data_1WER
# 
_entry.id   1WER 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1WER         
WWPDB D_1000177184 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WER 
_pdbx_database_status.recvd_initial_deposition_date   1996-11-20 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Scheffzek, K.'    1 
'Lautwein, A.'     2 
'Kabsch, W.'       3 
'Ahmadian, M.R.'   4 
'Wittinghofer, A.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of the GTPase-activating domain of human p120GAP and implications for the interaction with Ras.' Nature 
384 591  596 1996 NATUAS UK 0028-0836 0006 ? 8955277 10.1038/384591a0 
1       'Crystallization and Preliminary X-Ray Crystallographic Study of the Ras-Gtpase-Activating Domain of Human P120Gap' 
Proteins 27  315  ?   1997 PSFGEY US 0887-3585 0867 ? ?       ?                
2       'Molecular Cloning of Two Types of Gap Complementary DNA from Human Placenta'                                       
Science  242 1697 ?   1988 SCIEAS US 0036-8075 0038 ? ?       ?                
3       'A Cytoplasmic Protein Stimulates Normal N-Ras P21 Gtpase, But Does not Affect Oncogenic Mutants'                   
Science  238 542  ?   1987 SCIEAS US 0036-8075 0038 ? ?       ?                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Scheffzek, K.'    1  
primary 'Lautwein, A.'     2  
primary 'Kabsch, W.'       3  
primary 'Ahmadian, M.R.'   4  
primary 'Wittinghofer, A.' 5  
1       'Scheffzek, K.'    6  
1       'Lautwein, A.'     7  
1       'Scherer, A.'      8  
1       'Franken, S.'      9  
1       'Wittinghofer, A.' 10 
2       'Trahey, M.'       11 
2       'Wong, G.'         12 
2       'Halenbeck, R.'    13 
2       'Rubinfeld, B.'    14 
2       'Martin, G.A.'     15 
2       'Ladner, M.'       16 
2       'Long, C.M.'       17 
2       'Crosier, W.J.'    18 
2       'Watt, K.'         19 
2       'Koths, K.'        20 
2       'Mccormick, F.'    21 
3       'Trahey, M.'       22 
3       'Mccormick, F.'    23 
# 
_cell.entry_id           1WER 
_cell.length_a           42.200 
_cell.length_b           55.600 
_cell.length_c           142.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1WER 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man P120GAP 38223.277 1   ? ? 'CATALYTIC DOMAIN, RESIDUES 714 - 1047' ? 
2 water   nat water   18.015    181 ? ? ?                                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GAP-334, GAPETTE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEKIMPEEEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISMEDEATTLFRATTL
ASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNLTHLLNILSELVEKIFMASEILPPTLRYI
YGCLQKSVQHKWPTNTTMRTRVVSGFVFLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYM
EGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELL
QQKQNQYTKTNDVR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEKIMPEEEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISMEDEATTLFRATTL
ASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNLTHLLNILSELVEKIFMASEILPPTLRYI
YGCLQKSVQHKWPTNTTMRTRVVSGFVFLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYM
EGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELL
QQKQNQYTKTNDVR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   LYS n 
1 4   ILE n 
1 5   MET n 
1 6   PRO n 
1 7   GLU n 
1 8   GLU n 
1 9   GLU n 
1 10  TYR n 
1 11  SER n 
1 12  GLU n 
1 13  PHE n 
1 14  LYS n 
1 15  GLU n 
1 16  LEU n 
1 17  ILE n 
1 18  LEU n 
1 19  GLN n 
1 20  LYS n 
1 21  GLU n 
1 22  LEU n 
1 23  HIS n 
1 24  VAL n 
1 25  VAL n 
1 26  TYR n 
1 27  ALA n 
1 28  LEU n 
1 29  SER n 
1 30  HIS n 
1 31  VAL n 
1 32  CYS n 
1 33  GLY n 
1 34  GLN n 
1 35  ASP n 
1 36  ARG n 
1 37  THR n 
1 38  LEU n 
1 39  LEU n 
1 40  ALA n 
1 41  SER n 
1 42  ILE n 
1 43  LEU n 
1 44  LEU n 
1 45  ARG n 
1 46  ILE n 
1 47  PHE n 
1 48  LEU n 
1 49  HIS n 
1 50  GLU n 
1 51  LYS n 
1 52  LEU n 
1 53  GLU n 
1 54  SER n 
1 55  LEU n 
1 56  LEU n 
1 57  LEU n 
1 58  CYS n 
1 59  THR n 
1 60  LEU n 
1 61  ASN n 
1 62  ASP n 
1 63  ARG n 
1 64  GLU n 
1 65  ILE n 
1 66  SER n 
1 67  MET n 
1 68  GLU n 
1 69  ASP n 
1 70  GLU n 
1 71  ALA n 
1 72  THR n 
1 73  THR n 
1 74  LEU n 
1 75  PHE n 
1 76  ARG n 
1 77  ALA n 
1 78  THR n 
1 79  THR n 
1 80  LEU n 
1 81  ALA n 
1 82  SER n 
1 83  THR n 
1 84  LEU n 
1 85  MET n 
1 86  GLU n 
1 87  GLN n 
1 88  TYR n 
1 89  MET n 
1 90  LYS n 
1 91  ALA n 
1 92  THR n 
1 93  ALA n 
1 94  THR n 
1 95  GLN n 
1 96  PHE n 
1 97  VAL n 
1 98  HIS n 
1 99  HIS n 
1 100 ALA n 
1 101 LEU n 
1 102 LYS n 
1 103 ASP n 
1 104 SER n 
1 105 ILE n 
1 106 LEU n 
1 107 LYS n 
1 108 ILE n 
1 109 MET n 
1 110 GLU n 
1 111 SER n 
1 112 LYS n 
1 113 GLN n 
1 114 SER n 
1 115 CYS n 
1 116 GLU n 
1 117 LEU n 
1 118 SER n 
1 119 PRO n 
1 120 SER n 
1 121 LYS n 
1 122 LEU n 
1 123 GLU n 
1 124 LYS n 
1 125 ASN n 
1 126 GLU n 
1 127 ASP n 
1 128 VAL n 
1 129 ASN n 
1 130 THR n 
1 131 ASN n 
1 132 LEU n 
1 133 THR n 
1 134 HIS n 
1 135 LEU n 
1 136 LEU n 
1 137 ASN n 
1 138 ILE n 
1 139 LEU n 
1 140 SER n 
1 141 GLU n 
1 142 LEU n 
1 143 VAL n 
1 144 GLU n 
1 145 LYS n 
1 146 ILE n 
1 147 PHE n 
1 148 MET n 
1 149 ALA n 
1 150 SER n 
1 151 GLU n 
1 152 ILE n 
1 153 LEU n 
1 154 PRO n 
1 155 PRO n 
1 156 THR n 
1 157 LEU n 
1 158 ARG n 
1 159 TYR n 
1 160 ILE n 
1 161 TYR n 
1 162 GLY n 
1 163 CYS n 
1 164 LEU n 
1 165 GLN n 
1 166 LYS n 
1 167 SER n 
1 168 VAL n 
1 169 GLN n 
1 170 HIS n 
1 171 LYS n 
1 172 TRP n 
1 173 PRO n 
1 174 THR n 
1 175 ASN n 
1 176 THR n 
1 177 THR n 
1 178 MET n 
1 179 ARG n 
1 180 THR n 
1 181 ARG n 
1 182 VAL n 
1 183 VAL n 
1 184 SER n 
1 185 GLY n 
1 186 PHE n 
1 187 VAL n 
1 188 PHE n 
1 189 LEU n 
1 190 ARG n 
1 191 LEU n 
1 192 ILE n 
1 193 CYS n 
1 194 PRO n 
1 195 ALA n 
1 196 ILE n 
1 197 LEU n 
1 198 ASN n 
1 199 PRO n 
1 200 ARG n 
1 201 MET n 
1 202 PHE n 
1 203 ASN n 
1 204 ILE n 
1 205 ILE n 
1 206 SER n 
1 207 ASP n 
1 208 SER n 
1 209 PRO n 
1 210 SER n 
1 211 PRO n 
1 212 ILE n 
1 213 ALA n 
1 214 ALA n 
1 215 ARG n 
1 216 THR n 
1 217 LEU n 
1 218 ILE n 
1 219 LEU n 
1 220 VAL n 
1 221 ALA n 
1 222 LYS n 
1 223 SER n 
1 224 VAL n 
1 225 GLN n 
1 226 ASN n 
1 227 LEU n 
1 228 ALA n 
1 229 ASN n 
1 230 LEU n 
1 231 VAL n 
1 232 GLU n 
1 233 PHE n 
1 234 GLY n 
1 235 ALA n 
1 236 LYS n 
1 237 GLU n 
1 238 PRO n 
1 239 TYR n 
1 240 MET n 
1 241 GLU n 
1 242 GLY n 
1 243 VAL n 
1 244 ASN n 
1 245 PRO n 
1 246 PHE n 
1 247 ILE n 
1 248 LYS n 
1 249 SER n 
1 250 ASN n 
1 251 LYS n 
1 252 HIS n 
1 253 ARG n 
1 254 MET n 
1 255 ILE n 
1 256 MET n 
1 257 PHE n 
1 258 LEU n 
1 259 ASP n 
1 260 GLU n 
1 261 LEU n 
1 262 GLY n 
1 263 ASN n 
1 264 VAL n 
1 265 PRO n 
1 266 GLU n 
1 267 LEU n 
1 268 PRO n 
1 269 ASP n 
1 270 THR n 
1 271 THR n 
1 272 GLU n 
1 273 HIS n 
1 274 SER n 
1 275 ARG n 
1 276 THR n 
1 277 ASP n 
1 278 LEU n 
1 279 SER n 
1 280 ARG n 
1 281 ASP n 
1 282 LEU n 
1 283 ALA n 
1 284 ALA n 
1 285 LEU n 
1 286 HIS n 
1 287 GLU n 
1 288 ILE n 
1 289 CYS n 
1 290 VAL n 
1 291 ALA n 
1 292 HIS n 
1 293 SER n 
1 294 ASP n 
1 295 GLU n 
1 296 LEU n 
1 297 ARG n 
1 298 THR n 
1 299 LEU n 
1 300 SER n 
1 301 ASN n 
1 302 GLU n 
1 303 ARG n 
1 304 GLY n 
1 305 ALA n 
1 306 GLN n 
1 307 GLN n 
1 308 HIS n 
1 309 VAL n 
1 310 LEU n 
1 311 LYS n 
1 312 LYS n 
1 313 LEU n 
1 314 LEU n 
1 315 ALA n 
1 316 ILE n 
1 317 THR n 
1 318 GLU n 
1 319 LEU n 
1 320 LEU n 
1 321 GLN n 
1 322 GLN n 
1 323 LYS n 
1 324 GLN n 
1 325 ASN n 
1 326 GLN n 
1 327 TYR n 
1 328 THR n 
1 329 LYS n 
1 330 THR n 
1 331 ASN n 
1 332 ASP n 
1 333 VAL n 
1 334 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'GENE FRAGMENT OF P120GAP' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                PLACENTA 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    CYTOSOL 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 'GENE FRAGMENT OF P120GAP (POSITION 2258-3259)' 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DG103 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          'PKK233-2 DERIVATIVE' 
_entity_src_gen.pdbx_host_org_vector               PTRC99A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PTRCGAP-334 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RASA1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P20936 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGTLGGGAALGSEFLGAGSVAGA
LGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLPTSLLAETLGPGGGFPPLPPPPYLPPLGAGLGTVDEGDSLD
GPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYY
IGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWV
TNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFK
ICPTPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGY
LLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGE
TPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSE
EFVFDDLPPDINRFEITLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPE
EEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISMEDEATTLFRATTLASTLMEQ
YMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKS
VQHKWPTNTTMRTRVVSGFVFLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFI
KSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQY
TKTNDVR
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WER 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 334 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P20936 
_struct_ref_seq.db_align_beg                  714 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1047 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       714 
_struct_ref_seq.pdbx_auth_seq_align_end       1047 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1WER 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.2 
_exptl_crystal.density_percent_sol   40. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'SEE REFERENCE 1, pH 6.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-03-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID2 
_diffrn_source.pdbx_wavelength             0.99 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1WER 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50. 
_reflns.d_resolution_high            1.6 
_reflns.number_obs                   42457 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98. 
_reflns.pdbx_Rmerge_I_obs            0.0640000 
_reflns.pdbx_Rsym_value              0.0640000 
_reflns.pdbx_netI_over_sigmaI        15.4 
_reflns.B_iso_Wilson_estimate        21.9 
_reflns.pdbx_redundancy              3.9 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.60 
_reflns_shell.d_res_low              1.70 
_reflns_shell.percent_possible_all   97. 
_reflns_shell.Rmerge_I_obs           0.2000000 
_reflns_shell.pdbx_Rsym_value        0.2000000 
_reflns_shell.meanI_over_sigI_obs    6.70 
_reflns_shell.pdbx_redundancy        2.9 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1WER 
_refine.ls_number_reflns_obs                     40803 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               100000.00 
_refine.pdbx_data_cutoff_low_absF                0.10000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             5.00 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    97.9 
_refine.ls_R_factor_obs                          0.2210000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2210000 
_refine.ls_R_factor_R_free                       0.2710000 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  4074 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               26.1 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;RESIDUES 714 - 717 (N-TERMINUS) AND 1042 - 1047
(C-TERMINUS) ARE NOT VISIBLE IN THE ELECTRON DENSITY AND
WERE NOT INCLUDED IN THE MODEL.

RESIDUES 836 - 839 AND 982 - 988 SHOW WEAK ELECTRON DENSITY
FOR MAIN- AND SIDE-CHAIN ATOMS AND WERE MODELLED
STEREOCHEMICALLY.  THE SIDE CHAINS OF THE FOLLOWING
RESIDUES SHOW WEAK OR PARTIAL ELECTRON DENSITY:
GLU 720, GLU 721, GLU 722, LYS 733, GLU 734, GLN 747,
GLU 783, ARG 789, LYS 803, LYS 820, LYS 826, GLN 827,
LYS 858, ARG 894, LYS 949, GLU 950, TYR 952, LYS 961,
THR 989, ASP 990, ARG 993, ASP 994, GLU 1000, ASP 1007,
GLU 1015, ARG 1016, LYS 1024, LYS 1025, ASN 1038.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MULTIPLE ISOMORPHOUS REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1WER 
_refine_analyze.Luzzati_coordinate_error_obs    0.21 
_refine_analyze.Luzzati_sigma_a_obs             0.20 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.23 
_refine_analyze.Luzzati_sigma_a_free            0.15 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2771 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             181 
_refine_hist.number_atoms_total               2952 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        5.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             0.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      22.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.56  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.55  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.44  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.99  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            4.74  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.60 
_refine_ls_shell.d_res_low                        1.70 
_refine_ls_shell.number_reflns_R_work             5917 
_refine_ls_shell.R_factor_R_work                  0.3010000 
_refine_ls_shell.percent_reflns_obs               96.8 
_refine_ls_shell.R_factor_R_free                  0.3140000 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            10.5 
_refine_ls_shell.number_reflns_R_free             696 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1WER 
_struct.title                     'RAS-GTPASE-ACTIVATING DOMAIN OF HUMAN P120GAP' 
_struct.pdbx_descriptor           P120GAP 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WER 
_struct_keywords.pdbx_keywords   'GTPASE ACTIVATION' 
_struct_keywords.text            'GTPASE ACTIVATION, RAS, GAP, SIGNAL TRANSDUCTION, GROWTH REGULATION, CANCER' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 6   ? GLU A 9   ? PRO A 719  GLU A 722  5 ? 4  
HELX_P HELX_P2  2  TYR A 10  ? LEU A 18  ? TYR A 723  LEU A 731  1 ? 9  
HELX_P HELX_P3  3  LEU A 22  ? CYS A 32  ? LEU A 735  CYS A 745  1 ? 11 
HELX_P HELX_P4  4  ASP A 35  ? GLU A 50  ? ASP A 748  GLU A 763  1 ? 16 
HELX_P HELX_P5  5  LEU A 52  ? GLU A 68  ? LEU A 765  GLU A 781  1 ? 17 
HELX_P HELX_P6  6  GLU A 70  ? LEU A 74  ? GLU A 783  LEU A 787  5 ? 5  
HELX_P HELX_P7  7  THR A 79  ? ALA A 93  ? THR A 792  ALA A 806  1 ? 15 
HELX_P HELX_P8  8  ALA A 93  ? SER A 111 ? ALA A 806  SER A 824  1 ? 19 
HELX_P HELX_P9  9  SER A 118 ? LEU A 122 ? SER A 831  LEU A 835  5 ? 5  
HELX_P HELX_P10 10 ASP A 127 ? MET A 148 ? ASP A 840  MET A 861  1 ? 22 
HELX_P HELX_P11 11 ALA A 149 ? LEU A 153 ? ALA A 862  LEU A 866  5 ? 5  
HELX_P HELX_P12 12 PRO A 154 ? TRP A 172 ? PRO A 867  TRP A 885  1 ? 19 
HELX_P HELX_P13 13 THR A 177 ? PHE A 188 ? THR A 890  PHE A 901  1 ? 12 
HELX_P HELX_P14 14 LEU A 191 ? ASN A 198 ? LEU A 904  ASN A 911  1 ? 8  
HELX_P HELX_P15 15 SER A 210 ? ASN A 229 ? SER A 923  ASN A 942  1 ? 20 
HELX_P HELX_P16 16 GLU A 237 ? GLY A 242 ? GLU A 950  GLY A 955  5 ? 6  
HELX_P HELX_P17 17 VAL A 243 ? GLY A 262 ? VAL A 956  GLY A 975  1 ? 20 
HELX_P HELX_P18 18 LEU A 278 ? HIS A 292 ? LEU A 991  HIS A 1005 1 ? 15 
HELX_P HELX_P19 19 HIS A 292 ? ASN A 301 ? HIS A 1005 ASN A 1014 1 ? 10 
HELX_P HELX_P20 20 GLN A 306 ? GLN A 326 ? GLN A 1019 GLN A 1039 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1WER 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WER 
_atom_sites.fract_transf_matrix[1][1]   0.023697 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017986 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007032 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 5   ? -9.249  17.917 35.701  1.00 38.48 ? 718  MET A N   1 
ATOM   2    C CA  . MET A 1 5   ? -9.582  18.789 36.860  1.00 38.66 ? 718  MET A CA  1 
ATOM   3    C C   . MET A 1 5   ? -9.964  20.180 36.362  1.00 38.74 ? 718  MET A C   1 
ATOM   4    O O   . MET A 1 5   ? -9.713  20.514 35.204  1.00 39.16 ? 718  MET A O   1 
ATOM   5    C CB  . MET A 1 5   ? -8.376  18.881 37.796  1.00 40.30 ? 718  MET A CB  1 
ATOM   6    C CG  . MET A 1 5   ? -8.006  17.563 38.457  1.00 42.80 ? 718  MET A CG  1 
ATOM   7    S SD  . MET A 1 5   ? -6.668  17.751 39.640  1.00 43.43 ? 718  MET A SD  1 
ATOM   8    C CE  . MET A 1 5   ? -5.451  18.571 38.620  1.00 43.62 ? 718  MET A CE  1 
ATOM   9    N N   . PRO A 1 6   ? -10.587 21.005 37.227  1.00 38.18 ? 719  PRO A N   1 
ATOM   10   C CA  . PRO A 1 6   ? -10.835 22.418 36.913  1.00 38.90 ? 719  PRO A CA  1 
ATOM   11   C C   . PRO A 1 6   ? -9.568  23.129 36.427  1.00 39.79 ? 719  PRO A C   1 
ATOM   12   O O   . PRO A 1 6   ? -8.474  22.834 36.898  1.00 39.47 ? 719  PRO A O   1 
ATOM   13   C CB  . PRO A 1 6   ? -11.332 22.996 38.236  1.00 37.93 ? 719  PRO A CB  1 
ATOM   14   C CG  . PRO A 1 6   ? -11.931 21.836 38.940  1.00 37.27 ? 719  PRO A CG  1 
ATOM   15   C CD  . PRO A 1 6   ? -11.087 20.652 38.569  1.00 37.60 ? 719  PRO A CD  1 
ATOM   16   N N   . GLU A 1 7   ? -9.729  24.048 35.477  1.00 40.84 ? 720  GLU A N   1 
ATOM   17   C CA  . GLU A 1 7   ? -8.607  24.759 34.863  1.00 41.23 ? 720  GLU A CA  1 
ATOM   18   C C   . GLU A 1 7   ? -7.703  25.401 35.903  1.00 39.81 ? 720  GLU A C   1 
ATOM   19   O O   . GLU A 1 7   ? -6.484  25.353 35.785  1.00 39.46 ? 720  GLU A O   1 
ATOM   20   C CB  . GLU A 1 7   ? -9.129  25.823 33.882  1.00 45.13 ? 720  GLU A CB  1 
ATOM   21   C CG  . GLU A 1 7   ? -8.339  27.139 33.837  1.00 48.51 ? 720  GLU A CG  1 
ATOM   22   C CD  . GLU A 1 7   ? -7.829  27.490 32.445  1.00 50.68 ? 720  GLU A CD  1 
ATOM   23   O OE1 . GLU A 1 7   ? -8.590  27.324 31.466  1.00 49.93 ? 720  GLU A OE1 1 
ATOM   24   O OE2 . GLU A 1 7   ? -6.672  27.963 32.336  1.00 51.76 ? 720  GLU A OE2 1 
ATOM   25   N N   . GLU A 1 8   ? -8.312  25.929 36.956  1.00 39.45 ? 721  GLU A N   1 
ATOM   26   C CA  . GLU A 1 8   ? -7.584  26.590 38.027  1.00 38.77 ? 721  GLU A CA  1 
ATOM   27   C C   . GLU A 1 8   ? -6.579  25.663 38.713  1.00 36.37 ? 721  GLU A C   1 
ATOM   28   O O   . GLU A 1 8   ? -5.487  26.091 39.069  1.00 36.17 ? 721  GLU A O   1 
ATOM   29   C CB  . GLU A 1 8   ? -8.572  27.157 39.052  1.00 42.38 ? 721  GLU A CB  1 
ATOM   30   C CG  . GLU A 1 8   ? -9.337  28.404 38.580  1.00 47.10 ? 721  GLU A CG  1 
ATOM   31   C CD  . GLU A 1 8   ? -10.294 28.130 37.419  1.00 49.70 ? 721  GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 8   ? -11.427 27.668 37.676  1.00 51.23 ? 721  GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 8   ? -9.920  28.398 36.254  1.00 49.34 ? 721  GLU A OE2 1 
ATOM   34   N N   . GLU A 1 9   ? -6.891  24.373 38.768  1.00 33.75 ? 722  GLU A N   1 
ATOM   35   C CA  . GLU A 1 9   ? -5.999  23.405 39.398  1.00 34.72 ? 722  GLU A CA  1 
ATOM   36   C C   . GLU A 1 9   ? -4.679  23.223 38.637  1.00 33.57 ? 722  GLU A C   1 
ATOM   37   O O   . GLU A 1 9   ? -3.730  22.664 39.174  1.00 33.47 ? 722  GLU A O   1 
ATOM   38   C CB  . GLU A 1 9   ? -6.695  22.045 39.544  1.00 38.64 ? 722  GLU A CB  1 
ATOM   39   C CG  . GLU A 1 9   ? -8.113  22.092 40.146  1.00 43.74 ? 722  GLU A CG  1 
ATOM   40   C CD  . GLU A 1 9   ? -8.147  22.147 41.675  1.00 47.20 ? 722  GLU A CD  1 
ATOM   41   O OE1 . GLU A 1 9   ? -7.103  21.907 42.323  1.00 48.93 ? 722  GLU A OE1 1 
ATOM   42   O OE2 . GLU A 1 9   ? -9.237  22.419 42.230  1.00 47.35 ? 722  GLU A OE2 1 
ATOM   43   N N   . TYR A 1 10  ? -4.624  23.687 37.390  1.00 32.12 ? 723  TYR A N   1 
ATOM   44   C CA  . TYR A 1 10  ? -3.417  23.560 36.570  1.00 30.26 ? 723  TYR A CA  1 
ATOM   45   C C   . TYR A 1 10  ? -2.615  24.852 36.511  1.00 30.62 ? 723  TYR A C   1 
ATOM   46   O O   . TYR A 1 10  ? -1.621  24.920 35.795  1.00 32.96 ? 723  TYR A O   1 
ATOM   47   C CB  . TYR A 1 10  ? -3.767  23.153 35.131  1.00 29.19 ? 723  TYR A CB  1 
ATOM   48   C CG  . TYR A 1 10  ? -4.423  21.801 34.981  1.00 31.00 ? 723  TYR A CG  1 
ATOM   49   C CD1 . TYR A 1 10  ? -3.667  20.627 34.988  1.00 30.20 ? 723  TYR A CD1 1 
ATOM   50   C CD2 . TYR A 1 10  ? -5.813  21.691 34.854  1.00 33.02 ? 723  TYR A CD2 1 
ATOM   51   C CE1 . TYR A 1 10  ? -4.281  19.378 34.879  1.00 30.63 ? 723  TYR A CE1 1 
ATOM   52   C CE2 . TYR A 1 10  ? -6.436  20.448 34.748  1.00 31.79 ? 723  TYR A CE2 1 
ATOM   53   C CZ  . TYR A 1 10  ? -5.666  19.300 34.772  1.00 30.86 ? 723  TYR A CZ  1 
ATOM   54   O OH  . TYR A 1 10  ? -6.289  18.078 34.778  1.00 33.37 ? 723  TYR A OH  1 
ATOM   55   N N   . SER A 1 11  ? -3.049  25.883 37.231  1.00 30.67 ? 724  SER A N   1 
ATOM   56   C CA  . SER A 1 11  ? -2.466  27.220 37.079  1.00 31.14 ? 724  SER A CA  1 
ATOM   57   C C   . SER A 1 11  ? -1.000  27.327 37.511  1.00 31.11 ? 724  SER A C   1 
ATOM   58   O O   . SER A 1 11  ? -0.271  28.199 37.037  1.00 32.26 ? 724  SER A O   1 
ATOM   59   C CB  . SER A 1 11  ? -3.307  28.260 37.834  1.00 33.09 ? 724  SER A CB  1 
ATOM   60   O OG  . SER A 1 11  ? -3.307  28.015 39.231  1.00 36.02 ? 724  SER A OG  1 
ATOM   61   N N   . GLU A 1 12  ? -0.595  26.492 38.462  1.00 30.17 ? 725  GLU A N   1 
ATOM   62   C CA  . GLU A 1 12  ? 0.808   26.399 38.867  1.00 31.43 ? 725  GLU A CA  1 
ATOM   63   C C   . GLU A 1 12  ? 1.692   25.757 37.781  1.00 29.96 ? 725  GLU A C   1 
ATOM   64   O O   . GLU A 1 12  ? 2.730   26.301 37.403  1.00 28.08 ? 725  GLU A O   1 
ATOM   65   C CB  . GLU A 1 12  ? 0.923   25.615 40.185  1.00 35.11 ? 725  GLU A CB  1 
ATOM   66   C CG  . GLU A 1 12  ? 0.694   24.100 40.081  1.00 40.41 ? 725  GLU A CG  1 
ATOM   67   C CD  . GLU A 1 12  ? -0.642  23.728 39.456  1.00 40.19 ? 725  GLU A CD  1 
ATOM   68   O OE1 . GLU A 1 12  ? -1.674  24.277 39.893  1.00 46.17 ? 725  GLU A OE1 1 
ATOM   69   O OE2 . GLU A 1 12  ? -0.662  22.892 38.529  1.00 37.60 ? 725  GLU A OE2 1 
ATOM   70   N N   . PHE A 1 13  ? 1.213   24.652 37.221  1.00 28.12 ? 726  PHE A N   1 
ATOM   71   C CA  . PHE A 1 13  ? 1.888   23.950 36.140  1.00 25.50 ? 726  PHE A CA  1 
ATOM   72   C C   . PHE A 1 13  ? 2.013   24.865 34.927  1.00 25.60 ? 726  PHE A C   1 
ATOM   73   O O   . PHE A 1 13  ? 3.091   24.994 34.344  1.00 25.34 ? 726  PHE A O   1 
ATOM   74   C CB  . PHE A 1 13  ? 1.082   22.696 35.793  1.00 26.35 ? 726  PHE A CB  1 
ATOM   75   C CG  . PHE A 1 13  ? 1.575   21.949 34.587  1.00 26.97 ? 726  PHE A CG  1 
ATOM   76   C CD1 . PHE A 1 13  ? 2.881   21.473 34.526  1.00 27.08 ? 726  PHE A CD1 1 
ATOM   77   C CD2 . PHE A 1 13  ? 0.688   21.610 33.563  1.00 24.89 ? 726  PHE A CD2 1 
ATOM   78   C CE1 . PHE A 1 13  ? 3.295   20.664 33.475  1.00 25.82 ? 726  PHE A CE1 1 
ATOM   79   C CE2 . PHE A 1 13  ? 1.092   20.801 32.514  1.00 24.63 ? 726  PHE A CE2 1 
ATOM   80   C CZ  . PHE A 1 13  ? 2.398   20.324 32.471  1.00 26.23 ? 726  PHE A CZ  1 
ATOM   81   N N   . LYS A 1 14  ? 0.949   25.610 34.643  1.00 24.80 ? 727  LYS A N   1 
ATOM   82   C CA  . LYS A 1 14  ? 0.918   26.466 33.467  1.00 26.24 ? 727  LYS A CA  1 
ATOM   83   C C   . LYS A 1 14  ? 1.884   27.653 33.546  1.00 26.36 ? 727  LYS A C   1 
ATOM   84   O O   . LYS A 1 14  ? 2.511   28.008 32.547  1.00 23.79 ? 727  LYS A O   1 
ATOM   85   C CB  . LYS A 1 14  ? -0.501  26.966 33.200  1.00 29.58 ? 727  LYS A CB  1 
ATOM   86   C CG  . LYS A 1 14  ? -0.738  27.321 31.740  1.00 33.37 ? 727  LYS A CG  1 
ATOM   87   C CD  . LYS A 1 14  ? -2.027  28.080 31.546  1.00 37.04 ? 727  LYS A CD  1 
ATOM   88   C CE  . LYS A 1 14  ? -1.795  29.574 31.644  1.00 39.33 ? 727  LYS A CE  1 
ATOM   89   N NZ  . LYS A 1 14  ? -3.045  30.343 31.402  1.00 42.25 ? 727  LYS A NZ  1 
ATOM   90   N N   . GLU A 1 15  ? 2.054   28.239 34.729  1.00 25.42 ? 728  GLU A N   1 
ATOM   91   C CA  . GLU A 1 15  ? 2.936   29.392 34.830  1.00 26.46 ? 728  GLU A CA  1 
ATOM   92   C C   . GLU A 1 15  ? 4.404   28.983 34.725  1.00 26.93 ? 728  GLU A C   1 
ATOM   93   O O   . GLU A 1 15  ? 5.227   29.700 34.143  1.00 27.40 ? 728  GLU A O   1 
ATOM   94   C CB  . GLU A 1 15  ? 2.673   30.175 36.117  1.00 26.77 ? 728  GLU A CB  1 
ATOM   95   C CG  . GLU A 1 15  ? 2.839   31.685 35.936  1.00 32.70 ? 728  GLU A CG  1 
ATOM   96   C CD  . GLU A 1 15  ? 2.599   32.147 34.491  1.00 36.08 ? 728  GLU A CD  1 
ATOM   97   O OE1 . GLU A 1 15  ? 1.452   32.037 34.004  1.00 38.85 ? 728  GLU A OE1 1 
ATOM   98   O OE2 . GLU A 1 15  ? 3.565   32.596 33.832  1.00 38.86 ? 728  GLU A OE2 1 
ATOM   99   N N   . LEU A 1 16  ? 4.681   27.749 35.127  1.00 25.86 ? 729  LEU A N   1 
ATOM   100  C CA  . LEU A 1 16  ? 5.978   27.130 34.893  1.00 25.57 ? 729  LEU A CA  1 
ATOM   101  C C   . LEU A 1 16  ? 6.264   26.986 33.390  1.00 24.17 ? 729  LEU A C   1 
ATOM   102  O O   . LEU A 1 16  ? 7.327   27.392 32.918  1.00 23.68 ? 729  LEU A O   1 
ATOM   103  C CB  . LEU A 1 16  ? 6.005   25.755 35.558  1.00 26.60 ? 729  LEU A CB  1 
ATOM   104  C CG  . LEU A 1 16  ? 7.336   25.205 36.046  1.00 27.56 ? 729  LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 16  ? 7.962   26.167 37.045  1.00 26.52 ? 729  LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 16  ? 7.093   23.844 36.677  1.00 29.15 ? 729  LEU A CD2 1 
ATOM   107  N N   . ILE A 1 17  ? 5.295   26.445 32.646  1.00 22.59 ? 730  ILE A N   1 
ATOM   108  C CA  . ILE A 1 17  ? 5.459   26.190 31.212  1.00 23.53 ? 730  ILE A CA  1 
ATOM   109  C C   . ILE A 1 17  ? 5.646   27.466 30.404  1.00 23.18 ? 730  ILE A C   1 
ATOM   110  O O   . ILE A 1 17  ? 6.359   27.470 29.392  1.00 22.79 ? 730  ILE A O   1 
ATOM   111  C CB  . ILE A 1 17  ? 4.254   25.450 30.609  1.00 23.15 ? 730  ILE A CB  1 
ATOM   112  C CG1 . ILE A 1 17  ? 3.986   24.153 31.364  1.00 25.31 ? 730  ILE A CG1 1 
ATOM   113  C CG2 . ILE A 1 17  ? 4.526   25.120 29.150  1.00 26.00 ? 730  ILE A CG2 1 
ATOM   114  C CD1 . ILE A 1 17  ? 2.569   23.655 31.157  1.00 26.62 ? 730  ILE A CD1 1 
ATOM   115  N N   . LEU A 1 18  ? 4.977   28.537 30.823  1.00 22.82 ? 731  LEU A N   1 
ATOM   116  C CA  . LEU A 1 18  ? 5.001   29.790 30.064  1.00 25.07 ? 731  LEU A CA  1 
ATOM   117  C C   . LEU A 1 18  ? 6.188   30.700 30.380  1.00 25.48 ? 731  LEU A C   1 
ATOM   118  O O   . LEU A 1 18  ? 6.351   31.739 29.751  1.00 27.06 ? 731  LEU A O   1 
ATOM   119  C CB  . LEU A 1 18  ? 3.697   30.565 30.266  1.00 23.69 ? 731  LEU A CB  1 
ATOM   120  C CG  . LEU A 1 18  ? 2.413   29.817 29.906  1.00 24.50 ? 731  LEU A CG  1 
ATOM   121  C CD1 . LEU A 1 18  ? 1.210   30.681 30.281  1.00 24.31 ? 731  LEU A CD1 1 
ATOM   122  C CD2 . LEU A 1 18  ? 2.398   29.476 28.411  1.00 23.85 ? 731  LEU A CD2 1 
ATOM   123  N N   . GLN A 1 19  ? 7.059   30.274 31.287  1.00 25.59 ? 732  GLN A N   1 
ATOM   124  C CA  . GLN A 1 19  ? 8.239   31.057 31.621  1.00 28.34 ? 732  GLN A CA  1 
ATOM   125  C C   . GLN A 1 19  ? 9.166   31.246 30.412  1.00 29.73 ? 732  GLN A C   1 
ATOM   126  O O   . GLN A 1 19  ? 9.384   30.313 29.628  1.00 28.11 ? 732  GLN A O   1 
ATOM   127  C CB  . GLN A 1 19  ? 8.993   30.402 32.780  1.00 30.40 ? 732  GLN A CB  1 
ATOM   128  C CG  . GLN A 1 19  ? 8.642   30.983 34.133  1.00 33.98 ? 732  GLN A CG  1 
ATOM   129  C CD  . GLN A 1 19  ? 9.014   30.068 35.284  1.00 38.05 ? 732  GLN A CD  1 
ATOM   130  O OE1 . GLN A 1 19  ? 10.086  29.458 35.296  1.00 37.53 ? 732  GLN A OE1 1 
ATOM   131  N NE2 . GLN A 1 19  ? 8.128   29.979 36.271  1.00 39.36 ? 732  GLN A NE2 1 
ATOM   132  N N   . LYS A 1 20  ? 9.754   32.440 30.317  1.00 30.19 ? 733  LYS A N   1 
ATOM   133  C CA  . LYS A 1 20  ? 10.481  32.884 29.126  1.00 31.04 ? 733  LYS A CA  1 
ATOM   134  C C   . LYS A 1 20  ? 11.711  32.056 28.773  1.00 29.47 ? 733  LYS A C   1 
ATOM   135  O O   . LYS A 1 20  ? 12.135  32.038 27.618  1.00 28.42 ? 733  LYS A O   1 
ATOM   136  C CB  . LYS A 1 20  ? 10.893  34.354 29.272  1.00 35.74 ? 733  LYS A CB  1 
ATOM   137  C CG  . LYS A 1 20  ? 11.739  34.650 30.514  1.00 40.89 ? 733  LYS A CG  1 
ATOM   138  C CD  . LYS A 1 20  ? 12.694  35.817 30.278  1.00 43.53 ? 733  LYS A CD  1 
ATOM   139  C CE  . LYS A 1 20  ? 13.296  36.333 31.581  1.00 45.86 ? 733  LYS A CE  1 
ATOM   140  N NZ  . LYS A 1 20  ? 12.363  37.231 32.334  1.00 47.42 ? 733  LYS A NZ  1 
ATOM   141  N N   . GLU A 1 21  ? 12.306  31.410 29.772  1.00 27.95 ? 734  GLU A N   1 
ATOM   142  C CA  . GLU A 1 21  ? 13.503  30.601 29.553  1.00 28.66 ? 734  GLU A CA  1 
ATOM   143  C C   . GLU A 1 21  ? 13.188  29.259 28.883  1.00 27.19 ? 734  GLU A C   1 
ATOM   144  O O   . GLU A 1 21  ? 14.088  28.577 28.387  1.00 26.99 ? 734  GLU A O   1 
ATOM   145  C CB  . GLU A 1 21  ? 14.222  30.356 30.877  1.00 32.09 ? 734  GLU A CB  1 
ATOM   146  C CG  . GLU A 1 21  ? 14.349  31.597 31.765  1.00 40.25 ? 734  GLU A CG  1 
ATOM   147  C CD  . GLU A 1 21  ? 13.355  31.594 32.918  1.00 42.55 ? 734  GLU A CD  1 
ATOM   148  O OE1 . GLU A 1 21  ? 13.673  30.991 33.974  1.00 45.18 ? 734  GLU A OE1 1 
ATOM   149  O OE2 . GLU A 1 21  ? 12.249  32.162 32.753  1.00 41.74 ? 734  GLU A OE2 1 
ATOM   150  N N   . LEU A 1 22  ? 11.912  28.876 28.909  1.00 25.77 ? 735  LEU A N   1 
ATOM   151  C CA  . LEU A 1 22  ? 11.426  27.651 28.272  1.00 23.16 ? 735  LEU A CA  1 
ATOM   152  C C   . LEU A 1 22  ? 12.139  26.365 28.695  1.00 22.05 ? 735  LEU A C   1 
ATOM   153  O O   . LEU A 1 22  ? 12.169  25.393 27.937  1.00 20.97 ? 735  LEU A O   1 
ATOM   154  C CB  . LEU A 1 22  ? 11.479  27.783 26.748  1.00 23.42 ? 735  LEU A CB  1 
ATOM   155  C CG  . LEU A 1 22  ? 10.629  28.880 26.113  1.00 23.80 ? 735  LEU A CG  1 
ATOM   156  C CD1 . LEU A 1 22  ? 10.642  28.694 24.608  1.00 25.90 ? 735  LEU A CD1 1 
ATOM   157  C CD2 . LEU A 1 22  ? 9.208   28.817 26.639  1.00 26.15 ? 735  LEU A CD2 1 
ATOM   158  N N   . HIS A 1 23  ? 12.569  26.299 29.953  1.00 19.84 ? 736  HIS A N   1 
ATOM   159  C CA  . HIS A 1 23  ? 13.285  25.121 30.433  1.00 19.42 ? 736  HIS A CA  1 
ATOM   160  C C   . HIS A 1 23  ? 12.422  23.869 30.455  1.00 18.06 ? 736  HIS A C   1 
ATOM   161  O O   . HIS A 1 23  ? 12.900  22.796 30.096  1.00 19.60 ? 736  HIS A O   1 
ATOM   162  C CB  . HIS A 1 23  ? 13.879  25.374 31.821  1.00 23.16 ? 736  HIS A CB  1 
ATOM   163  C CG  . HIS A 1 23  ? 15.031  26.330 31.815  1.00 24.40 ? 736  HIS A CG  1 
ATOM   164  N ND1 . HIS A 1 23  ? 15.198  27.301 32.777  1.00 27.08 ? 736  HIS A ND1 1 
ATOM   165  C CD2 . HIS A 1 23  ? 16.063  26.477 30.951  1.00 24.95 ? 736  HIS A CD2 1 
ATOM   166  C CE1 . HIS A 1 23  ? 16.283  28.003 32.510  1.00 24.44 ? 736  HIS A CE1 1 
ATOM   167  N NE2 . HIS A 1 23  ? 16.826  27.524 31.409  1.00 26.92 ? 736  HIS A NE2 1 
ATOM   168  N N   . VAL A 1 24  ? 11.133  24.013 30.770  1.00 16.17 ? 737  VAL A N   1 
ATOM   169  C CA  . VAL A 1 24  ? 10.213  22.874 30.734  1.00 14.90 ? 737  VAL A CA  1 
ATOM   170  C C   . VAL A 1 24  ? 10.015  22.388 29.301  1.00 14.06 ? 737  VAL A C   1 
ATOM   171  O O   . VAL A 1 24  ? 10.044  21.197 29.042  1.00 13.81 ? 737  VAL A O   1 
ATOM   172  C CB  . VAL A 1 24  ? 8.825   23.223 31.330  1.00 17.58 ? 737  VAL A CB  1 
ATOM   173  C CG1 . VAL A 1 24  ? 7.866   22.040 31.152  1.00 19.85 ? 737  VAL A CG1 1 
ATOM   174  C CG2 . VAL A 1 24  ? 8.953   23.583 32.811  1.00 16.97 ? 737  VAL A CG2 1 
ATOM   175  N N   . VAL A 1 25  ? 9.822   23.318 28.374  1.00 15.24 ? 738  VAL A N   1 
ATOM   176  C CA  . VAL A 1 25  ? 9.676   22.971 26.961  1.00 16.36 ? 738  VAL A CA  1 
ATOM   177  C C   . VAL A 1 25  ? 10.891  22.209 26.417  1.00 17.37 ? 738  VAL A C   1 
ATOM   178  O O   . VAL A 1 25  ? 10.741  21.208 25.705  1.00 16.39 ? 738  VAL A O   1 
ATOM   179  C CB  . VAL A 1 25  ? 9.419   24.238 26.101  1.00 17.25 ? 738  VAL A CB  1 
ATOM   180  C CG1 . VAL A 1 25  ? 9.493   23.900 24.603  1.00 17.18 ? 738  VAL A CG1 1 
ATOM   181  C CG2 . VAL A 1 25  ? 8.042   24.785 26.415  1.00 15.91 ? 738  VAL A CG2 1 
ATOM   182  N N   . TYR A 1 26  ? 12.086  22.654 26.796  1.00 18.28 ? 739  TYR A N   1 
ATOM   183  C CA  . TYR A 1 26  ? 13.325  21.988 26.388  1.00 19.49 ? 739  TYR A CA  1 
ATOM   184  C C   . TYR A 1 26  ? 13.450  20.579 26.951  1.00 18.39 ? 739  TYR A C   1 
ATOM   185  O O   . TYR A 1 26  ? 13.890  19.673 26.256  1.00 19.01 ? 739  TYR A O   1 
ATOM   186  C CB  . TYR A 1 26  ? 14.537  22.825 26.807  1.00 20.84 ? 739  TYR A CB  1 
ATOM   187  C CG  . TYR A 1 26  ? 14.711  24.050 25.954  1.00 22.48 ? 739  TYR A CG  1 
ATOM   188  C CD1 . TYR A 1 26  ? 14.571  23.970 24.569  1.00 27.47 ? 739  TYR A CD1 1 
ATOM   189  C CD2 . TYR A 1 26  ? 14.959  25.292 26.518  1.00 23.35 ? 739  TYR A CD2 1 
ATOM   190  C CE1 . TYR A 1 26  ? 14.677  25.096 23.766  1.00 27.50 ? 739  TYR A CE1 1 
ATOM   191  C CE2 . TYR A 1 26  ? 15.059  26.436 25.719  1.00 25.67 ? 739  TYR A CE2 1 
ATOM   192  C CZ  . TYR A 1 26  ? 14.916  26.322 24.344  1.00 26.33 ? 739  TYR A CZ  1 
ATOM   193  O OH  . TYR A 1 26  ? 15.011  27.420 23.532  1.00 28.60 ? 739  TYR A OH  1 
ATOM   194  N N   . ALA A 1 27  ? 13.102  20.409 28.222  1.00 18.10 ? 740  ALA A N   1 
ATOM   195  C CA  . ALA A 1 27  ? 13.153  19.099 28.859  1.00 16.64 ? 740  ALA A CA  1 
ATOM   196  C C   . ALA A 1 27  ? 12.156  18.151 28.201  1.00 17.52 ? 740  ALA A C   1 
ATOM   197  O O   . ALA A 1 27  ? 12.466  16.984 27.959  1.00 18.49 ? 740  ALA A O   1 
ATOM   198  C CB  . ALA A 1 27  ? 12.854  19.227 30.343  1.00 16.01 ? 740  ALA A CB  1 
ATOM   199  N N   . LEU A 1 28  ? 10.968  18.666 27.898  1.00 16.13 ? 741  LEU A N   1 
ATOM   200  C CA  . LEU A 1 28  ? 9.926   17.886 27.248  1.00 16.65 ? 741  LEU A CA  1 
ATOM   201  C C   . LEU A 1 28  ? 10.342  17.464 25.845  1.00 17.95 ? 741  LEU A C   1 
ATOM   202  O O   . LEU A 1 28  ? 10.106  16.329 25.450  1.00 20.38 ? 741  LEU A O   1 
ATOM   203  C CB  . LEU A 1 28  ? 8.622   18.690 27.182  1.00 18.96 ? 741  LEU A CB  1 
ATOM   204  C CG  . LEU A 1 28  ? 7.843   18.848 28.496  1.00 19.56 ? 741  LEU A CG  1 
ATOM   205  C CD1 . LEU A 1 28  ? 6.560   19.608 28.236  1.00 20.45 ? 741  LEU A CD1 1 
ATOM   206  C CD2 . LEU A 1 28  ? 7.545   17.475 29.105  1.00 24.29 ? 741  LEU A CD2 1 
ATOM   207  N N   . SER A 1 29  ? 10.962  18.367 25.088  1.00 18.42 ? 742  SER A N   1 
ATOM   208  C CA  . SER A 1 29  ? 11.383  18.024 23.737  1.00 20.55 ? 742  SER A CA  1 
ATOM   209  C C   . SER A 1 29  ? 12.470  16.966 23.777  1.00 20.83 ? 742  SER A C   1 
ATOM   210  O O   . SER A 1 29  ? 12.480  16.055 22.951  1.00 23.34 ? 742  SER A O   1 
ATOM   211  C CB  . SER A 1 29  ? 11.858  19.255 22.959  1.00 22.50 ? 742  SER A CB  1 
ATOM   212  O OG  . SER A 1 29  ? 13.048  19.798 23.486  1.00 30.26 ? 742  SER A OG  1 
ATOM   213  N N   . HIS A 1 30  ? 13.291  17.000 24.822  1.00 19.52 ? 743  HIS A N   1 
ATOM   214  C CA  . HIS A 1 30  ? 14.302  15.976 25.010  1.00 22.08 ? 743  HIS A CA  1 
ATOM   215  C C   . HIS A 1 30  ? 13.670  14.601 25.239  1.00 23.83 ? 743  HIS A C   1 
ATOM   216  O O   . HIS A 1 30  ? 13.944  13.655 24.499  1.00 23.88 ? 743  HIS A O   1 
ATOM   217  C CB  . HIS A 1 30  ? 15.214  16.331 26.186  1.00 24.16 ? 743  HIS A CB  1 
ATOM   218  C CG  . HIS A 1 30  ? 16.403  15.428 26.313  1.00 26.19 ? 743  HIS A CG  1 
ATOM   219  N ND1 . HIS A 1 30  ? 16.338  14.205 26.945  1.00 28.27 ? 743  HIS A ND1 1 
ATOM   220  C CD2 . HIS A 1 30  ? 17.621  15.481 25.727  1.00 25.69 ? 743  HIS A CD2 1 
ATOM   221  C CE1 . HIS A 1 30  ? 17.456  13.536 26.726  1.00 28.35 ? 743  HIS A CE1 1 
ATOM   222  N NE2 . HIS A 1 30  ? 18.249  14.289 25.987  1.00 29.56 ? 743  HIS A NE2 1 
ATOM   223  N N   . VAL A 1 31  ? 12.783  14.502 26.223  1.00 24.93 ? 744  VAL A N   1 
ATOM   224  C CA  . VAL A 1 31  ? 12.254  13.198 26.620  1.00 27.68 ? 744  VAL A CA  1 
ATOM   225  C C   . VAL A 1 31  ? 11.279  12.620 25.604  1.00 29.69 ? 744  VAL A C   1 
ATOM   226  O O   . VAL A 1 31  ? 11.147  11.400 25.491  1.00 30.93 ? 744  VAL A O   1 
ATOM   227  C CB  . VAL A 1 31  ? 11.586  13.247 28.024  1.00 26.08 ? 744  VAL A CB  1 
ATOM   228  C CG1 . VAL A 1 31  ? 12.622  13.629 29.066  1.00 24.81 ? 744  VAL A CG1 1 
ATOM   229  C CG2 . VAL A 1 31  ? 10.415  14.228 28.041  1.00 25.44 ? 744  VAL A CG2 1 
ATOM   230  N N   . CYS A 1 32  ? 10.636  13.502 24.843  1.00 31.71 ? 745  CYS A N   1 
ATOM   231  C CA  . CYS A 1 32  ? 9.757   13.106 23.746  1.00 35.92 ? 745  CYS A CA  1 
ATOM   232  C C   . CYS A 1 32  ? 10.601  12.978 22.482  1.00 40.42 ? 745  CYS A C   1 
ATOM   233  O O   . CYS A 1 32  ? 11.053  13.982 21.932  1.00 44.10 ? 745  CYS A O   1 
ATOM   234  C CB  . CYS A 1 32  ? 8.656   14.158 23.527  1.00 31.03 ? 745  CYS A CB  1 
ATOM   235  S SG  . CYS A 1 32  ? 7.575   14.471 24.960  1.00 27.21 ? 745  CYS A SG  1 
ATOM   236  N N   . GLY A 1 33  ? 10.876  11.745 22.070  1.00 44.77 ? 746  GLY A N   1 
ATOM   237  C CA  . GLY A 1 33  ? 11.706  11.524 20.894  1.00 47.38 ? 746  GLY A CA  1 
ATOM   238  C C   . GLY A 1 33  ? 10.911  11.465 19.605  1.00 48.81 ? 746  GLY A C   1 
ATOM   239  O O   . GLY A 1 33  ? 10.924  12.408 18.815  1.00 50.42 ? 746  GLY A O   1 
ATOM   240  N N   . GLN A 1 34  ? 10.202  10.356 19.404  1.00 50.10 ? 747  GLN A N   1 
ATOM   241  C CA  . GLN A 1 34  ? 9.381   10.159 18.214  1.00 50.24 ? 747  GLN A CA  1 
ATOM   242  C C   . GLN A 1 34  ? 8.185   11.096 18.227  1.00 48.78 ? 747  GLN A C   1 
ATOM   243  O O   . GLN A 1 34  ? 7.834   11.690 17.200  1.00 50.17 ? 747  GLN A O   1 
ATOM   244  C CB  . GLN A 1 34  ? 8.887   8.709  18.140  1.00 51.61 ? 747  GLN A CB  1 
ATOM   245  C CG  . GLN A 1 34  ? 9.408   7.919  16.942  1.00 53.48 ? 747  GLN A CG  1 
ATOM   246  C CD  . GLN A 1 34  ? 8.458   7.933  15.757  1.00 54.86 ? 747  GLN A CD  1 
ATOM   247  O OE1 . GLN A 1 34  ? 7.763   6.951  15.491  1.00 55.89 ? 747  GLN A OE1 1 
ATOM   248  N NE2 . GLN A 1 34  ? 8.428   9.047  15.033  1.00 56.39 ? 747  GLN A NE2 1 
ATOM   249  N N   . ASP A 1 35  ? 7.603   11.277 19.413  1.00 45.19 ? 748  ASP A N   1 
ATOM   250  C CA  . ASP A 1 35  ? 6.304   11.934 19.539  1.00 41.28 ? 748  ASP A CA  1 
ATOM   251  C C   . ASP A 1 35  ? 6.389   13.454 19.663  1.00 36.04 ? 748  ASP A C   1 
ATOM   252  O O   . ASP A 1 35  ? 5.619   14.098 20.374  1.00 31.22 ? 748  ASP A O   1 
ATOM   253  C CB  . ASP A 1 35  ? 5.525   11.307 20.693  1.00 44.26 ? 748  ASP A CB  1 
ATOM   254  C CG  . ASP A 1 35  ? 5.004   9.925  20.346  1.00 46.47 ? 748  ASP A CG  1 
ATOM   255  O OD1 . ASP A 1 35  ? 5.763   9.128  19.742  1.00 46.47 ? 748  ASP A OD1 1 
ATOM   256  O OD2 . ASP A 1 35  ? 3.816   9.658  20.618  1.00 50.53 ? 748  ASP A OD2 1 
ATOM   257  N N   . ARG A 1 36  ? 7.349   13.996 18.931  1.00 33.42 ? 749  ARG A N   1 
ATOM   258  C CA  . ARG A 1 36  ? 7.438   15.403 18.585  1.00 31.52 ? 749  ARG A CA  1 
ATOM   259  C C   . ARG A 1 36  ? 6.093   15.967 18.143  1.00 28.59 ? 749  ARG A C   1 
ATOM   260  O O   . ARG A 1 36  ? 5.724   17.076 18.525  1.00 26.92 ? 749  ARG A O   1 
ATOM   261  C CB  . ARG A 1 36  ? 8.455   15.536 17.452  1.00 34.77 ? 749  ARG A CB  1 
ATOM   262  C CG  . ARG A 1 36  ? 8.645   16.919 16.865  1.00 37.10 ? 749  ARG A CG  1 
ATOM   263  C CD  . ARG A 1 36  ? 9.711   16.875 15.785  1.00 37.02 ? 749  ARG A CD  1 
ATOM   264  N NE  . ARG A 1 36  ? 10.944  16.255 16.262  1.00 38.79 ? 749  ARG A NE  1 
ATOM   265  C CZ  . ARG A 1 36  ? 11.271  14.982 16.057  1.00 40.42 ? 749  ARG A CZ  1 
ATOM   266  N NH1 . ARG A 1 36  ? 10.444  14.176 15.404  1.00 38.56 ? 749  ARG A NH1 1 
ATOM   267  N NH2 . ARG A 1 36  ? 12.415  14.506 16.532  1.00 43.45 ? 749  ARG A NH2 1 
ATOM   268  N N   . THR A 1 37  ? 5.403   15.218 17.287  1.00 25.26 ? 750  THR A N   1 
ATOM   269  C CA  . THR A 1 37  ? 4.152   15.655 16.675  1.00 24.32 ? 750  THR A CA  1 
ATOM   270  C C   . THR A 1 37  ? 3.100   16.008 17.717  1.00 23.29 ? 750  THR A C   1 
ATOM   271  O O   . THR A 1 37  ? 2.520   17.095 17.678  1.00 22.91 ? 750  THR A O   1 
ATOM   272  C CB  . THR A 1 37  ? 3.586   14.559 15.739  1.00 25.73 ? 750  THR A CB  1 
ATOM   273  O OG1 . THR A 1 37  ? 4.554   14.247 14.729  1.00 28.65 ? 750  THR A OG1 1 
ATOM   274  C CG2 . THR A 1 37  ? 2.305   15.029 15.064  1.00 27.15 ? 750  THR A CG2 1 
ATOM   275  N N   . LEU A 1 38  ? 2.882   15.096 18.661  1.00 21.96 ? 751  LEU A N   1 
ATOM   276  C CA  . LEU A 1 38  ? 1.941   15.308 19.755  1.00 22.17 ? 751  LEU A CA  1 
ATOM   277  C C   . LEU A 1 38  ? 2.340   16.495 20.639  1.00 19.28 ? 751  LEU A C   1 
ATOM   278  O O   . LEU A 1 38  ? 1.538   17.398 20.876  1.00 17.75 ? 751  LEU A O   1 
ATOM   279  C CB  . LEU A 1 38  ? 1.825   14.035 20.602  1.00 22.61 ? 751  LEU A CB  1 
ATOM   280  C CG  . LEU A 1 38  ? 0.850   14.114 21.782  1.00 24.71 ? 751  LEU A CG  1 
ATOM   281  C CD1 . LEU A 1 38  ? -0.546  14.431 21.262  1.00 26.69 ? 751  LEU A CD1 1 
ATOM   282  C CD2 . LEU A 1 38  ? 0.854   12.804 22.563  1.00 24.12 ? 751  LEU A CD2 1 
ATOM   283  N N   . LEU A 1 39  ? 3.582   16.487 21.114  1.00 19.31 ? 752  LEU A N   1 
ATOM   284  C CA  . LEU A 1 39  ? 4.096   17.582 21.933  1.00 17.77 ? 752  LEU A CA  1 
ATOM   285  C C   . LEU A 1 39  ? 3.909   18.933 21.245  1.00 17.00 ? 752  LEU A C   1 
ATOM   286  O O   . LEU A 1 39  ? 3.369   19.862 21.842  1.00 15.58 ? 752  LEU A O   1 
ATOM   287  C CB  . LEU A 1 39  ? 5.576   17.370 22.249  1.00 16.93 ? 752  LEU A CB  1 
ATOM   288  C CG  . LEU A 1 39  ? 6.242   18.451 23.114  1.00 16.57 ? 752  LEU A CG  1 
ATOM   289  C CD1 . LEU A 1 39  ? 5.560   18.511 24.477  1.00 17.51 ? 752  LEU A CD1 1 
ATOM   290  C CD2 . LEU A 1 39  ? 7.726   18.152 23.276  1.00 14.60 ? 752  LEU A CD2 1 
ATOM   291  N N   . ALA A 1 40  ? 4.259   19.000 19.961  1.00 15.33 ? 753  ALA A N   1 
ATOM   292  C CA  . ALA A 1 40  ? 4.129   20.231 19.192  1.00 16.40 ? 753  ALA A CA  1 
ATOM   293  C C   . ALA A 1 40  ? 2.694   20.753 19.196  1.00 16.26 ? 753  ALA A C   1 
ATOM   294  O O   . ALA A 1 40  ? 2.455   21.934 19.472  1.00 17.66 ? 753  ALA A O   1 
ATOM   295  C CB  . ALA A 1 40  ? 4.604   20.005 17.763  1.00 16.02 ? 753  ALA A CB  1 
ATOM   296  N N   . SER A 1 41  ? 1.743   19.850 18.961  1.00 17.95 ? 754  SER A N   1 
ATOM   297  C CA  . SER A 1 41  ? 0.319   20.182 18.904  1.00 17.25 ? 754  SER A CA  1 
ATOM   298  C C   . SER A 1 41  ? -0.163  20.801 20.200  1.00 15.66 ? 754  SER A C   1 
ATOM   299  O O   . SER A 1 41  ? -0.922  21.765 20.184  1.00 16.89 ? 754  SER A O   1 
ATOM   300  C CB  . SER A 1 41  ? -0.508  18.925 18.617  1.00 16.14 ? 754  SER A CB  1 
ATOM   301  O OG  . SER A 1 41  ? -0.147  18.378 17.367  1.00 26.10 ? 754  SER A OG  1 
ATOM   302  N N   . ILE A 1 42  ? 0.215   20.180 21.317  1.00 17.13 ? 755  ILE A N   1 
ATOM   303  C CA  . ILE A 1 42  ? -0.250  20.604 22.639  1.00 15.87 ? 755  ILE A CA  1 
ATOM   304  C C   . ILE A 1 42  ? 0.383   21.939 22.982  1.00 13.24 ? 755  ILE A C   1 
ATOM   305  O O   . ILE A 1 42  ? -0.305  22.873 23.392  1.00 14.80 ? 755  ILE A O   1 
ATOM   306  C CB  . ILE A 1 42  ? 0.115   19.565 23.749  1.00 16.44 ? 755  ILE A CB  1 
ATOM   307  C CG1 . ILE A 1 42  ? -0.582  18.226 23.480  1.00 16.45 ? 755  ILE A CG1 1 
ATOM   308  C CG2 . ILE A 1 42  ? -0.338  20.079 25.115  1.00 14.40 ? 755  ILE A CG2 1 
ATOM   309  C CD1 . ILE A 1 42  ? 0.095   17.025 24.124  1.00 18.12 ? 755  ILE A CD1 1 
ATOM   310  N N   . LEU A 1 43  ? 1.687   22.045 22.753  1.00 14.23 ? 756  LEU A N   1 
ATOM   311  C CA  . LEU A 1 43  ? 2.419   23.268 23.080  1.00 14.59 ? 756  LEU A CA  1 
ATOM   312  C C   . LEU A 1 43  ? 1.908   24.451 22.274  1.00 14.32 ? 756  LEU A C   1 
ATOM   313  O O   . LEU A 1 43  ? 1.691   25.526 22.819  1.00 14.99 ? 756  LEU A O   1 
ATOM   314  C CB  . LEU A 1 43  ? 3.914   23.089 22.826  1.00 15.28 ? 756  LEU A CB  1 
ATOM   315  C CG  . LEU A 1 43  ? 4.700   22.200 23.792  1.00 16.35 ? 756  LEU A CG  1 
ATOM   316  C CD1 . LEU A 1 43  ? 6.148   22.157 23.331  1.00 18.12 ? 756  LEU A CD1 1 
ATOM   317  C CD2 . LEU A 1 43  ? 4.594   22.725 25.220  1.00 14.79 ? 756  LEU A CD2 1 
ATOM   318  N N   . LEU A 1 44  ? 1.649   24.232 20.988  1.00 14.42 ? 757  LEU A N   1 
ATOM   319  C CA  . LEU A 1 44  ? 1.163   25.309 20.145  1.00 17.26 ? 757  LEU A CA  1 
ATOM   320  C C   . LEU A 1 44  ? -0.218  25.810 20.571  1.00 18.26 ? 757  LEU A C   1 
ATOM   321  O O   . LEU A 1 44  ? -0.429  27.020 20.672  1.00 19.80 ? 757  LEU A O   1 
ATOM   322  C CB  . LEU A 1 44  ? 1.147   24.890 18.677  1.00 17.36 ? 757  LEU A CB  1 
ATOM   323  C CG  . LEU A 1 44  ? 1.072   26.079 17.719  1.00 16.68 ? 757  LEU A CG  1 
ATOM   324  C CD1 . LEU A 1 44  ? 2.359   26.886 17.795  1.00 19.19 ? 757  LEU A CD1 1 
ATOM   325  C CD2 . LEU A 1 44  ? 0.830   25.583 16.303  1.00 21.40 ? 757  LEU A CD2 1 
ATOM   326  N N   . ARG A 1 45  ? -1.129  24.892 20.896  1.00 17.08 ? 758  ARG A N   1 
ATOM   327  C CA  . ARG A 1 45  ? -2.426  25.280 21.431  1.00 18.38 ? 758  ARG A CA  1 
ATOM   328  C C   . ARG A 1 45  ? -2.319  26.049 22.756  1.00 18.95 ? 758  ARG A C   1 
ATOM   329  O O   . ARG A 1 45  ? -2.998  27.054 22.955  1.00 19.80 ? 758  ARG A O   1 
ATOM   330  C CB  . ARG A 1 45  ? -3.321  24.053 21.602  1.00 20.74 ? 758  ARG A CB  1 
ATOM   331  C CG  . ARG A 1 45  ? -4.041  23.651 20.318  1.00 26.13 ? 758  ARG A CG  1 
ATOM   332  C CD  . ARG A 1 45  ? -5.167  22.655 20.572  1.00 27.01 ? 758  ARG A CD  1 
ATOM   333  N NE  . ARG A 1 45  ? -4.676  21.463 21.249  1.00 28.31 ? 758  ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 45  ? -4.250  20.364 20.635  1.00 31.64 ? 758  ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 45  ? -4.398  20.227 19.324  1.00 33.69 ? 758  ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 45  ? -3.732  19.373 21.343  1.00 32.68 ? 758  ARG A NH2 1 
ATOM   337  N N   . ILE A 1 46  ? -1.436  25.612 23.647  1.00 18.69 ? 759  ILE A N   1 
ATOM   338  C CA  . ILE A 1 46  ? -1.285  26.290 24.927  1.00 16.89 ? 759  ILE A CA  1 
ATOM   339  C C   . ILE A 1 46  ? -0.752  27.699 24.707  1.00 16.17 ? 759  ILE A C   1 
ATOM   340  O O   . ILE A 1 46  ? -1.335  28.661 25.191  1.00 18.47 ? 759  ILE A O   1 
ATOM   341  C CB  . ILE A 1 46  ? -0.347  25.503 25.888  1.00 17.18 ? 759  ILE A CB  1 
ATOM   342  C CG1 . ILE A 1 46  ? -1.083  24.286 26.465  1.00 16.23 ? 759  ILE A CG1 1 
ATOM   343  C CG2 . ILE A 1 46  ? 0.134   26.403 27.044  1.00 19.60 ? 759  ILE A CG2 1 
ATOM   344  C CD1 . ILE A 1 46  ? -0.144  23.279 27.146  1.00 18.58 ? 759  ILE A CD1 1 
ATOM   345  N N   . PHE A 1 47  ? 0.318   27.827 23.930  1.00 15.23 ? 760  PHE A N   1 
ATOM   346  C CA  . PHE A 1 47  ? 0.969   29.121 23.752  1.00 16.01 ? 760  PHE A CA  1 
ATOM   347  C C   . PHE A 1 47  ? 0.145   30.059 22.894  1.00 17.05 ? 760  PHE A C   1 
ATOM   348  O O   . PHE A 1 47  ? 0.149   31.264 23.122  1.00 18.84 ? 760  PHE A O   1 
ATOM   349  C CB  . PHE A 1 47  ? 2.364   28.950 23.153  1.00 15.47 ? 760  PHE A CB  1 
ATOM   350  C CG  . PHE A 1 47  ? 3.423   28.624 24.172  1.00 14.74 ? 760  PHE A CG  1 
ATOM   351  C CD1 . PHE A 1 47  ? 3.523   27.340 24.709  1.00 14.30 ? 760  PHE A CD1 1 
ATOM   352  C CD2 . PHE A 1 47  ? 4.306   29.606 24.617  1.00 14.01 ? 760  PHE A CD2 1 
ATOM   353  C CE1 . PHE A 1 47  ? 4.490   27.040 25.679  1.00 14.16 ? 760  PHE A CE1 1 
ATOM   354  C CE2 . PHE A 1 47  ? 5.275   29.318 25.585  1.00 15.04 ? 760  PHE A CE2 1 
ATOM   355  C CZ  . PHE A 1 47  ? 5.365   28.034 26.116  1.00 13.90 ? 760  PHE A CZ  1 
ATOM   356  N N   . LEU A 1 48  ? -0.632  29.497 21.971  1.00 19.53 ? 761  LEU A N   1 
ATOM   357  C CA  . LEU A 1 48  ? -1.559  30.283 21.160  1.00 22.16 ? 761  LEU A CA  1 
ATOM   358  C C   . LEU A 1 48  ? -2.661  30.865 22.029  1.00 23.90 ? 761  LEU A C   1 
ATOM   359  O O   . LEU A 1 48  ? -2.949  32.063 21.967  1.00 23.24 ? 761  LEU A O   1 
ATOM   360  C CB  . LEU A 1 48  ? -2.185  29.420 20.065  1.00 23.71 ? 761  LEU A CB  1 
ATOM   361  C CG  . LEU A 1 48  ? -1.526  29.478 18.684  1.00 27.03 ? 761  LEU A CG  1 
ATOM   362  C CD1 . LEU A 1 48  ? -1.923  28.250 17.860  1.00 25.82 ? 761  LEU A CD1 1 
ATOM   363  C CD2 . LEU A 1 48  ? -1.945  30.764 17.973  1.00 26.92 ? 761  LEU A CD2 1 
ATOM   364  N N   . HIS A 1 49  ? -3.206  30.026 22.905  1.00 24.27 ? 762  HIS A N   1 
ATOM   365  C CA  . HIS A 1 49  ? -4.266  30.435 23.815  1.00 26.61 ? 762  HIS A CA  1 
ATOM   366  C C   . HIS A 1 49  ? -3.854  31.674 24.615  1.00 28.23 ? 762  HIS A C   1 
ATOM   367  O O   . HIS A 1 49  ? -4.659  32.579 24.814  1.00 30.18 ? 762  HIS A O   1 
ATOM   368  C CB  . HIS A 1 49  ? -4.600  29.281 24.763  1.00 28.14 ? 762  HIS A CB  1 
ATOM   369  C CG  . HIS A 1 49  ? -5.842  29.499 25.570  1.00 29.76 ? 762  HIS A CG  1 
ATOM   370  N ND1 . HIS A 1 49  ? -5.876  30.326 26.668  1.00 31.30 ? 762  HIS A ND1 1 
ATOM   371  C CD2 . HIS A 1 49  ? -7.099  29.020 25.416  1.00 29.16 ? 762  HIS A CD2 1 
ATOM   372  C CE1 . HIS A 1 49  ? -7.103  30.350 27.160  1.00 30.32 ? 762  HIS A CE1 1 
ATOM   373  N NE2 . HIS A 1 49  ? -7.863  29.570 26.415  1.00 29.45 ? 762  HIS A NE2 1 
ATOM   374  N N   . GLU A 1 50  ? -2.564  31.761 24.943  1.00 28.20 ? 763  GLU A N   1 
ATOM   375  C CA  . GLU A 1 50  ? -2.039  32.800 25.822  1.00 26.65 ? 763  GLU A CA  1 
ATOM   376  C C   . GLU A 1 50  ? -1.441  33.975 25.060  1.00 27.42 ? 763  GLU A C   1 
ATOM   377  O O   . GLU A 1 50  ? -0.840  34.867 25.666  1.00 26.61 ? 763  GLU A O   1 
ATOM   378  C CB  . GLU A 1 50  ? -0.964  32.224 26.741  1.00 27.20 ? 763  GLU A CB  1 
ATOM   379  C CG  . GLU A 1 50  ? -1.374  30.973 27.481  1.00 32.34 ? 763  GLU A CG  1 
ATOM   380  C CD  . GLU A 1 50  ? -2.555  31.201 28.384  1.00 37.77 ? 763  GLU A CD  1 
ATOM   381  O OE1 . GLU A 1 50  ? -2.499  32.138 29.210  1.00 41.01 ? 763  GLU A OE1 1 
ATOM   382  O OE2 . GLU A 1 50  ? -3.548  30.453 28.256  1.00 41.74 ? 763  GLU A OE2 1 
ATOM   383  N N   . LYS A 1 51  ? -1.532  33.931 23.734  1.00 25.10 ? 764  LYS A N   1 
ATOM   384  C CA  . LYS A 1 51  ? -0.936  34.956 22.881  1.00 26.47 ? 764  LYS A CA  1 
ATOM   385  C C   . LYS A 1 51  ? 0.591   34.999 23.028  1.00 23.78 ? 764  LYS A C   1 
ATOM   386  O O   . LYS A 1 51  ? 1.222   36.046 22.859  1.00 22.68 ? 764  LYS A O   1 
ATOM   387  C CB  . LYS A 1 51  ? -1.539  36.334 23.194  1.00 31.13 ? 764  LYS A CB  1 
ATOM   388  C CG  . LYS A 1 51  ? -3.036  36.448 22.919  1.00 35.59 ? 764  LYS A CG  1 
ATOM   389  C CD  . LYS A 1 51  ? -3.335  37.603 21.963  1.00 40.39 ? 764  LYS A CD  1 
ATOM   390  C CE  . LYS A 1 51  ? -3.242  38.957 22.659  1.00 41.53 ? 764  LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 51  ? -3.225  40.088 21.686  1.00 43.15 ? 764  LYS A NZ  1 
ATOM   392  N N   . LEU A 1 52  ? 1.180   33.831 23.264  1.00 20.37 ? 765  LEU A N   1 
ATOM   393  C CA  . LEU A 1 52  ? 2.620   33.720 23.427  1.00 19.17 ? 765  LEU A CA  1 
ATOM   394  C C   . LEU A 1 52  ? 3.261   32.804 22.373  1.00 18.53 ? 765  LEU A C   1 
ATOM   395  O O   . LEU A 1 52  ? 4.398   32.360 22.536  1.00 16.34 ? 765  LEU A O   1 
ATOM   396  C CB  . LEU A 1 52  ? 2.948   33.236 24.848  1.00 19.89 ? 765  LEU A CB  1 
ATOM   397  C CG  . LEU A 1 52  ? 2.663   34.192 26.024  1.00 20.58 ? 765  LEU A CG  1 
ATOM   398  C CD1 . LEU A 1 52  ? 3.125   33.565 27.326  1.00 20.56 ? 765  LEU A CD1 1 
ATOM   399  C CD2 . LEU A 1 52  ? 3.364   35.529 25.813  1.00 22.36 ? 765  LEU A CD2 1 
ATOM   400  N N   . GLU A 1 53  ? 2.571   32.623 21.246  1.00 19.04 ? 766  GLU A N   1 
ATOM   401  C CA  . GLU A 1 53  ? 3.087   31.804 20.144  1.00 21.86 ? 766  GLU A CA  1 
ATOM   402  C C   . GLU A 1 53  ? 4.442   32.297 19.622  1.00 20.93 ? 766  GLU A C   1 
ATOM   403  O O   . GLU A 1 53  ? 5.288   31.491 19.225  1.00 19.29 ? 766  GLU A O   1 
ATOM   404  C CB  . GLU A 1 53  ? 2.096   31.752 18.973  1.00 24.83 ? 766  GLU A CB  1 
ATOM   405  C CG  . GLU A 1 53  ? 0.689   32.199 19.293  1.00 33.72 ? 766  GLU A CG  1 
ATOM   406  C CD  . GLU A 1 53  ? 0.462   33.664 18.996  1.00 36.07 ? 766  GLU A CD  1 
ATOM   407  O OE1 . GLU A 1 53  ? 0.678   34.085 17.841  1.00 37.73 ? 766  GLU A OE1 1 
ATOM   408  O OE2 . GLU A 1 53  ? 0.070   34.398 19.923  1.00 39.42 ? 766  GLU A OE2 1 
ATOM   409  N N   . SER A 1 54  ? 4.638   33.616 19.608  1.00 19.04 ? 767  SER A N   1 
ATOM   410  C CA  . SER A 1 54  ? 5.919   34.187 19.204  1.00 18.33 ? 767  SER A CA  1 
ATOM   411  C C   . SER A 1 54  ? 7.034   33.904 20.189  1.00 16.83 ? 767  SER A C   1 
ATOM   412  O O   . SER A 1 54  ? 8.163   33.670 19.781  1.00 19.31 ? 767  SER A O   1 
ATOM   413  C CB  . SER A 1 54  ? 5.800   35.689 18.995  1.00 18.33 ? 767  SER A CB  1 
ATOM   414  O OG  . SER A 1 54  ? 4.946   35.937 17.899  1.00 27.89 ? 767  SER A OG  1 
ATOM   415  N N   . LEU A 1 55  ? 6.736   33.972 21.485  1.00 17.32 ? 768  LEU A N   1 
ATOM   416  C CA  . LEU A 1 55  ? 7.713   33.623 22.510  1.00 14.66 ? 768  LEU A CA  1 
ATOM   417  C C   . LEU A 1 55  ? 8.217   32.195 22.289  1.00 14.44 ? 768  LEU A C   1 
ATOM   418  O O   . LEU A 1 55  ? 9.422   31.944 22.289  1.00 16.56 ? 768  LEU A O   1 
ATOM   419  C CB  . LEU A 1 55  ? 7.099   33.749 23.915  1.00 15.48 ? 768  LEU A CB  1 
ATOM   420  C CG  . LEU A 1 55  ? 7.999   33.207 25.032  1.00 19.96 ? 768  LEU A CG  1 
ATOM   421  C CD1 . LEU A 1 55  ? 9.159   34.184 25.256  1.00 19.93 ? 768  LEU A CD1 1 
ATOM   422  C CD2 . LEU A 1 55  ? 7.203   32.982 26.320  1.00 17.96 ? 768  LEU A CD2 1 
ATOM   423  N N   . LEU A 1 56  ? 7.289   31.273 22.051  1.00 14.24 ? 769  LEU A N   1 
ATOM   424  C CA  . LEU A 1 56  ? 7.637   29.880 21.814  1.00 13.05 ? 769  LEU A CA  1 
ATOM   425  C C   . LEU A 1 56  ? 8.457   29.694 20.526  1.00 13.84 ? 769  LEU A C   1 
ATOM   426  O O   . LEU A 1 56  ? 9.566   29.152 20.566  1.00 13.32 ? 769  LEU A O   1 
ATOM   427  C CB  . LEU A 1 56  ? 6.369   29.038 21.748  1.00 10.90 ? 769  LEU A CB  1 
ATOM   428  C CG  . LEU A 1 56  ? 6.600   27.549 21.504  1.00 13.05 ? 769  LEU A CG  1 
ATOM   429  C CD1 . LEU A 1 56  ? 7.303   26.929 22.704  1.00 11.22 ? 769  LEU A CD1 1 
ATOM   430  C CD2 . LEU A 1 56  ? 5.264   26.867 21.214  1.00 13.48 ? 769  LEU A CD2 1 
ATOM   431  N N   . LEU A 1 57  ? 7.926   30.176 19.402  1.00 12.32 ? 770  LEU A N   1 
ATOM   432  C CA  . LEU A 1 57  ? 8.553   29.951 18.104  1.00 13.92 ? 770  LEU A CA  1 
ATOM   433  C C   . LEU A 1 57  ? 9.876   30.695 17.965  1.00 14.07 ? 770  LEU A C   1 
ATOM   434  O O   . LEU A 1 57  ? 10.882  30.110 17.545  1.00 12.05 ? 770  LEU A O   1 
ATOM   435  C CB  . LEU A 1 57  ? 7.606   30.356 16.967  1.00 15.23 ? 770  LEU A CB  1 
ATOM   436  C CG  . LEU A 1 57  ? 6.268   29.606 16.875  1.00 19.62 ? 770  LEU A CG  1 
ATOM   437  C CD1 . LEU A 1 57  ? 5.560   30.007 15.606  1.00 20.99 ? 770  LEU A CD1 1 
ATOM   438  C CD2 . LEU A 1 57  ? 6.476   28.109 16.904  1.00 19.59 ? 770  LEU A CD2 1 
ATOM   439  N N   . CYS A 1 58  ? 9.883   31.969 18.355  1.00 12.81 ? 771  CYS A N   1 
ATOM   440  C CA  . CYS A 1 58  ? 11.073  32.801 18.214  1.00 12.32 ? 771  CYS A CA  1 
ATOM   441  C C   . CYS A 1 58  ? 12.217  32.297 19.064  1.00 12.87 ? 771  CYS A C   1 
ATOM   442  O O   . CYS A 1 58  ? 13.358  32.231 18.596  1.00 13.00 ? 771  CYS A O   1 
ATOM   443  C CB  . CYS A 1 58  ? 10.760  34.250 18.574  1.00 13.95 ? 771  CYS A CB  1 
ATOM   444  S SG  . CYS A 1 58  ? 9.743   35.113 17.347  1.00 19.09 ? 771  CYS A SG  1 
ATOM   445  N N   . THR A 1 59  ? 11.892  31.827 20.267  1.00 12.42 ? 772  THR A N   1 
ATOM   446  C CA  . THR A 1 59  ? 12.904  31.319 21.188  1.00 13.50 ? 772  THR A CA  1 
ATOM   447  C C   . THR A 1 59  ? 13.512  30.008 20.682  1.00 13.88 ? 772  THR A C   1 
ATOM   448  O O   . THR A 1 59  ? 14.742  29.873 20.616  1.00 12.91 ? 772  THR A O   1 
ATOM   449  C CB  . THR A 1 59  ? 12.322  31.115 22.621  1.00 14.81 ? 772  THR A CB  1 
ATOM   450  O OG1 . THR A 1 59  ? 11.759  32.346 23.096  1.00 15.29 ? 772  THR A OG1 1 
ATOM   451  C CG2 . THR A 1 59  ? 13.414  30.671 23.590  1.00 13.77 ? 772  THR A CG2 1 
ATOM   452  N N   . LEU A 1 60  ? 12.656  29.080 20.254  1.00 11.92 ? 773  LEU A N   1 
ATOM   453  C CA  . LEU A 1 60  ? 13.133  27.801 19.743  1.00 13.49 ? 773  LEU A CA  1 
ATOM   454  C C   . LEU A 1 60  ? 13.936  27.960 18.456  1.00 14.34 ? 773  LEU A C   1 
ATOM   455  O O   . LEU A 1 60  ? 14.938  27.260 18.249  1.00 13.83 ? 773  LEU A O   1 
ATOM   456  C CB  . LEU A 1 60  ? 11.967  26.839 19.509  1.00 15.28 ? 773  LEU A CB  1 
ATOM   457  C CG  . LEU A 1 60  ? 11.397  26.203 20.782  1.00 18.13 ? 773  LEU A CG  1 
ATOM   458  C CD1 . LEU A 1 60  ? 10.217  25.335 20.430  1.00 19.97 ? 773  LEU A CD1 1 
ATOM   459  C CD2 . LEU A 1 60  ? 12.449  25.387 21.478  1.00 21.36 ? 773  LEU A CD2 1 
ATOM   460  N N   . ASN A 1 61  ? 13.528  28.913 17.616  1.00 13.99 ? 774  ASN A N   1 
ATOM   461  C CA  . ASN A 1 61  ? 14.228  29.176 16.356  1.00 14.53 ? 774  ASN A CA  1 
ATOM   462  C C   . ASN A 1 61  ? 15.609  29.734 16.627  1.00 14.71 ? 774  ASN A C   1 
ATOM   463  O O   . ASN A 1 61  ? 16.591  29.274 16.042  1.00 13.17 ? 774  ASN A O   1 
ATOM   464  C CB  . ASN A 1 61  ? 13.442  30.157 15.484  1.00 13.74 ? 774  ASN A CB  1 
ATOM   465  C CG  . ASN A 1 61  ? 12.188  29.538 14.895  1.00 15.31 ? 774  ASN A CG  1 
ATOM   466  O OD1 . ASN A 1 61  ? 11.975  28.325 14.983  1.00 13.13 ? 774  ASN A OD1 1 
ATOM   467  N ND2 . ASN A 1 61  ? 11.330  30.377 14.320  1.00 13.92 ? 774  ASN A ND2 1 
ATOM   468  N N   . ASP A 1 62  ? 15.701  30.655 17.582  1.00 15.06 ? 775  ASP A N   1 
ATOM   469  C CA  . ASP A 1 62  ? 16.994  31.246 17.907  1.00 17.18 ? 775  ASP A CA  1 
ATOM   470  C C   . ASP A 1 62  ? 17.928  30.216 18.527  1.00 16.53 ? 775  ASP A C   1 
ATOM   471  O O   . ASP A 1 62  ? 19.125  30.232 18.261  1.00 15.55 ? 775  ASP A O   1 
ATOM   472  C CB  . ASP A 1 62  ? 16.843  32.445 18.839  1.00 19.16 ? 775  ASP A CB  1 
ATOM   473  C CG  . ASP A 1 62  ? 18.170  33.114 19.138  1.00 27.96 ? 775  ASP A CG  1 
ATOM   474  O OD1 . ASP A 1 62  ? 18.855  33.556 18.190  1.00 29.86 ? 775  ASP A OD1 1 
ATOM   475  O OD2 . ASP A 1 62  ? 18.579  33.115 20.318  1.00 34.57 ? 775  ASP A OD2 1 
ATOM   476  N N   . ARG A 1 63  ? 17.361  29.273 19.275  1.00 16.81 ? 776  ARG A N   1 
ATOM   477  C CA  . ARG A 1 63  ? 18.137  28.191 19.867  1.00 19.05 ? 776  ARG A CA  1 
ATOM   478  C C   . ARG A 1 63  ? 18.721  27.266 18.785  1.00 17.83 ? 776  ARG A C   1 
ATOM   479  O O   . ARG A 1 63  ? 19.908  26.951 18.812  1.00 16.63 ? 776  ARG A O   1 
ATOM   480  C CB  . ARG A 1 63  ? 17.263  27.406 20.856  1.00 22.86 ? 776  ARG A CB  1 
ATOM   481  C CG  . ARG A 1 63  ? 17.786  26.016 21.230  1.00 32.03 ? 776  ARG A CG  1 
ATOM   482  C CD  . ARG A 1 63  ? 18.752  26.048 22.399  1.00 39.11 ? 776  ARG A CD  1 
ATOM   483  N NE  . ARG A 1 63  ? 18.122  25.590 23.638  1.00 46.45 ? 776  ARG A NE  1 
ATOM   484  C CZ  . ARG A 1 63  ? 18.647  24.680 24.455  1.00 48.31 ? 776  ARG A CZ  1 
ATOM   485  N NH1 . ARG A 1 63  ? 19.779  24.064 24.136  1.00 50.51 ? 776  ARG A NH1 1 
ATOM   486  N NH2 . ARG A 1 63  ? 18.032  24.371 25.587  1.00 49.46 ? 776  ARG A NH2 1 
ATOM   487  N N   . GLU A 1 64  ? 17.917  26.904 17.791  1.00 16.19 ? 777  GLU A N   1 
ATOM   488  C CA  . GLU A 1 64  ? 18.431  26.132 16.659  1.00 17.63 ? 777  GLU A CA  1 
ATOM   489  C C   . GLU A 1 64  ? 19.555  26.871 15.921  1.00 17.55 ? 777  GLU A C   1 
ATOM   490  O O   . GLU A 1 64  ? 20.580  26.281 15.591  1.00 17.82 ? 777  GLU A O   1 
ATOM   491  C CB  . GLU A 1 64  ? 17.306  25.802 15.673  1.00 21.85 ? 777  GLU A CB  1 
ATOM   492  C CG  . GLU A 1 64  ? 16.302  24.778 16.174  1.00 27.15 ? 777  GLU A CG  1 
ATOM   493  C CD  . GLU A 1 64  ? 16.933  23.430 16.491  1.00 32.81 ? 777  GLU A CD  1 
ATOM   494  O OE1 . GLU A 1 64  ? 17.765  22.940 15.691  1.00 34.01 ? 777  GLU A OE1 1 
ATOM   495  O OE2 . GLU A 1 64  ? 16.588  22.856 17.546  1.00 34.74 ? 777  GLU A OE2 1 
ATOM   496  N N   . ILE A 1 65  ? 19.349  28.156 15.645  1.00 15.34 ? 778  ILE A N   1 
ATOM   497  C CA  . ILE A 1 65  ? 20.344  28.963 14.950  1.00 15.77 ? 778  ILE A CA  1 
ATOM   498  C C   . ILE A 1 65  ? 21.672  29.015 15.726  1.00 17.42 ? 778  ILE A C   1 
ATOM   499  O O   . ILE A 1 65  ? 22.742  28.814 15.152  1.00 15.93 ? 778  ILE A O   1 
ATOM   500  C CB  . ILE A 1 65  ? 19.790  30.406 14.689  1.00 14.49 ? 778  ILE A CB  1 
ATOM   501  C CG1 . ILE A 1 65  ? 18.747  30.356 13.571  1.00 14.83 ? 778  ILE A CG1 1 
ATOM   502  C CG2 . ILE A 1 65  ? 20.918  31.368 14.290  1.00 15.06 ? 778  ILE A CG2 1 
ATOM   503  C CD1 . ILE A 1 65  ? 17.814  31.553 13.527  1.00 14.35 ? 778  ILE A CD1 1 
ATOM   504  N N   . SER A 1 66  ? 21.588  29.176 17.043  1.00 18.83 ? 779  SER A N   1 
ATOM   505  C CA  . SER A 1 66  ? 22.780  29.263 17.884  1.00 21.65 ? 779  SER A CA  1 
ATOM   506  C C   . SER A 1 66  ? 23.573  27.946 17.906  1.00 22.75 ? 779  SER A C   1 
ATOM   507  O O   . SER A 1 66  ? 24.803  27.951 17.976  1.00 26.05 ? 779  SER A O   1 
ATOM   508  C CB  . SER A 1 66  ? 22.386  29.657 19.313  1.00 21.81 ? 779  SER A CB  1 
ATOM   509  O OG  . SER A 1 66  ? 21.804  28.562 19.996  1.00 26.67 ? 779  SER A OG  1 
ATOM   510  N N   . MET A 1 67  ? 22.867  26.826 17.803  1.00 24.73 ? 780  MET A N   1 
ATOM   511  C CA  . MET A 1 67  ? 23.497  25.509 17.853  1.00 24.99 ? 780  MET A CA  1 
ATOM   512  C C   . MET A 1 67  ? 24.054  25.040 16.510  1.00 23.61 ? 780  MET A C   1 
ATOM   513  O O   . MET A 1 67  ? 24.689  23.992 16.439  1.00 25.96 ? 780  MET A O   1 
ATOM   514  C CB  . MET A 1 67  ? 22.501  24.463 18.359  1.00 27.20 ? 780  MET A CB  1 
ATOM   515  C CG  . MET A 1 67  ? 21.971  24.712 19.756  1.00 29.85 ? 780  MET A CG  1 
ATOM   516  S SD  . MET A 1 67  ? 20.813  23.436 20.307  1.00 38.20 ? 780  MET A SD  1 
ATOM   517  C CE  . MET A 1 67  ? 19.847  23.138 18.810  1.00 33.15 ? 780  MET A CE  1 
ATOM   518  N N   . GLU A 1 68  ? 23.767  25.766 15.437  1.00 22.75 ? 781  GLU A N   1 
ATOM   519  C CA  . GLU A 1 68  ? 24.181  25.329 14.108  1.00 23.30 ? 781  GLU A CA  1 
ATOM   520  C C   . GLU A 1 68  ? 25.613  25.754 13.809  1.00 24.91 ? 781  GLU A C   1 
ATOM   521  O O   . GLU A 1 68  ? 25.946  26.931 13.865  1.00 24.98 ? 781  GLU A O   1 
ATOM   522  C CB  . GLU A 1 68  ? 23.235  25.880 13.037  1.00 20.74 ? 781  GLU A CB  1 
ATOM   523  C CG  . GLU A 1 68  ? 23.553  25.433 11.620  1.00 22.35 ? 781  GLU A CG  1 
ATOM   524  C CD  . GLU A 1 68  ? 23.620  23.918 11.473  1.00 24.64 ? 781  GLU A CD  1 
ATOM   525  O OE1 . GLU A 1 68  ? 22.565  23.284 11.286  1.00 26.66 ? 781  GLU A OE1 1 
ATOM   526  O OE2 . GLU A 1 68  ? 24.734  23.361 11.509  1.00 27.86 ? 781  GLU A OE2 1 
ATOM   527  N N   . ASP A 1 69  ? 26.456  24.783 13.481  1.00 27.74 ? 782  ASP A N   1 
ATOM   528  C CA  . ASP A 1 69  ? 27.857  25.064 13.194  1.00 31.34 ? 782  ASP A CA  1 
ATOM   529  C C   . ASP A 1 69  ? 28.171  25.027 11.703  1.00 32.41 ? 782  ASP A C   1 
ATOM   530  O O   . ASP A 1 69  ? 29.330  25.117 11.304  1.00 37.12 ? 782  ASP A O   1 
ATOM   531  C CB  . ASP A 1 69  ? 28.756  24.085 13.946  1.00 34.16 ? 782  ASP A CB  1 
ATOM   532  C CG  . ASP A 1 69  ? 28.336  22.644 13.758  1.00 36.74 ? 782  ASP A CG  1 
ATOM   533  O OD1 . ASP A 1 69  ? 27.399  22.200 14.452  1.00 41.49 ? 782  ASP A OD1 1 
ATOM   534  O OD2 . ASP A 1 69  ? 28.971  21.944 12.942  1.00 40.79 ? 782  ASP A OD2 1 
ATOM   535  N N   . GLU A 1 70  ? 27.133  24.928 10.881  1.00 31.26 ? 783  GLU A N   1 
ATOM   536  C CA  . GLU A 1 70  ? 27.281  25.042 9.435   1.00 29.71 ? 783  GLU A CA  1 
ATOM   537  C C   . GLU A 1 70  ? 26.008  25.636 8.839   1.00 27.83 ? 783  GLU A C   1 
ATOM   538  O O   . GLU A 1 70  ? 24.964  24.982 8.794   1.00 27.27 ? 783  GLU A O   1 
ATOM   539  C CB  . GLU A 1 70  ? 27.575  23.668 8.821   1.00 32.73 ? 783  GLU A CB  1 
ATOM   540  C CG  . GLU A 1 70  ? 27.487  23.610 7.297   1.00 36.40 ? 783  GLU A CG  1 
ATOM   541  C CD  . GLU A 1 70  ? 28.486  24.519 6.599   1.00 38.66 ? 783  GLU A CD  1 
ATOM   542  O OE1 . GLU A 1 70  ? 29.660  24.111 6.458   1.00 38.74 ? 783  GLU A OE1 1 
ATOM   543  O OE2 . GLU A 1 70  ? 28.085  25.624 6.160   1.00 39.10 ? 783  GLU A OE2 1 
ATOM   544  N N   . ALA A 1 71  ? 26.120  26.864 8.344   1.00 25.66 ? 784  ALA A N   1 
ATOM   545  C CA  . ALA A 1 71  ? 24.962  27.637 7.906   1.00 26.92 ? 784  ALA A CA  1 
ATOM   546  C C   . ALA A 1 71  ? 24.210  26.985 6.751   1.00 27.31 ? 784  ALA A C   1 
ATOM   547  O O   . ALA A 1 71  ? 23.027  27.268 6.550   1.00 26.22 ? 784  ALA A O   1 
ATOM   548  C CB  . ALA A 1 71  ? 25.389  29.045 7.513   1.00 25.92 ? 784  ALA A CB  1 
ATOM   549  N N   . THR A 1 72  ? 24.886  26.098 6.019   1.00 27.32 ? 785  THR A N   1 
ATOM   550  C CA  . THR A 1 72  ? 24.290  25.444 4.857   1.00 28.70 ? 785  THR A CA  1 
ATOM   551  C C   . THR A 1 72  ? 23.250  24.415 5.259   1.00 27.71 ? 785  THR A C   1 
ATOM   552  O O   . THR A 1 72  ? 22.370  24.089 4.468   1.00 29.64 ? 785  THR A O   1 
ATOM   553  C CB  . THR A 1 72  ? 25.350  24.735 3.964   1.00 29.51 ? 785  THR A CB  1 
ATOM   554  O OG1 . THR A 1 72  ? 26.029  23.720 4.719   1.00 30.59 ? 785  THR A OG1 1 
ATOM   555  C CG2 . THR A 1 72  ? 26.352  25.744 3.418   1.00 29.49 ? 785  THR A CG2 1 
ATOM   556  N N   . THR A 1 73  ? 23.354  23.903 6.479   1.00 25.32 ? 786  THR A N   1 
ATOM   557  C CA  . THR A 1 73  ? 22.420  22.881 6.944   1.00 26.22 ? 786  THR A CA  1 
ATOM   558  C C   . THR A 1 73  ? 21.333  23.426 7.864   1.00 23.14 ? 786  THR A C   1 
ATOM   559  O O   . THR A 1 73  ? 20.602  22.653 8.489   1.00 21.94 ? 786  THR A O   1 
ATOM   560  C CB  . THR A 1 73  ? 23.154  21.746 7.695   1.00 28.20 ? 786  THR A CB  1 
ATOM   561  O OG1 . THR A 1 73  ? 23.835  22.287 8.837   1.00 30.63 ? 786  THR A OG1 1 
ATOM   562  C CG2 . THR A 1 73  ? 24.150  21.052 6.775   1.00 29.87 ? 786  THR A CG2 1 
ATOM   563  N N   . LEU A 1 74  ? 21.210  24.748 7.934   1.00 20.74 ? 787  LEU A N   1 
ATOM   564  C CA  . LEU A 1 74  ? 20.322  25.364 8.918   1.00 18.67 ? 787  LEU A CA  1 
ATOM   565  C C   . LEU A 1 74  ? 18.865  24.974 8.701   1.00 16.31 ? 787  LEU A C   1 
ATOM   566  O O   . LEU A 1 74  ? 18.333  25.092 7.589   1.00 16.09 ? 787  LEU A O   1 
ATOM   567  C CB  . LEU A 1 74  ? 20.456  26.890 8.897   1.00 17.18 ? 787  LEU A CB  1 
ATOM   568  C CG  . LEU A 1 74  ? 19.545  27.605 9.902   1.00 18.43 ? 787  LEU A CG  1 
ATOM   569  C CD1 . LEU A 1 74  ? 19.921  27.206 11.331  1.00 15.70 ? 787  LEU A CD1 1 
ATOM   570  C CD2 . LEU A 1 74  ? 19.642  29.114 9.703   1.00 17.88 ? 787  LEU A CD2 1 
ATOM   571  N N   . PHE A 1 75  ? 18.267  24.412 9.749   1.00 14.59 ? 788  PHE A N   1 
ATOM   572  C CA  . PHE A 1 75  ? 16.855  24.020 9.761   1.00 14.29 ? 788  PHE A CA  1 
ATOM   573  C C   . PHE A 1 75  ? 16.496  22.846 8.842   1.00 14.00 ? 788  PHE A C   1 
ATOM   574  O O   . PHE A 1 75  ? 15.322  22.594 8.586   1.00 14.68 ? 788  PHE A O   1 
ATOM   575  C CB  . PHE A 1 75  ? 15.955  25.228 9.439   1.00 13.72 ? 788  PHE A CB  1 
ATOM   576  C CG  . PHE A 1 75  ? 15.785  26.180 10.587  1.00 11.33 ? 788  PHE A CG  1 
ATOM   577  C CD1 . PHE A 1 75  ? 15.276  25.743 11.803  1.00 12.54 ? 788  PHE A CD1 1 
ATOM   578  C CD2 . PHE A 1 75  ? 16.160  27.506 10.461  1.00 12.57 ? 788  PHE A CD2 1 
ATOM   579  C CE1 . PHE A 1 75  ? 15.147  26.609 12.879  1.00 11.10 ? 788  PHE A CE1 1 
ATOM   580  C CE2 . PHE A 1 75  ? 16.036  28.383 11.537  1.00 12.67 ? 788  PHE A CE2 1 
ATOM   581  C CZ  . PHE A 1 75  ? 15.529  27.930 12.748  1.00 11.36 ? 788  PHE A CZ  1 
ATOM   582  N N   . ARG A 1 76  ? 17.492  22.100 8.383   1.00 15.39 ? 789  ARG A N   1 
ATOM   583  C CA  . ARG A 1 76  ? 17.218  20.973 7.494   1.00 18.59 ? 789  ARG A CA  1 
ATOM   584  C C   . ARG A 1 76  ? 16.657  19.774 8.249   1.00 15.63 ? 789  ARG A C   1 
ATOM   585  O O   . ARG A 1 76  ? 15.727  19.121 7.780   1.00 15.84 ? 789  ARG A O   1 
ATOM   586  C CB  . ARG A 1 76  ? 18.476  20.558 6.735   1.00 21.10 ? 789  ARG A CB  1 
ATOM   587  C CG  . ARG A 1 76  ? 18.306  20.608 5.241   1.00 30.87 ? 789  ARG A CG  1 
ATOM   588  C CD  . ARG A 1 76  ? 18.163  22.047 4.736   1.00 34.97 ? 789  ARG A CD  1 
ATOM   589  N NE  . ARG A 1 76  ? 19.404  22.559 4.149   1.00 40.86 ? 789  ARG A NE  1 
ATOM   590  C CZ  . ARG A 1 76  ? 19.905  22.163 2.980   1.00 43.19 ? 789  ARG A CZ  1 
ATOM   591  N NH1 . ARG A 1 76  ? 19.308  21.203 2.283   1.00 45.92 ? 789  ARG A NH1 1 
ATOM   592  N NH2 . ARG A 1 76  ? 21.018  22.712 2.510   1.00 45.02 ? 789  ARG A NH2 1 
ATOM   593  N N   . ALA A 1 77  ? 17.152  19.556 9.462   1.00 16.10 ? 790  ALA A N   1 
ATOM   594  C CA  . ALA A 1 77  ? 16.707  18.428 10.279  1.00 15.73 ? 790  ALA A CA  1 
ATOM   595  C C   . ALA A 1 77  ? 15.277  18.634 10.800  1.00 17.53 ? 790  ALA A C   1 
ATOM   596  O O   . ALA A 1 77  ? 14.781  19.769 10.843  1.00 16.08 ? 790  ALA A O   1 
ATOM   597  C CB  . ALA A 1 77  ? 17.669  18.210 11.446  1.00 16.08 ? 790  ALA A CB  1 
ATOM   598  N N   . THR A 1 78  ? 14.600  17.528 11.118  1.00 13.50 ? 791  THR A N   1 
ATOM   599  C CA  . THR A 1 78  ? 13.284  17.580 11.745  1.00 12.35 ? 791  THR A CA  1 
ATOM   600  C C   . THR A 1 78  ? 13.475  17.836 13.237  1.00 14.49 ? 791  THR A C   1 
ATOM   601  O O   . THR A 1 78  ? 14.104  17.039 13.936  1.00 12.79 ? 791  THR A O   1 
ATOM   602  C CB  . THR A 1 78  ? 12.513  16.242 11.538  1.00 13.12 ? 791  THR A CB  1 
ATOM   603  O OG1 . THR A 1 78  ? 12.232  16.051 10.143  1.00 14.84 ? 791  THR A OG1 1 
ATOM   604  C CG2 . THR A 1 78  ? 11.197  16.253 12.296  1.00 15.17 ? 791  THR A CG2 1 
ATOM   605  N N   . THR A 1 79  ? 13.048  19.010 13.697  1.00 14.87 ? 792  THR A N   1 
ATOM   606  C CA  . THR A 1 79  ? 13.163  19.363 15.113  1.00 13.91 ? 792  THR A CA  1 
ATOM   607  C C   . THR A 1 79  ? 11.812  19.802 15.679  1.00 14.06 ? 792  THR A C   1 
ATOM   608  O O   . THR A 1 79  ? 10.867  20.032 14.927  1.00 12.98 ? 792  THR A O   1 
ATOM   609  C CB  . THR A 1 79  ? 14.163  20.520 15.318  1.00 16.45 ? 792  THR A CB  1 
ATOM   610  O OG1 . THR A 1 79  ? 13.791  21.620 14.482  1.00 14.17 ? 792  THR A OG1 1 
ATOM   611  C CG2 . THR A 1 79  ? 15.579  20.083 14.980  1.00 18.54 ? 792  THR A CG2 1 
ATOM   612  N N   . LEU A 1 80  ? 11.730  19.972 16.999  1.00 12.83 ? 793  LEU A N   1 
ATOM   613  C CA  . LEU A 1 80  ? 10.535  20.574 17.584  1.00 13.12 ? 793  LEU A CA  1 
ATOM   614  C C   . LEU A 1 80  ? 10.292  21.955 16.981  1.00 12.04 ? 793  LEU A C   1 
ATOM   615  O O   . LEU A 1 80  ? 9.163   22.295 16.637  1.00 13.13 ? 793  LEU A O   1 
ATOM   616  C CB  . LEU A 1 80  ? 10.657  20.692 19.104  1.00 13.85 ? 793  LEU A CB  1 
ATOM   617  C CG  . LEU A 1 80  ? 9.413   21.294 19.765  1.00 11.86 ? 793  LEU A CG  1 
ATOM   618  C CD1 . LEU A 1 80  ? 8.185   20.443 19.441  1.00 15.39 ? 793  LEU A CD1 1 
ATOM   619  C CD2 . LEU A 1 80  ? 9.616   21.377 21.265  1.00 16.12 ? 793  LEU A CD2 1 
ATOM   620  N N   . ALA A 1 81  ? 11.366  22.719 16.802  1.00 12.37 ? 794  ALA A N   1 
ATOM   621  C CA  . ALA A 1 81  ? 11.281  24.055 16.217  1.00 13.43 ? 794  ALA A CA  1 
ATOM   622  C C   . ALA A 1 81  ? 10.633  24.030 14.831  1.00 14.16 ? 794  ALA A C   1 
ATOM   623  O O   . ALA A 1 81  ? 9.686   24.777 14.570  1.00 13.88 ? 794  ALA A O   1 
ATOM   624  C CB  . ALA A 1 81  ? 12.676  24.687 16.136  1.00 12.00 ? 794  ALA A CB  1 
ATOM   625  N N   . SER A 1 82  ? 11.134  23.164 13.949  1.00 13.05 ? 795  SER A N   1 
ATOM   626  C CA  . SER A 1 82  ? 10.637  23.122 12.584  1.00 12.02 ? 795  SER A CA  1 
ATOM   627  C C   . SER A 1 82  ? 9.219   22.559 12.538  1.00 12.26 ? 795  SER A C   1 
ATOM   628  O O   . SER A 1 82  ? 8.378   23.046 11.783  1.00 12.67 ? 795  SER A O   1 
ATOM   629  C CB  . SER A 1 82  ? 11.581  22.303 11.698  1.00 13.49 ? 795  SER A CB  1 
ATOM   630  O OG  . SER A 1 82  ? 11.595  20.939 12.073  1.00 17.29 ? 795  SER A OG  1 
ATOM   631  N N   . THR A 1 83  ? 8.914   21.642 13.451  1.00 11.54 ? 796  THR A N   1 
ATOM   632  C CA  . THR A 1 83  ? 7.587   21.042 13.531  1.00 12.25 ? 796  THR A CA  1 
ATOM   633  C C   . THR A 1 83  ? 6.550   22.047 14.027  1.00 13.00 ? 796  THR A C   1 
ATOM   634  O O   . THR A 1 83  ? 5.453   22.150 13.467  1.00 12.71 ? 796  THR A O   1 
ATOM   635  C CB  . THR A 1 83  ? 7.595   19.822 14.459  1.00 11.39 ? 796  THR A CB  1 
ATOM   636  O OG1 . THR A 1 83  ? 8.475   18.829 13.918  1.00 14.63 ? 796  THR A OG1 1 
ATOM   637  C CG2 . THR A 1 83  ? 6.197   19.239 14.593  1.00 14.29 ? 796  THR A CG2 1 
ATOM   638  N N   . LEU A 1 84  ? 6.943   22.854 15.008  1.00 12.20 ? 797  LEU A N   1 
ATOM   639  C CA  . LEU A 1 84  ? 6.105   23.946 15.472  1.00 12.05 ? 797  LEU A CA  1 
ATOM   640  C C   . LEU A 1 84  ? 5.847   24.966 14.361  1.00 13.39 ? 797  LEU A C   1 
ATOM   641  O O   . LEU A 1 84  ? 4.697   25.345 14.112  1.00 14.35 ? 797  LEU A O   1 
ATOM   642  C CB  . LEU A 1 84  ? 6.742   24.621 16.688  1.00 10.57 ? 797  LEU A CB  1 
ATOM   643  C CG  . LEU A 1 84  ? 6.490   23.846 17.982  1.00 10.34 ? 797  LEU A CG  1 
ATOM   644  C CD1 . LEU A 1 84  ? 7.414   24.343 19.062  1.00 12.14 ? 797  LEU A CD1 1 
ATOM   645  C CD2 . LEU A 1 84  ? 5.048   24.007 18.407  1.00 14.07 ? 797  LEU A CD2 1 
ATOM   646  N N   . MET A 1 85  ? 6.893   25.330 13.625  1.00 12.60 ? 798  MET A N   1 
ATOM   647  C CA  . MET A 1 85  ? 6.726   26.279 12.541  1.00 12.33 ? 798  MET A CA  1 
ATOM   648  C C   . MET A 1 85  ? 5.755   25.760 11.465  1.00 14.50 ? 798  MET A C   1 
ATOM   649  O O   . MET A 1 85  ? 4.885   26.501 10.998  1.00 12.25 ? 798  MET A O   1 
ATOM   650  C CB  . MET A 1 85  ? 8.085   26.620 11.931  1.00 15.50 ? 798  MET A CB  1 
ATOM   651  C CG  . MET A 1 85  ? 8.929   27.554 12.783  1.00 14.87 ? 798  MET A CG  1 
ATOM   652  S SD  . MET A 1 85  ? 8.245   29.230 12.814  1.00 16.07 ? 798  MET A SD  1 
ATOM   653  C CE  . MET A 1 85  ? 8.545   29.778 11.144  1.00 18.41 ? 798  MET A CE  1 
ATOM   654  N N   . GLU A 1 86  ? 5.849   24.473 11.133  1.00 12.22 ? 799  GLU A N   1 
ATOM   655  C CA  . GLU A 1 86  ? 4.977   23.882 10.121  1.00 14.57 ? 799  GLU A CA  1 
ATOM   656  C C   . GLU A 1 86  ? 3.515   23.849 10.558  1.00 15.08 ? 799  GLU A C   1 
ATOM   657  O O   . GLU A 1 86  ? 2.632   24.314 9.831   1.00 14.12 ? 799  GLU A O   1 
ATOM   658  C CB  . GLU A 1 86  ? 5.460   22.472 9.767   1.00 16.01 ? 799  GLU A CB  1 
ATOM   659  C CG  . GLU A 1 86  ? 6.794   22.493 9.032   1.00 23.04 ? 799  GLU A CG  1 
ATOM   660  C CD  . GLU A 1 86  ? 7.454   21.131 8.905   1.00 28.52 ? 799  GLU A CD  1 
ATOM   661  O OE1 . GLU A 1 86  ? 7.253   20.257 9.781   1.00 31.53 ? 799  GLU A OE1 1 
ATOM   662  O OE2 . GLU A 1 86  ? 8.219   20.953 7.939   1.00 29.74 ? 799  GLU A OE2 1 
ATOM   663  N N   . GLN A 1 87  ? 3.281   23.425 11.799  1.00 16.05 ? 800  GLN A N   1 
ATOM   664  C CA  . GLN A 1 87  ? 1.940   23.440 12.378  1.00 15.62 ? 800  GLN A CA  1 
ATOM   665  C C   . GLN A 1 87  ? 1.386   24.860 12.459  1.00 15.33 ? 800  GLN A C   1 
ATOM   666  O O   . GLN A 1 87  ? 0.205   25.094 12.201  1.00 15.32 ? 800  GLN A O   1 
ATOM   667  C CB  . GLN A 1 87  ? 1.954   22.815 13.776  1.00 17.32 ? 800  GLN A CB  1 
ATOM   668  C CG  . GLN A 1 87  ? 2.257   21.314 13.782  1.00 20.94 ? 800  GLN A CG  1 
ATOM   669  C CD  . GLN A 1 87  ? 1.829   20.630 15.067  1.00 19.27 ? 800  GLN A CD  1 
ATOM   670  O OE1 . GLN A 1 87  ? 1.032   21.171 15.830  1.00 23.85 ? 800  GLN A OE1 1 
ATOM   671  N NE2 . GLN A 1 87  ? 2.307   19.407 15.276  1.00 21.19 ? 800  GLN A NE2 1 
ATOM   672  N N   . TYR A 1 88  ? 2.241   25.808 12.818  1.00 13.60 ? 801  TYR A N   1 
ATOM   673  C CA  . TYR A 1 88  ? 1.795   27.179 12.991  1.00 14.66 ? 801  TYR A CA  1 
ATOM   674  C C   . TYR A 1 88  ? 1.399   27.788 11.655  1.00 14.25 ? 801  TYR A C   1 
ATOM   675  O O   . TYR A 1 88  ? 0.355   28.439 11.545  1.00 12.62 ? 801  TYR A O   1 
ATOM   676  C CB  . TYR A 1 88  ? 2.889   28.015 13.658  1.00 15.13 ? 801  TYR A CB  1 
ATOM   677  C CG  . TYR A 1 88  ? 2.519   29.464 13.835  1.00 14.96 ? 801  TYR A CG  1 
ATOM   678  C CD1 . TYR A 1 88  ? 1.456   29.836 14.652  1.00 16.19 ? 801  TYR A CD1 1 
ATOM   679  C CD2 . TYR A 1 88  ? 3.189   30.459 13.126  1.00 16.27 ? 801  TYR A CD2 1 
ATOM   680  C CE1 . TYR A 1 88  ? 1.062   31.169 14.750  1.00 20.35 ? 801  TYR A CE1 1 
ATOM   681  C CE2 . TYR A 1 88  ? 2.812   31.786 13.221  1.00 17.72 ? 801  TYR A CE2 1 
ATOM   682  C CZ  . TYR A 1 88  ? 1.752   32.137 14.029  1.00 19.69 ? 801  TYR A CZ  1 
ATOM   683  O OH  . TYR A 1 88  ? 1.392   33.458 14.127  1.00 24.59 ? 801  TYR A OH  1 
ATOM   684  N N   . MET A 1 89  ? 2.248   27.591 10.647  1.00 14.32 ? 802  MET A N   1 
ATOM   685  C CA  . MET A 1 89  ? 1.980   28.104 9.307   1.00 15.05 ? 802  MET A CA  1 
ATOM   686  C C   . MET A 1 89  ? 0.739   27.443 8.734   1.00 17.34 ? 802  MET A C   1 
ATOM   687  O O   . MET A 1 89  ? -0.067  28.099 8.097   1.00 16.65 ? 802  MET A O   1 
ATOM   688  C CB  . MET A 1 89  ? 3.164   27.857 8.372   1.00 15.95 ? 802  MET A CB  1 
ATOM   689  C CG  . MET A 1 89  ? 4.413   28.644 8.721   1.00 16.38 ? 802  MET A CG  1 
ATOM   690  S SD  . MET A 1 89  ? 5.667   28.546 7.432   1.00 19.62 ? 802  MET A SD  1 
ATOM   691  C CE  . MET A 1 89  ? 6.471   26.956 7.823   1.00 17.38 ? 802  MET A CE  1 
ATOM   692  N N   . LYS A 1 90  ? 0.562   26.155 9.005   1.00 18.77 ? 803  LYS A N   1 
ATOM   693  C CA  . LYS A 1 90  ? -0.629  25.447 8.560   1.00 24.28 ? 803  LYS A CA  1 
ATOM   694  C C   . LYS A 1 90  ? -1.885  26.091 9.153   1.00 25.56 ? 803  LYS A C   1 
ATOM   695  O O   . LYS A 1 90  ? -2.818  26.433 8.422   1.00 27.32 ? 803  LYS A O   1 
ATOM   696  C CB  . LYS A 1 90  ? -0.531  23.960 8.941   1.00 27.68 ? 803  LYS A CB  1 
ATOM   697  C CG  . LYS A 1 90  ? -1.685  23.413 9.774   1.00 33.78 ? 803  LYS A CG  1 
ATOM   698  C CD  . LYS A 1 90  ? -1.173  22.602 10.958  1.00 36.04 ? 803  LYS A CD  1 
ATOM   699  C CE  . LYS A 1 90  ? -1.944  22.942 12.218  1.00 37.53 ? 803  LYS A CE  1 
ATOM   700  N NZ  . LYS A 1 90  ? -1.306  22.362 13.427  1.00 40.74 ? 803  LYS A NZ  1 
ATOM   701  N N   . ALA A 1 91  ? -1.813  26.433 10.437  1.00 25.34 ? 804  ALA A N   1 
ATOM   702  C CA  . ALA A 1 91  ? -2.949  27.002 11.154  1.00 23.91 ? 804  ALA A CA  1 
ATOM   703  C C   . ALA A 1 91  ? -3.291  28.431 10.717  1.00 24.27 ? 804  ALA A C   1 
ATOM   704  O O   . ALA A 1 91  ? -4.441  28.858 10.834  1.00 25.74 ? 804  ALA A O   1 
ATOM   705  C CB  . ALA A 1 91  ? -2.680  26.971 12.654  1.00 25.21 ? 804  ALA A CB  1 
ATOM   706  N N   . THR A 1 92  ? -2.295  29.185 10.255  1.00 21.05 ? 805  THR A N   1 
ATOM   707  C CA  . THR A 1 92  ? -2.478  30.623 10.059  1.00 20.37 ? 805  THR A CA  1 
ATOM   708  C C   . THR A 1 92  ? -2.279  31.138 8.630   1.00 18.39 ? 805  THR A C   1 
ATOM   709  O O   . THR A 1 92  ? -2.744  32.227 8.298   1.00 22.05 ? 805  THR A O   1 
ATOM   710  C CB  . THR A 1 92  ? -1.571  31.463 11.018  1.00 18.80 ? 805  THR A CB  1 
ATOM   711  O OG1 . THR A 1 92  ? -0.189  31.186 10.756  1.00 19.40 ? 805  THR A OG1 1 
ATOM   712  C CG2 . THR A 1 92  ? -1.883  31.148 12.473  1.00 22.03 ? 805  THR A CG2 1 
ATOM   713  N N   . ALA A 1 93  ? -1.584  30.380 7.791   1.00 16.97 ? 806  ALA A N   1 
ATOM   714  C CA  . ALA A 1 93  ? -1.191  30.890 6.472   1.00 18.51 ? 806  ALA A CA  1 
ATOM   715  C C   . ALA A 1 93  ? -2.039  30.358 5.315   1.00 17.88 ? 806  ALA A C   1 
ATOM   716  O O   . ALA A 1 93  ? -1.648  30.483 4.152   1.00 16.10 ? 806  ALA A O   1 
ATOM   717  C CB  . ALA A 1 93  ? 0.295   30.606 6.208   1.00 17.69 ? 806  ALA A CB  1 
ATOM   718  N N   . THR A 1 94  ? -3.229  29.839 5.627   1.00 17.58 ? 807  THR A N   1 
ATOM   719  C CA  . THR A 1 94  ? -4.111  29.264 4.609   1.00 17.93 ? 807  THR A CA  1 
ATOM   720  C C   . THR A 1 94  ? -4.517  30.280 3.541   1.00 15.98 ? 807  THR A C   1 
ATOM   721  O O   . THR A 1 94  ? -4.537  29.953 2.356   1.00 13.77 ? 807  THR A O   1 
ATOM   722  C CB  . THR A 1 94  ? -5.391  28.639 5.253   1.00 19.82 ? 807  THR A CB  1 
ATOM   723  O OG1 . THR A 1 94  ? -5.031  27.450 5.959   1.00 23.10 ? 807  THR A OG1 1 
ATOM   724  C CG2 . THR A 1 94  ? -6.428  28.274 4.192   1.00 22.27 ? 807  THR A CG2 1 
ATOM   725  N N   . GLN A 1 95  ? -4.795  31.516 3.952   1.00 14.62 ? 808  GLN A N   1 
ATOM   726  C CA  . GLN A 1 95  ? -5.205  32.539 2.997   1.00 15.94 ? 808  GLN A CA  1 
ATOM   727  C C   . GLN A 1 95  ? -4.065  32.941 2.065   1.00 13.87 ? 808  GLN A C   1 
ATOM   728  O O   . GLN A 1 95  ? -4.268  33.095 0.856   1.00 13.75 ? 808  GLN A O   1 
ATOM   729  C CB  . GLN A 1 95  ? -5.760  33.764 3.724   1.00 19.31 ? 808  GLN A CB  1 
ATOM   730  C CG  . GLN A 1 95  ? -7.094  33.493 4.388   1.00 26.76 ? 808  GLN A CG  1 
ATOM   731  C CD  . GLN A 1 95  ? -7.516  34.595 5.337   1.00 34.92 ? 808  GLN A CD  1 
ATOM   732  O OE1 . GLN A 1 95  ? -8.590  35.188 5.181   1.00 38.38 ? 808  GLN A OE1 1 
ATOM   733  N NE2 . GLN A 1 95  ? -6.701  34.841 6.360   1.00 36.67 ? 808  GLN A NE2 1 
ATOM   734  N N   . PHE A 1 96  ? -2.851  32.995 2.602   1.00 12.81 ? 809  PHE A N   1 
ATOM   735  C CA  . PHE A 1 96  ? -1.676  33.225 1.778   1.00 11.20 ? 809  PHE A CA  1 
ATOM   736  C C   . PHE A 1 96  ? -1.518  32.087 0.776   1.00 11.36 ? 809  PHE A C   1 
ATOM   737  O O   . PHE A 1 96  ? -1.303  32.333 -0.410  1.00 11.07 ? 809  PHE A O   1 
ATOM   738  C CB  . PHE A 1 96  ? -0.420  33.327 2.643   1.00 11.74 ? 809  PHE A CB  1 
ATOM   739  C CG  . PHE A 1 96  ? 0.860   33.271 1.861   1.00 11.18 ? 809  PHE A CG  1 
ATOM   740  C CD1 . PHE A 1 96  ? 1.307   34.377 1.151   1.00 12.89 ? 809  PHE A CD1 1 
ATOM   741  C CD2 . PHE A 1 96  ? 1.617   32.102 1.824   1.00 12.41 ? 809  PHE A CD2 1 
ATOM   742  C CE1 . PHE A 1 96  ? 2.489   34.323 0.418   1.00 14.77 ? 809  PHE A CE1 1 
ATOM   743  C CE2 . PHE A 1 96  ? 2.800   32.032 1.097   1.00 12.52 ? 809  PHE A CE2 1 
ATOM   744  C CZ  . PHE A 1 96  ? 3.240   33.145 0.389   1.00 15.43 ? 809  PHE A CZ  1 
ATOM   745  N N   . VAL A 1 97  ? -1.614  30.847 1.258   1.00 11.94 ? 810  VAL A N   1 
ATOM   746  C CA  . VAL A 1 97  ? -1.413  29.684 0.395   1.00 12.76 ? 810  VAL A CA  1 
ATOM   747  C C   . VAL A 1 97  ? -2.467  29.640 -0.721  1.00 13.08 ? 810  VAL A C   1 
ATOM   748  O O   . VAL A 1 97  ? -2.131  29.392 -1.881  1.00 13.05 ? 810  VAL A O   1 
ATOM   749  C CB  . VAL A 1 97  ? -1.425  28.343 1.210   1.00 13.50 ? 810  VAL A CB  1 
ATOM   750  C CG1 . VAL A 1 97  ? -1.326  27.137 0.269   1.00 13.13 ? 810  VAL A CG1 1 
ATOM   751  C CG2 . VAL A 1 97  ? -0.265  28.305 2.180   1.00 12.71 ? 810  VAL A CG2 1 
ATOM   752  N N   . HIS A 1 98  ? -3.713  29.979 -0.392  1.00 13.18 ? 811  HIS A N   1 
ATOM   753  C CA  . HIS A 1 98  ? -4.767  30.023 -1.403  1.00 14.61 ? 811  HIS A CA  1 
ATOM   754  C C   . HIS A 1 98  ? -4.539  31.154 -2.407  1.00 14.62 ? 811  HIS A C   1 
ATOM   755  O O   . HIS A 1 98  ? -4.540  30.925 -3.621  1.00 12.52 ? 811  HIS A O   1 
ATOM   756  C CB  . HIS A 1 98  ? -6.147  30.176 -0.758  1.00 16.39 ? 811  HIS A CB  1 
ATOM   757  C CG  . HIS A 1 98  ? -6.685  28.906 -0.168  1.00 22.28 ? 811  HIS A CG  1 
ATOM   758  N ND1 . HIS A 1 98  ? -6.014  27.706 -0.240  1.00 25.32 ? 811  HIS A ND1 1 
ATOM   759  C CD2 . HIS A 1 98  ? -7.807  28.669 0.553   1.00 23.77 ? 811  HIS A CD2 1 
ATOM   760  C CE1 . HIS A 1 98  ? -6.696  26.782 0.417   1.00 25.85 ? 811  HIS A CE1 1 
ATOM   761  N NE2 . HIS A 1 98  ? -7.787  27.340 0.906   1.00 25.64 ? 811  HIS A NE2 1 
ATOM   762  N N   . HIS A 1 99  ? -4.274  32.353 -1.901  1.00 13.53 ? 812  HIS A N   1 
ATOM   763  C CA  . HIS A 1 99  ? -3.956  33.485 -2.768  1.00 14.70 ? 812  HIS A CA  1 
ATOM   764  C C   . HIS A 1 99  ? -2.777  33.188 -3.695  1.00 13.28 ? 812  HIS A C   1 
ATOM   765  O O   . HIS A 1 99  ? -2.832  33.474 -4.885  1.00 13.62 ? 812  HIS A O   1 
ATOM   766  C CB  . HIS A 1 99  ? -3.639  34.719 -1.924  1.00 17.10 ? 812  HIS A CB  1 
ATOM   767  C CG  . HIS A 1 99  ? -4.848  35.483 -1.498  1.00 21.06 ? 812  HIS A CG  1 
ATOM   768  N ND1 . HIS A 1 99  ? -5.075  36.793 -1.877  1.00 22.96 ? 812  HIS A ND1 1 
ATOM   769  C CD2 . HIS A 1 99  ? -5.899  35.130 -0.721  1.00 20.35 ? 812  HIS A CD2 1 
ATOM   770  C CE1 . HIS A 1 99  ? -6.211  37.209 -1.349  1.00 22.20 ? 812  HIS A CE1 1 
ATOM   771  N NE2 . HIS A 1 99  ? -6.731  36.220 -0.643  1.00 19.90 ? 812  HIS A NE2 1 
ATOM   772  N N   . ALA A 1 100 ? -1.752  32.536 -3.153  1.00 12.51 ? 813  ALA A N   1 
ATOM   773  C CA  . ALA A 1 100 ? -0.548  32.212 -3.908  1.00 13.99 ? 813  ALA A CA  1 
ATOM   774  C C   . ALA A 1 100 ? -0.763  31.118 -4.954  1.00 13.60 ? 813  ALA A C   1 
ATOM   775  O O   . ALA A 1 100 ? -0.247  31.222 -6.070  1.00 14.12 ? 813  ALA A O   1 
ATOM   776  C CB  . ALA A 1 100 ? 0.570   31.803 -2.955  1.00 14.50 ? 813  ALA A CB  1 
ATOM   777  N N   . LEU A 1 101 ? -1.516  30.079 -4.593  1.00 12.53 ? 814  LEU A N   1 
ATOM   778  C CA  . LEU A 1 101 ? -1.463  28.798 -5.309  1.00 13.12 ? 814  LEU A CA  1 
ATOM   779  C C   . LEU A 1 101 ? -2.761  28.323 -5.954  1.00 12.39 ? 814  LEU A C   1 
ATOM   780  O O   . LEU A 1 101 ? -2.717  27.581 -6.936  1.00 12.62 ? 814  LEU A O   1 
ATOM   781  C CB  . LEU A 1 101 ? -0.960  27.679 -4.381  1.00 12.21 ? 814  LEU A CB  1 
ATOM   782  C CG  . LEU A 1 101 ? 0.387   27.807 -3.665  1.00 12.74 ? 814  LEU A CG  1 
ATOM   783  C CD1 . LEU A 1 101 ? 0.682   26.487 -2.934  1.00 11.90 ? 814  LEU A CD1 1 
ATOM   784  C CD2 . LEU A 1 101 ? 1.507   28.135 -4.669  1.00 12.83 ? 814  LEU A CD2 1 
ATOM   785  N N   . LYS A 1 102 ? -3.903  28.668 -5.368  1.00 14.05 ? 815  LYS A N   1 
ATOM   786  C CA  . LYS A 1 102 ? -5.172  28.050 -5.768  1.00 18.44 ? 815  LYS A CA  1 
ATOM   787  C C   . LYS A 1 102 ? -5.479  28.106 -7.272  1.00 18.85 ? 815  LYS A C   1 
ATOM   788  O O   . LYS A 1 102 ? -5.723  27.075 -7.895  1.00 18.10 ? 815  LYS A O   1 
ATOM   789  C CB  . LYS A 1 102 ? -6.345  28.652 -4.991  1.00 20.81 ? 815  LYS A CB  1 
ATOM   790  C CG  . LYS A 1 102 ? -7.677  27.943 -5.261  1.00 22.65 ? 815  LYS A CG  1 
ATOM   791  C CD  . LYS A 1 102 ? -8.831  28.673 -4.607  1.00 27.25 ? 815  LYS A CD  1 
ATOM   792  C CE  . LYS A 1 102 ? -9.206  28.034 -3.286  1.00 32.59 ? 815  LYS A CE  1 
ATOM   793  N NZ  . LYS A 1 102 ? -9.712  26.646 -3.489  1.00 37.34 ? 815  LYS A NZ  1 
ATOM   794  N N   . ASP A 1 103 ? -5.430  29.301 -7.851  1.00 18.81 ? 816  ASP A N   1 
ATOM   795  C CA  . ASP A 1 103 ? -5.750  29.487 -9.262  1.00 20.38 ? 816  ASP A CA  1 
ATOM   796  C C   . ASP A 1 103 ? -4.813  28.734 -10.190 1.00 17.88 ? 816  ASP A C   1 
ATOM   797  O O   . ASP A 1 103 ? -5.252  28.171 -11.188 1.00 19.56 ? 816  ASP A O   1 
ATOM   798  C CB  . ASP A 1 103 ? -5.730  30.973 -9.617  1.00 25.39 ? 816  ASP A CB  1 
ATOM   799  C CG  . ASP A 1 103 ? -6.814  31.760 -8.906  1.00 32.09 ? 816  ASP A CG  1 
ATOM   800  O OD1 . ASP A 1 103 ? -7.822  31.150 -8.480  1.00 34.18 ? 816  ASP A OD1 1 
ATOM   801  O OD2 . ASP A 1 103 ? -6.649  32.993 -8.770  1.00 37.66 ? 816  ASP A OD2 1 
ATOM   802  N N   . SER A 1 104 ? -3.520  28.753 -9.882  1.00 16.66 ? 817  SER A N   1 
ATOM   803  C CA  . SER A 1 104 ? -2.530  28.048 -10.694 1.00 16.80 ? 817  SER A CA  1 
ATOM   804  C C   . SER A 1 104 ? -2.751  26.538 -10.651 1.00 14.69 ? 817  SER A C   1 
ATOM   805  O O   . SER A 1 104 ? -2.718  25.861 -11.690 1.00 13.40 ? 817  SER A O   1 
ATOM   806  C CB  . SER A 1 104 ? -1.112  28.376 -10.210 1.00 20.06 ? 817  SER A CB  1 
ATOM   807  O OG  . SER A 1 104 ? -0.753  29.706 -10.546 1.00 19.97 ? 817  SER A OG  1 
ATOM   808  N N   . ILE A 1 105 ? -3.029  26.024 -9.458  1.00 11.78 ? 818  ILE A N   1 
ATOM   809  C CA  . ILE A 1 105 ? -3.220  24.589 -9.281  1.00 12.12 ? 818  ILE A CA  1 
ATOM   810  C C   . ILE A 1 105 ? -4.511  24.086 -9.929  1.00 10.95 ? 818  ILE A C   1 
ATOM   811  O O   . ILE A 1 105 ? -4.500  23.073 -10.615 1.00 12.06 ? 818  ILE A O   1 
ATOM   812  C CB  . ILE A 1 105 ? -3.168  24.193 -7.778  1.00 13.13 ? 818  ILE A CB  1 
ATOM   813  C CG1 . ILE A 1 105 ? -1.724  24.305 -7.263  1.00 15.79 ? 818  ILE A CG1 1 
ATOM   814  C CG2 . ILE A 1 105 ? -3.672  22.759 -7.581  1.00 13.48 ? 818  ILE A CG2 1 
ATOM   815  C CD1 . ILE A 1 105 ? -1.571  24.108 -5.770  1.00 15.34 ? 818  ILE A CD1 1 
ATOM   816  N N   . LEU A 1 106 ? -5.587  24.856 -9.827  1.00 13.25 ? 819  LEU A N   1 
ATOM   817  C CA  . LEU A 1 106 ? -6.860  24.464 -10.436 1.00 16.29 ? 819  LEU A CA  1 
ATOM   818  C C   . LEU A 1 106 ? -6.771  24.455 -11.959 1.00 16.41 ? 819  LEU A C   1 
ATOM   819  O O   . LEU A 1 106 ? -7.384  23.615 -12.613 1.00 15.92 ? 819  LEU A O   1 
ATOM   820  C CB  . LEU A 1 106 ? -7.990  25.396 -9.990  1.00 18.93 ? 819  LEU A CB  1 
ATOM   821  C CG  . LEU A 1 106 ? -8.350  25.402 -8.504  1.00 21.50 ? 819  LEU A CG  1 
ATOM   822  C CD1 . LEU A 1 106 ? -9.459  26.412 -8.285  1.00 22.32 ? 819  LEU A CD1 1 
ATOM   823  C CD2 . LEU A 1 106 ? -8.784  24.007 -8.056  1.00 23.19 ? 819  LEU A CD2 1 
ATOM   824  N N   . LYS A 1 107 ? -5.985  25.372 -12.516 1.00 16.08 ? 820  LYS A N   1 
ATOM   825  C CA  . LYS A 1 107 ? -5.697  25.361 -13.945 1.00 17.77 ? 820  LYS A CA  1 
ATOM   826  C C   . LYS A 1 107 ? -4.913  24.112 -14.363 1.00 17.62 ? 820  LYS A C   1 
ATOM   827  O O   . LYS A 1 107 ? -5.247  23.460 -15.362 1.00 16.29 ? 820  LYS A O   1 
ATOM   828  C CB  . LYS A 1 107 ? -4.924  26.619 -14.340 1.00 19.85 ? 820  LYS A CB  1 
ATOM   829  C CG  . LYS A 1 107 ? -5.818  27.780 -14.741 1.00 27.42 ? 820  LYS A CG  1 
ATOM   830  C CD  . LYS A 1 107 ? -5.038  29.090 -14.838 1.00 33.28 ? 820  LYS A CD  1 
ATOM   831  C CE  . LYS A 1 107 ? -4.965  29.596 -16.272 1.00 38.25 ? 820  LYS A CE  1 
ATOM   832  N NZ  . LYS A 1 107 ? -5.188  31.077 -16.370 1.00 39.71 ? 820  LYS A NZ  1 
ATOM   833  N N   . ILE A 1 108 ? -3.896  23.764 -13.578 1.00 15.81 ? 821  ILE A N   1 
ATOM   834  C CA  . ILE A 1 108 ? -3.093  22.570 -13.843 1.00 15.86 ? 821  ILE A CA  1 
ATOM   835  C C   . ILE A 1 108 ? -3.964  21.309 -13.791 1.00 17.20 ? 821  ILE A C   1 
ATOM   836  O O   . ILE A 1 108 ? -3.892  20.462 -14.690 1.00 15.98 ? 821  ILE A O   1 
ATOM   837  C CB  . ILE A 1 108 ? -1.909  22.462 -12.836 1.00 17.19 ? 821  ILE A CB  1 
ATOM   838  C CG1 . ILE A 1 108 ? -0.869  23.551 -13.139 1.00 18.13 ? 821  ILE A CG1 1 
ATOM   839  C CG2 . ILE A 1 108 ? -1.232  21.088 -12.927 1.00 14.31 ? 821  ILE A CG2 1 
ATOM   840  C CD1 . ILE A 1 108 ? 0.277   23.621 -12.125 1.00 17.84 ? 821  ILE A CD1 1 
ATOM   841  N N   . MET A 1 109 ? -4.852  21.240 -12.798 1.00 16.27 ? 822  MET A N   1 
ATOM   842  C CA  . MET A 1 109 ? -5.764  20.103 -12.642 1.00 18.31 ? 822  MET A CA  1 
ATOM   843  C C   . MET A 1 109 ? -6.645  19.898 -13.866 1.00 19.48 ? 822  MET A C   1 
ATOM   844  O O   . MET A 1 109 ? -7.053  18.779 -14.163 1.00 20.40 ? 822  MET A O   1 
ATOM   845  C CB  . MET A 1 109 ? -6.658  20.291 -11.415 1.00 18.04 ? 822  MET A CB  1 
ATOM   846  C CG  . MET A 1 109 ? -5.912  20.288 -10.092 1.00 20.72 ? 822  MET A CG  1 
ATOM   847  S SD  . MET A 1 109 ? -5.119  18.703 -9.718  1.00 22.68 ? 822  MET A SD  1 
ATOM   848  C CE  . MET A 1 109 ? -3.437  19.172 -9.928  1.00 29.56 ? 822  MET A CE  1 
ATOM   849  N N   . GLU A 1 110 ? -6.935  20.990 -14.565 1.00 20.14 ? 823  GLU A N   1 
ATOM   850  C CA  . GLU A 1 110 ? -7.884  20.981 -15.666 1.00 23.42 ? 823  GLU A CA  1 
ATOM   851  C C   . GLU A 1 110 ? -7.181  20.877 -17.007 1.00 23.84 ? 823  GLU A C   1 
ATOM   852  O O   . GLU A 1 110 ? -7.829  20.727 -18.048 1.00 26.05 ? 823  GLU A O   1 
ATOM   853  C CB  . GLU A 1 110 ? -8.728  22.257 -15.639 1.00 26.78 ? 823  GLU A CB  1 
ATOM   854  C CG  . GLU A 1 110 ? -9.869  22.231 -14.638 1.00 32.68 ? 823  GLU A CG  1 
ATOM   855  C CD  . GLU A 1 110 ? -10.805 23.412 -14.810 1.00 37.91 ? 823  GLU A CD  1 
ATOM   856  O OE1 . GLU A 1 110 ? -11.573 23.422 -15.798 1.00 41.59 ? 823  GLU A OE1 1 
ATOM   857  O OE2 . GLU A 1 110 ? -10.759 24.339 -13.972 1.00 40.08 ? 823  GLU A OE2 1 
ATOM   858  N N   . SER A 1 111 ? -5.861  21.002 -16.987 1.00 22.59 ? 824  SER A N   1 
ATOM   859  C CA  . SER A 1 111 ? -5.099  21.123 -18.217 1.00 21.97 ? 824  SER A CA  1 
ATOM   860  C C   . SER A 1 111 ? -4.769  19.777 -18.828 1.00 22.21 ? 824  SER A C   1 
ATOM   861  O O   . SER A 1 111 ? -4.459  18.815 -18.129 1.00 19.85 ? 824  SER A O   1 
ATOM   862  C CB  . SER A 1 111 ? -3.809  21.904 -17.976 1.00 21.71 ? 824  SER A CB  1 
ATOM   863  O OG  . SER A 1 111 ? -3.053  22.009 -19.170 1.00 20.42 ? 824  SER A OG  1 
ATOM   864  N N   . LYS A 1 112 ? -4.811  19.747 -20.152 1.00 23.50 ? 825  LYS A N   1 
ATOM   865  C CA  . LYS A 1 112 ? -4.472  18.564 -20.933 1.00 26.81 ? 825  LYS A CA  1 
ATOM   866  C C   . LYS A 1 112 ? -3.057  18.702 -21.513 1.00 25.20 ? 825  LYS A C   1 
ATOM   867  O O   . LYS A 1 112 ? -2.528  17.754 -22.091 1.00 25.76 ? 825  LYS A O   1 
ATOM   868  C CB  . LYS A 1 112 ? -5.487  18.396 -22.064 1.00 27.97 ? 825  LYS A CB  1 
ATOM   869  C CG  . LYS A 1 112 ? -5.740  16.982 -22.486 1.00 34.29 ? 825  LYS A CG  1 
ATOM   870  C CD  . LYS A 1 112 ? -6.843  16.934 -23.540 1.00 40.85 ? 825  LYS A CD  1 
ATOM   871  C CE  . LYS A 1 112 ? -6.390  17.523 -24.879 1.00 44.77 ? 825  LYS A CE  1 
ATOM   872  N NZ  . LYS A 1 112 ? -5.523  16.593 -25.672 1.00 46.96 ? 825  LYS A NZ  1 
ATOM   873  N N   . GLN A 1 113 ? -2.440  19.870 -21.326 1.00 23.87 ? 826  GLN A N   1 
ATOM   874  C CA  . GLN A 1 113 ? -1.122  20.147 -21.898 1.00 23.95 ? 826  GLN A CA  1 
ATOM   875  C C   . GLN A 1 113 ? 0.019   19.721 -20.975 1.00 21.85 ? 826  GLN A C   1 
ATOM   876  O O   . GLN A 1 113 ? 0.122   20.165 -19.828 1.00 21.03 ? 826  GLN A O   1 
ATOM   877  C CB  . GLN A 1 113 ? -0.988  21.629 -22.278 1.00 24.80 ? 826  GLN A CB  1 
ATOM   878  C CG  . GLN A 1 113 ? 0.456   22.144 -22.382 1.00 29.49 ? 826  GLN A CG  1 
ATOM   879  C CD  . GLN A 1 113 ? 1.123   21.946 -23.742 1.00 33.38 ? 826  GLN A CD  1 
ATOM   880  O OE1 . GLN A 1 113 ? 2.087   21.173 -23.874 1.00 30.28 ? 826  GLN A OE1 1 
ATOM   881  N NE2 . GLN A 1 113 ? 0.721   22.758 -24.715 1.00 33.79 ? 826  GLN A NE2 1 
ATOM   882  N N   . SER A 1 114 ? 0.911   18.914 -21.536 1.00 21.01 ? 827  SER A N   1 
ATOM   883  C CA  . SER A 1 114 ? 2.021   18.315 -20.812 1.00 20.14 ? 827  SER A CA  1 
ATOM   884  C C   . SER A 1 114 ? 3.125   19.336 -20.549 1.00 19.47 ? 827  SER A C   1 
ATOM   885  O O   . SER A 1 114 ? 3.321   20.263 -21.328 1.00 21.08 ? 827  SER A O   1 
ATOM   886  C CB  . SER A 1 114 ? 2.581   17.154 -21.637 1.00 19.41 ? 827  SER A CB  1 
ATOM   887  O OG  . SER A 1 114 ? 3.559   16.415 -20.931 1.00 21.15 ? 827  SER A OG  1 
ATOM   888  N N   . CYS A 1 115 ? 3.839   19.153 -19.446 1.00 19.70 ? 828  CYS A N   1 
ATOM   889  C CA  . CYS A 1 115 ? 5.064   19.897 -19.165 1.00 20.32 ? 828  CYS A CA  1 
ATOM   890  C C   . CYS A 1 115 ? 6.246   18.935 -19.144 1.00 20.62 ? 828  CYS A C   1 
ATOM   891  O O   . CYS A 1 115 ? 7.334   19.288 -18.689 1.00 20.50 ? 828  CYS A O   1 
ATOM   892  C CB  . CYS A 1 115 ? 4.959   20.602 -17.809 1.00 20.39 ? 828  CYS A CB  1 
ATOM   893  S SG  . CYS A 1 115 ? 3.746   21.939 -17.768 1.00 23.18 ? 828  CYS A SG  1 
ATOM   894  N N   . GLU A 1 116 ? 6.023   17.722 -19.644 1.00 21.82 ? 829  GLU A N   1 
ATOM   895  C CA  . GLU A 1 116 ? 7.036   16.668 -19.635 1.00 24.77 ? 829  GLU A CA  1 
ATOM   896  C C   . GLU A 1 116 ? 8.318   17.084 -20.365 1.00 23.99 ? 829  GLU A C   1 
ATOM   897  O O   . GLU A 1 116 ? 8.289   17.478 -21.530 1.00 23.38 ? 829  GLU A O   1 
ATOM   898  C CB  . GLU A 1 116 ? 6.465   15.390 -20.263 1.00 26.07 ? 829  GLU A CB  1 
ATOM   899  C CG  . GLU A 1 116 ? 7.384   14.184 -20.164 1.00 31.46 ? 829  GLU A CG  1 
ATOM   900  C CD  . GLU A 1 116 ? 7.689   13.811 -18.724 1.00 34.74 ? 829  GLU A CD  1 
ATOM   901  O OE1 . GLU A 1 116 ? 6.798   13.238 -18.060 1.00 37.16 ? 829  GLU A OE1 1 
ATOM   902  O OE2 . GLU A 1 116 ? 8.805   14.114 -18.244 1.00 36.76 ? 829  GLU A OE2 1 
ATOM   903  N N   . LEU A 1 117 ? 9.441   17.006 -19.660 1.00 26.07 ? 830  LEU A N   1 
ATOM   904  C CA  . LEU A 1 117 ? 10.715  17.465 -20.201 1.00 27.64 ? 830  LEU A CA  1 
ATOM   905  C C   . LEU A 1 117 ? 11.676  16.311 -20.462 1.00 29.27 ? 830  LEU A C   1 
ATOM   906  O O   . LEU A 1 117 ? 12.696  16.486 -21.126 1.00 31.13 ? 830  LEU A O   1 
ATOM   907  C CB  . LEU A 1 117 ? 11.360  18.471 -19.241 1.00 26.00 ? 830  LEU A CB  1 
ATOM   908  C CG  . LEU A 1 117 ? 10.539  19.702 -18.840 1.00 25.25 ? 830  LEU A CG  1 
ATOM   909  C CD1 . LEU A 1 117 ? 11.291  20.463 -17.747 1.00 25.93 ? 830  LEU A CD1 1 
ATOM   910  C CD2 . LEU A 1 117 ? 10.277  20.590 -20.054 1.00 21.05 ? 830  LEU A CD2 1 
ATOM   911  N N   . SER A 1 118 ? 11.394  15.162 -19.857 1.00 32.79 ? 831  SER A N   1 
ATOM   912  C CA  . SER A 1 118 ? 12.169  13.943 -20.090 1.00 35.28 ? 831  SER A CA  1 
ATOM   913  C C   . SER A 1 118 ? 11.766  13.304 -21.420 1.00 36.01 ? 831  SER A C   1 
ATOM   914  O O   . SER A 1 118 ? 10.692  12.713 -21.528 1.00 35.41 ? 831  SER A O   1 
ATOM   915  C CB  . SER A 1 118 ? 11.938  12.939 -18.954 1.00 35.58 ? 831  SER A CB  1 
ATOM   916  O OG  . SER A 1 118 ? 11.500  13.586 -17.767 1.00 40.10 ? 831  SER A OG  1 
ATOM   917  N N   . PRO A 1 119 ? 12.627  13.412 -22.448 1.00 37.76 ? 832  PRO A N   1 
ATOM   918  C CA  . PRO A 1 119 ? 12.328  12.896 -23.788 1.00 39.35 ? 832  PRO A CA  1 
ATOM   919  C C   . PRO A 1 119 ? 11.897  11.429 -23.807 1.00 40.63 ? 832  PRO A C   1 
ATOM   920  O O   . PRO A 1 119 ? 10.976  11.057 -24.536 1.00 40.92 ? 832  PRO A O   1 
ATOM   921  C CB  . PRO A 1 119 ? 13.632  13.122 -24.547 1.00 39.07 ? 832  PRO A CB  1 
ATOM   922  C CG  . PRO A 1 119 ? 14.208  14.330 -23.891 1.00 38.68 ? 832  PRO A CG  1 
ATOM   923  C CD  . PRO A 1 119 ? 13.923  14.113 -22.426 1.00 37.68 ? 832  PRO A CD  1 
ATOM   924  N N   . SER A 1 120 ? 12.483  10.630 -22.922 1.00 42.06 ? 833  SER A N   1 
ATOM   925  C CA  . SER A 1 120 ? 12.164  9.208  -22.838 1.00 42.16 ? 833  SER A CA  1 
ATOM   926  C C   . SER A 1 120 ? 10.758  8.968  -22.303 1.00 41.22 ? 833  SER A C   1 
ATOM   927  O O   . SER A 1 120 ? 10.156  7.925  -22.562 1.00 40.85 ? 833  SER A O   1 
ATOM   928  C CB  . SER A 1 120 ? 13.180  8.496  -21.947 1.00 43.74 ? 833  SER A CB  1 
ATOM   929  O OG  . SER A 1 120 ? 13.364  9.204  -20.731 1.00 46.73 ? 833  SER A OG  1 
ATOM   930  N N   . LYS A 1 121 ? 10.237  9.932  -21.551 1.00 41.05 ? 834  LYS A N   1 
ATOM   931  C CA  . LYS A 1 121 ? 8.864   9.847  -21.061 1.00 41.42 ? 834  LYS A CA  1 
ATOM   932  C C   . LYS A 1 121 ? 7.839   10.412 -22.047 1.00 41.64 ? 834  LYS A C   1 
ATOM   933  O O   . LYS A 1 121 ? 6.638   10.335 -21.805 1.00 40.15 ? 834  LYS A O   1 
ATOM   934  C CB  . LYS A 1 121 ? 8.737   10.543 -19.706 1.00 39.99 ? 834  LYS A CB  1 
ATOM   935  C CG  . LYS A 1 121 ? 9.363   9.769  -18.561 1.00 40.09 ? 834  LYS A CG  1 
ATOM   936  C CD  . LYS A 1 121 ? 9.380   10.600 -17.289 1.00 43.61 ? 834  LYS A CD  1 
ATOM   937  C CE  . LYS A 1 121 ? 10.167  9.909  -16.189 1.00 44.89 ? 834  LYS A CE  1 
ATOM   938  N NZ  . LYS A 1 121 ? 10.439  10.833 -15.053 1.00 47.41 ? 834  LYS A NZ  1 
ATOM   939  N N   . LEU A 1 122 ? 8.313   10.898 -23.192 1.00 44.85 ? 835  LEU A N   1 
ATOM   940  C CA  . LEU A 1 122 ? 7.426   11.372 -24.251 1.00 48.66 ? 835  LEU A CA  1 
ATOM   941  C C   . LEU A 1 122 ? 6.735   10.205 -24.949 1.00 50.95 ? 835  LEU A C   1 
ATOM   942  O O   . LEU A 1 122 ? 5.600   10.337 -25.407 1.00 51.92 ? 835  LEU A O   1 
ATOM   943  C CB  . LEU A 1 122 ? 8.200   12.202 -25.283 1.00 49.62 ? 835  LEU A CB  1 
ATOM   944  C CG  . LEU A 1 122 ? 8.841   13.523 -24.841 1.00 50.12 ? 835  LEU A CG  1 
ATOM   945  C CD1 . LEU A 1 122 ? 9.252   14.306 -26.071 1.00 49.97 ? 835  LEU A CD1 1 
ATOM   946  C CD2 . LEU A 1 122 ? 7.877   14.340 -23.991 1.00 50.12 ? 835  LEU A CD2 1 
ATOM   947  N N   . GLU A 1 123 ? 7.433   9.075  -25.037 1.00 53.92 ? 836  GLU A N   1 
ATOM   948  C CA  . GLU A 1 123 ? 6.881   7.842  -25.598 1.00 56.51 ? 836  GLU A CA  1 
ATOM   949  C C   . GLU A 1 123 ? 6.171   8.028  -26.943 1.00 57.68 ? 836  GLU A C   1 
ATOM   950  O O   . GLU A 1 123 ? 6.814   7.965  -27.994 1.00 59.25 ? 836  GLU A O   1 
ATOM   951  C CB  . GLU A 1 123 ? 5.948   7.176  -24.580 1.00 57.76 ? 836  GLU A CB  1 
ATOM   952  C CG  . GLU A 1 123 ? 6.687   6.478  -23.444 1.00 60.52 ? 836  GLU A CG  1 
ATOM   953  C CD  . GLU A 1 123 ? 5.769   6.059  -22.308 1.00 62.38 ? 836  GLU A CD  1 
ATOM   954  O OE1 . GLU A 1 123 ? 4.961   5.124  -22.503 1.00 63.96 ? 836  GLU A OE1 1 
ATOM   955  O OE2 . GLU A 1 123 ? 5.868   6.658  -21.215 1.00 62.11 ? 836  GLU A OE2 1 
ATOM   956  N N   . LYS A 1 124 ? 4.876   8.338  -26.915 1.00 58.25 ? 837  LYS A N   1 
ATOM   957  C CA  . LYS A 1 124 ? 4.110   8.495  -28.150 1.00 58.94 ? 837  LYS A CA  1 
ATOM   958  C C   . LYS A 1 124 ? 3.959   9.946  -28.617 1.00 58.68 ? 837  LYS A C   1 
ATOM   959  O O   . LYS A 1 124 ? 2.873   10.522 -28.552 1.00 59.48 ? 837  LYS A O   1 
ATOM   960  C CB  . LYS A 1 124 ? 2.727   7.844  -28.014 1.00 59.45 ? 837  LYS A CB  1 
ATOM   961  C CG  . LYS A 1 124 ? 2.582   6.518  -28.750 1.00 59.50 ? 837  LYS A CG  1 
ATOM   962  C CD  . LYS A 1 124 ? 1.126   6.246  -29.117 1.00 59.90 ? 837  LYS A CD  1 
ATOM   963  C CE  . LYS A 1 124 ? 0.739   4.795  -28.850 1.00 60.65 ? 837  LYS A CE  1 
ATOM   964  N NZ  . LYS A 1 124 ? 0.566   4.503  -27.397 1.00 60.63 ? 837  LYS A NZ  1 
ATOM   965  N N   . ASN A 1 125 ? 5.069   10.531 -29.060 1.00 58.24 ? 838  ASN A N   1 
ATOM   966  C CA  . ASN A 1 125 ? 5.062   11.694 -29.952 1.00 57.06 ? 838  ASN A CA  1 
ATOM   967  C C   . ASN A 1 125 ? 4.421   12.968 -29.412 1.00 57.42 ? 838  ASN A C   1 
ATOM   968  O O   . ASN A 1 125 ? 3.252   13.256 -29.682 1.00 57.04 ? 838  ASN A O   1 
ATOM   969  C CB  . ASN A 1 125 ? 4.408   11.334 -31.287 1.00 57.33 ? 838  ASN A CB  1 
ATOM   970  C CG  . ASN A 1 125 ? 5.011   10.095 -31.914 1.00 58.23 ? 838  ASN A CG  1 
ATOM   971  O OD1 . ASN A 1 125 ? 4.889   8.992  -31.381 1.00 58.01 ? 838  ASN A OD1 1 
ATOM   972  N ND2 . ASN A 1 125 ? 5.629   10.263 -33.077 1.00 58.04 ? 838  ASN A ND2 1 
ATOM   973  N N   . GLU A 1 126 ? 5.200   13.722 -28.642 1.00 57.64 ? 839  GLU A N   1 
ATOM   974  C CA  . GLU A 1 126 ? 4.954   15.145 -28.418 1.00 55.41 ? 839  GLU A CA  1 
ATOM   975  C C   . GLU A 1 126 ? 6.301   15.858 -28.418 1.00 53.29 ? 839  GLU A C   1 
ATOM   976  O O   . GLU A 1 126 ? 7.332   15.228 -28.659 1.00 54.40 ? 839  GLU A O   1 
ATOM   977  C CB  . GLU A 1 126 ? 4.227   15.376 -27.092 1.00 55.77 ? 839  GLU A CB  1 
ATOM   978  C CG  . GLU A 1 126 ? 4.940   14.834 -25.866 1.00 56.31 ? 839  GLU A CG  1 
ATOM   979  C CD  . GLU A 1 126 ? 4.253   15.238 -24.572 1.00 57.50 ? 839  GLU A CD  1 
ATOM   980  O OE1 . GLU A 1 126 ? 3.511   16.246 -24.585 1.00 57.46 ? 839  GLU A OE1 1 
ATOM   981  O OE2 . GLU A 1 126 ? 4.459   14.558 -23.541 1.00 55.64 ? 839  GLU A OE2 1 
ATOM   982  N N   . ASP A 1 127 ? 6.298   17.159 -28.137 1.00 50.86 ? 840  ASP A N   1 
ATOM   983  C CA  . ASP A 1 127 ? 7.488   17.990 -28.327 1.00 47.84 ? 840  ASP A CA  1 
ATOM   984  C C   . ASP A 1 127 ? 7.950   18.625 -27.016 1.00 44.89 ? 840  ASP A C   1 
ATOM   985  O O   . ASP A 1 127 ? 7.244   19.455 -26.448 1.00 45.07 ? 840  ASP A O   1 
ATOM   986  C CB  . ASP A 1 127 ? 7.183   19.079 -29.364 1.00 47.98 ? 840  ASP A CB  1 
ATOM   987  C CG  . ASP A 1 127 ? 8.364   19.987 -29.642 1.00 48.89 ? 840  ASP A CG  1 
ATOM   988  O OD1 . ASP A 1 127 ? 9.514   19.497 -29.673 1.00 52.24 ? 840  ASP A OD1 1 
ATOM   989  O OD2 . ASP A 1 127 ? 8.135   21.193 -29.875 1.00 48.53 ? 840  ASP A OD2 1 
ATOM   990  N N   . VAL A 1 128 ? 9.158   18.281 -26.573 1.00 41.87 ? 841  VAL A N   1 
ATOM   991  C CA  . VAL A 1 128 ? 9.713   18.866 -25.350 1.00 40.88 ? 841  VAL A CA  1 
ATOM   992  C C   . VAL A 1 128 ? 9.720   20.393 -25.381 1.00 39.85 ? 841  VAL A C   1 
ATOM   993  O O   . VAL A 1 128 ? 9.323   21.028 -24.415 1.00 39.36 ? 841  VAL A O   1 
ATOM   994  C CB  . VAL A 1 128 ? 11.163  18.371 -25.042 1.00 41.59 ? 841  VAL A CB  1 
ATOM   995  C CG1 . VAL A 1 128 ? 11.129  16.967 -24.471 1.00 41.74 ? 841  VAL A CG1 1 
ATOM   996  C CG2 . VAL A 1 128 ? 12.037  18.425 -26.290 1.00 42.77 ? 841  VAL A CG2 1 
ATOM   997  N N   . ASN A 1 129 ? 10.071  20.971 -26.527 1.00 39.01 ? 842  ASN A N   1 
ATOM   998  C CA  . ASN A 1 129 ? 10.113  22.425 -26.679 1.00 37.76 ? 842  ASN A CA  1 
ATOM   999  C C   . ASN A 1 129 ? 8.766   23.047 -26.337 1.00 35.25 ? 842  ASN A C   1 
ATOM   1000 O O   . ASN A 1 129 ? 8.701   24.053 -25.629 1.00 34.28 ? 842  ASN A O   1 
ATOM   1001 C CB  . ASN A 1 129 ? 10.492  22.814 -28.113 1.00 41.32 ? 842  ASN A CB  1 
ATOM   1002 C CG  . ASN A 1 129 ? 11.859  22.291 -28.530 1.00 43.36 ? 842  ASN A CG  1 
ATOM   1003 O OD1 . ASN A 1 129 ? 12.194  22.307 -29.711 1.00 46.17 ? 842  ASN A OD1 1 
ATOM   1004 N ND2 . ASN A 1 129 ? 12.661  21.852 -27.565 1.00 44.03 ? 842  ASN A ND2 1 
ATOM   1005 N N   . THR A 1 130 ? 7.697   22.434 -26.838 1.00 32.64 ? 843  THR A N   1 
ATOM   1006 C CA  . THR A 1 130 ? 6.341   22.894 -26.563 1.00 30.07 ? 843  THR A CA  1 
ATOM   1007 C C   . THR A 1 130 ? 6.027   22.694 -25.091 1.00 25.89 ? 843  THR A C   1 
ATOM   1008 O O   . THR A 1 130 ? 5.442   23.567 -24.457 1.00 27.32 ? 843  THR A O   1 
ATOM   1009 C CB  . THR A 1 130 ? 5.304   22.122 -27.401 1.00 32.62 ? 843  THR A CB  1 
ATOM   1010 O OG1 . THR A 1 130 ? 5.628   22.246 -28.790 1.00 35.14 ? 843  THR A OG1 1 
ATOM   1011 C CG2 . THR A 1 130 ? 3.903   22.676 -27.168 1.00 32.86 ? 843  THR A CG2 1 
ATOM   1012 N N   . ASN A 1 131 ? 6.489   21.577 -24.540 1.00 22.38 ? 844  ASN A N   1 
ATOM   1013 C CA  . ASN A 1 131 ? 6.294   21.277 -23.125 1.00 22.37 ? 844  ASN A CA  1 
ATOM   1014 C C   . ASN A 1 131 ? 7.052   22.252 -22.219 1.00 22.26 ? 844  ASN A C   1 
ATOM   1015 O O   . ASN A 1 131 ? 6.589   22.577 -21.124 1.00 22.04 ? 844  ASN A O   1 
ATOM   1016 C CB  . ASN A 1 131 ? 6.737   19.844 -22.828 1.00 20.88 ? 844  ASN A CB  1 
ATOM   1017 C CG  . ASN A 1 131 ? 5.768   18.805 -23.370 1.00 19.85 ? 844  ASN A CG  1 
ATOM   1018 O OD1 . ASN A 1 131 ? 5.901   17.623 -23.078 1.00 22.22 ? 844  ASN A OD1 1 
ATOM   1019 N ND2 . ASN A 1 131 ? 4.781   19.241 -24.136 1.00 18.12 ? 844  ASN A ND2 1 
ATOM   1020 N N   . LEU A 1 132 ? 8.170   22.778 -22.717 1.00 20.99 ? 845  LEU A N   1 
ATOM   1021 C CA  . LEU A 1 132 ? 8.981   23.697 -21.941 1.00 18.84 ? 845  LEU A CA  1 
ATOM   1022 C C   . LEU A 1 132 ? 8.372   25.083 -21.957 1.00 19.50 ? 845  LEU A C   1 
ATOM   1023 O O   . LEU A 1 132 ? 8.341   25.753 -20.931 1.00 17.58 ? 845  LEU A O   1 
ATOM   1024 C CB  . LEU A 1 132 ? 10.413  23.765 -22.472 1.00 20.19 ? 845  LEU A CB  1 
ATOM   1025 C CG  . LEU A 1 132 ? 11.312  24.742 -21.695 1.00 20.32 ? 845  LEU A CG  1 
ATOM   1026 C CD1 . LEU A 1 132 ? 11.578  24.227 -20.270 1.00 18.93 ? 845  LEU A CD1 1 
ATOM   1027 C CD2 . LEU A 1 132 ? 12.606  24.941 -22.443 1.00 21.18 ? 845  LEU A CD2 1 
ATOM   1028 N N   . THR A 1 133 ? 7.929   25.532 -23.128 1.00 19.32 ? 846  THR A N   1 
ATOM   1029 C CA  . THR A 1 133 ? 7.326   26.855 -23.236 1.00 20.44 ? 846  THR A CA  1 
ATOM   1030 C C   . THR A 1 133 ? 6.128   26.926 -22.303 1.00 20.47 ? 846  THR A C   1 
ATOM   1031 O O   . THR A 1 133 ? 6.007   27.859 -21.513 1.00 22.34 ? 846  THR A O   1 
ATOM   1032 C CB  . THR A 1 133 ? 6.857   27.145 -24.662 1.00 22.00 ? 846  THR A CB  1 
ATOM   1033 O OG1 . THR A 1 133 ? 7.991   27.148 -25.538 1.00 26.34 ? 846  THR A OG1 1 
ATOM   1034 C CG2 . THR A 1 133 ? 6.164   28.501 -24.735 1.00 22.19 ? 846  THR A CG2 1 
ATOM   1035 N N   . HIS A 1 134 ? 5.345   25.851 -22.290 1.00 20.64 ? 847  HIS A N   1 
ATOM   1036 C CA  . HIS A 1 134 ? 4.187   25.755 -21.417 1.00 19.65 ? 847  HIS A CA  1 
ATOM   1037 C C   . HIS A 1 134 ? 4.566   25.813 -19.931 1.00 18.05 ? 847  HIS A C   1 
ATOM   1038 O O   . HIS A 1 134 ? 4.014   26.629 -19.192 1.00 18.88 ? 847  HIS A O   1 
ATOM   1039 C CB  . HIS A 1 134 ? 3.410   24.476 -21.716 1.00 19.94 ? 847  HIS A CB  1 
ATOM   1040 C CG  . HIS A 1 134 ? 2.232   24.270 -20.820 1.00 22.22 ? 847  HIS A CG  1 
ATOM   1041 N ND1 . HIS A 1 134 ? 1.141   25.114 -20.817 1.00 24.16 ? 847  HIS A ND1 1 
ATOM   1042 C CD2 . HIS A 1 134 ? 1.966   23.308 -19.905 1.00 22.98 ? 847  HIS A CD2 1 
ATOM   1043 C CE1 . HIS A 1 134 ? 0.252   24.677 -19.943 1.00 24.44 ? 847  HIS A CE1 1 
ATOM   1044 N NE2 . HIS A 1 134 ? 0.727   23.579 -19.381 1.00 23.87 ? 847  HIS A NE2 1 
ATOM   1045 N N   . LEU A 1 135 ? 5.524   24.986 -19.509 1.00 14.15 ? 848  LEU A N   1 
ATOM   1046 C CA  . LEU A 1 135 ? 6.006   25.006 -18.126 1.00 14.14 ? 848  LEU A CA  1 
ATOM   1047 C C   . LEU A 1 135 ? 6.522   26.391 -17.713 1.00 15.24 ? 848  LEU A C   1 
ATOM   1048 O O   . LEU A 1 135 ? 6.242   26.862 -16.612 1.00 15.09 ? 848  LEU A O   1 
ATOM   1049 C CB  . LEU A 1 135 ? 7.112   23.968 -17.932 1.00 16.00 ? 848  LEU A CB  1 
ATOM   1050 C CG  . LEU A 1 135 ? 7.762   23.890 -16.544 1.00 16.19 ? 848  LEU A CG  1 
ATOM   1051 C CD1 . LEU A 1 135 ? 6.757   23.344 -15.544 1.00 16.42 ? 848  LEU A CD1 1 
ATOM   1052 C CD2 . LEU A 1 135 ? 9.003   23.007 -16.582 1.00 15.45 ? 848  LEU A CD2 1 
ATOM   1053 N N   . LEU A 1 136 ? 7.256   27.045 -18.606 1.00 15.80 ? 849  LEU A N   1 
ATOM   1054 C CA  . LEU A 1 136 ? 7.762   28.389 -18.342 1.00 16.42 ? 849  LEU A CA  1 
ATOM   1055 C C   . LEU A 1 136 ? 6.645   29.428 -18.212 1.00 16.98 ? 849  LEU A C   1 
ATOM   1056 O O   . LEU A 1 136 ? 6.735   30.332 -17.380 1.00 17.84 ? 849  LEU A O   1 
ATOM   1057 C CB  . LEU A 1 136 ? 8.749   28.811 -19.436 1.00 17.62 ? 849  LEU A CB  1 
ATOM   1058 C CG  . LEU A 1 136 ? 10.071  28.037 -19.536 1.00 19.16 ? 849  LEU A CG  1 
ATOM   1059 C CD1 . LEU A 1 136 ? 10.942  28.660 -20.610 1.00 19.14 ? 849  LEU A CD1 1 
ATOM   1060 C CD2 . LEU A 1 136 ? 10.800  28.034 -18.207 1.00 17.84 ? 849  LEU A CD2 1 
ATOM   1061 N N   . ASN A 1 137 ? 5.574   29.268 -18.986 1.00 16.48 ? 850  ASN A N   1 
ATOM   1062 C CA  . ASN A 1 137 ? 4.394   30.120 -18.846 1.00 18.63 ? 850  ASN A CA  1 
ATOM   1063 C C   . ASN A 1 137 ? 3.689   29.912 -17.503 1.00 17.79 ? 850  ASN A C   1 
ATOM   1064 O O   . ASN A 1 137 ? 3.305   30.879 -16.841 1.00 15.58 ? 850  ASN A O   1 
ATOM   1065 C CB  . ASN A 1 137 ? 3.408   29.866 -19.988 1.00 20.91 ? 850  ASN A CB  1 
ATOM   1066 C CG  . ASN A 1 137 ? 3.947   30.304 -21.329 1.00 27.57 ? 850  ASN A CG  1 
ATOM   1067 O OD1 . ASN A 1 137 ? 3.501   29.824 -22.372 1.00 33.45 ? 850  ASN A OD1 1 
ATOM   1068 N ND2 . ASN A 1 137 ? 4.926   31.199 -21.316 1.00 29.74 ? 850  ASN A ND2 1 
ATOM   1069 N N   . ILE A 1 138 ? 3.507   28.646 -17.125 1.00 15.22 ? 851  ILE A N   1 
ATOM   1070 C CA  . ILE A 1 138 ? 2.956   28.283 -15.824 1.00 15.21 ? 851  ILE A CA  1 
ATOM   1071 C C   . ILE A 1 138 ? 3.778   28.918 -14.708 1.00 13.71 ? 851  ILE A C   1 
ATOM   1072 O O   . ILE A 1 138 ? 3.226   29.531 -13.794 1.00 14.66 ? 851  ILE A O   1 
ATOM   1073 C CB  . ILE A 1 138 ? 2.976   26.746 -15.624 1.00 17.60 ? 851  ILE A CB  1 
ATOM   1074 C CG1 . ILE A 1 138 ? 1.978   26.073 -16.559 1.00 22.37 ? 851  ILE A CG1 1 
ATOM   1075 C CG2 . ILE A 1 138 ? 2.630   26.389 -14.181 1.00 20.98 ? 851  ILE A CG2 1 
ATOM   1076 C CD1 . ILE A 1 138 ? 1.959   24.566 -16.397 1.00 23.82 ? 851  ILE A CD1 1 
ATOM   1077 N N   . LEU A 1 139 ? 5.098   28.782 -14.804 1.00 14.36 ? 852  LEU A N   1 
ATOM   1078 C CA  . LEU A 1 139 ? 6.016   29.270 -13.778 1.00 12.93 ? 852  LEU A CA  1 
ATOM   1079 C C   . LEU A 1 139 ? 5.996   30.784 -13.605 1.00 13.58 ? 852  LEU A C   1 
ATOM   1080 O O   . LEU A 1 139 ? 5.910   31.270 -12.481 1.00 14.11 ? 852  LEU A O   1 
ATOM   1081 C CB  . LEU A 1 139 ? 7.438   28.798 -14.070 1.00 13.15 ? 852  LEU A CB  1 
ATOM   1082 C CG  . LEU A 1 139 ? 7.671   27.316 -13.750 1.00 15.46 ? 852  LEU A CG  1 
ATOM   1083 C CD1 . LEU A 1 139 ? 9.059   26.893 -14.185 1.00 14.92 ? 852  LEU A CD1 1 
ATOM   1084 C CD2 . LEU A 1 139 ? 7.483   27.068 -12.259 1.00 17.96 ? 852  LEU A CD2 1 
ATOM   1085 N N   . SER A 1 140 ? 5.966   31.516 -14.715 1.00 14.52 ? 853  SER A N   1 
ATOM   1086 C CA  . SER A 1 140 ? 5.885   32.974 -14.674 1.00 17.14 ? 853  SER A CA  1 
ATOM   1087 C C   . SER A 1 140 ? 4.637   33.426 -13.937 1.00 17.32 ? 853  SER A C   1 
ATOM   1088 O O   . SER A 1 140 ? 4.726   34.183 -12.961 1.00 17.22 ? 853  SER A O   1 
ATOM   1089 C CB  . SER A 1 140 ? 5.863   33.558 -16.089 1.00 18.05 ? 853  SER A CB  1 
ATOM   1090 O OG  . SER A 1 140 ? 6.947   33.064 -16.846 1.00 29.97 ? 853  SER A OG  1 
ATOM   1091 N N   . GLU A 1 141 ? 3.479   32.939 -14.387 1.00 17.99 ? 854  GLU A N   1 
ATOM   1092 C CA  . GLU A 1 141 ? 2.199   33.314 -13.778 1.00 19.75 ? 854  GLU A CA  1 
ATOM   1093 C C   . GLU A 1 141 ? 2.183   32.982 -12.291 1.00 16.70 ? 854  GLU A C   1 
ATOM   1094 O O   . GLU A 1 141 ? 1.774   33.803 -11.469 1.00 15.17 ? 854  GLU A O   1 
ATOM   1095 C CB  . GLU A 1 141 ? 1.032   32.596 -14.464 1.00 24.05 ? 854  GLU A CB  1 
ATOM   1096 C CG  . GLU A 1 141 ? -0.320  32.850 -13.786 1.00 32.13 ? 854  GLU A CG  1 
ATOM   1097 C CD  . GLU A 1 141 ? -1.317  31.708 -13.966 1.00 38.66 ? 854  GLU A CD  1 
ATOM   1098 O OE1 . GLU A 1 141 ? -1.635  31.376 -15.131 1.00 42.68 ? 854  GLU A OE1 1 
ATOM   1099 O OE2 . GLU A 1 141 ? -1.809  31.167 -12.942 1.00 38.40 ? 854  GLU A OE2 1 
ATOM   1100 N N   . LEU A 1 142 ? 2.670   31.788 -11.955 1.00 16.45 ? 855  LEU A N   1 
ATOM   1101 C CA  . LEU A 1 142 ? 2.670   31.308 -10.571 1.00 14.51 ? 855  LEU A CA  1 
ATOM   1102 C C   . LEU A 1 142 ? 3.542   32.161 -9.657  1.00 13.79 ? 855  LEU A C   1 
ATOM   1103 O O   . LEU A 1 142 ? 3.130   32.549 -8.565  1.00 14.54 ? 855  LEU A O   1 
ATOM   1104 C CB  . LEU A 1 142 ? 3.160   29.861 -10.518 1.00 12.80 ? 855  LEU A CB  1 
ATOM   1105 C CG  . LEU A 1 142 ? 3.360   29.314 -9.104  1.00 12.92 ? 855  LEU A CG  1 
ATOM   1106 C CD1 . LEU A 1 142 ? 2.024   29.246 -8.365  1.00 13.54 ? 855  LEU A CD1 1 
ATOM   1107 C CD2 . LEU A 1 142 ? 4.016   27.954 -9.176  1.00 15.05 ? 855  LEU A CD2 1 
ATOM   1108 N N   . VAL A 1 143 ? 4.757   32.432 -10.109 1.00 13.36 ? 856  VAL A N   1 
ATOM   1109 C CA  . VAL A 1 143 ? 5.742   33.129 -9.307  1.00 14.31 ? 856  VAL A CA  1 
ATOM   1110 C C   . VAL A 1 143 ? 5.307   34.574 -9.062  1.00 13.73 ? 856  VAL A C   1 
ATOM   1111 O O   . VAL A 1 143 ? 5.434   35.084 -7.949  1.00 13.25 ? 856  VAL A O   1 
ATOM   1112 C CB  . VAL A 1 143 ? 7.128   33.021 -10.002 1.00 18.09 ? 856  VAL A CB  1 
ATOM   1113 C CG1 . VAL A 1 143 ? 7.793   34.365 -10.159 1.00 20.15 ? 856  VAL A CG1 1 
ATOM   1114 C CG2 . VAL A 1 143 ? 7.995   32.029 -9.248  1.00 17.12 ? 856  VAL A CG2 1 
ATOM   1115 N N   . GLU A 1 144 ? 4.615   35.155 -10.034 1.00 14.10 ? 857  GLU A N   1 
ATOM   1116 C CA  . GLU A 1 144 ? 3.997   36.457 -9.832  1.00 14.93 ? 857  GLU A CA  1 
ATOM   1117 C C   . GLU A 1 144 ? 2.895   36.407 -8.768  1.00 14.78 ? 857  GLU A C   1 
ATOM   1118 O O   . GLU A 1 144 ? 2.853   37.261 -7.883  1.00 14.73 ? 857  GLU A O   1 
ATOM   1119 C CB  . GLU A 1 144 ? 3.435   36.994 -11.148 1.00 16.82 ? 857  GLU A CB  1 
ATOM   1120 C CG  . GLU A 1 144 ? 2.674   38.303 -10.983 1.00 21.29 ? 857  GLU A CG  1 
ATOM   1121 C CD  . GLU A 1 144 ? 2.241   38.905 -12.299 1.00 26.00 ? 857  GLU A CD  1 
ATOM   1122 O OE1 . GLU A 1 144 ? 1.613   38.202 -13.124 1.00 28.06 ? 857  GLU A OE1 1 
ATOM   1123 O OE2 . GLU A 1 144 ? 2.494   40.107 -12.496 1.00 32.51 ? 857  GLU A OE2 1 
ATOM   1124 N N   . LYS A 1 145 ? 2.057   35.370 -8.798  1.00 13.18 ? 858  LYS A N   1 
ATOM   1125 C CA  . LYS A 1 145 ? 1.013   35.218 -7.783  1.00 13.05 ? 858  LYS A CA  1 
ATOM   1126 C C   . LYS A 1 145 ? 1.568   35.002 -6.375  1.00 11.93 ? 858  LYS A C   1 
ATOM   1127 O O   . LYS A 1 145 ? 1.061   35.578 -5.413  1.00 11.43 ? 858  LYS A O   1 
ATOM   1128 C CB  . LYS A 1 145 ? 0.049   34.090 -8.166  1.00 14.41 ? 858  LYS A CB  1 
ATOM   1129 C CG  . LYS A 1 145 ? -1.113  34.610 -9.006  1.00 21.03 ? 858  LYS A CG  1 
ATOM   1130 C CD  . LYS A 1 145 ? -1.902  33.509 -9.692  1.00 29.38 ? 858  LYS A CD  1 
ATOM   1131 C CE  . LYS A 1 145 ? -2.972  34.096 -10.622 1.00 31.95 ? 858  LYS A CE  1 
ATOM   1132 N NZ  . LYS A 1 145 ? -3.558  33.064 -11.530 1.00 35.45 ? 858  LYS A NZ  1 
ATOM   1133 N N   . ILE A 1 146 ? 2.680   34.278 -6.277  1.00 10.90 ? 859  ILE A N   1 
ATOM   1134 C CA  . ILE A 1 146 ? 3.315   34.031 -4.992  1.00 11.12 ? 859  ILE A CA  1 
ATOM   1135 C C   . ILE A 1 146 ? 3.912   35.323 -4.453  1.00 11.54 ? 859  ILE A C   1 
ATOM   1136 O O   . ILE A 1 146 ? 3.646   35.698 -3.313  1.00 14.66 ? 859  ILE A O   1 
ATOM   1137 C CB  . ILE A 1 146 ? 4.421   32.956 -5.104  1.00 9.96  ? 859  ILE A CB  1 
ATOM   1138 C CG1 . ILE A 1 146 ? 3.779   31.581 -5.313  1.00 10.77 ? 859  ILE A CG1 1 
ATOM   1139 C CG2 . ILE A 1 146 ? 5.281   32.932 -3.845  1.00 9.50  ? 859  ILE A CG2 1 
ATOM   1140 C CD1 . ILE A 1 146 ? 4.766   30.495 -5.602  1.00 12.56 ? 859  ILE A CD1 1 
ATOM   1141 N N   . PHE A 1 147 ? 4.683   36.020 -5.280  1.00 11.07 ? 860  PHE A N   1 
ATOM   1142 C CA  . PHE A 1 147 ? 5.390   37.212 -4.818  1.00 12.69 ? 860  PHE A CA  1 
ATOM   1143 C C   . PHE A 1 147 ? 4.423   38.310 -4.391  1.00 12.91 ? 860  PHE A C   1 
ATOM   1144 O O   . PHE A 1 147 ? 4.621   38.933 -3.354  1.00 14.28 ? 860  PHE A O   1 
ATOM   1145 C CB  . PHE A 1 147 ? 6.316   37.745 -5.908  1.00 10.97 ? 860  PHE A CB  1 
ATOM   1146 C CG  . PHE A 1 147 ? 7.476   36.843 -6.227  1.00 10.33 ? 860  PHE A CG  1 
ATOM   1147 C CD1 . PHE A 1 147 ? 8.004   35.984 -5.268  1.00 11.02 ? 860  PHE A CD1 1 
ATOM   1148 C CD2 . PHE A 1 147 ? 8.086   36.900 -7.482  1.00 13.03 ? 860  PHE A CD2 1 
ATOM   1149 C CE1 . PHE A 1 147 ? 9.126   35.199 -5.550  1.00 10.43 ? 860  PHE A CE1 1 
ATOM   1150 C CE2 . PHE A 1 147 ? 9.210   36.116 -7.770  1.00 12.35 ? 860  PHE A CE2 1 
ATOM   1151 C CZ  . PHE A 1 147 ? 9.728   35.269 -6.803  1.00 11.27 ? 860  PHE A CZ  1 
ATOM   1152 N N   . MET A 1 148 ? 3.335   38.472 -5.145  1.00 12.34 ? 861  MET A N   1 
ATOM   1153 C CA  . MET A 1 148 ? 2.346   39.511 -4.875  1.00 11.93 ? 861  MET A CA  1 
ATOM   1154 C C   . MET A 1 148 ? 1.390   39.124 -3.740  1.00 12.54 ? 861  MET A C   1 
ATOM   1155 O O   . MET A 1 148 ? 0.556   39.937 -3.327  1.00 14.69 ? 861  MET A O   1 
ATOM   1156 C CB  . MET A 1 148 ? 1.539   39.816 -6.141  1.00 14.22 ? 861  MET A CB  1 
ATOM   1157 C CG  . MET A 1 148 ? 2.307   40.596 -7.211  1.00 17.06 ? 861  MET A CG  1 
ATOM   1158 S SD  . MET A 1 148 ? 2.990   42.168 -6.614  1.00 17.47 ? 861  MET A SD  1 
ATOM   1159 C CE  . MET A 1 148 ? 4.281   42.457 -7.831  1.00 18.27 ? 861  MET A CE  1 
ATOM   1160 N N   . ALA A 1 149 ? 1.500   37.890 -3.245  1.00 10.49 ? 862  ALA A N   1 
ATOM   1161 C CA  . ALA A 1 149 ? 0.746   37.464 -2.072  1.00 10.53 ? 862  ALA A CA  1 
ATOM   1162 C C   . ALA A 1 149 ? 1.462   37.813 -0.758  1.00 11.71 ? 862  ALA A C   1 
ATOM   1163 O O   . ALA A 1 149 ? 0.966   37.508 0.334   1.00 12.44 ? 862  ALA A O   1 
ATOM   1164 C CB  . ALA A 1 149 ? 0.478   35.951 -2.143  1.00 11.49 ? 862  ALA A CB  1 
ATOM   1165 N N   . SER A 1 150 ? 2.602   38.490 -0.860  1.00 11.90 ? 863  SER A N   1 
ATOM   1166 C CA  . SER A 1 150 ? 3.391   38.870 0.308   1.00 12.54 ? 863  SER A CA  1 
ATOM   1167 C C   . SER A 1 150 ? 2.567   39.491 1.468   1.00 14.87 ? 863  SER A C   1 
ATOM   1168 O O   . SER A 1 150 ? 2.654   39.056 2.622   1.00 14.11 ? 863  SER A O   1 
ATOM   1169 C CB  . SER A 1 150 ? 4.485   39.836 -0.133  1.00 14.64 ? 863  SER A CB  1 
ATOM   1170 O OG  . SER A 1 150 ? 5.170   40.360 0.987   1.00 21.46 ? 863  SER A OG  1 
ATOM   1171 N N   . GLU A 1 151 ? 1.750   40.491 1.147   1.00 14.54 ? 864  GLU A N   1 
ATOM   1172 C CA  . GLU A 1 151 ? 1.000   41.226 2.159   1.00 15.53 ? 864  GLU A CA  1 
ATOM   1173 C C   . GLU A 1 151 ? -0.097  40.383 2.802   1.00 15.70 ? 864  GLU A C   1 
ATOM   1174 O O   . GLU A 1 151 ? -0.610  40.736 3.866   1.00 14.51 ? 864  GLU A O   1 
ATOM   1175 C CB  . GLU A 1 151 ? 0.388   42.493 1.549   1.00 18.40 ? 864  GLU A CB  1 
ATOM   1176 C CG  . GLU A 1 151 ? 1.413   43.511 1.090   1.00 23.65 ? 864  GLU A CG  1 
ATOM   1177 C CD  . GLU A 1 151 ? 2.009   44.311 2.235   1.00 29.79 ? 864  GLU A CD  1 
ATOM   1178 O OE1 . GLU A 1 151 ? 2.971   43.829 2.872   1.00 30.24 ? 864  GLU A OE1 1 
ATOM   1179 O OE2 . GLU A 1 151 ? 1.543   45.449 2.469   1.00 34.87 ? 864  GLU A OE2 1 
ATOM   1180 N N   . ILE A 1 152 ? -0.461  39.279 2.151   1.00 13.90 ? 865  ILE A N   1 
ATOM   1181 C CA  . ILE A 1 152 ? -1.492  38.385 2.672   1.00 13.52 ? 865  ILE A CA  1 
ATOM   1182 C C   . ILE A 1 152 ? -0.985  37.547 3.854   1.00 14.64 ? 865  ILE A C   1 
ATOM   1183 O O   . ILE A 1 152 ? -1.753  37.190 4.751   1.00 15.42 ? 865  ILE A O   1 
ATOM   1184 C CB  . ILE A 1 152 ? -2.028  37.441 1.556   1.00 13.18 ? 865  ILE A CB  1 
ATOM   1185 C CG1 . ILE A 1 152 ? -2.465  38.257 0.338   1.00 13.77 ? 865  ILE A CG1 1 
ATOM   1186 C CG2 . ILE A 1 152 ? -3.207  36.628 2.067   1.00 12.64 ? 865  ILE A CG2 1 
ATOM   1187 C CD1 . ILE A 1 152 ? -3.485  39.327 0.652   1.00 12.83 ? 865  ILE A CD1 1 
ATOM   1188 N N   . LEU A 1 153 ? 0.312   37.258 3.867   1.00 14.59 ? 866  LEU A N   1 
ATOM   1189 C CA  . LEU A 1 153 ? 0.918   36.518 4.967   1.00 15.69 ? 866  LEU A CA  1 
ATOM   1190 C C   . LEU A 1 153 ? 0.706   37.278 6.280   1.00 17.30 ? 866  LEU A C   1 
ATOM   1191 O O   . LEU A 1 153 ? 0.862   38.499 6.329   1.00 16.24 ? 866  LEU A O   1 
ATOM   1192 C CB  . LEU A 1 153 ? 2.412   36.327 4.694   1.00 16.62 ? 866  LEU A CB  1 
ATOM   1193 C CG  . LEU A 1 153 ? 3.117   35.114 5.318   1.00 20.87 ? 866  LEU A CG  1 
ATOM   1194 C CD1 . LEU A 1 153 ? 2.736   33.854 4.583   1.00 19.90 ? 866  LEU A CD1 1 
ATOM   1195 C CD2 . LEU A 1 153 ? 4.630   35.315 5.258   1.00 22.52 ? 866  LEU A CD2 1 
ATOM   1196 N N   . PRO A 1 154 ? 0.196   36.587 7.317   1.00 18.02 ? 867  PRO A N   1 
ATOM   1197 C CA  . PRO A 1 154 ? -0.180  37.260 8.564   1.00 18.03 ? 867  PRO A CA  1 
ATOM   1198 C C   . PRO A 1 154 ? 1.012   37.959 9.198   1.00 17.88 ? 867  PRO A C   1 
ATOM   1199 O O   . PRO A 1 154 ? 2.143   37.475 9.099   1.00 15.62 ? 867  PRO A O   1 
ATOM   1200 C CB  . PRO A 1 154 ? -0.685  36.119 9.441   1.00 19.40 ? 867  PRO A CB  1 
ATOM   1201 C CG  . PRO A 1 154 ? -1.102  35.074 8.481   1.00 19.99 ? 867  PRO A CG  1 
ATOM   1202 C CD  . PRO A 1 154 ? -0.090  35.146 7.385   1.00 19.46 ? 867  PRO A CD  1 
ATOM   1203 N N   . PRO A 1 155 ? 0.768   39.099 9.874   1.00 16.36 ? 868  PRO A N   1 
ATOM   1204 C CA  . PRO A 1 155 ? 1.821   39.967 10.407  1.00 16.64 ? 868  PRO A CA  1 
ATOM   1205 C C   . PRO A 1 155 ? 2.683   39.249 11.438  1.00 14.23 ? 868  PRO A C   1 
ATOM   1206 O O   . PRO A 1 155 ? 3.885   39.487 11.533  1.00 12.90 ? 868  PRO A O   1 
ATOM   1207 C CB  . PRO A 1 155 ? 1.051   41.124 11.053  1.00 16.06 ? 868  PRO A CB  1 
ATOM   1208 C CG  . PRO A 1 155 ? -0.269  41.117 10.407  1.00 19.54 ? 868  PRO A CG  1 
ATOM   1209 C CD  . PRO A 1 155 ? -0.567  39.670 10.111  1.00 20.90 ? 868  PRO A CD  1 
ATOM   1210 N N   . THR A 1 156 ? 2.048   38.419 12.257  1.00 16.76 ? 869  THR A N   1 
ATOM   1211 C CA  . THR A 1 156 ? 2.768   37.724 13.319  1.00 14.63 ? 869  THR A CA  1 
ATOM   1212 C C   . THR A 1 156 ? 3.779   36.753 12.724  1.00 13.45 ? 869  THR A C   1 
ATOM   1213 O O   . THR A 1 156 ? 4.940   36.781 13.105  1.00 14.31 ? 869  THR A O   1 
ATOM   1214 C CB  . THR A 1 156 ? 1.809   36.989 14.284  1.00 15.95 ? 869  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 156 ? 0.851   37.922 14.807  1.00 17.42 ? 869  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 156 ? 2.588   36.392 15.452  1.00 15.39 ? 869  THR A CG2 1 
ATOM   1217 N N   . LEU A 1 157 ? 3.386   36.037 11.672  1.00 12.77 ? 870  LEU A N   1 
ATOM   1218 C CA  . LEU A 1 157 ? 4.311   35.142 10.980  1.00 13.31 ? 870  LEU A CA  1 
ATOM   1219 C C   . LEU A 1 157 ? 5.455   35.931 10.331  1.00 13.15 ? 870  LEU A C   1 
ATOM   1220 O O   . LEU A 1 157 ? 6.612   35.544 10.413  1.00 12.89 ? 870  LEU A O   1 
ATOM   1221 C CB  . LEU A 1 157 ? 3.574   34.319 9.914   1.00 13.55 ? 870  LEU A CB  1 
ATOM   1222 C CG  . LEU A 1 157 ? 4.422   33.323 9.109   1.00 15.39 ? 870  LEU A CG  1 
ATOM   1223 C CD1 . LEU A 1 157 ? 5.173   32.399 10.051  1.00 17.32 ? 870  LEU A CD1 1 
ATOM   1224 C CD2 . LEU A 1 157 ? 3.521   32.511 8.176   1.00 20.23 ? 870  LEU A CD2 1 
ATOM   1225 N N   . ARG A 1 158 ? 5.140   37.076 9.741   1.00 11.89 ? 871  ARG A N   1 
ATOM   1226 C CA  . ARG A 1 158 ? 6.177   37.917 9.167   1.00 13.34 ? 871  ARG A CA  1 
ATOM   1227 C C   . ARG A 1 158 ? 7.135   38.452 10.243  1.00 13.05 ? 871  ARG A C   1 
ATOM   1228 O O   . ARG A 1 158 ? 8.352   38.510 10.025  1.00 13.80 ? 871  ARG A O   1 
ATOM   1229 C CB  . ARG A 1 158 ? 5.534   39.061 8.381   1.00 13.09 ? 871  ARG A CB  1 
ATOM   1230 C CG  . ARG A 1 158 ? 4.663   38.562 7.231   1.00 14.06 ? 871  ARG A CG  1 
ATOM   1231 C CD  . ARG A 1 158 ? 4.150   39.708 6.387   1.00 17.12 ? 871  ARG A CD  1 
ATOM   1232 N NE  . ARG A 1 158 ? 5.217   40.325 5.605   1.00 20.67 ? 871  ARG A NE  1 
ATOM   1233 C CZ  . ARG A 1 158 ? 5.076   41.440 4.898   1.00 23.96 ? 871  ARG A CZ  1 
ATOM   1234 N NH1 . ARG A 1 158 ? 3.953   42.146 4.975   1.00 27.03 ? 871  ARG A NH1 1 
ATOM   1235 N NH2 . ARG A 1 158 ? 6.082   41.886 4.164   1.00 25.42 ? 871  ARG A NH2 1 
ATOM   1236 N N   . TYR A 1 159 ? 6.597   38.733 11.431  1.00 11.00 ? 872  TYR A N   1 
ATOM   1237 C CA  . TYR A 1 159 ? 7.402   39.147 12.569  1.00 10.52 ? 872  TYR A CA  1 
ATOM   1238 C C   . TYR A 1 159 ? 8.341   38.021 13.021  1.00 10.95 ? 872  TYR A C   1 
ATOM   1239 O O   . TYR A 1 159 ? 9.517   38.255 13.313  1.00 12.11 ? 872  TYR A O   1 
ATOM   1240 C CB  . TYR A 1 159 ? 6.488   39.558 13.728  1.00 13.93 ? 872  TYR A CB  1 
ATOM   1241 C CG  . TYR A 1 159 ? 7.216   39.783 15.027  1.00 12.62 ? 872  TYR A CG  1 
ATOM   1242 C CD1 . TYR A 1 159 ? 7.986   40.926 15.228  1.00 13.33 ? 872  TYR A CD1 1 
ATOM   1243 C CD2 . TYR A 1 159 ? 7.184   38.825 16.034  1.00 13.91 ? 872  TYR A CD2 1 
ATOM   1244 C CE1 . TYR A 1 159 ? 8.701   41.105 16.399  1.00 14.94 ? 872  TYR A CE1 1 
ATOM   1245 C CE2 . TYR A 1 159 ? 7.903   38.990 17.203  1.00 13.70 ? 872  TYR A CE2 1 
ATOM   1246 C CZ  . TYR A 1 159 ? 8.658   40.131 17.385  1.00 15.34 ? 872  TYR A CZ  1 
ATOM   1247 O OH  . TYR A 1 159 ? 9.375   40.289 18.559  1.00 18.94 ? 872  TYR A OH  1 
ATOM   1248 N N   . ILE A 1 160 ? 7.822   36.799 13.049  1.00 11.38 ? 873  ILE A N   1 
ATOM   1249 C CA  . ILE A 1 160 ? 8.628   35.620 13.363  1.00 10.69 ? 873  ILE A CA  1 
ATOM   1250 C C   . ILE A 1 160 ? 9.742   35.396 12.337  1.00 8.67  ? 873  ILE A C   1 
ATOM   1251 O O   . ILE A 1 160 ? 10.880  35.133 12.707  1.00 9.66  ? 873  ILE A O   1 
ATOM   1252 C CB  . ILE A 1 160 ? 7.716   34.357 13.497  1.00 10.67 ? 873  ILE A CB  1 
ATOM   1253 C CG1 . ILE A 1 160 ? 6.916   34.463 14.803  1.00 11.47 ? 873  ILE A CG1 1 
ATOM   1254 C CG2 . ILE A 1 160 ? 8.545   33.062 13.481  1.00 9.62  ? 873  ILE A CG2 1 
ATOM   1255 C CD1 . ILE A 1 160 ? 5.791   33.466 14.917  1.00 11.42 ? 873  ILE A CD1 1 
ATOM   1256 N N   . TYR A 1 161 ? 9.442   35.656 11.069  1.00 11.73 ? 874  TYR A N   1 
ATOM   1257 C CA  . TYR A 1 161 ? 10.448  35.655 10.004  1.00 12.72 ? 874  TYR A CA  1 
ATOM   1258 C C   . TYR A 1 161 ? 11.522  36.740 10.196  1.00 11.77 ? 874  TYR A C   1 
ATOM   1259 O O   . TYR A 1 161 ? 12.714  36.478 10.044  1.00 11.31 ? 874  TYR A O   1 
ATOM   1260 C CB  . TYR A 1 161 ? 9.773   35.857 8.649   1.00 11.53 ? 874  TYR A CB  1 
ATOM   1261 C CG  . TYR A 1 161 ? 8.954   34.685 8.168   1.00 14.56 ? 874  TYR A CG  1 
ATOM   1262 C CD1 . TYR A 1 161 ? 9.070   33.420 8.763   1.00 15.02 ? 874  TYR A CD1 1 
ATOM   1263 C CD2 . TYR A 1 161 ? 8.120   34.817 7.059   1.00 17.21 ? 874  TYR A CD2 1 
ATOM   1264 C CE1 . TYR A 1 161 ? 8.380   32.316 8.253   1.00 16.11 ? 874  TYR A CE1 1 
ATOM   1265 C CE2 . TYR A 1 161 ? 7.436   33.722 6.536   1.00 17.16 ? 874  TYR A CE2 1 
ATOM   1266 C CZ  . TYR A 1 161 ? 7.571   32.473 7.135   1.00 19.00 ? 874  TYR A CZ  1 
ATOM   1267 O OH  . TYR A 1 161 ? 6.893   31.395 6.602   1.00 18.47 ? 874  TYR A OH  1 
ATOM   1268 N N   . GLY A 1 162 ? 11.095  37.947 10.556  1.00 12.07 ? 875  GLY A N   1 
ATOM   1269 C CA  . GLY A 1 162 ? 12.034  39.016 10.851  1.00 11.48 ? 875  GLY A CA  1 
ATOM   1270 C C   . GLY A 1 162 ? 12.968  38.683 12.001  1.00 10.84 ? 875  GLY A C   1 
ATOM   1271 O O   . GLY A 1 162 ? 14.135  39.093 12.008  1.00 12.31 ? 875  GLY A O   1 
ATOM   1272 N N   . CYS A 1 163 ? 12.473  37.899 12.953  1.00 9.70  ? 876  CYS A N   1 
ATOM   1273 C CA  . CYS A 1 163 ? 13.285  37.456 14.073  1.00 10.53 ? 876  CYS A CA  1 
ATOM   1274 C C   . CYS A 1 163 ? 14.311  36.408 13.645  1.00 10.92 ? 876  CYS A C   1 
ATOM   1275 O O   . CYS A 1 163 ? 15.447  36.430 14.117  1.00 12.71 ? 876  CYS A O   1 
ATOM   1276 C CB  . CYS A 1 163 ? 12.399  36.914 15.200  1.00 12.58 ? 876  CYS A CB  1 
ATOM   1277 S SG  . CYS A 1 163 ? 11.545  38.225 16.148  1.00 17.33 ? 876  CYS A SG  1 
ATOM   1278 N N   . LEU A 1 164 ? 13.932  35.527 12.722  1.00 9.54  ? 877  LEU A N   1 
ATOM   1279 C CA  . LEU A 1 164 ? 14.888  34.594 12.116  1.00 11.17 ? 877  LEU A CA  1 
ATOM   1280 C C   . LEU A 1 164 ? 16.017  35.365 11.442  1.00 10.52 ? 877  LEU A C   1 
ATOM   1281 O O   . LEU A 1 164 ? 17.179  35.000 11.546  1.00 11.18 ? 877  LEU A O   1 
ATOM   1282 C CB  . LEU A 1 164 ? 14.206  33.722 11.056  1.00 12.28 ? 877  LEU A CB  1 
ATOM   1283 C CG  . LEU A 1 164 ? 13.245  32.605 11.474  1.00 13.42 ? 877  LEU A CG  1 
ATOM   1284 C CD1 . LEU A 1 164 ? 12.525  32.086 10.240  1.00 12.94 ? 877  LEU A CD1 1 
ATOM   1285 C CD2 . LEU A 1 164 ? 13.997  31.479 12.157  1.00 14.10 ? 877  LEU A CD2 1 
ATOM   1286 N N   . GLN A 1 165 ? 15.652  36.429 10.732  1.00 11.57 ? 878  GLN A N   1 
ATOM   1287 C CA  . GLN A 1 165 ? 16.613  37.250 10.011  1.00 10.60 ? 878  GLN A CA  1 
ATOM   1288 C C   . GLN A 1 165 ? 17.603  37.940 10.957  1.00 12.44 ? 878  GLN A C   1 
ATOM   1289 O O   . GLN A 1 165 ? 18.813  37.835 10.766  1.00 12.85 ? 878  GLN A O   1 
ATOM   1290 C CB  . GLN A 1 165 ? 15.878  38.294 9.168   1.00 10.58 ? 878  GLN A CB  1 
ATOM   1291 C CG  . GLN A 1 165 ? 15.056  37.710 8.026   1.00 10.50 ? 878  GLN A CG  1 
ATOM   1292 C CD  . GLN A 1 165 ? 14.334  38.772 7.217   1.00 13.65 ? 878  GLN A CD  1 
ATOM   1293 O OE1 . GLN A 1 165 ? 13.875  39.785 7.759   1.00 16.22 ? 878  GLN A OE1 1 
ATOM   1294 N NE2 . GLN A 1 165 ? 14.213  38.543 5.918   1.00 13.95 ? 878  GLN A NE2 1 
ATOM   1295 N N   . LYS A 1 166 ? 17.102  38.568 12.016  1.00 11.36 ? 879  LYS A N   1 
ATOM   1296 C CA  . LYS A 1 166 ? 17.983  39.198 12.996  1.00 14.61 ? 879  LYS A CA  1 
ATOM   1297 C C   . LYS A 1 166 ? 18.879  38.161 13.672  1.00 14.57 ? 879  LYS A C   1 
ATOM   1298 O O   . LYS A 1 166 ? 20.064  38.406 13.884  1.00 16.00 ? 879  LYS A O   1 
ATOM   1299 C CB  . LYS A 1 166 ? 17.177  39.949 14.064  1.00 17.30 ? 879  LYS A CB  1 
ATOM   1300 C CG  . LYS A 1 166 ? 16.487  41.219 13.567  1.00 21.89 ? 879  LYS A CG  1 
ATOM   1301 C CD  . LYS A 1 166 ? 17.494  42.300 13.180  1.00 29.40 ? 879  LYS A CD  1 
ATOM   1302 C CE  . LYS A 1 166 ? 18.038  43.043 14.397  1.00 33.34 ? 879  LYS A CE  1 
ATOM   1303 N NZ  . LYS A 1 166 ? 17.194  44.216 14.767  1.00 34.52 ? 879  LYS A NZ  1 
ATOM   1304 N N   . SER A 1 167 ? 18.354  36.959 13.871  1.00 13.64 ? 880  SER A N   1 
ATOM   1305 C CA  . SER A 1 167 ? 19.130  35.891 14.490  1.00 14.17 ? 880  SER A CA  1 
ATOM   1306 C C   . SER A 1 167 ? 20.289  35.378 13.632  1.00 13.10 ? 880  SER A C   1 
ATOM   1307 O O   . SER A 1 167 ? 21.380  35.161 14.147  1.00 14.01 ? 880  SER A O   1 
ATOM   1308 C CB  . SER A 1 167 ? 18.217  34.731 14.876  1.00 15.98 ? 880  SER A CB  1 
ATOM   1309 O OG  . SER A 1 167 ? 17.441  35.065 16.009  1.00 22.37 ? 880  SER A OG  1 
ATOM   1310 N N   . VAL A 1 168 ? 20.073  35.183 12.333  1.00 12.40 ? 881  VAL A N   1 
ATOM   1311 C CA  . VAL A 1 168 ? 21.159  34.671 11.492  1.00 12.59 ? 881  VAL A CA  1 
ATOM   1312 C C   . VAL A 1 168 ? 22.197  35.740 11.176  1.00 14.54 ? 881  VAL A C   1 
ATOM   1313 O O   . VAL A 1 168 ? 23.373  35.428 10.992  1.00 15.23 ? 881  VAL A O   1 
ATOM   1314 C CB  . VAL A 1 168 ? 20.656  34.033 10.162  1.00 12.93 ? 881  VAL A CB  1 
ATOM   1315 C CG1 . VAL A 1 168 ? 19.703  32.888 10.476  1.00 12.40 ? 881  VAL A CG1 1 
ATOM   1316 C CG2 . VAL A 1 168 ? 19.996  35.080 9.255   1.00 10.14 ? 881  VAL A CG2 1 
ATOM   1317 N N   . GLN A 1 169 ? 21.777  37.004 11.179  1.00 16.71 ? 882  GLN A N   1 
ATOM   1318 C CA  . GLN A 1 169 ? 22.708  38.119 10.986  1.00 17.00 ? 882  GLN A CA  1 
ATOM   1319 C C   . GLN A 1 169 ? 23.684  38.200 12.141  1.00 17.73 ? 882  GLN A C   1 
ATOM   1320 O O   . GLN A 1 169 ? 24.854  38.513 11.949  1.00 19.76 ? 882  GLN A O   1 
ATOM   1321 C CB  . GLN A 1 169 ? 21.954  39.438 10.883  1.00 19.28 ? 882  GLN A CB  1 
ATOM   1322 C CG  . GLN A 1 169 ? 21.154  39.582 9.599   1.00 20.87 ? 882  GLN A CG  1 
ATOM   1323 C CD  . GLN A 1 169 ? 20.388  40.898 9.518   1.00 24.20 ? 882  GLN A CD  1 
ATOM   1324 O OE1 . GLN A 1 169 ? 19.783  41.194 8.496   1.00 26.05 ? 882  GLN A OE1 1 
ATOM   1325 N NE2 . GLN A 1 169 ? 20.410  41.687 10.594  1.00 24.05 ? 882  GLN A NE2 1 
ATOM   1326 N N   . HIS A 1 170 ? 23.188  37.917 13.342  1.00 18.30 ? 883  HIS A N   1 
ATOM   1327 C CA  . HIS A 1 170 ? 23.994  37.949 14.557  1.00 22.22 ? 883  HIS A CA  1 
ATOM   1328 C C   . HIS A 1 170 ? 24.976  36.776 14.562  1.00 22.37 ? 883  HIS A C   1 
ATOM   1329 O O   . HIS A 1 170 ? 26.159  36.941 14.857  1.00 23.77 ? 883  HIS A O   1 
ATOM   1330 C CB  . HIS A 1 170 ? 23.072  37.886 15.784  1.00 23.87 ? 883  HIS A CB  1 
ATOM   1331 C CG  . HIS A 1 170 ? 23.795  37.965 17.093  1.00 31.15 ? 883  HIS A CG  1 
ATOM   1332 N ND1 . HIS A 1 170 ? 24.301  39.144 17.595  1.00 35.43 ? 883  HIS A ND1 1 
ATOM   1333 C CD2 . HIS A 1 170 ? 24.145  36.999 17.977  1.00 34.70 ? 883  HIS A CD2 1 
ATOM   1334 C CE1 . HIS A 1 170 ? 24.946  38.901 18.724  1.00 36.83 ? 883  HIS A CE1 1 
ATOM   1335 N NE2 . HIS A 1 170 ? 24.866  37.608 18.977  1.00 36.19 ? 883  HIS A NE2 1 
ATOM   1336 N N   . LYS A 1 171 ? 24.495  35.615 14.135  1.00 21.54 ? 884  LYS A N   1 
ATOM   1337 C CA  . LYS A 1 171 ? 25.286  34.390 14.159  1.00 21.36 ? 884  LYS A CA  1 
ATOM   1338 C C   . LYS A 1 171 ? 26.361  34.367 13.069  1.00 20.03 ? 884  LYS A C   1 
ATOM   1339 O O   . LYS A 1 171 ? 27.499  33.992 13.329  1.00 21.64 ? 884  LYS A O   1 
ATOM   1340 C CB  . LYS A 1 171 ? 24.355  33.179 14.030  1.00 20.83 ? 884  LYS A CB  1 
ATOM   1341 C CG  . LYS A 1 171 ? 25.058  31.858 13.789  1.00 21.05 ? 884  LYS A CG  1 
ATOM   1342 C CD  . LYS A 1 171 ? 25.447  31.166 15.068  1.00 20.88 ? 884  LYS A CD  1 
ATOM   1343 C CE  . LYS A 1 171 ? 25.892  29.751 14.760  1.00 22.90 ? 884  LYS A CE  1 
ATOM   1344 N NZ  . LYS A 1 171 ? 26.545  29.101 15.923  1.00 27.39 ? 884  LYS A NZ  1 
ATOM   1345 N N   . TRP A 1 172 ? 26.020  34.822 11.867  1.00 18.58 ? 885  TRP A N   1 
ATOM   1346 C CA  . TRP A 1 172 ? 26.976  34.839 10.761  1.00 17.13 ? 885  TRP A CA  1 
ATOM   1347 C C   . TRP A 1 172 ? 27.065  36.235 10.130  1.00 17.42 ? 885  TRP A C   1 
ATOM   1348 O O   . TRP A 1 172 ? 26.509  36.481 9.054   1.00 15.51 ? 885  TRP A O   1 
ATOM   1349 C CB  . TRP A 1 172 ? 26.585  33.798 9.700   1.00 17.32 ? 885  TRP A CB  1 
ATOM   1350 C CG  . TRP A 1 172 ? 26.557  32.375 10.214  1.00 19.48 ? 885  TRP A CG  1 
ATOM   1351 C CD1 . TRP A 1 172 ? 27.637  31.574 10.487  1.00 21.04 ? 885  TRP A CD1 1 
ATOM   1352 C CD2 . TRP A 1 172 ? 25.394  31.574 10.458  1.00 18.92 ? 885  TRP A CD2 1 
ATOM   1353 N NE1 . TRP A 1 172 ? 27.214  30.321 10.867  1.00 20.24 ? 885  TRP A NE1 1 
ATOM   1354 C CE2 . TRP A 1 172 ? 25.845  30.293 10.857  1.00 21.26 ? 885  TRP A CE2 1 
ATOM   1355 C CE3 . TRP A 1 172 ? 24.017  31.815 10.381  1.00 18.90 ? 885  TRP A CE3 1 
ATOM   1356 C CZ2 . TRP A 1 172 ? 24.958  29.247 11.174  1.00 19.72 ? 885  TRP A CZ2 1 
ATOM   1357 C CZ3 . TRP A 1 172 ? 23.136  30.776 10.702  1.00 21.49 ? 885  TRP A CZ3 1 
ATOM   1358 C CH2 . TRP A 1 172 ? 23.617  29.506 11.091  1.00 19.17 ? 885  TRP A CH2 1 
ATOM   1359 N N   . PRO A 1 173 ? 27.785  37.163 10.788  1.00 17.66 ? 886  PRO A N   1 
ATOM   1360 C CA  . PRO A 1 173 ? 27.769  38.582 10.409  1.00 19.80 ? 886  PRO A CA  1 
ATOM   1361 C C   . PRO A 1 173 ? 28.410  38.930 9.058   1.00 20.98 ? 886  PRO A C   1 
ATOM   1362 O O   . PRO A 1 173 ? 28.160  40.003 8.528   1.00 20.05 ? 886  PRO A O   1 
ATOM   1363 C CB  . PRO A 1 173 ? 28.492  39.276 11.567  1.00 19.64 ? 886  PRO A CB  1 
ATOM   1364 C CG  . PRO A 1 173 ? 28.348  38.329 12.718  1.00 23.07 ? 886  PRO A CG  1 
ATOM   1365 C CD  . PRO A 1 173 ? 28.451  36.966 12.086  1.00 20.06 ? 886  PRO A CD  1 
ATOM   1366 N N   . THR A 1 174 ? 29.266  38.064 8.521   1.00 21.27 ? 887  THR A N   1 
ATOM   1367 C CA  . THR A 1 174 ? 29.863  38.347 7.215   1.00 22.87 ? 887  THR A CA  1 
ATOM   1368 C C   . THR A 1 174 ? 29.177  37.569 6.103   1.00 23.08 ? 887  THR A C   1 
ATOM   1369 O O   . THR A 1 174 ? 29.556  37.671 4.931   1.00 25.58 ? 887  THR A O   1 
ATOM   1370 C CB  . THR A 1 174 ? 31.383  38.030 7.175   1.00 23.35 ? 887  THR A CB  1 
ATOM   1371 O OG1 . THR A 1 174 ? 31.609  36.682 7.604   1.00 24.54 ? 887  THR A OG1 1 
ATOM   1372 C CG2 . THR A 1 174 ? 32.151  38.990 8.060   1.00 27.65 ? 887  THR A CG2 1 
ATOM   1373 N N   . ASN A 1 175 ? 28.204  36.748 6.480   1.00 21.17 ? 888  ASN A N   1 
ATOM   1374 C CA  . ASN A 1 175 ? 27.381  36.037 5.509   1.00 19.86 ? 888  ASN A CA  1 
ATOM   1375 C C   . ASN A 1 175 ? 26.138  36.872 5.203   1.00 19.05 ? 888  ASN A C   1 
ATOM   1376 O O   . ASN A 1 175 ? 25.219  36.945 6.019   1.00 20.22 ? 888  ASN A O   1 
ATOM   1377 C CB  . ASN A 1 175 ? 26.979  34.669 6.071   1.00 19.59 ? 888  ASN A CB  1 
ATOM   1378 C CG  . ASN A 1 175 ? 26.280  33.801 5.045   1.00 23.07 ? 888  ASN A CG  1 
ATOM   1379 O OD1 . ASN A 1 175 ? 25.508  34.297 4.224   1.00 24.02 ? 888  ASN A OD1 1 
ATOM   1380 N ND2 . ASN A 1 175 ? 26.514  32.492 5.111   1.00 20.95 ? 888  ASN A ND2 1 
ATOM   1381 N N   . THR A 1 176 ? 26.109  37.506 4.037   1.00 15.72 ? 889  THR A N   1 
ATOM   1382 C CA  . THR A 1 176 ? 25.000  38.396 3.693   1.00 19.41 ? 889  THR A CA  1 
ATOM   1383 C C   . THR A 1 176 ? 23.843  37.676 2.997   1.00 20.93 ? 889  THR A C   1 
ATOM   1384 O O   . THR A 1 176 ? 22.870  38.302 2.563   1.00 19.28 ? 889  THR A O   1 
ATOM   1385 C CB  . THR A 1 176 ? 25.476  39.554 2.800   1.00 18.96 ? 889  THR A CB  1 
ATOM   1386 O OG1 . THR A 1 176 ? 26.231  39.033 1.696   1.00 22.09 ? 889  THR A OG1 1 
ATOM   1387 C CG2 . THR A 1 176 ? 26.348  40.497 3.603   1.00 20.51 ? 889  THR A CG2 1 
ATOM   1388 N N   . THR A 1 177 ? 23.896  36.351 3.020   1.00 20.04 ? 890  THR A N   1 
ATOM   1389 C CA  . THR A 1 177 ? 23.004  35.539 2.215   1.00 22.70 ? 890  THR A CA  1 
ATOM   1390 C C   . THR A 1 177 ? 21.962  34.859 3.110   1.00 20.60 ? 890  THR A C   1 
ATOM   1391 O O   . THR A 1 177 ? 20.839  34.582 2.684   1.00 19.95 ? 890  THR A O   1 
ATOM   1392 C CB  . THR A 1 177 ? 23.838  34.485 1.402   1.00 25.19 ? 890  THR A CB  1 
ATOM   1393 O OG1 . THR A 1 177 ? 23.228  34.253 0.129   1.00 35.75 ? 890  THR A OG1 1 
ATOM   1394 C CG2 . THR A 1 177 ? 23.951  33.176 2.145   1.00 20.45 ? 890  THR A CG2 1 
ATOM   1395 N N   . MET A 1 178 ? 22.311  34.666 4.375   1.00 17.68 ? 891  MET A N   1 
ATOM   1396 C CA  . MET A 1 178 ? 21.441  33.916 5.272   1.00 17.21 ? 891  MET A CA  1 
ATOM   1397 C C   . MET A 1 178 ? 20.084  34.553 5.552   1.00 15.92 ? 891  MET A C   1 
ATOM   1398 O O   . MET A 1 178 ? 19.129  33.831 5.823   1.00 15.15 ? 891  MET A O   1 
ATOM   1399 C CB  . MET A 1 178 ? 22.151  33.613 6.600   1.00 15.40 ? 891  MET A CB  1 
ATOM   1400 C CG  . MET A 1 178 ? 23.186  32.511 6.496   1.00 19.84 ? 891  MET A CG  1 
ATOM   1401 S SD  . MET A 1 178 ? 22.566  31.048 5.631   1.00 23.82 ? 891  MET A SD  1 
ATOM   1402 C CE  . MET A 1 178 ? 21.457  30.382 6.873   1.00 22.23 ? 891  MET A CE  1 
ATOM   1403 N N   . ARG A 1 179 ? 19.998  35.886 5.538   1.00 15.31 ? 892  ARG A N   1 
ATOM   1404 C CA  . ARG A 1 179 ? 18.740  36.551 5.902   1.00 16.10 ? 892  ARG A CA  1 
ATOM   1405 C C   . ARG A 1 179 ? 17.607  36.258 4.915   1.00 14.56 ? 892  ARG A C   1 
ATOM   1406 O O   . ARG A 1 179 ? 16.437  36.331 5.270   1.00 14.21 ? 892  ARG A O   1 
ATOM   1407 C CB  . ARG A 1 179 ? 18.930  38.069 6.065   1.00 18.05 ? 892  ARG A CB  1 
ATOM   1408 C CG  . ARG A 1 179 ? 19.243  38.848 4.791   1.00 23.19 ? 892  ARG A CG  1 
ATOM   1409 C CD  . ARG A 1 179 ? 18.575  40.236 4.790   1.00 27.90 ? 892  ARG A CD  1 
ATOM   1410 N NE  . ARG A 1 179 ? 18.372  40.740 6.140   1.00 28.91 ? 892  ARG A NE  1 
ATOM   1411 C CZ  . ARG A 1 179 ? 17.257  41.319 6.579   1.00 28.92 ? 892  ARG A CZ  1 
ATOM   1412 N NH1 . ARG A 1 179 ? 16.343  41.757 5.726   1.00 28.73 ? 892  ARG A NH1 1 
ATOM   1413 N NH2 . ARG A 1 179 ? 17.112  41.566 7.878   1.00 28.72 ? 892  ARG A NH2 1 
ATOM   1414 N N   . THR A 1 180 ? 17.953  35.898 3.685   1.00 13.73 ? 893  THR A N   1 
ATOM   1415 C CA  . THR A 1 180 ? 16.930  35.473 2.743   1.00 14.34 ? 893  THR A CA  1 
ATOM   1416 C C   . THR A 1 180 ? 16.787  33.957 2.745   1.00 14.11 ? 893  THR A C   1 
ATOM   1417 O O   . THR A 1 180 ? 15.667  33.443 2.742   1.00 14.79 ? 893  THR A O   1 
ATOM   1418 C CB  . THR A 1 180 ? 17.203  35.981 1.299   1.00 16.79 ? 893  THR A CB  1 
ATOM   1419 O OG1 . THR A 1 180 ? 18.572  35.744 0.941   1.00 16.21 ? 893  THR A OG1 1 
ATOM   1420 C CG2 . THR A 1 180 ? 16.900  37.479 1.198   1.00 15.56 ? 893  THR A CG2 1 
ATOM   1421 N N   . ARG A 1 181 ? 17.898  33.253 2.941   1.00 14.75 ? 894  ARG A N   1 
ATOM   1422 C CA  . ARG A 1 181 ? 17.872  31.789 2.925   1.00 15.44 ? 894  ARG A CA  1 
ATOM   1423 C C   . ARG A 1 181 ? 17.050  31.185 4.064   1.00 14.66 ? 894  ARG A C   1 
ATOM   1424 O O   . ARG A 1 181 ? 16.306  30.215 3.863   1.00 13.12 ? 894  ARG A O   1 
ATOM   1425 C CB  . ARG A 1 181 ? 19.296  31.216 2.954   1.00 19.68 ? 894  ARG A CB  1 
ATOM   1426 C CG  . ARG A 1 181 ? 20.171  31.697 1.796   1.00 28.35 ? 894  ARG A CG  1 
ATOM   1427 C CD  . ARG A 1 181 ? 21.075  30.597 1.273   1.00 35.38 ? 894  ARG A CD  1 
ATOM   1428 N NE  . ARG A 1 181 ? 22.184  30.295 2.175   1.00 41.43 ? 894  ARG A NE  1 
ATOM   1429 C CZ  . ARG A 1 181 ? 23.417  29.992 1.773   1.00 45.90 ? 894  ARG A CZ  1 
ATOM   1430 N NH1 . ARG A 1 181 ? 23.725  29.991 0.478   1.00 46.92 ? 894  ARG A NH1 1 
ATOM   1431 N NH2 . ARG A 1 181 ? 24.362  29.742 2.671   1.00 46.23 ? 894  ARG A NH2 1 
ATOM   1432 N N   . VAL A 1 182 ? 17.143  31.793 5.243   1.00 13.04 ? 895  VAL A N   1 
ATOM   1433 C CA  . VAL A 1 182 ? 16.456  31.263 6.403   1.00 13.40 ? 895  VAL A CA  1 
ATOM   1434 C C   . VAL A 1 182 ? 14.944  31.441 6.268   1.00 11.36 ? 895  VAL A C   1 
ATOM   1435 O O   . VAL A 1 182 ? 14.169  30.619 6.758   1.00 13.93 ? 895  VAL A O   1 
ATOM   1436 C CB  . VAL A 1 182 ? 16.988  31.901 7.746   1.00 13.67 ? 895  VAL A CB  1 
ATOM   1437 C CG1 . VAL A 1 182 ? 16.551  33.362 7.889   1.00 12.94 ? 895  VAL A CG1 1 
ATOM   1438 C CG2 . VAL A 1 182 ? 16.521  31.067 8.940   1.00 11.76 ? 895  VAL A CG2 1 
ATOM   1439 N N   . VAL A 1 183 ? 14.525  32.480 5.553   1.00 11.60 ? 896  VAL A N   1 
ATOM   1440 C CA  . VAL A 1 183 ? 13.101  32.697 5.328   1.00 11.16 ? 896  VAL A CA  1 
ATOM   1441 C C   . VAL A 1 183 ? 12.588  31.731 4.261   1.00 11.26 ? 896  VAL A C   1 
ATOM   1442 O O   . VAL A 1 183 ? 11.522  31.120 4.422   1.00 11.28 ? 896  VAL A O   1 
ATOM   1443 C CB  . VAL A 1 183 ? 12.809  34.163 4.914   1.00 13.24 ? 896  VAL A CB  1 
ATOM   1444 C CG1 . VAL A 1 183 ? 11.333  34.323 4.482   1.00 11.34 ? 896  VAL A CG1 1 
ATOM   1445 C CG2 . VAL A 1 183 ? 13.103  35.094 6.091   1.00 14.55 ? 896  VAL A CG2 1 
ATOM   1446 N N   . SER A 1 184 ? 13.408  31.509 3.235   1.00 11.31 ? 897  SER A N   1 
ATOM   1447 C CA  . SER A 1 184 ? 13.063  30.578 2.155   1.00 11.81 ? 897  SER A CA  1 
ATOM   1448 C C   . SER A 1 184 ? 12.811  29.165 2.695   1.00 9.98  ? 897  SER A C   1 
ATOM   1449 O O   . SER A 1 184 ? 11.872  28.489 2.280   1.00 10.80 ? 897  SER A O   1 
ATOM   1450 C CB  . SER A 1 184 ? 14.183  30.541 1.114   1.00 12.22 ? 897  SER A CB  1 
ATOM   1451 O OG  . SER A 1 184 ? 13.907  29.571 0.121   1.00 13.62 ? 897  SER A OG  1 
ATOM   1452 N N   . GLY A 1 185 ? 13.619  28.754 3.663   1.00 11.47 ? 898  GLY A N   1 
ATOM   1453 C CA  . GLY A 1 185 ? 13.515  27.413 4.207   1.00 12.45 ? 898  GLY A CA  1 
ATOM   1454 C C   . GLY A 1 185 ? 12.194  27.136 4.895   1.00 13.50 ? 898  GLY A C   1 
ATOM   1455 O O   . GLY A 1 185 ? 11.805  25.985 5.045   1.00 15.61 ? 898  GLY A O   1 
ATOM   1456 N N   . PHE A 1 186 ? 11.467  28.183 5.266   1.00 12.84 ? 899  PHE A N   1 
ATOM   1457 C CA  . PHE A 1 186 ? 10.155  27.989 5.860   1.00 14.17 ? 899  PHE A CA  1 
ATOM   1458 C C   . PHE A 1 186 ? 9.024   28.188 4.877   1.00 15.43 ? 899  PHE A C   1 
ATOM   1459 O O   . PHE A 1 186 ? 8.200   27.293 4.680   1.00 15.46 ? 899  PHE A O   1 
ATOM   1460 C CB  . PHE A 1 186 ? 9.977   28.904 7.065   1.00 14.22 ? 899  PHE A CB  1 
ATOM   1461 C CG  . PHE A 1 186 ? 10.698  28.415 8.280   1.00 13.25 ? 899  PHE A CG  1 
ATOM   1462 C CD1 . PHE A 1 186 ? 10.294  27.237 8.909   1.00 12.22 ? 899  PHE A CD1 1 
ATOM   1463 C CD2 . PHE A 1 186 ? 11.859  29.047 8.713   1.00 13.63 ? 899  PHE A CD2 1 
ATOM   1464 C CE1 . PHE A 1 186 ? 11.048  26.689 9.944   1.00 13.46 ? 899  PHE A CE1 1 
ATOM   1465 C CE2 . PHE A 1 186 ? 12.617  28.513 9.747   1.00 13.60 ? 899  PHE A CE2 1 
ATOM   1466 C CZ  . PHE A 1 186 ? 12.213  27.327 10.363  1.00 13.51 ? 899  PHE A CZ  1 
ATOM   1467 N N   . VAL A 1 187 ? 9.073   29.298 4.151   1.00 14.53 ? 900  VAL A N   1 
ATOM   1468 C CA  . VAL A 1 187 ? 7.962   29.665 3.300   1.00 12.96 ? 900  VAL A CA  1 
ATOM   1469 C C   . VAL A 1 187 ? 7.917   28.859 1.992   1.00 11.99 ? 900  VAL A C   1 
ATOM   1470 O O   . VAL A 1 187 ? 6.843   28.647 1.439   1.00 13.05 ? 900  VAL A O   1 
ATOM   1471 C CB  . VAL A 1 187 ? 7.946   31.201 3.043   1.00 15.63 ? 900  VAL A CB  1 
ATOM   1472 C CG1 . VAL A 1 187 ? 9.000   31.597 2.042   1.00 18.01 ? 900  VAL A CG1 1 
ATOM   1473 C CG2 . VAL A 1 187 ? 6.567   31.631 2.575   1.00 19.28 ? 900  VAL A CG2 1 
ATOM   1474 N N   . PHE A 1 188 ? 9.047   28.299 1.577   1.00 11.15 ? 901  PHE A N   1 
ATOM   1475 C CA  . PHE A 1 188 ? 9.063   27.428 0.403   1.00 11.57 ? 901  PHE A CA  1 
ATOM   1476 C C   . PHE A 1 188 ? 9.281   25.956 0.741   1.00 14.18 ? 901  PHE A C   1 
ATOM   1477 O O   . PHE A 1 188 ? 8.377   25.135 0.540   1.00 13.51 ? 901  PHE A O   1 
ATOM   1478 C CB  . PHE A 1 188 ? 10.099  27.902 -0.624  1.00 11.26 ? 901  PHE A CB  1 
ATOM   1479 C CG  . PHE A 1 188 ? 9.657   29.098 -1.415  1.00 12.72 ? 901  PHE A CG  1 
ATOM   1480 C CD1 . PHE A 1 188 ? 8.667   28.975 -2.393  1.00 14.20 ? 901  PHE A CD1 1 
ATOM   1481 C CD2 . PHE A 1 188 ? 10.126  30.362 -1.096  1.00 11.93 ? 901  PHE A CD2 1 
ATOM   1482 C CE1 . PHE A 1 188 ? 8.144   30.097 -3.031  1.00 13.00 ? 901  PHE A CE1 1 
ATOM   1483 C CE2 . PHE A 1 188 ? 9.605   31.492 -1.727  1.00 13.54 ? 901  PHE A CE2 1 
ATOM   1484 C CZ  . PHE A 1 188 ? 8.610   31.357 -2.696  1.00 12.58 ? 901  PHE A CZ  1 
ATOM   1485 N N   . LEU A 1 189 ? 10.442  25.615 1.295   1.00 13.72 ? 902  LEU A N   1 
ATOM   1486 C CA  . LEU A 1 189 ? 10.725  24.207 1.572   1.00 17.30 ? 902  LEU A CA  1 
ATOM   1487 C C   . LEU A 1 189 ? 9.685   23.576 2.507   1.00 17.16 ? 902  LEU A C   1 
ATOM   1488 O O   . LEU A 1 189 ? 9.364   22.392 2.367   1.00 13.53 ? 902  LEU A O   1 
ATOM   1489 C CB  . LEU A 1 189 ? 12.131  24.023 2.165   1.00 20.48 ? 902  LEU A CB  1 
ATOM   1490 C CG  . LEU A 1 189 ? 12.436  22.602 2.674   1.00 23.58 ? 902  LEU A CG  1 
ATOM   1491 C CD1 . LEU A 1 189 ? 12.780  21.695 1.500   1.00 22.54 ? 902  LEU A CD1 1 
ATOM   1492 C CD2 . LEU A 1 189 ? 13.577  22.631 3.693   1.00 25.34 ? 902  LEU A CD2 1 
ATOM   1493 N N   . ARG A 1 190 ? 9.131   24.372 3.425   1.00 13.90 ? 903  ARG A N   1 
ATOM   1494 C CA  . ARG A 1 190 ? 8.205   23.826 4.417   1.00 15.17 ? 903  ARG A CA  1 
ATOM   1495 C C   . ARG A 1 190 ? 6.774   24.365 4.361   1.00 14.76 ? 903  ARG A C   1 
ATOM   1496 O O   . ARG A 1 190 ? 5.979   24.104 5.264   1.00 15.61 ? 903  ARG A O   1 
ATOM   1497 C CB  . ARG A 1 190 ? 8.777   24.009 5.829   1.00 15.41 ? 903  ARG A CB  1 
ATOM   1498 C CG  . ARG A 1 190 ? 10.072  23.242 6.077   1.00 13.94 ? 903  ARG A CG  1 
ATOM   1499 C CD  . ARG A 1 190 ? 10.619  23.494 7.485   1.00 17.21 ? 903  ARG A CD  1 
ATOM   1500 N NE  . ARG A 1 190 ? 11.884  22.787 7.725   1.00 17.90 ? 903  ARG A NE  1 
ATOM   1501 C CZ  . ARG A 1 190 ? 11.977  21.497 8.042   1.00 19.83 ? 903  ARG A CZ  1 
ATOM   1502 N NH1 . ARG A 1 190 ? 10.881  20.781 8.243   1.00 20.36 ? 903  ARG A NH1 1 
ATOM   1503 N NH2 . ARG A 1 190 ? 13.167  20.922 8.178   1.00 18.55 ? 903  ARG A NH2 1 
ATOM   1504 N N   . LEU A 1 191 ? 6.437   25.103 3.306   1.00 13.72 ? 904  LEU A N   1 
ATOM   1505 C CA  . LEU A 1 191 ? 5.059   25.563 3.120   1.00 13.68 ? 904  LEU A CA  1 
ATOM   1506 C C   . LEU A 1 191 ? 4.594   25.421 1.671   1.00 13.10 ? 904  LEU A C   1 
ATOM   1507 O O   . LEU A 1 191 ? 3.815   24.520 1.337   1.00 11.25 ? 904  LEU A O   1 
ATOM   1508 C CB  . LEU A 1 191 ? 4.895   27.023 3.588   1.00 12.45 ? 904  LEU A CB  1 
ATOM   1509 C CG  . LEU A 1 191 ? 3.479   27.597 3.406   1.00 14.17 ? 904  LEU A CG  1 
ATOM   1510 C CD1 . LEU A 1 191 ? 2.504   26.802 4.286   1.00 15.96 ? 904  LEU A CD1 1 
ATOM   1511 C CD2 . LEU A 1 191 ? 3.425   29.084 3.746   1.00 12.14 ? 904  LEU A CD2 1 
ATOM   1512 N N   . ILE A 1 192 ? 5.108   26.292 0.810   1.00 13.21 ? 905  ILE A N   1 
ATOM   1513 C CA  . ILE A 1 192 ? 4.645   26.375 -0.571  1.00 13.14 ? 905  ILE A CA  1 
ATOM   1514 C C   . ILE A 1 192 ? 4.954   25.125 -1.398  1.00 13.02 ? 905  ILE A C   1 
ATOM   1515 O O   . ILE A 1 192 ? 4.092   24.625 -2.108  1.00 13.69 ? 905  ILE A O   1 
ATOM   1516 C CB  . ILE A 1 192 ? 5.232   27.626 -1.249  1.00 12.87 ? 905  ILE A CB  1 
ATOM   1517 C CG1 . ILE A 1 192 ? 4.447   28.854 -0.795  1.00 14.26 ? 905  ILE A CG1 1 
ATOM   1518 C CG2 . ILE A 1 192 ? 5.189   27.496 -2.765  1.00 15.00 ? 905  ILE A CG2 1 
ATOM   1519 C CD1 . ILE A 1 192 ? 5.158   30.155 -1.074  1.00 22.13 ? 905  ILE A CD1 1 
ATOM   1520 N N   . CYS A 1 193 ? 6.170   24.602 -1.296  1.00 13.95 ? 906  CYS A N   1 
ATOM   1521 C CA  . CYS A 1 193 ? 6.530   23.459 -2.131  1.00 15.13 ? 906  CYS A CA  1 
ATOM   1522 C C   . CYS A 1 193 ? 5.819   22.142 -1.748  1.00 14.98 ? 906  CYS A C   1 
ATOM   1523 O O   . CYS A 1 193 ? 5.256   21.482 -2.630  1.00 14.16 ? 906  CYS A O   1 
ATOM   1524 C CB  . CYS A 1 193 ? 8.055   23.295 -2.191  1.00 16.25 ? 906  CYS A CB  1 
ATOM   1525 S SG  . CYS A 1 193 ? 8.876   24.659 -3.096  1.00 19.31 ? 906  CYS A SG  1 
ATOM   1526 N N   . PRO A 1 194 ? 5.629   21.870 -0.433  1.00 14.43 ? 907  PRO A N   1 
ATOM   1527 C CA  . PRO A 1 194 ? 4.727   20.771 -0.054  1.00 14.22 ? 907  PRO A CA  1 
ATOM   1528 C C   . PRO A 1 194 ? 3.293   20.930 -0.563  1.00 14.48 ? 907  PRO A C   1 
ATOM   1529 O O   . PRO A 1 194 ? 2.677   19.957 -1.008  1.00 14.99 ? 907  PRO A O   1 
ATOM   1530 C CB  . PRO A 1 194 ? 4.785   20.764 1.474   1.00 11.99 ? 907  PRO A CB  1 
ATOM   1531 C CG  . PRO A 1 194 ? 6.108   21.300 1.783   1.00 13.92 ? 907  PRO A CG  1 
ATOM   1532 C CD  . PRO A 1 194 ? 6.377   22.365 0.735   1.00 14.97 ? 907  PRO A CD  1 
ATOM   1533 N N   . ALA A 1 195 ? 2.790   22.161 -0.558  1.00 13.11 ? 908  ALA A N   1 
ATOM   1534 C CA  . ALA A 1 195 ? 1.415   22.432 -0.984  1.00 12.57 ? 908  ALA A CA  1 
ATOM   1535 C C   . ALA A 1 195 ? 1.203   22.216 -2.477  1.00 11.86 ? 908  ALA A C   1 
ATOM   1536 O O   . ALA A 1 195 ? 0.126   21.804 -2.901  1.00 14.45 ? 908  ALA A O   1 
ATOM   1537 C CB  . ALA A 1 195 ? 1.017   23.850 -0.604  1.00 10.55 ? 908  ALA A CB  1 
ATOM   1538 N N   . ILE A 1 196 ? 2.217   22.533 -3.277  1.00 12.21 ? 909  ILE A N   1 
ATOM   1539 C CA  . ILE A 1 196 ? 2.183   22.241 -4.704  1.00 11.98 ? 909  ILE A CA  1 
ATOM   1540 C C   . ILE A 1 196 ? 2.257   20.733 -4.967  1.00 12.34 ? 909  ILE A C   1 
ATOM   1541 O O   . ILE A 1 196 ? 1.509   20.205 -5.800  1.00 14.61 ? 909  ILE A O   1 
ATOM   1542 C CB  . ILE A 1 196 ? 3.338   22.962 -5.447  1.00 12.12 ? 909  ILE A CB  1 
ATOM   1543 C CG1 . ILE A 1 196 ? 3.151   24.483 -5.342  1.00 11.13 ? 909  ILE A CG1 1 
ATOM   1544 C CG2 . ILE A 1 196 ? 3.379   22.522 -6.906  1.00 11.95 ? 909  ILE A CG2 1 
ATOM   1545 C CD1 . ILE A 1 196 ? 4.352   25.294 -5.772  1.00 13.93 ? 909  ILE A CD1 1 
ATOM   1546 N N   . LEU A 1 197 ? 3.087   20.038 -4.195  1.00 12.53 ? 910  LEU A N   1 
ATOM   1547 C CA  . LEU A 1 197 ? 3.237   18.592 -4.338  1.00 14.96 ? 910  LEU A CA  1 
ATOM   1548 C C   . LEU A 1 197 ? 2.004   17.817 -3.901  1.00 15.81 ? 910  LEU A C   1 
ATOM   1549 O O   . LEU A 1 197 ? 1.638   16.836 -4.542  1.00 18.91 ? 910  LEU A O   1 
ATOM   1550 C CB  . LEU A 1 197 ? 4.455   18.098 -3.564  1.00 15.29 ? 910  LEU A CB  1 
ATOM   1551 C CG  . LEU A 1 197 ? 5.785   18.476 -4.219  1.00 18.76 ? 910  LEU A CG  1 
ATOM   1552 C CD1 . LEU A 1 197 ? 6.949   18.200 -3.264  1.00 19.72 ? 910  LEU A CD1 1 
ATOM   1553 C CD2 . LEU A 1 197 ? 5.934   17.709 -5.537  1.00 18.39 ? 910  LEU A CD2 1 
ATOM   1554 N N   . ASN A 1 198 ? 1.338   18.280 -2.847  1.00 15.17 ? 911  ASN A N   1 
ATOM   1555 C CA  . ASN A 1 198 ? 0.083   17.673 -2.419  1.00 17.48 ? 911  ASN A CA  1 
ATOM   1556 C C   . ASN A 1 198 ? -0.927  18.758 -2.077  1.00 15.78 ? 911  ASN A C   1 
ATOM   1557 O O   . ASN A 1 198 ? -1.039  19.174 -0.929  1.00 15.99 ? 911  ASN A O   1 
ATOM   1558 C CB  . ASN A 1 198 ? 0.306   16.756 -1.211  1.00 22.53 ? 911  ASN A CB  1 
ATOM   1559 C CG  . ASN A 1 198 ? -1.006  16.224 -0.618  1.00 28.08 ? 911  ASN A CG  1 
ATOM   1560 O OD1 . ASN A 1 198 ? -1.956  15.905 -1.342  1.00 29.29 ? 911  ASN A OD1 1 
ATOM   1561 N ND2 . ASN A 1 198 ? -1.061  16.141 0.707   1.00 30.44 ? 911  ASN A ND2 1 
ATOM   1562 N N   . PRO A 1 199 ? -1.670  19.243 -3.084  1.00 17.01 ? 912  PRO A N   1 
ATOM   1563 C CA  . PRO A 1 199 ? -2.585  20.375 -2.882  1.00 17.44 ? 912  PRO A CA  1 
ATOM   1564 C C   . PRO A 1 199 ? -3.773  20.041 -1.981  1.00 19.97 ? 912  PRO A C   1 
ATOM   1565 O O   . PRO A 1 199 ? -4.503  20.938 -1.553  1.00 21.18 ? 912  PRO A O   1 
ATOM   1566 C CB  . PRO A 1 199 ? -3.036  20.736 -4.300  1.00 18.77 ? 912  PRO A CB  1 
ATOM   1567 C CG  . PRO A 1 199 ? -2.032  20.068 -5.223  1.00 17.46 ? 912  PRO A CG  1 
ATOM   1568 C CD  . PRO A 1 199 ? -1.620  18.825 -4.496  1.00 18.33 ? 912  PRO A CD  1 
ATOM   1569 N N   . ARG A 1 200 ? -3.941  18.759 -1.663  1.00 21.28 ? 913  ARG A N   1 
ATOM   1570 C CA  . ARG A 1 200 ? -4.993  18.322 -0.754  1.00 26.06 ? 913  ARG A CA  1 
ATOM   1571 C C   . ARG A 1 200 ? -4.807  18.787 0.687   1.00 28.56 ? 913  ARG A C   1 
ATOM   1572 O O   . ARG A 1 200 ? -5.782  18.985 1.407   1.00 29.45 ? 913  ARG A O   1 
ATOM   1573 C CB  . ARG A 1 200 ? -5.098  16.804 -0.766  1.00 27.27 ? 913  ARG A CB  1 
ATOM   1574 C CG  . ARG A 1 200 ? -6.017  16.269 -1.817  1.00 29.13 ? 913  ARG A CG  1 
ATOM   1575 C CD  . ARG A 1 200 ? -6.575  14.941 -1.385  1.00 32.38 ? 913  ARG A CD  1 
ATOM   1576 N NE  . ARG A 1 200 ? -6.615  13.993 -2.489  1.00 37.34 ? 913  ARG A NE  1 
ATOM   1577 C CZ  . ARG A 1 200 ? -7.651  13.205 -2.751  1.00 39.52 ? 913  ARG A CZ  1 
ATOM   1578 N NH1 . ARG A 1 200 ? -8.761  13.304 -2.026  1.00 41.26 ? 913  ARG A NH1 1 
ATOM   1579 N NH2 . ARG A 1 200 ? -7.592  12.348 -3.759  1.00 37.24 ? 913  ARG A NH2 1 
ATOM   1580 N N   . MET A 1 201 ? -3.565  18.949 1.125   1.00 31.79 ? 914  MET A N   1 
ATOM   1581 C CA  . MET A 1 201 ? -3.326  19.245 2.525   1.00 34.54 ? 914  MET A CA  1 
ATOM   1582 C C   . MET A 1 201 ? -3.688  20.673 2.916   1.00 32.92 ? 914  MET A C   1 
ATOM   1583 O O   . MET A 1 201 ? -3.873  20.963 4.097   1.00 34.14 ? 914  MET A O   1 
ATOM   1584 C CB  . MET A 1 201 ? -1.882  18.928 2.900   1.00 41.64 ? 914  MET A CB  1 
ATOM   1585 C CG  . MET A 1 201 ? -1.772  17.770 3.885   1.00 49.03 ? 914  MET A CG  1 
ATOM   1586 S SD  . MET A 1 201 ? -2.878  17.969 5.322   1.00 57.98 ? 914  MET A SD  1 
ATOM   1587 C CE  . MET A 1 201 ? -1.688  18.431 6.609   1.00 55.26 ? 914  MET A CE  1 
ATOM   1588 N N   . PHE A 1 202 ? -3.840  21.549 1.925   1.00 29.76 ? 915  PHE A N   1 
ATOM   1589 C CA  . PHE A 1 202 ? -4.463  22.849 2.145   1.00 27.19 ? 915  PHE A CA  1 
ATOM   1590 C C   . PHE A 1 202 ? -5.834  22.910 1.481   1.00 27.65 ? 915  PHE A C   1 
ATOM   1591 O O   . PHE A 1 202 ? -6.444  23.981 1.362   1.00 26.44 ? 915  PHE A O   1 
ATOM   1592 C CB  . PHE A 1 202 ? -3.562  23.972 1.628   1.00 27.04 ? 915  PHE A CB  1 
ATOM   1593 C CG  . PHE A 1 202 ? -2.583  24.479 2.655   1.00 27.32 ? 915  PHE A CG  1 
ATOM   1594 C CD1 . PHE A 1 202 ? -3.012  25.321 3.687   1.00 28.07 ? 915  PHE A CD1 1 
ATOM   1595 C CD2 . PHE A 1 202 ? -1.246  24.069 2.631   1.00 23.55 ? 915  PHE A CD2 1 
ATOM   1596 C CE1 . PHE A 1 202 ? -2.120  25.748 4.685   1.00 26.57 ? 915  PHE A CE1 1 
ATOM   1597 C CE2 . PHE A 1 202 ? -0.348  24.484 3.617   1.00 23.29 ? 915  PHE A CE2 1 
ATOM   1598 C CZ  . PHE A 1 202 ? -0.783  25.325 4.645   1.00 25.88 ? 915  PHE A CZ  1 
ATOM   1599 N N   . ASN A 1 203 ? -6.352  21.731 1.142   1.00 26.76 ? 916  ASN A N   1 
ATOM   1600 C CA  . ASN A 1 203 ? -7.691  21.579 0.580   1.00 26.03 ? 916  ASN A CA  1 
ATOM   1601 C C   . ASN A 1 203 ? -7.912  22.414 -0.666  1.00 24.37 ? 916  ASN A C   1 
ATOM   1602 O O   . ASN A 1 203 ? -9.006  22.918 -0.917  1.00 23.39 ? 916  ASN A O   1 
ATOM   1603 C CB  . ASN A 1 203 ? -8.742  21.909 1.634   1.00 29.81 ? 916  ASN A CB  1 
ATOM   1604 C CG  . ASN A 1 203 ? -9.109  20.712 2.459   1.00 33.90 ? 916  ASN A CG  1 
ATOM   1605 O OD1 . ASN A 1 203 ? -10.043 19.984 2.119   1.00 38.47 ? 916  ASN A OD1 1 
ATOM   1606 N ND2 . ASN A 1 203 ? -8.305  20.422 3.472   1.00 32.78 ? 916  ASN A ND2 1 
ATOM   1607 N N   . ILE A 1 204 ? -6.839  22.600 -1.421  1.00 23.32 ? 917  ILE A N   1 
ATOM   1608 C CA  . ILE A 1 204 ? -6.923  23.265 -2.711  1.00 22.53 ? 917  ILE A CA  1 
ATOM   1609 C C   . ILE A 1 204 ? -7.647  22.332 -3.669  1.00 20.89 ? 917  ILE A C   1 
ATOM   1610 O O   . ILE A 1 204 ? -8.514  22.761 -4.427  1.00 22.25 ? 917  ILE A O   1 
ATOM   1611 C CB  . ILE A 1 204 ? -5.507  23.598 -3.242  1.00 22.10 ? 917  ILE A CB  1 
ATOM   1612 C CG1 . ILE A 1 204 ? -4.842  24.603 -2.306  1.00 24.16 ? 917  ILE A CG1 1 
ATOM   1613 C CG2 . ILE A 1 204 ? -5.572  24.159 -4.653  1.00 21.47 ? 917  ILE A CG2 1 
ATOM   1614 C CD1 . ILE A 1 204 ? -3.342  24.534 -2.325  1.00 28.87 ? 917  ILE A CD1 1 
ATOM   1615 N N   . ILE A 1 205 ? -7.381  21.037 -3.532  1.00 21.28 ? 918  ILE A N   1 
ATOM   1616 C CA  . ILE A 1 205 ? -7.960  20.050 -4.429  1.00 23.60 ? 918  ILE A CA  1 
ATOM   1617 C C   . ILE A 1 205 ? -8.658  18.925 -3.660  1.00 24.96 ? 918  ILE A C   1 
ATOM   1618 O O   . ILE A 1 205 ? -8.385  18.700 -2.481  1.00 24.47 ? 918  ILE A O   1 
ATOM   1619 C CB  . ILE A 1 205 ? -6.881  19.488 -5.388  1.00 24.47 ? 918  ILE A CB  1 
ATOM   1620 C CG1 . ILE A 1 205 ? -7.517  19.136 -6.718  1.00 30.60 ? 918  ILE A CG1 1 
ATOM   1621 C CG2 . ILE A 1 205 ? -6.190  18.277 -4.795  1.00 25.21 ? 918  ILE A CG2 1 
ATOM   1622 C CD1 . ILE A 1 205 ? -8.153  20.320 -7.394  1.00 38.13 ? 918  ILE A CD1 1 
ATOM   1623 N N   . SER A 1 206 ? -9.590  18.257 -4.332  1.00 26.50 ? 919  SER A N   1 
ATOM   1624 C CA  . SER A 1 206 ? -10.477 17.282 -3.705  1.00 28.91 ? 919  SER A CA  1 
ATOM   1625 C C   . SER A 1 206 ? -10.220 15.877 -4.241  1.00 29.71 ? 919  SER A C   1 
ATOM   1626 O O   . SER A 1 206 ? -10.472 14.891 -3.560  1.00 32.54 ? 919  SER A O   1 
ATOM   1627 C CB  . SER A 1 206 ? -11.933 17.665 -3.979  1.00 30.52 ? 919  SER A CB  1 
ATOM   1628 O OG  . SER A 1 206 ? -12.736 17.520 -2.824  1.00 34.24 ? 919  SER A OG  1 
ATOM   1629 N N   . ASP A 1 207 ? -9.814  15.799 -5.502  1.00 28.22 ? 920  ASP A N   1 
ATOM   1630 C CA  . ASP A 1 207 ? -9.586  14.527 -6.169  1.00 26.90 ? 920  ASP A CA  1 
ATOM   1631 C C   . ASP A 1 207 ? -8.118  14.430 -6.561  1.00 23.40 ? 920  ASP A C   1 
ATOM   1632 O O   . ASP A 1 207 ? -7.496  15.440 -6.897  1.00 21.83 ? 920  ASP A O   1 
ATOM   1633 C CB  . ASP A 1 207 ? -10.446 14.424 -7.436  1.00 31.04 ? 920  ASP A CB  1 
ATOM   1634 C CG  . ASP A 1 207 ? -11.932 14.598 -7.159  1.00 36.03 ? 920  ASP A CG  1 
ATOM   1635 O OD1 . ASP A 1 207 ? -12.473 13.886 -6.280  1.00 38.55 ? 920  ASP A OD1 1 
ATOM   1636 O OD2 . ASP A 1 207 ? -12.565 15.427 -7.845  1.00 39.04 ? 920  ASP A OD2 1 
ATOM   1637 N N   . SER A 1 208 ? -7.614  13.200 -6.634  1.00 18.17 ? 921  SER A N   1 
ATOM   1638 C CA  . SER A 1 208 ? -6.244  12.948 -7.045  1.00 16.53 ? 921  SER A CA  1 
ATOM   1639 C C   . SER A 1 208 ? -6.003  13.470 -8.449  1.00 15.53 ? 921  SER A C   1 
ATOM   1640 O O   . SER A 1 208 ? -6.842  13.294 -9.334  1.00 17.56 ? 921  SER A O   1 
ATOM   1641 C CB  . SER A 1 208 ? -5.957  11.453 -7.012  1.00 19.34 ? 921  SER A CB  1 
ATOM   1642 O OG  . SER A 1 208 ? -6.083  10.963 -5.690  1.00 28.09 ? 921  SER A OG  1 
ATOM   1643 N N   . PRO A 1 209 ? -4.873  14.160 -8.665  1.00 14.46 ? 922  PRO A N   1 
ATOM   1644 C CA  . PRO A 1 209 ? -4.557  14.704 -9.990  1.00 14.45 ? 922  PRO A CA  1 
ATOM   1645 C C   . PRO A 1 209 ? -4.456  13.617 -11.056 1.00 14.78 ? 922  PRO A C   1 
ATOM   1646 O O   . PRO A 1 209 ? -4.104  12.469 -10.761 1.00 13.71 ? 922  PRO A O   1 
ATOM   1647 C CB  . PRO A 1 209 ? -3.213  15.401 -9.771  1.00 12.74 ? 922  PRO A CB  1 
ATOM   1648 C CG  . PRO A 1 209 ? -3.187  15.686 -8.305  1.00 12.33 ? 922  PRO A CG  1 
ATOM   1649 C CD  . PRO A 1 209 ? -3.832  14.499 -7.683  1.00 13.67 ? 922  PRO A CD  1 
ATOM   1650 N N   . SER A 1 210 ? -4.820  13.975 -12.283 1.00 15.07 ? 923  SER A N   1 
ATOM   1651 C CA  . SER A 1 210 ? -4.597  13.110 -13.441 1.00 16.43 ? 923  SER A CA  1 
ATOM   1652 C C   . SER A 1 210 ? -3.083  12.908 -13.600 1.00 15.55 ? 923  SER A C   1 
ATOM   1653 O O   . SER A 1 210 ? -2.294  13.609 -12.971 1.00 15.00 ? 923  SER A O   1 
ATOM   1654 C CB  . SER A 1 210 ? -5.200  13.757 -14.702 1.00 17.92 ? 923  SER A CB  1 
ATOM   1655 O OG  . SER A 1 210 ? -4.549  14.984 -15.031 1.00 20.96 ? 923  SER A OG  1 
ATOM   1656 N N   . PRO A 1 211 ? -2.660  11.891 -14.361 1.00 14.38 ? 924  PRO A N   1 
ATOM   1657 C CA  . PRO A 1 211 ? -1.219  11.682 -14.520 1.00 13.97 ? 924  PRO A CA  1 
ATOM   1658 C C   . PRO A 1 211 ? -0.462  12.909 -15.046 1.00 13.92 ? 924  PRO A C   1 
ATOM   1659 O O   . PRO A 1 211 ? 0.606   13.239 -14.529 1.00 16.37 ? 924  PRO A O   1 
ATOM   1660 C CB  . PRO A 1 211 ? -1.135  10.501 -15.484 1.00 14.79 ? 924  PRO A CB  1 
ATOM   1661 C CG  . PRO A 1 211 ? -2.379  9.757  -15.246 1.00 15.42 ? 924  PRO A CG  1 
ATOM   1662 C CD  . PRO A 1 211 ? -3.435  10.801 -14.977 1.00 15.13 ? 924  PRO A CD  1 
ATOM   1663 N N   . ILE A 1 212 ? -1.027  13.602 -16.036 1.00 12.86 ? 925  ILE A N   1 
ATOM   1664 C CA  . ILE A 1 212 ? -0.374  14.794 -16.592 1.00 14.33 ? 925  ILE A CA  1 
ATOM   1665 C C   . ILE A 1 212 ? -0.301  15.930 -15.564 1.00 12.93 ? 925  ILE A C   1 
ATOM   1666 O O   . ILE A 1 212 ? 0.743   16.563 -15.414 1.00 13.41 ? 925  ILE A O   1 
ATOM   1667 C CB  . ILE A 1 212 ? -1.090  15.294 -17.883 1.00 16.70 ? 925  ILE A CB  1 
ATOM   1668 C CG1 . ILE A 1 212 ? -0.852  14.293 -19.023 1.00 20.08 ? 925  ILE A CG1 1 
ATOM   1669 C CG2 . ILE A 1 212 ? -0.569  16.678 -18.297 1.00 17.40 ? 925  ILE A CG2 1 
ATOM   1670 C CD1 . ILE A 1 212 ? -1.490  14.680 -20.339 1.00 23.15 ? 925  ILE A CD1 1 
ATOM   1671 N N   . ALA A 1 213 ? -1.370  16.108 -14.791 1.00 10.97 ? 926  ALA A N   1 
ATOM   1672 C CA  . ALA A 1 213 ? -1.378  17.099 -13.720 1.00 13.50 ? 926  ALA A CA  1 
ATOM   1673 C C   . ALA A 1 213 ? -0.379  16.737 -12.625 1.00 13.08 ? 926  ALA A C   1 
ATOM   1674 O O   . ALA A 1 213 ? 0.337   17.596 -12.131 1.00 11.43 ? 926  ALA A O   1 
ATOM   1675 C CB  . ALA A 1 213 ? -2.789  17.240 -13.126 1.00 14.49 ? 926  ALA A CB  1 
ATOM   1676 N N   . ALA A 1 214 ? -0.281  15.451 -12.307 1.00 13.26 ? 927  ALA A N   1 
ATOM   1677 C CA  . ALA A 1 214 ? 0.612   14.994 -11.254 1.00 13.89 ? 927  ALA A CA  1 
ATOM   1678 C C   . ALA A 1 214 ? 2.066   15.286 -11.606 1.00 13.63 ? 927  ALA A C   1 
ATOM   1679 O O   . ALA A 1 214 ? 2.829   15.763 -10.775 1.00 15.12 ? 927  ALA A O   1 
ATOM   1680 C CB  . ALA A 1 214 ? 0.415   13.505 -11.012 1.00 14.21 ? 927  ALA A CB  1 
ATOM   1681 N N   . ARG A 1 215 ? 2.420   15.057 -12.865 1.00 14.49 ? 928  ARG A N   1 
ATOM   1682 C CA  . ARG A 1 215 ? 3.771   15.290 -13.352 1.00 16.02 ? 928  ARG A CA  1 
ATOM   1683 C C   . ARG A 1 215 ? 4.091   16.788 -13.343 1.00 15.61 ? 928  ARG A C   1 
ATOM   1684 O O   . ARG A 1 215 ? 5.167   17.207 -12.925 1.00 12.88 ? 928  ARG A O   1 
ATOM   1685 C CB  . ARG A 1 215 ? 3.901   14.735 -14.774 1.00 17.53 ? 928  ARG A CB  1 
ATOM   1686 C CG  . ARG A 1 215 ? 5.272   14.925 -15.392 1.00 22.85 ? 928  ARG A CG  1 
ATOM   1687 C CD  . ARG A 1 215 ? 6.318   14.112 -14.642 1.00 24.76 ? 928  ARG A CD  1 
ATOM   1688 N NE  . ARG A 1 215 ? 7.570   14.044 -15.383 1.00 26.85 ? 928  ARG A NE  1 
ATOM   1689 C CZ  . ARG A 1 215 ? 8.761   14.303 -14.864 1.00 25.61 ? 928  ARG A CZ  1 
ATOM   1690 N NH1 . ARG A 1 215 ? 8.881   14.524 -13.564 1.00 26.25 ? 928  ARG A NH1 1 
ATOM   1691 N NH2 . ARG A 1 215 ? 9.835   14.309 -15.644 1.00 26.44 ? 928  ARG A NH2 1 
ATOM   1692 N N   . THR A 1 216 ? 3.136   17.587 -13.803 1.00 14.38 ? 929  THR A N   1 
ATOM   1693 C CA  . THR A 1 216 ? 3.295   19.030 -13.835 1.00 14.49 ? 929  THR A CA  1 
ATOM   1694 C C   . THR A 1 216 ? 3.494   19.603 -12.422 1.00 13.04 ? 929  THR A C   1 
ATOM   1695 O O   . THR A 1 216 ? 4.417   20.383 -12.194 1.00 11.53 ? 929  THR A O   1 
ATOM   1696 C CB  . THR A 1 216 ? 2.086   19.689 -14.554 1.00 12.87 ? 929  THR A CB  1 
ATOM   1697 O OG1 . THR A 1 216 ? 2.084   19.266 -15.919 1.00 11.25 ? 929  THR A OG1 1 
ATOM   1698 C CG2 . THR A 1 216 ? 2.186   21.219 -14.522 1.00 11.65 ? 929  THR A CG2 1 
ATOM   1699 N N   . LEU A 1 217 ? 2.740   19.101 -11.453 1.00 11.24 ? 930  LEU A N   1 
ATOM   1700 C CA  . LEU A 1 217 ? 2.932   19.528 -10.077 1.00 13.59 ? 930  LEU A CA  1 
ATOM   1701 C C   . LEU A 1 217 ? 4.356   19.241 -9.586  1.00 15.14 ? 930  LEU A C   1 
ATOM   1702 O O   . LEU A 1 217 ? 4.996   20.098 -8.967  1.00 12.50 ? 930  LEU A O   1 
ATOM   1703 C CB  . LEU A 1 217 ? 1.915   18.851 -9.155  1.00 15.02 ? 930  LEU A CB  1 
ATOM   1704 C CG  . LEU A 1 217 ? 0.455   19.304 -9.278  1.00 16.22 ? 930  LEU A CG  1 
ATOM   1705 C CD1 . LEU A 1 217 ? -0.400  18.483 -8.328  1.00 14.97 ? 930  LEU A CD1 1 
ATOM   1706 C CD2 . LEU A 1 217 ? 0.320   20.797 -8.965  1.00 15.60 ? 930  LEU A CD2 1 
ATOM   1707 N N   . ILE A 1 218 ? 4.867   18.053 -9.900  1.00 13.48 ? 931  ILE A N   1 
ATOM   1708 C CA  . ILE A 1 218 ? 6.223   17.700 -9.514  1.00 15.03 ? 931  ILE A CA  1 
ATOM   1709 C C   . ILE A 1 218 ? 7.264   18.613 -10.156 1.00 15.41 ? 931  ILE A C   1 
ATOM   1710 O O   . ILE A 1 218 ? 8.162   19.098 -9.470  1.00 15.66 ? 931  ILE A O   1 
ATOM   1711 C CB  . ILE A 1 218 ? 6.528   16.222 -9.848  1.00 17.67 ? 931  ILE A CB  1 
ATOM   1712 C CG1 . ILE A 1 218 ? 5.793   15.319 -8.842  1.00 18.46 ? 931  ILE A CG1 1 
ATOM   1713 C CG2 . ILE A 1 218 ? 8.047   15.962 -9.821  1.00 17.00 ? 931  ILE A CG2 1 
ATOM   1714 C CD1 . ILE A 1 218 ? 5.585   13.897 -9.321  1.00 20.38 ? 931  ILE A CD1 1 
ATOM   1715 N N   . LEU A 1 219 ? 7.094   18.921 -11.438 1.00 13.43 ? 932  LEU A N   1 
ATOM   1716 C CA  . LEU A 1 219 ? 8.093   19.712 -12.156 1.00 14.96 ? 932  LEU A CA  1 
ATOM   1717 C C   . LEU A 1 219 ? 8.017   21.188 -11.764 1.00 14.93 ? 932  LEU A C   1 
ATOM   1718 O O   . LEU A 1 219 ? 9.040   21.871 -11.682 1.00 14.36 ? 932  LEU A O   1 
ATOM   1719 C CB  . LEU A 1 219 ? 7.920   19.556 -13.671 1.00 15.82 ? 932  LEU A CB  1 
ATOM   1720 C CG  . LEU A 1 219 ? 8.261   18.187 -14.273 1.00 17.14 ? 932  LEU A CG  1 
ATOM   1721 C CD1 . LEU A 1 219 ? 7.990   18.208 -15.769 1.00 18.39 ? 932  LEU A CD1 1 
ATOM   1722 C CD2 . LEU A 1 219 ? 9.716   17.847 -14.009 1.00 18.18 ? 932  LEU A CD2 1 
ATOM   1723 N N   . VAL A 1 220 ? 6.807   21.644 -11.444 1.00 13.80 ? 933  VAL A N   1 
ATOM   1724 C CA  . VAL A 1 220 ? 6.584   23.009 -10.969 1.00 12.90 ? 933  VAL A CA  1 
ATOM   1725 C C   . VAL A 1 220 ? 7.187   23.214 -9.578  1.00 13.42 ? 933  VAL A C   1 
ATOM   1726 O O   . VAL A 1 220 ? 7.959   24.149 -9.375  1.00 11.73 ? 933  VAL A O   1 
ATOM   1727 C CB  . VAL A 1 220 ? 5.060   23.355 -10.943 1.00 14.42 ? 933  VAL A CB  1 
ATOM   1728 C CG1 . VAL A 1 220 ? 4.807   24.624 -10.106 1.00 10.65 ? 933  VAL A CG1 1 
ATOM   1729 C CG2 . VAL A 1 220 ? 4.545   23.542 -12.367 1.00 9.84  ? 933  VAL A CG2 1 
ATOM   1730 N N   . ALA A 1 221 ? 6.932   22.273 -8.668  1.00 11.29 ? 934  ALA A N   1 
ATOM   1731 C CA  . ALA A 1 221 ? 7.500   22.312 -7.323  1.00 14.00 ? 934  ALA A CA  1 
ATOM   1732 C C   . ALA A 1 221 ? 9.028   22.234 -7.333  1.00 14.76 ? 934  ALA A C   1 
ATOM   1733 O O   . ALA A 1 221 ? 9.694   22.953 -6.588  1.00 14.43 ? 934  ALA A O   1 
ATOM   1734 C CB  . ALA A 1 221 ? 6.926   21.181 -6.486  1.00 13.00 ? 934  ALA A CB  1 
ATOM   1735 N N   . LYS A 1 222 ? 9.574   21.426 -8.240  1.00 13.99 ? 935  LYS A N   1 
ATOM   1736 C CA  . LYS A 1 222 ? 11.017  21.299 -8.415  1.00 15.34 ? 935  LYS A CA  1 
ATOM   1737 C C   . LYS A 1 222 ? 11.649  22.612 -8.877  1.00 13.90 ? 935  LYS A C   1 
ATOM   1738 O O   . LYS A 1 222 ? 12.716  23.013 -8.398  1.00 15.27 ? 935  LYS A O   1 
ATOM   1739 C CB  . LYS A 1 222 ? 11.308  20.209 -9.443  1.00 20.66 ? 935  LYS A CB  1 
ATOM   1740 C CG  . LYS A 1 222 ? 12.717  19.661 -9.388  1.00 29.71 ? 935  LYS A CG  1 
ATOM   1741 C CD  . LYS A 1 222 ? 12.938  18.617 -10.477 1.00 34.35 ? 935  LYS A CD  1 
ATOM   1742 C CE  . LYS A 1 222 ? 12.018  17.424 -10.285 1.00 38.48 ? 935  LYS A CE  1 
ATOM   1743 N NZ  . LYS A 1 222 ? 12.372  16.668 -9.046  1.00 42.58 ? 935  LYS A NZ  1 
ATOM   1744 N N   . SER A 1 223 ? 11.014  23.237 -9.862  1.00 13.92 ? 936  SER A N   1 
ATOM   1745 C CA  . SER A 1 223 ? 11.470  24.509 -10.409 1.00 14.01 ? 936  SER A CA  1 
ATOM   1746 C C   . SER A 1 223 ? 11.403  25.616 -9.368  1.00 13.78 ? 936  SER A C   1 
ATOM   1747 O O   . SER A 1 223 ? 12.342  26.393 -9.210  1.00 14.14 ? 936  SER A O   1 
ATOM   1748 C CB  . SER A 1 223 ? 10.609  24.893 -11.614 1.00 14.71 ? 936  SER A CB  1 
ATOM   1749 O OG  . SER A 1 223 ? 10.687  23.901 -12.626 1.00 16.83 ? 936  SER A OG  1 
ATOM   1750 N N   . VAL A 1 224 ? 10.318  25.639 -8.604  1.00 13.22 ? 937  VAL A N   1 
ATOM   1751 C CA  . VAL A 1 224 ? 10.135  26.680 -7.605  1.00 13.40 ? 937  VAL A CA  1 
ATOM   1752 C C   . VAL A 1 224 ? 11.143  26.503 -6.479  1.00 14.43 ? 937  VAL A C   1 
ATOM   1753 O O   . VAL A 1 224 ? 11.720  27.477 -6.002  1.00 14.30 ? 937  VAL A O   1 
ATOM   1754 C CB  . VAL A 1 224 ? 8.685   26.679 -7.045  1.00 13.96 ? 937  VAL A CB  1 
ATOM   1755 C CG1 . VAL A 1 224 ? 8.586   27.567 -5.794  1.00 15.66 ? 937  VAL A CG1 1 
ATOM   1756 C CG2 . VAL A 1 224 ? 7.714   27.186 -8.117  1.00 13.25 ? 937  VAL A CG2 1 
ATOM   1757 N N   . GLN A 1 225 ? 11.436  25.253 -6.130  1.00 14.83 ? 938  GLN A N   1 
ATOM   1758 C CA  . GLN A 1 225 ? 12.371  24.980 -5.043  1.00 14.85 ? 938  GLN A CA  1 
ATOM   1759 C C   . GLN A 1 225 ? 13.794  25.427 -5.395  1.00 13.35 ? 938  GLN A C   1 
ATOM   1760 O O   . GLN A 1 225 ? 14.473  26.065 -4.591  1.00 11.70 ? 938  GLN A O   1 
ATOM   1761 C CB  . GLN A 1 225 ? 12.360  23.494 -4.685  1.00 15.99 ? 938  GLN A CB  1 
ATOM   1762 C CG  . GLN A 1 225 ? 13.172  23.152 -3.439  1.00 17.84 ? 938  GLN A CG  1 
ATOM   1763 C CD  . GLN A 1 225 ? 12.878  24.087 -2.265  1.00 20.95 ? 938  GLN A CD  1 
ATOM   1764 O OE1 . GLN A 1 225 ? 13.556  25.106 -2.067  1.00 21.78 ? 938  GLN A OE1 1 
ATOM   1765 N NE2 . GLN A 1 225 ? 11.829  23.777 -1.522  1.00 18.72 ? 938  GLN A NE2 1 
ATOM   1766 N N   . ASN A 1 226 ? 14.194  25.192 -6.636  1.00 13.44 ? 939  ASN A N   1 
ATOM   1767 C CA  . ASN A 1 226 ? 15.497  25.664 -7.098  1.00 15.27 ? 939  ASN A CA  1 
ATOM   1768 C C   . ASN A 1 226 ? 15.604  27.191 -7.131  1.00 14.73 ? 939  ASN A C   1 
ATOM   1769 O O   . ASN A 1 226 ? 16.594  27.744 -6.631  1.00 14.05 ? 939  ASN A O   1 
ATOM   1770 C CB  . ASN A 1 226 ? 15.831  25.077 -8.472  1.00 15.13 ? 939  ASN A CB  1 
ATOM   1771 C CG  . ASN A 1 226 ? 16.764  23.897 -8.372  1.00 18.26 ? 939  ASN A CG  1 
ATOM   1772 O OD1 . ASN A 1 226 ? 16.488  22.937 -7.656  1.00 21.37 ? 939  ASN A OD1 1 
ATOM   1773 N ND2 . ASN A 1 226 ? 17.920  24.001 -9.018  1.00 21.26 ? 939  ASN A ND2 1 
ATOM   1774 N N   . LEU A 1 227 ? 14.564  27.865 -7.643  1.00 13.74 ? 940  LEU A N   1 
ATOM   1775 C CA  . LEU A 1 227 ? 14.492  29.330 -7.552  1.00 13.60 ? 940  LEU A CA  1 
ATOM   1776 C C   . LEU A 1 227 ? 14.522  29.801 -6.094  1.00 13.05 ? 940  LEU A C   1 
ATOM   1777 O O   . LEU A 1 227 ? 15.268  30.715 -5.751  1.00 13.16 ? 940  LEU A O   1 
ATOM   1778 C CB  . LEU A 1 227 ? 13.237  29.882 -8.245  1.00 12.54 ? 940  LEU A CB  1 
ATOM   1779 C CG  . LEU A 1 227 ? 13.038  31.410 -8.215  1.00 12.59 ? 940  LEU A CG  1 
ATOM   1780 C CD1 . LEU A 1 227 ? 14.265  32.158 -8.727  1.00 11.56 ? 940  LEU A CD1 1 
ATOM   1781 C CD2 . LEU A 1 227 ? 11.819  31.780 -9.048  1.00 16.67 ? 940  LEU A CD2 1 
ATOM   1782 N N   . ALA A 1 228 ? 13.806  29.098 -5.223  1.00 11.71 ? 941  ALA A N   1 
ATOM   1783 C CA  . ALA A 1 228 ? 13.787  29.435 -3.801  1.00 12.75 ? 941  ALA A CA  1 
ATOM   1784 C C   . ALA A 1 228 ? 15.171  29.321 -3.159  1.00 12.91 ? 941  ALA A C   1 
ATOM   1785 O O   . ALA A 1 228 ? 15.490  30.052 -2.223  1.00 12.78 ? 941  ALA A O   1 
ATOM   1786 C CB  . ALA A 1 228 ? 12.781  28.552 -3.054  1.00 11.55 ? 941  ALA A CB  1 
ATOM   1787 N N   . ASN A 1 229 ? 15.974  28.390 -3.662  1.00 13.75 ? 942  ASN A N   1 
ATOM   1788 C CA  . ASN A 1 229 ? 17.342  28.189 -3.194  1.00 15.06 ? 942  ASN A CA  1 
ATOM   1789 C C   . ASN A 1 229 ? 18.350  29.014 -4.000  1.00 16.26 ? 942  ASN A C   1 
ATOM   1790 O O   . ASN A 1 229 ? 19.556  28.967 -3.742  1.00 17.32 ? 942  ASN A O   1 
ATOM   1791 C CB  . ASN A 1 229 ? 17.700  26.707 -3.276  1.00 13.45 ? 942  ASN A CB  1 
ATOM   1792 C CG  . ASN A 1 229 ? 16.981  25.879 -2.240  1.00 17.59 ? 942  ASN A CG  1 
ATOM   1793 O OD1 . ASN A 1 229 ? 16.880  26.272 -1.084  1.00 20.68 ? 942  ASN A OD1 1 
ATOM   1794 N ND2 . ASN A 1 229 ? 16.467  24.726 -2.648  1.00 19.54 ? 942  ASN A ND2 1 
ATOM   1795 N N   . LEU A 1 230 ? 17.845  29.773 -4.967  1.00 16.80 ? 943  LEU A N   1 
ATOM   1796 C CA  . LEU A 1 230 ? 18.669  30.632 -5.805  1.00 19.22 ? 943  LEU A CA  1 
ATOM   1797 C C   . LEU A 1 230 ? 19.793  29.851 -6.488  1.00 21.31 ? 943  LEU A C   1 
ATOM   1798 O O   . LEU A 1 230 ? 20.945  30.296 -6.522  1.00 23.36 ? 943  LEU A O   1 
ATOM   1799 C CB  . LEU A 1 230 ? 19.233  31.788 -4.968  1.00 19.68 ? 943  LEU A CB  1 
ATOM   1800 C CG  . LEU A 1 230 ? 18.160  32.629 -4.265  1.00 19.70 ? 943  LEU A CG  1 
ATOM   1801 C CD1 . LEU A 1 230 ? 18.799  33.497 -3.203  1.00 24.92 ? 943  LEU A CD1 1 
ATOM   1802 C CD2 . LEU A 1 230 ? 17.418  33.477 -5.284  1.00 20.22 ? 943  LEU A CD2 1 
ATOM   1803 N N   . VAL A 1 231 ? 19.446  28.694 -7.053  1.00 21.50 ? 944  VAL A N   1 
ATOM   1804 C CA  . VAL A 1 231 ? 20.418  27.861 -7.769  1.00 22.54 ? 944  VAL A CA  1 
ATOM   1805 C C   . VAL A 1 231 ? 19.864  27.277 -9.064  1.00 21.78 ? 944  VAL A C   1 
ATOM   1806 O O   . VAL A 1 231 ? 18.735  26.788 -9.107  1.00 20.98 ? 944  VAL A O   1 
ATOM   1807 C CB  . VAL A 1 231 ? 20.938  26.689 -6.893  1.00 23.74 ? 944  VAL A CB  1 
ATOM   1808 C CG1 . VAL A 1 231 ? 21.683  27.231 -5.682  1.00 27.71 ? 944  VAL A CG1 1 
ATOM   1809 C CG2 . VAL A 1 231 ? 19.793  25.795 -6.454  1.00 23.59 ? 944  VAL A CG2 1 
ATOM   1810 N N   . GLU A 1 232 ? 20.676  27.314 -10.116 1.00 23.12 ? 945  GLU A N   1 
ATOM   1811 C CA  . GLU A 1 232 ? 20.319  26.677 -11.384 1.00 25.04 ? 945  GLU A CA  1 
ATOM   1812 C C   . GLU A 1 232 ? 20.475  25.160 -11.294 1.00 23.83 ? 945  GLU A C   1 
ATOM   1813 O O   . GLU A 1 232 ? 21.278  24.650 -10.516 1.00 23.44 ? 945  GLU A O   1 
ATOM   1814 C CB  . GLU A 1 232 ? 21.209  27.186 -12.512 1.00 27.14 ? 945  GLU A CB  1 
ATOM   1815 C CG  . GLU A 1 232 ? 21.017  28.628 -12.894 1.00 33.98 ? 945  GLU A CG  1 
ATOM   1816 C CD  . GLU A 1 232 ? 22.200  29.149 -13.691 1.00 42.42 ? 945  GLU A CD  1 
ATOM   1817 O OE1 . GLU A 1 232 ? 22.453  28.618 -14.801 1.00 45.22 ? 945  GLU A OE1 1 
ATOM   1818 O OE2 . GLU A 1 232 ? 22.918  30.041 -13.178 1.00 44.62 ? 945  GLU A OE2 1 
ATOM   1819 N N   . PHE A 1 233 ? 19.707  24.448 -12.107 1.00 23.81 ? 946  PHE A N   1 
ATOM   1820 C CA  . PHE A 1 233 ? 19.892  23.016 -12.272 1.00 24.30 ? 946  PHE A CA  1 
ATOM   1821 C C   . PHE A 1 233 ? 21.209  22.753 -12.979 1.00 24.97 ? 946  PHE A C   1 
ATOM   1822 O O   . PHE A 1 233 ? 21.524  23.401 -13.977 1.00 26.18 ? 946  PHE A O   1 
ATOM   1823 C CB  . PHE A 1 233 ? 18.750  22.439 -13.100 1.00 21.99 ? 946  PHE A CB  1 
ATOM   1824 C CG  . PHE A 1 233 ? 17.421  22.488 -12.406 1.00 21.84 ? 946  PHE A CG  1 
ATOM   1825 C CD1 . PHE A 1 233 ? 17.088  21.531 -11.447 1.00 18.59 ? 946  PHE A CD1 1 
ATOM   1826 C CD2 . PHE A 1 233 ? 16.483  23.463 -12.741 1.00 21.54 ? 946  PHE A CD2 1 
ATOM   1827 C CE1 . PHE A 1 233 ? 15.843  21.539 -10.840 1.00 20.44 ? 946  PHE A CE1 1 
ATOM   1828 C CE2 . PHE A 1 233 ? 15.230  23.483 -12.137 1.00 21.65 ? 946  PHE A CE2 1 
ATOM   1829 C CZ  . PHE A 1 233 ? 14.909  22.515 -11.185 1.00 21.63 ? 946  PHE A CZ  1 
ATOM   1830 N N   . GLY A 1 234 ? 21.994  21.832 -12.434 1.00 27.49 ? 947  GLY A N   1 
ATOM   1831 C CA  . GLY A 1 234 ? 23.257  21.471 -13.059 1.00 29.20 ? 947  GLY A CA  1 
ATOM   1832 C C   . GLY A 1 234 ? 23.155  20.285 -14.000 1.00 31.03 ? 947  GLY A C   1 
ATOM   1833 O O   . GLY A 1 234 ? 22.074  19.738 -14.221 1.00 29.77 ? 947  GLY A O   1 
ATOM   1834 N N   . ALA A 1 235 ? 24.307  19.833 -14.488 1.00 33.26 ? 948  ALA A N   1 
ATOM   1835 C CA  . ALA A 1 235 ? 24.373  18.741 -15.454 1.00 33.35 ? 948  ALA A CA  1 
ATOM   1836 C C   . ALA A 1 235 ? 23.903  17.391 -14.903 1.00 33.41 ? 948  ALA A C   1 
ATOM   1837 O O   . ALA A 1 235 ? 23.602  16.475 -15.671 1.00 32.60 ? 948  ALA A O   1 
ATOM   1838 C CB  . ALA A 1 235 ? 25.789  18.623 -15.995 1.00 36.64 ? 948  ALA A CB  1 
ATOM   1839 N N   . LYS A 1 236 ? 23.814  17.271 -13.582 1.00 32.19 ? 949  LYS A N   1 
ATOM   1840 C CA  . LYS A 1 236 ? 23.254  16.063 -12.984 1.00 35.51 ? 949  LYS A CA  1 
ATOM   1841 C C   . LYS A 1 236 ? 21.721  16.029 -13.094 1.00 33.89 ? 949  LYS A C   1 
ATOM   1842 O O   . LYS A 1 236 ? 21.091  14.998 -12.849 1.00 33.38 ? 949  LYS A O   1 
ATOM   1843 C CB  . LYS A 1 236 ? 23.696  15.940 -11.515 1.00 40.58 ? 949  LYS A CB  1 
ATOM   1844 C CG  . LYS A 1 236 ? 22.671  16.416 -10.485 1.00 46.39 ? 949  LYS A CG  1 
ATOM   1845 C CD  . LYS A 1 236 ? 23.222  16.338 -9.071  1.00 50.75 ? 949  LYS A CD  1 
ATOM   1846 C CE  . LYS A 1 236 ? 22.207  16.855 -8.061  1.00 53.52 ? 949  LYS A CE  1 
ATOM   1847 N NZ  . LYS A 1 236 ? 22.710  16.714 -6.665  1.00 57.75 ? 949  LYS A NZ  1 
ATOM   1848 N N   . GLU A 1 237 ? 21.124  17.164 -13.447 1.00 31.81 ? 950  GLU A N   1 
ATOM   1849 C CA  . GLU A 1 237 ? 19.691  17.217 -13.705 1.00 30.52 ? 950  GLU A CA  1 
ATOM   1850 C C   . GLU A 1 237 ? 19.416  17.675 -15.133 1.00 28.76 ? 950  GLU A C   1 
ATOM   1851 O O   . GLU A 1 237 ? 18.876  18.763 -15.359 1.00 26.42 ? 950  GLU A O   1 
ATOM   1852 C CB  . GLU A 1 237 ? 19.009  18.136 -12.693 1.00 32.02 ? 950  GLU A CB  1 
ATOM   1853 C CG  . GLU A 1 237 ? 18.983  17.551 -11.287 1.00 36.91 ? 950  GLU A CG  1 
ATOM   1854 C CD  . GLU A 1 237 ? 17.704  17.866 -10.533 1.00 40.48 ? 950  GLU A CD  1 
ATOM   1855 O OE1 . GLU A 1 237 ? 16.601  17.644 -11.084 1.00 42.49 ? 950  GLU A OE1 1 
ATOM   1856 O OE2 . GLU A 1 237 ? 17.807  18.314 -9.372  1.00 43.62 ? 950  GLU A OE2 1 
ATOM   1857 N N   . PRO A 1 238 ? 19.785  16.838 -16.121 1.00 27.92 ? 951  PRO A N   1 
ATOM   1858 C CA  . PRO A 1 238 ? 20.026  17.279 -17.502 1.00 27.31 ? 951  PRO A CA  1 
ATOM   1859 C C   . PRO A 1 238 ? 18.800  17.920 -18.140 1.00 26.20 ? 951  PRO A C   1 
ATOM   1860 O O   . PRO A 1 238 ? 18.915  18.924 -18.845 1.00 26.87 ? 951  PRO A O   1 
ATOM   1861 C CB  . PRO A 1 238 ? 20.421  15.988 -18.236 1.00 28.11 ? 951  PRO A CB  1 
ATOM   1862 C CG  . PRO A 1 238 ? 20.796  15.016 -17.160 1.00 28.24 ? 951  PRO A CG  1 
ATOM   1863 C CD  . PRO A 1 238 ? 19.943  15.379 -15.980 1.00 28.16 ? 951  PRO A CD  1 
ATOM   1864 N N   . TYR A 1 239 ? 17.635  17.318 -17.914 1.00 25.52 ? 952  TYR A N   1 
ATOM   1865 C CA  . TYR A 1 239 ? 16.416  17.765 -18.576 1.00 28.09 ? 952  TYR A CA  1 
ATOM   1866 C C   . TYR A 1 239 ? 15.813  19.022 -17.959 1.00 27.11 ? 952  TYR A C   1 
ATOM   1867 O O   . TYR A 1 239 ? 15.083  19.756 -18.626 1.00 27.41 ? 952  TYR A O   1 
ATOM   1868 C CB  . TYR A 1 239 ? 15.378  16.638 -18.625 1.00 32.59 ? 952  TYR A CB  1 
ATOM   1869 C CG  . TYR A 1 239 ? 15.062  15.983 -17.301 1.00 38.65 ? 952  TYR A CG  1 
ATOM   1870 C CD1 . TYR A 1 239 ? 15.920  15.029 -16.753 1.00 42.50 ? 952  TYR A CD1 1 
ATOM   1871 C CD2 . TYR A 1 239 ? 13.841  16.216 -16.662 1.00 42.22 ? 952  TYR A CD2 1 
ATOM   1872 C CE1 . TYR A 1 239 ? 15.570  14.312 -15.605 1.00 46.49 ? 952  TYR A CE1 1 
ATOM   1873 C CE2 . TYR A 1 239 ? 13.477  15.504 -15.516 1.00 45.18 ? 952  TYR A CE2 1 
ATOM   1874 C CZ  . TYR A 1 239 ? 14.345  14.551 -14.996 1.00 47.12 ? 952  TYR A CZ  1 
ATOM   1875 O OH  . TYR A 1 239 ? 13.984  13.819 -13.890 1.00 48.84 ? 952  TYR A OH  1 
ATOM   1876 N N   . MET A 1 240 ? 16.221  19.327 -16.730 1.00 27.76 ? 953  MET A N   1 
ATOM   1877 C CA  . MET A 1 240 ? 15.743  20.517 -16.028 1.00 28.28 ? 953  MET A CA  1 
ATOM   1878 C C   . MET A 1 240 ? 16.472  21.790 -16.446 1.00 28.83 ? 953  MET A C   1 
ATOM   1879 O O   . MET A 1 240 ? 16.019  22.889 -16.143 1.00 26.95 ? 953  MET A O   1 
ATOM   1880 C CB  . MET A 1 240 ? 15.868  20.328 -14.512 1.00 28.27 ? 953  MET A CB  1 
ATOM   1881 C CG  . MET A 1 240 ? 14.926  19.285 -13.904 1.00 27.90 ? 953  MET A CG  1 
ATOM   1882 S SD  . MET A 1 240 ? 13.201  19.403 -14.480 1.00 27.60 ? 953  MET A SD  1 
ATOM   1883 C CE  . MET A 1 240 ? 12.737  21.058 -13.931 1.00 24.04 ? 953  MET A CE  1 
ATOM   1884 N N   . GLU A 1 241 ? 17.517  21.636 -17.257 1.00 30.94 ? 954  GLU A N   1 
ATOM   1885 C CA  . GLU A 1 241 ? 18.335  22.760 -17.727 1.00 31.32 ? 954  GLU A CA  1 
ATOM   1886 C C   . GLU A 1 241 ? 17.581  23.856 -18.488 1.00 28.56 ? 954  GLU A C   1 
ATOM   1887 O O   . GLU A 1 241 ? 18.019  25.010 -18.508 1.00 29.76 ? 954  GLU A O   1 
ATOM   1888 C CB  . GLU A 1 241 ? 19.479  22.247 -18.606 1.00 35.23 ? 954  GLU A CB  1 
ATOM   1889 C CG  . GLU A 1 241 ? 20.855  22.460 -18.011 1.00 39.78 ? 954  GLU A CG  1 
ATOM   1890 C CD  . GLU A 1 241 ? 21.268  21.344 -17.074 1.00 43.78 ? 954  GLU A CD  1 
ATOM   1891 O OE1 . GLU A 1 241 ? 20.465  20.974 -16.192 1.00 43.56 ? 954  GLU A OE1 1 
ATOM   1892 O OE2 . GLU A 1 241 ? 22.409  20.846 -17.213 1.00 45.79 ? 954  GLU A OE2 1 
ATOM   1893 N N   . GLY A 1 242 ? 16.480  23.489 -19.143 1.00 24.39 ? 955  GLY A N   1 
ATOM   1894 C CA  . GLY A 1 242 ? 15.696  24.459 -19.894 1.00 20.83 ? 955  GLY A CA  1 
ATOM   1895 C C   . GLY A 1 242 ? 14.979  25.471 -19.019 1.00 19.59 ? 955  GLY A C   1 
ATOM   1896 O O   . GLY A 1 242 ? 14.483  26.481 -19.508 1.00 19.22 ? 955  GLY A O   1 
ATOM   1897 N N   . VAL A 1 243 ? 14.934  25.197 -17.718 1.00 18.47 ? 956  VAL A N   1 
ATOM   1898 C CA  . VAL A 1 243 ? 14.288  26.082 -16.747 1.00 19.69 ? 956  VAL A CA  1 
ATOM   1899 C C   . VAL A 1 243 ? 15.286  27.101 -16.169 1.00 19.17 ? 956  VAL A C   1 
ATOM   1900 O O   . VAL A 1 243 ? 14.889  28.105 -15.558 1.00 17.50 ? 956  VAL A O   1 
ATOM   1901 C CB  . VAL A 1 243 ? 13.627  25.251 -15.584 1.00 18.66 ? 956  VAL A CB  1 
ATOM   1902 C CG1 . VAL A 1 243 ? 12.908  26.164 -14.597 1.00 17.83 ? 956  VAL A CG1 1 
ATOM   1903 C CG2 . VAL A 1 243 ? 12.633  24.246 -16.161 1.00 17.66 ? 956  VAL A CG2 1 
ATOM   1904 N N   . ASN A 1 244 ? 16.568  26.901 -16.471 1.00 19.13 ? 957  ASN A N   1 
ATOM   1905 C CA  . ASN A 1 244 ? 17.635  27.740 -15.930 1.00 20.08 ? 957  ASN A CA  1 
ATOM   1906 C C   . ASN A 1 244 ? 17.553  29.223 -16.287 1.00 21.33 ? 957  ASN A C   1 
ATOM   1907 O O   . ASN A 1 244 ? 17.835  30.074 -15.442 1.00 19.69 ? 957  ASN A O   1 
ATOM   1908 C CB  . ASN A 1 244 ? 18.999  27.199 -16.343 1.00 21.51 ? 957  ASN A CB  1 
ATOM   1909 C CG  . ASN A 1 244 ? 19.363  25.942 -15.611 1.00 24.62 ? 957  ASN A CG  1 
ATOM   1910 O OD1 . ASN A 1 244 ? 20.217  25.181 -16.063 1.00 25.49 ? 957  ASN A OD1 1 
ATOM   1911 N ND2 . ASN A 1 244 ? 18.749  25.729 -14.447 1.00 21.01 ? 957  ASN A ND2 1 
ATOM   1912 N N   . PRO A 1 245 ? 17.214  29.556 -17.549 1.00 23.58 ? 958  PRO A N   1 
ATOM   1913 C CA  . PRO A 1 245 ? 16.944  30.951 -17.903 1.00 22.30 ? 958  PRO A CA  1 
ATOM   1914 C C   . PRO A 1 245 ? 15.897  31.594 -17.008 1.00 22.21 ? 958  PRO A C   1 
ATOM   1915 O O   . PRO A 1 245 ? 16.125  32.683 -16.491 1.00 23.59 ? 958  PRO A O   1 
ATOM   1916 C CB  . PRO A 1 245 ? 16.485  30.854 -19.352 1.00 22.47 ? 958  PRO A CB  1 
ATOM   1917 C CG  . PRO A 1 245 ? 17.252  29.702 -19.871 1.00 21.51 ? 958  PRO A CG  1 
ATOM   1918 C CD  . PRO A 1 245 ? 17.226  28.703 -18.753 1.00 21.29 ? 958  PRO A CD  1 
ATOM   1919 N N   . PHE A 1 246 ? 14.817  30.860 -16.734 1.00 22.56 ? 959  PHE A N   1 
ATOM   1920 C CA  . PHE A 1 246 ? 13.744  31.326 -15.844 1.00 22.91 ? 959  PHE A CA  1 
ATOM   1921 C C   . PHE A 1 246 ? 14.254  31.619 -14.439 1.00 20.11 ? 959  PHE A C   1 
ATOM   1922 O O   . PHE A 1 246 ? 13.961  32.671 -13.875 1.00 20.93 ? 959  PHE A O   1 
ATOM   1923 C CB  . PHE A 1 246 ? 12.607  30.294 -15.783 1.00 24.54 ? 959  PHE A CB  1 
ATOM   1924 C CG  . PHE A 1 246 ? 11.762  30.376 -14.524 1.00 26.41 ? 959  PHE A CG  1 
ATOM   1925 C CD1 . PHE A 1 246 ? 10.783  31.356 -14.384 1.00 29.19 ? 959  PHE A CD1 1 
ATOM   1926 C CD2 . PHE A 1 246 ? 11.962  29.479 -13.472 1.00 27.31 ? 959  PHE A CD2 1 
ATOM   1927 C CE1 . PHE A 1 246 ? 10.017  31.445 -13.208 1.00 25.96 ? 959  PHE A CE1 1 
ATOM   1928 C CE2 . PHE A 1 246 ? 11.204  29.559 -12.296 1.00 28.18 ? 959  PHE A CE2 1 
ATOM   1929 C CZ  . PHE A 1 246 ? 10.232  30.546 -12.167 1.00 28.43 ? 959  PHE A CZ  1 
ATOM   1930 N N   . ILE A 1 247 ? 14.997  30.674 -13.877 1.00 17.36 ? 960  ILE A N   1 
ATOM   1931 C CA  . ILE A 1 247 ? 15.599  30.850 -12.560 1.00 17.86 ? 960  ILE A CA  1 
ATOM   1932 C C   . ILE A 1 247 ? 16.550  32.056 -12.522 1.00 19.65 ? 960  ILE A C   1 
ATOM   1933 O O   . ILE A 1 247 ? 16.413  32.923 -11.663 1.00 20.33 ? 960  ILE A O   1 
ATOM   1934 C CB  . ILE A 1 247 ? 16.351  29.565 -12.124 1.00 18.28 ? 960  ILE A CB  1 
ATOM   1935 C CG1 . ILE A 1 247 ? 15.353  28.419 -11.945 1.00 17.30 ? 960  ILE A CG1 1 
ATOM   1936 C CG2 . ILE A 1 247 ? 17.115  29.802 -10.826 1.00 18.94 ? 960  ILE A CG2 1 
ATOM   1937 C CD1 . ILE A 1 247 ? 15.978  27.122 -11.495 1.00 16.92 ? 960  ILE A CD1 1 
ATOM   1938 N N   . LYS A 1 248 ? 17.446  32.158 -13.499 1.00 20.63 ? 961  LYS A N   1 
ATOM   1939 C CA  . LYS A 1 248 ? 18.423  33.245 -13.520 1.00 23.56 ? 961  LYS A CA  1 
ATOM   1940 C C   . LYS A 1 248 ? 17.739  34.605 -13.534 1.00 23.34 ? 961  LYS A C   1 
ATOM   1941 O O   . LYS A 1 248 ? 18.060  35.470 -12.721 1.00 25.68 ? 961  LYS A O   1 
ATOM   1942 C CB  . LYS A 1 248 ? 19.344  33.131 -14.740 1.00 26.78 ? 961  LYS A CB  1 
ATOM   1943 C CG  . LYS A 1 248 ? 20.402  32.043 -14.632 1.00 31.76 ? 961  LYS A CG  1 
ATOM   1944 C CD  . LYS A 1 248 ? 21.348  32.047 -15.833 1.00 33.57 ? 961  LYS A CD  1 
ATOM   1945 C CE  . LYS A 1 248 ? 22.638  32.792 -15.513 1.00 37.55 ? 961  LYS A CE  1 
ATOM   1946 N NZ  . LYS A 1 248 ? 23.827  31.890 -15.537 1.00 39.27 ? 961  LYS A NZ  1 
ATOM   1947 N N   . SER A 1 249 ? 16.746  34.765 -14.401 1.00 22.58 ? 962  SER A N   1 
ATOM   1948 C CA  . SER A 1 249 ? 16.087  36.058 -14.569 1.00 23.99 ? 962  SER A CA  1 
ATOM   1949 C C   . SER A 1 249 ? 15.200  36.428 -13.383 1.00 22.73 ? 962  SER A C   1 
ATOM   1950 O O   . SER A 1 249 ? 14.782  37.577 -13.246 1.00 21.92 ? 962  SER A O   1 
ATOM   1951 C CB  . SER A 1 249 ? 15.256  36.060 -15.855 1.00 28.27 ? 962  SER A CB  1 
ATOM   1952 O OG  . SER A 1 249 ? 14.327  34.987 -15.884 1.00 34.27 ? 962  SER A OG  1 
ATOM   1953 N N   . ASN A 1 250 ? 14.880  35.440 -12.552 1.00 21.62 ? 963  ASN A N   1 
ATOM   1954 C CA  . ASN A 1 250 ? 13.926  35.644 -11.470 1.00 19.95 ? 963  ASN A CA  1 
ATOM   1955 C C   . ASN A 1 250 ? 14.553  35.625 -10.088 1.00 17.97 ? 963  ASN A C   1 
ATOM   1956 O O   . ASN A 1 250 ? 13.856  35.837 -9.085  1.00 15.67 ? 963  ASN A O   1 
ATOM   1957 C CB  . ASN A 1 250 ? 12.814  34.598 -11.547 1.00 21.01 ? 963  ASN A CB  1 
ATOM   1958 C CG  . ASN A 1 250 ? 11.889  34.828 -12.717 1.00 25.86 ? 963  ASN A CG  1 
ATOM   1959 O OD1 . ASN A 1 250 ? 11.891  34.069 -13.685 1.00 25.92 ? 963  ASN A OD1 1 
ATOM   1960 N ND2 . ASN A 1 250 ? 11.149  35.928 -12.671 1.00 26.57 ? 963  ASN A ND2 1 
ATOM   1961 N N   . LYS A 1 251 ? 15.873  35.446 -10.037 1.00 15.90 ? 964  LYS A N   1 
ATOM   1962 C CA  . LYS A 1 251 ? 16.578  35.345 -8.765  1.00 17.13 ? 964  LYS A CA  1 
ATOM   1963 C C   . LYS A 1 251 ? 16.494  36.623 -7.925  1.00 15.55 ? 964  LYS A C   1 
ATOM   1964 O O   . LYS A 1 251 ? 16.381  36.564 -6.693  1.00 13.99 ? 964  LYS A O   1 
ATOM   1965 C CB  . LYS A 1 251 ? 18.047  34.979 -8.991  1.00 21.12 ? 964  LYS A CB  1 
ATOM   1966 C CG  . LYS A 1 251 ? 18.314  33.495 -9.203  1.00 21.21 ? 964  LYS A CG  1 
ATOM   1967 C CD  . LYS A 1 251 ? 19.801  33.196 -9.025  1.00 27.11 ? 964  LYS A CD  1 
ATOM   1968 C CE  . LYS A 1 251 ? 20.169  31.823 -9.578  1.00 29.65 ? 964  LYS A CE  1 
ATOM   1969 N NZ  . LYS A 1 251 ? 21.599  31.459 -9.314  1.00 34.15 ? 964  LYS A NZ  1 
ATOM   1970 N N   . HIS A 1 252 ? 16.519  37.776 -8.586  1.00 15.04 ? 965  HIS A N   1 
ATOM   1971 C CA  . HIS A 1 252 ? 16.477  39.038 -7.859  1.00 15.29 ? 965  HIS A CA  1 
ATOM   1972 C C   . HIS A 1 252 ? 15.081  39.288 -7.270  1.00 13.72 ? 965  HIS A C   1 
ATOM   1973 O O   . HIS A 1 252 ? 14.951  39.769 -6.143  1.00 11.84 ? 965  HIS A O   1 
ATOM   1974 C CB  . HIS A 1 252 ? 16.898  40.209 -8.762  1.00 15.31 ? 965  HIS A CB  1 
ATOM   1975 C CG  . HIS A 1 252 ? 17.175  41.471 -8.004  1.00 18.30 ? 965  HIS A CG  1 
ATOM   1976 N ND1 . HIS A 1 252 ? 16.423  42.618 -8.164  1.00 18.82 ? 965  HIS A ND1 1 
ATOM   1977 C CD2 . HIS A 1 252 ? 18.032  41.727 -6.982  1.00 18.55 ? 965  HIS A CD2 1 
ATOM   1978 C CE1 . HIS A 1 252 ? 16.799  43.518 -7.272  1.00 19.74 ? 965  HIS A CE1 1 
ATOM   1979 N NE2 . HIS A 1 252 ? 17.772  43.001 -6.542  1.00 19.47 ? 965  HIS A NE2 1 
ATOM   1980 N N   . ARG A 1 253 ? 14.046  38.923 -8.025  1.00 13.97 ? 966  ARG A N   1 
ATOM   1981 C CA  . ARG A 1 253 ? 12.669  38.997 -7.542  1.00 13.49 ? 966  ARG A CA  1 
ATOM   1982 C C   . ARG A 1 253 ? 12.457  38.094 -6.325  1.00 11.12 ? 966  ARG A C   1 
ATOM   1983 O O   . ARG A 1 253 ? 11.842  38.502 -5.345  1.00 11.49 ? 966  ARG A O   1 
ATOM   1984 C CB  . ARG A 1 253 ? 11.697  38.597 -8.660  1.00 14.35 ? 966  ARG A CB  1 
ATOM   1985 C CG  . ARG A 1 253 ? 11.527  39.652 -9.745  1.00 16.79 ? 966  ARG A CG  1 
ATOM   1986 C CD  . ARG A 1 253 ? 10.723  39.130 -10.920 1.00 18.80 ? 966  ARG A CD  1 
ATOM   1987 N NE  . ARG A 1 253 ? 9.323   38.907 -10.571 1.00 21.39 ? 966  ARG A NE  1 
ATOM   1988 C CZ  . ARG A 1 253 ? 8.535   38.015 -11.165 1.00 23.32 ? 966  ARG A CZ  1 
ATOM   1989 N NH1 . ARG A 1 253 ? 9.010   37.232 -12.122 1.00 23.20 ? 966  ARG A NH1 1 
ATOM   1990 N NH2 . ARG A 1 253 ? 7.264   37.907 -10.808 1.00 24.93 ? 966  ARG A NH2 1 
ATOM   1991 N N   . MET A 1 254 ? 13.068  36.914 -6.352  1.00 11.08 ? 967  MET A N   1 
ATOM   1992 C CA  . MET A 1 254 ? 12.996  35.974 -5.234  1.00 10.85 ? 967  MET A CA  1 
ATOM   1993 C C   . MET A 1 254 ? 13.659  36.555 -3.982  1.00 9.83  ? 967  MET A C   1 
ATOM   1994 O O   . MET A 1 254 ? 13.097  36.499 -2.889  1.00 9.38  ? 967  MET A O   1 
ATOM   1995 C CB  . MET A 1 254 ? 13.672  34.649 -5.614  1.00 9.81  ? 967  MET A CB  1 
ATOM   1996 C CG  . MET A 1 254 ? 13.710  33.607 -4.503  1.00 11.57 ? 967  MET A CG  1 
ATOM   1997 S SD  . MET A 1 254 ? 12.079  33.166 -3.840  1.00 15.19 ? 967  MET A SD  1 
ATOM   1998 C CE  . MET A 1 254 ? 12.550  32.111 -2.603  1.00 25.06 ? 967  MET A CE  1 
ATOM   1999 N N   . ILE A 1 255 ? 14.830  37.161 -4.166  1.00 11.49 ? 968  ILE A N   1 
ATOM   2000 C CA  . ILE A 1 255 ? 15.574  37.779 -3.077  1.00 10.77 ? 968  ILE A CA  1 
ATOM   2001 C C   . ILE A 1 255 ? 14.803  38.938 -2.463  1.00 10.20 ? 968  ILE A C   1 
ATOM   2002 O O   . ILE A 1 255 ? 14.705  39.042 -1.242  1.00 11.99 ? 968  ILE A O   1 
ATOM   2003 C CB  . ILE A 1 255 ? 16.970  38.248 -3.576  1.00 15.11 ? 968  ILE A CB  1 
ATOM   2004 C CG1 . ILE A 1 255 ? 17.904  37.031 -3.660  1.00 14.89 ? 968  ILE A CG1 1 
ATOM   2005 C CG2 . ILE A 1 255 ? 17.554  39.342 -2.649  1.00 14.60 ? 968  ILE A CG2 1 
ATOM   2006 C CD1 . ILE A 1 255 ? 19.227  37.300 -4.336  1.00 21.52 ? 968  ILE A CD1 1 
ATOM   2007 N N   . MET A 1 256 ? 14.184  39.758 -3.306  1.00 10.58 ? 969  MET A N   1 
ATOM   2008 C CA  . MET A 1 256 ? 13.396  40.888 -2.819  1.00 13.22 ? 969  MET A CA  1 
ATOM   2009 C C   . MET A 1 256 ? 12.204  40.391 -1.998  1.00 11.85 ? 969  MET A C   1 
ATOM   2010 O O   . MET A 1 256 ? 11.929  40.903 -0.920  1.00 12.30 ? 969  MET A O   1 
ATOM   2011 C CB  . MET A 1 256 ? 12.888  41.734 -3.986  1.00 15.62 ? 969  MET A CB  1 
ATOM   2012 C CG  . MET A 1 256 ? 13.975  42.448 -4.770  1.00 23.09 ? 969  MET A CG  1 
ATOM   2013 S SD  . MET A 1 256 ? 15.013  43.508 -3.748  1.00 31.34 ? 969  MET A SD  1 
ATOM   2014 C CE  . MET A 1 256 ? 13.773  44.582 -2.954  1.00 25.50 ? 969  MET A CE  1 
ATOM   2015 N N   . PHE A 1 257 ? 11.555  39.339 -2.489  1.00 9.43  ? 970  PHE A N   1 
ATOM   2016 C CA  . PHE A 1 257 ? 10.421  38.744 -1.809  1.00 10.09 ? 970  PHE A CA  1 
ATOM   2017 C C   . PHE A 1 257 ? 10.808  38.219 -0.434  1.00 9.93  ? 970  PHE A C   1 
ATOM   2018 O O   . PHE A 1 257 ? 10.134  38.505 0.564   1.00 10.34 ? 970  PHE A O   1 
ATOM   2019 C CB  . PHE A 1 257 ? 9.836   37.613 -2.666  1.00 9.93  ? 970  PHE A CB  1 
ATOM   2020 C CG  . PHE A 1 257 ? 8.785   36.785 -1.956  1.00 12.74 ? 970  PHE A CG  1 
ATOM   2021 C CD1 . PHE A 1 257 ? 7.484   37.260 -1.814  1.00 10.67 ? 970  PHE A CD1 1 
ATOM   2022 C CD2 . PHE A 1 257 ? 9.083   35.505 -1.495  1.00 13.35 ? 970  PHE A CD2 1 
ATOM   2023 C CE1 . PHE A 1 257 ? 6.491   36.475 -1.240  1.00 9.74  ? 970  PHE A CE1 1 
ATOM   2024 C CE2 . PHE A 1 257 ? 8.093   34.709 -0.912  1.00 14.00 ? 970  PHE A CE2 1 
ATOM   2025 C CZ  . PHE A 1 257 ? 6.794   35.198 -0.790  1.00 12.27 ? 970  PHE A CZ  1 
ATOM   2026 N N   . LEU A 1 258 ? 11.892  37.450 -0.383  1.00 10.06 ? 971  LEU A N   1 
ATOM   2027 C CA  . LEU A 1 258 ? 12.327  36.821 0.859   1.00 12.36 ? 971  LEU A CA  1 
ATOM   2028 C C   . LEU A 1 258 ? 12.814  37.851 1.860   1.00 12.79 ? 971  LEU A C   1 
ATOM   2029 O O   . LEU A 1 258 ? 12.535  37.750 3.055   1.00 11.48 ? 971  LEU A O   1 
ATOM   2030 C CB  . LEU A 1 258 ? 13.450  35.825 0.602   1.00 11.65 ? 971  LEU A CB  1 
ATOM   2031 C CG  . LEU A 1 258 ? 13.112  34.641 -0.294  1.00 10.86 ? 971  LEU A CG  1 
ATOM   2032 C CD1 . LEU A 1 258 ? 14.419  33.968 -0.674  1.00 9.48  ? 971  LEU A CD1 1 
ATOM   2033 C CD2 . LEU A 1 258 ? 12.139  33.676 0.409   1.00 11.67 ? 971  LEU A CD2 1 
ATOM   2034 N N   . ASP A 1 259 ? 13.515  38.860 1.362   1.00 12.90 ? 972  ASP A N   1 
ATOM   2035 C CA  . ASP A 1 259 ? 14.034  39.890 2.240   1.00 15.04 ? 972  ASP A CA  1 
ATOM   2036 C C   . ASP A 1 259 ? 12.915  40.625 2.953   1.00 14.52 ? 972  ASP A C   1 
ATOM   2037 O O   . ASP A 1 259 ? 12.926  40.740 4.178   1.00 15.81 ? 972  ASP A O   1 
ATOM   2038 C CB  . ASP A 1 259 ? 14.893  40.888 1.469   1.00 17.40 ? 972  ASP A CB  1 
ATOM   2039 C CG  . ASP A 1 259 ? 15.658  41.813 2.401   1.00 21.95 ? 972  ASP A CG  1 
ATOM   2040 O OD1 . ASP A 1 259 ? 15.021  42.725 2.966   1.00 26.57 ? 972  ASP A OD1 1 
ATOM   2041 O OD2 . ASP A 1 259 ? 16.859  41.568 2.655   1.00 21.44 ? 972  ASP A OD2 1 
ATOM   2042 N N   . GLU A 1 260 ? 11.951  41.114 2.178   1.00 14.90 ? 973  GLU A N   1 
ATOM   2043 C CA  . GLU A 1 260 ? 10.891  41.965 2.702   1.00 15.30 ? 973  GLU A CA  1 
ATOM   2044 C C   . GLU A 1 260 ? 9.798   41.196 3.441   1.00 14.88 ? 973  GLU A C   1 
ATOM   2045 O O   . GLU A 1 260 ? 9.042   41.778 4.211   1.00 13.47 ? 973  GLU A O   1 
ATOM   2046 C CB  . GLU A 1 260 ? 10.281  42.792 1.576   1.00 17.18 ? 973  GLU A CB  1 
ATOM   2047 C CG  . GLU A 1 260 ? 11.242  43.838 1.012   1.00 23.31 ? 973  GLU A CG  1 
ATOM   2048 C CD  . GLU A 1 260 ? 10.617  44.754 -0.039  1.00 29.49 ? 973  GLU A CD  1 
ATOM   2049 O OE1 . GLU A 1 260 ? 9.450   44.527 -0.440  1.00 28.46 ? 973  GLU A OE1 1 
ATOM   2050 O OE2 . GLU A 1 260 ? 11.311  45.695 -0.487  1.00 31.12 ? 973  GLU A OE2 1 
ATOM   2051 N N   . LEU A 1 261 ? 9.791   39.875 3.293   1.00 12.87 ? 974  LEU A N   1 
ATOM   2052 C CA  . LEU A 1 261 ? 8.807   39.045 3.979   1.00 15.38 ? 974  LEU A CA  1 
ATOM   2053 C C   . LEU A 1 261 ? 8.896   39.211 5.487   1.00 13.50 ? 974  LEU A C   1 
ATOM   2054 O O   . LEU A 1 261 ? 7.898   39.095 6.188   1.00 14.42 ? 974  LEU A O   1 
ATOM   2055 C CB  . LEU A 1 261 ? 9.008   37.569 3.611   1.00 16.23 ? 974  LEU A CB  1 
ATOM   2056 C CG  . LEU A 1 261 ? 7.764   36.690 3.487   1.00 18.38 ? 974  LEU A CG  1 
ATOM   2057 C CD1 . LEU A 1 261 ? 6.692   37.391 2.659   1.00 20.85 ? 974  LEU A CD1 1 
ATOM   2058 C CD2 . LEU A 1 261 ? 8.154   35.369 2.851   1.00 17.74 ? 974  LEU A CD2 1 
ATOM   2059 N N   . GLY A 1 262 ? 10.089  39.522 5.979   1.00 14.16 ? 975  GLY A N   1 
ATOM   2060 C CA  . GLY A 1 262 ? 10.288  39.624 7.414   1.00 16.80 ? 975  GLY A CA  1 
ATOM   2061 C C   . GLY A 1 262 ? 10.217  41.031 7.979   1.00 17.69 ? 975  GLY A C   1 
ATOM   2062 O O   . GLY A 1 262 ? 10.529  41.229 9.149   1.00 17.35 ? 975  GLY A O   1 
ATOM   2063 N N   . ASN A 1 263 ? 9.693   41.975 7.197   1.00 20.05 ? 976  ASN A N   1 
ATOM   2064 C CA  . ASN A 1 263 ? 9.819   43.399 7.511   1.00 20.96 ? 976  ASN A CA  1 
ATOM   2065 C C   . ASN A 1 263 ? 8.724   43.884 8.467   1.00 21.49 ? 976  ASN A C   1 
ATOM   2066 O O   . ASN A 1 263 ? 8.147   44.955 8.282   1.00 21.99 ? 976  ASN A O   1 
ATOM   2067 C CB  . ASN A 1 263 ? 9.805   44.216 6.211   1.00 24.99 ? 976  ASN A CB  1 
ATOM   2068 C CG  . ASN A 1 263 ? 10.251  45.678 6.401   1.00 32.46 ? 976  ASN A CG  1 
ATOM   2069 O OD1 . ASN A 1 263 ? 10.279  46.452 5.437   1.00 35.86 ? 976  ASN A OD1 1 
ATOM   2070 N ND2 . ASN A 1 263 ? 10.598  46.058 7.636   1.00 35.41 ? 976  ASN A ND2 1 
ATOM   2071 N N   . VAL A 1 264 ? 8.428   43.088 9.485   1.00 18.35 ? 977  VAL A N   1 
ATOM   2072 C CA  . VAL A 1 264 ? 7.529   43.516 10.542  1.00 19.45 ? 977  VAL A CA  1 
ATOM   2073 C C   . VAL A 1 264 ? 8.322   43.527 11.846  1.00 20.95 ? 977  VAL A C   1 
ATOM   2074 O O   . VAL A 1 264 ? 8.622   42.473 12.403  1.00 18.74 ? 977  VAL A O   1 
ATOM   2075 C CB  . VAL A 1 264 ? 6.300   42.569 10.671  1.00 17.81 ? 977  VAL A CB  1 
ATOM   2076 C CG1 . VAL A 1 264 ? 5.437   42.979 11.858  1.00 16.88 ? 977  VAL A CG1 1 
ATOM   2077 C CG2 . VAL A 1 264 ? 5.477   42.608 9.390   1.00 16.18 ? 977  VAL A CG2 1 
ATOM   2078 N N   . PRO A 1 265 ? 8.798   44.716 12.260  1.00 22.26 ? 978  PRO A N   1 
ATOM   2079 C CA  . PRO A 1 265 ? 9.763   44.882 13.354  1.00 21.59 ? 978  PRO A CA  1 
ATOM   2080 C C   . PRO A 1 265 ? 9.154   44.638 14.722  1.00 21.71 ? 978  PRO A C   1 
ATOM   2081 O O   . PRO A 1 265 ? 9.829   44.174 15.633  1.00 22.75 ? 978  PRO A O   1 
ATOM   2082 C CB  . PRO A 1 265 ? 10.226  46.337 13.213  1.00 22.80 ? 978  PRO A CB  1 
ATOM   2083 C CG  . PRO A 1 265 ? 9.879   46.715 11.807  1.00 25.48 ? 978  PRO A CG  1 
ATOM   2084 C CD  . PRO A 1 265 ? 8.606   45.976 11.521  1.00 24.25 ? 978  PRO A CD  1 
ATOM   2085 N N   . GLU A 1 266 ? 7.888   45.009 14.871  1.00 24.03 ? 979  GLU A N   1 
ATOM   2086 C CA  . GLU A 1 266 ? 7.208   44.943 16.159  1.00 26.10 ? 979  GLU A CA  1 
ATOM   2087 C C   . GLU A 1 266 ? 6.177   43.816 16.204  1.00 25.49 ? 979  GLU A C   1 
ATOM   2088 O O   . GLU A 1 266 ? 5.599   43.438 15.181  1.00 22.79 ? 979  GLU A O   1 
ATOM   2089 C CB  . GLU A 1 266 ? 6.512   46.277 16.457  1.00 29.32 ? 979  GLU A CB  1 
ATOM   2090 C CG  . GLU A 1 266 ? 7.388   47.315 17.132  1.00 34.91 ? 979  GLU A CG  1 
ATOM   2091 C CD  . GLU A 1 266 ? 8.542   47.773 16.265  1.00 40.62 ? 979  GLU A CD  1 
ATOM   2092 O OE1 . GLU A 1 266 ? 8.306   48.167 15.099  1.00 42.12 ? 979  GLU A OE1 1 
ATOM   2093 O OE2 . GLU A 1 266 ? 9.692   47.746 16.757  1.00 44.05 ? 979  GLU A OE2 1 
ATOM   2094 N N   . LEU A 1 267 ? 5.959   43.273 17.398  1.00 26.04 ? 980  LEU A N   1 
ATOM   2095 C CA  . LEU A 1 267 ? 4.938   42.251 17.583  1.00 27.48 ? 980  LEU A CA  1 
ATOM   2096 C C   . LEU A 1 267 ? 3.558   42.873 17.392  1.00 29.27 ? 980  LEU A C   1 
ATOM   2097 O O   . LEU A 1 267 ? 3.188   43.811 18.090  1.00 27.88 ? 980  LEU A O   1 
ATOM   2098 C CB  . LEU A 1 267 ? 5.058   41.619 18.975  1.00 27.39 ? 980  LEU A CB  1 
ATOM   2099 C CG  . LEU A 1 267 ? 4.055   40.522 19.370  1.00 27.09 ? 980  LEU A CG  1 
ATOM   2100 C CD1 . LEU A 1 267 ? 4.301   39.264 18.558  1.00 22.99 ? 980  LEU A CD1 1 
ATOM   2101 C CD2 . LEU A 1 267 ? 4.187   40.227 20.866  1.00 26.57 ? 980  LEU A CD2 1 
ATOM   2102 N N   . PRO A 1 268 ? 2.821   42.413 16.375  1.00 32.84 ? 981  PRO A N   1 
ATOM   2103 C CA  . PRO A 1 268 ? 1.425   42.819 16.169  1.00 37.37 ? 981  PRO A CA  1 
ATOM   2104 C C   . PRO A 1 268 ? 0.490   42.268 17.257  1.00 42.88 ? 981  PRO A C   1 
ATOM   2105 O O   . PRO A 1 268 ? -0.030  43.025 18.077  1.00 43.33 ? 981  PRO A O   1 
ATOM   2106 C CB  . PRO A 1 268 ? 1.091   42.255 14.782  1.00 36.63 ? 981  PRO A CB  1 
ATOM   2107 C CG  . PRO A 1 268 ? 2.430   41.869 14.174  1.00 34.28 ? 981  PRO A CG  1 
ATOM   2108 C CD  . PRO A 1 268 ? 3.270   41.474 15.334  1.00 32.06 ? 981  PRO A CD  1 
ATOM   2109 N N   . ASP A 1 269 ? 0.159   40.981 17.146  1.00 50.22 ? 982  ASP A N   1 
ATOM   2110 C CA  . ASP A 1 269 ? -0.431  40.200 18.234  1.00 56.35 ? 982  ASP A CA  1 
ATOM   2111 C C   . ASP A 1 269 ? -1.935  40.398 18.482  1.00 58.77 ? 982  ASP A C   1 
ATOM   2112 O O   . ASP A 1 269 ? -2.616  39.463 18.908  1.00 60.12 ? 982  ASP A O   1 
ATOM   2113 C CB  . ASP A 1 269 ? 0.358   40.431 19.533  1.00 58.42 ? 982  ASP A CB  1 
ATOM   2114 C CG  . ASP A 1 269 ? -0.070  39.506 20.662  1.00 61.20 ? 982  ASP A CG  1 
ATOM   2115 O OD1 . ASP A 1 269 ? -0.081  38.268 20.471  1.00 62.35 ? 982  ASP A OD1 1 
ATOM   2116 O OD2 . ASP A 1 269 ? -0.377  40.022 21.756  1.00 64.18 ? 982  ASP A OD2 1 
ATOM   2117 N N   . THR A 1 270 ? -2.458  41.580 18.170  1.00 60.52 ? 983  THR A N   1 
ATOM   2118 C CA  . THR A 1 270 ? -3.823  41.939 18.555  1.00 63.30 ? 983  THR A CA  1 
ATOM   2119 C C   . THR A 1 270 ? -4.870  40.904 18.123  1.00 64.00 ? 983  THR A C   1 
ATOM   2120 O O   . THR A 1 270 ? -4.991  40.576 16.943  1.00 65.12 ? 983  THR A O   1 
ATOM   2121 C CB  . THR A 1 270 ? -4.221  43.330 17.991  1.00 63.77 ? 983  THR A CB  1 
ATOM   2122 O OG1 . THR A 1 270 ? -3.167  44.269 18.249  1.00 64.83 ? 983  THR A OG1 1 
ATOM   2123 C CG2 . THR A 1 270 ? -5.506  43.832 18.647  1.00 62.87 ? 983  THR A CG2 1 
ATOM   2124 N N   . THR A 1 271 ? -5.512  40.297 19.117  1.00 65.07 ? 984  THR A N   1 
ATOM   2125 C CA  . THR A 1 271 ? -6.626  39.373 18.901  1.00 65.85 ? 984  THR A CA  1 
ATOM   2126 C C   . THR A 1 271 ? -7.609  39.487 20.069  1.00 66.57 ? 984  THR A C   1 
ATOM   2127 O O   . THR A 1 271 ? -8.553  38.700 20.187  1.00 66.72 ? 984  THR A O   1 
ATOM   2128 C CB  . THR A 1 271 ? -6.140  37.902 18.803  1.00 65.22 ? 984  THR A CB  1 
ATOM   2129 O OG1 . THR A 1 271 ? -4.725  37.840 19.032  1.00 64.37 ? 984  THR A OG1 1 
ATOM   2130 C CG2 . THR A 1 271 ? -6.451  37.334 17.430  1.00 65.09 ? 984  THR A CG2 1 
ATOM   2131 N N   . GLU A 1 272 ? -7.340  40.454 20.946  1.00 67.08 ? 985  GLU A N   1 
ATOM   2132 C CA  . GLU A 1 272 ? -8.168  40.767 22.112  1.00 66.65 ? 985  GLU A CA  1 
ATOM   2133 C C   . GLU A 1 272 ? -8.143  39.741 23.244  1.00 66.05 ? 985  GLU A C   1 
ATOM   2134 O O   . GLU A 1 272 ? -7.342  39.870 24.170  1.00 66.32 ? 985  GLU A O   1 
ATOM   2135 C CB  . GLU A 1 272 ? -9.614  41.065 21.696  1.00 66.24 ? 985  GLU A CB  1 
ATOM   2136 C CG  . GLU A 1 272 ? -9.966  42.546 21.755  1.00 66.14 ? 985  GLU A CG  1 
ATOM   2137 C CD  . GLU A 1 272 ? -9.555  43.193 23.070  1.00 68.00 ? 985  GLU A CD  1 
ATOM   2138 O OE1 . GLU A 1 272 ? -9.949  42.676 24.138  1.00 68.41 ? 985  GLU A OE1 1 
ATOM   2139 O OE2 . GLU A 1 272 ? -8.831  44.212 23.037  1.00 68.19 ? 985  GLU A OE2 1 
ATOM   2140 N N   . HIS A 1 273 ? -9.029  38.749 23.189  1.00 65.45 ? 986  HIS A N   1 
ATOM   2141 C CA  . HIS A 1 273 ? -9.244  37.868 24.335  1.00 64.75 ? 986  HIS A CA  1 
ATOM   2142 C C   . HIS A 1 273 ? -9.768  36.488 23.943  1.00 64.23 ? 986  HIS A C   1 
ATOM   2143 O O   . HIS A 1 273 ? -10.975 36.305 23.754  1.00 64.04 ? 986  HIS A O   1 
ATOM   2144 C CB  . HIS A 1 273 ? -10.214 38.526 25.328  1.00 64.49 ? 986  HIS A CB  1 
ATOM   2145 C CG  . HIS A 1 273 ? -10.784 37.580 26.339  1.00 63.71 ? 986  HIS A CG  1 
ATOM   2146 N ND1 . HIS A 1 273 ? -9.999  36.871 27.224  1.00 64.08 ? 986  HIS A ND1 1 
ATOM   2147 C CD2 . HIS A 1 273 ? -12.062 37.205 26.589  1.00 63.80 ? 986  HIS A CD2 1 
ATOM   2148 C CE1 . HIS A 1 273 ? -10.767 36.106 27.978  1.00 62.68 ? 986  HIS A CE1 1 
ATOM   2149 N NE2 . HIS A 1 273 ? -12.023 36.289 27.612  1.00 63.73 ? 986  HIS A NE2 1 
ATOM   2150 N N   . SER A 1 274 ? -8.887  35.494 24.001  1.00 63.07 ? 987  SER A N   1 
ATOM   2151 C CA  . SER A 1 274 ? -9.286  34.117 23.746  1.00 62.35 ? 987  SER A CA  1 
ATOM   2152 C C   . SER A 1 274 ? -9.049  33.225 24.957  1.00 61.80 ? 987  SER A C   1 
ATOM   2153 O O   . SER A 1 274 ? -7.984  32.614 25.093  1.00 61.76 ? 987  SER A O   1 
ATOM   2154 C CB  . SER A 1 274 ? -8.537  33.563 22.533  1.00 63.00 ? 987  SER A CB  1 
ATOM   2155 O OG  . SER A 1 274 ? -8.947  34.212 21.342  1.00 63.91 ? 987  SER A OG  1 
ATOM   2156 N N   . ARG A 1 275 ? -10.045 33.151 25.838  1.00 60.30 ? 988  ARG A N   1 
ATOM   2157 C CA  . ARG A 1 275 ? -9.981  32.221 26.956  1.00 59.26 ? 988  ARG A CA  1 
ATOM   2158 C C   . ARG A 1 275 ? -11.159 31.244 27.032  1.00 57.33 ? 988  ARG A C   1 
ATOM   2159 O O   . ARG A 1 275 ? -12.009 31.338 27.915  1.00 56.63 ? 988  ARG A O   1 
ATOM   2160 C CB  . ARG A 1 275 ? -9.814  32.973 28.280  1.00 60.61 ? 988  ARG A CB  1 
ATOM   2161 C CG  . ARG A 1 275 ? -8.395  33.482 28.524  1.00 61.04 ? 988  ARG A CG  1 
ATOM   2162 C CD  . ARG A 1 275 ? -8.160  33.812 29.993  1.00 62.68 ? 988  ARG A CD  1 
ATOM   2163 N NE  . ARG A 1 275 ? -6.857  34.437 30.214  1.00 63.03 ? 988  ARG A NE  1 
ATOM   2164 C CZ  . ARG A 1 275 ? -5.818  33.834 30.788  1.00 62.06 ? 988  ARG A CZ  1 
ATOM   2165 N NH1 . ARG A 1 275 ? -5.943  32.616 31.298  1.00 60.47 ? 988  ARG A NH1 1 
ATOM   2166 N NH2 . ARG A 1 275 ? -4.658  34.468 30.881  1.00 62.57 ? 988  ARG A NH2 1 
ATOM   2167 N N   . THR A 1 276 ? -11.201 30.321 26.075  1.00 54.41 ? 989  THR A N   1 
ATOM   2168 C CA  . THR A 1 276 ? -11.911 29.057 26.239  1.00 51.88 ? 989  THR A CA  1 
ATOM   2169 C C   . THR A 1 276 ? -11.143 28.224 27.267  1.00 49.81 ? 989  THR A C   1 
ATOM   2170 O O   . THR A 1 276 ? -9.989  28.523 27.568  1.00 49.43 ? 989  THR A O   1 
ATOM   2171 C CB  . THR A 1 276 ? -11.966 28.288 24.900  1.00 53.23 ? 989  THR A CB  1 
ATOM   2172 O OG1 . THR A 1 276 ? -12.491 29.150 23.882  1.00 55.47 ? 989  THR A OG1 1 
ATOM   2173 C CG2 . THR A 1 276 ? -12.854 27.048 25.009  1.00 54.57 ? 989  THR A CG2 1 
ATOM   2174 N N   . ASP A 1 277 ? -11.791 27.210 27.832  1.00 47.34 ? 990  ASP A N   1 
ATOM   2175 C CA  . ASP A 1 277 ? -11.155 26.358 28.838  1.00 46.27 ? 990  ASP A CA  1 
ATOM   2176 C C   . ASP A 1 277 ? -9.914  25.644 28.284  1.00 43.48 ? 990  ASP A C   1 
ATOM   2177 O O   . ASP A 1 277 ? -9.988  24.952 27.269  1.00 44.15 ? 990  ASP A O   1 
ATOM   2178 C CB  . ASP A 1 277 ? -12.168 25.334 29.366  1.00 47.47 ? 990  ASP A CB  1 
ATOM   2179 C CG  . ASP A 1 277 ? -11.549 24.334 30.319  1.00 47.13 ? 990  ASP A CG  1 
ATOM   2180 O OD1 . ASP A 1 277 ? -11.401 24.659 31.516  1.00 46.21 ? 990  ASP A OD1 1 
ATOM   2181 O OD2 . ASP A 1 277 ? -11.201 23.223 29.862  1.00 49.19 ? 990  ASP A OD2 1 
ATOM   2182 N N   . LEU A 1 278 ? -8.796  25.766 28.997  1.00 41.13 ? 991  LEU A N   1 
ATOM   2183 C CA  . LEU A 1 278 ? -7.511  25.266 28.516  1.00 38.61 ? 991  LEU A CA  1 
ATOM   2184 C C   . LEU A 1 278 ? -7.054  24.000 29.250  1.00 37.53 ? 991  LEU A C   1 
ATOM   2185 O O   . LEU A 1 278 ? -6.089  23.346 28.836  1.00 33.64 ? 991  LEU A O   1 
ATOM   2186 C CB  . LEU A 1 278 ? -6.443  26.362 28.652  1.00 38.83 ? 991  LEU A CB  1 
ATOM   2187 C CG  . LEU A 1 278 ? -5.020  26.068 28.151  1.00 40.62 ? 991  LEU A CG  1 
ATOM   2188 C CD1 . LEU A 1 278 ? -5.044  25.751 26.653  1.00 41.66 ? 991  LEU A CD1 1 
ATOM   2189 C CD2 . LEU A 1 278 ? -4.107  27.256 28.441  1.00 38.24 ? 991  LEU A CD2 1 
ATOM   2190 N N   . SER A 1 279 ? -7.764  23.637 30.316  1.00 36.61 ? 992  SER A N   1 
ATOM   2191 C CA  . SER A 1 279 ? -7.323  22.540 31.181  1.00 38.29 ? 992  SER A CA  1 
ATOM   2192 C C   . SER A 1 279 ? -7.203  21.198 30.453  1.00 37.33 ? 992  SER A C   1 
ATOM   2193 O O   . SER A 1 279 ? -6.394  20.350 30.833  1.00 38.14 ? 992  SER A O   1 
ATOM   2194 C CB  . SER A 1 279 ? -8.244  22.396 32.403  1.00 38.74 ? 992  SER A CB  1 
ATOM   2195 O OG  . SER A 1 279 ? -9.613  22.501 32.059  1.00 40.49 ? 992  SER A OG  1 
ATOM   2196 N N   . ARG A 1 280 ? -7.926  21.056 29.347  1.00 36.08 ? 993  ARG A N   1 
ATOM   2197 C CA  . ARG A 1 280 ? -7.840  19.857 28.524  1.00 36.10 ? 993  ARG A CA  1 
ATOM   2198 C C   . ARG A 1 280 ? -6.425  19.671 27.960  1.00 34.18 ? 993  ARG A C   1 
ATOM   2199 O O   . ARG A 1 280 ? -5.824  18.604 28.098  1.00 30.97 ? 993  ARG A O   1 
ATOM   2200 C CB  . ARG A 1 280 ? -8.851  19.946 27.384  1.00 40.71 ? 993  ARG A CB  1 
ATOM   2201 C CG  . ARG A 1 280 ? -9.220  18.612 26.773  1.00 47.47 ? 993  ARG A CG  1 
ATOM   2202 C CD  . ARG A 1 280 ? -10.527 18.073 27.348  1.00 51.90 ? 993  ARG A CD  1 
ATOM   2203 N NE  . ARG A 1 280 ? -10.314 17.061 28.380  1.00 55.91 ? 993  ARG A NE  1 
ATOM   2204 C CZ  . ARG A 1 280 ? -9.856  15.832 28.153  1.00 57.86 ? 993  ARG A CZ  1 
ATOM   2205 N NH1 . ARG A 1 280 ? -9.370  15.503 26.964  1.00 57.97 ? 993  ARG A NH1 1 
ATOM   2206 N NH2 . ARG A 1 280 ? -9.797  14.955 29.147  1.00 59.05 ? 993  ARG A NH2 1 
ATOM   2207 N N   . ASP A 1 281 ? -5.867  20.739 27.397  1.00 32.64 ? 994  ASP A N   1 
ATOM   2208 C CA  . ASP A 1 281 ? -4.517  20.680 26.847  1.00 31.20 ? 994  ASP A CA  1 
ATOM   2209 C C   . ASP A 1 281 ? -3.436  20.690 27.914  1.00 27.48 ? 994  ASP A C   1 
ATOM   2210 O O   . ASP A 1 281 ? -2.425  19.993 27.786  1.00 24.93 ? 994  ASP A O   1 
ATOM   2211 C CB  . ASP A 1 281 ? -4.291  21.814 25.856  1.00 36.06 ? 994  ASP A CB  1 
ATOM   2212 C CG  . ASP A 1 281 ? -4.543  21.377 24.429  1.00 44.38 ? 994  ASP A CG  1 
ATOM   2213 O OD1 . ASP A 1 281 ? -5.725  21.345 24.015  1.00 47.39 ? 994  ASP A OD1 1 
ATOM   2214 O OD2 . ASP A 1 281 ? -3.570  20.972 23.750  1.00 48.14 ? 994  ASP A OD2 1 
ATOM   2215 N N   . LEU A 1 282 ? -3.694  21.398 29.008  1.00 23.94 ? 995  LEU A N   1 
ATOM   2216 C CA  . LEU A 1 282 ? -2.811  21.338 30.163  1.00 22.24 ? 995  LEU A CA  1 
ATOM   2217 C C   . LEU A 1 282 ? -2.753  19.927 30.746  1.00 21.71 ? 995  LEU A C   1 
ATOM   2218 O O   . LEU A 1 282 ? -1.673  19.438 31.079  1.00 22.65 ? 995  LEU A O   1 
ATOM   2219 C CB  . LEU A 1 282 ? -3.262  22.338 31.225  1.00 22.14 ? 995  LEU A CB  1 
ATOM   2220 C CG  . LEU A 1 282 ? -3.135  23.803 30.795  1.00 20.74 ? 995  LEU A CG  1 
ATOM   2221 C CD1 . LEU A 1 282 ? -3.880  24.700 31.770  1.00 23.88 ? 995  LEU A CD1 1 
ATOM   2222 C CD2 . LEU A 1 282 ? -1.676  24.188 30.720  1.00 18.95 ? 995  LEU A CD2 1 
ATOM   2223 N N   . ALA A 1 283 ? -3.884  19.225 30.721  1.00 22.21 ? 996  ALA A N   1 
ATOM   2224 C CA  . ALA A 1 283 ? -3.939  17.840 31.186  1.00 21.48 ? 996  ALA A CA  1 
ATOM   2225 C C   . ALA A 1 283 ? -3.149  16.924 30.256  1.00 21.36 ? 996  ALA A C   1 
ATOM   2226 O O   . ALA A 1 283 ? -2.494  15.986 30.704  1.00 22.55 ? 996  ALA A O   1 
ATOM   2227 C CB  . ALA A 1 283 ? -5.390  17.370 31.282  1.00 20.44 ? 996  ALA A CB  1 
ATOM   2228 N N   . ALA A 1 284 ? -3.212  17.204 28.958  1.00 23.04 ? 997  ALA A N   1 
ATOM   2229 C CA  . ALA A 1 284 ? -2.487  16.429 27.957  1.00 21.99 ? 997  ALA A CA  1 
ATOM   2230 C C   . ALA A 1 284 ? -0.993  16.537 28.175  1.00 21.64 ? 997  ALA A C   1 
ATOM   2231 O O   . ALA A 1 284 ? -0.268  15.549 28.063  1.00 23.53 ? 997  ALA A O   1 
ATOM   2232 C CB  . ALA A 1 284 ? -2.839  16.921 26.557  1.00 23.71 ? 997  ALA A CB  1 
ATOM   2233 N N   . LEU A 1 285 ? -0.529  17.751 28.455  1.00 20.38 ? 998  LEU A N   1 
ATOM   2234 C CA  . LEU A 1 285 ? 0.889   17.982 28.665  1.00 20.73 ? 998  LEU A CA  1 
ATOM   2235 C C   . LEU A 1 285 ? 1.346   17.352 29.975  1.00 22.11 ? 998  LEU A C   1 
ATOM   2236 O O   . LEU A 1 285 ? 2.438   16.785 30.050  1.00 21.43 ? 998  LEU A O   1 
ATOM   2237 C CB  . LEU A 1 285 ? 1.191   19.481 28.671  1.00 21.14 ? 998  LEU A CB  1 
ATOM   2238 C CG  . LEU A 1 285 ? 2.638   19.846 28.345  1.00 21.19 ? 998  LEU A CG  1 
ATOM   2239 C CD1 . LEU A 1 285 ? 2.905   19.545 26.876  1.00 20.76 ? 998  LEU A CD1 1 
ATOM   2240 C CD2 . LEU A 1 285 ? 2.891   21.321 28.648  1.00 19.79 ? 998  LEU A CD2 1 
ATOM   2241 N N   . HIS A 1 286 ? 0.494   17.426 30.996  1.00 22.56 ? 999  HIS A N   1 
ATOM   2242 C CA  . HIS A 1 286 ? 0.778   16.794 32.282  1.00 23.55 ? 999  HIS A CA  1 
ATOM   2243 C C   . HIS A 1 286 ? 0.939   15.278 32.149  1.00 22.08 ? 999  HIS A C   1 
ATOM   2244 O O   . HIS A 1 286 ? 1.800   14.689 32.795  1.00 22.30 ? 999  HIS A O   1 
ATOM   2245 C CB  . HIS A 1 286 ? -0.336  17.111 33.282  1.00 27.37 ? 999  HIS A CB  1 
ATOM   2246 C CG  . HIS A 1 286 ? -0.214  16.372 34.578  1.00 33.13 ? 999  HIS A CG  1 
ATOM   2247 N ND1 . HIS A 1 286 ? 0.665   16.751 35.573  1.00 34.51 ? 999  HIS A ND1 1 
ATOM   2248 C CD2 . HIS A 1 286 ? -0.808  15.234 35.014  1.00 34.12 ? 999  HIS A CD2 1 
ATOM   2249 C CE1 . HIS A 1 286 ? 0.613   15.876 36.560  1.00 33.96 ? 999  HIS A CE1 1 
ATOM   2250 N NE2 . HIS A 1 286 ? -0.270  14.946 36.247  1.00 35.72 ? 999  HIS A NE2 1 
ATOM   2251 N N   . GLU A 1 287 ? 0.107   14.658 31.312  1.00 25.35 ? 1000 GLU A N   1 
ATOM   2252 C CA  . GLU A 1 287 ? 0.208   13.223 31.024  1.00 27.36 ? 1000 GLU A CA  1 
ATOM   2253 C C   . GLU A 1 287 ? 1.588   12.880 30.467  1.00 27.31 ? 1000 GLU A C   1 
ATOM   2254 O O   . GLU A 1 287 ? 2.122   11.799 30.727  1.00 26.39 ? 1000 GLU A O   1 
ATOM   2255 C CB  . GLU A 1 287 ? -0.844  12.795 29.994  1.00 31.56 ? 1000 GLU A CB  1 
ATOM   2256 C CG  . GLU A 1 287 ? -2.281  12.739 30.489  1.00 38.87 ? 1000 GLU A CG  1 
ATOM   2257 C CD  . GLU A 1 287 ? -3.245  12.279 29.397  1.00 44.04 ? 1000 GLU A CD  1 
ATOM   2258 O OE1 . GLU A 1 287 ? -3.501  13.056 28.449  1.00 46.64 ? 1000 GLU A OE1 1 
ATOM   2259 O OE2 . GLU A 1 287 ? -3.727  11.127 29.471  1.00 47.93 ? 1000 GLU A OE2 1 
ATOM   2260 N N   . ILE A 1 288 ? 2.129   13.780 29.648  1.00 26.83 ? 1001 ILE A N   1 
ATOM   2261 C CA  . ILE A 1 288 ? 3.438   13.584 29.042  1.00 26.13 ? 1001 ILE A CA  1 
ATOM   2262 C C   . ILE A 1 288 ? 4.534   13.640 30.094  1.00 26.09 ? 1001 ILE A C   1 
ATOM   2263 O O   . ILE A 1 288 ? 5.415   12.785 30.118  1.00 26.79 ? 1001 ILE A O   1 
ATOM   2264 C CB  . ILE A 1 288 ? 3.712   14.644 27.941  1.00 27.01 ? 1001 ILE A CB  1 
ATOM   2265 C CG1 . ILE A 1 288 ? 2.703   14.471 26.798  1.00 26.23 ? 1001 ILE A CG1 1 
ATOM   2266 C CG2 . ILE A 1 288 ? 5.159   14.525 27.434  1.00 27.12 ? 1001 ILE A CG2 1 
ATOM   2267 C CD1 . ILE A 1 288 ? 3.078   15.184 25.514  1.00 25.02 ? 1001 ILE A CD1 1 
ATOM   2268 N N   . CYS A 1 289 ? 4.464   14.631 30.978  1.00 26.48 ? 1002 CYS A N   1 
ATOM   2269 C CA  . CYS A 1 289 ? 5.398   14.729 32.097  1.00 26.80 ? 1002 CYS A CA  1 
ATOM   2270 C C   . CYS A 1 289 ? 5.325   13.492 32.988  1.00 27.51 ? 1002 CYS A C   1 
ATOM   2271 O O   . CYS A 1 289 ? 6.348   13.012 33.464  1.00 29.25 ? 1002 CYS A O   1 
ATOM   2272 C CB  . CYS A 1 289 ? 5.110   15.976 32.938  1.00 25.76 ? 1002 CYS A CB  1 
ATOM   2273 S SG  . CYS A 1 289 ? 5.089   17.545 32.032  1.00 23.79 ? 1002 CYS A SG  1 
ATOM   2274 N N   . VAL A 1 290 ? 4.118   12.972 33.202  1.00 29.10 ? 1003 VAL A N   1 
ATOM   2275 C CA  . VAL A 1 290 ? 3.938   11.771 34.014  1.00 29.63 ? 1003 VAL A CA  1 
ATOM   2276 C C   . VAL A 1 290 ? 4.497   10.556 33.291  1.00 29.75 ? 1003 VAL A C   1 
ATOM   2277 O O   . VAL A 1 290 ? 5.201   9.741  33.890  1.00 31.14 ? 1003 VAL A O   1 
ATOM   2278 C CB  . VAL A 1 290 ? 2.447   11.507 34.349  1.00 30.47 ? 1003 VAL A CB  1 
ATOM   2279 C CG1 . VAL A 1 290 ? 2.312   10.232 35.183  1.00 30.77 ? 1003 VAL A CG1 1 
ATOM   2280 C CG2 . VAL A 1 290 ? 1.866   12.672 35.120  1.00 29.23 ? 1003 VAL A CG2 1 
ATOM   2281 N N   . ALA A 1 291 ? 4.232   10.465 31.991  1.00 29.98 ? 1004 ALA A N   1 
ATOM   2282 C CA  . ALA A 1 291 ? 4.694   9.331  31.191  1.00 30.09 ? 1004 ALA A CA  1 
ATOM   2283 C C   . ALA A 1 291 ? 6.217   9.272  31.151  1.00 30.47 ? 1004 ALA A C   1 
ATOM   2284 O O   . ALA A 1 291 ? 6.801   8.191  31.017  1.00 30.52 ? 1004 ALA A O   1 
ATOM   2285 C CB  . ALA A 1 291 ? 4.136   9.424  29.774  1.00 30.71 ? 1004 ALA A CB  1 
ATOM   2286 N N   . HIS A 1 292 ? 6.845   10.437 31.309  1.00 28.79 ? 1005 HIS A N   1 
ATOM   2287 C CA  . HIS A 1 292 ? 8.296   10.569 31.237  1.00 30.55 ? 1005 HIS A CA  1 
ATOM   2288 C C   . HIS A 1 292 ? 8.896   11.069 32.552  1.00 30.61 ? 1005 HIS A C   1 
ATOM   2289 O O   . HIS A 1 292 ? 10.001  11.607 32.570  1.00 31.60 ? 1005 HIS A O   1 
ATOM   2290 C CB  . HIS A 1 292 ? 8.680   11.533 30.108  1.00 30.02 ? 1005 HIS A CB  1 
ATOM   2291 C CG  . HIS A 1 292 ? 8.283   11.059 28.744  1.00 29.41 ? 1005 HIS A CG  1 
ATOM   2292 N ND1 . HIS A 1 292 ? 7.099   11.429 28.143  1.00 30.17 ? 1005 HIS A ND1 1 
ATOM   2293 C CD2 . HIS A 1 292 ? 8.933   10.279 27.849  1.00 27.79 ? 1005 HIS A CD2 1 
ATOM   2294 C CE1 . HIS A 1 292 ? 7.038   10.901 26.933  1.00 28.15 ? 1005 HIS A CE1 1 
ATOM   2295 N NE2 . HIS A 1 292 ? 8.136   10.201 26.731  1.00 28.82 ? 1005 HIS A NE2 1 
ATOM   2296 N N   . SER A 1 293 ? 8.162   10.895 33.645  1.00 31.28 ? 1006 SER A N   1 
ATOM   2297 C CA  . SER A 1 293 ? 8.637   11.252 34.979  1.00 32.19 ? 1006 SER A CA  1 
ATOM   2298 C C   . SER A 1 293 ? 10.053  10.746 35.229  1.00 32.89 ? 1006 SER A C   1 
ATOM   2299 O O   . SER A 1 293 ? 10.873  11.441 35.832  1.00 32.75 ? 1006 SER A O   1 
ATOM   2300 C CB  . SER A 1 293 ? 7.705   10.649 36.022  1.00 33.77 ? 1006 SER A CB  1 
ATOM   2301 O OG  . SER A 1 293 ? 7.553   9.260  35.786  1.00 38.58 ? 1006 SER A OG  1 
ATOM   2302 N N   . ASP A 1 294 ? 10.310  9.519  34.779  1.00 34.71 ? 1007 ASP A N   1 
ATOM   2303 C CA  . ASP A 1 294 ? 11.596  8.835  34.948  1.00 35.32 ? 1007 ASP A CA  1 
ATOM   2304 C C   . ASP A 1 294 ? 12.751  9.570  34.281  1.00 33.32 ? 1007 ASP A C   1 
ATOM   2305 O O   . ASP A 1 294 ? 13.817  9.751  34.873  1.00 31.06 ? 1007 ASP A O   1 
ATOM   2306 C CB  . ASP A 1 294 ? 11.504  7.419  34.374  1.00 40.79 ? 1007 ASP A CB  1 
ATOM   2307 C CG  . ASP A 1 294 ? 10.583  7.337  33.157  1.00 48.17 ? 1007 ASP A CG  1 
ATOM   2308 O OD1 . ASP A 1 294 ? 9.350   7.194  33.354  1.00 48.96 ? 1007 ASP A OD1 1 
ATOM   2309 O OD2 . ASP A 1 294 ? 11.086  7.473  32.014  1.00 50.15 ? 1007 ASP A OD2 1 
ATOM   2310 N N   . GLU A 1 295 ? 12.529  9.969  33.033  1.00 32.31 ? 1008 GLU A N   1 
ATOM   2311 C CA  . GLU A 1 295 ? 13.506  10.721 32.257  1.00 32.43 ? 1008 GLU A CA  1 
ATOM   2312 C C   . GLU A 1 295 ? 13.718  12.134 32.804  1.00 30.54 ? 1008 GLU A C   1 
ATOM   2313 O O   . GLU A 1 295 ? 14.854  12.593 32.933  1.00 31.15 ? 1008 GLU A O   1 
ATOM   2314 C CB  . GLU A 1 295 ? 13.052  10.809 30.800  1.00 35.53 ? 1008 GLU A CB  1 
ATOM   2315 C CG  . GLU A 1 295 ? 13.173  9.515  30.006  1.00 39.67 ? 1008 GLU A CG  1 
ATOM   2316 C CD  . GLU A 1 295 ? 13.524  9.770  28.551  1.00 42.47 ? 1008 GLU A CD  1 
ATOM   2317 O OE1 . GLU A 1 295 ? 14.669  10.197 28.285  1.00 42.66 ? 1008 GLU A OE1 1 
ATOM   2318 O OE2 . GLU A 1 295 ? 12.637  9.612  27.684  1.00 45.35 ? 1008 GLU A OE2 1 
ATOM   2319 N N   . LEU A 1 296 ? 12.622  12.843 33.057  1.00 27.84 ? 1009 LEU A N   1 
ATOM   2320 C CA  . LEU A 1 296 ? 12.686  14.228 33.519  1.00 27.87 ? 1009 LEU A CA  1 
ATOM   2321 C C   . LEU A 1 296 ? 13.372  14.351 34.867  1.00 27.94 ? 1009 LEU A C   1 
ATOM   2322 O O   . LEU A 1 296 ? 14.009  15.363 35.157  1.00 28.41 ? 1009 LEU A O   1 
ATOM   2323 C CB  . LEU A 1 296 ? 11.284  14.817 33.612  1.00 25.78 ? 1009 LEU A CB  1 
ATOM   2324 C CG  . LEU A 1 296 ? 10.612  15.086 32.268  1.00 28.24 ? 1009 LEU A CG  1 
ATOM   2325 C CD1 . LEU A 1 296 ? 9.122   15.319 32.473  1.00 28.45 ? 1009 LEU A CD1 1 
ATOM   2326 C CD2 . LEU A 1 296 ? 11.271  16.289 31.611  1.00 25.97 ? 1009 LEU A CD2 1 
ATOM   2327 N N   . ARG A 1 297 ? 13.213  13.326 35.701  1.00 31.27 ? 1010 ARG A N   1 
ATOM   2328 C CA  . ARG A 1 297 ? 13.874  13.275 37.000  1.00 33.00 ? 1010 ARG A CA  1 
ATOM   2329 C C   . ARG A 1 297 ? 15.376  13.116 36.803  1.00 32.36 ? 1010 ARG A C   1 
ATOM   2330 O O   . ARG A 1 297 ? 16.172  13.768 37.483  1.00 32.87 ? 1010 ARG A O   1 
ATOM   2331 C CB  . ARG A 1 297 ? 13.315  12.118 37.830  1.00 35.32 ? 1010 ARG A CB  1 
ATOM   2332 C CG  . ARG A 1 297 ? 13.722  12.134 39.298  1.00 38.53 ? 1010 ARG A CG  1 
ATOM   2333 C CD  . ARG A 1 297 ? 12.672  11.469 40.187  1.00 38.96 ? 1010 ARG A CD  1 
ATOM   2334 N NE  . ARG A 1 297 ? 12.282  10.152 39.692  1.00 42.19 ? 1010 ARG A NE  1 
ATOM   2335 C CZ  . ARG A 1 297 ? 11.111  9.884  39.121  1.00 44.31 ? 1010 ARG A CZ  1 
ATOM   2336 N NH1 . ARG A 1 297 ? 10.176  10.823 39.037  1.00 45.85 ? 1010 ARG A NH1 1 
ATOM   2337 N NH2 . ARG A 1 297 ? 10.867  8.669  38.649  1.00 45.90 ? 1010 ARG A NH2 1 
ATOM   2338 N N   . THR A 1 298 ? 15.752  12.351 35.783  1.00 32.48 ? 1011 THR A N   1 
ATOM   2339 C CA  . THR A 1 298 ? 17.152  12.249 35.385  1.00 33.49 ? 1011 THR A CA  1 
ATOM   2340 C C   . THR A 1 298 ? 17.691  13.603 34.902  1.00 32.22 ? 1011 THR A C   1 
ATOM   2341 O O   . THR A 1 298 ? 18.718  14.069 35.392  1.00 32.22 ? 1011 THR A O   1 
ATOM   2342 C CB  . THR A 1 298 ? 17.340  11.168 34.288  1.00 35.02 ? 1011 THR A CB  1 
ATOM   2343 O OG1 . THR A 1 298 ? 17.034  9.880  34.838  1.00 37.25 ? 1011 THR A OG1 1 
ATOM   2344 C CG2 . THR A 1 298 ? 18.771  11.155 33.772  1.00 34.42 ? 1011 THR A CG2 1 
ATOM   2345 N N   . LEU A 1 299 ? 16.933  14.286 34.047  1.00 31.28 ? 1012 LEU A N   1 
ATOM   2346 C CA  . LEU A 1 299 ? 17.324  15.609 33.559  1.00 31.73 ? 1012 LEU A CA  1 
ATOM   2347 C C   . LEU A 1 299 ? 17.389  16.659 34.670  1.00 33.06 ? 1012 LEU A C   1 
ATOM   2348 O O   . LEU A 1 299 ? 18.198  17.588 34.612  1.00 31.90 ? 1012 LEU A O   1 
ATOM   2349 C CB  . LEU A 1 299 ? 16.360  16.084 32.468  1.00 31.25 ? 1012 LEU A CB  1 
ATOM   2350 C CG  . LEU A 1 299 ? 16.395  15.378 31.105  1.00 31.66 ? 1012 LEU A CG  1 
ATOM   2351 C CD1 . LEU A 1 299 ? 15.341  15.993 30.197  1.00 31.25 ? 1012 LEU A CD1 1 
ATOM   2352 C CD2 . LEU A 1 299 ? 17.772  15.505 30.469  1.00 30.36 ? 1012 LEU A CD2 1 
ATOM   2353 N N   . SER A 1 300 ? 16.534  16.512 35.679  1.00 35.91 ? 1013 SER A N   1 
ATOM   2354 C CA  . SER A 1 300 ? 16.473  17.466 36.782  1.00 37.01 ? 1013 SER A CA  1 
ATOM   2355 C C   . SER A 1 300 ? 17.694  17.378 37.695  1.00 39.21 ? 1013 SER A C   1 
ATOM   2356 O O   . SER A 1 300 ? 17.998  18.326 38.424  1.00 40.45 ? 1013 SER A O   1 
ATOM   2357 C CB  . SER A 1 300 ? 15.209  17.235 37.603  1.00 37.02 ? 1013 SER A CB  1 
ATOM   2358 O OG  . SER A 1 300 ? 15.333  16.053 38.368  1.00 37.47 ? 1013 SER A OG  1 
ATOM   2359 N N   . ASN A 1 301 ? 18.415  16.259 37.626  1.00 38.55 ? 1014 ASN A N   1 
ATOM   2360 C CA  . ASN A 1 301 ? 19.585  16.058 38.476  1.00 38.61 ? 1014 ASN A CA  1 
ATOM   2361 C C   . ASN A 1 301 ? 20.849  16.723 37.936  1.00 39.48 ? 1014 ASN A C   1 
ATOM   2362 O O   . ASN A 1 301 ? 21.909  16.644 38.552  1.00 39.27 ? 1014 ASN A O   1 
ATOM   2363 C CB  . ASN A 1 301 ? 19.824  14.562 38.695  1.00 37.75 ? 1014 ASN A CB  1 
ATOM   2364 C CG  . ASN A 1 301 ? 18.667  13.887 39.421  1.00 39.51 ? 1014 ASN A CG  1 
ATOM   2365 O OD1 . ASN A 1 301 ? 18.411  12.700 39.224  1.00 42.07 ? 1014 ASN A OD1 1 
ATOM   2366 N ND2 . ASN A 1 301 ? 17.953  14.646 40.250  1.00 39.18 ? 1014 ASN A ND2 1 
ATOM   2367 N N   . GLU A 1 302 ? 20.707  17.466 36.843  1.00 41.19 ? 1015 GLU A N   1 
ATOM   2368 C CA  . GLU A 1 302 ? 21.825  18.199 36.261  1.00 41.58 ? 1015 GLU A CA  1 
ATOM   2369 C C   . GLU A 1 302 ? 21.819  19.627 36.778  1.00 41.15 ? 1015 GLU A C   1 
ATOM   2370 O O   . GLU A 1 302 ? 20.798  20.304 36.710  1.00 42.83 ? 1015 GLU A O   1 
ATOM   2371 C CB  . GLU A 1 302 ? 21.712  18.208 34.737  1.00 43.27 ? 1015 GLU A CB  1 
ATOM   2372 C CG  . GLU A 1 302 ? 23.022  17.963 34.015  1.00 47.34 ? 1015 GLU A CG  1 
ATOM   2373 C CD  . GLU A 1 302 ? 24.037  19.082 34.216  1.00 49.45 ? 1015 GLU A CD  1 
ATOM   2374 O OE1 . GLU A 1 302 ? 23.807  20.195 33.695  1.00 50.25 ? 1015 GLU A OE1 1 
ATOM   2375 O OE2 . GLU A 1 302 ? 25.088  18.832 34.852  1.00 49.20 ? 1015 GLU A OE2 1 
ATOM   2376 N N   . ARG A 1 303 ? 22.957  20.080 37.300  1.00 40.81 ? 1016 ARG A N   1 
ATOM   2377 C CA  . ARG A 1 303 ? 23.096  21.462 37.754  1.00 39.70 ? 1016 ARG A CA  1 
ATOM   2378 C C   . ARG A 1 303 ? 22.984  22.409 36.571  1.00 37.94 ? 1016 ARG A C   1 
ATOM   2379 O O   . ARG A 1 303 ? 23.163  22.010 35.421  1.00 38.20 ? 1016 ARG A O   1 
ATOM   2380 C CB  . ARG A 1 303 ? 24.438  21.675 38.471  1.00 41.47 ? 1016 ARG A CB  1 
ATOM   2381 C CG  . ARG A 1 303 ? 25.674  21.545 37.586  1.00 42.25 ? 1016 ARG A CG  1 
ATOM   2382 C CD  . ARG A 1 303 ? 26.285  22.900 37.246  1.00 43.95 ? 1016 ARG A CD  1 
ATOM   2383 N NE  . ARG A 1 303 ? 26.500  23.034 35.805  1.00 48.91 ? 1016 ARG A NE  1 
ATOM   2384 C CZ  . ARG A 1 303 ? 26.118  24.084 35.080  1.00 50.36 ? 1016 ARG A CZ  1 
ATOM   2385 N NH1 . ARG A 1 303 ? 25.664  25.181 35.674  1.00 53.08 ? 1016 ARG A NH1 1 
ATOM   2386 N NH2 . ARG A 1 303 ? 26.235  24.056 33.759  1.00 51.33 ? 1016 ARG A NH2 1 
ATOM   2387 N N   . GLY A 1 304 ? 22.683  23.667 36.858  1.00 37.41 ? 1017 GLY A N   1 
ATOM   2388 C CA  . GLY A 1 304 ? 22.467  24.625 35.796  1.00 36.48 ? 1017 GLY A CA  1 
ATOM   2389 C C   . GLY A 1 304 ? 21.187  25.406 35.985  1.00 35.46 ? 1017 GLY A C   1 
ATOM   2390 O O   . GLY A 1 304 ? 20.415  25.157 36.916  1.00 34.55 ? 1017 GLY A O   1 
ATOM   2391 N N   . ALA A 1 305 ? 20.941  26.333 35.064  1.00 35.01 ? 1018 ALA A N   1 
ATOM   2392 C CA  . ALA A 1 305 ? 19.823  27.255 35.183  1.00 33.35 ? 1018 ALA A CA  1 
ATOM   2393 C C   . ALA A 1 305 ? 18.476  26.544 35.056  1.00 32.55 ? 1018 ALA A C   1 
ATOM   2394 O O   . ALA A 1 305 ? 17.474  27.007 35.605  1.00 34.25 ? 1018 ALA A O   1 
ATOM   2395 C CB  . ALA A 1 305 ? 19.948  28.354 34.140  1.00 30.78 ? 1018 ALA A CB  1 
ATOM   2396 N N   . GLN A 1 306 ? 18.456  25.407 34.366  1.00 30.67 ? 1019 GLN A N   1 
ATOM   2397 C CA  . GLN A 1 306 ? 17.213  24.655 34.205  1.00 30.32 ? 1019 GLN A CA  1 
ATOM   2398 C C   . GLN A 1 306 ? 16.800  23.891 35.464  1.00 31.33 ? 1019 GLN A C   1 
ATOM   2399 O O   . GLN A 1 306 ? 15.632  23.523 35.618  1.00 28.77 ? 1019 GLN A O   1 
ATOM   2400 C CB  . GLN A 1 306 ? 17.310  23.684 33.017  1.00 28.95 ? 1019 GLN A CB  1 
ATOM   2401 C CG  . GLN A 1 306 ? 18.073  22.395 33.283  1.00 27.50 ? 1019 GLN A CG  1 
ATOM   2402 C CD  . GLN A 1 306 ? 19.566  22.615 33.461  1.00 30.97 ? 1019 GLN A CD  1 
ATOM   2403 O OE1 . GLN A 1 306 ? 20.157  23.498 32.832  1.00 32.01 ? 1019 GLN A OE1 1 
ATOM   2404 N NE2 . GLN A 1 306 ? 20.179  21.832 34.342  1.00 29.03 ? 1019 GLN A NE2 1 
ATOM   2405 N N   . GLN A 1 307 ? 17.753  23.675 36.368  1.00 31.63 ? 1020 GLN A N   1 
ATOM   2406 C CA  . GLN A 1 307 ? 17.543  22.740 37.463  1.00 32.23 ? 1020 GLN A CA  1 
ATOM   2407 C C   . GLN A 1 307 ? 16.426  23.177 38.398  1.00 31.94 ? 1020 GLN A C   1 
ATOM   2408 O O   . GLN A 1 307 ? 15.623  22.353 38.829  1.00 30.59 ? 1020 GLN A O   1 
ATOM   2409 C CB  . GLN A 1 307 ? 18.832  22.546 38.257  1.00 33.03 ? 1020 GLN A CB  1 
ATOM   2410 C CG  . GLN A 1 307 ? 18.706  21.476 39.317  1.00 36.79 ? 1020 GLN A CG  1 
ATOM   2411 C CD  . GLN A 1 307 ? 19.972  21.280 40.110  1.00 38.84 ? 1020 GLN A CD  1 
ATOM   2412 O OE1 . GLN A 1 307 ? 20.733  22.224 40.333  1.00 39.18 ? 1020 GLN A OE1 1 
ATOM   2413 N NE2 . GLN A 1 307 ? 20.209  20.045 40.543  1.00 39.20 ? 1020 GLN A NE2 1 
ATOM   2414 N N   . HIS A 1 308 ? 16.375  24.475 38.688  1.00 32.28 ? 1021 HIS A N   1 
ATOM   2415 C CA  . HIS A 1 308 ? 15.360  25.055 39.565  1.00 34.08 ? 1021 HIS A CA  1 
ATOM   2416 C C   . HIS A 1 308 ? 13.965  24.667 39.073  1.00 32.99 ? 1021 HIS A C   1 
ATOM   2417 O O   . HIS A 1 308 ? 13.203  24.000 39.779  1.00 32.09 ? 1021 HIS A O   1 
ATOM   2418 C CB  . HIS A 1 308 ? 15.493  26.583 39.569  1.00 38.02 ? 1021 HIS A CB  1 
ATOM   2419 C CG  . HIS A 1 308 ? 15.592  27.186 40.937  1.00 43.50 ? 1021 HIS A CG  1 
ATOM   2420 N ND1 . HIS A 1 308 ? 14.696  28.127 41.397  1.00 45.26 ? 1021 HIS A ND1 1 
ATOM   2421 C CD2 . HIS A 1 308 ? 16.537  27.061 41.902  1.00 44.18 ? 1021 HIS A CD2 1 
ATOM   2422 C CE1 . HIS A 1 308 ? 15.090  28.567 42.581  1.00 43.68 ? 1021 HIS A CE1 1 
ATOM   2423 N NE2 . HIS A 1 308 ? 16.203  27.937 42.908  1.00 43.64 ? 1021 HIS A NE2 1 
ATOM   2424 N N   . VAL A 1 309 ? 13.717  24.961 37.799  1.00 31.69 ? 1022 VAL A N   1 
ATOM   2425 C CA  . VAL A 1 309 ? 12.412  24.767 37.173  1.00 27.82 ? 1022 VAL A CA  1 
ATOM   2426 C C   . VAL A 1 309 ? 12.028  23.297 37.107  1.00 25.08 ? 1022 VAL A C   1 
ATOM   2427 O O   . VAL A 1 309 ? 10.871  22.949 37.299  1.00 25.74 ? 1022 VAL A O   1 
ATOM   2428 C CB  . VAL A 1 309 ? 12.411  25.342 35.740  1.00 29.73 ? 1022 VAL A CB  1 
ATOM   2429 C CG1 . VAL A 1 309 ? 11.084  25.055 35.053  1.00 30.95 ? 1022 VAL A CG1 1 
ATOM   2430 C CG2 . VAL A 1 309 ? 12.682  26.840 35.777  1.00 30.15 ? 1022 VAL A CG2 1 
ATOM   2431 N N   . LEU A 1 310 ? 13.000  22.439 36.821  1.00 24.79 ? 1023 LEU A N   1 
ATOM   2432 C CA  . LEU A 1 310 ? 12.732  21.027 36.585  1.00 23.63 ? 1023 LEU A CA  1 
ATOM   2433 C C   . LEU A 1 310 ? 12.378  20.247 37.845  1.00 22.76 ? 1023 LEU A C   1 
ATOM   2434 O O   . LEU A 1 310 ? 11.586  19.309 37.792  1.00 22.25 ? 1023 LEU A O   1 
ATOM   2435 C CB  . LEU A 1 310 ? 13.926  20.373 35.888  1.00 24.38 ? 1023 LEU A CB  1 
ATOM   2436 C CG  . LEU A 1 310 ? 14.046  20.632 34.383  1.00 27.02 ? 1023 LEU A CG  1 
ATOM   2437 C CD1 . LEU A 1 310 ? 15.125  19.726 33.806  1.00 24.76 ? 1023 LEU A CD1 1 
ATOM   2438 C CD2 . LEU A 1 310 ? 12.698  20.391 33.692  1.00 26.18 ? 1023 LEU A CD2 1 
ATOM   2439 N N   . LYS A 1 311 ? 13.038  20.575 38.950  1.00 25.03 ? 1024 LYS A N   1 
ATOM   2440 C CA  . LYS A 1 311 ? 12.680  20.031 40.256  1.00 26.98 ? 1024 LYS A CA  1 
ATOM   2441 C C   . LYS A 1 311 ? 11.284  20.516 40.621  1.00 27.87 ? 1024 LYS A C   1 
ATOM   2442 O O   . LYS A 1 311 ? 10.439  19.730 41.046  1.00 27.98 ? 1024 LYS A O   1 
ATOM   2443 C CB  . LYS A 1 311 ? 13.689  20.489 41.318  1.00 29.25 ? 1024 LYS A CB  1 
ATOM   2444 C CG  . LYS A 1 311 ? 15.121  20.040 41.037  1.00 32.41 ? 1024 LYS A CG  1 
ATOM   2445 C CD  . LYS A 1 311 ? 16.073  20.449 42.147  1.00 36.37 ? 1024 LYS A CD  1 
ATOM   2446 C CE  . LYS A 1 311 ? 16.162  21.966 42.294  1.00 39.00 ? 1024 LYS A CE  1 
ATOM   2447 N NZ  . LYS A 1 311 ? 17.563  22.455 42.126  1.00 39.84 ? 1024 LYS A NZ  1 
ATOM   2448 N N   . LYS A 1 312 ? 11.016  21.780 40.299  1.00 27.39 ? 1025 LYS A N   1 
ATOM   2449 C CA  . LYS A 1 312 ? 9.699   22.382 40.474  1.00 28.09 ? 1025 LYS A CA  1 
ATOM   2450 C C   . LYS A 1 312 ? 8.666   21.667 39.611  1.00 28.04 ? 1025 LYS A C   1 
ATOM   2451 O O   . LYS A 1 312 ? 7.531   21.457 40.038  1.00 26.66 ? 1025 LYS A O   1 
ATOM   2452 C CB  . LYS A 1 312 ? 9.753   23.865 40.091  1.00 31.04 ? 1025 LYS A CB  1 
ATOM   2453 C CG  . LYS A 1 312 ? 8.932   24.778 40.975  1.00 35.34 ? 1025 LYS A CG  1 
ATOM   2454 C CD  . LYS A 1 312 ? 9.805   25.848 41.624  1.00 39.79 ? 1025 LYS A CD  1 
ATOM   2455 C CE  . LYS A 1 312 ? 9.393   27.256 41.199  1.00 44.13 ? 1025 LYS A CE  1 
ATOM   2456 N NZ  . LYS A 1 312 ? 9.870   27.606 39.823  1.00 46.90 ? 1025 LYS A NZ  1 
ATOM   2457 N N   . LEU A 1 313 ? 9.071   21.274 38.404  1.00 27.67 ? 1026 LEU A N   1 
ATOM   2458 C CA  . LEU A 1 313 ? 8.169   20.594 37.477  1.00 26.72 ? 1026 LEU A CA  1 
ATOM   2459 C C   . LEU A 1 313 ? 7.754   19.227 38.007  1.00 27.07 ? 1026 LEU A C   1 
ATOM   2460 O O   . LEU A 1 313 ? 6.572   18.889 37.977  1.00 28.43 ? 1026 LEU A O   1 
ATOM   2461 C CB  . LEU A 1 313 ? 8.813   20.445 36.085  1.00 23.19 ? 1026 LEU A CB  1 
ATOM   2462 C CG  . LEU A 1 313 ? 8.076   19.542 35.083  1.00 20.15 ? 1026 LEU A CG  1 
ATOM   2463 C CD1 . LEU A 1 313 ? 6.751   20.181 34.669  1.00 16.44 ? 1026 LEU A CD1 1 
ATOM   2464 C CD2 . LEU A 1 313 ? 8.957   19.290 33.867  1.00 21.20 ? 1026 LEU A CD2 1 
ATOM   2465 N N   . LEU A 1 314 ? 8.722   18.452 38.493  1.00 28.08 ? 1027 LEU A N   1 
ATOM   2466 C CA  . LEU A 1 314 ? 8.452   17.108 39.010  1.00 30.67 ? 1027 LEU A CA  1 
ATOM   2467 C C   . LEU A 1 314 ? 7.553   17.174 40.242  1.00 31.57 ? 1027 LEU A C   1 
ATOM   2468 O O   . LEU A 1 314 ? 6.616   16.384 40.384  1.00 32.55 ? 1027 LEU A O   1 
ATOM   2469 C CB  . LEU A 1 314 ? 9.759   16.400 39.370  1.00 31.93 ? 1027 LEU A CB  1 
ATOM   2470 C CG  . LEU A 1 314 ? 10.681  15.966 38.227  1.00 32.78 ? 1027 LEU A CG  1 
ATOM   2471 C CD1 . LEU A 1 314 ? 12.090  15.816 38.762  1.00 33.15 ? 1027 LEU A CD1 1 
ATOM   2472 C CD2 . LEU A 1 314 ? 10.193  14.662 37.616  1.00 34.06 ? 1027 LEU A CD2 1 
ATOM   2473 N N   . ALA A 1 315 ? 7.827   18.146 41.106  1.00 31.39 ? 1028 ALA A N   1 
ATOM   2474 C CA  . ALA A 1 315 ? 6.950   18.459 42.224  1.00 33.00 ? 1028 ALA A CA  1 
ATOM   2475 C C   . ALA A 1 315 ? 5.507   18.666 41.751  1.00 33.76 ? 1028 ALA A C   1 
ATOM   2476 O O   . ALA A 1 315 ? 4.608   17.913 42.136  1.00 34.30 ? 1028 ALA A O   1 
ATOM   2477 C CB  . ALA A 1 315 ? 7.457   19.708 42.947  1.00 31.93 ? 1028 ALA A CB  1 
ATOM   2478 N N   . ILE A 1 316 ? 5.302   19.644 40.872  1.00 33.81 ? 1029 ILE A N   1 
ATOM   2479 C CA  . ILE A 1 316 ? 3.968   19.961 40.363  1.00 33.75 ? 1029 ILE A CA  1 
ATOM   2480 C C   . ILE A 1 316 ? 3.304   18.739 39.732  1.00 32.43 ? 1029 ILE A C   1 
ATOM   2481 O O   . ILE A 1 316 ? 2.132   18.468 39.989  1.00 32.29 ? 1029 ILE A O   1 
ATOM   2482 C CB  . ILE A 1 316 ? 4.025   21.114 39.325  1.00 36.29 ? 1029 ILE A CB  1 
ATOM   2483 C CG1 . ILE A 1 316 ? 4.357   22.430 40.034  1.00 38.33 ? 1029 ILE A CG1 1 
ATOM   2484 C CG2 . ILE A 1 316 ? 2.694   21.255 38.595  1.00 33.77 ? 1029 ILE A CG2 1 
ATOM   2485 C CD1 . ILE A 1 316 ? 4.426   23.632 39.105  1.00 40.30 ? 1029 ILE A CD1 1 
ATOM   2486 N N   . THR A 1 317 ? 4.098   17.936 39.028  1.00 30.23 ? 1030 THR A N   1 
ATOM   2487 C CA  . THR A 1 317 ? 3.596   16.752 38.340  1.00 30.97 ? 1030 THR A CA  1 
ATOM   2488 C C   . THR A 1 317 ? 3.051   15.717 39.323  1.00 33.50 ? 1030 THR A C   1 
ATOM   2489 O O   . THR A 1 317 ? 2.042   15.060 39.052  1.00 31.18 ? 1030 THR A O   1 
ATOM   2490 C CB  . THR A 1 317 ? 4.704   16.112 37.478  1.00 28.36 ? 1030 THR A CB  1 
ATOM   2491 O OG1 . THR A 1 317 ? 5.022   16.990 36.393  1.00 28.92 ? 1030 THR A OG1 1 
ATOM   2492 C CG2 . THR A 1 317 ? 4.261   14.776 36.919  1.00 28.40 ? 1030 THR A CG2 1 
ATOM   2493 N N   . GLU A 1 318 ? 3.704   15.610 40.478  1.00 36.95 ? 1031 GLU A N   1 
ATOM   2494 C CA  . GLU A 1 318 ? 3.297   14.670 41.520  1.00 38.32 ? 1031 GLU A CA  1 
ATOM   2495 C C   . GLU A 1 318 ? 2.046   15.148 42.249  1.00 36.30 ? 1031 GLU A C   1 
ATOM   2496 O O   . GLU A 1 318 ? 1.129   14.369 42.480  1.00 36.80 ? 1031 GLU A O   1 
ATOM   2497 C CB  . GLU A 1 318 ? 4.439   14.466 42.521  1.00 41.07 ? 1031 GLU A CB  1 
ATOM   2498 C CG  . GLU A 1 318 ? 5.104   13.097 42.438  1.00 45.82 ? 1031 GLU A CG  1 
ATOM   2499 C CD  . GLU A 1 318 ? 4.323   12.017 43.178  1.00 49.96 ? 1031 GLU A CD  1 
ATOM   2500 O OE1 . GLU A 1 318 ? 3.178   11.720 42.769  1.00 54.52 ? 1031 GLU A OE1 1 
ATOM   2501 O OE2 . GLU A 1 318 ? 4.856   11.457 44.164  1.00 50.88 ? 1031 GLU A OE2 1 
ATOM   2502 N N   . LEU A 1 319 ? 1.987   16.443 42.538  1.00 36.47 ? 1032 LEU A N   1 
ATOM   2503 C CA  . LEU A 1 319 ? 0.831   17.037 43.202  1.00 38.32 ? 1032 LEU A CA  1 
ATOM   2504 C C   . LEU A 1 319 ? -0.450  16.941 42.364  1.00 39.53 ? 1032 LEU A C   1 
ATOM   2505 O O   . LEU A 1 319 ? -1.527  16.644 42.891  1.00 40.03 ? 1032 LEU A O   1 
ATOM   2506 C CB  . LEU A 1 319 ? 1.114   18.502 43.552  1.00 39.08 ? 1032 LEU A CB  1 
ATOM   2507 C CG  . LEU A 1 319 ? -0.085  19.346 44.000  1.00 40.55 ? 1032 LEU A CG  1 
ATOM   2508 C CD1 . LEU A 1 319 ? -0.520  18.949 45.409  1.00 38.46 ? 1032 LEU A CD1 1 
ATOM   2509 C CD2 . LEU A 1 319 ? 0.279   20.821 43.942  1.00 42.40 ? 1032 LEU A CD2 1 
ATOM   2510 N N   . LEU A 1 320 ? -0.338  17.210 41.067  1.00 37.98 ? 1033 LEU A N   1 
ATOM   2511 C CA  . LEU A 1 320 ? -1.485  17.105 40.175  1.00 37.39 ? 1033 LEU A CA  1 
ATOM   2512 C C   . LEU A 1 320 ? -1.892  15.643 40.036  1.00 37.88 ? 1033 LEU A C   1 
ATOM   2513 O O   . LEU A 1 320 ? -3.054  15.338 39.776  1.00 37.94 ? 1033 LEU A O   1 
ATOM   2514 C CB  . LEU A 1 320 ? -1.153  17.690 38.797  1.00 35.02 ? 1033 LEU A CB  1 
ATOM   2515 C CG  . LEU A 1 320 ? -0.958  19.205 38.719  1.00 33.86 ? 1033 LEU A CG  1 
ATOM   2516 C CD1 . LEU A 1 320 ? -0.395  19.584 37.365  1.00 35.15 ? 1033 LEU A CD1 1 
ATOM   2517 C CD2 . LEU A 1 320 ? -2.274  19.908 38.955  1.00 31.65 ? 1033 LEU A CD2 1 
ATOM   2518 N N   . GLN A 1 321 ? -0.931  14.739 40.207  1.00 39.06 ? 1034 GLN A N   1 
ATOM   2519 C CA  . GLN A 1 321 ? -1.238  13.314 40.228  1.00 42.63 ? 1034 GLN A CA  1 
ATOM   2520 C C   . GLN A 1 321 ? -1.857  12.880 41.559  1.00 43.54 ? 1034 GLN A C   1 
ATOM   2521 O O   . GLN A 1 321 ? -2.561  11.873 41.625  1.00 45.51 ? 1034 GLN A O   1 
ATOM   2522 C CB  . GLN A 1 321 ? 0.014   12.492 39.940  1.00 42.51 ? 1034 GLN A CB  1 
ATOM   2523 C CG  . GLN A 1 321 ? 0.180   12.138 38.480  1.00 44.21 ? 1034 GLN A CG  1 
ATOM   2524 C CD  . GLN A 1 321 ? 0.064   10.652 38.230  1.00 45.19 ? 1034 GLN A CD  1 
ATOM   2525 O OE1 . GLN A 1 321 ? -0.991  10.162 37.834  1.00 47.08 ? 1034 GLN A OE1 1 
ATOM   2526 N NE2 . GLN A 1 321 ? 1.151   9.926  38.451  1.00 45.12 ? 1034 GLN A NE2 1 
ATOM   2527 N N   . GLN A 1 322 ? -1.627  13.667 42.605  1.00 44.36 ? 1035 GLN A N   1 
ATOM   2528 C CA  . GLN A 1 322 ? -2.284  13.441 43.883  1.00 46.07 ? 1035 GLN A CA  1 
ATOM   2529 C C   . GLN A 1 322 ? -3.735  13.898 43.780  1.00 46.06 ? 1035 GLN A C   1 
ATOM   2530 O O   . GLN A 1 322 ? -4.651  13.090 43.931  1.00 46.62 ? 1035 GLN A O   1 
ATOM   2531 C CB  . GLN A 1 322 ? -1.560  14.198 45.002  1.00 46.27 ? 1035 GLN A CB  1 
ATOM   2532 C CG  . GLN A 1 322 ? -0.250  13.545 45.435  1.00 49.61 ? 1035 GLN A CG  1 
ATOM   2533 C CD  . GLN A 1 322 ? 0.799   14.551 45.892  1.00 51.27 ? 1035 GLN A CD  1 
ATOM   2534 O OE1 . GLN A 1 322 ? 0.498   15.718 46.158  1.00 51.82 ? 1035 GLN A OE1 1 
ATOM   2535 N NE2 . GLN A 1 322 ? 2.046   14.098 45.973  1.00 52.75 ? 1035 GLN A NE2 1 
ATOM   2536 N N   . LYS A 1 323 ? -3.930  15.148 43.364  1.00 45.49 ? 1036 LYS A N   1 
ATOM   2537 C CA  . LYS A 1 323 ? -5.266  15.734 43.254  1.00 44.53 ? 1036 LYS A CA  1 
ATOM   2538 C C   . LYS A 1 323 ? -6.158  14.931 42.313  1.00 43.67 ? 1036 LYS A C   1 
ATOM   2539 O O   . LYS A 1 323 ? -7.382  14.898 42.480  1.00 43.57 ? 1036 LYS A O   1 
ATOM   2540 C CB  . LYS A 1 323 ? -5.176  17.186 42.771  1.00 45.07 ? 1036 LYS A CB  1 
ATOM   2541 C CG  . LYS A 1 323 ? -4.695  18.158 43.834  1.00 47.64 ? 1036 LYS A CG  1 
ATOM   2542 C CD  . LYS A 1 323 ? -4.835  19.604 43.392  1.00 49.86 ? 1036 LYS A CD  1 
ATOM   2543 C CE  . LYS A 1 323 ? -4.883  20.532 44.602  1.00 52.30 ? 1036 LYS A CE  1 
ATOM   2544 N NZ  . LYS A 1 323 ? -4.999  21.978 44.244  1.00 53.31 ? 1036 LYS A NZ  1 
ATOM   2545 N N   . GLN A 1 324 ? -5.526  14.199 41.400  1.00 42.65 ? 1037 GLN A N   1 
ATOM   2546 C CA  . GLN A 1 324 ? -6.240  13.447 40.378  1.00 43.53 ? 1037 GLN A CA  1 
ATOM   2547 C C   . GLN A 1 324 ? -6.950  12.235 40.964  1.00 42.31 ? 1037 GLN A C   1 
ATOM   2548 O O   . GLN A 1 324 ? -8.178  12.182 40.995  1.00 42.44 ? 1037 GLN A O   1 
ATOM   2549 C CB  . GLN A 1 324 ? -5.267  12.994 39.289  1.00 45.34 ? 1037 GLN A CB  1 
ATOM   2550 C CG  . GLN A 1 324 ? -5.938  12.507 38.020  1.00 47.89 ? 1037 GLN A CG  1 
ATOM   2551 C CD  . GLN A 1 324 ? -5.706  13.433 36.837  1.00 49.83 ? 1037 GLN A CD  1 
ATOM   2552 O OE1 . GLN A 1 324 ? -6.426  13.369 35.836  1.00 50.61 ? 1037 GLN A OE1 1 
ATOM   2553 N NE2 . GLN A 1 324 ? -4.689  14.290 36.938  1.00 49.05 ? 1037 GLN A NE2 1 
ATOM   2554 N N   . ASN A 1 325 ? -6.171  11.272 41.447  1.00 42.08 ? 1038 ASN A N   1 
ATOM   2555 C CA  . ASN A 1 325 ? -6.713  9.992  41.881  1.00 41.62 ? 1038 ASN A CA  1 
ATOM   2556 C C   . ASN A 1 325 ? -7.046  9.967  43.371  1.00 39.37 ? 1038 ASN A C   1 
ATOM   2557 O O   . ASN A 1 325 ? -7.190  8.897  43.953  1.00 40.92 ? 1038 ASN A O   1 
ATOM   2558 C CB  . ASN A 1 325 ? -5.727  8.868  41.552  1.00 42.77 ? 1038 ASN A CB  1 
ATOM   2559 C CG  . ASN A 1 325 ? -6.378  7.710  40.805  1.00 47.21 ? 1038 ASN A CG  1 
ATOM   2560 O OD1 . ASN A 1 325 ? -7.603  7.656  40.648  1.00 47.60 ? 1038 ASN A OD1 1 
ATOM   2561 N ND2 . ASN A 1 325 ? -5.554  6.785  40.324  1.00 48.08 ? 1038 ASN A ND2 1 
ATOM   2562 N N   . GLN A 1 326 ? -7.181  11.145 43.975  1.00 36.78 ? 1039 GLN A N   1 
ATOM   2563 C CA  . GLN A 1 326 ? -7.529  11.278 45.392  1.00 35.18 ? 1039 GLN A CA  1 
ATOM   2564 C C   . GLN A 1 326 ? -8.905  10.687 45.698  1.00 33.80 ? 1039 GLN A C   1 
ATOM   2565 O O   . GLN A 1 326 ? -9.837  10.842 44.908  1.00 34.01 ? 1039 GLN A O   1 
ATOM   2566 C CB  . GLN A 1 326 ? -7.549  12.756 45.781  1.00 37.24 ? 1039 GLN A CB  1 
ATOM   2567 C CG  . GLN A 1 326 ? -6.550  13.154 46.840  1.00 40.88 ? 1039 GLN A CG  1 
ATOM   2568 C CD  . GLN A 1 326 ? -6.791  14.563 47.352  1.00 42.81 ? 1039 GLN A CD  1 
ATOM   2569 O OE1 . GLN A 1 326 ? -6.990  14.774 48.551  1.00 42.78 ? 1039 GLN A OE1 1 
ATOM   2570 N NE2 . GLN A 1 326 ? -6.814  15.531 46.440  1.00 44.08 ? 1039 GLN A NE2 1 
ATOM   2571 N N   . TYR A 1 327 ? -9.058  10.111 46.890  1.00 31.31 ? 1040 TYR A N   1 
ATOM   2572 C CA  . TYR A 1 327 ? -10.384 9.754  47.395  1.00 28.01 ? 1040 TYR A CA  1 
ATOM   2573 C C   . TYR A 1 327 ? -11.259 11.002 47.486  1.00 27.50 ? 1040 TYR A C   1 
ATOM   2574 O O   . TYR A 1 327 ? -10.835 12.034 48.005  1.00 25.33 ? 1040 TYR A O   1 
ATOM   2575 C CB  . TYR A 1 327 ? -10.293 9.094  48.780  1.00 24.45 ? 1040 TYR A CB  1 
ATOM   2576 C CG  . TYR A 1 327 ? -11.629 8.975  49.510  1.00 21.09 ? 1040 TYR A CG  1 
ATOM   2577 C CD1 . TYR A 1 327 ? -12.606 8.073  49.078  1.00 20.30 ? 1040 TYR A CD1 1 
ATOM   2578 C CD2 . TYR A 1 327 ? -11.922 9.778  50.615  1.00 19.12 ? 1040 TYR A CD2 1 
ATOM   2579 C CE1 . TYR A 1 327 ? -13.839 7.977  49.721  1.00 20.38 ? 1040 TYR A CE1 1 
ATOM   2580 C CE2 . TYR A 1 327 ? -13.150 9.684  51.270  1.00 19.74 ? 1040 TYR A CE2 1 
ATOM   2581 C CZ  . TYR A 1 327 ? -14.105 8.785  50.816  1.00 21.08 ? 1040 TYR A CZ  1 
ATOM   2582 O OH  . TYR A 1 327 ? -15.331 8.697  51.444  1.00 22.51 ? 1040 TYR A OH  1 
ATOM   2583 N N   . THR A 1 328 ? -12.449 10.912 46.907  1.00 27.94 ? 1041 THR A N   1 
ATOM   2584 C CA  . THR A 1 328 ? -13.480 11.917 47.093  1.00 31.61 ? 1041 THR A CA  1 
ATOM   2585 C C   . THR A 1 328 ? -14.820 11.197 47.287  1.00 33.01 ? 1041 THR A C   1 
ATOM   2586 O O   . THR A 1 328 ? -15.075 10.201 46.568  1.00 33.42 ? 1041 THR A O   1 
ATOM   2587 C CB  . THR A 1 328 ? -13.560 12.885 45.874  1.00 32.99 ? 1041 THR A CB  1 
ATOM   2588 O OG1 . THR A 1 328 ? -13.570 12.130 44.655  1.00 36.46 ? 1041 THR A OG1 1 
ATOM   2589 C CG2 . THR A 1 328 ? -12.360 13.828 45.852  1.00 31.56 ? 1041 THR A CG2 1 
HETATM 2590 O O   . HOH B 2 .   ? 11.866  33.189 14.724  1.00 14.20 ? 1    HOH A O   1 
HETATM 2591 O O   . HOH B 2 .   ? -1.008  37.108 -5.355  1.00 20.51 ? 2    HOH A O   1 
HETATM 2592 O O   . HOH B 2 .   ? 14.815  27.673 7.096   1.00 21.76 ? 3    HOH A O   1 
HETATM 2593 O O   . HOH B 2 .   ? 14.535  39.127 -10.935 1.00 22.17 ? 4    HOH A O   1 
HETATM 2594 O O   . HOH B 2 .   ? 9.530   40.129 -5.516  1.00 18.46 ? 5    HOH A O   1 
HETATM 2595 O O   . HOH B 2 .   ? 17.834  44.285 3.232   1.00 19.95 ? 6    HOH A O   1 
HETATM 2596 O O   . HOH B 2 .   ? 3.281   17.310 -17.373 1.00 18.18 ? 7    HOH A O   1 
HETATM 2597 O O   . HOH B 2 .   ? 13.128  26.717 0.373   1.00 23.80 ? 8    HOH A O   1 
HETATM 2598 O O   . HOH B 2 .   ? 19.757  44.040 7.959   1.00 20.37 ? 9    HOH A O   1 
HETATM 2599 O O   . HOH B 2 .   ? 16.783  31.080 22.155  1.00 24.42 ? 10   HOH A O   1 
HETATM 2600 O O   . HOH B 2 .   ? -6.365  16.264 -12.662 1.00 18.65 ? 11   HOH A O   1 
HETATM 2601 O O   . HOH B 2 .   ? 15.203  22.007 12.119  1.00 17.67 ? 12   HOH A O   1 
HETATM 2602 O O   . HOH B 2 .   ? 11.642  43.168 10.769  1.00 25.52 ? 13   HOH A O   1 
HETATM 2603 O O   . HOH B 2 .   ? 1.680   41.454 -1.637  1.00 19.99 ? 14   HOH A O   1 
HETATM 2604 O O   . HOH B 2 .   ? 11.976  28.305 32.419  1.00 25.99 ? 15   HOH A O   1 
HETATM 2605 O O   . HOH B 2 .   ? -0.969  37.924 12.585  1.00 24.29 ? 16   HOH A O   1 
HETATM 2606 O O   . HOH B 2 .   ? 0.020   35.882 -12.523 1.00 24.48 ? 17   HOH A O   1 
HETATM 2607 O O   . HOH B 2 .   ? 28.901  40.328 1.408   1.00 17.51 ? 18   HOH A O   1 
HETATM 2608 O O   . HOH B 2 .   ? 9.708   27.079 16.383  1.00 17.58 ? 19   HOH A O   1 
HETATM 2609 O O   . HOH B 2 .   ? 3.425   15.155 -5.769  1.00 25.44 ? 20   HOH A O   1 
HETATM 2610 O O   . HOH B 2 .   ? 20.117  23.819 12.179  1.00 26.10 ? 21   HOH A O   1 
HETATM 2611 O O   . HOH B 2 .   ? 14.332  18.846 18.458  1.00 23.14 ? 22   HOH A O   1 
HETATM 2612 O O   . HOH B 2 .   ? -3.527  35.849 -5.751  1.00 28.95 ? 23   HOH A O   1 
HETATM 2613 O O   . HOH B 2 .   ? 8.856   25.938 29.444  1.00 18.94 ? 24   HOH A O   1 
HETATM 2614 O O   . HOH B 2 .   ? 10.913  40.914 13.466  1.00 21.95 ? 25   HOH A O   1 
HETATM 2615 O O   . HOH B 2 .   ? 28.513  31.178 7.226   1.00 28.15 ? 26   HOH A O   1 
HETATM 2616 O O   . HOH B 2 .   ? -1.852  19.472 15.129  1.00 38.32 ? 27   HOH A O   1 
HETATM 2617 O O   . HOH B 2 .   ? 30.220  40.124 3.782   1.00 21.62 ? 28   HOH A O   1 
HETATM 2618 O O   . HOH B 2 .   ? -0.082  20.508 -17.220 1.00 21.31 ? 29   HOH A O   1 
HETATM 2619 O O   . HOH B 2 .   ? 3.895   17.446 -0.084  1.00 20.08 ? 30   HOH A O   1 
HETATM 2620 O O   . HOH B 2 .   ? -0.628  15.367 -5.433  1.00 27.05 ? 31   HOH A O   1 
HETATM 2621 O O   . HOH B 2 .   ? 7.980   40.197 0.419   1.00 14.32 ? 32   HOH A O   1 
HETATM 2622 O O   . HOH B 2 .   ? -2.503  19.184 -16.351 1.00 20.47 ? 33   HOH A O   1 
HETATM 2623 O O   . HOH B 2 .   ? 23.143  28.989 -9.646  1.00 29.92 ? 34   HOH A O   1 
HETATM 2624 O O   . HOH B 2 .   ? -5.296  27.543 21.493  1.00 22.25 ? 35   HOH A O   1 
HETATM 2625 O O   . HOH B 2 .   ? -2.576  33.664 5.407   1.00 22.22 ? 36   HOH A O   1 
HETATM 2626 O O   . HOH B 2 .   ? 12.130  12.546 10.755  1.00 30.33 ? 37   HOH A O   1 
HETATM 2627 O O   . HOH B 2 .   ? 17.717  22.583 12.899  1.00 26.73 ? 38   HOH A O   1 
HETATM 2628 O O   . HOH B 2 .   ? 1.454   41.405 6.758   1.00 28.18 ? 39   HOH A O   1 
HETATM 2629 O O   . HOH B 2 .   ? -4.643  31.818 -6.405  1.00 24.33 ? 40   HOH A O   1 
HETATM 2630 O O   . HOH B 2 .   ? 15.792  38.105 16.897  1.00 21.60 ? 41   HOH A O   1 
HETATM 2631 O O   . HOH B 2 .   ? -1.913  30.707 -8.072  1.00 21.27 ? 42   HOH A O   1 
HETATM 2632 O O   . HOH B 2 .   ? -4.154  35.973 5.833   1.00 30.78 ? 43   HOH A O   1 
HETATM 2633 O O   . HOH B 2 .   ? 23.911  35.904 8.211   1.00 17.20 ? 44   HOH A O   1 
HETATM 2634 O O   . HOH B 2 .   ? -5.773  8.282  -5.190  1.00 29.87 ? 45   HOH A O   1 
HETATM 2635 O O   . HOH B 2 .   ? 15.392  25.340 1.207   1.00 26.76 ? 46   HOH A O   1 
HETATM 2636 O O   . HOH B 2 .   ? 19.572  20.781 10.478  1.00 27.21 ? 47   HOH A O   1 
HETATM 2637 O O   . HOH B 2 .   ? 15.891  13.684 22.516  1.00 29.12 ? 48   HOH A O   1 
HETATM 2638 O O   . HOH B 2 .   ? 2.053   14.483 -8.095  1.00 22.03 ? 49   HOH A O   1 
HETATM 2639 O O   . HOH B 2 .   ? 2.678   14.592 -18.376 1.00 21.62 ? 50   HOH A O   1 
HETATM 2640 O O   . HOH B 2 .   ? 15.504  22.301 30.331  1.00 27.67 ? 51   HOH A O   1 
HETATM 2641 O O   . HOH B 2 .   ? -0.875  34.264 15.689  1.00 31.19 ? 52   HOH A O   1 
HETATM 2642 O O   . HOH B 2 .   ? 17.662  30.911 -0.565  1.00 27.56 ? 53   HOH A O   1 
HETATM 2643 O O   . HOH B 2 .   ? 9.923   26.671 31.934  1.00 24.18 ? 54   HOH A O   1 
HETATM 2644 O O   . HOH B 2 .   ? 15.286  24.812 19.455  1.00 22.81 ? 55   HOH A O   1 
HETATM 2645 O O   . HOH B 2 .   ? -8.526  8.744  -4.612  1.00 31.54 ? 56   HOH A O   1 
HETATM 2646 O O   . HOH B 2 .   ? 9.630   19.436 10.742  1.00 20.89 ? 57   HOH A O   1 
HETATM 2647 O O   . HOH B 2 .   ? 16.061  24.266 5.764   1.00 27.28 ? 58   HOH A O   1 
HETATM 2648 O O   . HOH B 2 .   ? 20.809  23.509 15.226  1.00 24.39 ? 59   HOH A O   1 
HETATM 2649 O O   . HOH B 2 .   ? 10.484  19.618 -5.208  1.00 29.29 ? 60   HOH A O   1 
HETATM 2650 O O   . HOH B 2 .   ? -9.087  29.577 -10.906 1.00 40.96 ? 61   HOH A O   1 
HETATM 2651 O O   . HOH B 2 .   ? 1.304   20.001 2.554   1.00 22.34 ? 62   HOH A O   1 
HETATM 2652 O O   . HOH B 2 .   ? 2.613   33.222 -18.138 1.00 27.45 ? 63   HOH A O   1 
HETATM 2653 O O   . HOH B 2 .   ? 13.548  24.923 6.720   1.00 25.22 ? 64   HOH A O   1 
HETATM 2654 O O   . HOH B 2 .   ? 9.134   19.995 3.789   1.00 27.50 ? 65   HOH A O   1 
HETATM 2655 O O   . HOH B 2 .   ? -1.037  23.065 -17.368 1.00 31.83 ? 66   HOH A O   1 
HETATM 2656 O O   . HOH B 2 .   ? -1.483  27.051 -14.042 1.00 24.52 ? 67   HOH A O   1 
HETATM 2657 O O   . HOH B 2 .   ? 13.945  21.227 21.273  1.00 29.70 ? 68   HOH A O   1 
HETATM 2658 O O   . HOH B 2 .   ? -6.468  15.654 27.947  1.00 28.12 ? 69   HOH A O   1 
HETATM 2659 O O   . HOH B 2 .   ? 17.184  22.985 -4.549  1.00 31.25 ? 70   HOH A O   1 
HETATM 2660 O O   . HOH B 2 .   ? 17.493  37.936 -11.318 1.00 28.63 ? 71   HOH A O   1 
HETATM 2661 O O   . HOH B 2 .   ? 9.249   17.868 -7.217  1.00 23.55 ? 72   HOH A O   1 
HETATM 2662 O O   . HOH B 2 .   ? 17.556  27.783 6.660   1.00 23.10 ? 73   HOH A O   1 
HETATM 2663 O O   . HOH B 2 .   ? 7.414   12.432 -12.114 1.00 31.66 ? 74   HOH A O   1 
HETATM 2664 O O   . HOH B 2 .   ? -4.786  27.412 34.360  1.00 28.85 ? 75   HOH A O   1 
HETATM 2665 O O   . HOH B 2 .   ? 21.090  19.552 8.459   1.00 45.09 ? 76   HOH A O   1 
HETATM 2666 O O   . HOH B 2 .   ? 11.715  17.996 8.412   1.00 28.01 ? 77   HOH A O   1 
HETATM 2667 O O   . HOH B 2 .   ? 14.249  33.967 16.046  1.00 23.37 ? 78   HOH A O   1 
HETATM 2668 O O   . HOH B 2 .   ? 9.206   40.705 -13.890 1.00 31.28 ? 79   HOH A O   1 
HETATM 2669 O O   . HOH B 2 .   ? -6.293  24.714 -17.464 1.00 24.66 ? 80   HOH A O   1 
HETATM 2670 O O   . HOH B 2 .   ? -2.079  11.884 -8.894  1.00 20.30 ? 81   HOH A O   1 
HETATM 2671 O O   . HOH B 2 .   ? 1.439   36.938 18.568  1.00 35.39 ? 82   HOH A O   1 
HETATM 2672 O O   . HOH B 2 .   ? -9.422  11.191 -5.828  1.00 26.11 ? 83   HOH A O   1 
HETATM 2673 O O   . HOH B 2 .   ? -5.818  22.020 -21.487 1.00 25.43 ? 84   HOH A O   1 
HETATM 2674 O O   . HOH B 2 .   ? -7.062  10.254 48.843  1.00 27.13 ? 85   HOH A O   1 
HETATM 2675 O O   . HOH B 2 .   ? 2.908   36.074 20.634  1.00 25.94 ? 86   HOH A O   1 
HETATM 2676 O O   . HOH B 2 .   ? 12.965  33.608 25.381  1.00 29.42 ? 87   HOH A O   1 
HETATM 2677 O O   . HOH B 2 .   ? 6.975   43.209 6.255   1.00 34.03 ? 88   HOH A O   1 
HETATM 2678 O O   . HOH B 2 .   ? 22.264  26.207 -18.381 1.00 28.00 ? 89   HOH A O   1 
HETATM 2679 O O   . HOH B 2 .   ? -8.894  25.824 -16.162 1.00 37.80 ? 90   HOH A O   1 
HETATM 2680 O O   . HOH B 2 .   ? -12.632 8.960  44.886  1.00 31.32 ? 91   HOH A O   1 
HETATM 2681 O O   . HOH B 2 .   ? -4.363  12.822 -3.918  1.00 29.46 ? 92   HOH A O   1 
HETATM 2682 O O   . HOH B 2 .   ? -6.592  17.703 3.486   1.00 40.29 ? 93   HOH A O   1 
HETATM 2683 O O   . HOH B 2 .   ? 13.875  22.523 18.393  1.00 22.06 ? 94   HOH A O   1 
HETATM 2684 O O   . HOH B 2 .   ? 5.667   46.347 12.733  1.00 31.99 ? 95   HOH A O   1 
HETATM 2685 O O   . HOH B 2 .   ? 11.032  17.941 42.765  1.00 41.71 ? 96   HOH A O   1 
HETATM 2686 O O   . HOH B 2 .   ? 21.352  27.553 4.414   1.00 35.31 ? 97   HOH A O   1 
HETATM 2687 O O   . HOH B 2 .   ? 3.659   12.286 18.146  1.00 32.42 ? 98   HOH A O   1 
HETATM 2688 O O   . HOH B 2 .   ? -3.908  33.930 9.981   1.00 26.00 ? 99   HOH A O   1 
HETATM 2689 O O   . HOH B 2 .   ? 2.165   11.184 -13.862 1.00 32.44 ? 100  HOH A O   1 
HETATM 2690 O O   . HOH B 2 .   ? 0.370   29.242 -13.155 1.00 21.21 ? 101  HOH A O   1 
HETATM 2691 O O   . HOH B 2 .   ? -7.753  22.365 25.728  1.00 36.25 ? 102  HOH A O   1 
HETATM 2692 O O   . HOH B 2 .   ? -9.226  18.664 0.108   1.00 36.25 ? 103  HOH A O   1 
HETATM 2693 O O   . HOH B 2 .   ? -12.556 14.437 49.543  1.00 57.92 ? 104  HOH A O   1 
HETATM 2694 O O   . HOH B 2 .   ? 8.418   40.120 -8.088  1.00 28.43 ? 105  HOH A O   1 
HETATM 2695 O O   . HOH B 2 .   ? 21.908  34.604 16.803  1.00 27.89 ? 106  HOH A O   1 
HETATM 2696 O O   . HOH B 2 .   ? 1.148   28.398 -21.984 1.00 31.79 ? 107  HOH A O   1 
HETATM 2697 O O   . HOH B 2 .   ? -8.679  30.946 2.021   1.00 34.07 ? 108  HOH A O   1 
HETATM 2698 O O   . HOH B 2 .   ? 8.604   15.283 -6.389  1.00 32.45 ? 109  HOH A O   1 
HETATM 2699 O O   . HOH B 2 .   ? 22.261  37.386 6.470   1.00 22.61 ? 110  HOH A O   1 
HETATM 2700 O O   . HOH B 2 .   ? -5.542  26.747 18.795  1.00 29.65 ? 111  HOH A O   1 
HETATM 2701 O O   . HOH B 2 .   ? 0.489   34.128 11.653  1.00 25.50 ? 112  HOH A O   1 
HETATM 2702 O O   . HOH B 2 .   ? 2.458   22.822 3.040   1.00 28.40 ? 113  HOH A O   1 
HETATM 2703 O O   . HOH B 2 .   ? 20.953  17.078 9.407   1.00 25.70 ? 114  HOH A O   1 
HETATM 2704 O O   . HOH B 2 .   ? 7.600   16.546 12.684  1.00 37.99 ? 115  HOH A O   1 
HETATM 2705 O O   . HOH B 2 .   ? 22.975  22.983 31.638  1.00 39.77 ? 116  HOH A O   1 
HETATM 2706 O O   . HOH B 2 .   ? 11.075  21.246 -2.087  1.00 32.81 ? 117  HOH A O   1 
HETATM 2707 O O   . HOH B 2 .   ? 25.288  21.074 13.122  1.00 49.47 ? 118  HOH A O   1 
HETATM 2708 O O   . HOH B 2 .   ? 16.752  29.279 24.709  1.00 27.78 ? 119  HOH A O   1 
HETATM 2709 O O   . HOH B 2 .   ? 18.341  39.915 -13.216 1.00 46.71 ? 120  HOH A O   1 
HETATM 2710 O O   . HOH B 2 .   ? -1.682  38.051 -10.466 1.00 41.23 ? 121  HOH A O   1 
HETATM 2711 O O   . HOH B 2 .   ? 28.595  28.582 8.456   1.00 27.79 ? 122  HOH A O   1 
HETATM 2712 O O   . HOH B 2 .   ? 16.182  19.857 24.580  1.00 33.20 ? 123  HOH A O   1 
HETATM 2713 O O   . HOH B 2 .   ? 17.090  25.657 3.528   1.00 33.14 ? 124  HOH A O   1 
HETATM 2714 O O   . HOH B 2 .   ? 16.730  19.947 2.830   1.00 35.07 ? 125  HOH A O   1 
HETATM 2715 O O   . HOH B 2 .   ? 30.445  33.285 5.801   1.00 41.75 ? 126  HOH A O   1 
HETATM 2716 O O   . HOH B 2 .   ? 4.786   28.162 38.565  1.00 29.09 ? 127  HOH A O   1 
HETATM 2717 O O   . HOH B 2 .   ? 21.024  20.175 -10.262 1.00 30.92 ? 128  HOH A O   1 
HETATM 2718 O O   . HOH B 2 .   ? 17.450  23.919 28.982  1.00 29.31 ? 129  HOH A O   1 
HETATM 2719 O O   . HOH B 2 .   ? -16.810 13.425 49.983  1.00 50.73 ? 130  HOH A O   1 
HETATM 2720 O O   . HOH B 2 .   ? 14.841  27.423 -22.075 1.00 40.18 ? 131  HOH A O   1 
HETATM 2721 O O   . HOH B 2 .   ? -1.002  24.780 -23.565 1.00 42.19 ? 132  HOH A O   1 
HETATM 2722 O O   . HOH B 2 .   ? 28.353  36.640 2.341   1.00 28.40 ? 133  HOH A O   1 
HETATM 2723 O O   . HOH B 2 .   ? 11.019  14.566 -11.538 1.00 34.96 ? 134  HOH A O   1 
HETATM 2724 O O   . HOH B 2 .   ? -9.449  26.860 -13.512 1.00 30.94 ? 135  HOH A O   1 
HETATM 2725 O O   . HOH B 2 .   ? 10.896  25.959 -25.169 1.00 36.31 ? 136  HOH A O   1 
HETATM 2726 O O   . HOH B 2 .   ? 2.521   11.738 -8.516  1.00 36.97 ? 137  HOH A O   1 
HETATM 2727 O O   . HOH B 2 .   ? -10.465 23.229 -11.459 1.00 46.41 ? 138  HOH A O   1 
HETATM 2728 O O   . HOH B 2 .   ? 4.226   19.586 -29.648 1.00 35.69 ? 139  HOH A O   1 
HETATM 2729 O O   . HOH B 2 .   ? -2.101  35.059 12.199  1.00 28.10 ? 140  HOH A O   1 
HETATM 2730 O O   . HOH B 2 .   ? -2.004  25.254 -16.240 1.00 26.71 ? 141  HOH A O   1 
HETATM 2731 O O   . HOH B 2 .   ? -1.041  30.804 36.298  1.00 50.06 ? 142  HOH A O   1 
HETATM 2732 O O   . HOH B 2 .   ? 4.770   36.615 22.697  1.00 32.66 ? 143  HOH A O   1 
HETATM 2733 O O   . HOH B 2 .   ? 18.476  21.873 26.891  1.00 43.55 ? 144  HOH A O   1 
HETATM 2734 O O   . HOH B 2 .   ? 11.354  14.011 -8.806  1.00 45.93 ? 145  HOH A O   1 
HETATM 2735 O O   . HOH B 2 .   ? 7.699   45.062 4.446   1.00 37.27 ? 146  HOH A O   1 
HETATM 2736 O O   . HOH B 2 .   ? 3.461   45.338 14.309  1.00 31.01 ? 147  HOH A O   1 
HETATM 2737 O O   . HOH B 2 .   ? 5.864   39.931 -9.448  1.00 22.16 ? 148  HOH A O   1 
HETATM 2738 O O   . HOH B 2 .   ? 19.101  40.317 1.493   1.00 23.47 ? 149  HOH A O   1 
HETATM 2739 O O   . HOH B 2 .   ? 20.281  37.720 1.897   1.00 23.96 ? 150  HOH A O   1 
HETATM 2740 O O   . HOH B 2 .   ? 12.901  44.038 4.408   1.00 37.47 ? 151  HOH A O   1 
HETATM 2741 O O   . HOH B 2 .   ? -4.974  32.311 6.785   1.00 38.00 ? 152  HOH A O   1 
HETATM 2742 O O   . HOH B 2 .   ? 23.911  19.096 -10.803 1.00 44.22 ? 153  HOH A O   1 
HETATM 2743 O O   . HOH B 2 .   ? 21.075  27.729 0.540   1.00 43.43 ? 154  HOH A O   1 
HETATM 2744 O O   . HOH B 2 .   ? 19.553  20.506 16.171  1.00 35.75 ? 155  HOH A O   1 
HETATM 2745 O O   . HOH B 2 .   ? 18.913  27.622 25.500  1.00 32.67 ? 156  HOH A O   1 
HETATM 2746 O O   . HOH B 2 .   ? 20.022  30.314 22.117  1.00 34.40 ? 157  HOH A O   1 
HETATM 2747 O O   . HOH B 2 .   ? 8.583   39.902 21.002  1.00 27.17 ? 158  HOH A O   1 
HETATM 2748 O O   . HOH B 2 .   ? 7.330   45.181 0.936   1.00 35.47 ? 159  HOH A O   1 
HETATM 2749 O O   . HOH B 2 .   ? 14.364  41.463 10.322  1.00 32.18 ? 160  HOH A O   1 
HETATM 2750 O O   . HOH B 2 .   ? 30.228  35.366 9.441   1.00 28.67 ? 161  HOH A O   1 
HETATM 2751 O O   . HOH B 2 .   ? 18.935  38.264 17.583  1.00 40.91 ? 162  HOH A O   1 
HETATM 2752 O O   . HOH B 2 .   ? 8.636   50.426 13.646  1.00 40.94 ? 163  HOH A O   1 
HETATM 2753 O O   . HOH B 2 .   ? 5.003   45.680 3.398   1.00 44.89 ? 164  HOH A O   1 
HETATM 2754 O O   . HOH B 2 .   ? 4.807   41.222 -11.617 1.00 31.27 ? 165  HOH A O   1 
HETATM 2755 O O   . HOH B 2 .   ? 29.209  28.974 13.379  1.00 42.39 ? 166  HOH A O   1 
HETATM 2756 O O   . HOH B 2 .   ? -1.722  23.258 17.579  1.00 35.43 ? 167  HOH A O   1 
HETATM 2757 O O   . HOH B 2 .   ? 18.794  19.077 32.135  1.00 29.46 ? 168  HOH A O   1 
HETATM 2758 O O   . HOH B 2 .   ? 16.902  20.268 18.062  1.00 39.41 ? 169  HOH A O   1 
HETATM 2759 O O   . HOH B 2 .   ? -10.545 18.176 -6.989  1.00 42.21 ? 170  HOH A O   1 
HETATM 2760 O O   . HOH B 2 .   ? 18.585  26.343 38.523  1.00 40.30 ? 171  HOH A O   1 
HETATM 2761 O O   . HOH B 2 .   ? 14.308  21.027 -7.119  1.00 39.34 ? 172  HOH A O   1 
HETATM 2762 O O   . HOH B 2 .   ? 6.326   46.924 8.242   1.00 39.35 ? 173  HOH A O   1 
HETATM 2763 O O   . HOH B 2 .   ? 18.355  19.978 35.850  1.00 30.13 ? 174  HOH A O   1 
HETATM 2764 O O   . HOH B 2 .   ? -7.717  16.603 50.713  1.00 37.55 ? 175  HOH A O   1 
HETATM 2765 O O   . HOH B 2 .   ? -10.604 25.796 -0.825  1.00 41.88 ? 176  HOH A O   1 
HETATM 2766 O O   . HOH B 2 .   ? -2.925  15.961 -3.924  1.00 32.11 ? 177  HOH A O   1 
HETATM 2767 O O   . HOH B 2 .   ? 28.386  26.965 16.238  1.00 39.74 ? 178  HOH A O   1 
HETATM 2768 O O   . HOH B 2 .   ? 6.688   36.539 -13.561 1.00 27.00 ? 179  HOH A O   1 
HETATM 2769 O O   . HOH B 2 .   ? 7.096   30.279 -22.123 1.00 31.44 ? 180  HOH A O   1 
HETATM 2770 O O   . HOH B 2 .   ? -5.606  33.428 21.607  1.00 40.24 ? 181  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   714  ?    ?   ?   A . n 
A 1 2   GLU 2   715  ?    ?   ?   A . n 
A 1 3   LYS 3   716  ?    ?   ?   A . n 
A 1 4   ILE 4   717  ?    ?   ?   A . n 
A 1 5   MET 5   718  718  MET MET A . n 
A 1 6   PRO 6   719  719  PRO PRO A . n 
A 1 7   GLU 7   720  720  GLU GLU A . n 
A 1 8   GLU 8   721  721  GLU GLU A . n 
A 1 9   GLU 9   722  722  GLU GLU A . n 
A 1 10  TYR 10  723  723  TYR TYR A . n 
A 1 11  SER 11  724  724  SER SER A . n 
A 1 12  GLU 12  725  725  GLU GLU A . n 
A 1 13  PHE 13  726  726  PHE PHE A . n 
A 1 14  LYS 14  727  727  LYS LYS A . n 
A 1 15  GLU 15  728  728  GLU GLU A . n 
A 1 16  LEU 16  729  729  LEU LEU A . n 
A 1 17  ILE 17  730  730  ILE ILE A . n 
A 1 18  LEU 18  731  731  LEU LEU A . n 
A 1 19  GLN 19  732  732  GLN GLN A . n 
A 1 20  LYS 20  733  733  LYS LYS A . n 
A 1 21  GLU 21  734  734  GLU GLU A . n 
A 1 22  LEU 22  735  735  LEU LEU A . n 
A 1 23  HIS 23  736  736  HIS HIS A . n 
A 1 24  VAL 24  737  737  VAL VAL A . n 
A 1 25  VAL 25  738  738  VAL VAL A . n 
A 1 26  TYR 26  739  739  TYR TYR A . n 
A 1 27  ALA 27  740  740  ALA ALA A . n 
A 1 28  LEU 28  741  741  LEU LEU A . n 
A 1 29  SER 29  742  742  SER SER A . n 
A 1 30  HIS 30  743  743  HIS HIS A . n 
A 1 31  VAL 31  744  744  VAL VAL A . n 
A 1 32  CYS 32  745  745  CYS CYS A . n 
A 1 33  GLY 33  746  746  GLY GLY A . n 
A 1 34  GLN 34  747  747  GLN GLN A . n 
A 1 35  ASP 35  748  748  ASP ASP A . n 
A 1 36  ARG 36  749  749  ARG ARG A . n 
A 1 37  THR 37  750  750  THR THR A . n 
A 1 38  LEU 38  751  751  LEU LEU A . n 
A 1 39  LEU 39  752  752  LEU LEU A . n 
A 1 40  ALA 40  753  753  ALA ALA A . n 
A 1 41  SER 41  754  754  SER SER A . n 
A 1 42  ILE 42  755  755  ILE ILE A . n 
A 1 43  LEU 43  756  756  LEU LEU A . n 
A 1 44  LEU 44  757  757  LEU LEU A . n 
A 1 45  ARG 45  758  758  ARG ARG A . n 
A 1 46  ILE 46  759  759  ILE ILE A . n 
A 1 47  PHE 47  760  760  PHE PHE A . n 
A 1 48  LEU 48  761  761  LEU LEU A . n 
A 1 49  HIS 49  762  762  HIS HIS A . n 
A 1 50  GLU 50  763  763  GLU GLU A . n 
A 1 51  LYS 51  764  764  LYS LYS A . n 
A 1 52  LEU 52  765  765  LEU LEU A . n 
A 1 53  GLU 53  766  766  GLU GLU A . n 
A 1 54  SER 54  767  767  SER SER A . n 
A 1 55  LEU 55  768  768  LEU LEU A . n 
A 1 56  LEU 56  769  769  LEU LEU A . n 
A 1 57  LEU 57  770  770  LEU LEU A . n 
A 1 58  CYS 58  771  771  CYS CYS A . n 
A 1 59  THR 59  772  772  THR THR A . n 
A 1 60  LEU 60  773  773  LEU LEU A . n 
A 1 61  ASN 61  774  774  ASN ASN A . n 
A 1 62  ASP 62  775  775  ASP ASP A . n 
A 1 63  ARG 63  776  776  ARG ARG A . n 
A 1 64  GLU 64  777  777  GLU GLU A . n 
A 1 65  ILE 65  778  778  ILE ILE A . n 
A 1 66  SER 66  779  779  SER SER A . n 
A 1 67  MET 67  780  780  MET MET A . n 
A 1 68  GLU 68  781  781  GLU GLU A . n 
A 1 69  ASP 69  782  782  ASP ASP A . n 
A 1 70  GLU 70  783  783  GLU GLU A . n 
A 1 71  ALA 71  784  784  ALA ALA A . n 
A 1 72  THR 72  785  785  THR THR A . n 
A 1 73  THR 73  786  786  THR THR A . n 
A 1 74  LEU 74  787  787  LEU LEU A . n 
A 1 75  PHE 75  788  788  PHE PHE A . n 
A 1 76  ARG 76  789  789  ARG ARG A . n 
A 1 77  ALA 77  790  790  ALA ALA A . n 
A 1 78  THR 78  791  791  THR THR A . n 
A 1 79  THR 79  792  792  THR THR A . n 
A 1 80  LEU 80  793  793  LEU LEU A . n 
A 1 81  ALA 81  794  794  ALA ALA A . n 
A 1 82  SER 82  795  795  SER SER A . n 
A 1 83  THR 83  796  796  THR THR A . n 
A 1 84  LEU 84  797  797  LEU LEU A . n 
A 1 85  MET 85  798  798  MET MET A . n 
A 1 86  GLU 86  799  799  GLU GLU A . n 
A 1 87  GLN 87  800  800  GLN GLN A . n 
A 1 88  TYR 88  801  801  TYR TYR A . n 
A 1 89  MET 89  802  802  MET MET A . n 
A 1 90  LYS 90  803  803  LYS LYS A . n 
A 1 91  ALA 91  804  804  ALA ALA A . n 
A 1 92  THR 92  805  805  THR THR A . n 
A 1 93  ALA 93  806  806  ALA ALA A . n 
A 1 94  THR 94  807  807  THR THR A . n 
A 1 95  GLN 95  808  808  GLN GLN A . n 
A 1 96  PHE 96  809  809  PHE PHE A . n 
A 1 97  VAL 97  810  810  VAL VAL A . n 
A 1 98  HIS 98  811  811  HIS HIS A . n 
A 1 99  HIS 99  812  812  HIS HIS A . n 
A 1 100 ALA 100 813  813  ALA ALA A . n 
A 1 101 LEU 101 814  814  LEU LEU A . n 
A 1 102 LYS 102 815  815  LYS LYS A . n 
A 1 103 ASP 103 816  816  ASP ASP A . n 
A 1 104 SER 104 817  817  SER SER A . n 
A 1 105 ILE 105 818  818  ILE ILE A . n 
A 1 106 LEU 106 819  819  LEU LEU A . n 
A 1 107 LYS 107 820  820  LYS LYS A . n 
A 1 108 ILE 108 821  821  ILE ILE A . n 
A 1 109 MET 109 822  822  MET MET A . n 
A 1 110 GLU 110 823  823  GLU GLU A . n 
A 1 111 SER 111 824  824  SER SER A . n 
A 1 112 LYS 112 825  825  LYS LYS A . n 
A 1 113 GLN 113 826  826  GLN GLN A . n 
A 1 114 SER 114 827  827  SER SER A . n 
A 1 115 CYS 115 828  828  CYS CYS A . n 
A 1 116 GLU 116 829  829  GLU GLU A . n 
A 1 117 LEU 117 830  830  LEU LEU A . n 
A 1 118 SER 118 831  831  SER SER A . n 
A 1 119 PRO 119 832  832  PRO PRO A . n 
A 1 120 SER 120 833  833  SER SER A . n 
A 1 121 LYS 121 834  834  LYS LYS A . n 
A 1 122 LEU 122 835  835  LEU LEU A . n 
A 1 123 GLU 123 836  836  GLU GLU A . n 
A 1 124 LYS 124 837  837  LYS LYS A . n 
A 1 125 ASN 125 838  838  ASN ASN A . n 
A 1 126 GLU 126 839  839  GLU GLU A . n 
A 1 127 ASP 127 840  840  ASP ASP A . n 
A 1 128 VAL 128 841  841  VAL VAL A . n 
A 1 129 ASN 129 842  842  ASN ASN A . n 
A 1 130 THR 130 843  843  THR THR A . n 
A 1 131 ASN 131 844  844  ASN ASN A . n 
A 1 132 LEU 132 845  845  LEU LEU A . n 
A 1 133 THR 133 846  846  THR THR A . n 
A 1 134 HIS 134 847  847  HIS HIS A . n 
A 1 135 LEU 135 848  848  LEU LEU A . n 
A 1 136 LEU 136 849  849  LEU LEU A . n 
A 1 137 ASN 137 850  850  ASN ASN A . n 
A 1 138 ILE 138 851  851  ILE ILE A . n 
A 1 139 LEU 139 852  852  LEU LEU A . n 
A 1 140 SER 140 853  853  SER SER A . n 
A 1 141 GLU 141 854  854  GLU GLU A . n 
A 1 142 LEU 142 855  855  LEU LEU A . n 
A 1 143 VAL 143 856  856  VAL VAL A . n 
A 1 144 GLU 144 857  857  GLU GLU A . n 
A 1 145 LYS 145 858  858  LYS LYS A . n 
A 1 146 ILE 146 859  859  ILE ILE A . n 
A 1 147 PHE 147 860  860  PHE PHE A . n 
A 1 148 MET 148 861  861  MET MET A . n 
A 1 149 ALA 149 862  862  ALA ALA A . n 
A 1 150 SER 150 863  863  SER SER A . n 
A 1 151 GLU 151 864  864  GLU GLU A . n 
A 1 152 ILE 152 865  865  ILE ILE A . n 
A 1 153 LEU 153 866  866  LEU LEU A . n 
A 1 154 PRO 154 867  867  PRO PRO A . n 
A 1 155 PRO 155 868  868  PRO PRO A . n 
A 1 156 THR 156 869  869  THR THR A . n 
A 1 157 LEU 157 870  870  LEU LEU A . n 
A 1 158 ARG 158 871  871  ARG ARG A . n 
A 1 159 TYR 159 872  872  TYR TYR A . n 
A 1 160 ILE 160 873  873  ILE ILE A . n 
A 1 161 TYR 161 874  874  TYR TYR A . n 
A 1 162 GLY 162 875  875  GLY GLY A . n 
A 1 163 CYS 163 876  876  CYS CYS A . n 
A 1 164 LEU 164 877  877  LEU LEU A . n 
A 1 165 GLN 165 878  878  GLN GLN A . n 
A 1 166 LYS 166 879  879  LYS LYS A . n 
A 1 167 SER 167 880  880  SER SER A . n 
A 1 168 VAL 168 881  881  VAL VAL A . n 
A 1 169 GLN 169 882  882  GLN GLN A . n 
A 1 170 HIS 170 883  883  HIS HIS A . n 
A 1 171 LYS 171 884  884  LYS LYS A . n 
A 1 172 TRP 172 885  885  TRP TRP A . n 
A 1 173 PRO 173 886  886  PRO PRO A . n 
A 1 174 THR 174 887  887  THR THR A . n 
A 1 175 ASN 175 888  888  ASN ASN A . n 
A 1 176 THR 176 889  889  THR THR A . n 
A 1 177 THR 177 890  890  THR THR A . n 
A 1 178 MET 178 891  891  MET MET A . n 
A 1 179 ARG 179 892  892  ARG ARG A . n 
A 1 180 THR 180 893  893  THR THR A . n 
A 1 181 ARG 181 894  894  ARG ARG A . n 
A 1 182 VAL 182 895  895  VAL VAL A . n 
A 1 183 VAL 183 896  896  VAL VAL A . n 
A 1 184 SER 184 897  897  SER SER A . n 
A 1 185 GLY 185 898  898  GLY GLY A . n 
A 1 186 PHE 186 899  899  PHE PHE A . n 
A 1 187 VAL 187 900  900  VAL VAL A . n 
A 1 188 PHE 188 901  901  PHE PHE A . n 
A 1 189 LEU 189 902  902  LEU LEU A . n 
A 1 190 ARG 190 903  903  ARG ARG A . n 
A 1 191 LEU 191 904  904  LEU LEU A . n 
A 1 192 ILE 192 905  905  ILE ILE A . n 
A 1 193 CYS 193 906  906  CYS CYS A . n 
A 1 194 PRO 194 907  907  PRO PRO A . n 
A 1 195 ALA 195 908  908  ALA ALA A . n 
A 1 196 ILE 196 909  909  ILE ILE A . n 
A 1 197 LEU 197 910  910  LEU LEU A . n 
A 1 198 ASN 198 911  911  ASN ASN A . n 
A 1 199 PRO 199 912  912  PRO PRO A . n 
A 1 200 ARG 200 913  913  ARG ARG A . n 
A 1 201 MET 201 914  914  MET MET A . n 
A 1 202 PHE 202 915  915  PHE PHE A . n 
A 1 203 ASN 203 916  916  ASN ASN A . n 
A 1 204 ILE 204 917  917  ILE ILE A . n 
A 1 205 ILE 205 918  918  ILE ILE A . n 
A 1 206 SER 206 919  919  SER SER A . n 
A 1 207 ASP 207 920  920  ASP ASP A . n 
A 1 208 SER 208 921  921  SER SER A . n 
A 1 209 PRO 209 922  922  PRO PRO A . n 
A 1 210 SER 210 923  923  SER SER A . n 
A 1 211 PRO 211 924  924  PRO PRO A . n 
A 1 212 ILE 212 925  925  ILE ILE A . n 
A 1 213 ALA 213 926  926  ALA ALA A . n 
A 1 214 ALA 214 927  927  ALA ALA A . n 
A 1 215 ARG 215 928  928  ARG ARG A . n 
A 1 216 THR 216 929  929  THR THR A . n 
A 1 217 LEU 217 930  930  LEU LEU A . n 
A 1 218 ILE 218 931  931  ILE ILE A . n 
A 1 219 LEU 219 932  932  LEU LEU A . n 
A 1 220 VAL 220 933  933  VAL VAL A . n 
A 1 221 ALA 221 934  934  ALA ALA A . n 
A 1 222 LYS 222 935  935  LYS LYS A . n 
A 1 223 SER 223 936  936  SER SER A . n 
A 1 224 VAL 224 937  937  VAL VAL A . n 
A 1 225 GLN 225 938  938  GLN GLN A . n 
A 1 226 ASN 226 939  939  ASN ASN A . n 
A 1 227 LEU 227 940  940  LEU LEU A . n 
A 1 228 ALA 228 941  941  ALA ALA A . n 
A 1 229 ASN 229 942  942  ASN ASN A . n 
A 1 230 LEU 230 943  943  LEU LEU A . n 
A 1 231 VAL 231 944  944  VAL VAL A . n 
A 1 232 GLU 232 945  945  GLU GLU A . n 
A 1 233 PHE 233 946  946  PHE PHE A . n 
A 1 234 GLY 234 947  947  GLY GLY A . n 
A 1 235 ALA 235 948  948  ALA ALA A . n 
A 1 236 LYS 236 949  949  LYS LYS A . n 
A 1 237 GLU 237 950  950  GLU GLU A . n 
A 1 238 PRO 238 951  951  PRO PRO A . n 
A 1 239 TYR 239 952  952  TYR TYR A . n 
A 1 240 MET 240 953  953  MET MET A . n 
A 1 241 GLU 241 954  954  GLU GLU A . n 
A 1 242 GLY 242 955  955  GLY GLY A . n 
A 1 243 VAL 243 956  956  VAL VAL A . n 
A 1 244 ASN 244 957  957  ASN ASN A . n 
A 1 245 PRO 245 958  958  PRO PRO A . n 
A 1 246 PHE 246 959  959  PHE PHE A . n 
A 1 247 ILE 247 960  960  ILE ILE A . n 
A 1 248 LYS 248 961  961  LYS LYS A . n 
A 1 249 SER 249 962  962  SER SER A . n 
A 1 250 ASN 250 963  963  ASN ASN A . n 
A 1 251 LYS 251 964  964  LYS LYS A . n 
A 1 252 HIS 252 965  965  HIS HIS A . n 
A 1 253 ARG 253 966  966  ARG ARG A . n 
A 1 254 MET 254 967  967  MET MET A . n 
A 1 255 ILE 255 968  968  ILE ILE A . n 
A 1 256 MET 256 969  969  MET MET A . n 
A 1 257 PHE 257 970  970  PHE PHE A . n 
A 1 258 LEU 258 971  971  LEU LEU A . n 
A 1 259 ASP 259 972  972  ASP ASP A . n 
A 1 260 GLU 260 973  973  GLU GLU A . n 
A 1 261 LEU 261 974  974  LEU LEU A . n 
A 1 262 GLY 262 975  975  GLY GLY A . n 
A 1 263 ASN 263 976  976  ASN ASN A . n 
A 1 264 VAL 264 977  977  VAL VAL A . n 
A 1 265 PRO 265 978  978  PRO PRO A . n 
A 1 266 GLU 266 979  979  GLU GLU A . n 
A 1 267 LEU 267 980  980  LEU LEU A . n 
A 1 268 PRO 268 981  981  PRO PRO A . n 
A 1 269 ASP 269 982  982  ASP ASP A . n 
A 1 270 THR 270 983  983  THR THR A . n 
A 1 271 THR 271 984  984  THR THR A . n 
A 1 272 GLU 272 985  985  GLU GLU A . n 
A 1 273 HIS 273 986  986  HIS HIS A . n 
A 1 274 SER 274 987  987  SER SER A . n 
A 1 275 ARG 275 988  988  ARG ARG A . n 
A 1 276 THR 276 989  989  THR THR A . n 
A 1 277 ASP 277 990  990  ASP ASP A . n 
A 1 278 LEU 278 991  991  LEU LEU A . n 
A 1 279 SER 279 992  992  SER SER A . n 
A 1 280 ARG 280 993  993  ARG ARG A . n 
A 1 281 ASP 281 994  994  ASP ASP A . n 
A 1 282 LEU 282 995  995  LEU LEU A . n 
A 1 283 ALA 283 996  996  ALA ALA A . n 
A 1 284 ALA 284 997  997  ALA ALA A . n 
A 1 285 LEU 285 998  998  LEU LEU A . n 
A 1 286 HIS 286 999  999  HIS HIS A . n 
A 1 287 GLU 287 1000 1000 GLU GLU A . n 
A 1 288 ILE 288 1001 1001 ILE ILE A . n 
A 1 289 CYS 289 1002 1002 CYS CYS A . n 
A 1 290 VAL 290 1003 1003 VAL VAL A . n 
A 1 291 ALA 291 1004 1004 ALA ALA A . n 
A 1 292 HIS 292 1005 1005 HIS HIS A . n 
A 1 293 SER 293 1006 1006 SER SER A . n 
A 1 294 ASP 294 1007 1007 ASP ASP A . n 
A 1 295 GLU 295 1008 1008 GLU GLU A . n 
A 1 296 LEU 296 1009 1009 LEU LEU A . n 
A 1 297 ARG 297 1010 1010 ARG ARG A . n 
A 1 298 THR 298 1011 1011 THR THR A . n 
A 1 299 LEU 299 1012 1012 LEU LEU A . n 
A 1 300 SER 300 1013 1013 SER SER A . n 
A 1 301 ASN 301 1014 1014 ASN ASN A . n 
A 1 302 GLU 302 1015 1015 GLU GLU A . n 
A 1 303 ARG 303 1016 1016 ARG ARG A . n 
A 1 304 GLY 304 1017 1017 GLY GLY A . n 
A 1 305 ALA 305 1018 1018 ALA ALA A . n 
A 1 306 GLN 306 1019 1019 GLN GLN A . n 
A 1 307 GLN 307 1020 1020 GLN GLN A . n 
A 1 308 HIS 308 1021 1021 HIS HIS A . n 
A 1 309 VAL 309 1022 1022 VAL VAL A . n 
A 1 310 LEU 310 1023 1023 LEU LEU A . n 
A 1 311 LYS 311 1024 1024 LYS LYS A . n 
A 1 312 LYS 312 1025 1025 LYS LYS A . n 
A 1 313 LEU 313 1026 1026 LEU LEU A . n 
A 1 314 LEU 314 1027 1027 LEU LEU A . n 
A 1 315 ALA 315 1028 1028 ALA ALA A . n 
A 1 316 ILE 316 1029 1029 ILE ILE A . n 
A 1 317 THR 317 1030 1030 THR THR A . n 
A 1 318 GLU 318 1031 1031 GLU GLU A . n 
A 1 319 LEU 319 1032 1032 LEU LEU A . n 
A 1 320 LEU 320 1033 1033 LEU LEU A . n 
A 1 321 GLN 321 1034 1034 GLN GLN A . n 
A 1 322 GLN 322 1035 1035 GLN GLN A . n 
A 1 323 LYS 323 1036 1036 LYS LYS A . n 
A 1 324 GLN 324 1037 1037 GLN GLN A . n 
A 1 325 ASN 325 1038 1038 ASN ASN A . n 
A 1 326 GLN 326 1039 1039 GLN GLN A . n 
A 1 327 TYR 327 1040 1040 TYR TYR A . n 
A 1 328 THR 328 1041 1041 THR THR A . n 
A 1 329 LYS 329 1042 ?    ?   ?   A . n 
A 1 330 THR 330 1043 ?    ?   ?   A . n 
A 1 331 ASN 331 1044 ?    ?   ?   A . n 
A 1 332 ASP 332 1045 ?    ?   ?   A . n 
A 1 333 VAL 333 1046 ?    ?   ?   A . n 
A 1 334 ARG 334 1047 ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   1   1   HOH HOH A . 
B 2 HOH 2   2   2   HOH HOH A . 
B 2 HOH 3   3   3   HOH HOH A . 
B 2 HOH 4   4   4   HOH HOH A . 
B 2 HOH 5   5   5   HOH HOH A . 
B 2 HOH 6   6   6   HOH HOH A . 
B 2 HOH 7   7   7   HOH HOH A . 
B 2 HOH 8   8   8   HOH HOH A . 
B 2 HOH 9   9   9   HOH HOH A . 
B 2 HOH 10  10  10  HOH HOH A . 
B 2 HOH 11  11  11  HOH HOH A . 
B 2 HOH 12  12  12  HOH HOH A . 
B 2 HOH 13  13  13  HOH HOH A . 
B 2 HOH 14  14  14  HOH HOH A . 
B 2 HOH 15  15  15  HOH HOH A . 
B 2 HOH 16  16  16  HOH HOH A . 
B 2 HOH 17  17  17  HOH HOH A . 
B 2 HOH 18  18  18  HOH HOH A . 
B 2 HOH 19  19  19  HOH HOH A . 
B 2 HOH 20  20  20  HOH HOH A . 
B 2 HOH 21  21  21  HOH HOH A . 
B 2 HOH 22  22  22  HOH HOH A . 
B 2 HOH 23  23  23  HOH HOH A . 
B 2 HOH 24  24  24  HOH HOH A . 
B 2 HOH 25  25  25  HOH HOH A . 
B 2 HOH 26  26  26  HOH HOH A . 
B 2 HOH 27  27  27  HOH HOH A . 
B 2 HOH 28  28  28  HOH HOH A . 
B 2 HOH 29  29  29  HOH HOH A . 
B 2 HOH 30  30  30  HOH HOH A . 
B 2 HOH 31  31  31  HOH HOH A . 
B 2 HOH 32  32  32  HOH HOH A . 
B 2 HOH 33  33  33  HOH HOH A . 
B 2 HOH 34  34  34  HOH HOH A . 
B 2 HOH 35  35  35  HOH HOH A . 
B 2 HOH 36  36  36  HOH HOH A . 
B 2 HOH 37  37  37  HOH HOH A . 
B 2 HOH 38  38  38  HOH HOH A . 
B 2 HOH 39  39  39  HOH HOH A . 
B 2 HOH 40  40  40  HOH HOH A . 
B 2 HOH 41  41  41  HOH HOH A . 
B 2 HOH 42  42  42  HOH HOH A . 
B 2 HOH 43  43  43  HOH HOH A . 
B 2 HOH 44  44  44  HOH HOH A . 
B 2 HOH 45  45  45  HOH HOH A . 
B 2 HOH 46  46  46  HOH HOH A . 
B 2 HOH 47  47  47  HOH HOH A . 
B 2 HOH 48  48  48  HOH HOH A . 
B 2 HOH 49  49  49  HOH HOH A . 
B 2 HOH 50  50  50  HOH HOH A . 
B 2 HOH 51  51  51  HOH HOH A . 
B 2 HOH 52  52  52  HOH HOH A . 
B 2 HOH 53  53  53  HOH HOH A . 
B 2 HOH 54  54  54  HOH HOH A . 
B 2 HOH 55  55  55  HOH HOH A . 
B 2 HOH 56  56  56  HOH HOH A . 
B 2 HOH 57  57  57  HOH HOH A . 
B 2 HOH 58  58  58  HOH HOH A . 
B 2 HOH 59  59  59  HOH HOH A . 
B 2 HOH 60  60  60  HOH HOH A . 
B 2 HOH 61  61  61  HOH HOH A . 
B 2 HOH 62  62  62  HOH HOH A . 
B 2 HOH 63  63  63  HOH HOH A . 
B 2 HOH 64  64  64  HOH HOH A . 
B 2 HOH 65  65  65  HOH HOH A . 
B 2 HOH 66  66  66  HOH HOH A . 
B 2 HOH 67  67  67  HOH HOH A . 
B 2 HOH 68  68  68  HOH HOH A . 
B 2 HOH 69  69  69  HOH HOH A . 
B 2 HOH 70  70  70  HOH HOH A . 
B 2 HOH 71  71  71  HOH HOH A . 
B 2 HOH 72  72  72  HOH HOH A . 
B 2 HOH 73  73  73  HOH HOH A . 
B 2 HOH 74  74  74  HOH HOH A . 
B 2 HOH 75  75  75  HOH HOH A . 
B 2 HOH 76  76  76  HOH HOH A . 
B 2 HOH 77  77  77  HOH HOH A . 
B 2 HOH 78  78  78  HOH HOH A . 
B 2 HOH 79  79  79  HOH HOH A . 
B 2 HOH 80  80  80  HOH HOH A . 
B 2 HOH 81  81  81  HOH HOH A . 
B 2 HOH 82  82  82  HOH HOH A . 
B 2 HOH 83  83  83  HOH HOH A . 
B 2 HOH 84  84  84  HOH HOH A . 
B 2 HOH 85  85  85  HOH HOH A . 
B 2 HOH 86  86  86  HOH HOH A . 
B 2 HOH 87  87  87  HOH HOH A . 
B 2 HOH 88  88  88  HOH HOH A . 
B 2 HOH 89  89  89  HOH HOH A . 
B 2 HOH 90  90  90  HOH HOH A . 
B 2 HOH 91  91  91  HOH HOH A . 
B 2 HOH 92  92  92  HOH HOH A . 
B 2 HOH 93  93  93  HOH HOH A . 
B 2 HOH 94  94  94  HOH HOH A . 
B 2 HOH 95  95  95  HOH HOH A . 
B 2 HOH 96  96  96  HOH HOH A . 
B 2 HOH 97  97  97  HOH HOH A . 
B 2 HOH 98  98  98  HOH HOH A . 
B 2 HOH 99  99  99  HOH HOH A . 
B 2 HOH 100 100 100 HOH HOH A . 
B 2 HOH 101 101 101 HOH HOH A . 
B 2 HOH 102 102 102 HOH HOH A . 
B 2 HOH 103 103 103 HOH HOH A . 
B 2 HOH 104 104 104 HOH HOH A . 
B 2 HOH 105 105 105 HOH HOH A . 
B 2 HOH 106 106 106 HOH HOH A . 
B 2 HOH 107 107 107 HOH HOH A . 
B 2 HOH 108 108 108 HOH HOH A . 
B 2 HOH 109 109 109 HOH HOH A . 
B 2 HOH 110 110 110 HOH HOH A . 
B 2 HOH 111 111 111 HOH HOH A . 
B 2 HOH 112 112 112 HOH HOH A . 
B 2 HOH 113 113 113 HOH HOH A . 
B 2 HOH 114 114 114 HOH HOH A . 
B 2 HOH 115 115 115 HOH HOH A . 
B 2 HOH 116 116 116 HOH HOH A . 
B 2 HOH 117 117 117 HOH HOH A . 
B 2 HOH 118 118 118 HOH HOH A . 
B 2 HOH 119 119 119 HOH HOH A . 
B 2 HOH 120 120 120 HOH HOH A . 
B 2 HOH 121 121 121 HOH HOH A . 
B 2 HOH 122 122 122 HOH HOH A . 
B 2 HOH 123 123 123 HOH HOH A . 
B 2 HOH 124 124 124 HOH HOH A . 
B 2 HOH 125 125 125 HOH HOH A . 
B 2 HOH 126 126 126 HOH HOH A . 
B 2 HOH 127 127 127 HOH HOH A . 
B 2 HOH 128 128 128 HOH HOH A . 
B 2 HOH 129 129 129 HOH HOH A . 
B 2 HOH 130 130 130 HOH HOH A . 
B 2 HOH 131 131 131 HOH HOH A . 
B 2 HOH 132 132 132 HOH HOH A . 
B 2 HOH 133 133 133 HOH HOH A . 
B 2 HOH 134 134 134 HOH HOH A . 
B 2 HOH 135 135 135 HOH HOH A . 
B 2 HOH 136 136 136 HOH HOH A . 
B 2 HOH 137 137 137 HOH HOH A . 
B 2 HOH 138 138 138 HOH HOH A . 
B 2 HOH 139 139 139 HOH HOH A . 
B 2 HOH 140 140 140 HOH HOH A . 
B 2 HOH 141 141 141 HOH HOH A . 
B 2 HOH 142 142 142 HOH HOH A . 
B 2 HOH 143 143 143 HOH HOH A . 
B 2 HOH 144 144 144 HOH HOH A . 
B 2 HOH 145 145 145 HOH HOH A . 
B 2 HOH 146 146 146 HOH HOH A . 
B 2 HOH 147 147 147 HOH HOH A . 
B 2 HOH 148 148 148 HOH HOH A . 
B 2 HOH 149 149 149 HOH HOH A . 
B 2 HOH 150 150 150 HOH HOH A . 
B 2 HOH 151 151 151 HOH HOH A . 
B 2 HOH 152 152 152 HOH HOH A . 
B 2 HOH 153 153 153 HOH HOH A . 
B 2 HOH 154 154 154 HOH HOH A . 
B 2 HOH 155 155 155 HOH HOH A . 
B 2 HOH 156 156 156 HOH HOH A . 
B 2 HOH 157 157 157 HOH HOH A . 
B 2 HOH 158 158 158 HOH HOH A . 
B 2 HOH 159 159 159 HOH HOH A . 
B 2 HOH 160 160 160 HOH HOH A . 
B 2 HOH 161 161 161 HOH HOH A . 
B 2 HOH 162 162 162 HOH HOH A . 
B 2 HOH 163 163 163 HOH HOH A . 
B 2 HOH 164 164 164 HOH HOH A . 
B 2 HOH 165 165 165 HOH HOH A . 
B 2 HOH 166 166 166 HOH HOH A . 
B 2 HOH 167 167 167 HOH HOH A . 
B 2 HOH 168 168 168 HOH HOH A . 
B 2 HOH 169 169 169 HOH HOH A . 
B 2 HOH 170 170 170 HOH HOH A . 
B 2 HOH 171 171 171 HOH HOH A . 
B 2 HOH 172 172 172 HOH HOH A . 
B 2 HOH 173 173 173 HOH HOH A . 
B 2 HOH 174 174 174 HOH HOH A . 
B 2 HOH 175 175 175 HOH HOH A . 
B 2 HOH 176 176 176 HOH HOH A . 
B 2 HOH 177 177 177 HOH HOH A . 
B 2 HOH 178 178 178 HOH HOH A . 
B 2 HOH 179 179 179 HOH HOH A . 
B 2 HOH 180 180 180 HOH HOH A . 
B 2 HOH 181 181 181 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-12-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.851 ? 1 
X-PLOR refinement       3.851 ? 2 
XDS    'data reduction' .     ? 3 
XSCALE 'data scaling'   .     ? 4 
X-PLOR phasing          3.851 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 748 ? ? -87.79  36.61  
2 1 GLU A 836 ? ? 48.25   -88.18 
3 1 ASN A 838 ? ? 62.32   82.89  
4 1 PHE A 901 ? ? -108.91 -63.94 
5 1 LEU A 904 ? ? -137.22 -73.24 
6 1 ASN A 976 ? ? -85.45  42.52  
7 1 PRO A 981 ? ? -68.74  -77.10 
8 1 ASP A 982 ? ? 79.07   -28.80 
9 1 GLU A 985 ? ? 70.85   -88.82 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 714  ? A MET 1   
2  1 Y 1 A GLU 715  ? A GLU 2   
3  1 Y 1 A LYS 716  ? A LYS 3   
4  1 Y 1 A ILE 717  ? A ILE 4   
5  1 Y 1 A LYS 1042 ? A LYS 329 
6  1 Y 1 A THR 1043 ? A THR 330 
7  1 Y 1 A ASN 1044 ? A ASN 331 
8  1 Y 1 A ASP 1045 ? A ASP 332 
9  1 Y 1 A VAL 1046 ? A VAL 333 
10 1 Y 1 A ARG 1047 ? A ARG 334 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#