1.00  25.96 ? 268  THR A N   1 
ATOM   1207 C CA  . THR A 1 161 ? -2.205  16.204  45.341 1.00  25.56 ? 268  THR A CA  1 
ATOM   1208 C C   . THR A 1 161 ? -2.794  15.571  44.091 1.00  24.98 ? 268  THR A C   1 
ATOM   1209 O O   . THR A 1 161 ? -3.894  15.940  43.665 1.00  24.60 ? 268  THR A O   1 
ATOM   1210 C CB  . THR A 1 161 ? -2.822  15.576  46.620 1.00  25.40 ? 268  THR A CB  1 
ATOM   1211 O OG1 . THR A 1 161 ? -4.252  15.588  46.532 1.00  27.80 ? 268  THR A OG1 1 
ATOM   1212 C CG2 . THR A 1 161 ? -2.506  16.414  47.829 1.00  24.48 ? 268  THR A CG2 1 
ATOM   1213 N N   . ILE A 1 162 ? -2.033  14.627  43.533 1.00  24.12 ? 269  ILE A N   1 
ATOM   1214 C CA  . ILE A 1 162 ? -2.324  13.936  42.290 1.00  24.02 ? 269  ILE A CA  1 
ATOM   1215 C C   . ILE A 1 162 ? -2.200  12.436  42.491 1.00  24.10 ? 269  ILE A C   1 
ATOM   1216 O O   . ILE A 1 162 ? -1.641  11.979  43.474 1.00  23.88 ? 269  ILE A O   1 
ATOM   1217 C CB  . ILE A 1 162 ? -1.308  14.360  41.176 1.00  23.71 ? 269  ILE A CB  1 
ATOM   1218 C CG1 . ILE A 1 162 ? 0.113   13.901  41.561 1.00  23.47 ? 269  ILE A CG1 1 
ATOM   1219 C CG2 . ILE A 1 162 ? -1.406  15.864  40.923 1.00  24.43 ? 269  ILE A CG2 1 
ATOM   1220 C CD1 . ILE A 1 162 ? 1.246   14.538  40.821 1.00  24.22 ? 269  ILE A CD1 1 
ATOM   1221 N N   . MET A 1 163 ? -2.706  11.686  41.533 1.00  24.84 ? 270  MET A N   1 
ATOM   1222 C CA  . MET A 1 163 ? -2.578  10.243  41.518 1.00  26.62 ? 270  MET A CA  1 
ATOM   1223 C C   . MET A 1 163 ? -2.511  9.790   40.070 1.00  27.05 ? 270  MET A C   1 
ATOM   1224 O O   . MET A 1 163 ? -3.238  10.314  39.265 1.00  26.72 ? 270  MET A O   1 
ATOM   1225 C CB  . MET A 1 163 ? -3.822  9.589   42.109 1.00  26.68 ? 270  MET A CB  1 
ATOM   1226 C CG  . MET A 1 163 ? -4.032  9.736   43.578 1.00  29.05 ? 270  MET A CG  1 
ATOM   1227 S SD  . MET A 1 163 ? -5.332  8.573   44.125 1.00  30.64 ? 270  MET A SD  1 
ATOM   1228 C CE  . MET A 1 163 ? -6.655  8.967   43.061 1.00  30.79 ? 270  MET A CE  1 
ATOM   1229 N N   . PRO A 1 164 ? -1.707  8.784   39.747 1.00  28.86 ? 271  PRO A N   1 
ATOM   1230 C CA  . PRO A 1 164 ? -1.738  8.200   38.396 1.00  30.22 ? 271  PRO A CA  1 
ATOM   1231 C C   . PRO A 1 164 ? -3.134  7.665   38.060 1.00  32.04 ? 271  PRO A C   1 
ATOM   1232 O O   . PRO A 1 164 ? -3.724  6.998   38.907 1.00  32.24 ? 271  PRO A O   1 
ATOM   1233 C CB  . PRO A 1 164 ? -0.712  7.058   38.468 1.00  30.15 ? 271  PRO A CB  1 
ATOM   1234 C CG  . PRO A 1 164 ? -0.421  6.847   39.929 1.00  29.19 ? 271  PRO A CG  1 
ATOM   1235 C CD  . PRO A 1 164 ? -0.727  8.120   40.627 1.00  28.86 ? 271  PRO A CD  1 
ATOM   1236 N N   . ALA A 1 165 ? -3.644  7.966   36.865 1.00  34.31 ? 272  ALA A N   1 
ATOM   1237 C CA  . ALA A 1 165 ? -5.020  7.613   36.467 1.00  36.39 ? 272  ALA A CA  1 
ATOM   1238 C C   . ALA A 1 165 ? -5.334  6.111   36.543 1.00  38.61 ? 272  ALA A C   1 
ATOM   1239 O O   . ALA A 1 165 ? -6.410  5.733   37.027 1.00  39.26 ? 272  ALA A O   1 
ATOM   1240 C CB  . ALA A 1 165 ? -5.337  8.147   35.078 1.00  36.19 ? 272  ALA A CB  1 
ATOM   1241 N N   . PHE A 1 166 ? -4.420  5.265   36.063 1.00  40.80 ? 273  PHE A N   1 
ATOM   1242 C CA  . PHE A 1 166 ? -4.478  3.808   36.331 1.00  42.73 ? 273  PHE A CA  1 
ATOM   1243 C C   . PHE A 1 166 ? -5.823  3.135   35.997 1.00  43.63 ? 273  PHE A C   1 
ATOM   1244 O O   . PHE A 1 166 ? -6.023  2.615   34.889 1.00  45.01 ? 273  PHE A O   1 
ATOM   1245 C CB  . PHE A 1 166 ? -4.125  3.514   37.808 1.00  42.90 ? 273  PHE A CB  1 
ATOM   1246 C CG  . PHE A 1 166 ? -2.760  2.891   38.006 1.00  44.35 ? 273  PHE A CG  1 
ATOM   1247 C CD1 . PHE A 1 166 ? -2.437  1.684   37.399 1.00  46.05 ? 273  PHE A CD1 1 
ATOM   1248 C CD2 . PHE A 1 166 ? -1.811  3.504   38.813 1.00  45.72 ? 273  PHE A CD2 1 
ATOM   1249 C CE1 . PHE A 1 166 ? -1.196  1.108   37.578 1.00  46.99 ? 273  PHE A CE1 1 
ATOM   1250 C CE2 . PHE A 1 166 ? -0.559  2.932   38.999 1.00  46.58 ? 273  PHE A CE2 1 
ATOM   1251 C CZ  . PHE A 1 166 ? -0.255  1.733   38.383 1.00  46.97 ? 273  PHE A CZ  1 
ATOM   1252 O OXT . PHE A 1 166 ? -6.763  3.060   36.813 1.00  44.38 ? 273  PHE A OXT 1 
ATOM   1253 N N   . MET B 1 3   ? 11.281  13.827  50.127 1.00  35.87 ? 110  MET B N   1 
ATOM   1254 C CA  . MET B 1 3   ? 10.315  14.859  49.636 1.00  35.47 ? 110  MET B CA  1 
ATOM   1255 C C   . MET B 1 3   ? 10.960  15.818  48.621 1.00  35.60 ? 110  MET B C   1 
ATOM   1256 O O   . MET B 1 3   ? 10.696  15.723  47.406 1.00  36.29 ? 110  MET B O   1 
ATOM   1257 C CB  . MET B 1 3   ? 9.735   15.646  50.819 0.010 35.05 ? 110  MET B CB  1 
ATOM   1258 C CG  . MET B 1 3   ? 8.817   14.834  51.724 0.010 33.66 ? 110  MET B CG  1 
ATOM   1259 S SD  . MET B 1 3   ? 7.187   14.541  51.008 0.010 31.24 ? 110  MET B SD  1 
ATOM   1260 C CE  . MET B 1 3   ? 6.450   16.167  51.159 0.010 29.70 ? 110  MET B CE  1 
ATOM   1261 N N   . ASP B 1 4   ? 11.797  16.736  49.114 1.00  35.00 ? 111  ASP B N   1 
ATOM   1262 C CA  . ASP B 1 4   ? 12.455  17.720  48.254 1.00  34.18 ? 111  ASP B CA  1 
ATOM   1263 C C   . ASP B 1 4   ? 13.413  16.988  47.321 1.00  32.92 ? 111  ASP B C   1 
ATOM   1264 O O   . ASP B 1 4   ? 13.899  15.911  47.654 1.00  31.73 ? 111  ASP B O   1 
ATOM   1265 C CB  . ASP B 1 4   ? 13.251  18.756  49.077 1.00  34.54 ? 111  ASP B CB  1 
ATOM   1266 C CG  . ASP B 1 4   ? 12.391  19.932  49.568 1.00  35.59 ? 111  ASP B CG  1 
ATOM   1267 O OD1 . ASP B 1 4   ? 12.906  20.722  50.375 1.00  37.56 ? 111  ASP B OD1 1 
ATOM   1268 O OD2 . ASP B 1 4   ? 11.212  20.163  49.218 1.00  37.10 ? 111  ASP B OD2 1 
ATOM   1269 N N   . PRO B 1 5   ? 13.714  17.583  46.171 1.00  31.78 ? 112  PRO B N   1 
ATOM   1270 C CA  . PRO B 1 5   ? 14.685  16.984  45.252 1.00  31.17 ? 112  PRO B CA  1 
ATOM   1271 C C   . PRO B 1 5   ? 16.097  17.197  45.797 1.00  30.41 ? 112  PRO B C   1 
ATOM   1272 O O   . PRO B 1 5   ? 16.276  17.989  46.731 1.00  30.25 ? 112  PRO B O   1 
ATOM   1273 C CB  . PRO B 1 5   ? 14.480  17.755  43.939 1.00  31.00 ? 112  PRO B CB  1 
ATOM   1274 C CG  . PRO B 1 5   ? 13.694  18.981  44.276 1.00  31.27 ? 112  PRO B CG  1 
ATOM   1275 C CD  . PRO B 1 5   ? 13.240  18.892  45.701 1.00  31.72 ? 112  PRO B CD  1 
ATOM   1276 N N   . ARG B 1 6   ? 17.062  16.477  45.237 1.00  29.81 ? 113  ARG B N   1 
ATOM   1277 C CA  . ARG B 1 6   ? 18.467  16.655  45.559 1.00  29.81 ? 113  ARG B CA  1 
ATOM   1278 C C   . ARG B 1 6   ? 19.284  16.844  44.285 1.00  29.83 ? 113  ARG B C   1 
ATOM   1279 O O   . ARG B 1 6   ? 18.896  16.421  43.199 1.00  27.65 ? 113  ARG B O   1 
ATOM   1280 C CB  . ARG B 1 6   ? 18.985  15.464  46.361 1.00  29.98 ? 113  ARG B CB  1 
ATOM   1281 C CG  . ARG B 1 6   ? 19.140  14.149  45.571 1.00  30.41 ? 113  ARG B CG  1 
ATOM   1282 C CD  . ARG B 1 6   ? 19.002  12.912  46.438 1.00  30.66 ? 113  ARG B CD  1 
ATOM   1283 N NE  . ARG B 1 6   ? 19.448  11.694  45.771 1.00  30.83 ? 113  ARG B NE  1 
ATOM   1284 C CZ  . ARG B 1 6   ? 20.718  11.332  45.625 1.00  31.90 ? 113  ARG B CZ  1 
ATOM   1285 N NH1 . ARG B 1 6   ? 21.712  12.098  46.067 1.00  33.44 ? 113  ARG B NH1 1 
ATOM   1286 N NH2 . ARG B 1 6   ? 21.007  10.197  45.018 1.00  32.24 ? 113  ARG B NH2 1 
ATOM   1287 N N   . GLU B 1 7   ? 20.422  17.505  44.438 1.00  30.52 ? 114  GLU B N   1 
ATOM   1288 C CA  . GLU B 1 7   ? 21.293  17.813  43.326 1.00  31.50 ? 114  GLU B CA  1 
ATOM   1289 C C   . GLU B 1 7   ? 22.477  16.868  43.410 1.00  31.73 ? 114  GLU B C   1 
ATOM   1290 O O   . GLU B 1 7   ? 22.981  16.603  44.491 1.00  31.15 ? 114  GLU B O   1 
ATOM   1291 C CB  . GLU B 1 7   ? 21.751  19.263  43.411 1.00  32.17 ? 114  GLU B CB  1 
ATOM   1292 C CG  . GLU B 1 7   ? 20.620  20.292  43.329 1.00  35.04 ? 114  GLU B CG  1 
ATOM   1293 C CD  . GLU B 1 7   ? 19.736  20.363  44.571 1.00  38.56 ? 114  GLU B CD  1 
ATOM   1294 O OE1 . GLU B 1 7   ? 20.274  20.339  45.714 1.00  41.07 ? 114  GLU B OE1 1 
ATOM   1295 O OE2 . GLU B 1 7   ? 18.488  20.448  44.402 1.00  40.61 ? 114  GLU B OE2 1 
ATOM   1296 N N   . VAL B 1 8   ? 22.873  16.319  42.276 1.00  32.29 ? 115  VAL B N   1 
ATOM   1297 C CA  . VAL B 1 8   ? 24.045  15.474  42.189 1.00  33.37 ? 115  VAL B CA  1 
ATOM   1298 C C   . VAL B 1 8   ? 24.919  16.000  41.062 1.00  34.79 ? 115  VAL B C   1 
ATOM   1299 O O   . VAL B 1 8   ? 24.433  16.656  40.131 1.00  34.43 ? 115  VAL B O   1 
ATOM   1300 C CB  . VAL B 1 8   ? 23.690  13.986  41.918 1.00  33.37 ? 115  VAL B CB  1 
ATOM   1301 C CG1 . VAL B 1 8   ? 22.981  13.375  43.099 1.00  32.85 ? 115  VAL B CG1 1 
ATOM   1302 C CG2 . VAL B 1 8   ? 22.842  13.824  40.638 1.00  33.35 ? 115  VAL B CG2 1 
ATOM   1303 N N   . ILE B 1 9   ? 26.211  15.713  41.160 1.00  36.34 ? 116  ILE B N   1 
ATOM   1304 C CA  . ILE B 1 9   ? 27.194  16.124  40.162 1.00  37.81 ? 116  ILE B CA  1 
ATOM   1305 C C   . ILE B 1 9   ? 27.974  14.888  39.765 1.00  39.15 ? 116  ILE B C   1 
ATOM   1306 O O   . ILE B 1 9   ? 28.692  14.317  40.587 1.00  39.46 ? 116  ILE B O   1 
ATOM   1307 C CB  . ILE B 1 9   ? 28.148  17.191  40.731 1.00  37.97 ? 116  ILE B CB  1 
ATOM   1308 C CG1 . ILE B 1 9   ? 27.368  18.260  41.500 1.00  37.95 ? 116  ILE B CG1 1 
ATOM   1309 C CG2 . ILE B 1 9   ? 28.976  17.821  39.608 1.00  37.78 ? 116  ILE B CG2 1 
ATOM   1310 C CD1 . ILE B 1 9   ? 26.584  19.190  40.638 1.00  38.80 ? 116  ILE B CD1 1 
ATOM   1311 N N   . LEU B 1 10  ? 27.779  14.439  38.529 1.00  41.03 ? 117  LEU B N   1 
ATOM   1312 C CA  . LEU B 1 10  ? 28.482  13.275  38.002 1.00  42.60 ? 117  LEU B CA  1 
ATOM   1313 C C   . LEU B 1 10  ? 29.700  13.711  37.189 1.00  44.05 ? 117  LEU B C   1 
ATOM   1314 O O   . LEU B 1 10  ? 29.802  14.868  36.770 1.00  43.86 ? 117  LEU B O   1 
ATOM   1315 C CB  . LEU B 1 10  ? 27.551  12.431  37.124 1.00  42.72 ? 117  LEU B CB  1 
ATOM   1316 C CG  . LEU B 1 10  ? 26.361  11.775  37.826 1.00  42.68 ? 117  LEU B CG  1 
ATOM   1317 C CD1 . LEU B 1 10  ? 25.204  12.752  37.971 1.00  43.52 ? 117  LEU B CD1 1 
ATOM   1318 C CD2 . LEU B 1 10  ? 25.913  10.525  37.085 1.00  43.51 ? 117  LEU B CD2 1 
ATOM   1319 N N   . CYS B 1 11  ? 30.623  12.777  36.983 1.00  45.75 ? 118  CYS B N   1 
ATOM   1320 C CA  . CYS B 1 11  ? 31.795  13.015  36.152 1.00  47.26 ? 118  CYS B CA  1 
ATOM   1321 C C   . CYS B 1 11  ? 31.923  11.938  35.083 1.00  48.16 ? 118  CYS B C   1 
ATOM   1322 O O   . CYS B 1 11  ? 31.938  10.756  35.406 1.00  47.79 ? 118  CYS B O   1 
ATOM   1323 C CB  . CYS B 1 11  ? 33.055  13.026  37.012 1.00  47.56 ? 118  CYS B CB  1 
ATOM   1324 S SG  . CYS B 1 11  ? 34.497  13.608  36.102 1.00  49.21 ? 118  CYS B SG  1 
ATOM   1325 N N   . LYS B 1 12  ? 32.026  12.349  33.818 1.00  49.74 ? 119  LYS B N   1 
ATOM   1326 C CA  . LYS B 1 12  ? 32.103  11.405  32.704 1.00  51.11 ? 119  LYS B CA  1 
ATOM   1327 C C   . LYS B 1 12  ? 33.407  10.609  32.766 1.00  52.34 ? 119  LYS B C   1 
ATOM   1328 O O   . LYS B 1 12  ? 34.443  11.131  33.178 1.00  52.35 ? 119  LYS B O   1 
ATOM   1329 C CB  . LYS B 1 12  ? 32.045  12.119  31.342 1.00  51.24 ? 119  LYS B CB  1 
ATOM   1330 C CG  . LYS B 1 12  ? 30.999  13.219  31.177 1.00  51.44 ? 119  LYS B CG  1 
ATOM   1331 C CD  . LYS B 1 12  ? 30.918  13.658  29.710 1.00  51.75 ? 119  LYS B CD  1 
ATOM   1332 C CE  . LYS B 1 12  ? 29.781  14.652  29.454 1.00  52.11 ? 119  LYS B CE  1 
ATOM   1333 N NZ  . LYS B 1 12  ? 29.909  15.368  28.144 1.00  51.34 ? 119  LYS B NZ  1 
ATOM   1334 N N   . ASP B 1 13  ? 33.352  9.352   32.335 1.00  53.98 ? 120  ASP B N   1 
ATOM   1335 C CA  . ASP B 1 13  ? 34.554  8.522   32.209 1.00  55.37 ? 120  ASP B CA  1 
ATOM   1336 C C   . ASP B 1 13  ? 35.378  8.926   30.955 1.00  56.41 ? 120  ASP B C   1 
ATOM   1337 O O   . ASP B 1 13  ? 35.270  10.067  30.478 1.00  56.67 ? 120  ASP B O   1 
ATOM   1338 C CB  . ASP B 1 13  ? 34.175  7.016   32.268 1.00  55.56 ? 120  ASP B CB  1 
ATOM   1339 C CG  . ASP B 1 13  ? 33.637  6.454   30.937 1.00  55.78 ? 120  ASP B CG  1 
ATOM   1340 O OD1 . ASP B 1 13  ? 32.397  6.389   30.755 1.00  54.60 ? 120  ASP B OD1 1 
ATOM   1341 O OD2 . ASP B 1 13  ? 34.389  6.007   30.040 1.00  55.90 ? 120  ASP B OD2 1 
ATOM   1342 N N   . GLN B 1 14  ? 36.204  8.001   30.453 1.00  57.62 ? 121  GLN B N   1 
ATOM   1343 C CA  . GLN B 1 14  ? 37.109  8.214   29.307 1.00  58.08 ? 121  GLN B CA  1 
ATOM   1344 C C   . GLN B 1 14  ? 36.443  8.647   27.985 1.00  58.12 ? 121  GLN B C   1 
ATOM   1345 O O   . GLN B 1 14  ? 36.933  9.565   27.315 1.00  58.12 ? 121  GLN B O   1 
ATOM   1346 C CB  . GLN B 1 14  ? 37.931  6.931   29.084 1.00  58.49 ? 121  GLN B CB  1 
ATOM   1347 C CG  . GLN B 1 14  ? 39.096  7.049   28.092 1.00  59.22 ? 121  GLN B CG  1 
ATOM   1348 C CD  . GLN B 1 14  ? 39.119  5.909   27.074 1.00  61.12 ? 121  GLN B CD  1 
ATOM   1349 O OE1 . GLN B 1 14  ? 40.092  5.141   27.006 1.00  61.81 ? 121  GLN B OE1 1 
ATOM   1350 N NE2 . GLN B 1 14  ? 38.049  5.798   26.280 1.00  61.49 ? 121  GLN B NE2 1 
ATOM   1351 N N   . ASP B 1 15  ? 35.349  7.984   27.611 1.00  58.09 ? 122  ASP B N   1 
ATOM   1352 C CA  . ASP B 1 15  ? 34.633  8.290   26.359 1.00  58.05 ? 122  ASP B CA  1 
ATOM   1353 C C   . ASP B 1 15  ? 33.655  9.444   26.569 1.00  57.61 ? 122  ASP B C   1 
ATOM   1354 O O   . ASP B 1 15  ? 33.601  10.389  25.774 1.00  57.77 ? 122  ASP B O   1 
ATOM   1355 C CB  . ASP B 1 15  ? 33.858  7.067   25.817 1.00  58.17 ? 122  ASP B CB  1 
ATOM   1356 C CG  . ASP B 1 15  ? 34.331  5.749   26.411 1.00  58.57 ? 122  ASP B CG  1 
ATOM   1357 O OD1 . ASP B 1 15  ? 33.647  5.232   27.325 1.00  58.36 ? 122  ASP B OD1 1 
ATOM   1358 O OD2 . ASP B 1 15  ? 35.373  5.168   26.031 1.00  58.71 ? 122  ASP B OD2 1 
ATOM   1359 N N   . GLY B 1 16  ? 32.899  9.353   27.659 1.00  57.05 ? 123  GLY B N   1 
ATOM   1360 C CA  . GLY B 1 16  ? 31.818  10.278  27.953 1.00  56.48 ? 123  GLY B CA  1 
ATOM   1361 C C   . GLY B 1 16  ? 30.539  9.599   28.426 1.00  55.95 ? 123  GLY B C   1 
ATOM   1362 O O   . GLY B 1 16  ? 29.471  10.218  28.374 1.00  56.24 ? 123  GLY B O   1 
ATOM   1363 N N   . LYS B 1 17  ? 30.644  8.343   28.882 1.00  54.92 ? 124  LYS B N   1 
ATOM   1364 C CA  . LYS B 1 17  ? 29.499  7.552   29.362 1.00  54.06 ? 124  LYS B CA  1 
ATOM   1365 C C   . LYS B 1 17  ? 29.368  7.690   30.886 1.00  52.61 ? 124  LYS B C   1 
ATOM   1366 O O   . LYS B 1 17  ? 30.356  7.961   31.572 1.00  52.94 ? 124  LYS B O   1 
ATOM   1367 C CB  . LYS B 1 17  ? 29.668  6.073   28.941 1.00  54.21 ? 124  LYS B CB  1 
ATOM   1368 C CG  . LYS B 1 17  ? 28.542  5.123   29.378 1.00  55.34 ? 124  LYS B CG  1 
ATOM   1369 C CD  . LYS B 1 17  ? 28.213  4.048   28.327 1.00  56.54 ? 124  LYS B CD  1 
ATOM   1370 C CE  . LYS B 1 17  ? 26.956  3.242   28.704 1.00  56.90 ? 124  LYS B CE  1 
ATOM   1371 N NZ  . LYS B 1 17  ? 25.651  3.898   28.337 1.00  56.60 ? 124  LYS B NZ  1 
ATOM   1372 N N   . ILE B 1 18  ? 28.149  7.533   31.408 1.00  50.62 ? 125  ILE B N   1 
ATOM   1373 C CA  . ILE B 1 18  ? 27.894  7.700   32.849 1.00  48.90 ? 125  ILE B CA  1 
ATOM   1374 C C   . ILE B 1 18  ? 27.182  6.523   33.532 1.00  47.40 ? 125  ILE B C   1 
ATOM   1375 O O   . ILE B 1 18  ? 26.954  6.557   34.743 1.00  47.08 ? 125  ILE B O   1 
ATOM   1376 C CB  . ILE B 1 18  ? 27.138  9.032   33.112 1.00  48.69 ? 125  ILE B CB  1 
ATOM   1377 C CG1 . ILE B 1 18  ? 25.812  9.086   32.356 1.00  48.41 ? 125  ILE B CG1 1 
ATOM   1378 C CG2 . ILE B 1 18  ? 27.994  10.213  32.690 1.00  48.80 ? 125  ILE B CG2 1 
ATOM   1379 C CD1 . ILE B 1 18  ? 25.024  10.347  32.641 1.00  48.52 ? 125  ILE B CD1 1 
ATOM   1380 N N   . GLY B 1 19  ? 26.854  5.485   32.763 1.00  45.59 ? 126  GLY B N   1 
ATOM   1381 C CA  . GLY B 1 19  ? 26.281  4.261   33.296 1.00  44.43 ? 126  GLY B CA  1 
ATOM   1382 C C   . GLY B 1 19  ? 24.782  4.306   33.524 1.00  43.23 ? 126  GLY B C   1 
ATOM   1383 O O   . GLY B 1 19  ? 24.279  3.648   34.432 1.00  42.73 ? 126  GLY B O   1 
ATOM   1384 N N   . LEU B 1 20  ? 24.072  5.053   32.678 1.00  42.21 ? 127  LEU B N   1 
ATOM   1385 C CA  . LEU B 1 20  ? 22.668  5.376   32.919 1.00  41.51 ? 127  LEU B CA  1 
ATOM   1386 C C   . LEU B 1 20  ? 21.785  5.201   31.681 1.00  40.51 ? 127  LEU B C   1 
ATOM   1387 O O   . LEU B 1 20  ? 22.105  5.716   30.608 1.00  40.40 ? 127  LEU B O   1 
ATOM   1388 C CB  . LEU B 1 20  ? 22.561  6.825   33.417 1.00  41.58 ? 127  LEU B CB  1 
ATOM   1389 C CG  . LEU B 1 20  ? 21.258  7.245   34.101 1.00  41.37 ? 127  LEU B CG  1 
ATOM   1390 C CD1 . LEU B 1 20  ? 20.901  6.290   35.216 1.00  41.05 ? 127  LEU B CD1 1 
ATOM   1391 C CD2 . LEU B 1 20  ? 21.369  8.668   34.620 1.00  41.45 ? 127  LEU B CD2 1 
ATOM   1392 N N   . ARG B 1 21  ? 20.690  4.459   31.843 1.00  39.31 ? 128  ARG B N   1 
ATOM   1393 C CA  . ARG B 1 21  ? 19.601  4.404   30.861 1.00  38.55 ? 128  ARG B CA  1 
ATOM   1394 C C   . ARG B 1 21  ? 18.363  5.043   31.489 1.00  36.74 ? 128  ARG B C   1 
ATOM   1395 O O   . ARG B 1 21  ? 18.096  4.838   32.668 1.00  36.16 ? 128  ARG B O   1 
ATOM   1396 C CB  . ARG B 1 21  ? 19.308  2.950   30.464 1.00  39.17 ? 128  ARG B CB  1 
ATOM   1397 C CG  . ARG B 1 21  ? 19.093  2.716   28.957 1.00  41.31 ? 128  ARG B CG  1 
ATOM   1398 C CD  . ARG B 1 21  ? 17.978  1.708   28.633 1.00  44.20 ? 128  ARG B CD  1 
ATOM   1399 N NE  . ARG B 1 21  ? 18.029  1.238   27.249 1.00  46.48 ? 128  ARG B NE  1 
ATOM   1400 C CZ  . ARG B 1 21  ? 18.805  0.248   26.796 1.00  48.96 ? 128  ARG B CZ  1 
ATOM   1401 N NH1 . ARG B 1 21  ? 19.632  -0.408  27.610 1.00  48.68 ? 128  ARG B NH1 1 
ATOM   1402 N NH2 . ARG B 1 21  ? 18.759  -0.083  25.503 1.00  50.00 ? 128  ARG B NH2 1 
ATOM   1403 N N   . LEU B 1 22  ? 17.625  5.813   30.692 1.00  35.13 ? 129  LEU B N   1 
ATOM   1404 C CA  . LEU B 1 22  ? 16.457  6.580   31.130 1.00  33.70 ? 129  LEU B CA  1 
ATOM   1405 C C   . LEU B 1 22  ? 15.195  6.238   30.311 1.00  33.02 ? 129  LEU B C   1 
ATOM   1406 O O   . LEU B 1 22  ? 15.272  5.600   29.257 1.00  33.05 ? 129  LEU B O   1 
ATOM   1407 C CB  . LEU B 1 22  ? 16.729  8.082   30.993 1.00  32.95 ? 129  LEU B CB  1 
ATOM   1408 C CG  . LEU B 1 22  ? 17.963  8.663   31.689 1.00  33.02 ? 129  LEU B CG  1 
ATOM   1409 C CD1 . LEU B 1 22  ? 18.097  10.151  31.366 1.00  31.01 ? 129  LEU B CD1 1 
ATOM   1410 C CD2 . LEU B 1 22  ? 17.938  8.443   33.212 1.00  32.27 ? 129  LEU B CD2 1 
ATOM   1411 N N   . LYS B 1 23  ? 14.044  6.723   30.778 1.00  31.74 ? 130  LYS B N   1 
ATOM   1412 C CA  . LYS B 1 23  ? 12.751  6.373   30.208 1.00  30.81 ? 130  LYS B CA  1 
ATOM   1413 C C   . LYS B 1 23  ? 11.771  7.513   30.396 1.00  30.01 ? 130  LYS B C   1 
ATOM   1414 O O   . LYS B 1 23  ? 11.627  8.041   31.508 1.00  29.87 ? 130  LYS B O   1 
ATOM   1415 C CB  . LYS B 1 23  ? 12.196  5.105   30.876 1.00  30.87 ? 130  LYS B CB  1 
ATOM   1416 C CG  . LYS B 1 23  ? 11.361  4.203   29.949 1.00  31.11 ? 130  LYS B CG  1 
ATOM   1417 C CD  . LYS B 1 23  ? 10.289  3.437   30.704 1.00  32.15 ? 130  LYS B CD  1 
ATOM   1418 C CE  . LYS B 1 23  ? 9.859   2.131   30.000 1.00  33.60 ? 130  LYS B CE  1 
ATOM   1419 N NZ  . LYS B 1 23  ? 8.842   2.312   28.910 1.00  34.61 ? 130  LYS B NZ  1 
ATOM   1420 N N   . SER B 1 24  ? 11.109  7.907   29.310 1.00  29.13 ? 131  SER B N   1 
ATOM   1421 C CA  . SER B 1 24  ? 9.971   8.830   29.380 1.00  28.12 ? 131  SER B CA  1 
ATOM   1422 C C   . SER B 1 24  ? 8.722   8.120   29.953 1.00  27.66 ? 131  SER B C   1 
ATOM   1423 O O   . SER B 1 24  ? 8.355   7.049   29.492 1.00  26.80 ? 131  SER B O   1 
ATOM   1424 C CB  . SER B 1 24  ? 9.663   9.403   27.990 1.00  28.40 ? 131  SER B CB  1 
ATOM   1425 O OG  . SER B 1 24  ? 8.627   10.387  28.028 1.00  28.77 ? 131  SER B OG  1 
ATOM   1426 N N   . ILE B 1 25  ? 8.104   8.726   30.970 1.00  27.07 ? 132  ILE B N   1 
ATOM   1427 C CA  . ILE B 1 25  ? 6.877   8.237   31.606 1.00  26.97 ? 132  ILE B CA  1 
ATOM   1428 C C   . ILE B 1 25  ? 6.043   9.450   32.011 1.00  26.59 ? 132  ILE B C   1 
ATOM   1429 O O   . ILE B 1 25  ? 6.468   10.247  32.858 1.00  26.10 ? 132  ILE B O   1 
ATOM   1430 C CB  . ILE B 1 25  ? 7.197   7.416   32.890 1.00  27.18 ? 132  ILE B CB  1 
ATOM   1431 C CG1 . ILE B 1 25  ? 8.043   6.186   32.576 1.00  27.73 ? 132  ILE B CG1 1 
ATOM   1432 C CG2 . ILE B 1 25  ? 5.921   7.002   33.605 1.00  27.78 ? 132  ILE B CG2 1 
ATOM   1433 C CD1 . ILE B 1 25  ? 8.520   5.470   33.817 1.00  29.53 ? 132  ILE B CD1 1 
ATOM   1434 N N   . ASP B 1 26  ? 4.859   9.588   31.418 1.00  25.92 ? 133  ASP B N   1 
ATOM   1435 C CA  . ASP B 1 26  ? 3.924   10.648  31.781 1.00  25.69 ? 133  ASP B CA  1 
ATOM   1436 C C   . ASP B 1 26  ? 4.565   12.032  31.680 1.00  24.84 ? 133  ASP B C   1 
ATOM   1437 O O   . ASP B 1 26  ? 4.334   12.890  32.520 1.00  24.21 ? 133  ASP B O   1 
ATOM   1438 C CB  . ASP B 1 26  ? 3.362   10.413  33.200 1.00  25.60 ? 133  ASP B CB  1 
ATOM   1439 C CG  . ASP B 1 26  ? 2.557   9.116   33.317 1.00  26.18 ? 133  ASP B CG  1 
ATOM   1440 O OD1 . ASP B 1 26  ? 2.089   8.608   32.286 1.00  25.43 ? 133  ASP B OD1 1 
ATOM   1441 O OD2 . ASP B 1 26  ? 2.341   8.531   34.412 1.00  26.04 ? 133  ASP B OD2 1 
ATOM   1442 N N   . ASN B 1 27  ? 5.368   12.220  30.633 1.00  24.35 ? 134  ASN B N   1 
ATOM   1443 C CA  . ASN B 1 27  ? 6.085   13.470  30.341 1.00  23.85 ? 134  ASN B CA  1 
ATOM   1444 C C   . ASN B 1 27  ? 7.139   13.823  31.395 1.00  22.70 ? 134  ASN B C   1 
ATOM   1445 O O   . ASN B 1 27  ? 7.502   14.972  31.596 1.00  22.09 ? 134  ASN B O   1 
ATOM   1446 C CB  . ASN B 1 27  ? 5.113   14.621  30.042 1.00  23.85 ? 134  ASN B CB  1 
ATOM   1447 C CG  . ASN B 1 27  ? 4.632   14.597  28.595 1.00  27.20 ? 134  ASN B CG  1 
ATOM   1448 O OD1 . ASN B 1 27  ? 5.401   14.895  27.678 1.00  31.22 ? 134  ASN B OD1 1 
ATOM   1449 N ND2 . ASN B 1 27  ? 3.375   14.189  28.377 1.00  28.53 ? 134  ASN B ND2 1 
ATOM   1450 N N   . GLY B 1 28  ? 7.638   12.787  32.047 1.00  22.20 ? 135  GLY B N   1 
ATOM   1451 C CA  . GLY B 1 28  ? 8.766   12.890  32.952 1.00  22.00 ? 135  GLY B CA  1 
ATOM   1452 C C   . GLY B 1 28  ? 9.854   11.974  32.432 1.00  21.58 ? 135  GLY B C   1 
ATOM   1453 O O   . GLY B 1 28  ? 9.623   11.212  31.506 1.00  20.07 ? 135  GLY B O   1 
ATOM   1454 N N   . ILE B 1 29  ? 11.040  12.090  33.019 1.00  21.87 ? 136  ILE B N   1 
ATOM   1455 C CA  . ILE B 1 29  ? 12.169  11.249  32.700 1.00  22.43 ? 136  ILE B CA  1 
ATOM   1456 C C   . ILE B 1 29  ? 12.524  10.483  33.960 1.00  22.87 ? 136  ILE B C   1 
ATOM   1457 O O   . ILE B 1 29  ? 12.642  11.071  35.019 1.00  23.40 ? 136  ILE B O   1 
ATOM   1458 C CB  . ILE B 1 29  ? 13.361  12.127  32.224 1.00  22.56 ? 136  ILE B CB  1 
ATOM   1459 C CG1 . ILE B 1 29  ? 13.084  12.712  30.830 1.00  23.34 ? 136  ILE B CG1 1 
ATOM   1460 C CG2 . ILE B 1 29  ? 14.674  11.339  32.268 1.00  22.22 ? 136  ILE B CG2 1 
ATOM   1461 C CD1 . ILE B 1 29  ? 13.190  11.683  29.679 1.00  24.62 ? 136  ILE B CD1 1 
ATOM   1462 N N   . PHE B 1 30  ? 12.698  9.175   33.837 1.00  23.62 ? 137  PHE B N   1 
ATOM   1463 C CA  . PHE B 1 30  ? 12.997  8.317   34.974 1.00  24.75 ? 137  PHE B CA  1 
ATOM   1464 C C   . PHE B 1 30  ? 14.185  7.407   34.688 1.00  26.08 ? 137  PHE B C   1 
ATOM   1465 O O   . PHE B 1 30  ? 14.413  6.958   33.559 1.00  26.05 ? 137  PHE B O   1 
ATOM   1466 C CB  . PHE B 1 30  ? 11.773  7.469   35.366 1.00  24.44 ? 137  PHE B CB  1 
ATOM   1467 C CG  . PHE B 1 30  ? 10.602  8.283   35.866 1.00  23.41 ? 137  PHE B CG  1 
ATOM   1468 C CD1 . PHE B 1 30  ? 9.765   8.937   34.983 1.00  22.60 ? 137  PHE B CD1 1 
ATOM   1469 C CD2 . PHE B 1 30  ? 10.338  8.388   37.232 1.00  23.09 ? 137  PHE B CD2 1 
ATOM   1470 C CE1 . PHE B 1 30  ? 8.685   9.676   35.455 1.00  23.58 ? 137  PHE B CE1 1 
ATOM   1471 C CE2 . PHE B 1 30  ? 9.272   9.138   37.701 1.00  22.14 ? 137  PHE B CE2 1 
ATOM   1472 C CZ  . PHE B 1 30  ? 8.447   9.780   36.820 1.00  21.84 ? 137  PHE B CZ  1 
ATOM   1473 N N   . VAL B 1 31  ? 14.937  7.137   35.736 1.00  27.78 ? 138  VAL B N   1 
ATOM   1474 C CA  . VAL B 1 31  ? 16.065  6.231   35.683 1.00  29.56 ? 138  VAL B CA  1 
ATOM   1475 C C   . VAL B 1 31  ? 15.556  4.803   35.465 1.00  31.02 ? 138  VAL B C   1 
ATOM   1476 O O   . VAL B 1 31  ? 14.843  4.255   36.302 1.00  31.08 ? 138  VAL B O   1 
ATOM   1477 C CB  . VAL B 1 31  ? 16.887  6.320   36.994 1.00  29.47 ? 138  VAL B CB  1 
ATOM   1478 C CG1 . VAL B 1 31  ? 18.049  5.323   36.989 1.00  29.68 ? 138  VAL B CG1 1 
ATOM   1479 C CG2 . VAL B 1 31  ? 17.388  7.757   37.218 1.00  29.70 ? 138  VAL B CG2 1 
ATOM   1480 N N   . GLN B 1 32  ? 15.934  4.219   34.331 1.00  33.46 ? 139  GLN B N   1 
ATOM   1481 C CA  . GLN B 1 32  ? 15.508  2.872   33.923 1.00  35.57 ? 139  GLN B CA  1 
ATOM   1482 C C   . GLN B 1 32  ? 16.519  1.784   34.313 1.00  36.88 ? 139  GLN B C   1 
ATOM   1483 O O   . GLN B 1 32  ? 16.124  0.705   34.730 1.00  37.20 ? 139  GLN B O   1 
ATOM   1484 C CB  . GLN B 1 32  ? 15.240  2.853   32.407 1.00  35.86 ? 139  GLN B CB  1 
ATOM   1485 C CG  . GLN B 1 32  ? 15.062  1.468   31.769 1.00  37.73 ? 139  GLN B CG  1 
ATOM   1486 C CD  . GLN B 1 32  ? 13.687  0.874   32.016 1.00  40.67 ? 139  GLN B CD  1 
ATOM   1487 O OE1 . GLN B 1 32  ? 13.020  1.213   33.002 1.00  42.00 ? 139  GLN B OE1 1 
ATOM   1488 N NE2 . GLN B 1 32  ? 13.253  -0.010  31.116 1.00  41.46 ? 139  GLN B NE2 1 
ATOM   1489 N N   . LEU B 1 33  ? 17.814  2.052   34.163 1.00  38.92 ? 140  LEU B N   1 
ATOM   1490 C CA  . LEU B 1 33  ? 18.857  1.130   34.654 1.00  40.29 ? 140  LEU B CA  1 
ATOM   1491 C C   . LEU B 1 33  ? 20.138  1.849   35.102 1.00  41.05 ? 140  LEU B C   1 
ATOM   1492 O O   . LEU B 1 33  ? 20.583  2.811   34.473 1.00  40.83 ? 140  LEU B O   1 
ATOM   1493 C CB  . LEU B 1 33  ? 19.196  0.081   33.585 1.00  40.51 ? 140  LEU B CB  1 
ATOM   1494 C CG  . LEU B 1 33  ? 20.124  -1.057  34.034 1.00  41.39 ? 140  LEU B CG  1 
ATOM   1495 C CD1 . LEU B 1 33  ? 19.497  -1.887  35.161 1.00  42.44 ? 140  LEU B CD1 1 
ATOM   1496 C CD2 . LEU B 1 33  ? 20.498  -1.957  32.873 1.00  41.54 ? 140  LEU B CD2 1 
ATOM   1497 N N   . VAL B 1 34  ? 20.729  1.368   36.193 1.00  42.35 ? 141  VAL B N   1 
ATOM   1498 C CA  . VAL B 1 34  ? 21.963  1.947   36.729 1.00  43.20 ? 141  VAL B CA  1 
ATOM   1499 C C   . VAL B 1 34  ? 23.032  0.861   36.838 1.00  44.20 ? 141  VAL B C   1 
ATOM   1500 O O   . VAL B 1 34  ? 23.008  0.020   37.756 1.00  44.29 ? 141  VAL B O   1 
ATOM   1501 C CB  . VAL B 1 34  ? 21.733  2.647   38.107 1.00  43.08 ? 141  VAL B CB  1 
ATOM   1502 C CG1 . VAL B 1 34  ? 23.047  2.902   38.848 1.00  43.15 ? 141  VAL B CG1 1 
ATOM   1503 C CG2 . VAL B 1 34  ? 21.009  3.973   37.914 1.00  43.26 ? 141  VAL B CG2 1 
ATOM   1504 N N   . GLN B 1 35  ? 23.952  0.887   35.872 1.00  45.38 ? 142  GLN B N   1 
ATOM   1505 C CA  . GLN B 1 35  ? 25.188  0.102   35.925 1.00  46.14 ? 142  GLN B CA  1 
ATOM   1506 C C   . GLN B 1 35  ? 25.918  0.349   37.229 1.00  46.41 ? 142  GLN B C   1 
ATOM   1507 O O   . GLN B 1 35  ? 25.998  1.486   37.694 1.00  46.42 ? 142  GLN B O   1 
ATOM   1508 C CB  . GLN B 1 35  ? 26.119  0.455   34.749 1.00  46.31 ? 142  GLN B CB  1 
ATOM   1509 C CG  . GLN B 1 35  ? 25.959  -0.448  33.496 1.00  47.19 ? 142  GLN B CG  1 
ATOM   1510 C CD  . GLN B 1 35  ? 24.504  -0.812  33.171 1.00  47.31 ? 142  GLN B CD  1 
ATOM   1511 O OE1 . GLN B 1 35  ? 23.861  -0.142  32.367 1.00  48.85 ? 142  GLN B OE1 1 
ATOM   1512 N NE2 . GLN B 1 35  ? 23.996  -1.871  33.794 1.00  46.79 ? 142  GLN B NE2 1 
ATOM   1513 N N   . ALA B 1 36  ? 26.442  -0.728  37.813 1.00  46.95 ? 143  ALA B N   1 
ATOM   1514 C CA  . ALA B 1 36  ? 27.216  -0.650  39.051 1.00  47.13 ? 143  ALA B CA  1 
ATOM   1515 C C   . ALA B 1 36  ? 28.620  -0.119  38.775 1.00  47.24 ? 143  ALA B C   1 
ATOM   1516 O O   . ALA B 1 36  ? 29.145  -0.274  37.666 1.00  47.11 ? 143  ALA B O   1 
ATOM   1517 C CB  . ALA B 1 36  ? 27.278  -2.015  39.726 1.00  47.27 ? 143  ALA B CB  1 
ATOM   1518 N N   . ASN B 1 37  ? 29.200  0.518   39.793 1.00  47.42 ? 144  ASN B N   1 
ATOM   1519 C CA  . ASN B 1 37  ? 30.518  1.172   39.714 1.00  47.56 ? 144  ASN B CA  1 
ATOM   1520 C C   . ASN B 1 37  ? 30.680  2.165   38.558 1.00  47.42 ? 144  ASN B C   1 
ATOM   1521 O O   . ASN B 1 37  ? 31.767  2.310   37.984 1.00  47.26 ? 144  ASN B O   1 
ATOM   1522 C CB  . ASN B 1 37  ? 31.638  0.130   39.707 1.00  47.62 ? 144  ASN B CB  1 
ATOM   1523 C CG  . ASN B 1 37  ? 31.479  -0.876  40.818 1.00  48.26 ? 144  ASN B CG  1 
ATOM   1524 O OD1 . ASN B 1 37  ? 31.306  -0.510  41.987 1.00  48.31 ? 144  ASN B OD1 1 
ATOM   1525 N ND2 . ASN B 1 37  ? 31.503  -2.156  40.461 1.00  49.79 ? 144  ASN B ND2 1 
ATOM   1526 N N   . SER B 1 38  ? 29.579  2.837   38.226 1.00  47.34 ? 145  SER B N   1 
ATOM   1527 C CA  . SER B 1 38  ? 29.586  3.946   37.287 1.00  47.10 ? 145  SER B CA  1 
ATOM   1528 C C   . SER B 1 38  ? 29.468  5.223   38.096 1.00  46.99 ? 145  SER B C   1 
ATOM   1529 O O   . SER B 1 38  ? 29.243  5.176   39.300 1.00  47.36 ? 145  SER B O   1 
ATOM   1530 C CB  . SER B 1 38  ? 28.420  3.819   36.303 1.00  47.42 ? 145  SER B CB  1 
ATOM   1531 O OG  . SER B 1 38  ? 27.160  4.026   36.922 1.00  46.26 ? 145  SER B OG  1 
ATOM   1532 N N   . PRO B 1 39  ? 29.650  6.369   37.464 1.00  46.75 ? 146  PRO B N   1 
ATOM   1533 C CA  . PRO B 1 39  ? 29.320  7.637   38.121 1.00  46.59 ? 146  PRO B CA  1 
ATOM   1534 C C   . PRO B 1 39  ? 27.843  7.708   38.578 1.00  46.43 ? 146  PRO B C   1 
ATOM   1535 O O   . PRO B 1 39  ? 27.565  8.339   39.608 1.00  46.44 ? 146  PRO B O   1 
ATOM   1536 C CB  . PRO B 1 39  ? 29.624  8.672   37.040 1.00  46.43 ? 146  PRO B CB  1 
ATOM   1537 C CG  . PRO B 1 39  ? 30.627  8.007   36.179 1.00  46.89 ? 146  PRO B CG  1 
ATOM   1538 C CD  . PRO B 1 39  ? 30.207  6.574   36.118 1.00  46.76 ? 146  PRO B CD  1 
ATOM   1539 N N   . ALA B 1 40  ? 26.924  7.066   37.847 1.00  46.01 ? 147  ALA B N   1 
ATOM   1540 C CA  . ALA B 1 40  ? 25.504  7.036   38.250 1.00  45.62 ? 147  ALA B CA  1 
ATOM   1541 C C   . ALA B 1 40  ? 25.333  6.333   39.582 1.00  45.13 ? 147  ALA B C   1 
ATOM   1542 O O   . ALA B 1 40  ? 24.556  6.766   40.425 1.00  44.99 ? 147  ALA B O   1 
ATOM   1543 C CB  . ALA B 1 40  ? 24.635  6.375   37.184 1.00  45.49 ? 147  ALA B CB  1 
ATOM   1544 N N   . SER B 1 41  ? 26.077  5.252   39.768 1.00  44.69 ? 148  SER B N   1 
ATOM   1545 C CA  . SER B 1 41  ? 26.079  4.523   41.032 1.00  44.34 ? 148  SER B CA  1 
ATOM   1546 C C   . SER B 1 41  ? 26.748  5.316   42.164 1.00  43.93 ? 148  SER B C   1 
ATOM   1547 O O   . SER B 1 41  ? 26.346  5.205   43.330 1.00  44.42 ? 148  SER B O   1 
ATOM   1548 C CB  . SER B 1 41  ? 26.803  3.197   40.846 1.00  44.44 ? 148  SER B CB  1 
ATOM   1549 O OG  . SER B 1 41  ? 28.170  3.430   40.529 1.00  44.86 ? 148  SER B OG  1 
ATOM   1550 N N   . LEU B 1 42  ? 27.772  6.099   41.821 1.00  43.18 ? 149  LEU B N   1 
ATOM   1551 C CA  . LEU B 1 42  ? 28.534  6.873   42.804 1.00  42.52 ? 149  LEU B CA  1 
ATOM   1552 C C   . LEU B 1 42  ? 27.629  7.900   43.472 1.00  41.74 ? 149  LEU B C   1 
ATOM   1553 O O   . LEU B 1 42  ? 27.621  8.025   44.693 1.00  41.92 ? 149  LEU B O   1 
ATOM   1554 C CB  . LEU B 1 42  ? 29.736  7.570   42.138 1.00  42.54 ? 149  LEU B CB  1 
ATOM   1555 C CG  . LEU B 1 42  ? 30.609  8.577   42.921 1.00  42.87 ? 149  LEU B CG  1 
ATOM   1556 C CD1 . LEU B 1 42  ? 31.698  7.895   43.732 1.00  42.35 ? 149  LEU B CD1 1 
ATOM   1557 C CD2 . LEU B 1 42  ? 31.246  9.600   41.983 1.00  43.35 ? 149  LEU B CD2 1 
ATOM   1558 N N   . VAL B 1 43  ? 26.848  8.614   42.667 1.00  40.68 ? 150  VAL B N   1 
ATOM   1559 C CA  . VAL B 1 43  ? 25.963  9.651   43.189 1.00  39.70 ? 150  VAL B CA  1 
ATOM   1560 C C   . VAL B 1 43  ? 24.574  9.156   43.650 1.00  38.37 ? 150  VAL B C   1 
ATOM   1561 O O   . VAL B 1 43  ? 23.669  9.965   43.839 1.00  38.37 ? 150  VAL B O   1 
ATOM   1562 C CB  . VAL B 1 43  ? 25.814  10.825  42.192 1.00  39.86 ? 150  VAL B CB  1 
ATOM   1563 C CG1 . VAL B 1 43  ? 27.181  11.310  41.731 1.00  40.24 ? 150  VAL B CG1 1 
ATOM   1564 C CG2 . VAL B 1 43  ? 24.937  10.450  40.998 1.00  40.26 ? 150  VAL B CG2 1 
ATOM   1565 N N   . GLY B 1 44  ? 24.416  7.846   43.836 1.00  36.82 ? 151  GLY B N   1 
ATOM   1566 C CA  . GLY B 1 44  ? 23.236  7.269   44.462 1.00  35.69 ? 151  GLY B CA  1 
ATOM   1567 C C   . GLY B 1 44  ? 21.952  7.185   43.636 1.00  34.88 ? 151  GLY B C   1 
ATOM   1568 O O   . GLY B 1 44  ? 20.872  7.044   44.212 1.00  34.70 ? 151  GLY B O   1 
ATOM   1569 N N   . LEU B 1 45  ? 22.055  7.273   42.310 1.00  33.52 ? 152  LEU B N   1 
ATOM   1570 C CA  . LEU B 1 45  ? 20.897  7.132   41.424 1.00  32.93 ? 152  LEU B CA  1 
ATOM   1571 C C   . LEU B 1 45  ? 20.386  5.703   41.405 1.00  32.43 ? 152  LEU B C   1 
ATOM   1572 O O   . LEU B 1 45  ? 21.176  4.760   41.364 1.00  32.69 ? 152  LEU B O   1 
ATOM   1573 C CB  . LEU B 1 45  ? 21.240  7.551   39.992 1.00  32.43 ? 152  LEU B CB  1 
ATOM   1574 C CG  . LEU B 1 45  ? 21.638  9.008   39.765 1.00  32.58 ? 152  LEU B CG  1 
ATOM   1575 C CD1 . LEU B 1 45  ? 22.000  9.258   38.307 1.00  32.12 ? 152  LEU B CD1 1 
ATOM   1576 C CD2 . LEU B 1 45  ? 20.533  9.941   40.190 1.00  32.76 ? 152  LEU B CD2 1 
ATOM   1577 N N   . ARG B 1 46  ? 19.064  5.550   41.432 1.00  31.97 ? 153  ARG B N   1 
ATOM   1578 C CA  . ARG B 1 46  ? 18.410  4.236   41.359 1.00  31.52 ? 153  ARG B CA  1 
ATOM   1579 C C   . ARG B 1 46  ? 17.246  4.196   40.383 1.00  30.30 ? 153  ARG B C   1 
ATOM   1580 O O   . ARG B 1 46  ? 16.702  5.220   39.987 1.00  30.00 ? 153  ARG B O   1 
ATOM   1581 C CB  . ARG B 1 46  ? 17.862  3.815   42.714 1.00  32.18 ? 153  ARG B CB  1 
ATOM   1582 C CG  . ARG B 1 46  ? 18.863  3.785   43.852 1.00  34.36 ? 153  ARG B CG  1 
ATOM   1583 C CD  . ARG B 1 46  ? 18.202  3.927   45.205 1.00  37.88 ? 153  ARG B CD  1 
ATOM   1584 N NE  . ARG B 1 46  ? 17.355  5.124   45.242 1.00  42.08 ? 153  ARG B NE  1 
ATOM   1585 C CZ  . ARG B 1 46  ? 16.500  5.421   46.221 1.00  43.85 ? 153  ARG B CZ  1 
ATOM   1586 N NH1 . ARG B 1 46  ? 16.375  4.628   47.284 1.00  44.20 ? 153  ARG B NH1 1 
ATOM   1587 N NH2 . ARG B 1 46  ? 15.771  6.528   46.136 1.00  44.01 ? 153  ARG B NH2 1 
ATOM   1588 N N   . PHE B 1 47  ? 16.877  2.975   40.017 1.00  29.31 ? 154  PHE B N   1 
ATOM   1589 C CA  . PHE B 1 47  ? 15.647  2.676   39.290 1.00  28.35 ? 154  PHE B CA  1 
ATOM   1590 C C   . PHE B 1 47  ? 14.431  3.380   39.925 1.00  26.99 ? 154  PHE B C   1 
ATOM   1591 O O   . PHE B 1 47  ? 14.140  3.202   41.097 1.00  26.46 ? 154  PHE B O   1 
ATOM   1592 C CB  . PHE B 1 47  ? 15.453  1.147   39.301 1.00  28.70 ? 154  PHE B CB  1 
ATOM   1593 C CG  . PHE B 1 47  ? 14.248  0.684   38.566 1.00  28.83 ? 154  PHE B CG  1 
ATOM   1594 C CD1 . PHE B 1 47  ? 14.267  0.589   37.193 1.00  29.73 ? 154  PHE B CD1 1 
ATOM   1595 C CD2 . PHE B 1 47  ? 13.089  0.341   39.246 1.00  29.79 ? 154  PHE B CD2 1 
ATOM   1596 C CE1 . PHE B 1 47  ? 13.146  0.173   36.497 1.00  30.65 ? 154  PHE B CE1 1 
ATOM   1597 C CE2 . PHE B 1 47  ? 11.963  -0.081  38.551 1.00  30.24 ? 154  PHE B CE2 1 
ATOM   1598 C CZ  . PHE B 1 47  ? 11.988  -0.161  37.186 1.00  30.29 ? 154  PHE B CZ  1 
ATOM   1599 N N   . GLY B 1 48  ? 13.730  4.186   39.145 1.00  25.98 ? 155  GLY B N   1 
ATOM   1600 C CA  . GLY B 1 48  ? 12.533  4.871   39.613 1.00  24.93 ? 155  GLY B CA  1 
ATOM   1601 C C   . GLY B 1 48  ? 12.734  6.344   39.925 1.00  24.11 ? 155  GLY B C   1 
ATOM   1602 O O   . GLY B 1 48  ? 11.780  7.098   39.956 1.00  23.50 ? 155  GLY B O   1 
ATOM   1603 N N   . ASP B 1 49  ? 13.971  6.750   40.191 1.00  23.61 ? 156  ASP B N   1 
ATOM   1604 C CA  . ASP B 1 49  ? 14.300  8.164   40.402 1.00  23.03 ? 156  ASP B CA  1 
ATOM   1605 C C   . ASP B 1 49  ? 13.833  9.012   39.222 1.00  22.48 ? 156  ASP B C   1 
ATOM   1606 O O   . ASP B 1 49  ? 14.004  8.624   38.071 1.00  22.12 ? 156  ASP B O   1 
ATOM   1607 C CB  . ASP B 1 49  ? 15.813  8.342   40.572 1.00  23.29 ? 156  ASP B CB  1 
ATOM   1608 C CG  . ASP B 1 49  ? 16.324  7.855   41.914 1.00  23.88 ? 156  ASP B CG  1 
ATOM   1609 O OD1 . ASP B 1 49  ? 15.517  7.523   42.802 1.00  24.12 ? 156  ASP B OD1 1 
ATOM   1610 O OD2 . ASP B 1 49  ? 17.543  7.789   42.168 1.00  25.39 ? 156  ASP B OD2 1 
ATOM   1611 N N   . GLN B 1 50  ? 13.222  10.156  39.522 1.00  21.66 ? 157  GLN B N   1 
ATOM   1612 C CA  . GLN B 1 50  ? 12.803  11.103  38.521 1.00  20.71 ? 157  GLN B CA  1 
ATOM   1613 C C   . GLN B 1 50  ? 13.906  12.137  38.315 1.00  21.14 ? 157  GLN B C   1 
ATOM   1614 O O   . GLN B 1 50  ? 14.391  12.720  39.277 1.00  21.25 ? 157  GLN B O   1 
ATOM   1615 C CB  . GLN B 1 50  ? 11.509  11.790  38.953 1.00  20.50 ? 157  GLN B CB  1 
ATOM   1616 C CG  . GLN B 1 50  ? 10.841  12.573  37.817 1.00  19.26 ? 157  GLN B CG  1 
ATOM   1617 C CD  . GLN B 1 50  ? 9.546   13.236  38.219 1.00  17.73 ? 157  GLN B CD  1 
ATOM   1618 O OE1 . GLN B 1 50  ? 9.076   13.071  39.353 1.00  17.97 ? 157  GLN B OE1 1 
ATOM   1619 N NE2 . GLN B 1 50  ? 8.976   14.029  37.302 1.00  17.05 ? 157  GLN B NE2 1 
ATOM   1620 N N   . VAL B 1 51  ? 14.303  12.347  37.060 1.00  21.01 ? 158  VAL B N   1 
ATOM   1621 C CA  . VAL B 1 51  ? 15.279  13.364  36.704 1.00  21.46 ? 158  VAL B CA  1 
ATOM   1622 C C   . VAL B 1 51  ? 14.534  14.630  36.306 1.00  21.80 ? 158  VAL B C   1 
ATOM   1623 O O   . VAL B 1 51  ? 13.922  14.714  35.230 1.00  21.68 ? 158  VAL B O   1 
ATOM   1624 C CB  . VAL B 1 51  ? 16.250  12.922  35.554 1.00  21.00 ? 158  VAL B CB  1 
ATOM   1625 C CG1 . VAL B 1 51  ? 17.369  13.919  35.422 1.00  21.09 ? 158  VAL B CG1 1 
ATOM   1626 C CG2 . VAL B 1 51  ? 16.821  11.530  35.806 1.00  21.48 ? 158  VAL B CG2 1 
ATOM   1627 N N   . LEU B 1 52  ? 14.573  15.613  37.195 1.00  21.84 ? 159  LEU B N   1 
ATOM   1628 C CA  . LEU B 1 52  ? 13.839  16.844  36.993 1.00  22.02 ? 159  LEU B CA  1 
ATOM   1629 C C   . LEU B 1 52  ? 14.582  17.769  36.067 1.00  22.12 ? 159  LEU B C   1 
ATOM   1630 O O   . LEU B 1 52  ? 13.968  18.501  35.300 1.00  22.44 ? 159  LEU B O   1 
ATOM   1631 C CB  . LEU B 1 52  ? 13.576  17.546  38.330 1.00  22.00 ? 159  LEU B CB  1 
ATOM   1632 C CG  . LEU B 1 52  ? 12.746  16.753  39.346 1.00  22.74 ? 159  LEU B CG  1 
ATOM   1633 C CD1 . LEU B 1 52  ? 12.599  17.539  40.657 1.00  24.37 ? 159  LEU B CD1 1 
ATOM   1634 C CD2 . LEU B 1 52  ? 11.380  16.386  38.793 1.00  22.45 ? 159  LEU B CD2 1 
ATOM   1635 N N   . GLN B 1 53  ? 15.899  17.751  36.162 1.00  22.54 ? 160  GLN B N   1 
ATOM   1636 C CA  . GLN B 1 53  ? 16.741  18.673  35.426 1.00  23.35 ? 160  GLN B CA  1 
ATOM   1637 C C   . GLN B 1 53  ? 18.098  18.057  35.123 1.00  23.41 ? 160  GLN B C   1 
ATOM   1638 O O   . GLN B 1 53  ? 18.618  17.267  35.895 1.00  23.89 ? 160  GLN B O   1 
ATOM   1639 C CB  . GLN B 1 53  ? 16.954  19.951  36.232 1.00  23.15 ? 160  GLN B CB  1 
ATOM   1640 C CG  . GLN B 1 53  ? 15.825  20.926  36.147 1.00  25.39 ? 160  GLN B CG  1 
ATOM   1641 C CD  . GLN B 1 53  ? 14.847  20.845  37.321 1.00  27.32 ? 160  GLN B CD  1 
ATOM   1642 O OE1 . GLN B 1 53  ? 15.240  20.507  38.450 1.00  29.30 ? 160  GLN B OE1 1 
ATOM   1643 N NE2 . GLN B 1 53  ? 13.579  21.154  37.056 1.00  25.01 ? 160  GLN B NE2 1 
ATOM   1644 N N   . ILE B 1 54  ? 18.653  18.414  33.975 1.00  23.88 ? 161  ILE B N   1 
ATOM   1645 C CA  . ILE B 1 54  ? 20.006  18.025  33.601 1.00  23.91 ? 161  ILE B CA  1 
ATOM   1646 C C   . ILE B 1 54  ? 20.668  19.276  33.064 1.00  23.88 ? 161  ILE B C   1 
ATOM   1647 O O   . ILE B 1 54  ? 20.127  19.934  32.194 1.00  24.07 ? 161  ILE B O   1 
ATOM   1648 C CB  . ILE B 1 54  ? 20.011  16.896  32.559 1.00  23.90 ? 161  ILE B CB  1 
ATOM   1649 C CG1 . ILE B 1 54  ? 19.404  15.614  33.144 1.00  24.15 ? 161  ILE B CG1 1 
ATOM   1650 C CG2 . ILE B 1 54  ? 21.448  16.618  32.081 1.00  23.74 ? 161  ILE B CG2 1 
ATOM   1651 C CD1 . ILE B 1 54  ? 19.364  14.412  32.165 1.00  23.64 ? 161  ILE B CD1 1 
ATOM   1652 N N   . ASN B 1 55  ? 21.819  19.612  33.633 1.00  24.42 ? 162  ASN B N   1 
ATOM   1653 C CA  . ASN B 1 55  ? 22.596  20.797  33.276 1.00  24.31 ? 162  ASN B CA  1 
ATOM   1654 C C   . ASN B 1 55  ? 21.775  22.077  33.105 1.00  23.96 ? 162  ASN B C   1 
ATOM   1655 O O   . ASN B 1 55  ? 21.959  22.818  32.130 1.00  24.08 ? 162  ASN B O   1 
ATOM   1656 C CB  . ASN B 1 55  ? 23.455  20.508  32.030 1.00  24.28 ? 162  ASN B CB  1 
ATOM   1657 C CG  . ASN B 1 55  ? 24.549  19.503  32.299 1.00  25.43 ? 162  ASN B CG  1 
ATOM   1658 O OD1 . ASN B 1 55  ? 24.927  19.280  33.448 1.00  27.24 ? 162  ASN B OD1 1 
ATOM   1659 N ND2 . ASN B 1 55  ? 25.057  18.867  31.241 1.00  26.92 ? 162  ASN B ND2 1 
ATOM   1660 N N   . GLY B 1 56  ? 20.872  22.330  34.057 1.00  23.55 ? 163  GLY B N   1 
ATOM   1661 C CA  . GLY B 1 56  ? 20.114  23.573  34.102 1.00  22.83 ? 163  GLY B CA  1 
ATOM   1662 C C   . GLY B 1 56  ? 18.947  23.654  33.123 1.00  22.52 ? 163  GLY B C   1 
ATOM   1663 O O   . GLY B 1 56  ? 18.357  24.717  32.955 1.00  22.36 ? 163  GLY B O   1 
ATOM   1664 N N   . GLU B 1 57  ? 18.619  22.526  32.500 1.00  21.91 ? 164  GLU B N   1 
ATOM   1665 C CA  . GLU B 1 57  ? 17.474  22.391  31.606 1.00  21.78 ? 164  GLU B CA  1 
ATOM   1666 C C   . GLU B 1 57  ? 16.453  21.418  32.209 1.00  20.99 ? 164  GLU B C   1 
ATOM   1667 O O   . GLU B 1 57  ? 16.820  20.334  32.621 1.00  19.95 ? 164  GLU B O   1 
ATOM   1668 C CB  . GLU B 1 57  ? 17.946  21.810  30.269 1.00  22.03 ? 164  GLU B CB  1 
ATOM   1669 C CG  . GLU B 1 57  ? 18.597  22.805  29.339 1.00  22.81 ? 164  GLU B CG  1 
ATOM   1670 C CD  . GLU B 1 57  ? 18.705  22.276  27.916 1.00  24.47 ? 164  GLU B CD  1 
ATOM   1671 O OE1 . GLU B 1 57  ? 19.407  21.258  27.665 1.00  21.06 ? 164  GLU B OE1 1 
ATOM   1672 O OE2 . GLU B 1 57  ? 18.056  22.883  27.057 1.00  27.76 ? 164  GLU B OE2 1 
ATOM   1673 N N   . ASN B 1 58  ? 15.186  21.821  32.267 1.00  21.08 ? 165  ASN B N   1 
ATOM   1674 C CA  . ASN B 1 58  ? 14.074  20.941  32.648 1.00  20.67 ? 165  ASN B CA  1 
ATOM   1675 C C   . ASN B 1 58  ? 13.896  19.755  31.690 1.00  21.35 ? 165  ASN B C   1 
ATOM   1676 O O   . ASN B 1 58  ? 13.867  19.926  30.449 1.00  20.55 ? 165  ASN B O   1 
ATOM   1677 C CB  . ASN B 1 58  ? 12.757  21.738  32.672 1.00  20.86 ? 165  ASN B CB  1 
ATOM   1678 C CG  . ASN B 1 58  ? 12.769  22.852  33.688 1.00  18.93 ? 165  ASN B CG  1 
ATOM   1679 O OD1 . ASN B 1 58  ? 12.989  22.612  34.868 1.00  18.61 ? 165  ASN B OD1 1 
ATOM   1680 N ND2 . ASN B 1 58  ? 12.531  24.078  33.237 1.00  18.59 ? 165  ASN B ND2 1 
ATOM   1681 N N   . CYS B 1 59  ? 13.719  18.568  32.269 1.00  21.32 ? 166  CYS B N   1 
ATOM   1682 C CA  . CYS B 1 59  ? 13.525  17.342  31.499 1.00  21.65 ? 166  CYS B CA  1 
ATOM   1683 C C   . CYS B 1 59  ? 12.080  17.078  31.125 1.00  21.58 ? 166  CYS B C   1 
ATOM   1684 O O   . CYS B 1 59  ? 11.802  16.101  30.422 1.00  21.11 ? 166  CYS B O   1 
ATOM   1685 C CB  . CYS B 1 59  ? 14.018  16.146  32.292 1.00  21.58 ? 166  CYS B CB  1 
ATOM   1686 S SG  . CYS B 1 59  ? 15.774  16.194  32.578 1.00  23.40 ? 166  CYS B SG  1 
ATOM   1687 N N   . ALA B 1 60  ? 11.167  17.935  31.597 1.00  21.39 ? 167  ALA B N   1 
ATOM   1688 C CA  . ALA B 1 60  ? 9.755   17.766  31.324 1.00  21.20 ? 167  ALA B CA  1 
ATOM   1689 C C   . ALA B 1 60  ? 9.529   17.676  29.811 1.00  21.92 ? 167  ALA B C   1 
ATOM   1690 O O   . ALA B 1 60  ? 10.038  18.500  29.043 1.00  21.92 ? 167  ALA B O   1 
ATOM   1691 C CB  . ALA B 1 60  ? 8.971   18.901  31.905 1.00  21.07 ? 167  ALA B CB  1 
ATOM   1692 N N   . GLY B 1 61  ? 8.795   16.652  29.393 1.00  22.05 ? 168  GLY B N   1 
ATOM   1693 C CA  . GLY B 1 61  ? 8.438   16.491  28.005 1.00  22.66 ? 168  GLY B CA  1 
ATOM   1694 C C   . GLY B 1 61  ? 9.509   15.851  27.154 1.00  22.83 ? 168  GLY B C   1 
ATOM   1695 O O   . GLY B 1 61  ? 9.261   15.628  25.973 1.00  23.95 ? 168  GLY B O   1 
ATOM   1696 N N   . TRP B 1 62  ? 10.679  15.542  27.723 1.00  22.71 ? 169  TRP B N   1 
ATOM   1697 C CA  . TRP B 1 62  ? 11.766  14.977  26.949 1.00  22.21 ? 169  TRP B CA  1 
ATOM   1698 C C   . TRP B 1 62  ? 11.471  13.506  26.698 1.00  22.87 ? 169  TRP B C   1 
ATOM   1699 O O   . TRP B 1 62  ? 10.934  12.807  27.544 1.00  22.84 ? 169  TRP B O   1 
ATOM   1700 C CB  . TRP B 1 62  ? 13.115  15.092  27.660 1.00  22.49 ? 169  TRP B CB  1 
ATOM   1701 C CG  . TRP B 1 62  ? 13.776  16.463  27.697 1.00  20.42 ? 169  TRP B CG  1 
ATOM   1702 C CD1 . TRP B 1 62  ? 13.240  17.659  27.326 1.00  19.72 ? 169  TRP B CD1 1 
ATOM   1703 C CD2 . TRP B 1 62  ? 15.096  16.751  28.153 1.00  19.83 ? 169  TRP B CD2 1 
ATOM   1704 N NE1 . TRP B 1 62  ? 14.150  18.669  27.513 1.00  17.22 ? 169  TRP B NE1 1 
ATOM   1705 C CE2 . TRP B 1 62  ? 15.296  18.136  28.026 1.00  17.29 ? 169  TRP B CE2 1 
ATOM   1706 C CE3 . TRP B 1 62  ? 16.142  15.972  28.662 1.00  21.07 ? 169  TRP B CE3 1 
ATOM   1707 C CZ2 . TRP B 1 62  ? 16.481  18.752  28.381 1.00  18.79 ? 169  TRP B CZ2 1 
ATOM   1708 C CZ3 . TRP B 1 62  ? 17.322  16.591  29.007 1.00  20.75 ? 169  TRP B CZ3 1 
ATOM   1709 C CH2 . TRP B 1 62  ? 17.481  17.968  28.863 1.00  19.34 ? 169  TRP B CH2 1 
ATOM   1710 N N   . SER B 1 63  ? 11.823  13.047  25.506 1.00  23.32 ? 170  SER B N   1 
ATOM   1711 C CA  . SER B 1 63  ? 11.776  11.646  25.171 1.00  23.49 ? 170  SER B CA  1 
ATOM   1712 C C   . SER B 1 63  ? 13.021  10.967  25.730 1.00  24.28 ? 170  SER B C   1 
ATOM   1713 O O   . SER B 1 63  ? 14.001  11.639  26.059 1.00  23.86 ? 170  SER B O   1 
ATOM   1714 C CB  . SER B 1 63  ? 11.723  11.500  23.660 1.00  23.58 ? 170  SER B CB  1 
ATOM   1715 O OG  . SER B 1 63  ? 12.868  12.101  23.065 1.00  24.02 ? 170  SER B OG  1 
ATOM   1716 N N   . SER B 1 64  ? 12.968  9.642   25.871 1.00  25.57 ? 171  SER B N   1 
ATOM   1717 C CA  . SER B 1 64  ? 14.161  8.841   26.174 1.00  26.97 ? 171  SER B CA  1 
ATOM   1718 C C   . SER B 1 64  ? 15.331  9.224   25.277 1.00  27.87 ? 171  SER B C   1 
ATOM   1719 O O   . SER B 1 64  ? 16.404  9.526   25.760 1.00  28.07 ? 171  SER B O   1 
ATOM   1720 C CB  . SER B 1 64  ? 13.897  7.352   25.968 1.00  26.64 ? 171  SER B CB  1 
ATOM   1721 O OG  . SER B 1 64  ? 12.752  6.933   26.652 1.00  28.94 ? 171  SER B OG  1 
ATOM   1722 N N   . ASP B 1 65  ? 15.116  9.212   23.964 1.00  29.30 ? 172  ASP B N   1 
ATOM   1723 C CA  . ASP B 1 65  ? 16.218  9.456   23.017 1.00  30.42 ? 172  ASP B CA  1 
ATOM   1724 C C   . ASP B 1 65  ? 16.840  10.827  23.199 1.00  30.78 ? 172  ASP B C   1 
ATOM   1725 O O   . ASP B 1 65  ? 18.060  10.954  23.150 1.00  31.04 ? 172  ASP B O   1 
ATOM   1726 C CB  . ASP B 1 65  ? 15.782  9.279   21.548 1.00  30.81 ? 172  ASP B CB  1 
ATOM   1727 C CG  . ASP B 1 65  ? 15.210  7.901   21.263 1.00  32.00 ? 172  ASP B CG  1 
ATOM   1728 O OD1 . ASP B 1 65  ? 15.418  6.979   22.082 1.00  35.36 ? 172  ASP B OD1 1 
ATOM   1729 O OD2 . ASP B 1 65  ? 14.528  7.646   20.243 1.00  35.62 ? 172  ASP B OD2 1 
ATOM   1730 N N   . LYS B 1 66  ? 16.016  11.849  23.414 1.00  31.65 ? 173  LYS B N   1 
ATOM   1731 C CA  . LYS B 1 66  ? 16.535  13.200  23.645 1.00  32.39 ? 173  LYS B CA  1 
ATOM   1732 C C   . LYS B 1 66  ? 17.391  13.292  24.906 1.00  33.45 ? 173  LYS B C   1 
ATOM   1733 O O   . LYS B 1 66  ? 18.481  13.849  24.862 1.00  34.23 ? 173  LYS B O   1 
ATOM   1734 C CB  . LYS B 1 66  ? 15.424  14.253  23.731 1.00  32.20 ? 173  LYS B CB  1 
ATOM   1735 C CG  . LYS B 1 66  ? 15.911  15.572  24.373 1.00  31.05 ? 173  LYS B CG  1 
ATOM   1736 C CD  . LYS B 1 66  ? 15.230  16.778  23.810 1.00  29.68 ? 173  LYS B CD  1 
ATOM   1737 C CE  . LYS B 1 66  ? 15.858  18.053  24.333 1.00  27.82 ? 173  LYS B CE  1 
ATOM   1738 N NZ  . LYS B 1 66  ? 14.854  19.151  24.462 1.00  27.05 ? 173  LYS B NZ  1 
ATOM   1739 N N   . ALA B 1 67  ? 16.878  12.781  26.019 1.00  34.51 ? 174  ALA B N   1 
ATOM   1740 C CA  . ALA B 1 67  ? 17.602  12.771  27.292 1.00  35.33 ? 174  ALA B CA  1 
ATOM   1741 C C   . ALA B 1 67  ? 18.951  12.046  27.175 1.00  36.34 ? 174  ALA B C   1 
ATOM   1742 O O   . ALA B 1 67  ? 19.966  12.531  27.676 1.00  36.62 ? 174  ALA B O   1 
ATOM   1743 C CB  . ALA B 1 67  ? 16.744  12.119  28.381 1.00  34.82 ? 174  ALA B CB  1 
ATOM   1744 N N   . HIS B 1 68  ? 18.942  10.875  26.536 1.00  37.35 ? 175  HIS B N   1 
ATOM   1745 C CA  . HIS B 1 68  ? 20.164  10.122  26.233 1.00  38.17 ? 175  HIS B CA  1 
ATOM   1746 C C   . HIS B 1 68  ? 21.122  10.883  25.300 1.00  39.01 ? 175  HIS B C   1 
ATOM   1747 O O   . HIS B 1 68  ? 22.343  10.794  25.462 1.00  39.07 ? 175  HIS B O   1 
ATOM   1748 C CB  . HIS B 1 68  ? 19.815  8.798   25.559 1.00  38.21 ? 175  HIS B CB  1 
ATOM   1749 C CG  . HIS B 1 68  ? 19.213  7.788   26.475 1.00  38.37 ? 175  HIS B CG  1 
ATOM   1750 N ND1 . HIS B 1 68  ? 18.493  6.710   26.014 1.00  38.71 ? 175  HIS B ND1 1 
ATOM   1751 C CD2 . HIS B 1 68  ? 19.211  7.692   27.824 1.00  39.22 ? 175  HIS B CD2 1 
ATOM   1752 C CE1 . HIS B 1 68  ? 18.088  5.981   27.035 1.00  38.46 ? 175  HIS B CE1 1 
ATOM   1753 N NE2 . HIS B 1 68  ? 18.510  6.557   28.146 1.00  38.99 ? 175  HIS B NE2 1 
ATOM   1754 N N   . LYS B 1 69  ? 20.563  11.600  24.320 1.00  39.74 ? 176  LYS B N   1 
ATOM   1755 C CA  . LYS B 1 69  ? 21.357  12.397  23.390 1.00  40.45 ? 176  LYS B CA  1 
ATOM   1756 C C   . LYS B 1 69  ? 22.059  13.496  24.146 1.00  41.08 ? 176  LYS B C   1 
ATOM   1757 O O   . LYS B 1 69  ? 23.222  13.786  23.875 1.00  41.29 ? 176  LYS B O   1 
ATOM   1758 C CB  . LYS B 1 69  ? 20.503  13.049  22.290 1.00  40.51 ? 176  LYS B CB  1 
ATOM   1759 C CG  . LYS B 1 69  ? 20.692  12.446  20.904 1.00  41.40 ? 176  LYS B CG  1 
ATOM   1760 C CD  . LYS B 1 69  ? 19.880  13.212  19.847 1.00  41.65 ? 176  LYS B CD  1 
ATOM   1761 C CE  . LYS B 1 69  ? 19.248  12.293  18.772 1.00  42.11 ? 176  LYS B CE  1 
ATOM   1762 N NZ  . LYS B 1 69  ? 17.818  12.689  18.470 1.00  41.84 ? 176  LYS B NZ  1 
ATOM   1763 N N   . VAL B 1 70  ? 21.341  14.124  25.076 1.00  41.54 ? 177  VAL B N   1 
ATOM   1764 C CA  . VAL B 1 70  ? 21.857  15.287  25.789 1.00  41.72 ? 177  VAL B CA  1 
ATOM   1765 C C   . VAL B 1 70  ? 23.013  14.880  26.696 1.00  42.02 ? 177  VAL B C   1 
ATOM   1766 O O   . VAL B 1 70  ? 24.006  15.602  26.802 1.00  41.99 ? 177  VAL B O   1 
ATOM   1767 C CB  . VAL B 1 70  ? 20.744  15.977  26.601 1.00  41.67 ? 177  VAL B CB  1 
ATOM   1768 C CG1 . VAL B 1 70  ? 21.318  16.844  27.721 1.00  41.34 ? 177  VAL B CG1 1 
ATOM   1769 C CG2 . VAL B 1 70  ? 19.867  16.811  25.677 1.00  41.56 ? 177  VAL B CG2 1 
ATOM   1770 N N   . LEU B 1 71  ? 22.878  13.720  27.331 1.00  42.50 ? 178  LEU B N   1 
ATOM   1771 C CA  . LEU B 1 71  ? 23.909  13.190  28.220 1.00  43.26 ? 178  LEU B CA  1 
ATOM   1772 C C   . LEU B 1 71  ? 25.183  12.743  27.480 1.00  44.20 ? 178  LEU B C   1 
ATOM   1773 O O   . LEU B 1 71  ? 26.234  12.544  28.096 1.00  44.49 ? 178  LEU B O   1 
ATOM   1774 C CB  . LEU B 1 71  ? 23.342  12.026  29.035 1.00  42.96 ? 178  LEU B CB  1 
ATOM   1775 C CG  . LEU B 1 71  ? 22.331  12.418  30.107 1.00  42.46 ? 178  LEU B CG  1 
ATOM   1776 C CD1 . LEU B 1 71  ? 21.640  11.179  30.646 1.00  41.57 ? 178  LEU B CD1 1 
ATOM   1777 C CD2 . LEU B 1 71  ? 23.014  13.203  31.229 1.00  41.97 ? 178  LEU B CD2 1 
ATOM   1778 N N   . LYS B 1 72  ? 25.069  12.568  26.167 1.00  45.34 ? 179  LYS B N   1 
ATOM   1779 C CA  . LYS B 1 72  ? 26.195  12.264  25.299 1.00  45.98 ? 179  LYS B CA  1 
ATOM   1780 C C   . LYS B 1 72  ? 26.929  13.539  24.886 1.00  46.68 ? 179  LYS B C   1 
ATOM   1781 O O   . LYS B 1 72  ? 28.153  13.618  24.968 1.00  46.68 ? 179  LYS B O   1 
ATOM   1782 C CB  . LYS B 1 72  ? 25.672  11.546  24.061 1.00  46.17 ? 179  LYS B CB  1 
ATOM   1783 C CG  . LYS B 1 72  ? 26.731  10.851  23.239 1.00  46.88 ? 179  LYS B CG  1 
ATOM   1784 C CD  . LYS B 1 72  ? 26.148  10.305  21.949 1.00  47.08 ? 179  LYS B CD  1 
ATOM   1785 C CE  . LYS B 1 72  ? 26.816  9.000   21.582 1.00  47.72 ? 179  LYS B CE  1 
ATOM   1786 N NZ  . LYS B 1 72  ? 28.304  9.122   21.539 1.00  47.84 ? 179  LYS B NZ  1 
ATOM   1787 N N   . GLN B 1 73  ? 26.163  14.548  24.475 1.00  47.42 ? 180  GLN B N   1 
ATOM   1788 C CA  . GLN B 1 73  ? 26.698  15.773  23.885 1.00  47.99 ? 180  GLN B CA  1 
ATOM   1789 C C   . GLN B 1 73  ? 26.948  16.912  24.899 1.00  48.75 ? 180  GLN B C   1 
ATOM   1790 O O   . GLN B 1 73  ? 27.095  18.090  24.518 1.00  48.27 ? 180  GLN B O   1 
ATOM   1791 C CB  . GLN B 1 73  ? 25.742  16.257  22.791 1.00  47.89 ? 180  GLN B CB  1 
ATOM   1792 C CG  . GLN B 1 73  ? 25.386  15.181  21.746 1.00  47.85 ? 180  GLN B CG  1 
ATOM   1793 C CD  . GLN B 1 73  ? 24.159  15.545  20.947 1.00  47.15 ? 180  GLN B CD  1 
ATOM   1794 O OE1 . GLN B 1 73  ? 23.781  16.708  20.889 1.00  46.40 ? 180  GLN B OE1 1 
ATOM   1795 N NE2 . GLN B 1 73  ? 23.530  14.553  20.333 1.00  48.97 ? 180  GLN B NE2 1 
ATOM   1796 N N   . ALA B 1 74  ? 27.019  16.565  26.180 1.00  49.57 ? 181  ALA B N   1 
ATOM   1797 C CA  . ALA B 1 74  ? 27.172  17.576  27.220 1.00  50.40 ? 181  ALA B CA  1 
ATOM   1798 C C   . ALA B 1 74  ? 28.545  18.256  27.122 1.00  51.07 ? 181  ALA B C   1 
ATOM   1799 O O   . ALA B 1 74  ? 29.551  17.625  26.780 1.00  50.94 ? 181  ALA B O   1 
ATOM   1800 C CB  . ALA B 1 74  ? 26.953  16.957  28.608 1.00  50.32 ? 181  ALA B CB  1 
ATOM   1801 N N   . PHE B 1 75  ? 28.570  19.555  27.403 1.00  52.09 ? 182  PHE B N   1 
ATOM   1802 C CA  . PHE B 1 75  ? 29.803  20.339  27.319 1.00  52.69 ? 182  PHE B CA  1 
ATOM   1803 C C   . PHE B 1 75  ? 30.625  20.198  28.604 1.00  52.44 ? 182  PHE B C   1 
ATOM   1804 O O   . PHE B 1 75  ? 30.265  20.757  29.644 1.00  52.43 ? 182  PHE B O   1 
ATOM   1805 C CB  . PHE B 1 75  ? 29.484  21.814  27.053 1.00  53.01 ? 182  PHE B CB  1 
ATOM   1806 C CG  . PHE B 1 75  ? 30.706  22.674  26.897 1.00  54.82 ? 182  PHE B CG  1 
ATOM   1807 C CD1 . PHE B 1 75  ? 31.515  22.548  25.774 1.00  55.77 ? 182  PHE B CD1 1 
ATOM   1808 C CD2 . PHE B 1 75  ? 31.058  23.595  27.884 1.00  56.30 ? 182  PHE B CD2 1 
ATOM   1809 C CE1 . PHE B 1 75  ? 32.649  23.332  25.624 1.00  56.35 ? 182  PHE B CE1 1 
ATOM   1810 C CE2 . PHE B 1 75  ? 32.194  24.383  27.747 1.00  56.77 ? 182  PHE B CE2 1 
ATOM   1811 C CZ  . PHE B 1 75  ? 32.990  24.255  26.612 1.00  56.91 ? 182  PHE B CZ  1 
ATOM   1812 N N   . GLY B 1 76  ? 31.720  19.443  28.519 1.00  52.08 ? 183  GLY B N   1 
ATOM   1813 C CA  . GLY B 1 76  ? 32.654  19.298  29.623 1.00  51.79 ? 183  GLY B CA  1 
ATOM   1814 C C   . GLY B 1 76  ? 32.524  17.964  30.324 1.00  51.34 ? 183  GLY B C   1 
ATOM   1815 O O   . GLY B 1 76  ? 31.708  17.125  29.928 1.00  51.52 ? 183  GLY B O   1 
ATOM   1816 N N   . GLU B 1 77  ? 33.329  17.785  31.373 1.00  50.60 ? 184  GLU B N   1 
ATOM   1817 C CA  . GLU B 1 77  ? 33.438  16.511  32.097 1.00  49.92 ? 184  GLU B CA  1 
ATOM   1818 C C   . GLU B 1 77  ? 32.474  16.419  33.290 1.00  48.79 ? 184  GLU B C   1 
ATOM   1819 O O   . GLU B 1 77  ? 32.380  15.370  33.934 1.00  48.82 ? 184  GLU B O   1 
ATOM   1820 C CB  . GLU B 1 77  ? 34.886  16.290  32.583 1.00  50.40 ? 184  GLU B CB  1 
ATOM   1821 C CG  . GLU B 1 77  ? 35.742  15.383  31.694 1.00  51.70 ? 184  GLU B CG  1 
ATOM   1822 C CD  . GLU B 1 77  ? 35.817  13.938  32.192 1.00  53.23 ? 184  GLU B CD  1 
ATOM   1823 O OE1 . GLU B 1 77  ? 36.304  13.718  33.329 1.00  53.94 ? 184  GLU B OE1 1 
ATOM   1824 O OE2 . GLU B 1 77  ? 35.402  13.018  31.441 1.00  53.73 ? 184  GLU B OE2 1 
ATOM   1825 N N   . LYS B 1 78  ? 31.755  17.505  33.575 1.00  47.05 ? 185  LYS B N   1 
ATOM   1826 C CA  . LYS B 1 78  ? 30.854  17.556  34.723 1.00  45.61 ? 185  LYS B CA  1 
ATOM   1827 C C   . LYS B 1 78  ? 29.380  17.607  34.296 1.00  43.42 ? 185  LYS B C   1 
ATOM   1828 O O   . LYS B 1 78  ? 28.991  18.459  33.498 1.00  43.38 ? 185  LYS B O   1 
ATOM   1829 C CB  . LYS B 1 78  ? 31.187  18.775  35.582 1.00  45.93 ? 185  LYS B CB  1 
ATOM   1830 C CG  . LYS B 1 78  ? 30.719  18.663  37.021 1.00  47.17 ? 185  LYS B CG  1 
ATOM   1831 C CD  . LYS B 1 78  ? 31.190  19.855  37.862 1.00  48.84 ? 185  LYS B CD  1 
ATOM   1832 C CE  . LYS B 1 78  ? 30.398  21.129  37.551 1.00  49.74 ? 185  LYS B CE  1 
ATOM   1833 N NZ  . LYS B 1 78  ? 31.047  21.928  36.459 1.00  50.77 ? 185  LYS B NZ  1 
ATOM   1834 N N   . ILE B 1 79  ? 28.570  16.696  34.834 1.00  40.70 ? 186  ILE B N   1 
ATOM   1835 C CA  . ILE B 1 79  ? 27.127  16.695  34.582 1.00  38.94 ? 186  ILE B CA  1 
ATOM   1836 C C   . ILE B 1 79  ? 26.327  16.944  35.868 1.00  36.87 ? 186  ILE B C   1 
ATOM   1837 O O   . ILE B 1 79  ? 26.422  16.195  36.838 1.00  36.01 ? 186  ILE B O   1 
ATOM   1838 C CB  . ILE B 1 79  ? 26.679  15.371  33.938 1.00  38.88 ? 186  ILE B CB  1 
ATOM   1839 C CG1 . ILE B 1 79  ? 27.401  15.141  32.612 1.00  38.76 ? 186  ILE B CG1 1 
ATOM   1840 C CG2 . ILE B 1 79  ? 25.169  15.371  33.699 1.00  39.37 ? 186  ILE B CG2 1 
ATOM   1841 C CD1 . ILE B 1 79  ? 27.511  13.694  32.272 1.00  39.21 ? 186  ILE B CD1 1 
ATOM   1842 N N   . THR B 1 80  ? 25.532  18.002  35.849 1.00  34.60 ? 187  THR B N   1 
ATOM   1843 C CA  . THR B 1 80  ? 24.652  18.337  36.959 1.00  33.54 ? 187  THR B CA  1 
ATOM   1844 C C   . THR B 1 80  ? 23.239  17.763  36.733 1.00  32.19 ? 187  THR B C   1 
ATOM   1845 O O   . THR B 1 80  ? 22.664  17.912  35.646 1.00  31.90 ? 187  THR B O   1 
ATOM   1846 C CB  . THR B 1 80  ? 24.625  19.867  37.117 1.00  33.48 ? 187  THR B CB  1 
ATOM   1847 O OG1 . THR B 1 80  ? 25.818  20.308  37.794 1.00  34.79 ? 187  THR B OG1 1 
ATOM   1848 C CG2 . THR B 1 80  ? 23.539  20.303  38.025 1.00  34.31 ? 187  THR B CG2 1 
ATOM   1849 N N   . MET B 1 81  ? 22.695  17.101  37.757 1.00  30.63 ? 188  MET B N   1 
ATOM   1850 C CA  . MET B 1 81  ? 21.303  16.649  37.765 1.00  29.71 ? 188  MET B CA  1 
ATOM   1851 C C   . MET B 1 81  ? 20.549  17.020  39.037 1.00  28.56 ? 188  MET B C   1 
ATOM   1852 O O   . MET B 1 81  ? 21.118  17.017  40.124 1.00  27.99 ? 188  MET B O   1 
ATOM   1853 C CB  . MET B 1 81  ? 21.245  15.136  37.605 1.00  30.01 ? 188  MET B CB  1 
ATOM   1854 C CG  . MET B 1 81  ? 21.775  14.635  36.291 1.00  30.87 ? 188  MET B CG  1 
ATOM   1855 S SD  . MET B 1 81  ? 21.515  12.886  36.176 1.00  34.56 ? 188  MET B SD  1 
ATOM   1856 C CE  . MET B 1 81  ? 22.757  12.470  35.009 1.00  34.03 ? 188  MET B CE  1 
ATOM   1857 N N   . THR B 1 82  ? 19.264  17.343  38.894 1.00  27.22 ? 189  THR B N   1 
ATOM   1858 C CA  . THR B 1 82  ? 18.354  17.421  40.031 1.00  26.48 ? 189  THR B CA  1 
ATOM   1859 C C   . THR B 1 82  ? 17.348  16.274  39.983 1.00  25.71 ? 189  THR B C   1 
ATOM   1860 O O   . THR B 1 82  ? 16.638  16.120  38.998 1.00  24.93 ? 189  THR B O   1 
ATOM   1861 C CB  . THR B 1 82  ? 17.608  18.744  40.047 1.00  26.21 ? 189  THR B CB  1 
ATOM   1862 O OG1 . THR B 1 82  ? 18.546  19.825  40.082 1.00  27.94 ? 189  THR B OG1 1 
ATOM   1863 C CG2 . THR B 1 82  ? 16.829  18.889  41.326 1.00  25.30 ? 189  THR B CG2 1 
ATOM   1864 N N   . ILE B 1 83  ? 17.280  15.527  41.082 1.00  25.13 ? 190  ILE B N   1 
ATOM   1865 C CA  . ILE B 1 83  ? 16.578  14.254  41.192 1.00  25.11 ? 190  ILE B CA  1 
ATOM   1866 C C   . ILE B 1 83  ? 15.463  14.320  42.242 1.00  25.50 ? 190  ILE B C   1 
ATOM   1867 O O   . ILE B 1 83  ? 15.647  14.888  43.318 1.00  24.97 ? 190  ILE B O   1 
ATOM   1868 C CB  . ILE B 1 83  ? 17.576  13.162  41.644 1.00  24.95 ? 190  ILE B CB  1 
ATOM   1869 C CG1 . ILE B 1 83  ? 18.801  13.076  40.726 1.00  25.56 ? 190  ILE B CG1 1 
ATOM   1870 C CG2 . ILE B 1 83  ? 16.903  11.790  41.744 1.00  25.38 ? 190  ILE B CG2 1 
ATOM   1871 C CD1 . ILE B 1 83  ? 18.501  12.745  39.303 1.00  25.75 ? 190  ILE B CD1 1 
ATOM   1872 N N   . ARG B 1 84  ? 14.317  13.716  41.927 1.00  26.25 ? 191  ARG B N   1 
ATOM   1873 C CA  . ARG B 1 84  ? 13.311  13.361  42.926 1.00  26.99 ? 191  ARG B CA  1 
ATOM   1874 C C   . ARG B 1 84  ? 13.398  11.866  43.185 1.00  27.46 ? 191  ARG B C   1 
ATOM   1875 O O   . ARG B 1 84  ? 13.108  11.062  42.302 1.00  27.24 ? 191  ARG B O   1 
ATOM   1876 C CB  . ARG B 1 84  ? 11.905  13.714  42.444 1.00  27.23 ? 191  ARG B CB  1 
ATOM   1877 C CG  . ARG B 1 84  ? 10.861  13.557  43.514 1.00  28.14 ? 191  ARG B CG  1 
ATOM   1878 C CD  . ARG B 1 84  ? 9.530   14.112  43.124 1.00  28.36 ? 191  ARG B CD  1 
ATOM   1879 N NE  . ARG B 1 84  ? 9.482   15.553  43.332 1.00  29.87 ? 191  ARG B NE  1 
ATOM   1880 C CZ  . ARG B 1 84  ? 8.892   16.415  42.508 1.00  31.54 ? 191  ARG B CZ  1 
ATOM   1881 N NH1 . ARG B 1 84  ? 8.241   15.986  41.418 1.00  33.21 ? 191  ARG B NH1 1 
ATOM   1882 N NH2 . ARG B 1 84  ? 8.916   17.716  42.796 1.00  31.83 ? 191  ARG B NH2 1 
ATOM   1883 N N   . ASP B 1 85  ? 13.843  11.507  44.387 1.00  27.87 ? 192  ASP B N   1 
ATOM   1884 C CA  . ASP B 1 85  ? 13.921  10.113  44.812 1.00  28.61 ? 192  ASP B CA  1 
ATOM   1885 C C   . ASP B 1 85  ? 12.637  9.316   44.562 1.00  28.75 ? 192  ASP B C   1 
ATOM   1886 O O   . ASP B 1 85  ? 11.575  9.645   45.098 1.00  28.40 ? 192  ASP B O   1 
ATOM   1887 C CB  . ASP B 1 85  ? 14.331  10.026  46.287 1.00  29.03 ? 192  ASP B CB  1 
ATOM   1888 C CG  . ASP B 1 85  ? 15.804  10.368  46.501 1.00  28.80 ? 192  ASP B CG  1 
ATOM   1889 O OD1 . ASP B 1 85  ? 16.539  10.521  45.510 1.00  27.81 ? 192  ASP B OD1 1 
ATOM   1890 O OD2 . ASP B 1 85  ? 16.316  10.511  47.618 1.00  31.05 ? 192  ASP B OD2 1 
ATOM   1891 N N   . ARG B 1 86  ? 12.781  8.278   43.729 1.00  29.03 ? 193  ARG B N   1 
ATOM   1892 C CA  . ARG B 1 86  ? 11.704  7.359   43.312 1.00  30.00 ? 193  ARG B CA  1 
ATOM   1893 C C   . ARG B 1 86  ? 10.336  7.715   43.869 1.00  29.26 ? 193  ARG B C   1 
ATOM   1894 O O   . ARG B 1 86  ? 9.933   7.185   44.892 1.00  29.86 ? 193  ARG B O   1 
ATOM   1895 C CB  . ARG B 1 86  ? 12.037  5.902   43.674 1.00  30.51 ? 193  ARG B CB  1 
ATOM   1896 C CG  . ARG B 1 86  ? 13.135  5.740   44.678 1.00  33.24 ? 193  ARG B CG  1 
ATOM   1897 C CD  . ARG B 1 86  ? 13.368  4.324   45.083 1.00  36.43 ? 193  ARG B CD  1 
ATOM   1898 N NE  . ARG B 1 86  ? 13.931  3.499   44.028 1.00  39.40 ? 193  ARG B NE  1 
ATOM   1899 C CZ  . ARG B 1 86  ? 14.161  2.181   44.162 1.00  41.36 ? 193  ARG B CZ  1 
ATOM   1900 N NH1 . ARG B 1 86  ? 13.885  1.569   45.320 1.00  41.55 ? 193  ARG B NH1 1 
ATOM   1901 N NH2 . ARG B 1 86  ? 14.678  1.473   43.149 1.00  39.38 ? 193  ARG B NH2 1 
ATOM   1902 N N   . PRO B 1 87  ? 9.628   8.608   43.200 1.00  28.37 ? 194  PRO B N   1 
ATOM   1903 C CA  . PRO B 1 87  ? 8.350   9.086   43.709 1.00  28.46 ? 194  PRO B CA  1 
ATOM   1904 C C   . PRO B 1 87  ? 7.224   8.031   43.646 1.00  28.24 ? 194  PRO B C   1 
ATOM   1905 O O   . PRO B 1 87  ? 6.265   8.179   44.367 1.00  28.10 ? 194  PRO B O   1 
ATOM   1906 C CB  . PRO B 1 87  ? 8.067   10.290  42.811 1.00  28.46 ? 194  PRO B CB  1 
ATOM   1907 C CG  . PRO B 1 87  ? 8.766   9.972   41.531 1.00  28.38 ? 194  PRO B CG  1 
ATOM   1908 C CD  . PRO B 1 87  ? 9.981   9.241   41.920 1.00  28.13 ? 194  PRO B CD  1 
ATOM   1909 N N   . PHE B 1 88  ? 7.352   7.007   42.805 1.00  28.51 ? 195  PHE B N   1 
ATOM   1910 C CA  . PHE B 1 88  ? 6.385   5.906   42.719 1.00  28.86 ? 195  PHE B CA  1 
ATOM   1911 C C   . PHE B 1 88  ? 6.626   4.771   43.749 1.00  28.71 ? 195  PHE B C   1 
ATOM   1912 O O   . PHE B 1 88  ? 5.851   3.816   43.804 1.00  28.49 ? 195  PHE B O   1 
ATOM   1913 C CB  . PHE B 1 88  ? 6.399   5.295   41.303 1.00  28.84 ? 195  PHE B CB  1 
ATOM   1914 C CG  . PHE B 1 88  ? 5.875   6.209   40.221 1.00  30.04 ? 195  PHE B CG  1 
ATOM   1915 C CD1 . PHE B 1 88  ? 4.559   6.632   40.227 1.00  31.95 ? 195  PHE B CD1 1 
ATOM   1916 C CD2 . PHE B 1 88  ? 6.697   6.635   39.191 1.00  32.58 ? 195  PHE B CD2 1 
ATOM   1917 C CE1 . PHE B 1 88  ? 4.074   7.464   39.233 1.00  33.14 ? 195  PHE B CE1 1 
ATOM   1918 C CE2 . PHE B 1 88  ? 6.212   7.476   38.191 1.00  33.33 ? 195  PHE B CE2 1 
ATOM   1919 C CZ  . PHE B 1 88  ? 4.908   7.887   38.216 1.00  33.15 ? 195  PHE B CZ  1 
ATOM   1920 N N   . GLU B 1 89  ? 7.684   4.865   44.549 1.00  28.76 ? 196  GLU B N   1 
ATOM   1921 C CA  . GLU B 1 89  ? 8.077   3.761   45.445 1.00  29.53 ? 196  GLU B CA  1 
ATOM   1922 C C   . GLU B 1 89  ? 7.149   3.605   46.651 1.00  29.54 ? 196  GLU B C   1 
ATOM   1923 O O   . GLU B 1 89  ? 6.742   4.587   47.250 1.00  29.36 ? 196  GLU B O   1 
ATOM   1924 C CB  . GLU B 1 89  ? 9.524   3.930   45.936 1.00  29.96 ? 196  GLU B CB  1 
ATOM   1925 C CG  . GLU B 1 89  ? 9.752   3.568   47.408 1.00  32.11 ? 196  GLU B CG  1 
ATOM   1926 C CD  . GLU B 1 89  ? 11.140  3.938   47.918 1.00  34.01 ? 196  GLU B CD  1 
ATOM   1927 O OE1 . GLU B 1 89  ? 12.135  3.376   47.426 1.00  35.00 ? 196  GLU B OE1 1 
ATOM   1928 O OE2 . GLU B 1 89  ? 11.237  4.779   48.833 1.00  35.77 ? 196  GLU B OE2 1 
ATOM   1929 N N   . ARG B 1 90  ? 6.876   2.350   47.015 1.00  29.53 ? 197  ARG B N   1 
ATOM   1930 C CA  . ARG B 1 90  ? 6.016   1.987   48.128 1.00  29.47 ? 197  ARG B CA  1 
ATOM   1931 C C   . ARG B 1 90  ? 6.637   0.791   48.869 1.00  29.20 ? 197  ARG B C   1 
ATOM   1932 O O   . ARG B 1 90  ? 7.171   -0.121  48.247 1.00  28.59 ? 197  ARG B O   1 
ATOM   1933 C CB  . ARG B 1 90  ? 4.628   1.575   47.620 1.00  29.82 ? 197  ARG B CB  1 
ATOM   1934 C CG  . ARG B 1 90  ? 3.772   2.712   47.086 1.00  31.21 ? 197  ARG B CG  1 
ATOM   1935 C CD  . ARG B 1 90  ? 2.277   2.464   47.168 1.00  32.88 ? 197  ARG B CD  1 
ATOM   1936 N NE  . ARG B 1 90  ? 1.910   1.070   46.876 1.00  34.49 ? 197  ARG B NE  1 
ATOM   1937 C CZ  . ARG B 1 90  ? 1.878   0.524   45.658 1.00  34.63 ? 197  ARG B CZ  1 
ATOM   1938 N NH1 . ARG B 1 90  ? 2.205   1.218   44.571 1.00  33.70 ? 197  ARG B NH1 1 
ATOM   1939 N NH2 . ARG B 1 90  ? 1.527   -0.745  45.532 1.00  35.94 ? 197  ARG B NH2 1 
ATOM   1940 N N   . THR B 1 91  ? 6.524   0.791   50.192 1.00  28.63 ? 198  THR B N   1 
ATOM   1941 C CA  . THR B 1 91  ? 7.062   -0.262  51.033 1.00  28.86 ? 198  THR B CA  1 
ATOM   1942 C C   . THR B 1 91  ? 5.917   -1.123  51.561 1.00  28.73 ? 198  THR B C   1 
ATOM   1943 O O   . THR B 1 91  ? 4.914   -0.592  52.036 1.00  28.59 ? 198  THR B O   1 
ATOM   1944 C CB  . THR B 1 91  ? 7.808   0.377   52.195 1.00  28.83 ? 198  THR B CB  1 
ATOM   1945 O OG1 . THR B 1 91  ? 9.002   1.001   51.709 1.00  31.78 ? 198  THR B OG1 1 
ATOM   1946 C CG2 . THR B 1 91  ? 8.319   -0.657  53.143 1.00  29.67 ? 198  THR B CG2 1 
ATOM   1947 N N   . ILE B 1 92  ? 6.050   -2.445  51.458 1.00  28.27 ? 199  ILE B N   1 
ATOM   1948 C CA  . ILE B 1 92  ? 5.082   -3.359  52.052 1.00  27.96 ? 199  ILE B CA  1 
ATOM   1949 C C   . ILE B 1 92  ? 5.804   -4.371  52.927 1.00  27.83 ? 199  ILE B C   1 
ATOM   1950 O O   . ILE B 1 92  ? 6.790   -4.985  52.504 1.00  27.47 ? 199  ILE B O   1 
ATOM   1951 C CB  . ILE B 1 92  ? 4.263   -4.062  50.961 1.00  28.06 ? 199  ILE B CB  1 
ATOM   1952 C CG1 . ILE B 1 92  ? 3.409   -3.014  50.243 1.00  29.21 ? 199  ILE B CG1 1 
ATOM   1953 C CG2 . ILE B 1 92  ? 3.424   -5.183  51.545 1.00  27.30 ? 199  ILE B CG2 1 
ATOM   1954 C CD1 . ILE B 1 92  ? 2.119   -3.503  49.709 1.00  29.65 ? 199  ILE B CD1 1 
ATOM   1955 N N   . THR B 1 93  ? 5.283   -4.549  54.139 1.00  27.17 ? 200  THR B N   1 
ATOM   1956 C CA  . THR B 1 93  ? 5.875   -5.451  55.123 1.00  26.69 ? 200  THR B CA  1 
ATOM   1957 C C   . THR B 1 93  ? 5.021   -6.708  55.294 1.00  26.12 ? 200  THR B C   1 
ATOM   1958 O O   . THR B 1 93  ? 3.833   -6.624  55.614 1.00  26.63 ? 200  THR B O   1 
ATOM   1959 C CB  . THR B 1 93  ? 6.047   -4.690  56.433 1.00  26.80 ? 200  THR B CB  1 
ATOM   1960 O OG1 . THR B 1 93  ? 7.092   -3.718  56.267 1.00  26.42 ? 200  THR B OG1 1 
ATOM   1961 C CG2 . THR B 1 93  ? 6.558   -5.596  57.554 1.00  27.64 ? 200  THR B CG2 1 
ATOM   1962 N N   . MET B 1 94  ? 5.619   -7.867  55.021 1.00  25.35 ? 201  MET B N   1 
ATOM   1963 C CA  . MET B 1 94  ? 4.940   -9.154  55.130 1.00  25.11 ? 201  MET B CA  1 
ATOM   1964 C C   . MET B 1 94  ? 5.654   -10.074 56.107 1.00  24.93 ? 201  MET B C   1 
ATOM   1965 O O   . MET B 1 94  ? 6.815   -9.897  56.386 1.00  24.19 ? 201  MET B O   1 
ATOM   1966 C CB  . MET B 1 94  ? 4.855   -9.838  53.763 1.00  24.65 ? 201  MET B CB  1 
ATOM   1967 C CG  . MET B 1 94  ? 4.018   -9.085  52.755 1.00  24.89 ? 201  MET B CG  1 
ATOM   1968 S SD  . MET B 1 94  ? 4.394   -9.497  51.053 1.00  23.22 ? 201  MET B SD  1 
ATOM   1969 C CE  . MET B 1 94  ? 5.974   -8.734  50.843 1.00  24.61 ? 201  MET B CE  1 
ATOM   1970 N N   . HIS B 1 95  ? 4.926   -11.063 56.606 1.00  26.07 ? 202  HIS B N   1 
ATOM   1971 C CA  . HIS B 1 95  ? 5.452   -12.093 57.496 1.00  27.22 ? 202  HIS B CA  1 
ATOM   1972 C C   . HIS B 1 95  ? 5.326   -13.483 56.853 1.00  27.35 ? 202  HIS B C   1 
ATOM   1973 O O   . HIS B 1 95  ? 4.318   -13.800 56.225 1.00  27.73 ? 202  HIS B O   1 
ATOM   1974 C CB  . HIS B 1 95  ? 4.691   -12.031 58.822 1.00  27.72 ? 202  HIS B CB  1 
ATOM   1975 C CG  . HIS B 1 95  ? 4.844   -10.719 59.541 1.00  30.29 ? 202  HIS B CG  1 
ATOM   1976 N ND1 . HIS B 1 95  ? 4.356   -9.528  59.040 1.00  32.76 ? 202  HIS B ND1 1 
ATOM   1977 C CD2 . HIS B 1 95  ? 5.421   -10.414 60.727 1.00  32.59 ? 202  HIS B CD2 1 
ATOM   1978 C CE1 . HIS B 1 95  ? 4.636   -8.548  59.880 1.00  32.39 ? 202  HIS B CE1 1 
ATOM   1979 N NE2 . HIS B 1 95  ? 5.283   -9.060  60.912 1.00  33.20 ? 202  HIS B NE2 1 
ATOM   1980 N N   . LYS B 1 96  ? 6.345   -14.320 57.008 1.00  27.95 ? 203  LYS B N   1 
ATOM   1981 C CA  . LYS B 1 96  ? 6.335   -15.644 56.392 1.00  28.27 ? 203  LYS B CA  1 
ATOM   1982 C C   . LYS B 1 96  ? 5.402   -16.553 57.166 1.00  28.63 ? 203  LYS B C   1 
ATOM   1983 O O   . LYS B 1 96  ? 5.323   -16.450 58.374 1.00  29.59 ? 203  LYS B O   1 
ATOM   1984 C CB  . LYS B 1 96  ? 7.740   -16.252 56.368 1.00  28.15 ? 203  LYS B CB  1 
ATOM   1985 C CG  . LYS B 1 96  ? 8.677   -15.662 55.329 1.00  27.83 ? 203  LYS B CG  1 
ATOM   1986 C CD  . LYS B 1 96  ? 10.071  -16.298 55.410 1.00  27.94 ? 203  LYS B CD  1 
ATOM   1987 C CE  . LYS B 1 96  ? 10.951  -15.889 54.236 1.00  27.73 ? 203  LYS B CE  1 
ATOM   1988 N NZ  . LYS B 1 96  ? 12.402  -15.853 54.582 1.00  26.72 ? 203  LYS B NZ  1 
ATOM   1989 N N   . ASP B 1 97  ? 4.695   -17.435 56.464 1.00  29.19 ? 204  ASP B N   1 
ATOM   1990 C CA  . ASP B 1 97  ? 3.907   -18.485 57.107 1.00  29.56 ? 204  ASP B CA  1 
ATOM   1991 C C   . ASP B 1 97  ? 4.844   -19.654 57.459 1.00  29.90 ? 204  ASP B C   1 
ATOM   1992 O O   . ASP B 1 97  ? 6.067   -19.475 57.448 1.00  29.42 ? 204  ASP B O   1 
ATOM   1993 C CB  . ASP B 1 97  ? 2.691   -18.904 56.239 1.00  29.32 ? 204  ASP B CB  1 
ATOM   1994 C CG  . ASP B 1 97  ? 3.073   -19.474 54.878 1.00  29.21 ? 204  ASP B CG  1 
ATOM   1995 O OD1 . ASP B 1 97  ? 4.248   -19.808 54.631 1.00  28.60 ? 204  ASP B OD1 1 
ATOM   1996 O OD2 . ASP B 1 97  ? 2.226   -19.632 53.969 1.00  30.10 ? 204  ASP B OD2 1 
ATOM   1997 N N   . SER B 1 98  ? 4.290   -20.822 57.796 1.00  30.40 ? 205  SER B N   1 
ATOM   1998 C CA  . SER B 1 98  ? 5.124   -21.953 58.253 1.00  30.79 ? 205  SER B CA  1 
ATOM   1999 C C   . SER B 1 98  ? 5.821   -22.711 57.123 1.00  30.66 ? 205  SER B C   1 
ATOM   2000 O O   . SER B 1 98  ? 6.799   -23.431 57.378 1.00  31.01 ? 205  SER B O   1 
ATOM   2001 C CB  . SER B 1 98  ? 4.348   -22.920 59.166 1.00  30.95 ? 205  SER B CB  1 
ATOM   2002 O OG  . SER B 1 98  ? 3.085   -23.293 58.646 1.00  32.78 ? 205  SER B OG  1 
ATOM   2003 N N   . THR B 1 99  ? 5.356   -22.528 55.883 1.00  30.35 ? 206  THR B N   1 
ATOM   2004 C CA  . THR B 1 99  ? 6.048   -23.071 54.701 1.00  29.72 ? 206  THR B CA  1 
ATOM   2005 C C   . THR B 1 99  ? 7.174   -22.135 54.213 1.00  29.15 ? 206  THR B C   1 
ATOM   2006 O O   . THR B 1 99  ? 7.851   -22.440 53.232 1.00  29.62 ? 206  THR B O   1 
ATOM   2007 C CB  . THR B 1 99  ? 5.058   -23.382 53.526 1.00  29.72 ? 206  THR B CB  1 
ATOM   2008 O OG1 . THR B 1 99  ? 4.704   -22.179 52.821 1.00  30.38 ? 206  THR B OG1 1 
ATOM   2009 C CG2 . THR B 1 99  ? 3.707   -23.933 54.016 1.00  29.58 ? 206  THR B CG2 1 
ATOM   2010 N N   . GLY B 1 100 ? 7.375   -21.011 54.896 1.00  28.59 ? 207  GLY B N   1 
ATOM   2011 C CA  . GLY B 1 100 ? 8.403   -20.041 54.543 1.00  27.68 ? 207  GLY B CA  1 
ATOM   2012 C C   . GLY B 1 100 ? 7.966   -19.074 53.446 1.00  27.11 ? 207  GLY B C   1 
ATOM   2013 O O   . GLY B 1 100 ? 8.783   -18.386 52.854 1.00  26.33 ? 207  GLY B O   1 
ATOM   2014 N N   . HIS B 1 101 ? 6.675   -19.027 53.172 1.00  26.77 ? 208  HIS B N   1 
ATOM   2015 C CA  . HIS B 1 101 ? 6.169   -18.203 52.086 1.00  27.09 ? 208  HIS B CA  1 
ATOM   2016 C C   . HIS B 1 101 ? 5.426   -16.968 52.547 1.00  26.72 ? 208  HIS B C   1 
ATOM   2017 O O   . HIS B 1 101 ? 4.601   -16.993 53.465 1.00  26.91 ? 208  HIS B O   1 
ATOM   2018 C CB  . HIS B 1 101 ? 5.287   -19.011 51.171 1.00  27.22 ? 208  HIS B CB  1 
ATOM   2019 C CG  . HIS B 1 101 ? 6.017   -20.126 50.501 1.00  29.36 ? 208  HIS B CG  1 
ATOM   2020 N ND1 . HIS B 1 101 ? 5.733   -21.451 50.744 1.00  31.11 ? 208  HIS B ND1 1 
ATOM   2021 C CD2 . HIS B 1 101 ? 7.046   -20.111 49.627 1.00  29.34 ? 208  HIS B CD2 1 
ATOM   2022 C CE1 . HIS B 1 101 ? 6.545   -22.206 50.033 1.00  30.16 ? 208  HIS B CE1 1 
ATOM   2023 N NE2 . HIS B 1 101 ? 7.356   -21.417 49.353 1.00  30.67 ? 208  HIS B NE2 1 
ATOM   2024 N N   . VAL B 1 102 ? 5.737   -15.886 51.859 1.00  25.74 ? 209  VAL B N   1 
ATOM   2025 C CA  . VAL B 1 102 ? 5.145   -14.594 52.099 1.00  25.06 ? 209  VAL B CA  1 
ATOM   2026 C C   . VAL B 1 102 ? 3.813   -14.472 51.310 1.00  24.69 ? 209  VAL B C   1 
ATOM   2027 O O   . VAL B 1 102 ? 2.873   -13.763 51.746 1.00  24.39 ? 209  VAL B O   1 
ATOM   2028 C CB  . VAL B 1 102 ? 6.231   -13.520 51.800 1.00  24.91 ? 209  VAL B CB  1 
ATOM   2029 C CG1 . VAL B 1 102 ? 5.672   -12.346 51.138 1.00  26.79 ? 209  VAL B CG1 1 
ATOM   2030 C CG2 . VAL B 1 102 ? 6.984   -13.146 53.112 1.00  23.71 ? 209  VAL B CG2 1 
ATOM   2031 N N   . GLY B 1 103 ? 3.739   -15.167 50.176 1.00  23.88 ? 210  GLY B N   1 
ATOM   2032 C CA  . GLY B 1 103 ? 2.516   -15.322 49.404 1.00  24.39 ? 210  GLY B CA  1 
ATOM   2033 C C   . GLY B 1 103 ? 2.357   -14.626 48.055 1.00  24.65 ? 210  GLY B C   1 
ATOM   2034 O O   . GLY B 1 103 ? 1.279   -14.100 47.784 1.00  24.60 ? 210  GLY B O   1 
ATOM   2035 N N   . PHE B 1 104 ? 3.394   -14.600 47.214 1.00  25.38 ? 211  PHE B N   1 
ATOM   2036 C CA  . PHE B 1 104 ? 3.229   -14.104 45.826 1.00  25.66 ? 211  PHE B CA  1 
ATOM   2037 C C   . PHE B 1 104 ? 4.064   -14.814 44.748 1.00  26.55 ? 211  PHE B C   1 
ATOM   2038 O O   . PHE B 1 104 ? 5.114   -15.390 45.018 1.00  26.16 ? 211  PHE B O   1 
ATOM   2039 C CB  . PHE B 1 104 ? 3.418   -12.577 45.742 1.00  25.37 ? 211  PHE B CB  1 
ATOM   2040 C CG  . PHE B 1 104 ? 4.823   -12.085 46.006 1.00  23.08 ? 211  PHE B CG  1 
ATOM   2041 C CD1 . PHE B 1 104 ? 5.724   -11.940 44.976 1.00  21.97 ? 211  PHE B CD1 1 
ATOM   2042 C CD2 . PHE B 1 104 ? 5.201   -11.683 47.272 1.00  22.37 ? 211  PHE B CD2 1 
ATOM   2043 C CE1 . PHE B 1 104 ? 7.000   -11.453 45.215 1.00  22.11 ? 211  PHE B CE1 1 
ATOM   2044 C CE2 . PHE B 1 104 ? 6.463   -11.197 47.523 1.00  21.74 ? 211  PHE B CE2 1 
ATOM   2045 C CZ  . PHE B 1 104 ? 7.368   -11.076 46.495 1.00  22.00 ? 211  PHE B CZ  1 
ATOM   2046 N N   . ILE B 1 105 ? 3.562   -14.759 43.515 1.00  28.10 ? 212  ILE B N   1 
ATOM   2047 C CA  . ILE B 1 105 ? 4.271   -15.277 42.356 1.00  29.01 ? 212  ILE B CA  1 
ATOM   2048 C C   . ILE B 1 105 ? 4.962   -14.111 41.633 1.00  29.43 ? 212  ILE B C   1 
ATOM   2049 O O   . ILE B 1 105 ? 4.358   -13.070 41.440 1.00  29.61 ? 212  ILE B O   1 
ATOM   2050 C CB  . ILE B 1 105 ? 3.283   -16.015 41.423 1.00  29.37 ? 212  ILE B CB  1 
ATOM   2051 C CG1 . ILE B 1 105 ? 2.411   -17.017 42.208 1.00  30.89 ? 212  ILE B CG1 1 
ATOM   2052 C CG2 . ILE B 1 105 ? 4.014   -16.732 40.314 1.00  29.48 ? 212  ILE B CG2 1 
ATOM   2053 C CD1 . ILE B 1 105 ? 3.157   -17.940 43.126 1.00  31.29 ? 212  ILE B CD1 1 
ATOM   2054 N N   . PHE B 1 106 ? 6.235   -14.273 41.276 1.00  29.99 ? 213  PHE B N   1 
ATOM   2055 C CA  . PHE B 1 106 ? 6.929   -13.298 40.446 1.00  30.54 ? 213  PHE B CA  1 
ATOM   2056 C C   . PHE B 1 106 ? 7.748   -13.942 39.308 1.00  30.98 ? 213  PHE B C   1 
ATOM   2057 O O   . PHE B 1 106 ? 8.107   -15.110 39.347 1.00  30.70 ? 213  PHE B O   1 
ATOM   2058 C CB  . PHE B 1 106 ? 7.795   -12.370 41.300 1.00  30.57 ? 213  PHE B CB  1 
ATOM   2059 C CG  . PHE B 1 106 ? 9.137   -12.936 41.653 1.00  31.46 ? 213  PHE B CG  1 
ATOM   2060 C CD1 . PHE B 1 106 ? 10.252  -12.662 40.863 1.00  31.62 ? 213  PHE B CD1 1 
ATOM   2061 C CD2 . PHE B 1 106 ? 9.295   -13.727 42.782 1.00  31.91 ? 213  PHE B CD2 1 
ATOM   2062 C CE1 . PHE B 1 106 ? 11.488  -13.179 41.183 1.00  31.31 ? 213  PHE B CE1 1 
ATOM   2063 C CE2 . PHE B 1 106 ? 10.540  -14.247 43.114 1.00  32.02 ? 213  PHE B CE2 1 
ATOM   2064 C CZ  . PHE B 1 106 ? 11.638  -13.968 42.311 1.00  32.89 ? 213  PHE B CZ  1 
ATOM   2065 N N   . LYS B 1 107 ? 8.024   -13.137 38.295 1.00  31.54 ? 214  LYS B N   1 
ATOM   2066 C CA  . LYS B 1 107 ? 8.679   -13.585 37.074 1.00  31.78 ? 214  LYS B CA  1 
ATOM   2067 C C   . LYS B 1 107 ? 9.255   -12.362 36.417 1.00  31.50 ? 214  LYS B C   1 
ATOM   2068 O O   . LYS B 1 107 ? 8.545   -11.384 36.215 1.00  31.73 ? 214  LYS B O   1 
ATOM   2069 C CB  . LYS B 1 107 ? 7.685   -14.272 36.123 1.00  32.04 ? 214  LYS B CB  1 
ATOM   2070 C CG  . LYS B 1 107 ? 8.369   -14.996 34.951 1.00  32.48 ? 214  LYS B CG  1 
ATOM   2071 C CD  . LYS B 1 107 ? 7.697   -14.730 33.624 1.00  33.33 ? 214  LYS B CD  1 
ATOM   2072 C CE  . LYS B 1 107 ? 6.417   -15.538 33.474 1.00  34.47 ? 214  LYS B CE  1 
ATOM   2073 N NZ  . LYS B 1 107 ? 6.730   -16.938 33.052 1.00  35.98 ? 214  LYS B NZ  1 
ATOM   2074 N N   . ASN B 1 108 ? 10.540  -12.418 36.097 1.00  31.26 ? 215  ASN B N   1 
ATOM   2075 C CA  . ASN B 1 108 ? 11.291  -11.267 35.624 1.00  31.45 ? 215  ASN B CA  1 
ATOM   2076 C C   . ASN B 1 108 ? 11.205  -10.043 36.543 1.00  31.64 ? 215  ASN B C   1 
ATOM   2077 O O   . ASN B 1 108 ? 11.104  -8.904  36.077 1.00  31.99 ? 215  ASN B O   1 
ATOM   2078 C CB  . ASN B 1 108 ? 10.862  -10.896 34.187 1.00  31.65 ? 215  ASN B CB  1 
ATOM   2079 C CG  . ASN B 1 108 ? 10.909  -12.085 33.236 1.00  30.72 ? 215  ASN B CG  1 
ATOM   2080 O OD1 . ASN B 1 108 ? 11.882  -12.843 33.216 1.00  30.48 ? 215  ASN B OD1 1 
ATOM   2081 N ND2 . ASN B 1 108 ? 9.858   -12.251 32.448 1.00  29.41 ? 215  ASN B ND2 1 
ATOM   2082 N N   . GLY B 1 109 ? 11.250  -10.276 37.850 1.00  31.20 ? 216  GLY B N   1 
ATOM   2083 C CA  . GLY B 1 109 ? 11.351  -9.189  38.808 1.00  30.63 ? 216  GLY B CA  1 
ATOM   2084 C C   . GLY B 1 109 ? 10.033  -8.487  39.059 1.00  30.04 ? 216  GLY B C   1 
ATOM   2085 O O   . GLY B 1 109 ? 9.980   -7.507  39.803 1.00  30.28 ? 216  GLY B O   1 
ATOM   2086 N N   . LYS B 1 110 ? 8.968   -9.007  38.459 1.00  29.36 ? 217  LYS B N   1 
ATOM   2087 C CA  . LYS B 1 110 ? 7.648   -8.420  38.555 1.00  28.74 ? 217  LYS B CA  1 
ATOM   2088 C C   . LYS B 1 110 ? 6.671   -9.396  39.196 1.00  28.00 ? 217  LYS B C   1 
ATOM   2089 O O   . LYS B 1 110 ? 6.558   -10.528 38.758 1.00  27.11 ? 217  LYS B O   1 
ATOM   2090 C CB  . LYS B 1 110 ? 7.150   -8.046  37.161 1.00  28.84 ? 217  LYS B CB  1 
ATOM   2091 C CG  . LYS B 1 110 ? 5.948   -7.106  37.175 1.00  30.21 ? 217  LYS B CG  1 
ATOM   2092 C CD  . LYS B 1 110 ? 5.505   -6.674  35.773 1.00  32.57 ? 217  LYS B CD  1 
ATOM   2093 C CE  . LYS B 1 110 ? 5.336   -7.842  34.804 1.00  33.76 ? 217  LYS B CE  1 
ATOM   2094 N NZ  . LYS B 1 110 ? 4.477   -7.504  33.616 1.00  35.24 ? 217  LYS B NZ  1 
ATOM   2095 N N   . ILE B 1 111 ? 5.952   -8.922  40.217 1.00  27.62 ? 218  ILE B N   1 
ATOM   2096 C CA  . ILE B 1 111 ? 4.871   -9.664  40.867 1.00  26.92 ? 218  ILE B CA  1 
ATOM   2097 C C   . ILE B 1 111 ? 3.720   -9.843  39.904 1.00  27.12 ? 218  ILE B C   1 
ATOM   2098 O O   . ILE B 1 111 ? 3.209   -8.869  39.360 1.00  27.58 ? 218  ILE B O   1 
ATOM   2099 C CB  . ILE B 1 111 ? 4.350   -8.915  42.131 1.00  27.01 ? 218  ILE B CB  1 
ATOM   2100 C CG1 . ILE B 1 111 ? 5.474   -8.666  43.155 1.00  25.69 ? 218  ILE B CG1 1 
ATOM   2101 C CG2 . ILE B 1 111 ? 3.188   -9.694  42.780 1.00  26.83 ? 218  ILE B CG2 1 
ATOM   2102 C CD1 . ILE B 1 111 ? 5.266   -7.405  43.977 1.00  25.83 ? 218  ILE B CD1 1 
ATOM   2103 N N   . THR B 1 112 ? 3.307   -11.088 39.704 1.00  27.09 ? 219  THR B N   1 
ATOM   2104 C CA  . THR B 1 112 ? 2.239   -11.432 38.763 1.00  27.04 ? 219  THR B CA  1 
ATOM   2105 C C   . THR B 1 112 ? 1.033   -12.093 39.433 1.00  26.56 ? 219  THR B C   1 
ATOM   2106 O O   . THR B 1 112 ? -0.052  -12.090 38.874 1.00  26.43 ? 219  THR B O   1 
ATOM   2107 C CB  . THR B 1 112 ? 2.803   -12.360 37.671 1.00  27.20 ? 219  THR B CB  1 
ATOM   2108 O OG1 . THR B 1 112 ? 3.432   -13.507 38.273 1.00  28.42 ? 219  THR B OG1 1 
ATOM   2109 C CG2 . THR B 1 112 ? 3.935   -11.678 36.922 1.00  27.30 ? 219  THR B CG2 1 
ATOM   2110 N N   . SER B 1 113 ? 1.213   -12.675 40.616 1.00  26.22 ? 220  SER B N   1 
ATOM   2111 C CA  . SER B 1 113 ? 0.080   -13.279 41.332 1.00  26.27 ? 220  SER B CA  1 
ATOM   2112 C C   . SER B 1 113 ? 0.187   -13.109 42.854 1.00  25.71 ? 220  SER B C   1 
ATOM   2113 O O   . SER B 1 113 ? 1.284   -13.013 43.397 1.00  26.00 ? 220  SER B O   1 
ATOM   2114 C CB  . SER B 1 113 ? -0.061  -14.762 40.965 1.00  26.22 ? 220  SER B CB  1 
ATOM   2115 O OG  . SER B 1 113 ? -1.427  -15.107 40.797 1.00  27.34 ? 220  SER B OG  1 
ATOM   2116 N N   . ILE B 1 114 ? -0.958  -13.033 43.522 1.00  25.57 ? 221  ILE B N   1 
ATOM   2117 C CA  . ILE B 1 114 ? -1.002  -12.933 44.979 1.00  25.72 ? 221  ILE B CA  1 
ATOM   2118 C C   . ILE B 1 114 ? -1.726  -14.174 45.478 1.00  25.75 ? 221  ILE B C   1 
ATOM   2119 O O   . ILE B 1 114 ? -2.859  -14.445 45.097 1.00  25.43 ? 221  ILE B O   1 
ATOM   2120 C CB  . ILE B 1 114 ? -1.720  -11.644 45.457 1.00  25.60 ? 221  ILE B CB  1 
ATOM   2121 C CG1 . ILE B 1 114 ? -1.137  -10.385 44.801 1.00  25.60 ? 221  ILE B CG1 1 
ATOM   2122 C CG2 . ILE B 1 114 ? -1.645  -11.507 46.980 1.00  26.53 ? 221  ILE B CG2 1 
ATOM   2123 C CD1 . ILE B 1 114 ? 0.323   -10.189 44.985 1.00  25.01 ? 221  ILE B CD1 1 
ATOM   2124 N N   . VAL B 1 115 ? -1.069  -14.926 46.346 1.00  25.84 ? 222  VAL B N   1 
ATOM   2125 C CA  . VAL B 1 115 ? -1.601  -16.216 46.767 1.00  25.54 ? 222  VAL B CA  1 
ATOM   2126 C C   . VAL B 1 115 ? -2.639  -16.014 47.870 1.00  26.02 ? 222  VAL B C   1 
ATOM   2127 O O   . VAL B 1 115 ? -2.392  -15.322 48.859 1.00  26.86 ? 222  VAL B O   1 
ATOM   2128 C CB  . VAL B 1 115 ? -0.480  -17.166 47.215 1.00  25.07 ? 222  VAL B CB  1 
ATOM   2129 C CG1 . VAL B 1 115 ? -1.051  -18.559 47.577 1.00  25.09 ? 222  VAL B CG1 1 
ATOM   2130 C CG2 . VAL B 1 115 ? 0.565   -17.271 46.125 1.00  23.90 ? 222  VAL B CG2 1 
ATOM   2131 N N   . LYS B 1 116 ? -3.801  -16.623 47.664 1.00  26.17 ? 223  LYS B N   1 
ATOM   2132 C CA  . LYS B 1 116 ? -4.923  -16.588 48.590 1.00  26.57 ? 223  LYS B CA  1 
ATOM   2133 C C   . LYS B 1 116 ? -4.485  -16.962 50.009 1.00  25.84 ? 223  LYS B C   1 
ATOM   2134 O O   . LYS B 1 116 ? -3.649  -17.849 50.188 1.00  25.91 ? 223  LYS B O   1 
ATOM   2135 C CB  . LYS B 1 116 ? -6.015  -17.532 48.029 1.00  27.18 ? 223  LYS B CB  1 
ATOM   2136 C CG  . LYS B 1 116 ? -7.027  -18.132 48.987 1.00  29.78 ? 223  LYS B CG  1 
ATOM   2137 C CD  . LYS B 1 116 ? -8.071  -19.011 48.222 1.00  33.12 ? 223  LYS B CD  1 
ATOM   2138 C CE  . LYS B 1 116 ? -7.721  -20.530 48.227 1.00  34.93 ? 223  LYS B CE  1 
ATOM   2139 N NZ  . LYS B 1 116 ? -7.306  -21.044 46.877 1.00  36.58 ? 223  LYS B NZ  1 
ATOM   2140 N N   . ASP B 1 117 ? -5.017  -16.229 50.990 1.00  25.69 ? 224  ASP B N   1 
ATOM   2141 C CA  . ASP B 1 117 ? -4.834  -16.477 52.436 1.00  25.28 ? 224  ASP B CA  1 
ATOM   2142 C C   . ASP B 1 117 ? -3.407  -16.262 52.933 1.00  23.96 ? 224  ASP B C   1 
ATOM   2143 O O   . ASP B 1 117 ? -3.027  -16.828 53.954 1.00  23.53 ? 224  ASP B O   1 
ATOM   2144 C CB  . ASP B 1 117 ? -5.288  -17.903 52.842 1.00  25.66 ? 224  ASP B CB  1 
ATOM   2145 C CG  . ASP B 1 117 ? -6.769  -18.158 52.587 1.00  28.03 ? 224  ASP B CG  1 
ATOM   2146 O OD1 . ASP B 1 117 ? -7.616  -17.310 52.970 1.00  30.62 ? 224  ASP B OD1 1 
ATOM   2147 O OD2 . ASP B 1 117 ? -7.183  -19.201 52.014 1.00  31.79 ? 224  ASP B OD2 1 
ATOM   2148 N N   . SER B 1 118 ? -2.627  -15.437 52.241 1.00  22.40 ? 225  SER B N   1 
ATOM   2149 C CA  . SER B 1 118 ? -1.240  -15.192 52.639 1.00  21.83 ? 225  SER B CA  1 
ATOM   2150 C C   . SER B 1 118 ? -1.042  -13.782 53.172 1.00  20.59 ? 225  SER B C   1 
ATOM   2151 O O   . SER B 1 118 ? -1.930  -12.944 53.073 1.00  19.99 ? 225  SER B O   1 
ATOM   2152 C CB  . SER B 1 118 ? -0.322  -15.372 51.434 1.00  22.36 ? 225  SER B CB  1 
ATOM   2153 O OG  . SER B 1 118 ? -0.631  -14.379 50.451 1.00  23.43 ? 225  SER B OG  1 
ATOM   2154 N N   . SER B 1 119 ? 0.153   -13.522 53.696 1.00  19.51 ? 226  SER B N   1 
ATOM   2155 C CA  . SER B 1 119 ? 0.506   -12.213 54.246 1.00  19.31 ? 226  SER B CA  1 
ATOM   2156 C C   . SER B 1 119 ? 0.536   -11.128 53.162 1.00  19.46 ? 226  SER B C   1 
ATOM   2157 O O   . SER B 1 119 ? 0.270   -9.953  53.419 1.00  18.70 ? 226  SER B O   1 
ATOM   2158 C CB  . SER B 1 119 ? 1.847   -12.289 54.964 1.00  19.11 ? 226  SER B CB  1 
ATOM   2159 O OG  . SER B 1 119 ? 2.140   -11.078 55.600 1.00  19.24 ? 226  SER B OG  1 
ATOM   2160 N N   . ALA B 1 120 ? 0.825   -11.557 51.944 1.00  20.22 ? 227  ALA B N   1 
ATOM   2161 C CA  . ALA B 1 120 ? 0.828   -10.702 50.772 1.00  20.43 ? 227  ALA B CA  1 
ATOM   2162 C C   . ALA B 1 120 ? -0.581  -10.183 50.480 1.00  20.45 ? 227  ALA B C   1 
ATOM   2163 O O   . ALA B 1 120 ? -0.784  -8.993  50.347 1.00  20.31 ? 227  ALA B O   1 
ATOM   2164 C CB  . ALA B 1 120 ? 1.394   -11.477 49.585 1.00  20.45 ? 227  ALA B CB  1 
ATOM   2165 N N   . ALA B 1 121 ? -1.544  -11.096 50.401 1.00  21.09 ? 228  ALA B N   1 
ATOM   2166 C CA  . ALA B 1 121 ? -2.971  -10.772 50.312 1.00  20.83 ? 228  ALA B CA  1 
ATOM   2167 C C   . ALA B 1 121 ? -3.461  -9.918  51.479 1.00  21.26 ? 228  ALA B C   1 
ATOM   2168 O O   . ALA B 1 121 ? -4.299  -9.022  51.306 1.00  21.54 ? 228  ALA B O   1 
ATOM   2169 C CB  . ALA B 1 121 ? -3.775  -12.064 50.266 1.00  20.77 ? 228  ALA B CB  1 
ATOM   2170 N N   . ARG B 1 122 ? -2.954  -10.226 52.673 1.00  21.53 ? 229  ARG B N   1 
ATOM   2171 C CA  . ARG B 1 122 ? -3.344  -9.541  53.895 1.00  21.43 ? 229  ARG B CA  1 
ATOM   2172 C C   . ARG B 1 122 ? -2.927  -8.091  53.836 1.00  19.93 ? 229  ARG B C   1 
ATOM   2173 O O   . ARG B 1 122 ? -3.672  -7.201  54.256 1.00  20.09 ? 229  ARG B O   1 
ATOM   2174 C CB  . ARG B 1 122 ? -2.712  -10.221 55.121 1.00  22.65 ? 229  ARG B CB  1 
ATOM   2175 C CG  . ARG B 1 122 ? -3.569  -10.178 56.396 1.00  26.50 ? 229  ARG B CG  1 
ATOM   2176 C CD  . ARG B 1 122 ? -3.505  -11.466 57.255 1.00  30.18 ? 229  ARG B CD  1 
ATOM   2177 N NE  . ARG B 1 122 ? -2.123  -11.904 57.525 1.00  34.09 ? 229  ARG B NE  1 
ATOM   2178 C CZ  . ARG B 1 122 ? -1.592  -13.103 57.194 1.00  36.78 ? 229  ARG B CZ  1 
ATOM   2179 N NH1 . ARG B 1 122 ? -2.301  -14.052 56.576 1.00  37.41 ? 229  ARG B NH1 1 
ATOM   2180 N NH2 . ARG B 1 122 ? -0.322  -13.359 57.488 1.00  37.80 ? 229  ARG B NH2 1 
ATOM   2181 N N   . ASN B 1 123 ? -1.746  -7.846  53.297 1.00  18.26 ? 230  ASN B N   1 
ATOM   2182 C CA  . ASN B 1 123 ? -1.167  -6.506  53.288 1.00  17.87 ? 230  ASN B CA  1 
ATOM   2183 C C   . ASN B 1 123 ? -1.352  -5.765  51.948 1.00  17.41 ? 230  ASN B C   1 
ATOM   2184 O O   . ASN B 1 123 ? -0.876  -4.640  51.775 1.00  16.46 ? 230  ASN B O   1 
ATOM   2185 C CB  . ASN B 1 123 ? 0.309   -6.587  53.661 1.00  17.76 ? 230  ASN B CB  1 
ATOM   2186 C CG  . ASN B 1 123 ? 0.510   -6.917  55.130 1.00  18.66 ? 230  ASN B CG  1 
ATOM   2187 O OD1 . ASN B 1 123 ? 0.506   -6.007  55.957 1.00  20.46 ? 230  ASN B OD1 1 
ATOM   2188 N ND2 . ASN B 1 123 ? 0.692   -8.222  55.462 1.00  15.07 ? 230  ASN B ND2 1 
ATOM   2189 N N   . GLY B 1 124 ? -2.049  -6.405  51.020 1.00  17.36 ? 231  GLY B N   1 
ATOM   2190 C CA  . GLY B 1 124 ? -2.491  -5.760  49.798 1.00  17.53 ? 231  GLY B CA  1 
ATOM   2191 C C   . GLY B 1 124 ? -1.382  -5.548  48.817 1.00  17.56 ? 231  GLY B C   1 
ATOM   2192 O O   . GLY B 1 124 ? -1.333  -4.524  48.169 1.00  17.61 ? 231  GLY B O   1 
ATOM   2193 N N   . LEU B 1 125 ? -0.483  -6.516  48.715 1.00  17.99 ? 232  LEU B N   1 
ATOM   2194 C CA  . LEU B 1 125 ? 0.519   -6.496  47.671 1.00  18.32 ? 232  LEU B CA  1 
ATOM   2195 C C   . LEU B 1 125 ? -0.174  -6.436  46.305 1.00  18.44 ? 232  LEU B C   1 
ATOM   2196 O O   . LEU B 1 125 ? -1.214  -7.067  46.115 1.00  18.58 ? 232  LEU B O   1 
ATOM   2197 C CB  . LEU B 1 125 ? 1.432   -7.718  47.763 1.00  18.10 ? 232  LEU B CB  1 
ATOM   2198 C CG  . LEU B 1 125 ? 2.669   -7.604  46.865 1.00  17.70 ? 232  LEU B CG  1 
ATOM   2199 C CD1 . LEU B 1 125 ? 3.531   -6.440  47.284 1.00  17.10 ? 232  LEU B CD1 1 
ATOM   2200 C CD2 . LEU B 1 125 ? 3.451   -8.887  46.872 1.00  19.24 ? 232  LEU B CD2 1 
ATOM   2201 N N   . LEU B 1 126 ? 0.368   -5.632  45.392 1.00  18.84 ? 233  LEU B N   1 
ATOM   2202 C CA  . LEU B 1 126 ? -0.229  -5.473  44.060 1.00  19.64 ? 233  LEU B CA  1 
ATOM   2203 C C   . LEU B 1 126 ? 0.589   -6.185  43.018 1.00  20.31 ? 233  LEU B C   1 
ATOM   2204 O O   . LEU B 1 126 ? 1.789   -6.295  43.153 1.00  21.11 ? 233  LEU B O   1 
ATOM   2205 C CB  . LEU B 1 126 ? -0.357  -4.005  43.658 1.00  18.93 ? 233  LEU B CB  1 
ATOM   2206 C CG  . LEU B 1 126 ? -1.283  -3.210  44.572 1.00  18.27 ? 233  LEU B CG  1 
ATOM   2207 C CD1 . LEU B 1 126 ? -1.244  -1.717  44.199 1.00  17.47 ? 233  LEU B CD1 1 
ATOM   2208 C CD2 . LEU B 1 126 ? -2.685  -3.768  44.559 1.00  17.16 ? 233  LEU B CD2 1 
ATOM   2209 N N   . THR B 1 127 ? -0.077  -6.685  41.989 1.00  21.58 ? 234  THR B N   1 
ATOM   2210 C CA  . THR B 1 127 ? 0.623   -7.225  40.827 1.00  22.99 ? 234  THR B CA  1 
ATOM   2211 C C   . THR B 1 127 ? 1.077   -6.105  39.865 1.00  24.11 ? 234  THR B C   1 
ATOM   2212 O O   . THR B 1 127 ? 0.912   -4.895  40.144 1.00  23.69 ? 234  THR B O   1 
ATOM   2213 C CB  . THR B 1 127 ? -0.255  -8.255  40.110 1.00  22.68 ? 234  THR B CB  1 
ATOM   2214 O OG1 . THR B 1 127 ? -1.502  -7.663  39.719 1.00  21.80 ? 234  THR B OG1 1 
ATOM   2215 C CG2 . THR B 1 127 ? -0.619  -9.397  41.076 1.00  23.23 ? 234  THR B CG2 1 
ATOM   2216 N N   . GLU B 1 128 ? 1.667   -6.510  38.745 1.00  25.30 ? 235  GLU B N   1 
ATOM   2217 C CA  . GLU B 1 128 ? 2.187   -5.563  37.776 1.00  26.19 ? 235  GLU B CA  1 
ATOM   2218 C C   . GLU B 1 128 ? 3.069   -4.507  38.474 1.00  26.16 ? 235  GLU B C   1 
ATOM   2219 O O   . GLU B 1 128 ? 3.071   -3.328  38.112 1.00  25.58 ? 235  GLU B O   1 
ATOM   2220 C CB  . GLU B 1 128 ? 1.021   -4.911  37.025 1.00  26.99 ? 235  GLU B CB  1 
ATOM   2221 C CG  . GLU B 1 128 ? 0.472   -5.734  35.871 1.00  29.77 ? 235  GLU B CG  1 
ATOM   2222 C CD  . GLU B 1 128 ? -0.292  -6.960  36.320 1.00  34.05 ? 235  GLU B CD  1 
ATOM   2223 O OE1 . GLU B 1 128 ? -1.270  -6.803  37.085 1.00  36.13 ? 235  GLU B OE1 1 
ATOM   2224 O OE2 . GLU B 1 128 ? 0.082   -8.082  35.895 1.00  36.03 ? 235  GLU B OE2 1 
ATOM   2225 N N   . HIS B 1 129 ? 3.820   -4.950  39.480 1.00  25.54 ? 236  HIS B N   1 
ATOM   2226 C CA  . HIS B 1 129 ? 4.755   -4.093  40.177 1.00  25.09 ? 236  HIS B CA  1 
ATOM   2227 C C   . HIS B 1 129 ? 6.115   -4.755  40.160 1.00  26.01 ? 236  HIS B C   1 
ATOM   2228 O O   . HIS B 1 129 ? 6.223   -5.978  40.335 1.00  25.87 ? 236  HIS B O   1 
ATOM   2229 C CB  . HIS B 1 129 ? 4.292   -3.864  41.625 1.00  24.63 ? 236  HIS B CB  1 
ATOM   2230 C CG  . HIS B 1 129 ? 3.303   -2.747  41.774 1.00  22.10 ? 236  HIS B CG  1 
ATOM   2231 N ND1 . HIS B 1 129 ? 2.089   -2.735  41.122 1.00  19.23 ? 236  HIS B ND1 1 
ATOM   2232 C CD2 . HIS B 1 129 ? 3.354   -1.602  42.492 1.00  19.57 ? 236  HIS B CD2 1 
ATOM   2233 C CE1 . HIS B 1 129 ? 1.428   -1.642  41.446 1.00  18.53 ? 236  HIS B CE1 1 
ATOM   2234 N NE2 . HIS B 1 129 ? 2.172   -0.939  42.279 1.00  18.54 ? 236  HIS B NE2 1 
ATOM   2235 N N   . ASN B 1 130 ? 7.145   -3.941  39.949 1.00  27.10 ? 237  ASN B N   1 
ATOM   2236 C CA  . ASN B 1 130 ? 8.532   -4.375  40.013 1.00  28.03 ? 237  ASN B CA  1 
ATOM   2237 C C   . ASN B 1 130 ? 9.027   -4.380  41.435 1.00  28.62 ? 237  ASN B C   1 
ATOM   2238 O O   . ASN B 1 130 ? 8.685   -3.493  42.207 1.00  29.01 ? 237  ASN B O   1 
ATOM   2239 C CB  . ASN B 1 130 ? 9.423   -3.444  39.190 1.00  28.43 ? 237  ASN B CB  1 
ATOM   2240 C CG  . ASN B 1 130 ? 9.166   -3.566  37.694 1.00  30.12 ? 237  ASN B CG  1 
ATOM   2241 O OD1 . ASN B 1 130 ? 8.875   -4.646  37.196 1.00  32.03 ? 237  ASN B OD1 1 
ATOM   2242 N ND2 . ASN B 1 130 ? 9.249   -2.446  36.982 1.00  32.82 ? 237  ASN B ND2 1 
ATOM   2243 N N   . ILE B 1 131 ? 9.846   -5.382  41.760 1.00  29.16 ? 238  ILE B N   1 
ATOM   2244 C CA  . ILE B 1 131 ? 10.508  -5.494  43.046 1.00  29.57 ? 238  ILE B CA  1 
ATOM   2245 C C   . ILE B 1 131 ? 11.802  -4.712  42.955 1.00  29.71 ? 238  ILE B C   1 
ATOM   2246 O O   . ILE B 1 131 ? 12.608  -4.975  42.066 1.00  30.13 ? 238  ILE B O   1 
ATOM   2247 C CB  . ILE B 1 131 ? 10.797  -6.984  43.376 1.00  29.89 ? 238  ILE B CB  1 
ATOM   2248 C CG1 . ILE B 1 131 ? 9.492   -7.778  43.446 1.00  30.37 ? 238  ILE B CG1 1 
ATOM   2249 C CG2 . ILE B 1 131 ? 11.537  -7.120  44.702 1.00  30.77 ? 238  ILE B CG2 1 
ATOM   2250 C CD1 . ILE B 1 131 ? 9.655   -9.237  43.109 1.00  30.93 ? 238  ILE B CD1 1 
ATOM   2251 N N   . CYS B 1 132 ? 12.002  -3.768  43.873 1.00  29.56 ? 239  CYS B N   1 
ATOM   2252 C CA  . CYS B 1 132 ? 13.172  -2.910  43.874 1.00  29.84 ? 239  CYS B CA  1 
ATOM   2253 C C   . CYS B 1 132 ? 14.176  -3.284  44.931 1.00  30.14 ? 239  CYS B C   1 
ATOM   2254 O O   . CYS B 1 132 ? 15.371  -3.309  44.663 1.00  30.41 ? 239  CYS B O   1 
ATOM   2255 C CB  . CYS B 1 132 ? 12.775  -1.464  44.123 1.00  29.95 ? 239  CYS B CB  1 
ATOM   2256 S SG  . CYS B 1 132 ? 11.650  -0.841  42.888 1.00  30.69 ? 239  CYS B SG  1 
ATOM   2257 N N   . GLU B 1 133 ? 13.688  -3.510  46.142 1.00  30.25 ? 240  GLU B N   1 
ATOM   2258 C CA  . GLU B 1 133 ? 14.541  -3.782  47.289 1.00  30.55 ? 240  GLU B CA  1 
ATOM   2259 C C   . GLU B 1 133 ? 13.865  -4.810  48.190 1.00  30.17 ? 240  GLU B C   1 
ATOM   2260 O O   . GLU B 1 133 ? 12.656  -4.837  48.285 1.00  30.01 ? 240  GLU B O   1 
ATOM   2261 C CB  . GLU B 1 133 ? 14.811  -2.489  48.071 1.00  31.18 ? 240  GLU B CB  1 
ATOM   2262 C CG  . GLU B 1 133 ? 16.080  -1.741  47.668 1.00  32.59 ? 240  GLU B CG  1 
ATOM   2263 C CD  . GLU B 1 133 ? 15.870  -0.254  47.403 1.00  34.19 ? 240  GLU B CD  1 
ATOM   2264 O OE1 . GLU B 1 133 ? 15.231  0.432   48.240 1.00  34.83 ? 240  GLU B OE1 1 
ATOM   2265 O OE2 . GLU B 1 133 ? 16.369  0.232   46.345 1.00  36.81 ? 240  GLU B OE2 1 
ATOM   2266 N N   . ILE B 1 134 ? 14.651  -5.675  48.809 1.00  30.15 ? 241  ILE B N   1 
ATOM   2267 C CA  . ILE B 1 134 ? 14.171  -6.565  49.860 1.00  30.52 ? 241  ILE B CA  1 
ATOM   2268 C C   . ILE B 1 134 ? 15.005  -6.307  51.105 1.00  31.00 ? 241  ILE B C   1 
ATOM   2269 O O   . ILE B 1 134 ? 16.201  -6.562  51.094 1.00  30.96 ? 241  ILE B O   1 
ATOM   2270 C CB  . ILE B 1 134 ? 14.325  -8.012  49.434 1.00  30.44 ? 241  ILE B CB  1 
ATOM   2271 C CG1 . ILE B 1 134 ? 13.586  -8.248  48.119 1.00  29.68 ? 241  ILE B CG1 1 
ATOM   2272 C CG2 . ILE B 1 134 ? 13.803  -8.945  50.531 1.00  30.48 ? 241  ILE B CG2 1 
ATOM   2273 C CD1 . ILE B 1 134 ? 13.968  -9.499  47.444 1.00  29.72 ? 241  ILE B CD1 1 
ATOM   2274 N N   . ASN B 1 135 ? 14.375  -5.800  52.165 1.00  31.68 ? 242  ASN B N   1 
ATOM   2275 C CA  . ASN B 1 135 ? 15.073  -5.428  53.401 1.00  32.20 ? 242  ASN B CA  1 
ATOM   2276 C C   . ASN B 1 135 ? 16.255  -4.502  53.089 1.00  33.57 ? 242  ASN B C   1 
ATOM   2277 O O   . ASN B 1 135 ? 17.417  -4.787  53.428 1.00  33.42 ? 242  ASN B O   1 
ATOM   2278 C CB  . ASN B 1 135 ? 15.529  -6.671  54.178 1.00  32.06 ? 242  ASN B CB  1 
ATOM   2279 C CG  . ASN B 1 135 ? 14.362  -7.471  54.760 1.00  31.99 ? 242  ASN B CG  1 
ATOM   2280 O OD1 . ASN B 1 135 ? 13.203  -7.220  54.444 1.00  30.01 ? 242  ASN B OD1 1 
ATOM   2281 N ND2 . ASN B 1 135 ? 14.676  -8.443  55.621 1.00  31.41 ? 242  ASN B ND2 1 
ATOM   2282 N N   . GLY B 1 136 ? 15.940  -3.407  52.393 1.00  34.52 ? 243  GLY B N   1 
ATOM   2283 C CA  . GLY B 1 136 ? 16.911  -2.384  52.055 1.00  35.22 ? 243  GLY B CA  1 
ATOM   2284 C C   . GLY B 1 136 ? 17.971  -2.764  51.037 1.00  35.68 ? 243  GLY B C   1 
ATOM   2285 O O   . GLY B 1 136 ? 18.912  -2.002  50.832 1.00  36.43 ? 243  GLY B O   1 
ATOM   2286 N N   . GLN B 1 137 ? 17.824  -3.913  50.386 1.00  36.48 ? 244  GLN B N   1 
ATOM   2287 C CA  . GLN B 1 137 ? 18.842  -4.435  49.472 1.00  36.90 ? 244  GLN B CA  1 
ATOM   2288 C C   . GLN B 1 137 ? 18.374  -4.433  48.011 1.00  36.93 ? 244  GLN B C   1 
ATOM   2289 O O   . GLN B 1 137 ? 17.425  -5.138  47.661 1.00  36.97 ? 244  GLN B O   1 
ATOM   2290 C CB  . GLN B 1 137 ? 19.205  -5.866  49.877 1.00  37.15 ? 244  GLN B CB  1 
ATOM   2291 C CG  . GLN B 1 137 ? 20.440  -6.403  49.163 1.00  39.09 ? 244  GLN B CG  1 
ATOM   2292 C CD  . GLN B 1 137 ? 20.778  -7.836  49.529 1.00  41.33 ? 244  GLN B CD  1 
ATOM   2293 O OE1 . GLN B 1 137 ? 20.427  -8.320  50.615 1.00  44.97 ? 244  GLN B OE1 1 
ATOM   2294 N NE2 . GLN B 1 137 ? 21.474  -8.520  48.628 1.00  43.06 ? 244  GLN B NE2 1 
ATOM   2295 N N   . ASN B 1 138 ? 19.065  -3.678  47.155 1.00  36.90 ? 245  ASN B N   1 
ATOM   2296 C CA  . ASN B 1 138 ? 18.745  -3.630  45.723 1.00  36.95 ? 245  ASN B CA  1 
ATOM   2297 C C   . ASN B 1 138 ? 18.690  -5.019  45.075 1.00  36.53 ? 245  ASN B C   1 
ATOM   2298 O O   . ASN B 1 138 ? 19.587  -5.831  45.257 1.00  36.87 ? 245  ASN B O   1 
ATOM   2299 C CB  . ASN B 1 138 ? 19.764  -2.742  44.993 1.00  37.06 ? 245  ASN B CB  1 
ATOM   2300 C CG  . ASN B 1 138 ? 19.453  -2.561  43.496 1.00  37.08 ? 245  ASN B CG  1 
ATOM   2301 O OD1 . ASN B 1 138 ? 18.353  -2.847  43.019 1.00  35.17 ? 245  ASN B OD1 1 
ATOM   2302 N ND2 . ASN B 1 138 ? 20.443  -2.079  42.756 1.00  38.61 ? 245  ASN B ND2 1 
ATOM   2303 N N   . VAL B 1 139 ? 17.620  -5.290  44.335 1.00  36.23 ? 246  VAL B N   1 
ATOM   2304 C CA  . VAL B 1 139 ? 17.488  -6.541  43.583 1.00  35.78 ? 246  VAL B CA  1 
ATOM   2305 C C   . VAL B 1 139 ? 17.104  -6.318  42.119 1.00  35.61 ? 246  VAL B C   1 
ATOM   2306 O O   . VAL B 1 139 ? 16.768  -7.272  41.408 1.00  35.49 ? 246  VAL B O   1 
ATOM   2307 C CB  . VAL B 1 139 ? 16.459  -7.496  44.237 1.00  35.68 ? 246  VAL B CB  1 
ATOM   2308 C CG1 . VAL B 1 139 ? 16.828  -7.804  45.681 1.00  34.92 ? 246  VAL B CG1 1 
ATOM   2309 C CG2 . VAL B 1 139 ? 15.049  -6.939  44.132 1.00  35.62 ? 246  VAL B CG2 1 
ATOM   2310 N N   . ILE B 1 140 ? 17.131  -5.063  41.671 1.00  35.59 ? 247  ILE B N   1 
ATOM   2311 C CA  . ILE B 1 140 ? 16.806  -4.743  40.285 1.00  35.80 ? 247  ILE B CA  1 
ATOM   2312 C C   . ILE B 1 140 ? 17.895  -5.292  39.395 1.00  35.75 ? 247  ILE B C   1 
ATOM   2313 O O   . ILE B 1 140 ? 19.065  -4.952  39.573 1.00  35.30 ? 247  ILE B O   1 
ATOM   2314 C CB  . ILE B 1 140 ? 16.701  -3.205  40.055 1.00  35.96 ? 247  ILE B CB  1 
ATOM   2315 C CG1 . ILE B 1 140 ? 15.513  -2.615  40.830 1.00  36.06 ? 247  ILE B CG1 1 
ATOM   2316 C CG2 . ILE B 1 140 ? 16.563  -2.891  38.552 1.00  35.86 ? 247  ILE B CG2 1 
ATOM   2317 C CD1 . ILE B 1 140 ? 14.152  -2.968  40.241 1.00  34.73 ? 247  ILE B CD1 1 
ATOM   2318 N N   . GLY B 1 141 ? 17.503  -6.139  38.447 1.00  36.19 ? 248  GLY B N   1 
ATOM   2319 C CA  . GLY B 1 141 ? 18.433  -6.685  37.466 1.00  36.67 ? 248  GLY B CA  1 
ATOM   2320 C C   . GLY B 1 141 ? 18.973  -8.059  37.816 1.00  36.65 ? 248  GLY B C   1 
ATOM   2321 O O   . GLY B 1 141 ? 19.472  -8.768  36.933 1.00  37.47 ? 248  GLY B O   1 
ATOM   2322 N N   . LEU B 1 142 ? 18.894  -8.436  39.092 1.00  36.30 ? 249  LEU B N   1 
ATOM   2323 C CA  . LEU B 1 142 ? 19.191  -9.808  39.496 1.00  36.10 ? 249  LEU B CA  1 
ATOM   2324 C C   . LEU B 1 142 ? 18.238  -10.784 38.797 1.00  35.83 ? 249  LEU B C   1 
ATOM   2325 O O   . LEU B 1 142 ? 17.096  -10.450 38.480 1.00  35.61 ? 249  LEU B O   1 
ATOM   2326 C CB  . LEU B 1 142 ? 19.064  -9.989  41.012 1.00  36.03 ? 249  LEU B CB  1 
ATOM   2327 C CG  . LEU B 1 142 ? 19.894  -9.145  41.982 1.00  35.64 ? 249  LEU B CG  1 
ATOM   2328 C CD1 . LEU B 1 142 ? 19.711  -9.706  43.381 1.00  35.73 ? 249  LEU B CD1 1 
ATOM   2329 C CD2 . LEU B 1 142 ? 21.370  -9.110  41.647 1.00  35.53 ? 249  LEU B CD2 1 
ATOM   2330 N N   . LYS B 1 143 ? 18.718  -11.993 38.551 1.00  35.63 ? 250  LYS B N   1 
ATOM   2331 C CA  . LYS B 1 143 ? 17.854  -13.057 38.057 1.00  35.77 ? 250  LYS B CA  1 
ATOM   2332 C C   . LYS B 1 143 ? 16.839  -13.404 39.132 1.00  34.97 ? 250  LYS B C   1 
ATOM   2333 O O   . LYS B 1 143 ? 17.102  -13.227 40.318 1.00  34.77 ? 250  LYS B O   1 
ATOM   2334 C CB  . LYS B 1 143 ? 18.662  -14.307 37.672 1.00  36.05 ? 250  LYS B CB  1 
ATOM   2335 C CG  . LYS B 1 143 ? 19.246  -14.262 36.267 1.00  37.79 ? 250  LYS B CG  1 
ATOM   2336 C CD  . LYS B 1 143 ? 20.492  -13.361 36.193 1.00  40.31 ? 250  LYS B CD  1 
ATOM   2337 C CE  . LYS B 1 143 ? 20.191  -11.966 35.640 1.00  41.12 ? 250  LYS B CE  1 
ATOM   2338 N NZ  . LYS B 1 143 ? 21.367  -11.058 35.805 1.00  41.53 ? 250  LYS B NZ  1 
ATOM   2339 N N   . ASP B 1 144 ? 15.690  -13.914 38.705 1.00  34.65 ? 251  ASP B N   1 
ATOM   2340 C CA  . ASP B 1 144 ? 14.623  -14.268 39.616 1.00  34.40 ? 251  ASP B CA  1 
ATOM   2341 C C   . ASP B 1 144 ? 15.089  -15.231 40.722 1.00  35.14 ? 251  ASP B C   1 
ATOM   2342 O O   . ASP B 1 144 ? 14.706  -15.086 41.873 1.00  35.01 ? 251  ASP B O   1 
ATOM   2343 C CB  . ASP B 1 144 ? 13.474  -14.899 38.845 1.00  33.95 ? 251  ASP B CB  1 
ATOM   2344 C CG  . ASP B 1 144 ? 12.751  -13.921 37.949 1.00  32.48 ? 251  ASP B CG  1 
ATOM   2345 O OD1 . ASP B 1 144 ? 12.941  -12.691 38.061 1.00  28.68 ? 251  ASP B OD1 1 
ATOM   2346 O OD2 . ASP B 1 144 ? 11.957  -14.318 37.078 1.00  31.25 ? 251  ASP B OD2 1 
ATOM   2347 N N   . SER B 1 145 ? 15.924  -16.202 40.363 1.00  35.78 ? 252  SER B N   1 
ATOM   2348 C CA  . SER B 1 145 ? 16.383  -17.221 41.313 1.00  36.10 ? 252  SER B CA  1 
ATOM   2349 C C   . SER B 1 145 ? 17.195  -16.609 42.453 1.00  36.17 ? 252  SER B C   1 
ATOM   2350 O O   . SER B 1 145 ? 17.129  -17.080 43.575 1.00  36.52 ? 252  SER B O   1 
ATOM   2351 C CB  . SER B 1 145 ? 17.190  -18.316 40.585 1.00  36.21 ? 252  SER B CB  1 
ATOM   2352 O OG  . SER B 1 145 ? 18.550  -17.941 40.417 1.00  36.14 ? 252  SER B OG  1 
ATOM   2353 N N   . GLN B 1 146 ? 17.952  -15.557 42.153 1.00  36.61 ? 253  GLN B N   1 
ATOM   2354 C CA  . GLN B 1 146 ? 18.694  -14.798 43.153 1.00  36.69 ? 253  GLN B CA  1 
ATOM   2355 C C   . GLN B 1 146 ? 17.792  -13.969 44.068 1.00  36.83 ? 253  GLN B C   1 
ATOM   2356 O O   . GLN B 1 146 ? 18.113  -13.748 45.241 1.00  36.96 ? 253  GLN B O   1 
ATOM   2357 C CB  . GLN B 1 146 ? 19.673  -13.850 42.467 1.00  37.08 ? 253  GLN B CB  1 
ATOM   2358 C CG  . GLN B 1 146 ? 20.740  -14.522 41.599 1.00  38.43 ? 253  GLN B CG  1 
ATOM   2359 C CD  . GLN B 1 146 ? 21.578  -13.506 40.847 1.00  38.86 ? 253  GLN B CD  1 
ATOM   2360 O OE1 . GLN B 1 146 ? 21.112  -12.927 39.877 1.00  40.02 ? 253  GLN B OE1 1 
ATOM   2361 N NE2 . GLN B 1 146 ? 22.803  -13.278 41.303 1.00  38.78 ? 253  GLN B NE2 1 
ATOM   2362 N N   . ILE B 1 147 ? 16.693  -13.463 43.519 1.00  37.15 ? 254  ILE B N   1 
ATOM   2363 C CA  . ILE B 1 147 ? 15.710  -12.729 44.311 1.00  37.21 ? 254  ILE B CA  1 
ATOM   2364 C C   . ILE B 1 147 ? 15.023  -13.690 45.276 1.00  37.13 ? 254  ILE B C   1 
ATOM   2365 O O   . ILE B 1 147 ? 14.875  -13.387 46.447 1.00  36.65 ? 254  ILE B O   1 
ATOM   2366 C CB  . ILE B 1 147 ? 14.693  -11.988 43.396 1.00  37.07 ? 254  ILE B CB  1 
ATOM   2367 C CG1 . ILE B 1 147 ? 15.360  -10.749 42.764 1.00  36.79 ? 254  ILE B CG1 1 
ATOM   2368 C CG2 . ILE B 1 147 ? 13.472  -11.561 44.189 1.00  36.82 ? 254  ILE B CG2 1 
ATOM   2369 C CD1 . ILE B 1 147 ? 14.853  -10.396 41.382 1.00  35.83 ? 254  ILE B CD1 1 
ATOM   2370 N N   . ALA B 1 148 ? 14.643  -14.864 44.786 1.00  37.67 ? 255  ALA B N   1 
ATOM   2371 C CA  . ALA B 1 148 ? 14.037  -15.883 45.637 1.00  38.14 ? 255  ALA B CA  1 
ATOM   2372 C C   . ALA B 1 148 ? 14.976  -16.341 46.757 1.00  38.49 ? 255  ALA B C   1 
ATOM   2373 O O   . ALA B 1 148 ? 14.505  -16.685 47.839 1.00  38.57 ? 255  ALA B O   1 
ATOM   2374 C CB  . ALA B 1 148 ? 13.551  -17.082 44.798 1.00  38.20 ? 255  ALA B CB  1 
ATOM   2375 N N   . ASP B 1 149 ? 16.291  -16.320 46.523 1.00  39.25 ? 256  ASP B N   1 
ATOM   2376 C CA  . ASP B 1 149 ? 17.251  -16.749 47.551 1.00  39.75 ? 256  ASP B CA  1 
ATOM   2377 C C   . ASP B 1 149 ? 17.508  -15.676 48.600 1.00  39.25 ? 256  ASP B C   1 
ATOM   2378 O O   . ASP B 1 149 ? 17.837  -16.008 49.733 1.00  39.68 ? 256  ASP B O   1 
ATOM   2379 C CB  . ASP B 1 149 ? 18.600  -17.195 46.968 1.00  40.43 ? 256  ASP B CB  1 
ATOM   2380 C CG  . ASP B 1 149 ? 18.478  -18.306 45.929 1.00  42.69 ? 256  ASP B CG  1 
ATOM   2381 O OD1 . ASP B 1 149 ? 17.445  -19.023 45.896 1.00  45.27 ? 256  ASP B OD1 1 
ATOM   2382 O OD2 . ASP B 1 149 ? 19.395  -18.532 45.098 1.00  45.53 ? 256  ASP B OD2 1 
ATOM   2383 N N   . ILE B 1 150 ? 17.390  -14.400 48.235 1.00  38.67 ? 257  ILE B N   1 
ATOM   2384 C CA  . ILE B 1 150 ? 17.519  -13.310 49.213 1.00  38.03 ? 257  ILE B CA  1 
ATOM   2385 C C   . ILE B 1 150 ? 16.325  -13.329 50.156 1.00  37.65 ? 257  ILE B C   1 
ATOM   2386 O O   . ILE B 1 150 ? 16.475  -13.153 51.369 1.00  37.16 ? 257  ILE B O   1 
ATOM   2387 C CB  . ILE B 1 150 ? 17.604  -11.926 48.521 1.00  38.15 ? 257  ILE B CB  1 
ATOM   2388 C CG1 . ILE B 1 150 ? 18.890  -11.798 47.694 1.00  37.72 ? 257  ILE B CG1 1 
ATOM   2389 C CG2 . ILE B 1 150 ? 17.539  -10.803 49.559 1.00  37.74 ? 257  ILE B CG2 1 
ATOM   2390 C CD1 . ILE B 1 150 ? 18.764  -10.854 46.520 1.00  37.83 ? 257  ILE B CD1 1 
ATOM   2391 N N   . LEU B 1 151 ? 15.145  -13.514 49.572 1.00  37.53 ? 258  LEU B N   1 
ATOM   2392 C CA  . LEU B 1 151 ? 13.893  -13.675 50.315 1.00  37.94 ? 258  LEU B CA  1 
ATOM   2393 C C   . LEU B 1 151 ? 13.920  -14.870 51.274 1.00  37.92 ? 258  LEU B C   1 
ATOM   2394 O O   . LEU B 1 151 ? 13.288  -14.840 52.328 1.00  38.03 ? 258  LEU B O   1 
ATOM   2395 C CB  . LEU B 1 151 ? 12.720  -13.840 49.345 1.00  38.07 ? 258  LEU B CB  1 
ATOM   2396 C CG  . LEU B 1 151 ? 12.202  -12.506 48.799 1.00  38.76 ? 258  LEU B CG  1 
ATOM   2397 C CD1 . LEU B 1 151 ? 11.518  -12.659 47.446 1.00  38.49 ? 258  LEU B CD1 1 
ATOM   2398 C CD2 . LEU B 1 151 ? 11.269  -11.862 49.790 1.00  38.93 ? 258  LEU B CD2 1 
ATOM   2399 N N   . SER B 1 152 ? 14.641  -15.919 50.886 1.00  37.78 ? 259  SER B N   1 
ATOM   2400 C CA  . SER B 1 152 ? 14.790  -17.110 51.708 1.00  37.56 ? 259  SER B CA  1 
ATOM   2401 C C   . SER B 1 152 ? 15.637  -16.801 52.938 1.00  37.32 ? 259  SER B C   1 
ATOM   2402 O O   . SER B 1 152 ? 15.381  -17.342 54.002 1.00  37.08 ? 259  SER B O   1 
ATOM   2403 C CB  . SER B 1 152 ? 15.433  -18.250 50.912 1.00  37.43 ? 259  SER B CB  1 
ATOM   2404 O OG  . SER B 1 152 ? 16.838  -18.266 51.133 1.00  37.52 ? 259  SER B OG  1 
ATOM   2405 N N   . THR B 1 153 ? 16.638  -15.934 52.791 1.00  37.11 ? 260  THR B N   1 
ATOM   2406 C CA  . THR B 1 153 ? 17.537  -15.614 53.905 1.00  37.17 ? 260  THR B CA  1 
ATOM   2407 C C   . THR B 1 153 ? 17.274  -14.264 54.563 1.00  36.81 ? 260  THR B C   1 
ATOM   2408 O O   . THR B 1 153 ? 18.108  -13.777 55.318 1.00  37.21 ? 260  THR B O   1 
ATOM   2409 C CB  . THR B 1 153 ? 19.024  -15.726 53.471 1.00  37.20 ? 260  THR B CB  1 
ATOM   2410 O OG1 . THR B 1 153 ? 19.343  -14.729 52.489 1.00  37.90 ? 260  THR B OG1 1 
ATOM   2411 C CG2 . THR B 1 153 ? 19.267  -17.046 52.759 1.00  36.87 ? 260  THR B CG2 1 
ATOM   2412 N N   . SER B 1 154 ? 16.116  -13.663 54.301 1.00  36.33 ? 261  SER B N   1 
ATOM   2413 C CA  . SER B 1 154 ? 15.670  -12.525 55.091 1.00  36.09 ? 261  SER B CA  1 
ATOM   2414 C C   . SER B 1 154 ? 15.106  -13.145 56.377 1.00  36.30 ? 261  SER B C   1 
ATOM   2415 O O   . SER B 1 154 ? 15.355  -14.321 56.664 1.00  37.13 ? 261  SER B O   1 
ATOM   2416 C CB  . SER B 1 154 ? 14.629  -11.701 54.321 1.00  36.48 ? 261  SER B CB  1 
ATOM   2417 O OG  . SER B 1 154 ? 15.101  -11.348 53.023 1.00  34.66 ? 261  SER B OG  1 
ATOM   2418 N N   . GLY B 1 155 ? 14.363  -12.401 57.177 1.00  35.74 ? 262  GLY B N   1 
ATOM   2419 C CA  . GLY B 1 155 ? 13.823  -13.010 58.389 1.00  34.85 ? 262  GLY B CA  1 
ATOM   2420 C C   . GLY B 1 155 ? 12.494  -13.670 58.129 1.00  33.87 ? 262  GLY B C   1 
ATOM   2421 O O   . GLY B 1 155 ? 12.183  -14.059 56.999 1.00  33.76 ? 262  GLY B O   1 
ATOM   2422 N N   . THR B 1 156 ? 11.710  -13.788 59.194 1.00  32.80 ? 263  THR B N   1 
ATOM   2423 C CA  . THR B 1 156 ? 10.275  -14.022 59.099 1.00  32.21 ? 263  THR B CA  1 
ATOM   2424 C C   . THR B 1 156 ? 9.564   -12.760 58.631 1.00  31.71 ? 263  THR B C   1 
ATOM   2425 O O   . THR B 1 156 ? 8.435   -12.838 58.136 1.00  32.17 ? 263  THR B O   1 
ATOM   2426 C CB  . THR B 1 156 ? 9.665   -14.377 60.480 1.00  32.10 ? 263  THR B CB  1 
ATOM   2427 O OG1 . THR B 1 156 ? 9.915   -13.309 61.406 1.00  32.03 ? 263  THR B OG1 1 
ATOM   2428 C CG2 . THR B 1 156 ? 10.333  -15.575 61.105 1.00  32.01 ? 263  THR B CG2 1 
ATOM   2429 N N   . VAL B 1 157 ? 10.194  -11.604 58.829 1.00  30.84 ? 264  VAL B N   1 
ATOM   2430 C CA  . VAL B 1 157 ? 9.576   -10.325 58.495 1.00  30.89 ? 264  VAL B CA  1 
ATOM   2431 C C   . VAL B 1 157 ? 10.251  -9.696  57.282 1.00  30.45 ? 264  VAL B C   1 
ATOM   2432 O O   . VAL B 1 157 ? 11.401  -9.281  57.341 1.00  30.55 ? 264  VAL B O   1 
ATOM   2433 C CB  . VAL B 1 157 ? 9.599   -9.345  59.684 1.00  30.81 ? 264  VAL B CB  1 
ATOM   2434 C CG1 . VAL B 1 157 ? 8.694   -8.156  59.394 1.00  30.94 ? 264  VAL B CG1 1 
ATOM   2435 C CG2 . VAL B 1 157 ? 9.155   -10.056 60.968 1.00  30.56 ? 264  VAL B CG2 1 
ATOM   2436 N N   . VAL B 1 158 ? 9.509   -9.629  56.184 1.00  30.39 ? 265  VAL B N   1 
ATOM   2437 C CA  . VAL B 1 158 ? 10.035  -9.192  54.899 1.00  30.29 ? 265  VAL B CA  1 
ATOM   2438 C C   . VAL B 1 158 ? 9.391   -7.883  54.453 1.00  29.99 ? 265  VAL B C   1 
ATOM   2439 O O   . VAL B 1 158 ? 8.219   -7.826  54.127 1.00  29.84 ? 265  VAL B O   1 
ATOM   2440 C CB  . VAL B 1 158 ? 9.804   -10.267 53.838 1.00  30.36 ? 265  VAL B CB  1 
ATOM   2441 C CG1 . VAL B 1 158 ? 10.076  -9.724  52.420 1.00  30.99 ? 265  VAL B CG1 1 
ATOM   2442 C CG2 . VAL B 1 158 ? 10.670  -11.475 54.126 1.00  29.93 ? 265  VAL B CG2 1 
ATOM   2443 N N   . THR B 1 159 ? 10.192  -6.838  54.432 1.00  30.30 ? 266  THR B N   1 
ATOM   2444 C CA  . THR B 1 159 ? 9.796   -5.543  53.904 1.00  30.23 ? 266  THR B CA  1 
ATOM   2445 C C   . THR B 1 159 ? 10.283  -5.417  52.474 1.00  30.09 ? 266  THR B C   1 
ATOM   2446 O O   . THR B 1 159 ? 11.478  -5.367  52.253 1.00  29.72 ? 266  THR B O   1 
ATOM   2447 C CB  . THR B 1 159 ? 10.443  -4.460  54.772 1.00  30.38 ? 266  THR B CB  1 
ATOM   2448 O OG1 . THR B 1 159 ? 9.821   -4.457  56.069 1.00  31.18 ? 266  THR B OG1 1 
ATOM   2449 C CG2 . THR B 1 159 ? 10.175  -3.073  54.228 1.00  30.76 ? 266  THR B CG2 1 
ATOM   2450 N N   . ILE B 1 160 ? 9.372   -5.372  51.501 1.00  29.97 ? 267  ILE B N   1 
ATOM   2451 C CA  . ILE B 1 160 ? 9.778   -5.130  50.120 1.00  29.92 ? 267  ILE B CA  1 
ATOM   2452 C C   . ILE B 1 160 ? 9.411   -3.725  49.613 1.00  29.57 ? 267  ILE B C   1 
ATOM   2453 O O   . ILE B 1 160 ? 8.455   -3.098  50.057 1.00  29.67 ? 267  ILE B O   1 
ATOM   2454 C CB  . ILE B 1 160 ? 9.281   -6.262  49.168 1.00  30.18 ? 267  ILE B CB  1 
ATOM   2455 C CG1 . ILE B 1 160 ? 7.787   -6.196  48.897 1.00  30.82 ? 267  ILE B CG1 1 
ATOM   2456 C CG2 . ILE B 1 160 ? 9.602   -7.625  49.749 1.00  30.86 ? 267  ILE B CG2 1 
ATOM   2457 C CD1 . ILE B 1 160 ? 7.384   -7.105  47.760 1.00  31.24 ? 267  ILE B CD1 1 
ATOM   2458 N N   . THR B 1 161 ? 10.232  -3.228  48.707 1.00  28.86 ? 268  THR B N   1 
ATOM   2459 C CA  . THR B 1 161 ? 9.994   -1.965  48.039 1.00  28.54 ? 268  THR B CA  1 
ATOM   2460 C C   . THR B 1 161 ? 9.576   -2.303  46.620 1.00  27.90 ? 268  THR B C   1 
ATOM   2461 O O   . THR B 1 161 ? 10.188  -3.135  45.947 1.00  27.74 ? 268  THR B O   1 
ATOM   2462 C CB  . THR B 1 161 ? 11.251  -1.107  48.033 1.00  28.34 ? 268  THR B CB  1 
ATOM   2463 O OG1 . THR B 1 161 ? 11.716  -0.916  49.382 1.00  29.92 ? 268  THR B OG1 1 
ATOM   2464 C CG2 . THR B 1 161 ? 10.939  0.271   47.571 1.00  28.35 ? 268  THR B CG2 1 
ATOM   2465 N N   . ILE B 1 162 ? 8.503   -1.679  46.182 1.00  27.09 ? 269  ILE B N   1 
ATOM   2466 C CA  . ILE B 1 162 ? 7.921   -2.013  44.908 1.00  27.00 ? 269  ILE B CA  1 
ATOM   2467 C C   . ILE B 1 162 ? 7.557   -0.725  44.179 1.00  26.84 ? 269  ILE B C   1 
ATOM   2468 O O   . ILE B 1 162 ? 7.545   0.330   44.766 1.00  25.81 ? 269  ILE B O   1 
ATOM   2469 C CB  . ILE B 1 162 ? 6.698   -2.915  45.137 1.00  26.86 ? 269  ILE B CB  1 
ATOM   2470 C CG1 . ILE B 1 162 ? 5.616   -2.182  45.916 1.00  26.70 ? 269  ILE B CG1 1 
ATOM   2471 C CG2 . ILE B 1 162 ? 7.106   -4.199  45.901 1.00  26.03 ? 269  ILE B CG2 1 
ATOM   2472 C CD1 . ILE B 1 162 ? 4.248   -2.741  45.671 1.00  28.38 ? 269  ILE B CD1 1 
ATOM   2473 N N   . MET B 1 163 ? 7.302   -0.815  42.891 1.00  27.34 ? 270  MET B N   1 
ATOM   2474 C CA  . MET B 1 163 ? 6.699   0.301   42.178 1.00  28.09 ? 270  MET B CA  1 
ATOM   2475 C C   . MET B 1 163 ? 6.045   -0.173  40.906 1.00  27.50 ? 270  MET B C   1 
ATOM   2476 O O   . MET B 1 163 ? 6.464   -1.160  40.321 1.00  27.38 ? 270  MET B O   1 
ATOM   2477 C CB  . MET B 1 163 ? 7.716   1.408   41.876 1.00  28.79 ? 270  MET B CB  1 
ATOM   2478 C CG  . MET B 1 163 ? 9.017   0.942   41.315 1.00  30.50 ? 270  MET B CG  1 
ATOM   2479 S SD  . MET B 1 163 ? 10.159  2.305   41.029 1.00  34.31 ? 270  MET B SD  1 
ATOM   2480 C CE  . MET B 1 163 ? 9.305   3.179   39.692 1.00  32.80 ? 270  MET B CE  1 
ATOM   2481 N N   . PRO B 1 164 ? 4.997   0.524   40.485 1.00  27.65 ? 271  PRO B N   1 
ATOM   2482 C CA  . PRO B 1 164 ? 4.238   0.098   39.314 1.00  27.35 ? 271  PRO B CA  1 
ATOM   2483 C C   . PRO B 1 164 ? 5.155   -0.073  38.121 1.00  27.58 ? 271  PRO B C   1 
ATOM   2484 O O   . PRO B 1 164 ? 6.126   0.697   37.985 1.00  26.97 ? 271  PRO B O   1 
ATOM   2485 C CB  . PRO B 1 164 ? 3.251   1.248   39.090 1.00  27.35 ? 271  PRO B CB  1 
ATOM   2486 C CG  . PRO B 1 164 ? 3.636   2.332   40.040 1.00  27.25 ? 271  PRO B CG  1 
ATOM   2487 C CD  . PRO B 1 164 ? 4.460   1.765   41.081 1.00  27.47 ? 271  PRO B CD  1 
ATOM   2488 N N   . ALA B 1 165 ? 4.870   -1.074  37.294 1.00  27.66 ? 272  ALA B N   1 
ATOM   2489 C CA  . ALA B 1 165 ? 5.614   -1.295  36.057 1.00  28.74 ? 272  ALA B CA  1 
ATOM   2490 C C   . ALA B 1 165 ? 5.155   -0.282  35.032 1.00  29.20 ? 272  ALA B C   1 
ATOM   2491 O O   . ALA B 1 165 ? 3.964   -0.259  34.698 1.00  31.14 ? 272  ALA B O   1 
ATOM   2492 C CB  . ALA B 1 165 ? 5.378   -2.710  35.523 1.00  28.58 ? 272  ALA B CB  1 
ATOM   2493 N N   . ASN C 2 2   ? 9.869   -19.388 33.512 1.00  42.02 ? 2    ASN S N   1 
ATOM   2494 C CA  . ASN C 2 2   ? 9.459   -19.919 34.848 1.00  42.50 ? 2    ASN S CA  1 
ATOM   2495 C C   . ASN C 2 2   ? 9.097   -18.811 35.837 1.00  42.31 ? 2    ASN S C   1 
ATOM   2496 O O   . ASN C 2 2   ? 9.707   -17.750 35.834 1.00  43.05 ? 2    ASN S O   1 
ATOM   2497 C CB  . ASN C 2 2   ? 10.575  -20.774 35.444 1.00  42.36 ? 2    ASN S CB  1 
ATOM   2498 C CG  . ASN C 2 2   ? 10.862  -22.011 34.620 1.00  42.90 ? 2    ASN S CG  1 
ATOM   2499 O OD1 . ASN C 2 2   ? 11.990  -22.221 34.169 1.00  43.11 ? 2    ASN S OD1 1 
ATOM   2500 N ND2 . ASN C 2 2   ? 9.840   -22.841 34.418 1.00  43.46 ? 2    ASN S ND2 1 
ATOM   2501 N N   . GLU C 2 3   ? 8.113   -19.081 36.682 1.00  42.11 ? 3    GLU S N   1 
ATOM   2502 C CA  . GLU C 2 3   ? 7.666   -18.146 37.715 1.00  42.00 ? 3    GLU S CA  1 
ATOM   2503 C C   . GLU C 2 3   ? 7.900   -18.746 39.095 1.00  41.43 ? 3    GLU S C   1 
ATOM   2504 O O   . GLU C 2 3   ? 7.760   -19.958 39.289 1.00  41.43 ? 3    GLU S O   1 
ATOM   2505 C CB  . GLU C 2 3   ? 6.186   -17.801 37.534 1.00  42.27 ? 3    GLU S CB  1 
ATOM   2506 C CG  . GLU C 2 3   ? 5.219   -18.975 37.678 1.00  43.62 ? 3    GLU S CG  1 
ATOM   2507 C CD  . GLU C 2 3   ? 3.827   -18.647 37.150 1.00  45.67 ? 3    GLU S CD  1 
ATOM   2508 O OE1 . GLU C 2 3   ? 3.723   -17.945 36.117 1.00  47.00 ? 3    GLU S OE1 1 
ATOM   2509 O OE2 . GLU C 2 3   ? 2.837   -19.082 37.777 1.00  46.58 ? 3    GLU S OE2 1 
ATOM   2510 N N   . TYR C 2 4   ? 8.263   -17.885 40.043 1.00  40.53 ? 4    TYR S N   1 
ATOM   2511 C CA  . TYR C 2 4   ? 8.686   -18.301 41.369 1.00  39.56 ? 4    TYR S CA  1 
ATOM   2512 C C   . TYR C 2 4   ? 7.617   -17.975 42.385 1.00  38.46 ? 4    TYR S C   1 
ATOM   2513 O O   . TYR C 2 4   ? 7.053   -16.886 42.364 1.00  38.38 ? 4    TYR S O   1 
ATOM   2514 C CB  . TYR C 2 4   ? 9.983   -17.592 41.749 1.00  39.84 ? 4    TYR S CB  1 
ATOM   2515 C CG  . TYR C 2 4   ? 11.167  -18.047 40.934 1.00  41.03 ? 4    TYR S CG  1 
ATOM   2516 C CD1 . TYR C 2 4   ? 12.259  -18.661 41.539 1.00  41.67 ? 4    TYR S CD1 1 
ATOM   2517 C CD2 . TYR C 2 4   ? 11.188  -17.876 39.546 1.00  42.22 ? 4    TYR S CD2 1 
ATOM   2518 C CE1 . TYR C 2 4   ? 13.341  -19.086 40.786 1.00  43.23 ? 4    TYR S CE1 1 
ATOM   2519 C CE2 . TYR C 2 4   ? 12.259  -18.292 38.790 1.00  42.86 ? 4    TYR S CE2 1 
ATOM   2520 C CZ  . TYR C 2 4   ? 13.332  -18.894 39.408 1.00  43.73 ? 4    TYR S CZ  1 
ATOM   2521 O OH  . TYR C 2 4   ? 14.393  -19.309 38.645 1.00  46.96 ? 4    TYR S OH  1 
ATOM   2522 N N   . TYR C 2 5   ? 7.342   -18.933 43.264 1.00  37.18 ? 5    TYR S N   1 
ATOM   2523 C CA  . TYR C 2 5   ? 6.432   -18.751 44.388 1.00  36.35 ? 5    TYR S CA  1 
ATOM   2524 C C   . TYR C 2 5   ? 7.303   -18.502 45.604 1.00  35.25 ? 5    TYR S C   1 
ATOM   2525 O O   . TYR C 2 5   ? 8.243   -19.246 45.863 1.00  34.68 ? 5    TYR S O   1 
ATOM   2526 C CB  . TYR C 2 5   ? 5.569   -19.997 44.583 1.00  36.57 ? 5    TYR S CB  1 
ATOM   2527 C CG  . TYR C 2 5   ? 4.828   -20.080 45.904 1.00  37.64 ? 5    TYR S CG  1 
ATOM   2528 C CD1 . TYR C 2 5   ? 4.246   -18.946 46.490 1.00  37.47 ? 5    TYR S CD1 1 
ATOM   2529 C CD2 . TYR C 2 5   ? 4.669   -21.306 46.549 1.00  37.74 ? 5    TYR S CD2 1 
ATOM   2530 C CE1 . TYR C 2 5   ? 3.555   -19.031 47.693 1.00  37.54 ? 5    TYR S CE1 1 
ATOM   2531 C CE2 . TYR C 2 5   ? 3.976   -21.402 47.753 1.00  38.26 ? 5    TYR S CE2 1 
ATOM   2532 C CZ  . TYR C 2 5   ? 3.428   -20.261 48.325 1.00  38.66 ? 5    TYR S CZ  1 
ATOM   2533 O OH  . TYR C 2 5   ? 2.744   -20.362 49.523 1.00  38.48 ? 5    TYR S OH  1 
ATOM   2534 N N   . VAL C 2 6   ? 6.996   -17.446 46.345 1.00  34.07 ? 6    VAL S N   1 
ATOM   2535 C CA  . VAL C 2 6   ? 7.909   -16.951 47.360 1.00  32.86 ? 6    VAL S CA  1 
ATOM   2536 C C   . VAL C 2 6   ? 7.128   -16.416 48.565 1.00  32.28 ? 6    VAL S C   1 
ATOM   2537 O O   . VAL C 2 6   ? 5.905   -16.326 48.522 1.00  30.88 ? 6    VAL S O   1 
ATOM   2538 C CB  . VAL C 2 6   ? 8.843   -15.904 46.706 1.00  33.23 ? 6    VAL S CB  1 
ATOM   2539 C CG1 . VAL C 2 6   ? 8.295   -14.464 46.829 1.00  32.93 ? 6    VAL S CG1 1 
ATOM   2540 C CG2 . VAL C 2 6   ? 10.260  -16.039 47.220 1.00  34.08 ? 6    VAL S CG2 1 
ATOM   2541 O OXT . VAL C 2 6   ? 7.675   -16.094 49.626 1.00  31.77 ? 6    VAL S OXT 1 
ATOM   2542 N N   . ASN D 2 2   ? -13.709 21.193  26.348 1.00  45.47 ? 2    ASN T N   1 
ATOM   2543 C CA  . ASN D 2 2   ? -12.740 22.291  26.645 1.00  45.69 ? 2    ASN T CA  1 
ATOM   2544 C C   . ASN D 2 2   ? -11.621 21.850  27.590 1.00  45.66 ? 2    ASN T C   1 
ATOM   2545 O O   . ASN D 2 2   ? -11.778 20.890  28.350 1.00  45.79 ? 2    ASN T O   1 
ATOM   2546 C CB  . ASN D 2 2   ? -13.451 23.491  27.285 1.00  45.68 ? 2    ASN T CB  1 
ATOM   2547 C CG  . ASN D 2 2   ? -14.129 24.408  26.269 1.00  46.10 ? 2    ASN T CG  1 
ATOM   2548 O OD1 . ASN D 2 2   ? -14.983 25.219  26.640 1.00  45.68 ? 2    ASN T OD1 1 
ATOM   2549 N ND2 . ASN D 2 2   ? -13.751 24.294  24.997 1.00  45.32 ? 2    ASN T ND2 1 
ATOM   2550 N N   . GLU D 2 3   ? -10.501 22.578  27.529 1.00  45.50 ? 3    GLU T N   1 
ATOM   2551 C CA  . GLU D 2 3   ? -9.391  22.433  28.473 1.00  45.13 ? 3    GLU T CA  1 
ATOM   2552 C C   . GLU D 2 3   ? -9.177  23.734  29.211 1.00  44.73 ? 3    GLU T C   1 
ATOM   2553 O O   . GLU D 2 3   ? -9.777  24.759  28.891 1.00  44.94 ? 3    GLU T O   1 
ATOM   2554 C CB  . GLU D 2 3   ? -8.082  22.087  27.779 1.00  45.08 ? 3    GLU T CB  1 
ATOM   2555 C CG  . GLU D 2 3   ? -8.227  21.319  26.491 1.00  45.39 ? 3    GLU T CG  1 
ATOM   2556 C CD  . GLU D 2 3   ? -6.988  21.406  25.636 1.00  46.05 ? 3    GLU T CD  1 
ATOM   2557 O OE1 . GLU D 2 3   ? -6.730  20.432  24.902 1.00  48.69 ? 3    GLU T OE1 1 
ATOM   2558 O OE2 . GLU D 2 3   ? -6.278  22.439  25.685 1.00  44.64 ? 3    GLU T OE2 1 
ATOM   2559 N N   . TYR D 2 4   ? -8.313  23.679  30.212 1.00  44.00 ? 4    TYR T N   1 
ATOM   2560 C CA  . TYR D 2 4   ? -8.007  24.840  31.011 1.00  43.56 ? 4    TYR T CA  1 
ATOM   2561 C C   . TYR D 2 4   ? -6.508  24.842  31.263 1.00  43.13 ? 4    TYR T C   1 
ATOM   2562 O O   . TYR D 2 4   ? -5.991  24.049  32.055 1.00  42.81 ? 4    TYR T O   1 
ATOM   2563 C CB  . TYR D 2 4   ? -8.808  24.822  32.318 1.00  43.56 ? 4    TYR T CB  1 
ATOM   2564 C CG  . TYR D 2 4   ? -10.320 24.814  32.118 1.00  43.68 ? 4    TYR T CG  1 
ATOM   2565 C CD1 . TYR D 2 4   ? -11.102 25.889  32.519 1.00  44.48 ? 4    TYR T CD1 1 
ATOM   2566 C CD2 . TYR D 2 4   ? -10.968 23.715  31.548 1.00  44.06 ? 4    TYR T CD2 1 
ATOM   2567 C CE1 . TYR D 2 4   ? -12.489 25.874  32.345 1.00  44.81 ? 4    TYR T CE1 1 
ATOM   2568 C CE2 . TYR D 2 4   ? -12.344 23.697  31.364 1.00  44.63 ? 4    TYR T CE2 1 
ATOM   2569 C CZ  . TYR D 2 4   ? -13.095 24.773  31.768 1.00  44.97 ? 4    TYR T CZ  1 
ATOM   2570 O OH  . TYR D 2 4   ? -14.453 24.742  31.584 1.00  46.48 ? 4    TYR T OH  1 
ATOM   2571 N N   . TYR D 2 5   ? -5.805  25.686  30.515 1.00  42.62 ? 5    TYR T N   1 
ATOM   2572 C CA  . TYR D 2 5   ? -4.449  26.074  30.878 1.00  42.12 ? 5    TYR T CA  1 
ATOM   2573 C C   . TYR D 2 5   ? -4.559  26.800  32.219 1.00  40.95 ? 5    TYR T C   1 
ATOM   2574 O O   . TYR D 2 5   ? -5.389  27.699  32.366 1.00  40.83 ? 5    TYR T O   1 
ATOM   2575 C CB  . TYR D 2 5   ? -3.851  26.992  29.801 1.00  42.45 ? 5    TYR T CB  1 
ATOM   2576 C CG  . TYR D 2 5   ? -2.560  27.705  30.194 1.00  44.22 ? 5    TYR T CG  1 
ATOM   2577 C CD1 . TYR D 2 5   ? -1.574  27.063  30.940 1.00  44.40 ? 5    TYR T CD1 1 
ATOM   2578 C CD2 . TYR D 2 5   ? -2.328  29.026  29.799 1.00  45.19 ? 5    TYR T CD2 1 
ATOM   2579 C CE1 . TYR D 2 5   ? -0.404  27.718  31.288 1.00  46.04 ? 5    TYR T CE1 1 
ATOM   2580 C CE2 . TYR D 2 5   ? -1.161  29.685  30.143 1.00  46.07 ? 5    TYR T CE2 1 
ATOM   2581 C CZ  . TYR D 2 5   ? -0.201  29.029  30.883 1.00  45.97 ? 5    TYR T CZ  1 
ATOM   2582 O OH  . TYR D 2 5   ? 0.955   29.683  31.224 1.00  44.96 ? 5    TYR T OH  1 
ATOM   2583 N N   . VAL D 2 6   ? -3.758  26.385  33.199 1.00  39.71 ? 6    VAL T N   1 
ATOM   2584 C CA  . VAL D 2 6   ? -3.797  26.984  34.535 1.00  39.12 ? 6    VAL T CA  1 
ATOM   2585 C C   . VAL D 2 6   ? -2.395  27.154  35.117 1.00  38.76 ? 6    VAL T C   1 
ATOM   2586 O O   . VAL D 2 6   ? -1.402  26.738  34.530 1.00  38.43 ? 6    VAL T O   1 
ATOM   2587 C CB  . VAL D 2 6   ? -4.686  26.163  35.527 1.00  39.04 ? 6    VAL T CB  1 
ATOM   2588 C CG1 . VAL D 2 6   ? -6.123  26.131  35.046 1.00  38.51 ? 6    VAL T CG1 1 
ATOM   2589 C CG2 . VAL D 2 6   ? -4.136  24.736  35.725 1.00  39.02 ? 6    VAL T CG2 1 
ATOM   2590 O OXT . VAL D 2 6   ? -2.217  27.719  36.194 1.00  38.46 ? 6    VAL T OXT 1 
HETATM 2591 C C   . BEZ E 3 .   ? 8.650   27.012  41.935 1.00  30.75 ? 1274 BEZ A C   1 
HETATM 2592 O O1  . BEZ E 3 .   ? 8.255   25.835  42.599 1.00  30.87 ? 1274 BEZ A O1  1 
HETATM 2593 O O2  . BEZ E 3 .   ? 8.463   27.092  40.649 1.00  30.69 ? 1274 BEZ A O2  1 
HETATM 2594 C C1  . BEZ E 3 .   ? 9.242   28.164  42.682 1.00  30.60 ? 1274 BEZ A C1  1 
HETATM 2595 C C2  . BEZ E 3 .   ? 9.298   29.419  42.074 1.00  31.02 ? 1274 BEZ A C2  1 
HETATM 2596 C C3  . BEZ E 3 .   ? 9.814   30.504  42.767 1.00  31.08 ? 1274 BEZ A C3  1 
HETATM 2597 C C4  . BEZ E 3 .   ? 10.285  30.329  44.069 1.00  31.59 ? 1274 BEZ A C4  1 
HETATM 2598 C C5  . BEZ E 3 .   ? 10.232  29.073  44.675 1.00  31.46 ? 1274 BEZ A C5  1 
HETATM 2599 C C6  . BEZ E 3 .   ? 9.700   27.987  43.982 1.00  30.28 ? 1274 BEZ A C6  1 
HETATM 2600 O O   . HOH F 4 .   ? 0.376   -0.353  55.422 1.00  67.56 ? 2001 HOH A O   1 
HETATM 2601 O O   . HOH F 4 .   ? -2.548  4.650   59.652 1.00  50.68 ? 2002 HOH A O   1 
HETATM 2602 O O   . HOH F 4 .   ? -2.569  4.025   55.344 1.00  31.14 ? 2003 HOH A O   1 
HETATM 2603 O O   . HOH F 4 .   ? -6.477  -1.340  60.192 1.00  58.41 ? 2004 HOH A O   1 
HETATM 2604 O O   . HOH F 4 .   ? -10.139 -3.580  66.013 1.00  32.86 ? 2005 HOH A O   1 
HETATM 2605 O O   . HOH F 4 .   ? -14.520 -3.605  64.306 1.00  41.26 ? 2006 HOH A O   1 
HETATM 2606 O O   . HOH F 4 .   ? -15.157 4.129   61.575 1.00  29.48 ? 2007 HOH A O   1 
HETATM 2607 O O   . HOH F 4 .   ? -38.938 1.106   52.136 1.00  51.78 ? 2008 HOH A O   1 
HETATM 2608 O O   . HOH F 4 .   ? -24.078 -2.293  49.347 1.00  63.07 ? 2009 HOH A O   1 
HETATM 2609 O O   . HOH F 4 .   ? -22.861 0.813   48.432 1.00  41.87 ? 2010 HOH A O   1 
HETATM 2610 O O   . HOH F 4 .   ? -19.564 3.135   35.928 1.00  46.79 ? 2011 HOH A O   1 
HETATM 2611 O O   . HOH F 4 .   ? -16.123 0.506   39.554 1.00  42.40 ? 2012 HOH A O   1 
HETATM 2612 O O   . HOH F 4 .   ? -7.165  -6.538  39.305 1.00  23.69 ? 2013 HOH A O   1 
HETATM 2613 O O   . HOH F 4 .   ? -5.214  -4.216  36.597 1.00  45.09 ? 2014 HOH A O   1 
HETATM 2614 O O   . HOH F 4 .   ? 0.959   -1.134  38.029 1.00  44.22 ? 2015 HOH A O   1 
HETATM 2615 O O   . HOH F 4 .   ? -3.841  -11.927 42.184 1.00  40.65 ? 2016 HOH A O   1 
HETATM 2616 O O   . HOH F 4 .   ? -3.884  -7.648  46.379 1.00  20.49 ? 2017 HOH A O   1 
HETATM 2617 O O   . HOH F 4 .   ? -3.538  -10.796 37.015 1.00  34.42 ? 2018 HOH A O   1 
HETATM 2618 O O   . HOH F 4 .   ? -10.532 3.510   42.142 1.00  45.17 ? 2019 HOH A O   1 
HETATM 2619 O O   . HOH F 4 .   ? -15.618 10.110  44.516 1.00  36.97 ? 2020 HOH A O   1 
HETATM 2620 O O   . HOH F 4 .   ? -28.943 8.973   46.077 1.00  48.74 ? 2021 HOH A O   1 
HETATM 2621 O O   . HOH F 4 .   ? -21.355 7.485   44.107 1.00  59.84 ? 2022 HOH A O   1 
HETATM 2622 O O   . HOH F 4 .   ? -20.301 13.834  51.534 1.00  26.34 ? 2023 HOH A O   1 
HETATM 2623 O O   . HOH F 4 .   ? -9.146  10.609  54.886 1.00  57.90 ? 2024 HOH A O   1 
HETATM 2624 O O   . HOH F 4 .   ? -12.674 11.702  46.992 1.00  38.62 ? 2025 HOH A O   1 
HETATM 2625 O O   . HOH F 4 .   ? -4.219  5.780   45.650 1.00  37.10 ? 2026 HOH A O   1 
HETATM 2626 O O   . HOH F 4 .   ? -9.052  7.615   53.749 1.00  32.66 ? 2027 HOH A O   1 
HETATM 2627 O O   . HOH F 4 .   ? -6.671  -4.123  47.860 1.00  16.65 ? 2028 HOH A O   1 
HETATM 2628 O O   . HOH F 4 .   ? -18.910 -9.439  54.935 1.00  48.76 ? 2029 HOH A O   1 
HETATM 2629 O O   . HOH F 4 .   ? -12.436 -5.315  57.935 1.00  18.53 ? 2030 HOH A O   1 
HETATM 2630 O O   . HOH F 4 .   ? -15.421 -14.888 48.939 1.00  38.48 ? 2031 HOH A O   1 
HETATM 2631 O O   . HOH F 4 .   ? -16.460 -10.397 54.172 1.00  34.41 ? 2032 HOH A O   1 
HETATM 2632 O O   . HOH F 4 .   ? -13.808 -14.020 55.273 1.00  60.64 ? 2033 HOH A O   1 
HETATM 2633 O O   . HOH F 4 .   ? -9.902  -13.695 53.797 1.00  34.97 ? 2034 HOH A O   1 
HETATM 2634 O O   . HOH F 4 .   ? -4.775  -13.770 54.898 1.00  28.57 ? 2035 HOH A O   1 
HETATM 2635 O O   . HOH F 4 .   ? -11.593 -13.596 50.411 1.00  54.12 ? 2036 HOH A O   1 
HETATM 2636 O O   . HOH F 4 .   ? -8.923  -12.542 48.393 1.00  37.83 ? 2037 HOH A O   1 
HETATM 2637 O O   . HOH F 4 .   ? -12.146 -6.306  60.540 1.00  49.84 ? 2038 HOH A O   1 
HETATM 2638 O O   . HOH F 4 .   ? -8.542  -12.501 40.632 1.00  29.40 ? 2039 HOH A O   1 
HETATM 2639 O O   . HOH F 4 .   ? -8.700  -7.191  42.464 1.00  23.13 ? 2040 HOH A O   1 
HETATM 2640 O O   . HOH F 4 .   ? -15.386 -12.122 39.832 1.00  27.55 ? 2041 HOH A O   1 
HETATM 2641 O O   . HOH F 4 .   ? -13.114 -3.130  38.277 1.00  35.55 ? 2042 HOH A O   1 
HETATM 2642 O O   . HOH F 4 .   ? -21.732 -6.806  42.129 1.00  48.22 ? 2043 HOH A O   1 
HETATM 2643 O O   . HOH F 4 .   ? -19.248 -6.397  35.082 1.00  33.31 ? 2044 HOH A O   1 
HETATM 2644 O O   . HOH F 4 .   ? -18.627 -3.566  40.095 1.00  57.73 ? 2045 HOH A O   1 
HETATM 2645 O O   . HOH F 4 .   ? -21.730 -4.291  40.878 1.00  38.88 ? 2046 HOH A O   1 
HETATM 2646 O O   . HOH F 4 .   ? -23.827 -6.407  44.118 1.00  28.74 ? 2047 HOH A O   1 
HETATM 2647 O O   . HOH F 4 .   ? -18.805 -14.622 42.515 1.00  36.96 ? 2048 HOH A O   1 
HETATM 2648 O O   . HOH F 4 .   ? -23.704 -13.930 41.646 1.00  51.87 ? 2049 HOH A O   1 
HETATM 2649 O O   . HOH F 4 .   ? -20.065 -11.221 40.914 1.00  36.37 ? 2050 HOH A O   1 
HETATM 2650 O O   . HOH F 4 .   ? -20.644 -10.569 52.582 1.00  28.95 ? 2051 HOH A O   1 
HETATM 2651 O O   . HOH F 4 .   ? -27.580 -5.095  50.406 1.00  58.56 ? 2052 HOH A O   1 
HETATM 2652 O O   . HOH F 4 .   ? -27.168 -10.493 46.973 1.00  57.77 ? 2053 HOH A O   1 
HETATM 2653 O O   . HOH F 4 .   ? -20.881 -11.226 56.695 1.00  40.17 ? 2054 HOH A O   1 
HETATM 2654 O O   . HOH F 4 .   ? -22.078 -6.062  57.714 1.00  43.01 ? 2055 HOH A O   1 
HETATM 2655 O O   . HOH F 4 .   ? -21.951 2.811   63.936 1.00  48.01 ? 2056 HOH A O   1 
HETATM 2656 O O   . HOH F 4 .   ? -22.632 -5.616  62.859 1.00  45.69 ? 2057 HOH A O   1 
HETATM 2657 O O   . HOH F 4 .   ? -21.891 -1.457  67.080 1.00  56.88 ? 2058 HOH A O   1 
HETATM 2658 O O   . HOH F 4 .   ? -3.032  8.467   56.450 1.00  41.39 ? 2059 HOH A O   1 
HETATM 2659 O O   . HOH F 4 .   ? 2.113   7.485   42.524 1.00  37.73 ? 2060 HOH A O   1 
HETATM 2660 O O   . HOH F 4 .   ? -1.504  14.505  51.478 1.00  45.12 ? 2061 HOH A O   1 
HETATM 2661 O O   . HOH F 4 .   ? -0.846  11.660  53.088 1.00  42.08 ? 2062 HOH A O   1 
HETATM 2662 O O   . HOH F 4 .   ? 5.817   9.134   40.912 1.00  77.33 ? 2063 HOH A O   1 
HETATM 2663 O O   . HOH F 4 .   ? 4.385   13.448  47.855 1.00  26.11 ? 2064 HOH A O   1 
HETATM 2664 O O   . HOH F 4 .   ? 6.206   14.810  44.714 1.00  32.72 ? 2065 HOH A O   1 
HETATM 2665 O O   . HOH F 4 .   ? 0.786   13.113  48.980 1.00  36.07 ? 2066 HOH A O   1 
HETATM 2666 O O   . HOH F 4 .   ? 6.433   30.217  38.730 1.00  35.90 ? 2067 HOH A O   1 
HETATM 2667 O O   . HOH F 4 .   ? -1.783  36.848  32.564 1.00  46.19 ? 2068 HOH A O   1 
HETATM 2668 O O   . HOH F 4 .   ? -3.987  30.080  38.275 1.00  41.84 ? 2069 HOH A O   1 
HETATM 2669 O O   . HOH F 4 .   ? 4.434   28.978  35.940 1.00  55.78 ? 2070 HOH A O   1 
HETATM 2670 O O   . HOH F 4 .   ? -8.521  14.514  30.494 1.00  33.49 ? 2071 HOH A O   1 
HETATM 2671 O O   . HOH F 4 .   ? -13.600 13.680  36.169 1.00  42.97 ? 2072 HOH A O   1 
HETATM 2672 O O   . HOH F 4 .   ? -10.529 13.544  30.000 1.00  51.95 ? 2073 HOH A O   1 
HETATM 2673 O O   . HOH F 4 .   ? -6.170  11.613  27.965 1.00  52.01 ? 2074 HOH A O   1 
HETATM 2674 O O   . HOH F 4 .   ? -7.598  17.671  34.623 1.00  51.53 ? 2075 HOH A O   1 
HETATM 2675 O O   . HOH F 4 .   ? -6.273  19.153  27.615 1.00  61.00 ? 2076 HOH A O   1 
HETATM 2676 O O   . HOH F 4 .   ? 4.679   24.287  26.089 1.00  36.90 ? 2077 HOH A O   1 
HETATM 2677 O O   . HOH F 4 .   ? 11.672  24.484  27.160 1.00  66.01 ? 2078 HOH A O   1 
HETATM 2678 O O   . HOH F 4 .   ? 11.729  26.896  34.275 1.00  29.58 ? 2079 HOH A O   1 
HETATM 2679 O O   . HOH F 4 .   ? 9.792   22.100  30.367 1.00  44.85 ? 2080 HOH A O   1 
HETATM 2680 O O   . HOH F 4 .   ? 14.713  24.306  30.591 1.00  27.16 ? 2081 HOH A O   1 
HETATM 2681 O O   . HOH F 4 .   ? 11.313  18.917  34.440 1.00  16.18 ? 2082 HOH A O   1 
HETATM 2682 O O   . HOH F 4 .   ? 7.038   20.214  44.456 1.00  21.21 ? 2083 HOH A O   1 
HETATM 2683 O O   . HOH F 4 .   ? 7.181   16.615  33.899 1.00  17.49 ? 2084 HOH A O   1 
HETATM 2684 O O   . HOH F 4 .   ? 0.317   14.955  37.955 1.00  68.75 ? 2085 HOH A O   1 
HETATM 2685 O O   . HOH F 4 .   ? 1.474   11.709  27.979 1.00  51.56 ? 2086 HOH A O   1 
HETATM 2686 O O   . HOH F 4 .   ? -1.161  13.664  27.987 1.00  59.09 ? 2087 HOH A O   1 
HETATM 2687 O O   . HOH F 4 .   ? -0.418  7.777   34.873 1.00  43.26 ? 2088 HOH A O   1 
HETATM 2688 O O   . HOH F 4 .   ? -6.148  8.022   39.570 1.00  42.72 ? 2089 HOH A O   1 
HETATM 2689 O O   . HOH F 4 .   ? -10.492 14.851  39.106 1.00  47.12 ? 2090 HOH A O   1 
HETATM 2690 O O   . HOH F 4 .   ? -4.699  18.584  50.935 1.00  36.96 ? 2091 HOH A O   1 
HETATM 2691 O O   . HOH F 4 .   ? -9.014  18.034  50.042 1.00  55.45 ? 2092 HOH A O   1 
HETATM 2692 O O   . HOH F 4 .   ? -13.418 27.211  46.509 1.00  37.41 ? 2093 HOH A O   1 
HETATM 2693 O O   . HOH F 4 .   ? -15.337 18.078  47.098 1.00  51.53 ? 2094 HOH A O   1 
HETATM 2694 O O   . HOH F 4 .   ? -16.456 19.400  33.683 1.00  50.44 ? 2095 HOH A O   1 
HETATM 2695 O O   . HOH F 4 .   ? -20.057 20.148  41.944 1.00  39.22 ? 2096 HOH A O   1 
HETATM 2696 O O   . HOH F 4 .   ? -14.899 25.911  42.340 1.00  46.21 ? 2097 HOH A O   1 
HETATM 2697 O O   . HOH F 4 .   ? -16.782 27.553  37.466 1.00  59.11 ? 2098 HOH A O   1 
HETATM 2698 O O   . HOH F 4 .   ? -15.124 32.386  36.272 1.00  44.60 ? 2099 HOH A O   1 
HETATM 2699 O O   . HOH F 4 .   ? -11.542 31.786  36.337 1.00  47.05 ? 2100 HOH A O   1 
HETATM 2700 O O   . HOH F 4 .   ? -13.964 28.580  35.180 1.00  44.86 ? 2101 HOH A O   1 
HETATM 2701 O O   . HOH F 4 .   ? -8.475  29.180  45.780 1.00  41.73 ? 2102 HOH A O   1 
HETATM 2702 O O   . HOH F 4 .   ? -1.680  29.600  48.682 1.00  39.02 ? 2103 HOH A O   1 
HETATM 2703 O O   . HOH F 4 .   ? -7.157  4.747   39.163 1.00  47.82 ? 2104 HOH A O   1 
HETATM 2704 O O   . HOH F 4 .   ? -4.573  -0.031  35.955 1.00  53.46 ? 2105 HOH A O   1 
HETATM 2705 O O   . HOH F 4 .   ? 7.400   24.899  44.721 1.00  41.04 ? 2106 HOH A O   1 
HETATM 2706 O O   . HOH G 4 .   ? 12.690  18.030  52.138 1.00  47.11 ? 2001 HOH B O   1 
HETATM 2707 O O   . HOH G 4 .   ? 13.728  13.378  46.497 1.00  36.89 ? 2002 HOH B O   1 
HETATM 2708 O O   . HOH G 4 .   ? 17.659  17.384  49.180 1.00  44.42 ? 2003 HOH B O   1 
HETATM 2709 O O   . HOH G 4 .   ? 22.330  14.773  46.385 1.00  23.94 ? 2004 HOH B O   1 
HETATM 2710 O O   . HOH G 4 .   ? 19.640  21.642  47.873 1.00  58.08 ? 2005 HOH B O   1 
HETATM 2711 O O   . HOH G 4 .   ? 18.916  23.387  45.066 1.00  46.92 ? 2006 HOH B O   1 
HETATM 2712 O O   . HOH G 4 .   ? 33.349  16.001  37.506 1.00  46.64 ? 2007 HOH B O   1 
HETATM 2713 O O   . HOH G 4 .   ? 32.579  10.116  37.880 1.00  50.54 ? 2008 HOH B O   1 
HETATM 2714 O O   . HOH G 4 .   ? 32.886  4.524   33.447 1.00  43.13 ? 2009 HOH B O   1 
HETATM 2715 O O   . HOH G 4 .   ? 38.567  9.062   31.820 1.00  65.31 ? 2010 HOH B O   1 
HETATM 2716 O O   . HOH G 4 .   ? 37.144  6.867   32.968 1.00  50.47 ? 2011 HOH B O   1 
HETATM 2717 O O   . HOH G 4 .   ? 28.758  12.327  27.751 1.00  66.03 ? 2012 HOH B O   1 
HETATM 2718 O O   . HOH G 4 .   ? 28.595  7.893   26.487 1.00  53.29 ? 2013 HOH B O   1 
HETATM 2719 O O   . HOH G 4 .   ? 25.399  6.611   29.734 1.00  45.78 ? 2014 HOH B O   1 
HETATM 2720 O O   . HOH G 4 .   ? 19.707  -0.644  30.466 1.00  52.63 ? 2015 HOH B O   1 
HETATM 2721 O O   . HOH G 4 .   ? 14.334  3.346   28.376 1.00  40.17 ? 2016 HOH B O   1 
HETATM 2722 O O   . HOH G 4 .   ? 8.500   11.137  25.122 1.00  47.60 ? 2017 HOH B O   1 
HETATM 2723 O O   . HOH G 4 .   ? 5.822   10.567  28.175 1.00  37.30 ? 2018 HOH B O   1 
HETATM 2724 O O   . HOH G 4 .   ? 0.587   6.108   31.934 1.00  30.95 ? 2019 HOH B O   1 
HETATM 2725 O O   . HOH G 4 .   ? 3.617   7.734   29.327 1.00  39.11 ? 2020 HOH B O   1 
HETATM 2726 O O   . HOH G 4 .   ? 6.016   13.215  25.113 1.00  35.42 ? 2021 HOH B O   1 
HETATM 2727 O O   . HOH G 4 .   ? 11.043  14.239  34.934 1.00  14.92 ? 2022 HOH B O   1 
HETATM 2728 O O   . HOH G 4 .   ? 11.527  -0.824  33.780 1.00  58.45 ? 2023 HOH B O   1 
HETATM 2729 O O   . HOH G 4 .   ? 32.345  4.977   39.603 1.00  48.50 ? 2024 HOH B O   1 
HETATM 2730 O O   . HOH G 4 .   ? 21.581  23.343  43.195 1.00  59.97 ? 2025 HOH B O   1 
HETATM 2731 O O   . HOH G 4 .   ? 9.689   6.023   41.026 1.00  29.68 ? 2026 HOH B O   1 
HETATM 2732 O O   . HOH G 4 .   ? 18.487  9.084   44.269 1.00  39.01 ? 2027 HOH B O   1 
HETATM 2733 O O   . HOH G 4 .   ? 16.902  22.450  39.469 1.00  45.94 ? 2028 HOH B O   1 
HETATM 2734 O O   . HOH G 4 .   ? 23.494  22.859  30.034 1.00  41.62 ? 2029 HOH B O   1 
HETATM 2735 O O   . HOH G 4 .   ? 19.695  27.280  33.181 1.00  35.29 ? 2030 HOH B O   1 
HETATM 2736 O O   . HOH G 4 .   ? 20.666  19.864  29.152 1.00  22.72 ? 2031 HOH B O   1 
HETATM 2737 O O   . HOH G 4 .   ? 17.966  25.713  27.818 1.00  53.89 ? 2032 HOH B O   1 
HETATM 2738 O O   . HOH G 4 .   ? 10.011  18.911  26.495 1.00  29.24 ? 2033 HOH B O   1 
HETATM 2739 O O   . HOH G 4 .   ? 11.454  20.740  29.063 1.00  29.19 ? 2034 HOH B O   1 
HETATM 2740 O O   . HOH G 4 .   ? 6.853   16.198  25.236 1.00  25.54 ? 2035 HOH B O   1 
HETATM 2741 O O   . HOH G 4 .   ? 8.999   12.939  29.227 1.00  24.18 ? 2036 HOH B O   1 
HETATM 2742 O O   . HOH G 4 .   ? 12.230  13.597  20.907 1.00  20.20 ? 2037 HOH B O   1 
HETATM 2743 O O   . HOH G 4 .   ? 10.594  5.895   26.768 1.00  48.46 ? 2038 HOH B O   1 
HETATM 2744 O O   . HOH G 4 .   ? 10.443  7.972   25.006 1.00  33.90 ? 2039 HOH B O   1 
HETATM 2745 O O   . HOH G 4 .   ? 15.913  5.695   24.703 1.00  51.46 ? 2040 HOH B O   1 
HETATM 2746 O O   . HOH G 4 .   ? 18.709  8.036   22.014 1.00  48.11 ? 2041 HOH B O   1 
HETATM 2747 O O   . HOH G 4 .   ? 16.184  4.667   20.901 1.00  44.58 ? 2042 HOH B O   1 
HETATM 2748 O O   . HOH G 4 .   ? 26.133  6.326   23.412 1.00  52.09 ? 2043 HOH B O   1 
HETATM 2749 O O   . HOH G 4 .   ? 16.490  14.080  20.534 1.00  35.46 ? 2044 HOH B O   1 
HETATM 2750 O O   . HOH G 4 .   ? 26.641  6.135   20.966 1.00  47.38 ? 2045 HOH B O   1 
HETATM 2751 O O   . HOH G 4 .   ? 37.896  13.870  35.860 1.00  42.95 ? 2046 HOH B O   1 
HETATM 2752 O O   . HOH G 4 .   ? 21.107  19.998  39.284 1.00  51.32 ? 2047 HOH B O   1 
HETATM 2753 O O   . HOH G 4 .   ? 11.102  16.977  44.860 1.00  62.56 ? 2048 HOH B O   1 
HETATM 2754 O O   . HOH G 4 .   ? -5.509  -6.406  48.403 1.00  20.31 ? 2049 HOH B O   1 
HETATM 2755 O O   . HOH G 4 .   ? 4.077   6.769   45.169 1.00  46.98 ? 2050 HOH B O   1 
HETATM 2756 O O   . HOH G 4 .   ? 3.126   3.817   43.693 1.00  22.72 ? 2051 HOH B O   1 
HETATM 2757 O O   . HOH G 4 .   ? 12.924  3.897   50.813 1.00  47.26 ? 2052 HOH B O   1 
HETATM 2758 O O   . HOH G 4 .   ? 0.973   -0.294  49.359 1.00  34.71 ? 2053 HOH B O   1 
HETATM 2759 O O   . HOH G 4 .   ? 5.138   2.992   51.586 1.00  34.76 ? 2054 HOH B O   1 
HETATM 2760 O O   . HOH G 4 .   ? 5.031   -2.334  58.209 1.00  47.36 ? 2055 HOH B O   1 
HETATM 2761 O O   . HOH G 4 .   ? 2.680   -3.274  55.022 1.00  45.71 ? 2056 HOH B O   1 
HETATM 2762 O O   . HOH G 4 .   ? 2.588   -6.799  57.942 1.00  39.00 ? 2057 HOH B O   1 
HETATM 2763 O O   . HOH G 4 .   ? 8.633   -19.266 58.854 1.00  42.81 ? 2058 HOH B O   1 
HETATM 2764 O O   . HOH G 4 .   ? 1.755   -22.427 51.884 1.00  50.35 ? 2059 HOH B O   1 
HETATM 2765 O O   . HOH G 4 .   ? 2.202   -15.630 54.411 1.00  26.40 ? 2060 HOH B O   1 
HETATM 2766 O O   . HOH G 4 .   ? 6.745   -10.666 34.242 1.00  41.85 ? 2061 HOH B O   1 
HETATM 2767 O O   . HOH G 4 .   ? 3.186   -5.034  34.352 1.00  51.78 ? 2062 HOH B O   1 
HETATM 2768 O O   . HOH G 4 .   ? 2.397   -7.869  34.754 1.00  58.31 ? 2063 HOH B O   1 
HETATM 2769 O O   . HOH G 4 .   ? 1.954   -15.505 38.395 1.00  59.84 ? 2064 HOH B O   1 
HETATM 2770 O O   . HOH G 4 .   ? -1.443  -18.842 51.281 1.00  31.77 ? 2065 HOH B O   1 
HETATM 2771 O O   . HOH G 4 .   ? -6.984  -14.322 50.773 1.00  29.66 ? 2066 HOH B O   1 
HETATM 2772 O O   . HOH G 4 .   ? -9.406  -18.128 51.067 1.00  56.60 ? 2067 HOH B O   1 
HETATM 2773 O O   . HOH G 4 .   ? -9.220  -15.398 51.389 1.00  44.84 ? 2068 HOH B O   1 
HETATM 2774 O O   . HOH G 4 .   ? 0.740   -10.486 57.873 1.00  24.59 ? 2069 HOH B O   1 
HETATM 2775 O O   . HOH G 4 .   ? 2.795   -8.328  50.180 1.00  75.59 ? 2070 HOH B O   1 
HETATM 2776 O O   . HOH G 4 .   ? -6.277  -8.077  50.609 1.00  18.88 ? 2071 HOH B O   1 
HETATM 2777 O O   . HOH G 4 .   ? -0.139  -14.177 59.741 1.00  45.88 ? 2072 HOH B O   1 
HETATM 2778 O O   . HOH G 4 .   ? 0.838   -3.205  47.095 1.00  43.06 ? 2073 HOH B O   1 
HETATM 2779 O O   . HOH G 4 .   ? 18.898  0.712   41.579 1.00  44.42 ? 2074 HOH B O   1 
HETATM 2780 O O   . HOH G 4 .   ? 16.909  -0.687  43.022 1.00  47.26 ? 2075 HOH B O   1 
HETATM 2781 O O   . HOH G 4 .   ? 22.578  -12.117 33.226 1.00  53.89 ? 2076 HOH B O   1 
HETATM 2782 O O   . HOH G 4 .   ? 15.529  -13.864 35.900 1.00  47.35 ? 2077 HOH B O   1 
HETATM 2783 O O   . HOH G 4 .   ? 22.821  -11.539 38.440 1.00  42.86 ? 2078 HOH B O   1 
HETATM 2784 O O   . HOH G 4 .   ? 14.869  -19.969 47.054 1.00  42.31 ? 2079 HOH B O   1 
HETATM 2785 O O   . HOH G 4 .   ? 20.562  -16.800 49.363 1.00  52.36 ? 2080 HOH B O   1 
HETATM 2786 O O   . HOH G 4 .   ? 14.934  -16.342 56.402 1.00  26.57 ? 2081 HOH B O   1 
HETATM 2787 O O   . HOH G 4 .   ? 13.580  -9.717  58.834 1.00  32.11 ? 2082 HOH B O   1 
HETATM 2788 O O   . HOH G 4 .   ? 12.970  -2.699  51.294 1.00  45.98 ? 2083 HOH B O   1 
HETATM 2789 O O   . HOH G 4 .   ? 8.852   0.319   37.895 1.00  33.63 ? 2084 HOH B O   1 
HETATM 2790 O O   . HOH G 4 .   ? 5.162   2.865   34.172 1.00  42.53 ? 2085 HOH B O   1 
HETATM 2791 O O   . HOH H 4 .   ? 12.002  -16.556 35.524 1.00  40.47 ? 2001 HOH S O   1 
HETATM 2792 O O   . HOH H 4 .   ? 15.334  -21.682 39.927 1.00  48.87 ? 2002 HOH S O   1 
HETATM 2793 O O   . HOH H 4 .   ? 15.995  -17.457 37.227 1.00  27.08 ? 2003 HOH S O   1 
HETATM 2794 O O   . HOH H 4 .   ? 10.175  -16.584 50.789 1.00  50.25 ? 2004 HOH S O   1 
HETATM 2795 O O   . HOH I 4 .   ? -16.381 22.039  27.301 1.00  54.61 ? 2001 HOH T O   1 
HETATM 2796 O O   . HOH I 4 .   ? -9.573  20.525  23.898 1.00  49.97 ? 2002 HOH T O   1 
HETATM 2797 O O   . HOH I 4 .   ? -15.795 22.491  31.068 1.00  39.69 ? 2003 HOH T O   1 
HETATM 2798 O O   . HOH I 4 .   ? 3.091   28.297  32.043 1.00  32.44 ? 2004 HOH T O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   108 ?   ?   ?   A . n 
A 1 2   ALA 2   109 ?   ?   ?   A . n 
A 1 3   MET 3   110 110 MET MET A . n 
A 1 4   ASP 4   111 111 ASP ASP A . n 
A 1 5   PRO 5   112 112 PRO PRO A . n 
A 1 6   ARG 6   113 113 ARG ARG A . n 
A 1 7   GLU 7   114 114 GLU GLU A . n 
A 1 8   VAL 8   115 115 VAL VAL A . n 
A 1 9   ILE 9   116 116 ILE ILE A . n 
A 1 10  LEU 10  117 117 LEU LEU A . n 
A 1 11  CYS 11  118 118 CYS CYS A . n 
A 1 12  LYS 12  119 119 LYS LYS A . n 
A 1 13  ASP 13  120 120 ASP ASP A . n 
A 1 14  GLN 14  121 121 GLN GLN A . n 
A 1 15  ASP 15  122 122 ASP ASP A . n 
A 1 16  GLY 16  123 123 GLY GLY A . n 
A 1 17  LYS 17  124 124 LYS LYS A . n 
A 1 18  ILE 18  125 125 ILE ILE A . n 
A 1 19  GLY 19  126 126 GLY GLY A . n 
A 1 20  LEU 20  127 127 LEU LEU A . n 
A 1 21  ARG 21  128 128 ARG ARG A . n 
A 1 22  LEU 22  129 129 LEU LEU A . n 
A 1 23  LYS 23  130 130 LYS LYS A . n 
A 1 24  SER 24  131 131 SER SER A . n 
A 1 25  ILE 25  132 132 ILE ILE A . n 
A 1 26  ASP 26  133 133 ASP ASP A . n 
A 1 27  ASN 27  134 134 ASN ASN A . n 
A 1 28  GLY 28  135 135 GLY GLY A . n 
A 1 29  ILE 29  136 136 ILE ILE A . n 
A 1 30  PHE 30  137 137 PHE PHE A . n 
A 1 31  VAL 31  138 138 VAL VAL A . n 
A 1 32  GLN 32  139 139 GLN GLN A . n 
A 1 33  LEU 33  140 140 LEU LEU A . n 
A 1 34  VAL 34  141 141 VAL VAL A . n 
A 1 35  GLN 35  142 142 GLN GLN A . n 
A 1 36  ALA 36  143 143 ALA ALA A . n 
A 1 37  ASN 37  144 144 ASN ASN A . n 
A 1 38  SER 38  145 145 SER SER A . n 
A 1 39  PRO 39  146 146 PRO PRO A . n 
A 1 40  ALA 40  147 147 ALA ALA A . n 
A 1 41  SER 41  148 148 SER SER A . n 
A 1 42  LEU 42  149 149 LEU LEU A . n 
A 1 43  VAL 43  150 150 VAL VAL A . n 
A 1 44  GLY 44  151 151 GLY GLY A . n 
A 1 45  LEU 45  152 152 LEU LEU A . n 
A 1 46  ARG 46  153 153 ARG ARG A . n 
A 1 47  PHE 47  154 154 PHE PHE A . n 
A 1 48  GLY 48  155 155 GLY GLY A . n 
A 1 49  ASP 49  156 156 ASP ASP A . n 
A 1 50  GLN 50  157 157 GLN GLN A . n 
A 1 51  VAL 51  158 158 VAL VAL A . n 
A 1 52  LEU 52  159 159 LEU LEU A . n 
A 1 53  GLN 53  160 160 GLN GLN A . n 
A 1 54  ILE 54  161 161 ILE ILE A . n 
A 1 55  ASN 55  162 162 ASN ASN A . n 
A 1 56  GLY 56  163 163 GLY GLY A . n 
A 1 57  GLU 57  164 164 GLU GLU A . n 
A 1 58  ASN 58  165 165 ASN ASN A . n 
A 1 59  CYS 59  166 166 CYS CYS A . n 
A 1 60  ALA 60  167 167 ALA ALA A . n 
A 1 61  GLY 61  168 168 GLY GLY A . n 
A 1 62  TRP 62  169 169 TRP TRP A . n 
A 1 63  SER 63  170 170 SER SER A . n 
A 1 64  SER 64  171 171 SER SER A . n 
A 1 65  ASP 65  172 172 ASP ASP A . n 
A 1 66  LYS 66  173 173 LYS LYS A . n 
A 1 67  ALA 67  174 174 ALA ALA A . n 
A 1 68  HIS 68  175 175 HIS HIS A . n 
A 1 69  LYS 69  176 176 LYS LYS A . n 
A 1 70  VAL 70  177 177 VAL VAL A . n 
A 1 71  LEU 71  178 178 LEU LEU A . n 
A 1 72  LYS 72  179 179 LYS LYS A . n 
A 1 73  GLN 73  180 180 GLN GLN A . n 
A 1 74  ALA 74  181 181 ALA ALA A . n 
A 1 75  PHE 75  182 182 PHE PHE A . n 
A 1 76  GLY 76  183 183 GLY GLY A . n 
A 1 77  GLU 77  184 184 GLU GLU A . n 
A 1 78  LYS 78  185 185 LYS LYS A . n 
A 1 79  ILE 79  186 186 ILE ILE A . n 
A 1 80  THR 80  187 187 THR THR A . n 
A 1 81  MET 81  188 188 MET MET A . n 
A 1 82  THR 82  189 189 THR THR A . n 
A 1 83  ILE 83  190 190 ILE ILE A . n 
A 1 84  ARG 84  191 191 ARG ARG A . n 
A 1 85  ASP 85  192 192 ASP ASP A . n 
A 1 86  ARG 86  193 193 ARG ARG A . n 
A 1 87  PRO 87  194 194 PRO PRO A . n 
A 1 88  PHE 88  195 195 PHE PHE A . n 
A 1 89  GLU 89  196 196 GLU GLU A . n 
A 1 90  ARG 90  197 197 ARG ARG A . n 
A 1 91  THR 91  198 198 THR THR A . n 
A 1 92  ILE 92  199 199 ILE ILE A . n 
A 1 93  THR 93  200 200 THR THR A . n 
A 1 94  MET 94  201 201 MET MET A . n 
A 1 95  HIS 95  202 202 HIS HIS A . n 
A 1 96  LYS 96  203 203 LYS LYS A . n 
A 1 97  ASP 97  204 204 ASP ASP A . n 
A 1 98  SER 98  205 205 SER SER A . n 
A 1 99  THR 99  206 206 THR THR A . n 
A 1 100 GLY 100 207 207 GLY GLY A . n 
A 1 101 HIS 101 208 208 HIS HIS A . n 
A 1 102 VAL 102 209 209 VAL VAL A . n 
A 1 103 GLY 103 210 210 GLY GLY A . n 
A 1 104 PHE 104 211 211 PHE PHE A . n 
A 1 105 ILE 105 212 212 ILE ILE A . n 
A 1 106 PHE 106 213 213 PHE PHE A . n 
A 1 107 LYS 107 214 214 LYS LYS A . n 
A 1 108 ASN 108 215 215 ASN ASN A . n 
A 1 109 GLY 109 216 216 GLY GLY A . n 
A 1 110 LYS 110 217 217 LYS LYS A . n 
A 1 111 ILE 111 218 218 ILE ILE A . n 
A 1 112 THR 112 219 219 THR THR A . n 
A 1 113 SER 113 220 220 SER SER A . n 
A 1 114 ILE 114 221 221 ILE ILE A . n 
A 1 115 VAL 115 222 222 VAL VAL A . n 
A 1 116 LYS 116 223 223 LYS LYS A . n 
A 1 117 ASP 117 224 224 ASP ASP A . n 
A 1 118 SER 118 225 225 SER SER A . n 
A 1 119 SER 119 226 226 SER SER A . n 
A 1 120 ALA 120 227 227 ALA ALA A . n 
A 1 121 ALA 121 228 228 ALA ALA A . n 
A 1 122 ARG 122 229 229 ARG ARG A . n 
A 1 123 ASN 123 230 230 ASN ASN A . n 
A 1 124 GLY 124 231 231 GLY GLY A . n 
A 1 125 LEU 125 232 232 LEU LEU A . n 
A 1 126 LEU 126 233 233 LEU LEU A . n 
A 1 127 THR 127 234 234 THR THR A . n 
A 1 128 GLU 128 235 235 GLU GLU A . n 
A 1 129 HIS 129 236 236 HIS HIS A . n 
A 1 130 ASN 130 237 237 ASN ASN A . n 
A 1 131 ILE 131 238 238 ILE ILE A . n 
A 1 132 CYS 132 239 239 CYS CYS A . n 
A 1 133 GLU 133 240 240 GLU GLU A . n 
A 1 134 ILE 134 241 241 ILE ILE A . n 
A 1 135 ASN 135 242 242 ASN ASN A . n 
A 1 136 GLY 136 243 243 GLY GLY A . n 
A 1 137 GLN 137 244 244 GLN GLN A . n 
A 1 138 ASN 138 245 245 ASN ASN A . n 
A 1 139 VAL 139 246 246 VAL VAL A . n 
A 1 140 ILE 140 247 247 ILE ILE A . n 
A 1 141 GLY 141 248 248 GLY GLY A . n 
A 1 142 LEU 142 249 249 LEU LEU A . n 
A 1 143 LYS 143 250 250 LYS LYS A . n 
A 1 144 ASP 144 251 251 ASP ASP A . n 
A 1 145 SER 145 252 252 SER SER A . n 
A 1 146 GLN 146 253 253 GLN GLN A . n 
A 1 147 ILE 147 254 254 ILE ILE A . n 
A 1 148 ALA 148 255 255 ALA ALA A . n 
A 1 149 ASP 149 256 256 ASP ASP A . n 
A 1 150 ILE 150 257 257 ILE ILE A . n 
A 1 151 LEU 151 258 258 LEU LEU A . n 
A 1 152 SER 152 259 259 SER SER A . n 
A 1 153 THR 153 260 260 THR THR A . n 
A 1 154 SER 154 261 261 SER SER A . n 
A 1 155 GLY 155 262 262 GLY GLY A . n 
A 1 156 THR 156 263 263 THR THR A . n 
A 1 157 VAL 157 264 264 VAL VAL A . n 
A 1 158 VAL 158 265 265 VAL VAL A . n 
A 1 159 THR 159 266 266 THR THR A . n 
A 1 160 ILE 160 267 267 ILE ILE A . n 
A 1 161 THR 161 268 268 THR THR A . n 
A 1 162 ILE 162 269 269 ILE ILE A . n 
A 1 163 MET 163 270 270 MET MET A . n 
A 1 164 PRO 164 271 271 PRO PRO A . n 
A 1 165 ALA 165 272 272 ALA ALA A . n 
A 1 166 PHE 166 273 273 PHE PHE A . n 
B 1 1   GLY 1   108 ?   ?   ?   B . n 
B 1 2   ALA 2   109 ?   ?   ?   B . n 
B 1 3   MET 3   110 110 MET MET B . n 
B 1 4   ASP 4   111 111 ASP ASP B . n 
B 1 5   PRO 5   112 112 PRO PRO B . n 
B 1 6   ARG 6   113 113 ARG ARG B . n 
B 1 7   GLU 7   114 114 GLU GLU B . n 
B 1 8   VAL 8   115 115 VAL VAL B . n 
B 1 9   ILE 9   116 116 ILE ILE B . n 
B 1 10  LEU 10  117 117 LEU LEU B . n 
B 1 11  CYS 11  118 118 CYS CYS B . n 
B 1 12  LYS 12  119 119 LYS LYS B . n 
B 1 13  ASP 13  120 120 ASP ASP B . n 
B 1 14  GLN 14  121 121 GLN GLN B . n 
B 1 15  ASP 15  122 122 ASP ASP B . n 
B 1 16  GLY 16  123 123 GLY GLY B . n 
B 1 17  LYS 17  124 124 LYS LYS B . n 
B 1 18  ILE 18  125 125 ILE ILE B . n 
B 1 19  GLY 19  126 126 GLY GLY B . n 
B 1 20  LEU 20  127 127 LEU LEU B . n 
B 1 21  ARG 21  128 128 ARG ARG B . n 
B 1 22  LEU 22  129 129 LEU LEU B . n 
B 1 23  LYS 23  130 130 LYS LYS B . n 
B 1 24  SER 24  131 131 SER SER B . n 
B 1 25  ILE 25  132 132 ILE ILE B . n 
B 1 26  ASP 26  133 133 ASP ASP B . n 
B 1 27  ASN 27  134 134 ASN ASN B . n 
B 1 28  GLY 28  135 135 GLY GLY B . n 
B 1 29  ILE 29  136 136 ILE ILE B . n 
B 1 30  PHE 30  137 137 PHE PHE B . n 
B 1 31  VAL 31  138 138 VAL VAL B . n 
B 1 32  GLN 32  139 139 GLN GLN B . n 
B 1 33  LEU 33  140 140 LEU LEU B . n 
B 1 34  VAL 34  141 141 VAL VAL B . n 
B 1 35  GLN 35  142 142 GLN GLN B . n 
B 1 36  ALA 36  143 143 ALA ALA B . n 
B 1 37  ASN 37  144 144 ASN ASN B . n 
B 1 38  SER 38  145 145 SER SER B . n 
B 1 39  PRO 39  146 146 PRO PRO B . n 
B 1 40  ALA 40  147 147 ALA ALA B . n 
B 1 41  SER 41  148 148 SER SER B . n 
B 1 42  LEU 42  149 149 LEU LEU B . n 
B 1 43  VAL 43  150 150 VAL VAL B . n 
B 1 44  GLY 44  151 151 GLY GLY B . n 
B 1 45  LEU 45  152 152 LEU LEU B . n 
B 1 46  ARG 46  153 153 ARG ARG B . n 
B 1 47  PHE 47  154 154 PHE PHE B . n 
B 1 48  GLY 48  155 155 GLY GLY B . n 
B 1 49  ASP 49  156 156 ASP ASP B . n 
B 1 50  GLN 50  157 157 GLN GLN B . n 
B 1 51  VAL 51  158 158 VAL VAL B . n 
B 1 52  LEU 52  159 159 LEU LEU B . n 
B 1 53  GLN 53  160 160 GLN GLN B . n 
B 1 54  ILE 54  161 161 ILE ILE B . n 
B 1 55  ASN 55  162 162 ASN ASN B . n 
B 1 56  GLY 56  163 163 GLY GLY B . n 
B 1 57  GLU 57  164 164 GLU GLU B . n 
B 1 58  ASN 58  165 165 ASN ASN B . n 
B 1 59  CYS 59  166 166 CYS CYS B . n 
B 1 60  ALA 60  167 167 ALA ALA B . n 
B 1 61  GLY 61  168 168 GLY GLY B . n 
B 1 62  TRP 62  169 169 TRP TRP B . n 
B 1 63  SER 63  170 170 SER SER B . n 
B 1 64  SER 64  171 171 SER SER B . n 
B 1 65  ASP 65  172 172 ASP ASP B . n 
B 1 66  LYS 66  173 173 LYS LYS B . n 
B 1 67  ALA 67  174 174 ALA ALA B . n 
B 1 68  HIS 68  175 175 HIS HIS B . n 
B 1 69  LYS 69  176 176 LYS LYS B . n 
B 1 70  VAL 70  177 177 VAL VAL B . n 
B 1 71  LEU 71  178 178 LEU LEU B . n 
B 1 72  LYS 72  179 179 LYS LYS B . n 
B 1 73  GLN 73  180 180 GLN GLN B . n 
B 1 74  ALA 74  181 181 ALA ALA B . n 
B 1 75  PHE 75  182 182 PHE PHE B . n 
B 1 76  GLY 76  183 183 GLY GLY B . n 
B 1 77  GLU 77  184 184 GLU GLU B . n 
B 1 78  LYS 78  185 185 LYS LYS B . n 
B 1 79  ILE 79  186 186 ILE ILE B . n 
B 1 80  THR 80  187 187 THR THR B . n 
B 1 81  MET 81  188 188 MET MET B . n 
B 1 82  THR 82  189 189 THR THR B . n 
B 1 83  ILE 83  190 190 ILE ILE B . n 
B 1 84  ARG 84  191 191 ARG ARG B . n 
B 1 85  ASP 85  192 192 ASP ASP B . n 
B 1 86  ARG 86  193 193 ARG ARG B . n 
B 1 87  PRO 87  194 194 PRO PRO B . n 
B 1 88  PHE 88  195 195 PHE PHE B . n 
B 1 89  GLU 89  196 196 GLU GLU B . n 
B 1 90  ARG 90  197 197 ARG ARG B . n 
B 1 91  THR 91  198 198 THR THR B . n 
B 1 92  ILE 92  199 199 ILE ILE B . n 
B 1 93  THR 93  200 200 THR THR B . n 
B 1 94  MET 94  201 201 MET MET B . n 
B 1 95  HIS 95  202 202 HIS HIS B . n 
B 1 96  LYS 96  203 203 LYS LYS B . n 
B 1 97  ASP 97  204 204 ASP ASP B . n 
B 1 98  SER 98  205 205 SER SER B . n 
B 1 99  THR 99  206 206 THR THR B . n 
B 1 100 GLY 100 207 207 GLY GLY B . n 
B 1 101 HIS 101 208 208 HIS HIS B . n 
B 1 102 VAL 102 209 209 VAL VAL B . n 
B 1 103 GLY 103 210 210 GLY GLY B . n 
B 1 104 PHE 104 211 211 PHE PHE B . n 
B 1 105 ILE 105 212 212 ILE ILE B . n 
B 1 106 PHE 106 213 213 PHE PHE B . n 
B 1 107 LYS 107 214 214 LYS LYS B . n 
B 1 108 ASN 108 215 215 ASN ASN B . n 
B 1 109 GLY 109 216 216 GLY GLY B . n 
B 1 110 LYS 110 217 217 LYS LYS B . n 
B 1 111 ILE 111 218 218 ILE ILE B . n 
B 1 112 THR 112 219 219 THR THR B . n 
B 1 113 SER 113 220 220 SER SER B . n 
B 1 114 ILE 114 221 221 ILE ILE B . n 
B 1 115 VAL 115 222 222 VAL VAL B . n 
B 1 116 LYS 116 223 223 LYS LYS B . n 
B 1 117 ASP 117 224 224 ASP ASP B . n 
B 1 118 SER 118 225 225 SER SER B . n 
B 1 119 SER 119 226 226 SER SER B . n 
B 1 120 ALA 120 227 227 ALA ALA B . n 
B 1 121 ALA 121 228 228 ALA ALA B . n 
B 1 122 ARG 122 229 229 ARG ARG B . n 
B 1 123 ASN 123 230 230 ASN ASN B . n 
B 1 124 GLY 124 231 231 GLY GLY B . n 
B 1 125 LEU 125 232 232 LEU LEU B . n 
B 1 126 LEU 126 233 233 LEU LEU B . n 
B 1 127 THR 127 234 234 THR THR B . n 
B 1 128 GLU 128 235 235 GLU GLU B . n 
B 1 129 HIS 129 236 236 HIS HIS B . n 
B 1 130 ASN 130 237 237 ASN ASN B . n 
B 1 131 ILE 131 238 238 ILE ILE B . n 
B 1 132 CYS 132 239 239 CYS CYS B . n 
B 1 133 GLU 133 240 240 GLU GLU B . n 
B 1 134 ILE 134 241 241 ILE ILE B . n 
B 1 135 ASN 135 242 242 ASN ASN B . n 
B 1 136 GLY 136 243 243 GLY GLY B . n 
B 1 137 GLN 137 244 244 GLN GLN B . n 
B 1 138 ASN 138 245 245 ASN ASN B . n 
B 1 139 VAL 139 246 246 VAL VAL B . n 
B 1 140 ILE 140 247 247 ILE ILE B . n 
B 1 141 GLY 141 248 248 GLY GLY B . n 
B 1 142 LEU 142 249 249 LEU LEU B . n 
B 1 143 LYS 143 250 250 LYS LYS B . n 
B 1 144 ASP 144 251 251 ASP ASP B . n 
B 1 145 SER 145 252 252 SER SER B . n 
B 1 146 GLN 146 253 253 GLN GLN B . n 
B 1 147 ILE 147 254 254 ILE ILE B . n 
B 1 148 ALA 148 255 255 ALA ALA B . n 
B 1 149 ASP 149 256 256 ASP ASP B . n 
B 1 150 ILE 150 257 257 ILE ILE B . n 
B 1 151 LEU 151 258 258 LEU LEU B . n 
B 1 152 SER 152 259 259 SER SER B . n 
B 1 153 THR 153 260 260 THR THR B . n 
B 1 154 SER 154 261 261 SER SER B . n 
B 1 155 GLY 155 262 262 GLY GLY B . n 
B 1 156 THR 156 263 263 THR THR B . n 
B 1 157 VAL 157 264 264 VAL VAL B . n 
B 1 158 VAL 158 265 265 VAL VAL B . n 
B 1 159 THR 159 266 266 THR THR B . n 
B 1 160 ILE 160 267 267 ILE ILE B . n 
B 1 161 THR 161 268 268 THR THR B . n 
B 1 162 ILE 162 269 269 ILE ILE B . n 
B 1 163 MET 163 270 270 MET MET B . n 
B 1 164 PRO 164 271 271 PRO PRO B . n 
B 1 165 ALA 165 272 272 ALA ALA B . n 
B 1 166 PHE 166 273 ?   ?   ?   B . n 
C 2 1   THR 1   1   ?   ?   ?   S . n 
C 2 2   ASN 2   2   2   ASN ASN S . n 
C 2 3   GLU 3   3   3   GLU GLU S . n 
C 2 4   TYR 4   4   4   TYR TYR S . n 
C 2 5   TYR 5   5   5   TYR TYR S . n 
C 2 6   VAL 6   6   6   VAL VAL S . n 
D 2 1   THR 1   1   ?   ?   ?   T . n 
D 2 2   ASN 2   2   2   ASN ASN T . n 
D 2 3   GLU 3   3   3   GLU GLU T . n 
D 2 4   TYR 4   4   4   TYR TYR T . n 
D 2 5   TYR 5   5   5   TYR TYR T . n 
D 2 6   VAL 6   6   6   VAL VAL T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 BEZ 1   1274 1274 BEZ BEZ A . 
F 4 HOH 1   2001 2001 HOH HOH A . 
F 4 HOH 2   2002 2002 HOH HOH A . 
F 4 HOH 3   2003 2003 HOH HOH A . 
F 4 HOH 4   2004 2004 HOH HOH A . 
F 4 HOH 5   2005 2005 HOH HOH A . 
F 4 HOH 6   2006 2006 HOH HOH A . 
F 4 HOH 7   2007 2007 HOH HOH A . 
F 4 HOH 8   2008 2008 HOH HOH A . 
F 4 HOH 9   2009 2009 HOH HOH A . 
F 4 HOH 10  2010 2010 HOH HOH A . 
F 4 HOH 11  2011 2011 HOH HOH A . 
F 4 HOH 12  2012 2012 HOH HOH A . 
F 4 HOH 13  2013 2013 HOH HOH A . 
F 4 HOH 14  2014 2014 HOH HOH A . 
F 4 HOH 15  2015 2015 HOH HOH A . 
F 4 HOH 16  2016 2016 HOH HOH A . 
F 4 HOH 17  2017 2017 HOH HOH A . 
F 4 HOH 18  2018 2018 HOH HOH A . 
F 4 HOH 19  2019 2019 HOH HOH A . 
F 4 HOH 20  2020 2020 HOH HOH A . 
F 4 HOH 21  2021 2021 HOH HOH A . 
F 4 HOH 22  2022 2022 HOH HOH A . 
F 4 HOH 23  2023 2023 HOH HOH A . 
F 4 HOH 24  2024 2024 HOH HOH A . 
F 4 HOH 25  2025 2025 HOH HOH A . 
F 4 HOH 26  2026 2026 HOH HOH A . 
F 4 HOH 27  2027 2027 HOH HOH A . 
F 4 HOH 28  2028 2028 HOH HOH A . 
F 4 HOH 29  2029 2029 HOH HOH A . 
F 4 HOH 30  2030 2030 HOH HOH A . 
F 4 HOH 31  2031 2031 HOH HOH A . 
F 4 HOH 32  2032 2032 HOH HOH A . 
F 4 HOH 33  2033 2033 HOH HOH A . 
F 4 HOH 34  2034 2034 HOH HOH A . 
F 4 HOH 35  2035 2035 HOH HOH A . 
F 4 HOH 36  2036 2036 HOH HOH A . 
F 4 HOH 37  2037 2037 HOH HOH A . 
F 4 HOH 38  2038 2038 HOH HOH A . 
F 4 HOH 39  2039 2039 HOH HOH A . 
F 4 HOH 40  2040 2040 HOH HOH A . 
F 4 HOH 41  2041 2041 HOH HOH A . 
F 4 HOH 42  2042 2042 HOH HOH A . 
F 4 HOH 43  2043 2043 HOH HOH A . 
F 4 HOH 44  2044 2044 HOH HOH A . 
F 4 HOH 45  2045 2045 HOH HOH A . 
F 4 HOH 46  2046 2046 HOH HOH A . 
F 4 HOH 47  2047 2047 HOH HOH A . 
F 4 HOH 48  2048 2048 HOH HOH A . 
F 4 HOH 49  2049 2049 HOH HOH A . 
F 4 HOH 50  2050 2050 HOH HOH A . 
F 4 HOH 51  2051 2051 HOH HOH A . 
F 4 HOH 52  2052 2052 HOH HOH A . 
F 4 HOH 53  2053 2053 HOH HOH A . 
F 4 HOH 54  2054 2054 HOH HOH A . 
F 4 HOH 55  2055 2055 HOH HOH A . 
F 4 HOH 56  2056 2056 HOH HOH A . 
F 4 HOH 57  2057 2057 HOH HOH A . 
F 4 HOH 58  2058 2058 HOH HOH A . 
F 4 HOH 59  2059 2059 HOH HOH A . 
F 4 HOH 60  2060 2060 HOH HOH A . 
F 4 HOH 61  2061 2061 HOH HOH A . 
F 4 HOH 62  2062 2062 HOH HOH A . 
F 4 HOH 63  2063 2063 HOH HOH A . 
F 4 HOH 64  2064 2064 HOH HOH A . 
F 4 HOH 65  2065 2065 HOH HOH A . 
F 4 HOH 66  2066 2066 HOH HOH A . 
F 4 HOH 67  2067 2067 HOH HOH A . 
F 4 HOH 68  2068 2068 HOH HOH A . 
F 4 HOH 69  2069 2069 HOH HOH A . 
F 4 HOH 70  2070 2070 HOH HOH A . 
F 4 HOH 71  2071 2071 HOH HOH A . 
F 4 HOH 72  2072 2072 HOH HOH A . 
F 4 HOH 73  2073 2073 HOH HOH A . 
F 4 HOH 74  2074 2074 HOH HOH A . 
F 4 HOH 75  2075 2075 HOH HOH A . 
F 4 HOH 76  2076 2076 HOH HOH A . 
F 4 HOH 77  2077 2077 HOH HOH A . 
F 4 HOH 78  2078 2078 HOH HOH A . 
F 4 HOH 79  2079 2079 HOH HOH A . 
F 4 HOH 80  2080 2080 HOH HOH A . 
F 4 HOH 81  2081 2081 HOH HOH A . 
F 4 HOH 82  2082 2082 HOH HOH A . 
F 4 HOH 83  2083 2083 HOH HOH A . 
F 4 HOH 84  2084 2084 HOH HOH A . 
F 4 HOH 85  2085 2085 HOH HOH A . 
F 4 HOH 86  2086 2086 HOH HOH A . 
F 4 HOH 87  2087 2087 HOH HOH A . 
F 4 HOH 88  2088 2088 HOH HOH A . 
F 4 HOH 89  2089 2089 HOH HOH A . 
F 4 HOH 90  2090 2090 HOH HOH A . 
F 4 HOH 91  2091 2091 HOH HOH A . 
F 4 HOH 92  2092 2092 HOH HOH A . 
F 4 HOH 93  2093 2093 HOH HOH A . 
F 4 HOH 94  2094 2094 HOH HOH A . 
F 4 HOH 95  2095 2095 HOH HOH A . 
F 4 HOH 96  2096 2096 HOH HOH A . 
F 4 HOH 97  2097 2097 HOH HOH A . 
F 4 HOH 98  2098 2098 HOH HOH A . 
F 4 HOH 99  2099 2099 HOH HOH A . 
F 4 HOH 100 2100 2100 HOH HOH A . 
F 4 HOH 101 2101 2101 HOH HOH A . 
F 4 HOH 102 2102 2102 HOH HOH A . 
F 4 HOH 103 2103 2103 HOH HOH A . 
F 4 HOH 104 2104 2104 HOH HOH A . 
F 4 HOH 105 2105 2105 HOH HOH A . 
F 4 HOH 106 2106 2106 HOH HOH A . 
G 4 HOH 1   2001 2001 HOH HOH B . 
G 4 HOH 2   2002 2002 HOH HOH B . 
G 4 HOH 3   2003 2003 HOH HOH B . 
G 4 HOH 4   2004 2004 HOH HOH B . 
G 4 HOH 5   2005 2005 HOH HOH B . 
G 4 HOH 6   2006 2006 HOH HOH B . 
G 4 HOH 7   2007 2007 HOH HOH B . 
G 4 HOH 8   2008 2008 HOH HOH B . 
G 4 HOH 9   2009 2009 HOH HOH B . 
G 4 HOH 10  2010 2010 HOH HOH B . 
G 4 HOH 11  2011 2011 HOH HOH B . 
G 4 HOH 12  2012 2012 HOH HOH B . 
G 4 HOH 13  2013 2013 HOH HOH B . 
G 4 HOH 14  2014 2014 HOH HOH B . 
G 4 HOH 15  2015 2015 HOH HOH B . 
G 4 HOH 16  2016 2016 HOH HOH B . 
G 4 HOH 17  2017 2017 HOH HOH B . 
G 4 HOH 18  2018 2018 HOH HOH B . 
G 4 HOH 19  2019 2019 HOH HOH B . 
G 4 HOH 20  2020 2020 HOH HOH B . 
G 4 HOH 21  2021 2021 HOH HOH B . 
G 4 HOH 22  2022 2022 HOH HOH B . 
G 4 HOH 23  2023 2023 HOH HOH B . 
G 4 HOH 24  2024 2024 HOH HOH B . 
G 4 HOH 25  2025 2025 HOH HOH B . 
G 4 HOH 26  2026 2026 HOH HOH B . 
G 4 HOH 27  2027 2027 HOH HOH B . 
G 4 HOH 28  2028 2028 HOH HOH B . 
G 4 HOH 29  2029 2029 HOH HOH B . 
G 4 HOH 30  2030 2030 HOH HOH B . 
G 4 HOH 31  2031 2031 HOH HOH B . 
G 4 HOH 32  2032 2032 HOH HOH B . 
G 4 HOH 33  2033 2033 HOH HOH B . 
G 4 HOH 34  2034 2034 HOH HOH B . 
G 4 HOH 35  2035 2035 HOH HOH B . 
G 4 HOH 36  2036 2036 HOH HOH B . 
G 4 HOH 37  2037 2037 HOH HOH B . 
G 4 HOH 38  2038 2038 HOH HOH B . 
G 4 HOH 39  2039 2039 HOH HOH B . 
G 4 HOH 40  2040 2040 HOH HOH B . 
G 4 HOH 41  2041 2041 HOH HOH B . 
G 4 HOH 42  2042 2042 HOH HOH B . 
G 4 HOH 43  2043 2043 HOH HOH B . 
G 4 HOH 44  2044 2044 HOH HOH B . 
G 4 HOH 45  2045 2045 HOH HOH B . 
G 4 HOH 46  2046 2046 HOH HOH B . 
G 4 HOH 47  2047 2047 HOH HOH B . 
G 4 HOH 48  2048 2048 HOH HOH B . 
G 4 HOH 49  2049 2049 HOH HOH B . 
G 4 HOH 50  2050 2050 HOH HOH B . 
G 4 HOH 51  2051 2051 HOH HOH B . 
G 4 HOH 52  2052 2052 HOH HOH B . 
G 4 HOH 53  2053 2053 HOH HOH B . 
G 4 HOH 54  2054 2054 HOH HOH B . 
G 4 HOH 55  2055 2055 HOH HOH B . 
G 4 HOH 56  2056 2056 HOH HOH B . 
G 4 HOH 57  2057 2057 HOH HOH B . 
G 4 HOH 58  2058 2058 HOH HOH B . 
G 4 HOH 59  2059 2059 HOH HOH B . 
G 4 HOH 60  2060 2060 HOH HOH B . 
G 4 HOH 61  2061 2061 HOH HOH B . 
G 4 HOH 62  2062 2062 HOH HOH B . 
G 4 HOH 63  2063 2063 HOH HOH B . 
G 4 HOH 64  2064 2064 HOH HOH B . 
G 4 HOH 65  2065 2065 HOH HOH B . 
G 4 HOH 66  2066 2066 HOH HOH B . 
G 4 HOH 67  2067 2067 HOH HOH B . 
G 4 HOH 68  2068 2068 HOH HOH B . 
G 4 HOH 69  2069 2069 HOH HOH B . 
G 4 HOH 70  2070 2070 HOH HOH B . 
G 4 HOH 71  2071 2071 HOH HOH B . 
G 4 HOH 72  2072 2072 HOH HOH B . 
G 4 HOH 73  2073 2073 HOH HOH B . 
G 4 HOH 74  2074 2074 HOH HOH B . 
G 4 HOH 75  2075 2075 HOH HOH B . 
G 4 HOH 76  2076 2076 HOH HOH B . 
G 4 HOH 77  2077 2077 HOH HOH B . 
G 4 HOH 78  2078 2078 HOH HOH B . 
G 4 HOH 79  2079 2079 HOH HOH B . 
G 4 HOH 80  2080 2080 HOH HOH B . 
G 4 HOH 81  2081 2081 HOH HOH B . 
G 4 HOH 82  2082 2082 HOH HOH B . 
G 4 HOH 83  2083 2083 HOH HOH B . 
G 4 HOH 84  2084 2084 HOH HOH B . 
G 4 HOH 85  2085 2085 HOH HOH B . 
H 4 HOH 1   2001 2001 HOH HOH S . 
H 4 HOH 2   2002 2002 HOH HOH S . 
H 4 HOH 3   2003 2003 HOH HOH S . 
H 4 HOH 4   2004 2004 HOH HOH S . 
I 4 HOH 1   2001 2001 HOH HOH T . 
I 4 HOH 2   2002 2002 HOH HOH T . 
I 4 HOH 3   2003 2003 HOH HOH T . 
I 4 HOH 4   2004 2004 HOH HOH T . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,E,F,I 
2 1 B,C,G,H   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1080 ? 
1 MORE         -4.1 ? 
1 'SSA (A^2)'  9530 ? 
2 'ABSA (A^2)' 910  ? 
2 MORE         -5.6 ? 
2 'SSA (A^2)'  9380 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-03-22 
2 'Structure model' 1 1 2012-05-30 
3 'Structure model' 1 2 2019-01-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Derived calculations'      
2 2 'Structure model' 'Non-polymer description'   
3 2 'Structure model' Other                       
4 2 'Structure model' 'Structure summary'         
5 2 'Structure model' 'Version format compliance' 
6 3 'Structure model' 'Data collection'           
7 3 'Structure model' 'Experimental preparation'  
8 3 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' exptl_crystal_grow  
2 3 'Structure model' pdbx_entity_src_syn 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_exptl_crystal_grow.method' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.1.24 ? 1 
HKL-2000 'data reduction' .      ? 2 
HKL-2000 'data scaling'   .      ? 3 
AMoRE    phasing          .      ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  B SER 261 ? ? O B HOH 2081 ? ? 2.08 
2 1 SD B MET 201 ? ? O B HOH 2070 ? ? 2.16 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2032 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2058 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_554 
_pdbx_validate_symm_contact.dist              2.14 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              111 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              111 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              111 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                125.37 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            7.07 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 120 ? ? -86.29 -151.27 
2 1 PHE A 154 ? ? -38.26 119.10  
3 1 ARG A 193 ? ? -4.14  89.14   
4 1 ASP A 204 ? ? -84.29 -154.16 
5 1 ASP B 120 ? ? -75.77 -157.24 
6 1 ARG B 193 ? ? 2.55   84.90   
7 1 SER B 261 ? ? -79.13 -165.58 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 108 ? A GLY 1   
2 1 Y 1 A ALA 109 ? A ALA 2   
3 1 Y 1 B GLY 108 ? B GLY 1   
4 1 Y 1 B ALA 109 ? B ALA 2   
5 1 Y 1 B PHE 273 ? B PHE 166 
6 1 Y 1 S THR 1   ? C THR 1   
7 1 Y 1 T THR 1   ? D THR 1   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'BENZOIC ACID' BEZ 
4 water          HOH 
#