data_1WF7
# 
_entry.id   1WF7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1WF7         pdb_00001wf7 10.2210/pdb1wf7/pdb 
RCSB  RCSB023513   ?            ?                   
WWPDB D_1000023513 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          mmt007006937.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WF7 
_pdbx_database_status.recvd_initial_deposition_date   2004-05-26 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Qin, X.'                                                1 
'Tochio, N.'                                             2 
'Kigawa, T.'                                             3 
'Hayashi, F.'                                            4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the PDZ domain of Enigma homologue protein' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Qin, X.'      1 ? 
primary 'Tochio, N.'   2 ? 
primary 'Kigawa, T.'   3 ? 
primary 'Hayashi, F.'  4 ? 
primary 'Yokoyama, S.' 5 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Enigma homologue protein' 
_entity.formula_weight             10309.564 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PDZ domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSL
NMTLQRASAAAKSEPVSSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSL
NMTLQRASAAAKSEPVSSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         mmt007006937.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   SER n 
1 9   VAL n 
1 10  SER n 
1 11  LEU n 
1 12  VAL n 
1 13  GLY n 
1 14  PRO n 
1 15  ALA n 
1 16  PRO n 
1 17  TRP n 
1 18  GLY n 
1 19  PHE n 
1 20  ARG n 
1 21  LEU n 
1 22  GLN n 
1 23  GLY n 
1 24  GLY n 
1 25  LYS n 
1 26  ASP n 
1 27  PHE n 
1 28  ASN n 
1 29  MET n 
1 30  PRO n 
1 31  LEU n 
1 32  THR n 
1 33  ILE n 
1 34  SER n 
1 35  SER n 
1 36  LEU n 
1 37  LYS n 
1 38  ASP n 
1 39  GLY n 
1 40  GLY n 
1 41  LYS n 
1 42  ALA n 
1 43  SER n 
1 44  GLN n 
1 45  ALA n 
1 46  HIS n 
1 47  VAL n 
1 48  ARG n 
1 49  ILE n 
1 50  GLY n 
1 51  ASP n 
1 52  VAL n 
1 53  VAL n 
1 54  LEU n 
1 55  SER n 
1 56  ILE n 
1 57  ASP n 
1 58  GLY n 
1 59  ILE n 
1 60  SER n 
1 61  ALA n 
1 62  GLN n 
1 63  GLY n 
1 64  MET n 
1 65  THR n 
1 66  HIS n 
1 67  LEU n 
1 68  GLU n 
1 69  ALA n 
1 70  GLN n 
1 71  ASN n 
1 72  LYS n 
1 73  ILE n 
1 74  LYS n 
1 75  ALA n 
1 76  CYS n 
1 77  THR n 
1 78  GLY n 
1 79  SER n 
1 80  LEU n 
1 81  ASN n 
1 82  MET n 
1 83  THR n 
1 84  LEU n 
1 85  GLN n 
1 86  ARG n 
1 87  ALA n 
1 88  SER n 
1 89  ALA n 
1 90  ALA n 
1 91  ALA n 
1 92  LYS n 
1 93  SER n 
1 94  GLU n 
1 95  PRO n 
1 96  VAL n 
1 97  SER n 
1 98  SER n 
1 99  GLY n 
1 100 PRO n 
1 101 SER n 
1 102 SER n 
1 103 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 'RIKEN 1110001A05' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P030203-44 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDLI5_MOUSE 
_struct_ref.pdbx_db_accession          Q8CI51 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA
SAAAKSEPVS
;
_struct_ref.pdbx_align_begin           5 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WF7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 97 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8CI51 
_struct_ref_seq.db_align_beg                  5 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  94 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       97 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WF7 GLY A 1   ? UNP Q8CI51 ? ? 'cloning artifact' 1   1  
1 1WF7 SER A 2   ? UNP Q8CI51 ? ? 'cloning artifact' 2   2  
1 1WF7 SER A 3   ? UNP Q8CI51 ? ? 'cloning artifact' 3   3  
1 1WF7 GLY A 4   ? UNP Q8CI51 ? ? 'cloning artifact' 4   4  
1 1WF7 SER A 5   ? UNP Q8CI51 ? ? 'cloning artifact' 5   5  
1 1WF7 SER A 6   ? UNP Q8CI51 ? ? 'cloning artifact' 6   6  
1 1WF7 GLY A 7   ? UNP Q8CI51 ? ? 'cloning artifact' 7   7  
1 1WF7 SER A 98  ? UNP Q8CI51 ? ? 'cloning artifact' 98  8  
1 1WF7 GLY A 99  ? UNP Q8CI51 ? ? 'cloning artifact' 99  9  
1 1WF7 PRO A 100 ? UNP Q8CI51 ? ? 'cloning artifact' 100 10 
1 1WF7 SER A 101 ? UNP Q8CI51 ? ? 'cloning artifact' 101 11 
1 1WF7 SER A 102 ? UNP Q8CI51 ? ? 'cloning artifact' 102 12 
1 1WF7 GLY A 103 ? UNP Q8CI51 ? ? 'cloning artifact' 103 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.06mM 13C, 15N-labeled protein; 20mM PiNa(pH6.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_pdbx_nmr_refine.entry_id           1WF7 
_pdbx_nmr_refine.method             'torsion angle dynamic' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1WF7 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1WF7 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
VNMR    6.1C     collection           Varian          1 
NMRPipe 20020425 processing           Delaglio.F.     2 
NMRView 5.0.4    'data analysis'      'Johnson, B.A.' 3 
KUJIRA  0.854    'data analysis'      'Kobayashi, N.' 4 
CYANA   1.0.7    'structure solution' 'Guentert, P.'  5 
CYANA   1.0.7    refinement           'Guentert, P.'  6 
# 
_exptl.entry_id          1WF7 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1WF7 
_struct.title                     'Solution structure of the PDZ domain of Enigma homologue protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WF7 
_struct_keywords.pdbx_keywords   'Structural genomics, unknown function' 
_struct_keywords.text            
'PDZ domain, Enigma homologue protein, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 40 ? ALA A 45 ? GLY A 40 ALA A 45 1 ? 6  
HELX_P HELX_P2 2 THR A 65 ? CYS A 76 ? THR A 65 CYS A 76 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 7  ? VAL A 12 ? GLY A 7  VAL A 12 
A 2 SER A 79 ? LEU A 84 ? SER A 79 LEU A 84 
A 3 VAL A 53 ? ILE A 56 ? VAL A 53 ILE A 56 
A 4 ILE A 59 ? SER A 60 ? ILE A 59 SER A 60 
B 1 LEU A 21 ? GLY A 24 ? LEU A 21 GLY A 24 
B 2 MET A 29 ? ILE A 33 ? MET A 29 ILE A 33 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 9  ? N VAL A 9  O MET A 82 ? O MET A 82 
A 2 3 O THR A 83 ? O THR A 83 N LEU A 54 ? N LEU A 54 
A 3 4 N ILE A 56 ? N ILE A 56 O ILE A 59 ? O ILE A 59 
B 1 2 N GLY A 24 ? N GLY A 24 O MET A 29 ? O MET A 29 
# 
_database_PDB_matrix.entry_id          1WF7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WF7 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -6.742  -21.003 16.875  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -7.213  -21.485 15.588  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -7.352  -20.334 14.589  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -6.357  -19.739 14.180  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -6.625  -20.011 16.939  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -6.519  -22.228 15.198  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -8.176  -21.981 15.713  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -8.596  -20.055 14.226  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -8.878  -18.986 13.283  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -9.377  -17.748 14.030  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -10.128 -17.862 14.996  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -9.908  -19.429 12.241  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -11.049 -20.035 12.843  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -9.400  -20.544 14.564  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -7.929  -18.779 12.789  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -10.223 -18.566 11.654  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -9.445  -20.133 11.550  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -11.881 -19.569 12.543  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -8.938  -16.592 13.553  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -9.330  -15.333 14.163  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -9.215  -14.199 13.143  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -8.512  -14.329 12.142  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -8.476  -15.028 15.395  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -9.004  -15.630 16.574  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -8.326  -16.508 12.766  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -10.368 -15.471 14.466  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -7.460  -15.387 15.229  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -8.414  -13.949 15.535  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -8.275  -16.090 17.080  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -9.915  -13.112 13.433  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -9.899  -11.955 12.553  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -10.216 -10.674 13.327  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -11.382 -10.362 13.568  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -10.483 -13.014 14.249  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -8.921  -11.866 12.081  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -10.628 -12.092 11.754  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -9.159  -9.966  13.695  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -9.310  -8.725  14.436  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -8.202  -7.744  14.046  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -7.129  -8.156  13.607  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -9.287  -8.979  15.945  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -10.370 -8.336  16.610  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -8.214  -10.226 13.494  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -10.286 -8.334  14.149  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -9.331  -10.052 16.132  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -8.344  -8.622  16.358  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -11.094 -8.998  16.804  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -8.500  -6.465  14.220  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -7.543  -5.422  13.892  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -6.152  -5.810  14.399  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -6.022  -6.678  15.261  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -7.968  -4.078  14.484  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -7.795  -4.039  15.898  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -9.375  -6.138  14.577  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -7.549  -5.357  12.804  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -7.386  -3.278  14.026  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -9.014  -3.889  14.242  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -7.438  -4.914  16.223  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -5.149  -5.148  13.842  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -3.773  -5.412  14.228  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -2.795  -4.684  13.303  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -3.014  -4.611  12.095  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -5.263  -4.443  13.142  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -3.612  -5.092  15.257  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -3.581  -6.485  14.193  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . SER A 1 8   ? -1.736  -4.163  13.906  1.00 0.00 ? 8   SER A N    1  
ATOM 67    C CA   . SER A 1 8   ? -0.724  -3.444  13.152  1.00 0.00 ? 8   SER A CA   1  
ATOM 68    C C    . SER A 1 8   ? 0.405   -4.395  12.752  1.00 0.00 ? 8   SER A C    1  
ATOM 69    O O    . SER A 1 8   ? 0.537   -5.480  13.316  1.00 0.00 ? 8   SER A O    1  
ATOM 70    C CB   . SER A 1 8   ? -0.168  -2.269  13.959  1.00 0.00 ? 8   SER A CB   1  
ATOM 71    O OG   . SER A 1 8   ? 0.856   -1.573  13.253  1.00 0.00 ? 8   SER A OG   1  
ATOM 72    H H    . SER A 1 8   ? -1.565  -4.227  14.889  1.00 0.00 ? 8   SER A H    1  
ATOM 73    H HA   . SER A 1 8   ? -1.237  -3.066  12.268  1.00 0.00 ? 8   SER A HA   1  
ATOM 74    H HB2  . SER A 1 8   ? -0.976  -1.578  14.199  1.00 0.00 ? 8   SER A HB2  1  
ATOM 75    H HB3  . SER A 1 8   ? 0.230   -2.635  14.905  1.00 0.00 ? 8   SER A HB3  1  
ATOM 76    H HG   . SER A 1 8   ? 1.516   -1.189  13.898  1.00 0.00 ? 8   SER A HG   1  
ATOM 77    N N    . VAL A 1 9   ? 1.191   -3.954  11.781  1.00 0.00 ? 9   VAL A N    1  
ATOM 78    C CA   . VAL A 1 9   ? 2.305   -4.752  11.298  1.00 0.00 ? 9   VAL A CA   1  
ATOM 79    C C    . VAL A 1 9   ? 3.516   -3.845  11.070  1.00 0.00 ? 9   VAL A C    1  
ATOM 80    O O    . VAL A 1 9   ? 3.376   -2.627  10.982  1.00 0.00 ? 9   VAL A O    1  
ATOM 81    C CB   . VAL A 1 9   ? 1.891   -5.524  10.044  1.00 0.00 ? 9   VAL A CB   1  
ATOM 82    C CG1  . VAL A 1 9   ? 0.993   -4.670  9.146   1.00 0.00 ? 9   VAL A CG1  1  
ATOM 83    C CG2  . VAL A 1 9   ? 3.118   -6.022  9.277   1.00 0.00 ? 9   VAL A CG2  1  
ATOM 84    H H    . VAL A 1 9   ? 1.077   -3.070  11.327  1.00 0.00 ? 9   VAL A H    1  
ATOM 85    H HA   . VAL A 1 9   ? 2.551   -5.477  12.074  1.00 0.00 ? 9   VAL A HA   1  
ATOM 86    H HB   . VAL A 1 9   ? 1.317   -6.395  10.360  1.00 0.00 ? 9   VAL A HB   1  
ATOM 87    H HG11 . VAL A 1 9   ? 1.080   -5.012  8.115   1.00 0.00 ? 9   VAL A HG11 1  
ATOM 88    H HG12 . VAL A 1 9   ? -0.042  -4.762  9.474   1.00 0.00 ? 9   VAL A HG12 1  
ATOM 89    H HG13 . VAL A 1 9   ? 1.303   -3.627  9.210   1.00 0.00 ? 9   VAL A HG13 1  
ATOM 90    H HG21 . VAL A 1 9   ? 2.795   -6.596  8.408   1.00 0.00 ? 9   VAL A HG21 1  
ATOM 91    H HG22 . VAL A 1 9   ? 3.713   -5.170  8.949   1.00 0.00 ? 9   VAL A HG22 1  
ATOM 92    H HG23 . VAL A 1 9   ? 3.720   -6.657  9.927   1.00 0.00 ? 9   VAL A HG23 1  
ATOM 93    N N    . SER A 1 10  ? 4.678   -4.475  10.980  1.00 0.00 ? 10  SER A N    1  
ATOM 94    C CA   . SER A 1 10  ? 5.913   -3.741  10.764  1.00 0.00 ? 10  SER A CA   1  
ATOM 95    C C    . SER A 1 10  ? 6.719   -4.392  9.639   1.00 0.00 ? 10  SER A C    1  
ATOM 96    O O    . SER A 1 10  ? 6.839   -5.615  9.583   1.00 0.00 ? 10  SER A O    1  
ATOM 97    C CB   . SER A 1 10  ? 6.747   -3.676  12.045  1.00 0.00 ? 10  SER A CB   1  
ATOM 98    O OG   . SER A 1 10  ? 8.000   -3.031  11.834  1.00 0.00 ? 10  SER A OG   1  
ATOM 99    H H    . SER A 1 10  ? 4.784   -5.467  11.053  1.00 0.00 ? 10  SER A H    1  
ATOM 100   H HA   . SER A 1 10  ? 5.604   -2.734  10.481  1.00 0.00 ? 10  SER A HA   1  
ATOM 101   H HB2  . SER A 1 10  ? 6.189   -3.141  12.814  1.00 0.00 ? 10  SER A HB2  1  
ATOM 102   H HB3  . SER A 1 10  ? 6.917   -4.685  12.419  1.00 0.00 ? 10  SER A HB3  1  
ATOM 103   H HG   . SER A 1 10  ? 7.854   -2.086  11.541  1.00 0.00 ? 10  SER A HG   1  
ATOM 104   N N    . LEU A 1 11  ? 7.251   -3.545  8.769   1.00 0.00 ? 11  LEU A N    1  
ATOM 105   C CA   . LEU A 1 11  ? 8.042   -4.023  7.647   1.00 0.00 ? 11  LEU A CA   1  
ATOM 106   C C    . LEU A 1 11  ? 9.451   -3.433  7.735   1.00 0.00 ? 11  LEU A C    1  
ATOM 107   O O    . LEU A 1 11  ? 9.645   -2.362  8.307   1.00 0.00 ? 11  LEU A O    1  
ATOM 108   C CB   . LEU A 1 11  ? 7.332   -3.726  6.325   1.00 0.00 ? 11  LEU A CB   1  
ATOM 109   C CG   . LEU A 1 11  ? 5.809   -3.868  6.335   1.00 0.00 ? 11  LEU A CG   1  
ATOM 110   C CD1  . LEU A 1 11  ? 5.196   -3.297  5.054   1.00 0.00 ? 11  LEU A CD1  1  
ATOM 111   C CD2  . LEU A 1 11  ? 5.396   -5.323  6.569   1.00 0.00 ? 11  LEU A CD2  1  
ATOM 112   H H    . LEU A 1 11  ? 7.148   -2.552  8.820   1.00 0.00 ? 11  LEU A H    1  
ATOM 113   H HA   . LEU A 1 11  ? 8.115   -5.107  7.737   1.00 0.00 ? 11  LEU A HA   1  
ATOM 114   H HB2  . LEU A 1 11  ? 7.580   -2.708  6.023   1.00 0.00 ? 11  LEU A HB2  1  
ATOM 115   H HB3  . LEU A 1 11  ? 7.734   -4.392  5.562   1.00 0.00 ? 11  LEU A HB3  1  
ATOM 116   H HG   . LEU A 1 11  ? 5.416   -3.284  7.167   1.00 0.00 ? 11  LEU A HG   1  
ATOM 117   H HD11 . LEU A 1 11  ? 4.162   -3.009  5.243   1.00 0.00 ? 11  LEU A HD11 1  
ATOM 118   H HD12 . LEU A 1 11  ? 5.765   -2.423  4.738   1.00 0.00 ? 11  LEU A HD12 1  
ATOM 119   H HD13 . LEU A 1 11  ? 5.225   -4.053  4.269   1.00 0.00 ? 11  LEU A HD13 1  
ATOM 120   H HD21 . LEU A 1 11  ? 6.076   -5.783  7.286   1.00 0.00 ? 11  LEU A HD21 1  
ATOM 121   H HD22 . LEU A 1 11  ? 4.379   -5.353  6.961   1.00 0.00 ? 11  LEU A HD22 1  
ATOM 122   H HD23 . LEU A 1 11  ? 5.438   -5.869  5.626   1.00 0.00 ? 11  LEU A HD23 1  
ATOM 123   N N    . VAL A 1 12  ? 10.398  -4.159  7.160   1.00 0.00 ? 12  VAL A N    1  
ATOM 124   C CA   . VAL A 1 12  ? 11.784  -3.721  7.166   1.00 0.00 ? 12  VAL A CA   1  
ATOM 125   C C    . VAL A 1 12  ? 12.249  -3.494  5.726   1.00 0.00 ? 12  VAL A C    1  
ATOM 126   O O    . VAL A 1 12  ? 12.470  -4.449  4.983   1.00 0.00 ? 12  VAL A O    1  
ATOM 127   C CB   . VAL A 1 12  ? 12.649  -4.732  7.921   1.00 0.00 ? 12  VAL A CB   1  
ATOM 128   C CG1  . VAL A 1 12  ? 12.528  -6.127  7.302   1.00 0.00 ? 12  VAL A CG1  1  
ATOM 129   C CG2  . VAL A 1 12  ? 14.109  -4.277  7.967   1.00 0.00 ? 12  VAL A CG2  1  
ATOM 130   H H    . VAL A 1 12  ? 10.232  -5.030  6.696   1.00 0.00 ? 12  VAL A H    1  
ATOM 131   H HA   . VAL A 1 12  ? 11.827  -2.773  7.702   1.00 0.00 ? 12  VAL A HA   1  
ATOM 132   H HB   . VAL A 1 12  ? 12.283  -4.787  8.946   1.00 0.00 ? 12  VAL A HB   1  
ATOM 133   H HG11 . VAL A 1 12  ? 11.998  -6.785  7.991   1.00 0.00 ? 12  VAL A HG11 1  
ATOM 134   H HG12 . VAL A 1 12  ? 11.977  -6.062  6.365   1.00 0.00 ? 12  VAL A HG12 1  
ATOM 135   H HG13 . VAL A 1 12  ? 13.524  -6.527  7.111   1.00 0.00 ? 12  VAL A HG13 1  
ATOM 136   H HG21 . VAL A 1 12  ? 14.204  -3.310  7.474   1.00 0.00 ? 12  VAL A HG21 1  
ATOM 137   H HG22 . VAL A 1 12  ? 14.429  -4.189  9.006   1.00 0.00 ? 12  VAL A HG22 1  
ATOM 138   H HG23 . VAL A 1 12  ? 14.734  -5.009  7.456   1.00 0.00 ? 12  VAL A HG23 1  
ATOM 139   N N    . GLY A 1 13  ? 12.383  -2.223  5.374   1.00 0.00 ? 13  GLY A N    1  
ATOM 140   C CA   . GLY A 1 13  ? 12.817  -1.859  4.037   1.00 0.00 ? 13  GLY A CA   1  
ATOM 141   C C    . GLY A 1 13  ? 12.939  -0.340  3.895   1.00 0.00 ? 13  GLY A C    1  
ATOM 142   O O    . GLY A 1 13  ? 12.264  0.409   4.599   1.00 0.00 ? 13  GLY A O    1  
ATOM 143   H H    . GLY A 1 13  ? 12.200  -1.452  5.984   1.00 0.00 ? 13  GLY A H    1  
ATOM 144   H HA2  . GLY A 1 13  ? 13.778  -2.326  3.823   1.00 0.00 ? 13  GLY A HA2  1  
ATOM 145   H HA3  . GLY A 1 13  ? 12.107  -2.240  3.303   1.00 0.00 ? 13  GLY A HA3  1  
ATOM 146   N N    . PRO A 1 14  ? 13.828  0.080   2.955   1.00 0.00 ? 14  PRO A N    1  
ATOM 147   C CA   . PRO A 1 14  ? 14.048  1.495   2.712   1.00 0.00 ? 14  PRO A CA   1  
ATOM 148   C C    . PRO A 1 14  ? 12.882  2.105   1.931   1.00 0.00 ? 14  PRO A C    1  
ATOM 149   O O    . PRO A 1 14  ? 12.832  3.317   1.727   1.00 0.00 ? 14  PRO A O    1  
ATOM 150   C CB   . PRO A 1 14  ? 15.367  1.566   1.961   1.00 0.00 ? 14  PRO A CB   1  
ATOM 151   C CG   . PRO A 1 14  ? 15.606  0.171   1.406   1.00 0.00 ? 14  PRO A CG   1  
ATOM 152   C CD   . PRO A 1 14  ? 14.646  -0.779  2.103   1.00 0.00 ? 14  PRO A CD   1  
ATOM 153   H HA   . PRO A 1 14  ? 14.087  1.994   3.578   1.00 0.00 ? 14  PRO A HA   1  
ATOM 154   H HB2  . PRO A 1 14  ? 15.322  2.303   1.160   1.00 0.00 ? 14  PRO A HB2  1  
ATOM 155   H HB3  . PRO A 1 14  ? 16.179  1.866   2.624   1.00 0.00 ? 14  PRO A HB3  1  
ATOM 156   H HG2  . PRO A 1 14  ? 15.442  0.156   0.328   1.00 0.00 ? 14  PRO A HG2  1  
ATOM 157   H HG3  . PRO A 1 14  ? 16.637  -0.136  1.575   1.00 0.00 ? 14  PRO A HG3  1  
ATOM 158   H HD2  . PRO A 1 14  ? 14.032  -1.321  1.384   1.00 0.00 ? 14  PRO A HD2  1  
ATOM 159   H HD3  . PRO A 1 14  ? 15.182  -1.524  2.690   1.00 0.00 ? 14  PRO A HD3  1  
ATOM 160   N N    . ALA A 1 15  ? 11.972  1.236   1.514   1.00 0.00 ? 15  ALA A N    1  
ATOM 161   C CA   . ALA A 1 15  ? 10.810  1.673   0.760   1.00 0.00 ? 15  ALA A CA   1  
ATOM 162   C C    . ALA A 1 15  ? 10.193  0.472   0.040   1.00 0.00 ? 15  ALA A C    1  
ATOM 163   O O    . ALA A 1 15  ? 8.989   0.239   0.135   1.00 0.00 ? 15  ALA A O    1  
ATOM 164   C CB   . ALA A 1 15  ? 11.218  2.785   -0.208  1.00 0.00 ? 15  ALA A CB   1  
ATOM 165   H H    . ALA A 1 15  ? 12.020  0.251   1.684   1.00 0.00 ? 15  ALA A H    1  
ATOM 166   H HA   . ALA A 1 15  ? 10.085  2.073   1.469   1.00 0.00 ? 15  ALA A HA   1  
ATOM 167   H HB1  . ALA A 1 15  ? 10.746  2.617   -1.176  1.00 0.00 ? 15  ALA A HB1  1  
ATOM 168   H HB2  . ALA A 1 15  ? 10.899  3.749   0.190   1.00 0.00 ? 15  ALA A HB2  1  
ATOM 169   H HB3  . ALA A 1 15  ? 12.302  2.783   -0.328  1.00 0.00 ? 15  ALA A HB3  1  
ATOM 170   N N    . PRO A 1 16  ? 11.069  -0.278  -0.681  1.00 0.00 ? 16  PRO A N    1  
ATOM 171   C CA   . PRO A 1 16  ? 10.622  -1.450  -1.416  1.00 0.00 ? 16  PRO A CA   1  
ATOM 172   C C    . PRO A 1 16  ? 10.347  -2.619  -0.468  1.00 0.00 ? 16  PRO A C    1  
ATOM 173   O O    . PRO A 1 16  ? 11.156  -3.540  -0.362  1.00 0.00 ? 16  PRO A O    1  
ATOM 174   C CB   . PRO A 1 16  ? 11.736  -1.739  -2.409  1.00 0.00 ? 16  PRO A CB   1  
ATOM 175   C CG   . PRO A 1 16  ? 12.962  -1.010  -1.884  1.00 0.00 ? 16  PRO A CG   1  
ATOM 176   C CD   . PRO A 1 16  ? 12.502  -0.032  -0.815  1.00 0.00 ? 16  PRO A CD   1  
ATOM 177   H HA   . PRO A 1 16  ? 9.755   -1.261  -1.876  1.00 0.00 ? 16  PRO A HA   1  
ATOM 178   H HB2  . PRO A 1 16  ? 11.922  -2.810  -2.486  1.00 0.00 ? 16  PRO A HB2  1  
ATOM 179   H HB3  . PRO A 1 16  ? 11.471  -1.389  -3.406  1.00 0.00 ? 16  PRO A HB3  1  
ATOM 180   H HG2  . PRO A 1 16  ? 13.679  -1.719  -1.469  1.00 0.00 ? 16  PRO A HG2  1  
ATOM 181   H HG3  . PRO A 1 16  ? 13.468  -0.482  -2.692  1.00 0.00 ? 16  PRO A HG3  1  
ATOM 182   H HD2  . PRO A 1 16  ? 13.022  -0.201  0.127   1.00 0.00 ? 16  PRO A HD2  1  
ATOM 183   H HD3  . PRO A 1 16  ? 12.700  0.998   -1.109  1.00 0.00 ? 16  PRO A HD3  1  
ATOM 184   N N    . TRP A 1 17  ? 9.203   -2.545  0.196   1.00 0.00 ? 17  TRP A N    1  
ATOM 185   C CA   . TRP A 1 17  ? 8.811   -3.586  1.130   1.00 0.00 ? 17  TRP A CA   1  
ATOM 186   C C    . TRP A 1 17  ? 8.449   -4.834  0.323   1.00 0.00 ? 17  TRP A C    1  
ATOM 187   O O    . TRP A 1 17  ? 8.511   -5.950  0.838   1.00 0.00 ? 17  TRP A O    1  
ATOM 188   C CB   . TRP A 1 17  ? 7.674   -3.109  2.036   1.00 0.00 ? 17  TRP A CB   1  
ATOM 189   C CG   . TRP A 1 17  ? 7.714   -1.612  2.350   1.00 0.00 ? 17  TRP A CG   1  
ATOM 190   C CD1  . TRP A 1 17  ? 7.156   -0.609  1.658   1.00 0.00 ? 17  TRP A CD1  1  
ATOM 191   C CD2  . TRP A 1 17  ? 8.371   -0.986  3.472   1.00 0.00 ? 17  TRP A CD2  1  
ATOM 192   N NE1  . TRP A 1 17  ? 7.405   0.613   2.248   1.00 0.00 ? 17  TRP A NE1  1  
ATOM 193   C CE2  . TRP A 1 17  ? 8.168   0.377   3.387   1.00 0.00 ? 17  TRP A CE2  1  
ATOM 194   C CE3  . TRP A 1 17  ? 9.113   -1.551  4.523   1.00 0.00 ? 17  TRP A CE3  1  
ATOM 195   C CZ2  . TRP A 1 17  ? 8.673   1.287   4.322   1.00 0.00 ? 17  TRP A CZ2  1  
ATOM 196   C CZ3  . TRP A 1 17  ? 9.612   -0.628  5.450   1.00 0.00 ? 17  TRP A CZ3  1  
ATOM 197   C CH2  . TRP A 1 17  ? 9.416   0.746   5.378   1.00 0.00 ? 17  TRP A CH2  1  
ATOM 198   H H    . TRP A 1 17  ? 8.551   -1.792  0.103   1.00 0.00 ? 17  TRP A H    1  
ATOM 199   H HA   . TRP A 1 17  ? 9.665   -3.793  1.775   1.00 0.00 ? 17  TRP A HA   1  
ATOM 200   H HB2  . TRP A 1 17  ? 6.722   -3.345  1.562   1.00 0.00 ? 17  TRP A HB2  1  
ATOM 201   H HB3  . TRP A 1 17  ? 7.711   -3.667  2.972   1.00 0.00 ? 17  TRP A HB3  1  
ATOM 202   H HD1  . TRP A 1 17  ? 6.579   -0.742  0.743   1.00 0.00 ? 17  TRP A HD1  1  
ATOM 203   H HE1  . TRP A 1 17  ? 7.067   1.584   1.889   1.00 0.00 ? 17  TRP A HE1  1  
ATOM 204   H HE3  . TRP A 1 17  ? 9.288   -2.623  4.613   1.00 0.00 ? 17  TRP A HE3  1  
ATOM 205   H HZ2  . TRP A 1 17  ? 8.499   2.359   4.233   1.00 0.00 ? 17  TRP A HZ2  1  
ATOM 206   H HZ3  . TRP A 1 17  ? 10.195  -1.014  6.286   1.00 0.00 ? 17  TRP A HZ3  1  
ATOM 207   H HH2  . TRP A 1 17  ? 9.838   1.400   6.142   1.00 0.00 ? 17  TRP A HH2  1  
ATOM 208   N N    . GLY A 1 18  ? 8.079   -4.604  -0.928  1.00 0.00 ? 18  GLY A N    1  
ATOM 209   C CA   . GLY A 1 18  ? 7.707   -5.696  -1.811  1.00 0.00 ? 18  GLY A CA   1  
ATOM 210   C C    . GLY A 1 18  ? 6.218   -5.639  -2.157  1.00 0.00 ? 18  GLY A C    1  
ATOM 211   O O    . GLY A 1 18  ? 5.772   -6.283  -3.105  1.00 0.00 ? 18  GLY A O    1  
ATOM 212   H H    . GLY A 1 18  ? 8.032   -3.693  -1.339  1.00 0.00 ? 18  GLY A H    1  
ATOM 213   H HA2  . GLY A 1 18  ? 8.299   -5.647  -2.726  1.00 0.00 ? 18  GLY A HA2  1  
ATOM 214   H HA3  . GLY A 1 18  ? 7.938   -6.649  -1.334  1.00 0.00 ? 18  GLY A HA3  1  
ATOM 215   N N    . PHE A 1 19  ? 5.490   -4.862  -1.368  1.00 0.00 ? 19  PHE A N    1  
ATOM 216   C CA   . PHE A 1 19  ? 4.060   -4.713  -1.579  1.00 0.00 ? 19  PHE A CA   1  
ATOM 217   C C    . PHE A 1 19  ? 3.736   -3.353  -2.201  1.00 0.00 ? 19  PHE A C    1  
ATOM 218   O O    . PHE A 1 19  ? 4.513   -2.408  -2.074  1.00 0.00 ? 19  PHE A O    1  
ATOM 219   C CB   . PHE A 1 19  ? 3.394   -4.803  -0.204  1.00 0.00 ? 19  PHE A CB   1  
ATOM 220   C CG   . PHE A 1 19  ? 3.333   -3.471  0.547   1.00 0.00 ? 19  PHE A CG   1  
ATOM 221   C CD1  . PHE A 1 19  ? 2.443   -2.516  0.166   1.00 0.00 ? 19  PHE A CD1  1  
ATOM 222   C CD2  . PHE A 1 19  ? 4.169   -3.243  1.595   1.00 0.00 ? 19  PHE A CD2  1  
ATOM 223   C CE1  . PHE A 1 19  ? 2.387   -1.280  0.863   1.00 0.00 ? 19  PHE A CE1  1  
ATOM 224   C CE2  . PHE A 1 19  ? 4.113   -2.007  2.291   1.00 0.00 ? 19  PHE A CE2  1  
ATOM 225   C CZ   . PHE A 1 19  ? 3.223   -1.052  1.911   1.00 0.00 ? 19  PHE A CZ   1  
ATOM 226   H H    . PHE A 1 19  ? 5.860   -4.342  -0.599  1.00 0.00 ? 19  PHE A H    1  
ATOM 227   H HA   . PHE A 1 19  ? 3.748   -5.505  -2.259  1.00 0.00 ? 19  PHE A HA   1  
ATOM 228   H HB2  . PHE A 1 19  ? 2.380   -5.185  -0.327  1.00 0.00 ? 19  PHE A HB2  1  
ATOM 229   H HB3  . PHE A 1 19  ? 3.936   -5.527  0.404   1.00 0.00 ? 19  PHE A HB3  1  
ATOM 230   H HD1  . PHE A 1 19  ? 1.773   -2.699  -0.674  1.00 0.00 ? 19  PHE A HD1  1  
ATOM 231   H HD2  . PHE A 1 19  ? 4.883   -4.009  1.899   1.00 0.00 ? 19  PHE A HD2  1  
ATOM 232   H HE1  . PHE A 1 19  ? 1.674   -0.514  0.558   1.00 0.00 ? 19  PHE A HE1  1  
ATOM 233   H HE2  . PHE A 1 19  ? 4.784   -1.824  3.131   1.00 0.00 ? 19  PHE A HE2  1  
ATOM 234   H HZ   . PHE A 1 19  ? 3.180   -0.103  2.446   1.00 0.00 ? 19  PHE A HZ   1  
ATOM 235   N N    . ARG A 1 20  ? 2.588   -3.298  -2.860  1.00 0.00 ? 20  ARG A N    1  
ATOM 236   C CA   . ARG A 1 20  ? 2.153   -2.069  -3.502  1.00 0.00 ? 20  ARG A CA   1  
ATOM 237   C C    . ARG A 1 20  ? 0.788   -1.641  -2.959  1.00 0.00 ? 20  ARG A C    1  
ATOM 238   O O    . ARG A 1 20  ? 0.171   -2.367  -2.181  1.00 0.00 ? 20  ARG A O    1  
ATOM 239   C CB   . ARG A 1 20  ? 2.058   -2.245  -5.019  1.00 0.00 ? 20  ARG A CB   1  
ATOM 240   C CG   . ARG A 1 20  ? 3.419   -2.027  -5.683  1.00 0.00 ? 20  ARG A CG   1  
ATOM 241   C CD   . ARG A 1 20  ? 3.398   -0.791  -6.585  1.00 0.00 ? 20  ARG A CD   1  
ATOM 242   N NE   . ARG A 1 20  ? 4.730   -0.588  -7.197  1.00 0.00 ? 20  ARG A NE   1  
ATOM 243   C CZ   . ARG A 1 20  ? 4.947   0.143   -8.299  1.00 0.00 ? 20  ARG A CZ   1  
ATOM 244   N NH1  . ARG A 1 20  ? 3.922   0.745   -8.916  1.00 0.00 ? 20  ARG A NH1  1  
ATOM 245   N NH2  . ARG A 1 20  ? 6.190   0.272   -8.783  1.00 0.00 ? 20  ARG A NH2  1  
ATOM 246   H H    . ARG A 1 20  ? 1.962   -4.071  -2.959  1.00 0.00 ? 20  ARG A H    1  
ATOM 247   H HA   . ARG A 1 20  ? 2.921   -1.337  -3.254  1.00 0.00 ? 20  ARG A HA   1  
ATOM 248   H HB2  . ARG A 1 20  ? 1.692   -3.245  -5.251  1.00 0.00 ? 20  ARG A HB2  1  
ATOM 249   H HB3  . ARG A 1 20  ? 1.334   -1.538  -5.426  1.00 0.00 ? 20  ARG A HB3  1  
ATOM 250   H HG2  . ARG A 1 20  ? 4.186   -1.909  -4.917  1.00 0.00 ? 20  ARG A HG2  1  
ATOM 251   H HG3  . ARG A 1 20  ? 3.686   -2.905  -6.270  1.00 0.00 ? 20  ARG A HG3  1  
ATOM 252   H HD2  . ARG A 1 20  ? 2.646   -0.913  -7.364  1.00 0.00 ? 20  ARG A HD2  1  
ATOM 253   H HD3  . ARG A 1 20  ? 3.117   0.088   -6.005  1.00 0.00 ? 20  ARG A HD3  1  
ATOM 254   H HE   . ARG A 1 20  ? 5.517   -1.024  -6.761  1.00 0.00 ? 20  ARG A HE   1  
ATOM 255   H HH11 . ARG A 1 20  ? 2.994   0.648   -8.555  1.00 0.00 ? 20  ARG A HH11 1  
ATOM 256   H HH12 . ARG A 1 20  ? 4.084   1.290   -9.739  1.00 0.00 ? 20  ARG A HH12 1  
ATOM 257   H HH21 . ARG A 1 20  ? 6.956   -0.177  -8.322  1.00 0.00 ? 20  ARG A HH21 1  
ATOM 258   H HH22 . ARG A 1 20  ? 6.352   0.817   -9.605  1.00 0.00 ? 20  ARG A HH22 1  
ATOM 259   N N    . LEU A 1 21  ? 0.357   -0.465  -3.391  1.00 0.00 ? 21  LEU A N    1  
ATOM 260   C CA   . LEU A 1 21  ? -0.923  0.068   -2.957  1.00 0.00 ? 21  LEU A CA   1  
ATOM 261   C C    . LEU A 1 21  ? -1.798  0.343   -4.182  1.00 0.00 ? 21  LEU A C    1  
ATOM 262   O O    . LEU A 1 21  ? -1.292  0.719   -5.238  1.00 0.00 ? 21  LEU A O    1  
ATOM 263   C CB   . LEU A 1 21  ? -0.719  1.291   -2.061  1.00 0.00 ? 21  LEU A CB   1  
ATOM 264   C CG   . LEU A 1 21  ? -0.179  1.011   -0.657  1.00 0.00 ? 21  LEU A CG   1  
ATOM 265   C CD1  . LEU A 1 21  ? -0.337  2.236   0.246   1.00 0.00 ? 21  LEU A CD1  1  
ATOM 266   C CD2  . LEU A 1 21  ? -0.837  -0.233  -0.055  1.00 0.00 ? 21  LEU A CD2  1  
ATOM 267   H H    . LEU A 1 21  ? 0.865   0.118   -4.024  1.00 0.00 ? 21  LEU A H    1  
ATOM 268   H HA   . LEU A 1 21  ? -1.408  -0.698  -2.352  1.00 0.00 ? 21  LEU A HA   1  
ATOM 269   H HB2  . LEU A 1 21  ? -0.033  1.973   -2.563  1.00 0.00 ? 21  LEU A HB2  1  
ATOM 270   H HB3  . LEU A 1 21  ? -1.672  1.810   -1.966  1.00 0.00 ? 21  LEU A HB3  1  
ATOM 271   H HG   . LEU A 1 21  ? 0.888   0.804   -0.736  1.00 0.00 ? 21  LEU A HG   1  
ATOM 272   H HD11 . LEU A 1 21  ? 0.051   2.008   1.238   1.00 0.00 ? 21  LEU A HD11 1  
ATOM 273   H HD12 . LEU A 1 21  ? 0.217   3.073   -0.178  1.00 0.00 ? 21  LEU A HD12 1  
ATOM 274   H HD13 . LEU A 1 21  ? -1.393  2.499   0.320   1.00 0.00 ? 21  LEU A HD13 1  
ATOM 275   H HD21 . LEU A 1 21  ? -1.853  -0.329  -0.439  1.00 0.00 ? 21  LEU A HD21 1  
ATOM 276   H HD22 . LEU A 1 21  ? -0.260  -1.117  -0.329  1.00 0.00 ? 21  LEU A HD22 1  
ATOM 277   H HD23 . LEU A 1 21  ? -0.865  -0.140  1.031   1.00 0.00 ? 21  LEU A HD23 1  
ATOM 278   N N    . GLN A 1 22  ? -3.095  0.143   -4.000  1.00 0.00 ? 22  GLN A N    1  
ATOM 279   C CA   . GLN A 1 22  ? -4.044  0.365   -5.078  1.00 0.00 ? 22  GLN A CA   1  
ATOM 280   C C    . GLN A 1 22  ? -5.369  0.889   -4.519  1.00 0.00 ? 22  GLN A C    1  
ATOM 281   O O    . GLN A 1 22  ? -5.857  0.395   -3.504  1.00 0.00 ? 22  GLN A O    1  
ATOM 282   C CB   . GLN A 1 22  ? -4.260  -0.913  -5.890  1.00 0.00 ? 22  GLN A CB   1  
ATOM 283   C CG   . GLN A 1 22  ? -4.852  -2.023  -5.019  1.00 0.00 ? 22  GLN A CG   1  
ATOM 284   C CD   . GLN A 1 22  ? -5.399  -3.163  -5.881  1.00 0.00 ? 22  GLN A CD   1  
ATOM 285   O OE1  . GLN A 1 22  ? -5.746  -2.990  -7.038  1.00 0.00 ? 22  GLN A OE1  1  
ATOM 286   N NE2  . GLN A 1 22  ? -5.458  -4.335  -5.254  1.00 0.00 ? 22  GLN A NE2  1  
ATOM 287   H H    . GLN A 1 22  ? -3.498  -0.163  -3.138  1.00 0.00 ? 22  GLN A H    1  
ATOM 288   H HA   . GLN A 1 22  ? -3.587  1.121   -5.716  1.00 0.00 ? 22  GLN A HA   1  
ATOM 289   H HB2  . GLN A 1 22  ? -4.927  -0.708  -6.727  1.00 0.00 ? 22  GLN A HB2  1  
ATOM 290   H HB3  . GLN A 1 22  ? -3.311  -1.245  -6.312  1.00 0.00 ? 22  GLN A HB3  1  
ATOM 291   H HG2  . GLN A 1 22  ? -4.088  -2.407  -4.344  1.00 0.00 ? 22  GLN A HG2  1  
ATOM 292   H HG3  . GLN A 1 22  ? -5.650  -1.616  -4.398  1.00 0.00 ? 22  GLN A HG3  1  
ATOM 293   H HE21 . GLN A 1 22  ? -5.157  -4.409  -4.303  1.00 0.00 ? 22  GLN A HE21 1  
ATOM 294   H HE22 . GLN A 1 22  ? -5.802  -5.142  -5.734  1.00 0.00 ? 22  GLN A HE22 1  
ATOM 295   N N    . GLY A 1 23  ? -5.912  1.883   -5.206  1.00 0.00 ? 23  GLY A N    1  
ATOM 296   C CA   . GLY A 1 23  ? -7.170  2.480   -4.791  1.00 0.00 ? 23  GLY A CA   1  
ATOM 297   C C    . GLY A 1 23  ? -6.945  3.866   -4.183  1.00 0.00 ? 23  GLY A C    1  
ATOM 298   O O    . GLY A 1 23  ? -5.925  4.503   -4.441  1.00 0.00 ? 23  GLY A O    1  
ATOM 299   H H    . GLY A 1 23  ? -5.508  2.280   -6.031  1.00 0.00 ? 23  GLY A H    1  
ATOM 300   H HA2  . GLY A 1 23  ? -7.839  2.559   -5.648  1.00 0.00 ? 23  GLY A HA2  1  
ATOM 301   H HA3  . GLY A 1 23  ? -7.660  1.835   -4.062  1.00 0.00 ? 23  GLY A HA3  1  
ATOM 302   N N    . GLY A 1 24  ? -7.915  4.293   -3.388  1.00 0.00 ? 24  GLY A N    1  
ATOM 303   C CA   . GLY A 1 24  ? -7.836  5.592   -2.742  1.00 0.00 ? 24  GLY A CA   1  
ATOM 304   C C    . GLY A 1 24  ? -9.069  6.439   -3.061  1.00 0.00 ? 24  GLY A C    1  
ATOM 305   O O    . GLY A 1 24  ? -9.916  6.035   -3.857  1.00 0.00 ? 24  GLY A O    1  
ATOM 306   H H    . GLY A 1 24  ? -8.742  3.769   -3.184  1.00 0.00 ? 24  GLY A H    1  
ATOM 307   H HA2  . GLY A 1 24  ? -7.750  5.461   -1.663  1.00 0.00 ? 24  GLY A HA2  1  
ATOM 308   H HA3  . GLY A 1 24  ? -6.937  6.112   -3.072  1.00 0.00 ? 24  GLY A HA3  1  
ATOM 309   N N    . LYS A 1 25  ? -9.131  7.600   -2.425  1.00 0.00 ? 25  LYS A N    1  
ATOM 310   C CA   . LYS A 1 25  ? -10.247 8.508   -2.632  1.00 0.00 ? 25  LYS A CA   1  
ATOM 311   C C    . LYS A 1 25  ? -10.278 8.945   -4.097  1.00 0.00 ? 25  LYS A C    1  
ATOM 312   O O    . LYS A 1 25  ? -11.340 8.972   -4.718  1.00 0.00 ? 25  LYS A O    1  
ATOM 313   C CB   . LYS A 1 25  ? -10.179 9.674   -1.643  1.00 0.00 ? 25  LYS A CB   1  
ATOM 314   C CG   . LYS A 1 25  ? -11.314 9.594   -0.622  1.00 0.00 ? 25  LYS A CG   1  
ATOM 315   C CD   . LYS A 1 25  ? -11.004 10.445  0.612   1.00 0.00 ? 25  LYS A CD   1  
ATOM 316   C CE   . LYS A 1 25  ? -11.380 11.909  0.377   1.00 0.00 ? 25  LYS A CE   1  
ATOM 317   N NZ   . LYS A 1 25  ? -12.143 12.439  1.529   1.00 0.00 ? 25  LYS A NZ   1  
ATOM 318   H H    . LYS A 1 25  ? -8.439  7.922   -1.780  1.00 0.00 ? 25  LYS A H    1  
ATOM 319   H HA   . LYS A 1 25  ? -11.162 7.956   -2.416  1.00 0.00 ? 25  LYS A HA   1  
ATOM 320   H HB2  . LYS A 1 25  ? -9.219  9.663   -1.127  1.00 0.00 ? 25  LYS A HB2  1  
ATOM 321   H HB3  . LYS A 1 25  ? -10.237 10.618  -2.185  1.00 0.00 ? 25  LYS A HB3  1  
ATOM 322   H HG2  . LYS A 1 25  ? -12.244 9.935   -1.078  1.00 0.00 ? 25  LYS A HG2  1  
ATOM 323   H HG3  . LYS A 1 25  ? -11.468 8.557   -0.323  1.00 0.00 ? 25  LYS A HG3  1  
ATOM 324   H HD2  . LYS A 1 25  ? -11.550 10.058  1.472   1.00 0.00 ? 25  LYS A HD2  1  
ATOM 325   H HD3  . LYS A 1 25  ? -9.942  10.372  0.850   1.00 0.00 ? 25  LYS A HD3  1  
ATOM 326   H HE2  . LYS A 1 25  ? -10.479 12.503  0.225   1.00 0.00 ? 25  LYS A HE2  1  
ATOM 327   H HE3  . LYS A 1 25  ? -11.976 11.996  -0.532  1.00 0.00 ? 25  LYS A HE3  1  
ATOM 328   H HZ1  . LYS A 1 25  ? -11.738 13.303  1.828   1.00 0.00 ? 25  LYS A HZ1  1  
ATOM 329   H HZ2  . LYS A 1 25  ? -13.093 12.593  1.257   1.00 0.00 ? 25  LYS A HZ2  1  
ATOM 330   H HZ3  . LYS A 1 25  ? -12.114 11.779  2.280   1.00 0.00 ? 25  LYS A HZ3  1  
ATOM 331   N N    . ASP A 1 26  ? -9.101  9.276   -4.608  1.00 0.00 ? 26  ASP A N    1  
ATOM 332   C CA   . ASP A 1 26  ? -8.981  9.711   -5.989  1.00 0.00 ? 26  ASP A CA   1  
ATOM 333   C C    . ASP A 1 26  ? -9.385  8.564   -6.918  1.00 0.00 ? 26  ASP A C    1  
ATOM 334   O O    . ASP A 1 26  ? -9.767  8.794   -8.064  1.00 0.00 ? 26  ASP A O    1  
ATOM 335   C CB   . ASP A 1 26  ? -7.539  10.101  -6.320  1.00 0.00 ? 26  ASP A CB   1  
ATOM 336   C CG   . ASP A 1 26  ? -7.198  10.114  -7.812  1.00 0.00 ? 26  ASP A CG   1  
ATOM 337   O OD1  . ASP A 1 26  ? -7.543  11.123  -8.464  1.00 0.00 ? 26  ASP A OD1  1  
ATOM 338   O OD2  . ASP A 1 26  ? -6.601  9.114   -8.266  1.00 0.00 ? 26  ASP A OD2  1  
ATOM 339   H H    . ASP A 1 26  ? -8.243  9.252   -4.096  1.00 0.00 ? 26  ASP A H    1  
ATOM 340   H HA   . ASP A 1 26  ? -9.643  10.572  -6.078  1.00 0.00 ? 26  ASP A HA   1  
ATOM 341   H HB2  . ASP A 1 26  ? -7.342  11.091  -5.910  1.00 0.00 ? 26  ASP A HB2  1  
ATOM 342   H HB3  . ASP A 1 26  ? -6.866  9.407   -5.815  1.00 0.00 ? 26  ASP A HB3  1  
ATOM 343   N N    . PHE A 1 27  ? -9.288  7.354   -6.388  1.00 0.00 ? 27  PHE A N    1  
ATOM 344   C CA   . PHE A 1 27  ? -9.639  6.170   -7.154  1.00 0.00 ? 27  PHE A CA   1  
ATOM 345   C C    . PHE A 1 27  ? -11.100 5.781   -6.923  1.00 0.00 ? 27  PHE A C    1  
ATOM 346   O O    . PHE A 1 27  ? -11.690 5.063   -7.729  1.00 0.00 ? 27  PHE A O    1  
ATOM 347   C CB   . PHE A 1 27  ? -8.737  5.036   -6.664  1.00 0.00 ? 27  PHE A CB   1  
ATOM 348   C CG   . PHE A 1 27  ? -7.311  5.093   -7.215  1.00 0.00 ? 27  PHE A CG   1  
ATOM 349   C CD1  . PHE A 1 27  ? -6.516  6.161   -6.935  1.00 0.00 ? 27  PHE A CD1  1  
ATOM 350   C CD2  . PHE A 1 27  ? -6.837  4.076   -7.983  1.00 0.00 ? 27  PHE A CD2  1  
ATOM 351   C CE1  . PHE A 1 27  ? -5.192  6.214   -7.446  1.00 0.00 ? 27  PHE A CE1  1  
ATOM 352   C CE2  . PHE A 1 27  ? -5.513  4.129   -8.494  1.00 0.00 ? 27  PHE A CE2  1  
ATOM 353   C CZ   . PHE A 1 27  ? -4.719  5.197   -8.215  1.00 0.00 ? 27  PHE A CZ   1  
ATOM 354   H H    . PHE A 1 27  ? -8.976  7.175   -5.454  1.00 0.00 ? 27  PHE A H    1  
ATOM 355   H HA   . PHE A 1 27  ? -9.492  6.412   -8.207  1.00 0.00 ? 27  PHE A HA   1  
ATOM 356   H HB2  . PHE A 1 27  ? -8.696  5.062   -5.575  1.00 0.00 ? 27  PHE A HB2  1  
ATOM 357   H HB3  . PHE A 1 27  ? -9.185  4.082   -6.943  1.00 0.00 ? 27  PHE A HB3  1  
ATOM 358   H HD1  . PHE A 1 27  ? -6.895  6.976   -6.319  1.00 0.00 ? 27  PHE A HD1  1  
ATOM 359   H HD2  . PHE A 1 27  ? -7.474  3.220   -8.207  1.00 0.00 ? 27  PHE A HD2  1  
ATOM 360   H HE1  . PHE A 1 27  ? -4.555  7.070   -7.223  1.00 0.00 ? 27  PHE A HE1  1  
ATOM 361   H HE2  . PHE A 1 27  ? -5.134  3.313   -9.110  1.00 0.00 ? 27  PHE A HE2  1  
ATOM 362   H HZ   . PHE A 1 27  ? -3.703  5.237   -8.607  1.00 0.00 ? 27  PHE A HZ   1  
ATOM 363   N N    . ASN A 1 28  ? -11.642 6.271   -5.817  1.00 0.00 ? 28  ASN A N    1  
ATOM 364   C CA   . ASN A 1 28  ? -13.023 5.982   -5.469  1.00 0.00 ? 28  ASN A CA   1  
ATOM 365   C C    . ASN A 1 28  ? -13.104 4.596   -4.828  1.00 0.00 ? 28  ASN A C    1  
ATOM 366   O O    . ASN A 1 28  ? -14.097 3.888   -4.994  1.00 0.00 ? 28  ASN A O    1  
ATOM 367   C CB   . ASN A 1 28  ? -13.915 5.982   -6.712  1.00 0.00 ? 28  ASN A CB   1  
ATOM 368   C CG   . ASN A 1 28  ? -15.331 6.452   -6.371  1.00 0.00 ? 28  ASN A CG   1  
ATOM 369   O OD1  . ASN A 1 28  ? -15.659 6.740   -5.232  1.00 0.00 ? 28  ASN A OD1  1  
ATOM 370   N ND2  . ASN A 1 28  ? -16.147 6.515   -7.419  1.00 0.00 ? 28  ASN A ND2  1  
ATOM 371   H H    . ASN A 1 28  ? -11.155 6.853   -5.167  1.00 0.00 ? 28  ASN A H    1  
ATOM 372   H HA   . ASN A 1 28  ? -13.317 6.777   -4.783  1.00 0.00 ? 28  ASN A HA   1  
ATOM 373   H HB2  . ASN A 1 28  ? -13.485 6.633   -7.473  1.00 0.00 ? 28  ASN A HB2  1  
ATOM 374   H HB3  . ASN A 1 28  ? -13.954 4.978   -7.136  1.00 0.00 ? 28  ASN A HB3  1  
ATOM 375   H HD21 . ASN A 1 28  ? -15.814 6.264   -8.328  1.00 0.00 ? 28  ASN A HD21 1  
ATOM 376   H HD22 . ASN A 1 28  ? -17.094 6.812   -7.298  1.00 0.00 ? 28  ASN A HD22 1  
ATOM 377   N N    . MET A 1 29  ? -12.047 4.248   -4.109  1.00 0.00 ? 29  MET A N    1  
ATOM 378   C CA   . MET A 1 29  ? -11.986 2.959   -3.443  1.00 0.00 ? 29  MET A CA   1  
ATOM 379   C C    . MET A 1 29  ? -11.018 2.999   -2.258  1.00 0.00 ? 29  MET A C    1  
ATOM 380   O O    . MET A 1 29  ? -10.212 3.920   -2.142  1.00 0.00 ? 29  MET A O    1  
ATOM 381   C CB   . MET A 1 29  ? -11.531 1.890   -4.438  1.00 0.00 ? 29  MET A CB   1  
ATOM 382   C CG   . MET A 1 29  ? -10.005 1.774   -4.460  1.00 0.00 ? 29  MET A CG   1  
ATOM 383   S SD   . MET A 1 29  ? -9.501  0.576   -5.682  1.00 0.00 ? 29  MET A SD   1  
ATOM 384   C CE   . MET A 1 29  ? -8.955  -0.746  -4.614  1.00 0.00 ? 29  MET A CE   1  
ATOM 385   H H    . MET A 1 29  ? -11.243 4.829   -3.979  1.00 0.00 ? 29  MET A H    1  
ATOM 386   H HA   . MET A 1 29  ? -12.998 2.765   -3.087  1.00 0.00 ? 29  MET A HA   1  
ATOM 387   H HB2  . MET A 1 29  ? -11.968 0.928   -4.170  1.00 0.00 ? 29  MET A HB2  1  
ATOM 388   H HB3  . MET A 1 29  ? -11.894 2.138   -5.435  1.00 0.00 ? 29  MET A HB3  1  
ATOM 389   H HG2  . MET A 1 29  ? -9.562  2.744   -4.684  1.00 0.00 ? 29  MET A HG2  1  
ATOM 390   H HG3  . MET A 1 29  ? -9.641  1.478   -3.476  1.00 0.00 ? 29  MET A HG3  1  
ATOM 391   H HE1  . MET A 1 29  ? -7.901  -0.951  -4.799  1.00 0.00 ? 29  MET A HE1  1  
ATOM 392   H HE2  . MET A 1 29  ? -9.091  -0.452  -3.573  1.00 0.00 ? 29  MET A HE2  1  
ATOM 393   H HE3  . MET A 1 29  ? -9.541  -1.643  -4.818  1.00 0.00 ? 29  MET A HE3  1  
ATOM 394   N N    . PRO A 1 30  ? -11.132 1.961   -1.387  1.00 0.00 ? 30  PRO A N    1  
ATOM 395   C CA   . PRO A 1 30  ? -10.276 1.869   -0.216  1.00 0.00 ? 30  PRO A CA   1  
ATOM 396   C C    . PRO A 1 30  ? -8.862  1.433   -0.604  1.00 0.00 ? 30  PRO A C    1  
ATOM 397   O O    . PRO A 1 30  ? -8.663  0.814   -1.648  1.00 0.00 ? 30  PRO A O    1  
ATOM 398   C CB   . PRO A 1 30  ? -10.973 0.878   0.703   1.00 0.00 ? 30  PRO A CB   1  
ATOM 399   C CG   . PRO A 1 30  ? -11.942 0.104   -0.176  1.00 0.00 ? 30  PRO A CG   1  
ATOM 400   C CD   . PRO A 1 30  ? -12.075 0.851   -1.493  1.00 0.00 ? 30  PRO A CD   1  
ATOM 401   H HA   . PRO A 1 30  ? -10.178 2.766   0.213   1.00 0.00 ? 30  PRO A HA   1  
ATOM 402   H HB2  . PRO A 1 30  ? -10.252 0.209   1.173   1.00 0.00 ? 30  PRO A HB2  1  
ATOM 403   H HB3  . PRO A 1 30  ? -11.500 1.394   1.505   1.00 0.00 ? 30  PRO A HB3  1  
ATOM 404   H HG2  . PRO A 1 30  ? -11.576 -0.909  -0.347  1.00 0.00 ? 30  PRO A HG2  1  
ATOM 405   H HG3  . PRO A 1 30  ? -12.912 0.015   0.312   1.00 0.00 ? 30  PRO A HG3  1  
ATOM 406   H HD2  . PRO A 1 30  ? -11.836 0.208   -2.340  1.00 0.00 ? 30  PRO A HD2  1  
ATOM 407   H HD3  . PRO A 1 30  ? -13.093 1.210   -1.644  1.00 0.00 ? 30  PRO A HD3  1  
ATOM 408   N N    . LEU A 1 31  ? -7.915  1.773   0.259   1.00 0.00 ? 31  LEU A N    1  
ATOM 409   C CA   . LEU A 1 31  ? -6.525  1.425   0.020   1.00 0.00 ? 31  LEU A CA   1  
ATOM 410   C C    . LEU A 1 31  ? -6.322  -0.065  0.300   1.00 0.00 ? 31  LEU A C    1  
ATOM 411   O O    . LEU A 1 31  ? -6.477  -0.514  1.435   1.00 0.00 ? 31  LEU A O    1  
ATOM 412   C CB   . LEU A 1 31  ? -5.598  2.335   0.828   1.00 0.00 ? 31  LEU A CB   1  
ATOM 413   C CG   . LEU A 1 31  ? -5.464  3.774   0.324   1.00 0.00 ? 31  LEU A CG   1  
ATOM 414   C CD1  . LEU A 1 31  ? -5.635  4.774   1.469   1.00 0.00 ? 31  LEU A CD1  1  
ATOM 415   C CD2  . LEU A 1 31  ? -4.141  3.973   -0.419  1.00 0.00 ? 31  LEU A CD2  1  
ATOM 416   H H    . LEU A 1 31  ? -8.085  2.277   1.106   1.00 0.00 ? 31  LEU A H    1  
ATOM 417   H HA   . LEU A 1 31  ? -6.319  1.609   -1.035  1.00 0.00 ? 31  LEU A HA   1  
ATOM 418   H HB2  . LEU A 1 31  ? -5.956  2.364   1.857   1.00 0.00 ? 31  LEU A HB2  1  
ATOM 419   H HB3  . LEU A 1 31  ? -4.606  1.884   0.848   1.00 0.00 ? 31  LEU A HB3  1  
ATOM 420   H HG   . LEU A 1 31  ? -6.266  3.962   -0.390  1.00 0.00 ? 31  LEU A HG   1  
ATOM 421   H HD11 . LEU A 1 31  ? -5.196  4.363   2.379   1.00 0.00 ? 31  LEU A HD11 1  
ATOM 422   H HD12 . LEU A 1 31  ? -5.134  5.708   1.214   1.00 0.00 ? 31  LEU A HD12 1  
ATOM 423   H HD13 . LEU A 1 31  ? -6.696  4.963   1.631   1.00 0.00 ? 31  LEU A HD13 1  
ATOM 424   H HD21 . LEU A 1 31  ? -4.172  4.914   -0.969  1.00 0.00 ? 31  LEU A HD21 1  
ATOM 425   H HD22 . LEU A 1 31  ? -3.322  3.999   0.299   1.00 0.00 ? 31  LEU A HD22 1  
ATOM 426   H HD23 . LEU A 1 31  ? -3.988  3.149   -1.115  1.00 0.00 ? 31  LEU A HD23 1  
ATOM 427   N N    . THR A 1 32  ? -5.977  -0.791  -0.753  1.00 0.00 ? 32  THR A N    1  
ATOM 428   C CA   . THR A 1 32  ? -5.751  -2.222  -0.634  1.00 0.00 ? 32  THR A CA   1  
ATOM 429   C C    . THR A 1 32  ? -4.351  -2.584  -1.133  1.00 0.00 ? 32  THR A C    1  
ATOM 430   O O    . THR A 1 32  ? -3.661  -1.749  -1.717  1.00 0.00 ? 32  THR A O    1  
ATOM 431   C CB   . THR A 1 32  ? -6.870  -2.942  -1.389  1.00 0.00 ? 32  THR A CB   1  
ATOM 432   O OG1  . THR A 1 32  ? -7.246  -2.023  -2.411  1.00 0.00 ? 32  THR A OG1  1  
ATOM 433   C CG2  . THR A 1 32  ? -8.137  -3.100  -0.546  1.00 0.00 ? 32  THR A CG2  1  
ATOM 434   H H    . THR A 1 32  ? -5.853  -0.419  -1.672  1.00 0.00 ? 32  THR A H    1  
ATOM 435   H HA   . THR A 1 32  ? -5.793  -2.490  0.422   1.00 0.00 ? 32  THR A HA   1  
ATOM 436   H HB   . THR A 1 32  ? -6.529  -3.907  -1.763  1.00 0.00 ? 32  THR A HB   1  
ATOM 437   H HG1  . THR A 1 32  ? -7.611  -1.187  -2.003  1.00 0.00 ? 32  THR A HG1  1  
ATOM 438   H HG21 . THR A 1 32  ? -8.224  -2.259  0.142   1.00 0.00 ? 32  THR A HG21 1  
ATOM 439   H HG22 . THR A 1 32  ? -9.008  -3.125  -1.201  1.00 0.00 ? 32  THR A HG22 1  
ATOM 440   H HG23 . THR A 1 32  ? -8.082  -4.029  0.022   1.00 0.00 ? 32  THR A HG23 1  
ATOM 441   N N    . ILE A 1 33  ? -3.972  -3.829  -0.885  1.00 0.00 ? 33  ILE A N    1  
ATOM 442   C CA   . ILE A 1 33  ? -2.667  -4.311  -1.302  1.00 0.00 ? 33  ILE A CA   1  
ATOM 443   C C    . ILE A 1 33  ? -2.701  -4.636  -2.797  1.00 0.00 ? 33  ILE A C    1  
ATOM 444   O O    . ILE A 1 33  ? -3.199  -5.687  -3.196  1.00 0.00 ? 33  ILE A O    1  
ATOM 445   C CB   . ILE A 1 33  ? -2.226  -5.487  -0.428  1.00 0.00 ? 33  ILE A CB   1  
ATOM 446   C CG1  . ILE A 1 33  ? -2.150  -5.077  1.044   1.00 0.00 ? 33  ILE A CG1  1  
ATOM 447   C CG2  . ILE A 1 33  ? -0.905  -6.076  -0.927  1.00 0.00 ? 33  ILE A CG2  1  
ATOM 448   C CD1  . ILE A 1 33  ? -0.948  -4.166  1.299   1.00 0.00 ? 33  ILE A CD1  1  
ATOM 449   H H    . ILE A 1 33  ? -4.539  -4.501  -0.409  1.00 0.00 ? 33  ILE A H    1  
ATOM 450   H HA   . ILE A 1 33  ? -1.953  -3.504  -1.140  1.00 0.00 ? 33  ILE A HA   1  
ATOM 451   H HB   . ILE A 1 33  ? -2.978  -6.272  -0.506  1.00 0.00 ? 33  ILE A HB   1  
ATOM 452   H HG12 . ILE A 1 33  ? -3.068  -4.563  1.330   1.00 0.00 ? 33  ILE A HG12 1  
ATOM 453   H HG13 . ILE A 1 33  ? -2.076  -5.967  1.670   1.00 0.00 ? 33  ILE A HG13 1  
ATOM 454   H HG21 . ILE A 1 33  ? -0.835  -5.947  -2.007  1.00 0.00 ? 33  ILE A HG21 1  
ATOM 455   H HG22 . ILE A 1 33  ? -0.073  -5.563  -0.445  1.00 0.00 ? 33  ILE A HG22 1  
ATOM 456   H HG23 . ILE A 1 33  ? -0.867  -7.138  -0.685  1.00 0.00 ? 33  ILE A HG23 1  
ATOM 457   H HD11 . ILE A 1 33  ? -0.643  -3.697  0.364   1.00 0.00 ? 33  ILE A HD11 1  
ATOM 458   H HD12 . ILE A 1 33  ? -1.222  -3.396  2.020   1.00 0.00 ? 33  ILE A HD12 1  
ATOM 459   H HD13 . ILE A 1 33  ? -0.122  -4.757  1.696   1.00 0.00 ? 33  ILE A HD13 1  
ATOM 460   N N    . SER A 1 34  ? -2.166  -3.713  -3.583  1.00 0.00 ? 34  SER A N    1  
ATOM 461   C CA   . SER A 1 34  ? -2.129  -3.888  -5.025  1.00 0.00 ? 34  SER A CA   1  
ATOM 462   C C    . SER A 1 34  ? -1.485  -5.231  -5.373  1.00 0.00 ? 34  SER A C    1  
ATOM 463   O O    . SER A 1 34  ? -2.151  -6.129  -5.886  1.00 0.00 ? 34  SER A O    1  
ATOM 464   C CB   . SER A 1 34  ? -1.369  -2.744  -5.699  1.00 0.00 ? 34  SER A CB   1  
ATOM 465   O OG   . SER A 1 34  ? -1.589  -2.713  -7.106  1.00 0.00 ? 34  SER A OG   1  
ATOM 466   H H    . SER A 1 34  ? -1.763  -2.860  -3.250  1.00 0.00 ? 34  SER A H    1  
ATOM 467   H HA   . SER A 1 34  ? -3.171  -3.869  -5.344  1.00 0.00 ? 34  SER A HA   1  
ATOM 468   H HB2  . SER A 1 34  ? -1.680  -1.795  -5.262  1.00 0.00 ? 34  SER A HB2  1  
ATOM 469   H HB3  . SER A 1 34  ? -0.302  -2.851  -5.501  1.00 0.00 ? 34  SER A HB3  1  
ATOM 470   H HG   . SER A 1 34  ? -1.396  -3.610  -7.503  1.00 0.00 ? 34  SER A HG   1  
ATOM 471   N N    . SER A 1 35  ? -0.196  -5.327  -5.080  1.00 0.00 ? 35  SER A N    1  
ATOM 472   C CA   . SER A 1 35  ? 0.545   -6.545  -5.356  1.00 0.00 ? 35  SER A CA   1  
ATOM 473   C C    . SER A 1 35  ? 1.597   -6.775  -4.269  1.00 0.00 ? 35  SER A C    1  
ATOM 474   O O    . SER A 1 35  ? 1.746   -5.958  -3.362  1.00 0.00 ? 35  SER A O    1  
ATOM 475   C CB   . SER A 1 35  ? 1.209   -6.486  -6.733  1.00 0.00 ? 35  SER A CB   1  
ATOM 476   O OG   . SER A 1 35  ? 0.584   -7.365  -7.665  1.00 0.00 ? 35  SER A OG   1  
ATOM 477   H H    . SER A 1 35  ? 0.338   -4.592  -4.663  1.00 0.00 ? 35  SER A H    1  
ATOM 478   H HA   . SER A 1 35  ? -0.197  -7.344  -5.345  1.00 0.00 ? 35  SER A HA   1  
ATOM 479   H HB2  . SER A 1 35  ? 1.166   -5.465  -7.113  1.00 0.00 ? 35  SER A HB2  1  
ATOM 480   H HB3  . SER A 1 35  ? 2.263   -6.748  -6.639  1.00 0.00 ? 35  SER A HB3  1  
ATOM 481   H HG   . SER A 1 35  ? -0.367  -7.090  -7.810  1.00 0.00 ? 35  SER A HG   1  
ATOM 482   N N    . LEU A 1 36  ? 2.300   -7.891  -4.397  1.00 0.00 ? 36  LEU A N    1  
ATOM 483   C CA   . LEU A 1 36  ? 3.334   -8.238  -3.437  1.00 0.00 ? 36  LEU A CA   1  
ATOM 484   C C    . LEU A 1 36  ? 4.442   -9.018  -4.148  1.00 0.00 ? 36  LEU A C    1  
ATOM 485   O O    . LEU A 1 36  ? 4.230   -9.555  -5.234  1.00 0.00 ? 36  LEU A O    1  
ATOM 486   C CB   . LEU A 1 36  ? 2.729   -8.979  -2.243  1.00 0.00 ? 36  LEU A CB   1  
ATOM 487   C CG   . LEU A 1 36  ? 2.892   -8.301  -0.881  1.00 0.00 ? 36  LEU A CG   1  
ATOM 488   C CD1  . LEU A 1 36  ? 1.858   -8.823  0.118   1.00 0.00 ? 36  LEU A CD1  1  
ATOM 489   C CD2  . LEU A 1 36  ? 4.322   -8.454  -0.359  1.00 0.00 ? 36  LEU A CD2  1  
ATOM 490   H H    . LEU A 1 36  ? 2.173   -8.550  -5.138  1.00 0.00 ? 36  LEU A H    1  
ATOM 491   H HA   . LEU A 1 36  ? 3.755   -7.307  -3.059  1.00 0.00 ? 36  LEU A HA   1  
ATOM 492   H HB2  . LEU A 1 36  ? 1.665   -9.122  -2.430  1.00 0.00 ? 36  LEU A HB2  1  
ATOM 493   H HB3  . LEU A 1 36  ? 3.180   -9.970  -2.189  1.00 0.00 ? 36  LEU A HB3  1  
ATOM 494   H HG   . LEU A 1 36  ? 2.707   -7.234  -1.006  1.00 0.00 ? 36  LEU A HG   1  
ATOM 495   H HD11 . LEU A 1 36  ? 2.346   -9.486  0.833   1.00 0.00 ? 36  LEU A HD11 1  
ATOM 496   H HD12 . LEU A 1 36  ? 1.409   -7.983  0.650   1.00 0.00 ? 36  LEU A HD12 1  
ATOM 497   H HD13 . LEU A 1 36  ? 1.081   -9.371  -0.415  1.00 0.00 ? 36  LEU A HD13 1  
ATOM 498   H HD21 . LEU A 1 36  ? 4.857   -9.177  -0.974  1.00 0.00 ? 36  LEU A HD21 1  
ATOM 499   H HD22 . LEU A 1 36  ? 4.830   -7.491  -0.405  1.00 0.00 ? 36  LEU A HD22 1  
ATOM 500   H HD23 . LEU A 1 36  ? 4.296   -8.803  0.673   1.00 0.00 ? 36  LEU A HD23 1  
ATOM 501   N N    . LYS A 1 37  ? 5.601   -9.056  -3.505  1.00 0.00 ? 37  LYS A N    1  
ATOM 502   C CA   . LYS A 1 37  ? 6.742   -9.761  -4.062  1.00 0.00 ? 37  LYS A CA   1  
ATOM 503   C C    . LYS A 1 37  ? 6.805   -11.170 -3.468  1.00 0.00 ? 37  LYS A C    1  
ATOM 504   O O    . LYS A 1 37  ? 6.232   -11.428 -2.411  1.00 0.00 ? 37  LYS A O    1  
ATOM 505   C CB   . LYS A 1 37  ? 8.024   -8.951  -3.859  1.00 0.00 ? 37  LYS A CB   1  
ATOM 506   C CG   . LYS A 1 37  ? 9.254   -9.752  -4.291  1.00 0.00 ? 37  LYS A CG   1  
ATOM 507   C CD   . LYS A 1 37  ? 10.532  -8.930  -4.118  1.00 0.00 ? 37  LYS A CD   1  
ATOM 508   C CE   . LYS A 1 37  ? 11.650  -9.776  -3.505  1.00 0.00 ? 37  LYS A CE   1  
ATOM 509   N NZ   . LYS A 1 37  ? 12.776  -9.914  -4.456  1.00 0.00 ? 37  LYS A NZ   1  
ATOM 510   H H    . LYS A 1 37  ? 5.765   -8.616  -2.622  1.00 0.00 ? 37  LYS A H    1  
ATOM 511   H HA   . LYS A 1 37  ? 6.582   -9.846  -5.137  1.00 0.00 ? 37  LYS A HA   1  
ATOM 512   H HB2  . LYS A 1 37  ? 7.969   -8.025  -4.433  1.00 0.00 ? 37  LYS A HB2  1  
ATOM 513   H HB3  . LYS A 1 37  ? 8.118   -8.669  -2.811  1.00 0.00 ? 37  LYS A HB3  1  
ATOM 514   H HG2  . LYS A 1 37  ? 9.322   -10.666 -3.701  1.00 0.00 ? 37  LYS A HG2  1  
ATOM 515   H HG3  . LYS A 1 37  ? 9.149   -10.053 -5.333  1.00 0.00 ? 37  LYS A HG3  1  
ATOM 516   H HD2  . LYS A 1 37  ? 10.853  -8.542  -5.085  1.00 0.00 ? 37  LYS A HD2  1  
ATOM 517   H HD3  . LYS A 1 37  ? 10.332  -8.069  -3.480  1.00 0.00 ? 37  LYS A HD3  1  
ATOM 518   H HE2  . LYS A 1 37  ? 12.000  -9.314  -2.583  1.00 0.00 ? 37  LYS A HE2  1  
ATOM 519   H HE3  . LYS A 1 37  ? 11.265  -10.762 -3.242  1.00 0.00 ? 37  LYS A HE3  1  
ATOM 520   H HZ1  . LYS A 1 37  ? 12.475  -10.436 -5.255  1.00 0.00 ? 37  LYS A HZ1  1  
ATOM 521   H HZ2  . LYS A 1 37  ? 13.081  -9.007  -4.745  1.00 0.00 ? 37  LYS A HZ2  1  
ATOM 522   H HZ3  . LYS A 1 37  ? 13.532  -10.394 -4.010  1.00 0.00 ? 37  LYS A HZ3  1  
ATOM 523   N N    . ASP A 1 38  ? 7.507   -12.044 -4.174  1.00 0.00 ? 38  ASP A N    1  
ATOM 524   C CA   . ASP A 1 38  ? 7.652   -13.420 -3.730  1.00 0.00 ? 38  ASP A CA   1  
ATOM 525   C C    . ASP A 1 38  ? 8.215   -13.435 -2.307  1.00 0.00 ? 38  ASP A C    1  
ATOM 526   O O    . ASP A 1 38  ? 9.312   -12.936 -2.064  1.00 0.00 ? 38  ASP A O    1  
ATOM 527   C CB   . ASP A 1 38  ? 8.622   -14.190 -4.629  1.00 0.00 ? 38  ASP A CB   1  
ATOM 528   C CG   . ASP A 1 38  ? 7.960   -15.024 -5.728  1.00 0.00 ? 38  ASP A CG   1  
ATOM 529   O OD1  . ASP A 1 38  ? 6.710   -15.051 -5.746  1.00 0.00 ? 38  ASP A OD1  1  
ATOM 530   O OD2  . ASP A 1 38  ? 8.719   -15.617 -6.525  1.00 0.00 ? 38  ASP A OD2  1  
ATOM 531   H H    . ASP A 1 38  ? 7.971   -11.826 -5.033  1.00 0.00 ? 38  ASP A H    1  
ATOM 532   H HA   . ASP A 1 38  ? 6.651   -13.847 -3.787  1.00 0.00 ? 38  ASP A HA   1  
ATOM 533   H HB2  . ASP A 1 38  ? 9.304   -13.479 -5.095  1.00 0.00 ? 38  ASP A HB2  1  
ATOM 534   H HB3  . ASP A 1 38  ? 9.226   -14.850 -4.006  1.00 0.00 ? 38  ASP A HB3  1  
ATOM 535   N N    . GLY A 1 39  ? 7.437   -14.013 -1.404  1.00 0.00 ? 39  GLY A N    1  
ATOM 536   C CA   . GLY A 1 39  ? 7.843   -14.100 -0.011  1.00 0.00 ? 39  GLY A CA   1  
ATOM 537   C C    . GLY A 1 39  ? 8.515   -12.804 0.446   1.00 0.00 ? 39  GLY A C    1  
ATOM 538   O O    . GLY A 1 39  ? 9.630   -12.827 0.965   1.00 0.00 ? 39  GLY A O    1  
ATOM 539   H H    . GLY A 1 39  ? 6.545   -14.417 -1.609  1.00 0.00 ? 39  GLY A H    1  
ATOM 540   H HA2  . GLY A 1 39  ? 6.973   -14.303 0.613   1.00 0.00 ? 39  GLY A HA2  1  
ATOM 541   H HA3  . GLY A 1 39  ? 8.531   -14.936 0.119   1.00 0.00 ? 39  GLY A HA3  1  
ATOM 542   N N    . GLY A 1 40  ? 7.808   -11.703 0.235   1.00 0.00 ? 40  GLY A N    1  
ATOM 543   C CA   . GLY A 1 40  ? 8.322   -10.399 0.619   1.00 0.00 ? 40  GLY A CA   1  
ATOM 544   C C    . GLY A 1 40  ? 7.928   -10.056 2.057   1.00 0.00 ? 40  GLY A C    1  
ATOM 545   O O    . GLY A 1 40  ? 7.187   -10.801 2.696   1.00 0.00 ? 40  GLY A O    1  
ATOM 546   H H    . GLY A 1 40  ? 6.902   -11.692 -0.188  1.00 0.00 ? 40  GLY A H    1  
ATOM 547   H HA2  . GLY A 1 40  ? 9.408   -10.390 0.524   1.00 0.00 ? 40  GLY A HA2  1  
ATOM 548   H HA3  . GLY A 1 40  ? 7.937   -9.638  -0.059  1.00 0.00 ? 40  GLY A HA3  1  
ATOM 549   N N    . LYS A 1 41  ? 8.440   -8.926  2.524   1.00 0.00 ? 41  LYS A N    1  
ATOM 550   C CA   . LYS A 1 41  ? 8.151   -8.475  3.874   1.00 0.00 ? 41  LYS A CA   1  
ATOM 551   C C    . LYS A 1 41  ? 6.654   -8.634  4.151   1.00 0.00 ? 41  LYS A C    1  
ATOM 552   O O    . LYS A 1 41  ? 6.259   -9.410  5.018   1.00 0.00 ? 41  LYS A O    1  
ATOM 553   C CB   . LYS A 1 41  ? 8.668   -7.051  4.086   1.00 0.00 ? 41  LYS A CB   1  
ATOM 554   C CG   . LYS A 1 41  ? 10.186  -7.041  4.278   1.00 0.00 ? 41  LYS A CG   1  
ATOM 555   C CD   . LYS A 1 41  ? 10.893  -6.515  3.027   1.00 0.00 ? 41  LYS A CD   1  
ATOM 556   C CE   . LYS A 1 41  ? 11.826  -7.576  2.438   1.00 0.00 ? 41  LYS A CE   1  
ATOM 557   N NZ   . LYS A 1 41  ? 11.799  -7.525  0.959   1.00 0.00 ? 41  LYS A NZ   1  
ATOM 558   H H    . LYS A 1 41  ? 9.042   -8.326  1.997   1.00 0.00 ? 41  LYS A H    1  
ATOM 559   H HA   . LYS A 1 41  ? 8.699   -9.122  4.559   1.00 0.00 ? 41  LYS A HA   1  
ATOM 560   H HB2  . LYS A 1 41  ? 8.402   -6.432  3.228   1.00 0.00 ? 41  LYS A HB2  1  
ATOM 561   H HB3  . LYS A 1 41  ? 8.185   -6.610  4.958   1.00 0.00 ? 41  LYS A HB3  1  
ATOM 562   H HG2  . LYS A 1 41  ? 10.444  -6.419  5.135   1.00 0.00 ? 41  LYS A HG2  1  
ATOM 563   H HG3  . LYS A 1 41  ? 10.534  -8.050  4.500   1.00 0.00 ? 41  LYS A HG3  1  
ATOM 564   H HD2  . LYS A 1 41  ? 10.153  -6.222  2.282   1.00 0.00 ? 41  LYS A HD2  1  
ATOM 565   H HD3  . LYS A 1 41  ? 11.465  -5.622  3.277   1.00 0.00 ? 41  LYS A HD3  1  
ATOM 566   H HE2  . LYS A 1 41  ? 12.842  -7.414  2.795   1.00 0.00 ? 41  LYS A HE2  1  
ATOM 567   H HE3  . LYS A 1 41  ? 11.522  -8.566  2.779   1.00 0.00 ? 41  LYS A HE3  1  
ATOM 568   H HZ1  . LYS A 1 41  ? 12.677  -7.842  0.599   1.00 0.00 ? 41  LYS A HZ1  1  
ATOM 569   H HZ2  . LYS A 1 41  ? 11.067  -8.113  0.618   1.00 0.00 ? 41  LYS A HZ2  1  
ATOM 570   H HZ3  . LYS A 1 41  ? 11.637  -6.584  0.661   1.00 0.00 ? 41  LYS A HZ3  1  
ATOM 571   N N    . ALA A 1 42  ? 5.863   -7.885  3.396   1.00 0.00 ? 42  ALA A N    1  
ATOM 572   C CA   . ALA A 1 42  ? 4.419   -7.932  3.549   1.00 0.00 ? 42  ALA A CA   1  
ATOM 573   C C    . ALA A 1 42  ? 3.969   -9.391  3.646   1.00 0.00 ? 42  ALA A C    1  
ATOM 574   O O    . ALA A 1 42  ? 3.170   -9.741  4.514   1.00 0.00 ? 42  ALA A O    1  
ATOM 575   C CB   . ALA A 1 42  ? 3.758   -7.194  2.383   1.00 0.00 ? 42  ALA A CB   1  
ATOM 576   H H    . ALA A 1 42  ? 6.194   -7.255  2.693   1.00 0.00 ? 42  ALA A H    1  
ATOM 577   H HA   . ALA A 1 42  ? 4.167   -7.420  4.477   1.00 0.00 ? 42  ALA A HA   1  
ATOM 578   H HB1  . ALA A 1 42  ? 4.491   -7.032  1.593   1.00 0.00 ? 42  ALA A HB1  1  
ATOM 579   H HB2  . ALA A 1 42  ? 2.933   -7.792  1.996   1.00 0.00 ? 42  ALA A HB2  1  
ATOM 580   H HB3  . ALA A 1 42  ? 3.379   -6.233  2.730   1.00 0.00 ? 42  ALA A HB3  1  
ATOM 581   N N    . SER A 1 43  ? 4.500   -10.203 2.744   1.00 0.00 ? 43  SER A N    1  
ATOM 582   C CA   . SER A 1 43  ? 4.163   -11.616 2.717   1.00 0.00 ? 43  SER A CA   1  
ATOM 583   C C    . SER A 1 43  ? 4.615   -12.286 4.016   1.00 0.00 ? 43  SER A C    1  
ATOM 584   O O    . SER A 1 43  ? 3.900   -13.119 4.571   1.00 0.00 ? 43  SER A O    1  
ATOM 585   C CB   . SER A 1 43  ? 4.798   -12.311 1.512   1.00 0.00 ? 43  SER A CB   1  
ATOM 586   O OG   . SER A 1 43  ? 4.316   -13.642 1.348   1.00 0.00 ? 43  SER A OG   1  
ATOM 587   H H    . SER A 1 43  ? 5.149   -9.910  2.042   1.00 0.00 ? 43  SER A H    1  
ATOM 588   H HA   . SER A 1 43  ? 3.077   -11.652 2.627   1.00 0.00 ? 43  SER A HA   1  
ATOM 589   H HB2  . SER A 1 43  ? 4.588   -11.736 0.610   1.00 0.00 ? 43  SER A HB2  1  
ATOM 590   H HB3  . SER A 1 43  ? 5.881   -12.330 1.633   1.00 0.00 ? 43  SER A HB3  1  
ATOM 591   H HG   . SER A 1 43  ? 4.263   -13.869 0.376   1.00 0.00 ? 43  SER A HG   1  
ATOM 592   N N    . GLN A 1 44  ? 5.801   -11.899 4.463   1.00 0.00 ? 44  GLN A N    1  
ATOM 593   C CA   . GLN A 1 44  ? 6.358   -12.452 5.686   1.00 0.00 ? 44  GLN A CA   1  
ATOM 594   C C    . GLN A 1 44  ? 5.487   -12.072 6.885   1.00 0.00 ? 44  GLN A C    1  
ATOM 595   O O    . GLN A 1 44  ? 5.521   -12.739 7.918   1.00 0.00 ? 44  GLN A O    1  
ATOM 596   C CB   . GLN A 1 44  ? 7.802   -11.990 5.889   1.00 0.00 ? 44  GLN A CB   1  
ATOM 597   C CG   . GLN A 1 44  ? 8.748   -12.710 4.926   1.00 0.00 ? 44  GLN A CG   1  
ATOM 598   C CD   . GLN A 1 44  ? 10.208  -12.513 5.341   1.00 0.00 ? 44  GLN A CD   1  
ATOM 599   O OE1  . GLN A 1 44  ? 10.669  -13.030 6.345   1.00 0.00 ? 44  GLN A OE1  1  
ATOM 600   N NE2  . GLN A 1 44  ? 10.905  -11.738 4.515   1.00 0.00 ? 44  GLN A NE2  1  
ATOM 601   H H    . GLN A 1 44  ? 6.377   -11.221 4.005   1.00 0.00 ? 44  GLN A H    1  
ATOM 602   H HA   . GLN A 1 44  ? 6.344   -13.533 5.547   1.00 0.00 ? 44  GLN A HA   1  
ATOM 603   H HB2  . GLN A 1 44  ? 7.869   -10.914 5.733   1.00 0.00 ? 44  GLN A HB2  1  
ATOM 604   H HB3  . GLN A 1 44  ? 8.108   -12.183 6.917   1.00 0.00 ? 44  GLN A HB3  1  
ATOM 605   H HG2  . GLN A 1 44  ? 8.513   -13.774 4.906   1.00 0.00 ? 44  GLN A HG2  1  
ATOM 606   H HG3  . GLN A 1 44  ? 8.600   -12.332 3.914   1.00 0.00 ? 44  GLN A HG3  1  
ATOM 607   H HE21 . GLN A 1 44  ? 10.466  -11.345 3.708   1.00 0.00 ? 44  GLN A HE21 1  
ATOM 608   H HE22 . GLN A 1 44  ? 11.869  -11.550 4.701   1.00 0.00 ? 44  GLN A HE22 1  
ATOM 609   N N    . ALA A 1 45  ? 4.726   -11.001 6.707   1.00 0.00 ? 45  ALA A N    1  
ATOM 610   C CA   . ALA A 1 45  ? 3.848   -10.524 7.762   1.00 0.00 ? 45  ALA A CA   1  
ATOM 611   C C    . ALA A 1 45  ? 2.454   -11.124 7.569   1.00 0.00 ? 45  ALA A C    1  
ATOM 612   O O    . ALA A 1 45  ? 1.499   -10.710 8.225   1.00 0.00 ? 45  ALA A O    1  
ATOM 613   C CB   . ALA A 1 45  ? 3.830   -8.994  7.758   1.00 0.00 ? 45  ALA A CB   1  
ATOM 614   H H    . ALA A 1 45  ? 4.704   -10.465 5.864   1.00 0.00 ? 45  ALA A H    1  
ATOM 615   H HA   . ALA A 1 45  ? 4.254   -10.868 8.713   1.00 0.00 ? 45  ALA A HA   1  
ATOM 616   H HB1  . ALA A 1 45  ? 3.649   -8.631  8.770   1.00 0.00 ? 45  ALA A HB1  1  
ATOM 617   H HB2  . ALA A 1 45  ? 4.790   -8.620  7.404   1.00 0.00 ? 45  ALA A HB2  1  
ATOM 618   H HB3  . ALA A 1 45  ? 3.037   -8.642  7.098   1.00 0.00 ? 45  ALA A HB3  1  
ATOM 619   N N    . HIS A 1 46  ? 2.380   -12.092 6.666   1.00 0.00 ? 46  HIS A N    1  
ATOM 620   C CA   . HIS A 1 46  ? 1.119   -12.753 6.379   1.00 0.00 ? 46  HIS A CA   1  
ATOM 621   C C    . HIS A 1 46  ? 0.118   -11.733 5.831   1.00 0.00 ? 46  HIS A C    1  
ATOM 622   O O    . HIS A 1 46  ? -1.004  -11.633 6.324   1.00 0.00 ? 46  HIS A O    1  
ATOM 623   C CB   . HIS A 1 46  ? 0.598   -13.490 7.614   1.00 0.00 ? 46  HIS A CB   1  
ATOM 624   C CG   . HIS A 1 46  ? 1.282   -14.811 7.875   1.00 0.00 ? 46  HIS A CG   1  
ATOM 625   N ND1  . HIS A 1 46  ? 0.593   -15.951 8.250   1.00 0.00 ? 46  HIS A ND1  1  
ATOM 626   C CD2  . HIS A 1 46  ? 2.599   -15.161 7.809   1.00 0.00 ? 46  HIS A CD2  1  
ATOM 627   C CE1  . HIS A 1 46  ? 1.466   -16.936 8.402   1.00 0.00 ? 46  HIS A CE1  1  
ATOM 628   N NE2  . HIS A 1 46  ? 2.708   -16.445 8.129   1.00 0.00 ? 46  HIS A NE2  1  
ATOM 629   H H    . HIS A 1 46  ? 3.162   -12.423 6.137   1.00 0.00 ? 46  HIS A H    1  
ATOM 630   H HA   . HIS A 1 46  ? 1.324   -13.497 5.609   1.00 0.00 ? 46  HIS A HA   1  
ATOM 631   H HB2  . HIS A 1 46  ? 0.724   -12.849 8.487   1.00 0.00 ? 46  HIS A HB2  1  
ATOM 632   H HB3  . HIS A 1 46  ? -0.471  -13.664 7.497   1.00 0.00 ? 46  HIS A HB3  1  
ATOM 633   H HD1  . HIS A 1 46  ? -0.395  -16.019 8.384   1.00 0.00 ? 46  HIS A HD1  1  
ATOM 634   H HD2  . HIS A 1 46  ? 3.422   -14.499 7.539   1.00 0.00 ? 46  HIS A HD2  1  
ATOM 635   H HE1  . HIS A 1 46  ? 1.232   -17.960 8.694   1.00 0.00 ? 46  HIS A HE1  1  
ATOM 636   N N    . VAL A 1 47  ? 0.561   -11.002 4.819   1.00 0.00 ? 47  VAL A N    1  
ATOM 637   C CA   . VAL A 1 47  ? -0.282  -9.994  4.199   1.00 0.00 ? 47  VAL A CA   1  
ATOM 638   C C    . VAL A 1 47  ? -0.763  -10.504 2.839   1.00 0.00 ? 47  VAL A C    1  
ATOM 639   O O    . VAL A 1 47  ? 0.044   -10.757 1.946   1.00 0.00 ? 47  VAL A O    1  
ATOM 640   C CB   . VAL A 1 47  ? 0.473   -8.666  4.106   1.00 0.00 ? 47  VAL A CB   1  
ATOM 641   C CG1  . VAL A 1 47  ? -0.339  -7.628  3.329   1.00 0.00 ? 47  VAL A CG1  1  
ATOM 642   C CG2  . VAL A 1 47  ? 0.840   -8.146  5.497   1.00 0.00 ? 47  VAL A CG2  1  
ATOM 643   H H    . VAL A 1 47  ? 1.476   -11.090 4.424   1.00 0.00 ? 47  VAL A H    1  
ATOM 644   H HA   . VAL A 1 47  ? -1.147  -9.846  4.845   1.00 0.00 ? 47  VAL A HA   1  
ATOM 645   H HB   . VAL A 1 47  ? 1.399   -8.845  3.560   1.00 0.00 ? 47  VAL A HB   1  
ATOM 646   H HG11 . VAL A 1 47  ? -0.762  -6.903  4.024   1.00 0.00 ? 47  VAL A HG11 1  
ATOM 647   H HG12 . VAL A 1 47  ? 0.312   -7.114  2.621   1.00 0.00 ? 47  VAL A HG12 1  
ATOM 648   H HG13 . VAL A 1 47  ? -1.143  -8.126  2.788   1.00 0.00 ? 47  VAL A HG13 1  
ATOM 649   H HG21 . VAL A 1 47  ? 0.308   -7.215  5.689   1.00 0.00 ? 47  VAL A HG21 1  
ATOM 650   H HG22 . VAL A 1 47  ? 0.560   -8.886  6.247   1.00 0.00 ? 47  VAL A HG22 1  
ATOM 651   H HG23 . VAL A 1 47  ? 1.914   -7.967  5.547   1.00 0.00 ? 47  VAL A HG23 1  
ATOM 652   N N    . ARG A 1 48  ? -2.076  -10.640 2.725   1.00 0.00 ? 48  ARG A N    1  
ATOM 653   C CA   . ARG A 1 48  ? -2.675  -11.115 1.489   1.00 0.00 ? 48  ARG A CA   1  
ATOM 654   C C    . ARG A 1 48  ? -3.271  -9.945  0.704   1.00 0.00 ? 48  ARG A C    1  
ATOM 655   O O    . ARG A 1 48  ? -3.573  -8.899  1.276   1.00 0.00 ? 48  ARG A O    1  
ATOM 656   C CB   . ARG A 1 48  ? -3.772  -12.144 1.769   1.00 0.00 ? 48  ARG A CB   1  
ATOM 657   C CG   . ARG A 1 48  ? -3.194  -13.560 1.821   1.00 0.00 ? 48  ARG A CG   1  
ATOM 658   C CD   . ARG A 1 48  ? -3.596  -14.269 3.116   1.00 0.00 ? 48  ARG A CD   1  
ATOM 659   N NE   . ARG A 1 48  ? -3.134  -13.487 4.285   1.00 0.00 ? 48  ARG A NE   1  
ATOM 660   C CZ   . ARG A 1 48  ? -3.674  -13.575 5.508   1.00 0.00 ? 48  ARG A CZ   1  
ATOM 661   N NH1  . ARG A 1 48  ? -4.697  -14.411 5.731   1.00 0.00 ? 48  ARG A NH1  1  
ATOM 662   N NH2  . ARG A 1 48  ? -3.190  -12.828 6.510   1.00 0.00 ? 48  ARG A NH2  1  
ATOM 663   H H    . ARG A 1 48  ? -2.726  -10.431 3.456   1.00 0.00 ? 48  ARG A H    1  
ATOM 664   H HA   . ARG A 1 48  ? -1.854  -11.577 0.941   1.00 0.00 ? 48  ARG A HA   1  
ATOM 665   H HB2  . ARG A 1 48  ? -4.261  -11.912 2.715   1.00 0.00 ? 48  ARG A HB2  1  
ATOM 666   H HB3  . ARG A 1 48  ? -4.535  -12.087 0.993   1.00 0.00 ? 48  ARG A HB3  1  
ATOM 667   H HG2  . ARG A 1 48  ? -3.548  -14.133 0.964   1.00 0.00 ? 48  ARG A HG2  1  
ATOM 668   H HG3  . ARG A 1 48  ? -2.108  -13.517 1.748   1.00 0.00 ? 48  ARG A HG3  1  
ATOM 669   H HD2  . ARG A 1 48  ? -4.679  -14.389 3.154   1.00 0.00 ? 48  ARG A HD2  1  
ATOM 670   H HD3  . ARG A 1 48  ? -3.163  -15.269 3.143   1.00 0.00 ? 48  ARG A HD3  1  
ATOM 671   H HE   . ARG A 1 48  ? -2.372  -12.853 4.154   1.00 0.00 ? 48  ARG A HE   1  
ATOM 672   H HH11 . ARG A 1 48  ? -5.058  -14.970 4.983   1.00 0.00 ? 48  ARG A HH11 1  
ATOM 673   H HH12 . ARG A 1 48  ? -5.100  -14.477 6.644   1.00 0.00 ? 48  ARG A HH12 1  
ATOM 674   H HH21 . ARG A 1 48  ? -2.427  -12.204 6.344   1.00 0.00 ? 48  ARG A HH21 1  
ATOM 675   H HH22 . ARG A 1 48  ? -3.593  -12.893 7.423   1.00 0.00 ? 48  ARG A HH22 1  
ATOM 676   N N    . ILE A 1 49  ? -3.423  -10.161 -0.594  1.00 0.00 ? 49  ILE A N    1  
ATOM 677   C CA   . ILE A 1 49  ? -3.978  -9.138  -1.464  1.00 0.00 ? 49  ILE A CA   1  
ATOM 678   C C    . ILE A 1 49  ? -5.435  -8.878  -1.073  1.00 0.00 ? 49  ILE A C    1  
ATOM 679   O O    . ILE A 1 49  ? -6.221  -9.814  -0.939  1.00 0.00 ? 49  ILE A O    1  
ATOM 680   C CB   . ILE A 1 49  ? -3.795  -9.526  -2.932  1.00 0.00 ? 49  ILE A CB   1  
ATOM 681   C CG1  . ILE A 1 49  ? -2.361  -9.261  -3.394  1.00 0.00 ? 49  ILE A CG1  1  
ATOM 682   C CG2  . ILE A 1 49  ? -4.822  -8.818  -3.818  1.00 0.00 ? 49  ILE A CG2  1  
ATOM 683   C CD1  . ILE A 1 49  ? -2.295  -9.097  -4.914  1.00 0.00 ? 49  ILE A CD1  1  
ATOM 684   H H    . ILE A 1 49  ? -3.175  -11.015 -1.052  1.00 0.00 ? 49  ILE A H    1  
ATOM 685   H HA   . ILE A 1 49  ? -3.408  -8.224  -1.298  1.00 0.00 ? 49  ILE A HA   1  
ATOM 686   H HB   . ILE A 1 49  ? -3.972  -10.597 -3.027  1.00 0.00 ? 49  ILE A HB   1  
ATOM 687   H HG12 . ILE A 1 49  ? -1.979  -8.362  -2.911  1.00 0.00 ? 49  ILE A HG12 1  
ATOM 688   H HG13 . ILE A 1 49  ? -1.718  -10.086 -3.086  1.00 0.00 ? 49  ILE A HG13 1  
ATOM 689   H HG21 . ILE A 1 49  ? -4.718  -9.167  -4.846  1.00 0.00 ? 49  ILE A HG21 1  
ATOM 690   H HG22 . ILE A 1 49  ? -5.827  -9.041  -3.459  1.00 0.00 ? 49  ILE A HG22 1  
ATOM 691   H HG23 . ILE A 1 49  ? -4.654  -7.742  -3.782  1.00 0.00 ? 49  ILE A HG23 1  
ATOM 692   H HD11 . ILE A 1 49  ? -2.757  -8.151  -5.197  1.00 0.00 ? 49  ILE A HD11 1  
ATOM 693   H HD12 . ILE A 1 49  ? -1.254  -9.104  -5.236  1.00 0.00 ? 49  ILE A HD12 1  
ATOM 694   H HD13 . ILE A 1 49  ? -2.829  -9.919  -5.392  1.00 0.00 ? 49  ILE A HD13 1  
ATOM 695   N N    . GLY A 1 50  ? -5.750  -7.602  -0.903  1.00 0.00 ? 50  GLY A N    1  
ATOM 696   C CA   . GLY A 1 50  ? -7.098  -7.208  -0.531  1.00 0.00 ? 50  GLY A CA   1  
ATOM 697   C C    . GLY A 1 50  ? -7.112  -6.536  0.844   1.00 0.00 ? 50  GLY A C    1  
ATOM 698   O O    . GLY A 1 50  ? -8.087  -5.881  1.208   1.00 0.00 ? 50  GLY A O    1  
ATOM 699   H H    . GLY A 1 50  ? -5.104  -6.847  -1.015  1.00 0.00 ? 50  GLY A H    1  
ATOM 700   H HA2  . GLY A 1 50  ? -7.499  -6.523  -1.278  1.00 0.00 ? 50  GLY A HA2  1  
ATOM 701   H HA3  . GLY A 1 50  ? -7.746  -8.083  -0.519  1.00 0.00 ? 50  GLY A HA3  1  
ATOM 702   N N    . ASP A 1 51  ? -6.020  -6.723  1.570   1.00 0.00 ? 51  ASP A N    1  
ATOM 703   C CA   . ASP A 1 51  ? -5.895  -6.144  2.897   1.00 0.00 ? 51  ASP A CA   1  
ATOM 704   C C    . ASP A 1 51  ? -6.052  -4.625  2.802   1.00 0.00 ? 51  ASP A C    1  
ATOM 705   O O    . ASP A 1 51  ? -5.390  -3.978  1.992   1.00 0.00 ? 51  ASP A O    1  
ATOM 706   C CB   . ASP A 1 51  ? -4.521  -6.440  3.500   1.00 0.00 ? 51  ASP A CB   1  
ATOM 707   C CG   . ASP A 1 51  ? -4.256  -7.914  3.813   1.00 0.00 ? 51  ASP A CG   1  
ATOM 708   O OD1  . ASP A 1 51  ? -5.254  -8.660  3.919   1.00 0.00 ? 51  ASP A OD1  1  
ATOM 709   O OD2  . ASP A 1 51  ? -3.063  -8.262  3.940   1.00 0.00 ? 51  ASP A OD2  1  
ATOM 710   H H    . ASP A 1 51  ? -5.231  -7.258  1.267   1.00 0.00 ? 51  ASP A H    1  
ATOM 711   H HA   . ASP A 1 51  ? -6.684  -6.608  3.488   1.00 0.00 ? 51  ASP A HA   1  
ATOM 712   H HB2  . ASP A 1 51  ? -3.754  -6.088  2.810   1.00 0.00 ? 51  ASP A HB2  1  
ATOM 713   H HB3  . ASP A 1 51  ? -4.412  -5.864  4.419   1.00 0.00 ? 51  ASP A HB3  1  
ATOM 714   N N    . VAL A 1 52  ? -6.932  -4.099  3.641   1.00 0.00 ? 52  VAL A N    1  
ATOM 715   C CA   . VAL A 1 52  ? -7.184  -2.668  3.663   1.00 0.00 ? 52  VAL A CA   1  
ATOM 716   C C    . VAL A 1 52  ? -6.331  -2.021  4.755   1.00 0.00 ? 52  VAL A C    1  
ATOM 717   O O    . VAL A 1 52  ? -6.303  -2.496  5.889   1.00 0.00 ? 52  VAL A O    1  
ATOM 718   C CB   . VAL A 1 52  ? -8.681  -2.403  3.837   1.00 0.00 ? 52  VAL A CB   1  
ATOM 719   C CG1  . VAL A 1 52  ? -8.956  -0.909  4.019   1.00 0.00 ? 52  VAL A CG1  1  
ATOM 720   C CG2  . VAL A 1 52  ? -9.479  -2.968  2.660   1.00 0.00 ? 52  VAL A CG2  1  
ATOM 721   H H    . VAL A 1 52  ? -7.467  -4.632  4.297   1.00 0.00 ? 52  VAL A H    1  
ATOM 722   H HA   . VAL A 1 52  ? -6.881  -2.267  2.696   1.00 0.00 ? 52  VAL A HA   1  
ATOM 723   H HB   . VAL A 1 52  ? -9.009  -2.917  4.741   1.00 0.00 ? 52  VAL A HB   1  
ATOM 724   H HG11 . VAL A 1 52  ? -8.212  -0.483  4.692   1.00 0.00 ? 52  VAL A HG11 1  
ATOM 725   H HG12 . VAL A 1 52  ? -8.901  -0.409  3.052   1.00 0.00 ? 52  VAL A HG12 1  
ATOM 726   H HG13 . VAL A 1 52  ? -9.950  -0.772  4.443   1.00 0.00 ? 52  VAL A HG13 1  
ATOM 727   H HG21 . VAL A 1 52  ? -8.843  -3.635  2.077   1.00 0.00 ? 52  VAL A HG21 1  
ATOM 728   H HG22 . VAL A 1 52  ? -10.338 -3.523  3.037   1.00 0.00 ? 52  VAL A HG22 1  
ATOM 729   H HG23 . VAL A 1 52  ? -9.823  -2.150  2.028   1.00 0.00 ? 52  VAL A HG23 1  
ATOM 730   N N    . VAL A 1 53  ? -5.657  -0.945  4.375   1.00 0.00 ? 53  VAL A N    1  
ATOM 731   C CA   . VAL A 1 53  ? -4.806  -0.227  5.308   1.00 0.00 ? 53  VAL A CA   1  
ATOM 732   C C    . VAL A 1 53  ? -5.650  0.782   6.089   1.00 0.00 ? 53  VAL A C    1  
ATOM 733   O O    . VAL A 1 53  ? -6.073  1.799   5.541   1.00 0.00 ? 53  VAL A O    1  
ATOM 734   C CB   . VAL A 1 53  ? -3.639  0.421   4.560   1.00 0.00 ? 53  VAL A CB   1  
ATOM 735   C CG1  . VAL A 1 53  ? -2.653  1.067   5.535   1.00 0.00 ? 53  VAL A CG1  1  
ATOM 736   C CG2  . VAL A 1 53  ? -2.934  -0.595  3.659   1.00 0.00 ? 53  VAL A CG2  1  
ATOM 737   H H    . VAL A 1 53  ? -5.686  -0.565  3.451   1.00 0.00 ? 53  VAL A H    1  
ATOM 738   H HA   . VAL A 1 53  ? -4.395  -0.956  6.007   1.00 0.00 ? 53  VAL A HA   1  
ATOM 739   H HB   . VAL A 1 53  ? -4.045  1.208   3.924   1.00 0.00 ? 53  VAL A HB   1  
ATOM 740   H HG11 . VAL A 1 53  ? -1.775  1.411   4.989   1.00 0.00 ? 53  VAL A HG11 1  
ATOM 741   H HG12 . VAL A 1 53  ? -3.130  1.914   6.027   1.00 0.00 ? 53  VAL A HG12 1  
ATOM 742   H HG13 . VAL A 1 53  ? -2.351  0.335   6.284   1.00 0.00 ? 53  VAL A HG13 1  
ATOM 743   H HG21 . VAL A 1 53  ? -2.385  -1.307  4.274   1.00 0.00 ? 53  VAL A HG21 1  
ATOM 744   H HG22 . VAL A 1 53  ? -3.675  -1.126  3.061   1.00 0.00 ? 53  VAL A HG22 1  
ATOM 745   H HG23 . VAL A 1 53  ? -2.240  -0.074  2.999   1.00 0.00 ? 53  VAL A HG23 1  
ATOM 746   N N    . LEU A 1 54  ? -5.869  0.466   7.357   1.00 0.00 ? 54  LEU A N    1  
ATOM 747   C CA   . LEU A 1 54  ? -6.655  1.333   8.219   1.00 0.00 ? 54  LEU A CA   1  
ATOM 748   C C    . LEU A 1 54  ? -5.826  2.565   8.588   1.00 0.00 ? 54  LEU A C    1  
ATOM 749   O O    . LEU A 1 54  ? -6.372  3.650   8.781   1.00 0.00 ? 54  LEU A O    1  
ATOM 750   C CB   . LEU A 1 54  ? -7.175  0.556   9.430   1.00 0.00 ? 54  LEU A CB   1  
ATOM 751   C CG   . LEU A 1 54  ? -8.145  -0.588  9.126   1.00 0.00 ? 54  LEU A CG   1  
ATOM 752   C CD1  . LEU A 1 54  ? -8.297  -1.514  10.335  1.00 0.00 ? 54  LEU A CD1  1  
ATOM 753   C CD2  . LEU A 1 54  ? -9.494  -0.050  8.644   1.00 0.00 ? 54  LEU A CD2  1  
ATOM 754   H H    . LEU A 1 54  ? -5.522  -0.363  7.795   1.00 0.00 ? 54  LEU A H    1  
ATOM 755   H HA   . LEU A 1 54  ? -7.524  1.660   7.648   1.00 0.00 ? 54  LEU A HA   1  
ATOM 756   H HB2  . LEU A 1 54  ? -6.320  0.147   9.969   1.00 0.00 ? 54  LEU A HB2  1  
ATOM 757   H HB3  . LEU A 1 54  ? -7.670  1.257   10.101  1.00 0.00 ? 54  LEU A HB3  1  
ATOM 758   H HG   . LEU A 1 54  ? -7.728  -1.184  8.315   1.00 0.00 ? 54  LEU A HG   1  
ATOM 759   H HD11 . LEU A 1 54  ? -8.899  -2.379  10.057  1.00 0.00 ? 54  LEU A HD11 1  
ATOM 760   H HD12 . LEU A 1 54  ? -7.312  -1.847  10.663  1.00 0.00 ? 54  LEU A HD12 1  
ATOM 761   H HD13 . LEU A 1 54  ? -8.787  -0.975  11.146  1.00 0.00 ? 54  LEU A HD13 1  
ATOM 762   H HD21 . LEU A 1 54  ? -9.750  -0.513  7.691   1.00 0.00 ? 54  LEU A HD21 1  
ATOM 763   H HD22 . LEU A 1 54  ? -10.263 -0.284  9.380   1.00 0.00 ? 54  LEU A HD22 1  
ATOM 764   H HD23 . LEU A 1 54  ? -9.429  1.031   8.517   1.00 0.00 ? 54  LEU A HD23 1  
ATOM 765   N N    . SER A 1 55  ? -4.521  2.356   8.676   1.00 0.00 ? 55  SER A N    1  
ATOM 766   C CA   . SER A 1 55  ? -3.611  3.435   9.019   1.00 0.00 ? 55  SER A CA   1  
ATOM 767   C C    . SER A 1 55  ? -2.280  3.251   8.287   1.00 0.00 ? 55  SER A C    1  
ATOM 768   O O    . SER A 1 55  ? -1.948  2.144   7.866   1.00 0.00 ? 55  SER A O    1  
ATOM 769   C CB   . SER A 1 55  ? -3.381  3.503   10.530  1.00 0.00 ? 55  SER A CB   1  
ATOM 770   O OG   . SER A 1 55  ? -3.385  2.210   11.129  1.00 0.00 ? 55  SER A OG   1  
ATOM 771   H H    . SER A 1 55  ? -4.085  1.470   8.517   1.00 0.00 ? 55  SER A H    1  
ATOM 772   H HA   . SER A 1 55  ? -4.107  4.347   8.687   1.00 0.00 ? 55  SER A HA   1  
ATOM 773   H HB2  . SER A 1 55  ? -2.428  3.992   10.730  1.00 0.00 ? 55  SER A HB2  1  
ATOM 774   H HB3  . SER A 1 55  ? -4.157  4.117   10.988  1.00 0.00 ? 55  SER A HB3  1  
ATOM 775   H HG   . SER A 1 55  ? -2.932  2.244   12.020  1.00 0.00 ? 55  SER A HG   1  
ATOM 776   N N    . ILE A 1 56  ? -1.555  4.352   8.159   1.00 0.00 ? 56  ILE A N    1  
ATOM 777   C CA   . ILE A 1 56  ? -0.267  4.325   7.486   1.00 0.00 ? 56  ILE A CA   1  
ATOM 778   C C    . ILE A 1 56  ? 0.757   5.094   8.323   1.00 0.00 ? 56  ILE A C    1  
ATOM 779   O O    . ILE A 1 56  ? 0.728   6.323   8.372   1.00 0.00 ? 56  ILE A O    1  
ATOM 780   C CB   . ILE A 1 56  ? -0.402  4.842   6.052   1.00 0.00 ? 56  ILE A CB   1  
ATOM 781   C CG1  . ILE A 1 56  ? -0.910  3.742   5.118   1.00 0.00 ? 56  ILE A CG1  1  
ATOM 782   C CG2  . ILE A 1 56  ? 0.915   5.448   5.562   1.00 0.00 ? 56  ILE A CG2  1  
ATOM 783   C CD1  . ILE A 1 56  ? -1.091  4.272   3.694   1.00 0.00 ? 56  ILE A CD1  1  
ATOM 784   H H    . ILE A 1 56  ? -1.832  5.248   8.505   1.00 0.00 ? 56  ILE A H    1  
ATOM 785   H HA   . ILE A 1 56  ? 0.048   3.284   7.424   1.00 0.00 ? 56  ILE A HA   1  
ATOM 786   H HB   . ILE A 1 56  ? -1.145  5.640   6.045   1.00 0.00 ? 56  ILE A HB   1  
ATOM 787   H HG12 . ILE A 1 56  ? -0.206  2.910   5.114   1.00 0.00 ? 56  ILE A HG12 1  
ATOM 788   H HG13 . ILE A 1 56  ? -1.859  3.355   5.489   1.00 0.00 ? 56  ILE A HG13 1  
ATOM 789   H HG21 . ILE A 1 56  ? 1.748   4.975   6.082   1.00 0.00 ? 56  ILE A HG21 1  
ATOM 790   H HG22 . ILE A 1 56  ? 1.015   5.280   4.489   1.00 0.00 ? 56  ILE A HG22 1  
ATOM 791   H HG23 . ILE A 1 56  ? 0.920   6.519   5.764   1.00 0.00 ? 56  ILE A HG23 1  
ATOM 792   H HD11 . ILE A 1 56  ? -1.960  3.799   3.238   1.00 0.00 ? 56  ILE A HD11 1  
ATOM 793   H HD12 . ILE A 1 56  ? -1.239  5.352   3.724   1.00 0.00 ? 56  ILE A HD12 1  
ATOM 794   H HD13 . ILE A 1 56  ? -0.202  4.044   3.106   1.00 0.00 ? 56  ILE A HD13 1  
ATOM 795   N N    . ASP A 1 57  ? 1.639   4.338   8.961   1.00 0.00 ? 57  ASP A N    1  
ATOM 796   C CA   . ASP A 1 57  ? 2.670   4.933   9.794   1.00 0.00 ? 57  ASP A CA   1  
ATOM 797   C C    . ASP A 1 57  ? 2.022   5.570   11.025  1.00 0.00 ? 57  ASP A C    1  
ATOM 798   O O    . ASP A 1 57  ? 2.459   6.623   11.486  1.00 0.00 ? 57  ASP A O    1  
ATOM 799   C CB   . ASP A 1 57  ? 3.426   6.028   9.037   1.00 0.00 ? 57  ASP A CB   1  
ATOM 800   C CG   . ASP A 1 57  ? 4.831   6.325   9.563   1.00 0.00 ? 57  ASP A CG   1  
ATOM 801   O OD1  . ASP A 1 57  ? 5.271   5.576   10.462  1.00 0.00 ? 57  ASP A OD1  1  
ATOM 802   O OD2  . ASP A 1 57  ? 5.434   7.295   9.055   1.00 0.00 ? 57  ASP A OD2  1  
ATOM 803   H H    . ASP A 1 57  ? 1.656   3.339   8.916   1.00 0.00 ? 57  ASP A H    1  
ATOM 804   H HA   . ASP A 1 57  ? 3.339   4.111   10.052  1.00 0.00 ? 57  ASP A HA   1  
ATOM 805   H HB2  . ASP A 1 57  ? 3.500   5.739   7.989   1.00 0.00 ? 57  ASP A HB2  1  
ATOM 806   H HB3  . ASP A 1 57  ? 2.838   6.945   9.074   1.00 0.00 ? 57  ASP A HB3  1  
ATOM 807   N N    . GLY A 1 58  ? 0.991   4.903   11.522  1.00 0.00 ? 58  GLY A N    1  
ATOM 808   C CA   . GLY A 1 58  ? 0.278   5.391   12.690  1.00 0.00 ? 58  GLY A CA   1  
ATOM 809   C C    . GLY A 1 58  ? -0.721  6.485   12.307  1.00 0.00 ? 58  GLY A C    1  
ATOM 810   O O    . GLY A 1 58  ? -1.447  6.994   13.159  1.00 0.00 ? 58  GLY A O    1  
ATOM 811   H H    . GLY A 1 58  ? 0.642   4.047   11.141  1.00 0.00 ? 58  GLY A H    1  
ATOM 812   H HA2  . GLY A 1 58  ? -0.248  4.566   13.171  1.00 0.00 ? 58  GLY A HA2  1  
ATOM 813   H HA3  . GLY A 1 58  ? 0.989   5.782   13.418  1.00 0.00 ? 58  GLY A HA3  1  
ATOM 814   N N    . ILE A 1 59  ? -0.725  6.814   11.023  1.00 0.00 ? 59  ILE A N    1  
ATOM 815   C CA   . ILE A 1 59  ? -1.623  7.837   10.516  1.00 0.00 ? 59  ILE A CA   1  
ATOM 816   C C    . ILE A 1 59  ? -2.892  7.175   9.976   1.00 0.00 ? 59  ILE A C    1  
ATOM 817   O O    . ILE A 1 59  ? -2.861  6.023   9.545   1.00 0.00 ? 59  ILE A O    1  
ATOM 818   C CB   . ILE A 1 59  ? -0.906  8.719   9.491   1.00 0.00 ? 59  ILE A CB   1  
ATOM 819   C CG1  . ILE A 1 59  ? 0.405   9.266   10.060  1.00 0.00 ? 59  ILE A CG1  1  
ATOM 820   C CG2  . ILE A 1 59  ? -1.824  9.836   8.991   1.00 0.00 ? 59  ILE A CG2  1  
ATOM 821   C CD1  . ILE A 1 59  ? 0.168   10.569  10.826  1.00 0.00 ? 59  ILE A CD1  1  
ATOM 822   H H    . ILE A 1 59  ? -0.131  6.394   10.336  1.00 0.00 ? 59  ILE A H    1  
ATOM 823   H HA   . ILE A 1 59  ? -1.897  8.477   11.355  1.00 0.00 ? 59  ILE A HA   1  
ATOM 824   H HB   . ILE A 1 59  ? -0.650  8.102   8.630   1.00 0.00 ? 59  ILE A HB   1  
ATOM 825   H HG12 . ILE A 1 59  ? 0.854   8.527   10.724  1.00 0.00 ? 59  ILE A HG12 1  
ATOM 826   H HG13 . ILE A 1 59  ? 1.113   9.439   9.250   1.00 0.00 ? 59  ILE A HG13 1  
ATOM 827   H HG21 . ILE A 1 59  ? -1.253  10.525  8.369   1.00 0.00 ? 59  ILE A HG21 1  
ATOM 828   H HG22 . ILE A 1 59  ? -2.635  9.404   8.404   1.00 0.00 ? 59  ILE A HG22 1  
ATOM 829   H HG23 . ILE A 1 59  ? -2.239  10.374  9.843   1.00 0.00 ? 59  ILE A HG23 1  
ATOM 830   H HD11 . ILE A 1 59  ? -0.681  10.447  11.498  1.00 0.00 ? 59  ILE A HD11 1  
ATOM 831   H HD12 . ILE A 1 59  ? 1.057   10.817  11.406  1.00 0.00 ? 59  ILE A HD12 1  
ATOM 832   H HD13 . ILE A 1 59  ? -0.040  11.373  10.120  1.00 0.00 ? 59  ILE A HD13 1  
ATOM 833   N N    . SER A 1 60  ? -3.980  7.931   10.018  1.00 0.00 ? 60  SER A N    1  
ATOM 834   C CA   . SER A 1 60  ? -5.257  7.432   9.539   1.00 0.00 ? 60  SER A CA   1  
ATOM 835   C C    . SER A 1 60  ? -5.311  7.513   8.012   1.00 0.00 ? 60  SER A C    1  
ATOM 836   O O    . SER A 1 60  ? -5.165  8.591   7.438   1.00 0.00 ? 60  SER A O    1  
ATOM 837   C CB   . SER A 1 60  ? -6.420  8.214   10.153  1.00 0.00 ? 60  SER A CB   1  
ATOM 838   O OG   . SER A 1 60  ? -7.237  7.392   10.982  1.00 0.00 ? 60  SER A OG   1  
ATOM 839   H H    . SER A 1 60  ? -3.997  8.867   10.370  1.00 0.00 ? 60  SER A H    1  
ATOM 840   H HA   . SER A 1 60  ? -5.304  6.394   9.869   1.00 0.00 ? 60  SER A HA   1  
ATOM 841   H HB2  . SER A 1 60  ? -6.028  9.044   10.740  1.00 0.00 ? 60  SER A HB2  1  
ATOM 842   H HB3  . SER A 1 60  ? -7.027  8.645   9.357   1.00 0.00 ? 60  SER A HB3  1  
ATOM 843   H HG   . SER A 1 60  ? -6.702  7.040   11.749  1.00 0.00 ? 60  SER A HG   1  
ATOM 844   N N    . ALA A 1 61  ? -5.520  6.358   7.397   1.00 0.00 ? 61  ALA A N    1  
ATOM 845   C CA   . ALA A 1 61  ? -5.595  6.284   5.948   1.00 0.00 ? 61  ALA A CA   1  
ATOM 846   C C    . ALA A 1 61  ? -7.063  6.262   5.518   1.00 0.00 ? 61  ALA A C    1  
ATOM 847   O O    . ALA A 1 61  ? -7.422  5.581   4.558   1.00 0.00 ? 61  ALA A O    1  
ATOM 848   C CB   . ALA A 1 61  ? -4.825  5.056   5.458   1.00 0.00 ? 61  ALA A CB   1  
ATOM 849   H H    . ALA A 1 61  ? -5.638  5.485   7.871   1.00 0.00 ? 61  ALA A H    1  
ATOM 850   H HA   . ALA A 1 61  ? -5.121  7.179   5.545   1.00 0.00 ? 61  ALA A HA   1  
ATOM 851   H HB1  . ALA A 1 61  ? -4.837  4.288   6.231   1.00 0.00 ? 61  ALA A HB1  1  
ATOM 852   H HB2  . ALA A 1 61  ? -5.296  4.669   4.554   1.00 0.00 ? 61  ALA A HB2  1  
ATOM 853   H HB3  . ALA A 1 61  ? -3.795  5.336   5.240   1.00 0.00 ? 61  ALA A HB3  1  
ATOM 854   N N    . GLN A 1 62  ? -7.872  7.015   6.249   1.00 0.00 ? 62  GLN A N    1  
ATOM 855   C CA   . GLN A 1 62  ? -9.293  7.090   5.955   1.00 0.00 ? 62  GLN A CA   1  
ATOM 856   C C    . GLN A 1 62  ? -9.566  8.190   4.926   1.00 0.00 ? 62  GLN A C    1  
ATOM 857   O O    . GLN A 1 62  ? -10.223 7.950   3.915   1.00 0.00 ? 62  GLN A O    1  
ATOM 858   C CB   . GLN A 1 62  ? -10.106 7.319   7.231   1.00 0.00 ? 62  GLN A CB   1  
ATOM 859   C CG   . GLN A 1 62  ? -10.669 6.001   7.766   1.00 0.00 ? 62  GLN A CG   1  
ATOM 860   C CD   . GLN A 1 62  ? -10.332 5.822   9.248   1.00 0.00 ? 62  GLN A CD   1  
ATOM 861   O OE1  . GLN A 1 62  ? -9.988  6.759   9.950   1.00 0.00 ? 62  GLN A OE1  1  
ATOM 862   N NE2  . GLN A 1 62  ? -10.450 4.571   9.682   1.00 0.00 ? 62  GLN A NE2  1  
ATOM 863   H H    . GLN A 1 62  ? -7.572  7.565   7.027   1.00 0.00 ? 62  GLN A H    1  
ATOM 864   H HA   . GLN A 1 62  ? -9.554  6.118   5.535   1.00 0.00 ? 62  GLN A HA   1  
ATOM 865   H HB2  . GLN A 1 62  ? -9.476  7.784   7.989   1.00 0.00 ? 62  GLN A HB2  1  
ATOM 866   H HB3  . GLN A 1 62  ? -10.922 8.012   7.027   1.00 0.00 ? 62  GLN A HB3  1  
ATOM 867   H HG2  . GLN A 1 62  ? -11.751 5.982   7.630   1.00 0.00 ? 62  GLN A HG2  1  
ATOM 868   H HG3  . GLN A 1 62  ? -10.262 5.168   7.194   1.00 0.00 ? 62  GLN A HG3  1  
ATOM 869   H HE21 . GLN A 1 62  ? -10.738 3.848   9.053   1.00 0.00 ? 62  GLN A HE21 1  
ATOM 870   H HE22 . GLN A 1 62  ? -10.252 4.353   10.638  1.00 0.00 ? 62  GLN A HE22 1  
ATOM 871   N N    . GLY A 1 63  ? -9.046  9.372   5.221   1.00 0.00 ? 63  GLY A N    1  
ATOM 872   C CA   . GLY A 1 63  ? -9.225  10.510  4.335   1.00 0.00 ? 63  GLY A CA   1  
ATOM 873   C C    . GLY A 1 63  ? -7.913  10.871  3.635   1.00 0.00 ? 63  GLY A C    1  
ATOM 874   O O    . GLY A 1 63  ? -7.525  12.038  3.599   1.00 0.00 ? 63  GLY A O    1  
ATOM 875   H H    . GLY A 1 63  ? -8.513  9.559   6.046   1.00 0.00 ? 63  GLY A H    1  
ATOM 876   H HA2  . GLY A 1 63  ? -9.987  10.279  3.590   1.00 0.00 ? 63  GLY A HA2  1  
ATOM 877   H HA3  . GLY A 1 63  ? -9.585  11.366  4.905   1.00 0.00 ? 63  GLY A HA3  1  
ATOM 878   N N    . MET A 1 64  ? -7.266  9.848   3.096   1.00 0.00 ? 64  MET A N    1  
ATOM 879   C CA   . MET A 1 64  ? -6.006  10.043  2.400   1.00 0.00 ? 64  MET A CA   1  
ATOM 880   C C    . MET A 1 64  ? -6.041  9.400   1.012   1.00 0.00 ? 64  MET A C    1  
ATOM 881   O O    . MET A 1 64  ? -6.430  8.242   0.870   1.00 0.00 ? 64  MET A O    1  
ATOM 882   C CB   . MET A 1 64  ? -4.869  9.429   3.219   1.00 0.00 ? 64  MET A CB   1  
ATOM 883   C CG   . MET A 1 64  ? -4.501  10.324  4.404   1.00 0.00 ? 64  MET A CG   1  
ATOM 884   S SD   . MET A 1 64  ? -2.739  10.275  4.682   1.00 0.00 ? 64  MET A SD   1  
ATOM 885   C CE   . MET A 1 64  ? -2.513  8.521   4.928   1.00 0.00 ? 64  MET A CE   1  
ATOM 886   H H    . MET A 1 64  ? -7.588  8.902   3.130   1.00 0.00 ? 64  MET A H    1  
ATOM 887   H HA   . MET A 1 64  ? -5.888  11.123  2.304   1.00 0.00 ? 64  MET A HA   1  
ATOM 888   H HB2  . MET A 1 64  ? -5.167  8.445   3.580   1.00 0.00 ? 64  MET A HB2  1  
ATOM 889   H HB3  . MET A 1 64  ? -3.995  9.284   2.583   1.00 0.00 ? 64  MET A HB3  1  
ATOM 890   H HG2  . MET A 1 64  ? -4.818  11.348  4.209   1.00 0.00 ? 64  MET A HG2  1  
ATOM 891   H HG3  . MET A 1 64  ? -5.028  9.992   5.298   1.00 0.00 ? 64  MET A HG3  1  
ATOM 892   H HE1  . MET A 1 64  ? -3.340  8.127   5.519   1.00 0.00 ? 64  MET A HE1  1  
ATOM 893   H HE2  . MET A 1 64  ? -2.485  8.019   3.961   1.00 0.00 ? 64  MET A HE2  1  
ATOM 894   H HE3  . MET A 1 64  ? -1.575  8.346   5.455   1.00 0.00 ? 64  MET A HE3  1  
ATOM 895   N N    . THR A 1 65  ? -5.630  10.179  0.023   1.00 0.00 ? 65  THR A N    1  
ATOM 896   C CA   . THR A 1 65  ? -5.609  9.700   -1.349  1.00 0.00 ? 65  THR A CA   1  
ATOM 897   C C    . THR A 1 65  ? -4.458  8.714   -1.552  1.00 0.00 ? 65  THR A C    1  
ATOM 898   O O    . THR A 1 65  ? -3.615  8.548   -0.672  1.00 0.00 ? 65  THR A O    1  
ATOM 899   C CB   . THR A 1 65  ? -5.538  10.917  -2.274  1.00 0.00 ? 65  THR A CB   1  
ATOM 900   O OG1  . THR A 1 65  ? -4.709  11.839  -1.571  1.00 0.00 ? 65  THR A OG1  1  
ATOM 901   C CG2  . THR A 1 65  ? -6.881  11.640  -2.395  1.00 0.00 ? 65  THR A CG2  1  
ATOM 902   H H    . THR A 1 65  ? -5.315  11.120  0.146   1.00 0.00 ? 65  THR A H    1  
ATOM 903   H HA   . THR A 1 65  ? -6.534  9.155   -1.536  1.00 0.00 ? 65  THR A HA   1  
ATOM 904   H HB   . THR A 1 65  ? -5.156  10.637  -3.256  1.00 0.00 ? 65  THR A HB   1  
ATOM 905   H HG1  . THR A 1 65  ? -3.851  11.397  -1.310  1.00 0.00 ? 65  THR A HG1  1  
ATOM 906   H HG21 . THR A 1 65  ? -7.031  12.275  -1.522  1.00 0.00 ? 65  THR A HG21 1  
ATOM 907   H HG22 . THR A 1 65  ? -6.883  12.254  -3.296  1.00 0.00 ? 65  THR A HG22 1  
ATOM 908   H HG23 . THR A 1 65  ? -7.685  10.906  -2.454  1.00 0.00 ? 65  THR A HG23 1  
ATOM 909   N N    . HIS A 1 66  ? -4.459  8.084   -2.718  1.00 0.00 ? 66  HIS A N    1  
ATOM 910   C CA   . HIS A 1 66  ? -3.424  7.119   -3.048  1.00 0.00 ? 66  HIS A CA   1  
ATOM 911   C C    . HIS A 1 66  ? -2.047  7.759   -2.865  1.00 0.00 ? 66  HIS A C    1  
ATOM 912   O O    . HIS A 1 66  ? -1.196  7.219   -2.161  1.00 0.00 ? 66  HIS A O    1  
ATOM 913   C CB   . HIS A 1 66  ? -3.635  6.557   -4.456  1.00 0.00 ? 66  HIS A CB   1  
ATOM 914   C CG   . HIS A 1 66  ? -2.921  5.250   -4.709  1.00 0.00 ? 66  HIS A CG   1  
ATOM 915   N ND1  . HIS A 1 66  ? -2.162  5.018   -5.842  1.00 0.00 ? 66  HIS A ND1  1  
ATOM 916   C CD2  . HIS A 1 66  ? -2.857  4.110   -3.963  1.00 0.00 ? 66  HIS A CD2  1  
ATOM 917   C CE1  . HIS A 1 66  ? -1.669  3.790   -5.772  1.00 0.00 ? 66  HIS A CE1  1  
ATOM 918   N NE2  . HIS A 1 66  ? -2.102  3.229   -4.606  1.00 0.00 ? 66  HIS A NE2  1  
ATOM 919   H H    . HIS A 1 66  ? -5.148  8.225   -3.429  1.00 0.00 ? 66  HIS A H    1  
ATOM 920   H HA   . HIS A 1 66  ? -3.529  6.295   -2.342  1.00 0.00 ? 66  HIS A HA   1  
ATOM 921   H HB2  . HIS A 1 66  ? -4.702  6.413   -4.623  1.00 0.00 ? 66  HIS A HB2  1  
ATOM 922   H HB3  . HIS A 1 66  ? -3.294  7.292   -5.184  1.00 0.00 ? 66  HIS A HB3  1  
ATOM 923   H HD1  . HIS A 1 66  ? -2.011  5.667   -6.588  1.00 0.00 ? 66  HIS A HD1  1  
ATOM 924   H HD2  . HIS A 1 66  ? -3.345  3.950   -3.001  1.00 0.00 ? 66  HIS A HD2  1  
ATOM 925   H HE1  . HIS A 1 66  ? -1.030  3.313   -6.515  1.00 0.00 ? 66  HIS A HE1  1  
ATOM 926   N N    . LEU A 1 67  ? -1.871  8.902   -3.512  1.00 0.00 ? 67  LEU A N    1  
ATOM 927   C CA   . LEU A 1 67  ? -0.612  9.622   -3.430  1.00 0.00 ? 67  LEU A CA   1  
ATOM 928   C C    . LEU A 1 67  ? -0.248  9.838   -1.959  1.00 0.00 ? 67  LEU A C    1  
ATOM 929   O O    . LEU A 1 67  ? 0.884   9.580   -1.552  1.00 0.00 ? 67  LEU A O    1  
ATOM 930   C CB   . LEU A 1 67  ? -0.680  10.916  -4.243  1.00 0.00 ? 67  LEU A CB   1  
ATOM 931   C CG   . LEU A 1 67  ? -0.132  12.169  -3.557  1.00 0.00 ? 67  LEU A CG   1  
ATOM 932   C CD1  . LEU A 1 67  ? -1.100  12.676  -2.487  1.00 0.00 ? 67  LEU A CD1  1  
ATOM 933   C CD2  . LEU A 1 67  ? 1.267   11.917  -2.991  1.00 0.00 ? 67  LEU A CD2  1  
ATOM 934   H H    . LEU A 1 67  ? -2.569  9.335   -4.083  1.00 0.00 ? 67  LEU A H    1  
ATOM 935   H HA   . LEU A 1 67  ? 0.154   8.995   -3.886  1.00 0.00 ? 67  LEU A HA   1  
ATOM 936   H HB2  . LEU A 1 67  ? -0.133  10.767  -5.174  1.00 0.00 ? 67  LEU A HB2  1  
ATOM 937   H HB3  . LEU A 1 67  ? -1.721  11.099  -4.511  1.00 0.00 ? 67  LEU A HB3  1  
ATOM 938   H HG   . LEU A 1 67  ? -0.039  12.956  -4.306  1.00 0.00 ? 67  LEU A HG   1  
ATOM 939   H HD11 . LEU A 1 67  ? -1.268  13.745  -2.625  1.00 0.00 ? 67  LEU A HD11 1  
ATOM 940   H HD12 . LEU A 1 67  ? -2.048  12.146  -2.573  1.00 0.00 ? 67  LEU A HD12 1  
ATOM 941   H HD13 . LEU A 1 67  ? -0.674  12.500  -1.499  1.00 0.00 ? 67  LEU A HD13 1  
ATOM 942   H HD21 . LEU A 1 67  ? 1.898   12.785  -3.182  1.00 0.00 ? 67  LEU A HD21 1  
ATOM 943   H HD22 . LEU A 1 67  ? 1.199   11.747  -1.917  1.00 0.00 ? 67  LEU A HD22 1  
ATOM 944   H HD23 . LEU A 1 67  ? 1.700   11.040  -3.472  1.00 0.00 ? 67  LEU A HD23 1  
ATOM 945   N N    . GLU A 1 68  ? -1.229  10.310  -1.203  1.00 0.00 ? 68  GLU A N    1  
ATOM 946   C CA   . GLU A 1 68  ? -1.026  10.564  0.213   1.00 0.00 ? 68  GLU A CA   1  
ATOM 947   C C    . GLU A 1 68  ? -0.391  9.345   0.885   1.00 0.00 ? 68  GLU A C    1  
ATOM 948   O O    . GLU A 1 68  ? 0.763   9.396   1.309   1.00 0.00 ? 68  GLU A O    1  
ATOM 949   C CB   . GLU A 1 68  ? -2.341  10.943  0.896   1.00 0.00 ? 68  GLU A CB   1  
ATOM 950   C CG   . GLU A 1 68  ? -2.630  12.438  0.738   1.00 0.00 ? 68  GLU A CG   1  
ATOM 951   C CD   . GLU A 1 68  ? -2.591  13.149  2.092   1.00 0.00 ? 68  GLU A CD   1  
ATOM 952   O OE1  . GLU A 1 68  ? -1.471  13.289  2.628   1.00 0.00 ? 68  GLU A OE1  1  
ATOM 953   O OE2  . GLU A 1 68  ? -3.683  13.536  2.561   1.00 0.00 ? 68  GLU A OE2  1  
ATOM 954   H H    . GLU A 1 68  ? -2.146  10.517  -1.543  1.00 0.00 ? 68  GLU A H    1  
ATOM 955   H HA   . GLU A 1 68  ? -0.342  11.411  0.260   1.00 0.00 ? 68  GLU A HA   1  
ATOM 956   H HB2  . GLU A 1 68  ? -3.159  10.364  0.466   1.00 0.00 ? 68  GLU A HB2  1  
ATOM 957   H HB3  . GLU A 1 68  ? -2.293  10.688  1.954   1.00 0.00 ? 68  GLU A HB3  1  
ATOM 958   H HG2  . GLU A 1 68  ? -1.896  12.884  0.068   1.00 0.00 ? 68  GLU A HG2  1  
ATOM 959   H HG3  . GLU A 1 68  ? -3.608  12.576  0.278   1.00 0.00 ? 68  GLU A HG3  1  
ATOM 960   N N    . ALA A 1 69  ? -1.172  8.277   0.962   1.00 0.00 ? 69  ALA A N    1  
ATOM 961   C CA   . ALA A 1 69  ? -0.701  7.047   1.575   1.00 0.00 ? 69  ALA A CA   1  
ATOM 962   C C    . ALA A 1 69  ? 0.708   6.736   1.066   1.00 0.00 ? 69  ALA A C    1  
ATOM 963   O O    . ALA A 1 69  ? 1.557   6.268   1.823   1.00 0.00 ? 69  ALA A O    1  
ATOM 964   C CB   . ALA A 1 69  ? -1.690  5.918   1.280   1.00 0.00 ? 69  ALA A CB   1  
ATOM 965   H H    . ALA A 1 69  ? -2.109  8.244   0.614   1.00 0.00 ? 69  ALA A H    1  
ATOM 966   H HA   . ALA A 1 69  ? -0.661  7.208   2.652   1.00 0.00 ? 69  ALA A HA   1  
ATOM 967   H HB1  . ALA A 1 69  ? -2.264  6.162   0.387   1.00 0.00 ? 69  ALA A HB1  1  
ATOM 968   H HB2  . ALA A 1 69  ? -1.143  4.989   1.119   1.00 0.00 ? 69  ALA A HB2  1  
ATOM 969   H HB3  . ALA A 1 69  ? -2.367  5.798   2.126   1.00 0.00 ? 69  ALA A HB3  1  
ATOM 970   N N    . GLN A 1 70  ? 0.914   7.008   -0.215  1.00 0.00 ? 70  GLN A N    1  
ATOM 971   C CA   . GLN A 1 70  ? 2.205   6.763   -0.834  1.00 0.00 ? 70  GLN A CA   1  
ATOM 972   C C    . GLN A 1 70  ? 3.255   7.723   -0.271  1.00 0.00 ? 70  GLN A C    1  
ATOM 973   O O    . GLN A 1 70  ? 4.406   7.341   -0.070  1.00 0.00 ? 70  GLN A O    1  
ATOM 974   C CB   . GLN A 1 70  ? 2.114   6.881   -2.357  1.00 0.00 ? 70  GLN A CB   1  
ATOM 975   C CG   . GLN A 1 70  ? 1.135   5.854   -2.929  1.00 0.00 ? 70  GLN A CG   1  
ATOM 976   C CD   . GLN A 1 70  ? 1.852   4.872   -3.858  1.00 0.00 ? 70  GLN A CD   1  
ATOM 977   O OE1  . GLN A 1 70  ? 2.472   3.912   -3.430  1.00 0.00 ? 70  GLN A OE1  1  
ATOM 978   N NE2  . GLN A 1 70  ? 1.732   5.164   -5.150  1.00 0.00 ? 70  GLN A NE2  1  
ATOM 979   H H    . GLN A 1 70  ? 0.218   7.389   -0.824  1.00 0.00 ? 70  GLN A H    1  
ATOM 980   H HA   . GLN A 1 70  ? 2.463   5.737   -0.570  1.00 0.00 ? 70  GLN A HA   1  
ATOM 981   H HB2  . GLN A 1 70  ? 1.792   7.886   -2.629  1.00 0.00 ? 70  GLN A HB2  1  
ATOM 982   H HB3  . GLN A 1 70  ? 3.100   6.732   -2.796  1.00 0.00 ? 70  GLN A HB3  1  
ATOM 983   H HG2  . GLN A 1 70  ? 0.658   5.307   -2.115  1.00 0.00 ? 70  GLN A HG2  1  
ATOM 984   H HG3  . GLN A 1 70  ? 0.343   6.366   -3.476  1.00 0.00 ? 70  GLN A HG3  1  
ATOM 985   H HE21 . GLN A 1 70  ? 1.208   5.967   -5.434  1.00 0.00 ? 70  GLN A HE21 1  
ATOM 986   H HE22 . GLN A 1 70  ? 2.165   4.581   -5.837  1.00 0.00 ? 70  GLN A HE22 1  
ATOM 987   N N    . ASN A 1 71  ? 2.819   8.952   -0.033  1.00 0.00 ? 71  ASN A N    1  
ATOM 988   C CA   . ASN A 1 71  ? 3.707   9.970   0.502   1.00 0.00 ? 71  ASN A CA   1  
ATOM 989   C C    . ASN A 1 71  ? 4.245   9.509   1.858   1.00 0.00 ? 71  ASN A C    1  
ATOM 990   O O    . ASN A 1 71  ? 5.448   9.574   2.107   1.00 0.00 ? 71  ASN A O    1  
ATOM 991   C CB   . ASN A 1 71  ? 2.965   11.292  0.712   1.00 0.00 ? 71  ASN A CB   1  
ATOM 992   C CG   . ASN A 1 71  ? 3.448   12.355  -0.277  1.00 0.00 ? 71  ASN A CG   1  
ATOM 993   O OD1  . ASN A 1 71  ? 4.610   12.415  -0.644  1.00 0.00 ? 71  ASN A OD1  1  
ATOM 994   N ND2  . ASN A 1 71  ? 2.495   13.187  -0.685  1.00 0.00 ? 71  ASN A ND2  1  
ATOM 995   H H    . ASN A 1 71  ? 1.881   9.254   -0.200  1.00 0.00 ? 71  ASN A H    1  
ATOM 996   H HA   . ASN A 1 71  ? 4.494   10.084  -0.242  1.00 0.00 ? 71  ASN A HA   1  
ATOM 997   H HB2  . ASN A 1 71  ? 1.894   11.136  0.589   1.00 0.00 ? 71  ASN A HB2  1  
ATOM 998   H HB3  . ASN A 1 71  ? 3.121   11.642  1.733   1.00 0.00 ? 71  ASN A HB3  1  
ATOM 999   H HD21 . ASN A 1 71  ? 1.560   13.083  -0.344  1.00 0.00 ? 71  ASN A HD21 1  
ATOM 1000  H HD22 . ASN A 1 71  ? 2.712   13.917  -1.333  1.00 0.00 ? 71  ASN A HD22 1  
ATOM 1001  N N    . LYS A 1 72  ? 3.328   9.054   2.699   1.00 0.00 ? 72  LYS A N    1  
ATOM 1002  C CA   . LYS A 1 72  ? 3.695   8.583   4.024   1.00 0.00 ? 72  LYS A CA   1  
ATOM 1003  C C    . LYS A 1 72  ? 4.692   7.430   3.891   1.00 0.00 ? 72  LYS A C    1  
ATOM 1004  O O    . LYS A 1 72  ? 5.770   7.465   4.484   1.00 0.00 ? 72  LYS A O    1  
ATOM 1005  C CB   . LYS A 1 72  ? 2.446   8.226   4.831   1.00 0.00 ? 72  LYS A CB   1  
ATOM 1006  C CG   . LYS A 1 72  ? 1.803   9.479   5.430   1.00 0.00 ? 72  LYS A CG   1  
ATOM 1007  C CD   . LYS A 1 72  ? 2.405   9.803   6.799   1.00 0.00 ? 72  LYS A CD   1  
ATOM 1008  C CE   . LYS A 1 72  ? 1.710   11.011  7.431   1.00 0.00 ? 72  LYS A CE   1  
ATOM 1009  N NZ   . LYS A 1 72  ? 2.494   11.517  8.580   1.00 0.00 ? 72  LYS A NZ   1  
ATOM 1010  H H    . LYS A 1 72  ? 2.351   9.005   2.489   1.00 0.00 ? 72  LYS A H    1  
ATOM 1011  H HA   . LYS A 1 72  ? 4.188   9.408   4.539   1.00 0.00 ? 72  LYS A HA   1  
ATOM 1012  H HB2  . LYS A 1 72  ? 1.727   7.715   4.191   1.00 0.00 ? 72  LYS A HB2  1  
ATOM 1013  H HB3  . LYS A 1 72  ? 2.710   7.532   5.629   1.00 0.00 ? 72  LYS A HB3  1  
ATOM 1014  H HG2  . LYS A 1 72  ? 1.949   10.323  4.756   1.00 0.00 ? 72  LYS A HG2  1  
ATOM 1015  H HG3  . LYS A 1 72  ? 0.728   9.330   5.527   1.00 0.00 ? 72  LYS A HG3  1  
ATOM 1016  H HD2  . LYS A 1 72  ? 2.308   8.938   7.456   1.00 0.00 ? 72  LYS A HD2  1  
ATOM 1017  H HD3  . LYS A 1 72  ? 3.470   10.006  6.694   1.00 0.00 ? 72  LYS A HD3  1  
ATOM 1018  H HE2  . LYS A 1 72  ? 1.591   11.799  6.688   1.00 0.00 ? 72  LYS A HE2  1  
ATOM 1019  H HE3  . LYS A 1 72  ? 0.710   10.731  7.761   1.00 0.00 ? 72  LYS A HE3  1  
ATOM 1020  H HZ1  . LYS A 1 72  ? 3.195   12.150  8.251   1.00 0.00 ? 72  LYS A HZ1  1  
ATOM 1021  H HZ2  . LYS A 1 72  ? 1.886   11.993  9.214   1.00 0.00 ? 72  LYS A HZ2  1  
ATOM 1022  H HZ3  . LYS A 1 72  ? 2.931   10.750  9.049   1.00 0.00 ? 72  LYS A HZ3  1  
ATOM 1023  N N    . ILE A 1 73  ? 4.297   6.435   3.111   1.00 0.00 ? 73  ILE A N    1  
ATOM 1024  C CA   . ILE A 1 73  ? 5.142   5.273   2.894   1.00 0.00 ? 73  ILE A CA   1  
ATOM 1025  C C    . ILE A 1 73  ? 6.554   5.736   2.529   1.00 0.00 ? 73  ILE A C    1  
ATOM 1026  O O    . ILE A 1 73  ? 7.538   5.200   3.036   1.00 0.00 ? 73  ILE A O    1  
ATOM 1027  C CB   . ILE A 1 73  ? 4.514   4.340   1.856   1.00 0.00 ? 73  ILE A CB   1  
ATOM 1028  C CG1  . ILE A 1 73  ? 3.220   3.721   2.388   1.00 0.00 ? 73  ILE A CG1  1  
ATOM 1029  C CG2  . ILE A 1 73  ? 5.514   3.275   1.400   1.00 0.00 ? 73  ILE A CG2  1  
ATOM 1030  C CD1  . ILE A 1 73  ? 2.227   3.466   1.252   1.00 0.00 ? 73  ILE A CD1  1  
ATOM 1031  H H    . ILE A 1 73  ? 3.419   6.414   2.633   1.00 0.00 ? 73  ILE A H    1  
ATOM 1032  H HA   . ILE A 1 73  ? 5.191   4.724   3.834   1.00 0.00 ? 73  ILE A HA   1  
ATOM 1033  H HB   . ILE A 1 73  ? 4.252   4.932   0.979   1.00 0.00 ? 73  ILE A HB   1  
ATOM 1034  H HG12 . ILE A 1 73  ? 3.443   2.784   2.898   1.00 0.00 ? 73  ILE A HG12 1  
ATOM 1035  H HG13 . ILE A 1 73  ? 2.771   4.386   3.126   1.00 0.00 ? 73  ILE A HG13 1  
ATOM 1036  H HG21 . ILE A 1 73  ? 6.472   3.442   1.892   1.00 0.00 ? 73  ILE A HG21 1  
ATOM 1037  H HG22 . ILE A 1 73  ? 5.137   2.287   1.664   1.00 0.00 ? 73  ILE A HG22 1  
ATOM 1038  H HG23 . ILE A 1 73  ? 5.644   3.338   0.320   1.00 0.00 ? 73  ILE A HG23 1  
ATOM 1039  H HD11 . ILE A 1 73  ? 2.012   2.399   1.190   1.00 0.00 ? 73  ILE A HD11 1  
ATOM 1040  H HD12 . ILE A 1 73  ? 1.304   4.012   1.447   1.00 0.00 ? 73  ILE A HD12 1  
ATOM 1041  H HD13 . ILE A 1 73  ? 2.658   3.805   0.310   1.00 0.00 ? 73  ILE A HD13 1  
ATOM 1042  N N    . LYS A 1 74  ? 6.609   6.728   1.652   1.00 0.00 ? 74  LYS A N    1  
ATOM 1043  C CA   . LYS A 1 74  ? 7.884   7.270   1.214   1.00 0.00 ? 74  LYS A CA   1  
ATOM 1044  C C    . LYS A 1 74  ? 8.608   7.891   2.410   1.00 0.00 ? 74  LYS A C    1  
ATOM 1045  O O    . LYS A 1 74  ? 9.835   7.847   2.489   1.00 0.00 ? 74  LYS A O    1  
ATOM 1046  C CB   . LYS A 1 74  ? 7.682   8.238   0.046   1.00 0.00 ? 74  LYS A CB   1  
ATOM 1047  C CG   . LYS A 1 74  ? 7.545   7.481   -1.276  1.00 0.00 ? 74  LYS A CG   1  
ATOM 1048  C CD   . LYS A 1 74  ? 6.334   7.977   -2.069  1.00 0.00 ? 74  LYS A CD   1  
ATOM 1049  C CE   . LYS A 1 74  ? 6.725   8.327   -3.506  1.00 0.00 ? 74  LYS A CE   1  
ATOM 1050  N NZ   . LYS A 1 74  ? 5.539   8.770   -4.273  1.00 0.00 ? 74  LYS A NZ   1  
ATOM 1051  H H    . LYS A 1 74  ? 5.804   7.159   1.244   1.00 0.00 ? 74  LYS A H    1  
ATOM 1052  H HA   . LYS A 1 74  ? 8.482   6.437   0.842   1.00 0.00 ? 74  LYS A HA   1  
ATOM 1053  H HB2  . LYS A 1 74  ? 6.791   8.841   0.219   1.00 0.00 ? 74  LYS A HB2  1  
ATOM 1054  H HB3  . LYS A 1 74  ? 8.526   8.926   -0.010  1.00 0.00 ? 74  LYS A HB3  1  
ATOM 1055  H HG2  . LYS A 1 74  ? 8.450   7.611   -1.869  1.00 0.00 ? 74  LYS A HG2  1  
ATOM 1056  H HG3  . LYS A 1 74  ? 7.443   6.414   -1.080  1.00 0.00 ? 74  LYS A HG3  1  
ATOM 1057  H HD2  . LYS A 1 74  ? 5.560   7.210   -2.075  1.00 0.00 ? 74  LYS A HD2  1  
ATOM 1058  H HD3  . LYS A 1 74  ? 5.909   8.854   -1.580  1.00 0.00 ? 74  LYS A HD3  1  
ATOM 1059  H HE2  . LYS A 1 74  ? 7.479   9.114   -3.503  1.00 0.00 ? 74  LYS A HE2  1  
ATOM 1060  H HE3  . LYS A 1 74  ? 7.173   7.458   -3.989  1.00 0.00 ? 74  LYS A HE3  1  
ATOM 1061  H HZ1  . LYS A 1 74  ? 4.710   8.430   -3.830  1.00 0.00 ? 74  LYS A HZ1  1  
ATOM 1062  H HZ2  . LYS A 1 74  ? 5.516   9.769   -4.302  1.00 0.00 ? 74  LYS A HZ2  1  
ATOM 1063  H HZ3  . LYS A 1 74  ? 5.591   8.410   -5.204  1.00 0.00 ? 74  LYS A HZ3  1  
ATOM 1064  N N    . ALA A 1 75  ? 7.817   8.456   3.311   1.00 0.00 ? 75  ALA A N    1  
ATOM 1065  C CA   . ALA A 1 75  ? 8.367   9.085   4.499   1.00 0.00 ? 75  ALA A CA   1  
ATOM 1066  C C    . ALA A 1 75  ? 9.108   8.036   5.331   1.00 0.00 ? 75  ALA A C    1  
ATOM 1067  O O    . ALA A 1 75  ? 10.210  8.288   5.817   1.00 0.00 ? 75  ALA A O    1  
ATOM 1068  C CB   . ALA A 1 75  ? 7.243   9.764   5.285   1.00 0.00 ? 75  ALA A CB   1  
ATOM 1069  H H    . ALA A 1 75  ? 6.821   8.487   3.239   1.00 0.00 ? 75  ALA A H    1  
ATOM 1070  H HA   . ALA A 1 75  ? 9.077   9.846   4.174   1.00 0.00 ? 75  ALA A HA   1  
ATOM 1071  H HB1  . ALA A 1 75  ? 7.082   9.232   6.222   1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1072  H HB2  . ALA A 1 75  ? 7.520   10.797  5.496   1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1073  H HB3  . ALA A 1 75  ? 6.327   9.747   4.695   1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1074  N N    . CYS A 1 76  ? 8.473   6.881   5.470   1.00 0.00 ? 76  CYS A N    1  
ATOM 1075  C CA   . CYS A 1 76  ? 9.058   5.793   6.234   1.00 0.00 ? 76  CYS A CA   1  
ATOM 1076  C C    . CYS A 1 76  ? 10.262  5.254   5.459   1.00 0.00 ? 76  CYS A C    1  
ATOM 1077  O O    . CYS A 1 76  ? 10.152  4.939   4.275   1.00 0.00 ? 76  CYS A O    1  
ATOM 1078  C CB   . CYS A 1 76  ? 8.033   4.696   6.531   1.00 0.00 ? 76  CYS A CB   1  
ATOM 1079  S SG   . CYS A 1 76  ? 7.202   5.031   8.127   1.00 0.00 ? 76  CYS A SG   1  
ATOM 1080  H H    . CYS A 1 76  ? 7.577   6.684   5.071   1.00 0.00 ? 76  CYS A H    1  
ATOM 1081  H HA   . CYS A 1 76  ? 9.370   6.213   7.190   1.00 0.00 ? 76  CYS A HA   1  
ATOM 1082  H HB2  . CYS A 1 76  ? 7.296   4.649   5.730   1.00 0.00 ? 76  CYS A HB2  1  
ATOM 1083  H HB3  . CYS A 1 76  ? 8.528   3.725   6.566   1.00 0.00 ? 76  CYS A HB3  1  
ATOM 1084  H HG   . CYS A 1 76  ? 6.422   3.954   8.106   1.00 0.00 ? 76  CYS A HG   1  
ATOM 1085  N N    . THR A 1 77  ? 11.384  5.165   6.158   1.00 0.00 ? 77  THR A N    1  
ATOM 1086  C CA   . THR A 1 77  ? 12.607  4.670   5.550   1.00 0.00 ? 77  THR A CA   1  
ATOM 1087  C C    . THR A 1 77  ? 13.101  3.422   6.286   1.00 0.00 ? 77  THR A C    1  
ATOM 1088  O O    . THR A 1 77  ? 13.543  2.461   5.658   1.00 0.00 ? 77  THR A O    1  
ATOM 1089  C CB   . THR A 1 77  ? 13.625  5.812   5.539   1.00 0.00 ? 77  THR A CB   1  
ATOM 1090  O OG1  . THR A 1 77  ? 13.691  6.232   6.899   1.00 0.00 ? 77  THR A OG1  1  
ATOM 1091  C CG2  . THR A 1 77  ? 13.114  7.045   4.792   1.00 0.00 ? 77  THR A CG2  1  
ATOM 1092  H H    . THR A 1 77  ? 11.465  5.423   7.121   1.00 0.00 ? 77  THR A H    1  
ATOM 1093  H HA   . THR A 1 77  ? 12.385  4.370   4.526   1.00 0.00 ? 77  THR A HA   1  
ATOM 1094  H HB   . THR A 1 77  ? 14.580  5.478   5.132   1.00 0.00 ? 77  THR A HB   1  
ATOM 1095  H HG1  . THR A 1 77  ? 14.493  5.831   7.342   1.00 0.00 ? 77  THR A HG1  1  
ATOM 1096  H HG21 . THR A 1 77  ? 12.040  6.951   4.628   1.00 0.00 ? 77  THR A HG21 1  
ATOM 1097  H HG22 . THR A 1 77  ? 13.314  7.938   5.385   1.00 0.00 ? 77  THR A HG22 1  
ATOM 1098  H HG23 . THR A 1 77  ? 13.622  7.125   3.831   1.00 0.00 ? 77  THR A HG23 1  
ATOM 1099  N N    . GLY A 1 78  ? 13.011  3.479   7.606   1.00 0.00 ? 78  GLY A N    1  
ATOM 1100  C CA   . GLY A 1 78  ? 13.443  2.365   8.434   1.00 0.00 ? 78  GLY A CA   1  
ATOM 1101  C C    . GLY A 1 78  ? 12.453  1.202   8.348   1.00 0.00 ? 78  GLY A C    1  
ATOM 1102  O O    . GLY A 1 78  ? 12.771  0.152   7.791   1.00 0.00 ? 78  GLY A O    1  
ATOM 1103  H H    . GLY A 1 78  ? 12.650  4.264   8.109   1.00 0.00 ? 78  GLY A H    1  
ATOM 1104  H HA2  . GLY A 1 78  ? 14.430  2.032   8.115   1.00 0.00 ? 78  GLY A HA2  1  
ATOM 1105  H HA3  . GLY A 1 78  ? 13.536  2.692   9.470   1.00 0.00 ? 78  GLY A HA3  1  
ATOM 1106  N N    . SER A 1 79  ? 11.274  1.427   8.909   1.00 0.00 ? 79  SER A N    1  
ATOM 1107  C CA   . SER A 1 79  ? 10.236  0.410   8.903   1.00 0.00 ? 79  SER A CA   1  
ATOM 1108  C C    . SER A 1 79  ? 8.881   1.048   8.591   1.00 0.00 ? 79  SER A C    1  
ATOM 1109  O O    . SER A 1 79  ? 8.719   2.261   8.712   1.00 0.00 ? 79  SER A O    1  
ATOM 1110  C CB   . SER A 1 79  ? 10.180  -0.328  10.242  1.00 0.00 ? 79  SER A CB   1  
ATOM 1111  O OG   . SER A 1 79  ? 10.408  0.547   11.343  1.00 0.00 ? 79  SER A OG   1  
ATOM 1112  H H    . SER A 1 79  ? 11.024  2.283   9.360   1.00 0.00 ? 79  SER A H    1  
ATOM 1113  H HA   . SER A 1 79  ? 10.520  -0.288  8.115   1.00 0.00 ? 79  SER A HA   1  
ATOM 1114  H HB2  . SER A 1 79  ? 9.206   -0.804  10.353  1.00 0.00 ? 79  SER A HB2  1  
ATOM 1115  H HB3  . SER A 1 79  ? 10.926  -1.123  10.249  1.00 0.00 ? 79  SER A HB3  1  
ATOM 1116  H HG   . SER A 1 79  ? 9.657   1.202   11.421  1.00 0.00 ? 79  SER A HG   1  
ATOM 1117  N N    . LEU A 1 80  ? 7.941   0.201   8.197   1.00 0.00 ? 80  LEU A N    1  
ATOM 1118  C CA   . LEU A 1 80  ? 6.604   0.667   7.868   1.00 0.00 ? 80  LEU A CA   1  
ATOM 1119  C C    . LEU A 1 80  ? 5.610   0.117   8.892   1.00 0.00 ? 80  LEU A C    1  
ATOM 1120  O O    . LEU A 1 80  ? 5.457   -1.096  9.024   1.00 0.00 ? 80  LEU A O    1  
ATOM 1121  C CB   . LEU A 1 80  ? 6.255   0.314   6.421   1.00 0.00 ? 80  LEU A CB   1  
ATOM 1122  C CG   . LEU A 1 80  ? 5.306   1.277   5.706   1.00 0.00 ? 80  LEU A CG   1  
ATOM 1123  C CD1  . LEU A 1 80  ? 5.955   2.650   5.519   1.00 0.00 ? 80  LEU A CD1  1  
ATOM 1124  C CD2  . LEU A 1 80  ? 4.823   0.687   4.379   1.00 0.00 ? 80  LEU A CD2  1  
ATOM 1125  H H    . LEU A 1 80  ? 8.080   -0.784  8.102   1.00 0.00 ? 80  LEU A H    1  
ATOM 1126  H HA   . LEU A 1 80  ? 6.610   1.755   7.942   1.00 0.00 ? 80  LEU A HA   1  
ATOM 1127  H HB2  . LEU A 1 80  ? 7.181   0.256   5.849   1.00 0.00 ? 80  LEU A HB2  1  
ATOM 1128  H HB3  . LEU A 1 80  ? 5.810   -0.681  6.408   1.00 0.00 ? 80  LEU A HB3  1  
ATOM 1129  H HG   . LEU A 1 80  ? 4.426   1.419   6.334   1.00 0.00 ? 80  LEU A HG   1  
ATOM 1130  H HD11 . LEU A 1 80  ? 6.920   2.667   6.025   1.00 0.00 ? 80  LEU A HD11 1  
ATOM 1131  H HD12 . LEU A 1 80  ? 6.098   2.843   4.456   1.00 0.00 ? 80  LEU A HD12 1  
ATOM 1132  H HD13 . LEU A 1 80  ? 5.309   3.418   5.944   1.00 0.00 ? 80  LEU A HD13 1  
ATOM 1133  H HD21 . LEU A 1 80  ? 3.882   1.157   4.094   1.00 0.00 ? 80  LEU A HD21 1  
ATOM 1134  H HD22 . LEU A 1 80  ? 5.570   0.870   3.607   1.00 0.00 ? 80  LEU A HD22 1  
ATOM 1135  H HD23 . LEU A 1 80  ? 4.673   -0.387  4.492   1.00 0.00 ? 80  LEU A HD23 1  
ATOM 1136  N N    . ASN A 1 81  ? 4.960   1.036   9.592   1.00 0.00 ? 81  ASN A N    1  
ATOM 1137  C CA   . ASN A 1 81  ? 3.985   0.657   10.600  1.00 0.00 ? 81  ASN A CA   1  
ATOM 1138  C C    . ASN A 1 81  ? 2.583   1.025   10.111  1.00 0.00 ? 81  ASN A C    1  
ATOM 1139  O O    . ASN A 1 81  ? 2.208   2.196   10.114  1.00 0.00 ? 81  ASN A O    1  
ATOM 1140  C CB   . ASN A 1 81  ? 4.236   1.399   11.915  1.00 0.00 ? 81  ASN A CB   1  
ATOM 1141  C CG   . ASN A 1 81  ? 4.978   0.508   12.914  1.00 0.00 ? 81  ASN A CG   1  
ATOM 1142  O OD1  . ASN A 1 81  ? 4.423   0.031   13.890  1.00 0.00 ? 81  ASN A OD1  1  
ATOM 1143  N ND2  . ASN A 1 81  ? 6.259   0.311   12.616  1.00 0.00 ? 81  ASN A ND2  1  
ATOM 1144  H H    . ASN A 1 81  ? 5.091   2.021   9.479   1.00 0.00 ? 81  ASN A H    1  
ATOM 1145  H HA   . ASN A 1 81  ? 4.112   -0.417  10.733  1.00 0.00 ? 81  ASN A HA   1  
ATOM 1146  H HB2  . ASN A 1 81  ? 4.819   2.300   11.723  1.00 0.00 ? 81  ASN A HB2  1  
ATOM 1147  H HB3  . ASN A 1 81  ? 3.287   1.719   12.343  1.00 0.00 ? 81  ASN A HB3  1  
ATOM 1148  H HD21 . ASN A 1 81  ? 6.653   0.732   11.799  1.00 0.00 ? 81  ASN A HD21 1  
ATOM 1149  H HD22 . ASN A 1 81  ? 6.829   -0.257  13.209  1.00 0.00 ? 81  ASN A HD22 1  
ATOM 1150  N N    . MET A 1 82  ? 1.847   0.002   9.701   1.00 0.00 ? 82  MET A N    1  
ATOM 1151  C CA   . MET A 1 82  ? 0.494   0.203   9.210   1.00 0.00 ? 82  MET A CA   1  
ATOM 1152  C C    . MET A 1 82  ? -0.465  -0.828  9.807   1.00 0.00 ? 82  MET A C    1  
ATOM 1153  O O    . MET A 1 82  ? -0.036  -1.881  10.277  1.00 0.00 ? 82  MET A O    1  
ATOM 1154  C CB   . MET A 1 82  ? 0.483   0.088   7.684   1.00 0.00 ? 82  MET A CB   1  
ATOM 1155  C CG   . MET A 1 82  ? 1.667   0.837   7.069   1.00 0.00 ? 82  MET A CG   1  
ATOM 1156  S SD   . MET A 1 82  ? 1.471   0.939   5.298   1.00 0.00 ? 82  MET A SD   1  
ATOM 1157  C CE   . MET A 1 82  ? 1.725   -0.772  4.858   1.00 0.00 ? 82  MET A CE   1  
ATOM 1158  H H    . MET A 1 82  ? 2.160   -0.947  9.702   1.00 0.00 ? 82  MET A H    1  
ATOM 1159  H HA   . MET A 1 82  ? 0.210   1.204   9.534   1.00 0.00 ? 82  MET A HA   1  
ATOM 1160  H HB2  . MET A 1 82  ? 0.522   -0.962  7.395   1.00 0.00 ? 82  MET A HB2  1  
ATOM 1161  H HB3  . MET A 1 82  ? -0.451  0.492   7.292   1.00 0.00 ? 82  MET A HB3  1  
ATOM 1162  H HG2  . MET A 1 82  ? 1.735   1.838   7.494   1.00 0.00 ? 82  MET A HG2  1  
ATOM 1163  H HG3  . MET A 1 82  ? 2.598   0.323   7.311   1.00 0.00 ? 82  MET A HG3  1  
ATOM 1164  H HE1  . MET A 1 82  ? 1.307   -1.413  5.634   1.00 0.00 ? 82  MET A HE1  1  
ATOM 1165  H HE2  . MET A 1 82  ? 1.230   -0.981  3.909   1.00 0.00 ? 82  MET A HE2  1  
ATOM 1166  H HE3  . MET A 1 82  ? 2.793   -0.967  4.762   1.00 0.00 ? 82  MET A HE3  1  
ATOM 1167  N N    . THR A 1 83  ? -1.745  -0.490  9.770   1.00 0.00 ? 83  THR A N    1  
ATOM 1168  C CA   . THR A 1 83  ? -2.769  -1.374  10.301  1.00 0.00 ? 83  THR A CA   1  
ATOM 1169  C C    . THR A 1 83  ? -3.608  -1.961  9.166   1.00 0.00 ? 83  THR A C    1  
ATOM 1170  O O    . THR A 1 83  ? -3.822  -1.309  8.145   1.00 0.00 ? 83  THR A O    1  
ATOM 1171  C CB   . THR A 1 83  ? -3.593  -0.584  11.320  1.00 0.00 ? 83  THR A CB   1  
ATOM 1172  O OG1  . THR A 1 83  ? -2.620  0.143   12.065  1.00 0.00 ? 83  THR A OG1  1  
ATOM 1173  C CG2  . THR A 1 83  ? -4.260  -1.486  12.360  1.00 0.00 ? 83  THR A CG2  1  
ATOM 1174  H H    . THR A 1 83  ? -2.086  0.368   9.386   1.00 0.00 ? 83  THR A H    1  
ATOM 1175  H HA   . THR A 1 83  ? -2.277  -2.208  10.800  1.00 0.00 ? 83  THR A HA   1  
ATOM 1176  H HB   . THR A 1 83  ? -4.329  0.046   10.821  1.00 0.00 ? 83  THR A HB   1  
ATOM 1177  H HG1  . THR A 1 83  ? -1.937  -0.484  12.440  1.00 0.00 ? 83  THR A HG1  1  
ATOM 1178  H HG21 . THR A 1 83  ? -5.117  -1.988  11.909  1.00 0.00 ? 83  THR A HG21 1  
ATOM 1179  H HG22 . THR A 1 83  ? -3.545  -2.231  12.707  1.00 0.00 ? 83  THR A HG22 1  
ATOM 1180  H HG23 . THR A 1 83  ? -4.596  -0.883  13.203  1.00 0.00 ? 83  THR A HG23 1  
ATOM 1181  N N    . LEU A 1 84  ? -4.062  -3.187  9.381   1.00 0.00 ? 84  LEU A N    1  
ATOM 1182  C CA   . LEU A 1 84  ? -4.874  -3.870  8.389   1.00 0.00 ? 84  LEU A CA   1  
ATOM 1183  C C    . LEU A 1 84  ? -6.289  -4.064  8.938   1.00 0.00 ? 84  LEU A C    1  
ATOM 1184  O O    . LEU A 1 84  ? -6.522  -3.900  10.135  1.00 0.00 ? 84  LEU A O    1  
ATOM 1185  C CB   . LEU A 1 84  ? -4.201  -5.173  7.950   1.00 0.00 ? 84  LEU A CB   1  
ATOM 1186  C CG   . LEU A 1 84  ? -2.772  -5.043  7.418   1.00 0.00 ? 84  LEU A CG   1  
ATOM 1187  C CD1  . LEU A 1 84  ? -2.276  -6.374  6.849   1.00 0.00 ? 84  LEU A CD1  1  
ATOM 1188  C CD2  . LEU A 1 84  ? -2.668  -3.908  6.398   1.00 0.00 ? 84  LEU A CD2  1  
ATOM 1189  H H    . LEU A 1 84  ? -3.885  -3.711  10.215  1.00 0.00 ? 84  LEU A H    1  
ATOM 1190  H HA   . LEU A 1 84  ? -4.929  -3.225  7.512   1.00 0.00 ? 84  LEU A HA   1  
ATOM 1191  H HB2  . LEU A 1 84  ? -4.191  -5.857  8.799   1.00 0.00 ? 84  LEU A HB2  1  
ATOM 1192  H HB3  . LEU A 1 84  ? -4.815  -5.633  7.176   1.00 0.00 ? 84  LEU A HB3  1  
ATOM 1193  H HG   . LEU A 1 84  ? -2.119  -4.787  8.253   1.00 0.00 ? 84  LEU A HG   1  
ATOM 1194  H HD11 . LEU A 1 84  ? -2.418  -7.161  7.589   1.00 0.00 ? 84  LEU A HD11 1  
ATOM 1195  H HD12 . LEU A 1 84  ? -2.840  -6.616  5.948   1.00 0.00 ? 84  LEU A HD12 1  
ATOM 1196  H HD13 . LEU A 1 84  ? -1.217  -6.292  6.604   1.00 0.00 ? 84  LEU A HD13 1  
ATOM 1197  H HD21 . LEU A 1 84  ? -3.596  -3.843  5.830   1.00 0.00 ? 84  LEU A HD21 1  
ATOM 1198  H HD22 . LEU A 1 84  ? -2.493  -2.966  6.918   1.00 0.00 ? 84  LEU A HD22 1  
ATOM 1199  H HD23 . LEU A 1 84  ? -1.839  -4.107  5.717   1.00 0.00 ? 84  LEU A HD23 1  
ATOM 1200  N N    . GLN A 1 85  ? -7.197  -4.411  8.038   1.00 0.00 ? 85  GLN A N    1  
ATOM 1201  C CA   . GLN A 1 85  ? -8.582  -4.629  8.417   1.00 0.00 ? 85  GLN A CA   1  
ATOM 1202  C C    . GLN A 1 85  ? -8.961  -6.099  8.221   1.00 0.00 ? 85  GLN A C    1  
ATOM 1203  O O    . GLN A 1 85  ? -8.696  -6.676  7.168   1.00 0.00 ? 85  GLN A O    1  
ATOM 1204  C CB   . GLN A 1 85  ? -9.518  -3.711  7.629   1.00 0.00 ? 85  GLN A CB   1  
ATOM 1205  C CG   . GLN A 1 85  ? -10.962 -4.213  7.693   1.00 0.00 ? 85  GLN A CG   1  
ATOM 1206  C CD   . GLN A 1 85  ? -11.902 -3.278  6.931   1.00 0.00 ? 85  GLN A CD   1  
ATOM 1207  O OE1  . GLN A 1 85  ? -12.688 -2.542  7.506   1.00 0.00 ? 85  GLN A OE1  1  
ATOM 1208  N NE2  . GLN A 1 85  ? -11.779 -3.346  5.609   1.00 0.00 ? 85  GLN A NE2  1  
ATOM 1209  H H    . GLN A 1 85  ? -6.999  -4.543  7.066   1.00 0.00 ? 85  GLN A H    1  
ATOM 1210  H HA   . GLN A 1 85  ? -8.637  -4.371  9.475   1.00 0.00 ? 85  GLN A HA   1  
ATOM 1211  H HB2  . GLN A 1 85  ? -9.463  -2.699  8.029   1.00 0.00 ? 85  GLN A HB2  1  
ATOM 1212  H HB3  . GLN A 1 85  ? -9.193  -3.661  6.589   1.00 0.00 ? 85  GLN A HB3  1  
ATOM 1213  H HG2  . GLN A 1 85  ? -11.021 -5.217  7.271   1.00 0.00 ? 85  GLN A HG2  1  
ATOM 1214  H HG3  . GLN A 1 85  ? -11.279 -4.286  8.734   1.00 0.00 ? 85  GLN A HG3  1  
ATOM 1215  H HE21 . GLN A 1 85  ? -11.114 -3.972  5.200   1.00 0.00 ? 85  GLN A HE21 1  
ATOM 1216  H HE22 . GLN A 1 85  ? -12.351 -2.772  5.023   1.00 0.00 ? 85  GLN A HE22 1  
ATOM 1217  N N    . ARG A 1 86  ? -9.576  -6.661  9.251   1.00 0.00 ? 86  ARG A N    1  
ATOM 1218  C CA   . ARG A 1 86  ? -9.995  -8.051  9.205   1.00 0.00 ? 86  ARG A CA   1  
ATOM 1219  C C    . ARG A 1 86  ? -11.258 -8.198  8.354   1.00 0.00 ? 86  ARG A C    1  
ATOM 1220  O O    . ARG A 1 86  ? -12.044 -7.259  8.237   1.00 0.00 ? 86  ARG A O    1  
ATOM 1221  C CB   . ARG A 1 86  ? -10.270 -8.591  10.610  1.00 0.00 ? 86  ARG A CB   1  
ATOM 1222  C CG   . ARG A 1 86  ? -11.668 -8.191  11.087  1.00 0.00 ? 86  ARG A CG   1  
ATOM 1223  C CD   . ARG A 1 86  ? -11.804 -6.670  11.174  1.00 0.00 ? 86  ARG A CD   1  
ATOM 1224  N NE   . ARG A 1 86  ? -13.039 -6.313  11.906  1.00 0.00 ? 86  ARG A NE   1  
ATOM 1225  C CZ   . ARG A 1 86  ? -14.261 -6.303  11.357  1.00 0.00 ? 86  ARG A CZ   1  
ATOM 1226  N NH1  . ARG A 1 86  ? -14.419 -6.629  10.067  1.00 0.00 ? 86  ARG A NH1  1  
ATOM 1227  N NH2  . ARG A 1 86  ? -15.326 -5.966  12.097  1.00 0.00 ? 86  ARG A NH2  1  
ATOM 1228  H H    . ARG A 1 86  ? -9.789  -6.184  10.104  1.00 0.00 ? 86  ARG A H    1  
ATOM 1229  H HA   . ARG A 1 86  ? -9.155  -8.580  8.755   1.00 0.00 ? 86  ARG A HA   1  
ATOM 1230  H HB2  . ARG A 1 86  ? -10.178 -9.677  10.611  1.00 0.00 ? 86  ARG A HB2  1  
ATOM 1231  H HB3  . ARG A 1 86  ? -9.522  -8.207  11.304  1.00 0.00 ? 86  ARG A HB3  1  
ATOM 1232  H HG2  . ARG A 1 86  ? -12.417 -8.588  10.401  1.00 0.00 ? 86  ARG A HG2  1  
ATOM 1233  H HG3  . ARG A 1 86  ? -11.863 -8.634  12.064  1.00 0.00 ? 86  ARG A HG3  1  
ATOM 1234  H HD2  . ARG A 1 86  ? -10.936 -6.248  11.681  1.00 0.00 ? 86  ARG A HD2  1  
ATOM 1235  H HD3  . ARG A 1 86  ? -11.827 -6.240  10.173  1.00 0.00 ? 86  ARG A HD3  1  
ATOM 1236  H HE   . ARG A 1 86  ? -12.957 -6.064  12.871  1.00 0.00 ? 86  ARG A HE   1  
ATOM 1237  H HH11 . ARG A 1 86  ? -13.624 -6.880  9.514   1.00 0.00 ? 86  ARG A HH11 1  
ATOM 1238  H HH12 . ARG A 1 86  ? -15.331 -6.621  9.657   1.00 0.00 ? 86  ARG A HH12 1  
ATOM 1239  H HH21 . ARG A 1 86  ? -15.209 -5.722  13.060  1.00 0.00 ? 86  ARG A HH21 1  
ATOM 1240  H HH22 . ARG A 1 86  ? -16.238 -5.958  11.687  1.00 0.00 ? 86  ARG A HH22 1  
ATOM 1241  N N    . ALA A 1 87  ? -11.413 -9.382  7.781   1.00 0.00 ? 87  ALA A N    1  
ATOM 1242  C CA   . ALA A 1 87  ? -12.567 -9.663  6.944   1.00 0.00 ? 87  ALA A CA   1  
ATOM 1243  C C    . ALA A 1 87  ? -12.944 -11.140 7.082   1.00 0.00 ? 87  ALA A C    1  
ATOM 1244  O O    . ALA A 1 87  ? -12.249 -12.012 6.564   1.00 0.00 ? 87  ALA A O    1  
ATOM 1245  C CB   . ALA A 1 87  ? -12.257 -9.273  5.498   1.00 0.00 ? 87  ALA A CB   1  
ATOM 1246  H H    . ALA A 1 87  ? -10.769 -10.141 7.882   1.00 0.00 ? 87  ALA A H    1  
ATOM 1247  H HA   . ALA A 1 87  ? -13.395 -9.051  7.303   1.00 0.00 ? 87  ALA A HA   1  
ATOM 1248  H HB1  . ALA A 1 87  ? -12.719 -8.312  5.274   1.00 0.00 ? 87  ALA A HB1  1  
ATOM 1249  H HB2  . ALA A 1 87  ? -11.177 -9.197  5.366   1.00 0.00 ? 87  ALA A HB2  1  
ATOM 1250  H HB3  . ALA A 1 87  ? -12.652 -10.033 4.824   1.00 0.00 ? 87  ALA A HB3  1  
ATOM 1251  N N    . SER A 1 88  ? -14.044 -11.374 7.783   1.00 0.00 ? 88  SER A N    1  
ATOM 1252  C CA   . SER A 1 88  ? -14.521 -12.730 7.995   1.00 0.00 ? 88  SER A CA   1  
ATOM 1253  C C    . SER A 1 88  ? -13.343 -13.658 8.301   1.00 0.00 ? 88  SER A C    1  
ATOM 1254  O O    . SER A 1 88  ? -12.257 -13.195 8.645   1.00 0.00 ? 88  SER A O    1  
ATOM 1255  C CB   . SER A 1 88  ? -15.295 -13.239 6.777   1.00 0.00 ? 88  SER A CB   1  
ATOM 1256  O OG   . SER A 1 88  ? -16.065 -12.208 6.165   1.00 0.00 ? 88  SER A OG   1  
ATOM 1257  H H    . SER A 1 88  ? -14.603 -10.659 8.201   1.00 0.00 ? 88  SER A H    1  
ATOM 1258  H HA   . SER A 1 88  ? -15.192 -12.669 8.851   1.00 0.00 ? 88  SER A HA   1  
ATOM 1259  H HB2  . SER A 1 88  ? -14.595 -13.649 6.048   1.00 0.00 ? 88  SER A HB2  1  
ATOM 1260  H HB3  . SER A 1 88  ? -15.953 -14.053 7.079   1.00 0.00 ? 88  SER A HB3  1  
ATOM 1261  H HG   . SER A 1 88  ? -16.045 -11.384 6.732   1.00 0.00 ? 88  SER A HG   1  
ATOM 1262  N N    . ALA A 1 89  ? -13.599 -14.951 8.164   1.00 0.00 ? 89  ALA A N    1  
ATOM 1263  C CA   . ALA A 1 89  ? -12.573 -15.947 8.421   1.00 0.00 ? 89  ALA A CA   1  
ATOM 1264  C C    . ALA A 1 89  ? -11.679 -16.083 7.188   1.00 0.00 ? 89  ALA A C    1  
ATOM 1265  O O    . ALA A 1 89  ? -12.167 -16.079 6.059   1.00 0.00 ? 89  ALA A O    1  
ATOM 1266  C CB   . ALA A 1 89  ? -13.234 -17.271 8.811   1.00 0.00 ? 89  ALA A CB   1  
ATOM 1267  H H    . ALA A 1 89  ? -14.485 -15.319 7.883   1.00 0.00 ? 89  ALA A H    1  
ATOM 1268  H HA   . ALA A 1 89  ? -11.971 -15.596 9.259   1.00 0.00 ? 89  ALA A HA   1  
ATOM 1269  H HB1  . ALA A 1 89  ? -12.588 -18.099 8.520   1.00 0.00 ? 89  ALA A HB1  1  
ATOM 1270  H HB2  . ALA A 1 89  ? -13.392 -17.295 9.889   1.00 0.00 ? 89  ALA A HB2  1  
ATOM 1271  H HB3  . ALA A 1 89  ? -14.193 -17.362 8.301   1.00 0.00 ? 89  ALA A HB3  1  
ATOM 1272  N N    . ALA A 1 90  ? -10.384 -16.200 7.444   1.00 0.00 ? 90  ALA A N    1  
ATOM 1273  C CA   . ALA A 1 90  ? -9.417  -16.337 6.369   1.00 0.00 ? 90  ALA A CA   1  
ATOM 1274  C C    . ALA A 1 90  ? -8.870  -17.766 6.359   1.00 0.00 ? 90  ALA A C    1  
ATOM 1275  O O    . ALA A 1 90  ? -7.725  -17.999 6.741   1.00 0.00 ? 90  ALA A O    1  
ATOM 1276  C CB   . ALA A 1 90  ? -8.313  -15.291 6.539   1.00 0.00 ? 90  ALA A CB   1  
ATOM 1277  H H    . ALA A 1 90  ? -9.995  -16.203 8.366   1.00 0.00 ? 90  ALA A H    1  
ATOM 1278  H HA   . ALA A 1 90  ? -9.937  -16.149 5.429   1.00 0.00 ? 90  ALA A HA   1  
ATOM 1279  H HB1  . ALA A 1 90  ? -8.759  -14.299 6.606   1.00 0.00 ? 90  ALA A HB1  1  
ATOM 1280  H HB2  . ALA A 1 90  ? -7.752  -15.500 7.450   1.00 0.00 ? 90  ALA A HB2  1  
ATOM 1281  H HB3  . ALA A 1 90  ? -7.641  -15.330 5.682   1.00 0.00 ? 90  ALA A HB3  1  
ATOM 1282  N N    . ALA A 1 91  ? -9.715  -18.686 5.917   1.00 0.00 ? 91  ALA A N    1  
ATOM 1283  C CA   . ALA A 1 91  ? -9.331  -20.085 5.852   1.00 0.00 ? 91  ALA A CA   1  
ATOM 1284  C C    . ALA A 1 91  ? -10.374 -20.859 5.042   1.00 0.00 ? 91  ALA A C    1  
ATOM 1285  O O    . ALA A 1 91  ? -11.574 -20.712 5.267   1.00 0.00 ? 91  ALA A O    1  
ATOM 1286  C CB   . ALA A 1 91  ? -9.169  -20.637 7.270   1.00 0.00 ? 91  ALA A CB   1  
ATOM 1287  H H    . ALA A 1 91  ? -10.646 -18.488 5.608   1.00 0.00 ? 91  ALA A H    1  
ATOM 1288  H HA   . ALA A 1 91  ? -8.370  -20.142 5.341   1.00 0.00 ? 91  ALA A HA   1  
ATOM 1289  H HB1  . ALA A 1 91  ? -9.417  -19.859 7.993   1.00 0.00 ? 91  ALA A HB1  1  
ATOM 1290  H HB2  . ALA A 1 91  ? -9.836  -21.487 7.408   1.00 0.00 ? 91  ALA A HB2  1  
ATOM 1291  H HB3  . ALA A 1 91  ? -8.137  -20.956 7.420   1.00 0.00 ? 91  ALA A HB3  1  
ATOM 1292  N N    . LYS A 1 92  ? -9.877  -21.666 4.116   1.00 0.00 ? 92  LYS A N    1  
ATOM 1293  C CA   . LYS A 1 92  ? -10.751 -22.463 3.272   1.00 0.00 ? 92  LYS A CA   1  
ATOM 1294  C C    . LYS A 1 92  ? -10.327 -23.931 3.349   1.00 0.00 ? 92  LYS A C    1  
ATOM 1295  O O    . LYS A 1 92  ? -9.139  -24.234 3.449   1.00 0.00 ? 92  LYS A O    1  
ATOM 1296  C CB   . LYS A 1 92  ? -10.774 -21.904 1.847   1.00 0.00 ? 92  LYS A CB   1  
ATOM 1297  C CG   . LYS A 1 92  ? -9.398  -22.024 1.189   1.00 0.00 ? 92  LYS A CG   1  
ATOM 1298  C CD   . LYS A 1 92  ? -8.607  -20.722 1.330   1.00 0.00 ? 92  LYS A CD   1  
ATOM 1299  C CE   . LYS A 1 92  ? -7.683  -20.509 0.130   1.00 0.00 ? 92  LYS A CE   1  
ATOM 1300  N NZ   . LYS A 1 92  ? -8.034  -19.258 -0.578  1.00 0.00 ? 92  LYS A NZ   1  
ATOM 1301  H H    . LYS A 1 92  ? -8.899  -21.780 3.940   1.00 0.00 ? 92  LYS A H    1  
ATOM 1302  H HA   . LYS A 1 92  ? -11.761 -22.373 3.670   1.00 0.00 ? 92  LYS A HA   1  
ATOM 1303  H HB2  . LYS A 1 92  ? -11.514 -22.442 1.254   1.00 0.00 ? 92  LYS A HB2  1  
ATOM 1304  H HB3  . LYS A 1 92  ? -11.081 -20.859 1.868   1.00 0.00 ? 92  LYS A HB3  1  
ATOM 1305  H HG2  . LYS A 1 92  ? -8.843  -22.843 1.645   1.00 0.00 ? 92  LYS A HG2  1  
ATOM 1306  H HG3  . LYS A 1 92  ? -9.517  -22.269 0.133   1.00 0.00 ? 92  LYS A HG3  1  
ATOM 1307  H HD2  . LYS A 1 92  ? -9.296  -19.882 1.418   1.00 0.00 ? 92  LYS A HD2  1  
ATOM 1308  H HD3  . LYS A 1 92  ? -8.018  -20.749 2.247   1.00 0.00 ? 92  LYS A HD3  1  
ATOM 1309  H HE2  . LYS A 1 92  ? -6.646  -20.466 0.464   1.00 0.00 ? 92  LYS A HE2  1  
ATOM 1310  H HE3  . LYS A 1 92  ? -7.763  -21.355 -0.553  1.00 0.00 ? 92  LYS A HE3  1  
ATOM 1311  H HZ1  . LYS A 1 92  ? -7.966  -19.403 -1.565  1.00 0.00 ? 92  LYS A HZ1  1  
ATOM 1312  H HZ2  . LYS A 1 92  ? -8.969  -18.993 -0.344  1.00 0.00 ? 92  LYS A HZ2  1  
ATOM 1313  H HZ3  . LYS A 1 92  ? -7.403  -18.532 -0.304  1.00 0.00 ? 92  LYS A HZ3  1  
ATOM 1314  N N    . SER A 1 93  ? -11.323 -24.804 3.301   1.00 0.00 ? 93  SER A N    1  
ATOM 1315  C CA   . SER A 1 93  ? -11.069 -26.233 3.365   1.00 0.00 ? 93  SER A CA   1  
ATOM 1316  C C    . SER A 1 93  ? -11.770 -26.942 2.204   1.00 0.00 ? 93  SER A C    1  
ATOM 1317  O O    . SER A 1 93  ? -12.971 -26.766 1.999   1.00 0.00 ? 93  SER A O    1  
ATOM 1318  C CB   . SER A 1 93  ? -11.533 -26.816 4.701   1.00 0.00 ? 93  SER A CB   1  
ATOM 1319  O OG   . SER A 1 93  ? -10.591 -27.741 5.236   1.00 0.00 ? 93  SER A OG   1  
ATOM 1320  H H    . SER A 1 93  ? -12.287 -24.549 3.220   1.00 0.00 ? 93  SER A H    1  
ATOM 1321  H HA   . SER A 1 93  ? -9.988  -26.338 3.279   1.00 0.00 ? 93  SER A HA   1  
ATOM 1322  H HB2  . SER A 1 93  ? -11.693 -26.007 5.414   1.00 0.00 ? 93  SER A HB2  1  
ATOM 1323  H HB3  . SER A 1 93  ? -12.493 -27.315 4.565   1.00 0.00 ? 93  SER A HB3  1  
ATOM 1324  H HG   . SER A 1 93  ? -10.817 -27.947 6.188   1.00 0.00 ? 93  SER A HG   1  
ATOM 1325  N N    . GLU A 1 94  ? -10.992 -27.727 1.475   1.00 0.00 ? 94  GLU A N    1  
ATOM 1326  C CA   . GLU A 1 94  ? -11.523 -28.463 0.340   1.00 0.00 ? 94  GLU A CA   1  
ATOM 1327  C C    . GLU A 1 94  ? -11.810 -29.913 0.735   1.00 0.00 ? 94  GLU A C    1  
ATOM 1328  O O    . GLU A 1 94  ? -10.902 -30.647 1.119   1.00 0.00 ? 94  GLU A O    1  
ATOM 1329  C CB   . GLU A 1 94  ? -10.566 -28.398 -0.852  1.00 0.00 ? 94  GLU A CB   1  
ATOM 1330  C CG   . GLU A 1 94  ? -11.262 -27.814 -2.083  1.00 0.00 ? 94  GLU A CG   1  
ATOM 1331  C CD   . GLU A 1 94  ? -10.550 -28.239 -3.369  1.00 0.00 ? 94  GLU A CD   1  
ATOM 1332  O OE1  . GLU A 1 94  ? -9.578  -27.544 -3.736  1.00 0.00 ? 94  GLU A OE1  1  
ATOM 1333  O OE2  . GLU A 1 94  ? -10.994 -29.249 -3.956  1.00 0.00 ? 94  GLU A OE2  1  
ATOM 1334  H H    . GLU A 1 94  ? -10.016 -27.864 1.648   1.00 0.00 ? 94  GLU A H    1  
ATOM 1335  H HA   . GLU A 1 94  ? -12.454 -27.959 0.078   1.00 0.00 ? 94  GLU A HA   1  
ATOM 1336  H HB2  . GLU A 1 94  ? -9.700  -27.788 -0.595  1.00 0.00 ? 94  GLU A HB2  1  
ATOM 1337  H HB3  . GLU A 1 94  ? -10.196 -29.398 -1.080  1.00 0.00 ? 94  GLU A HB3  1  
ATOM 1338  H HG2  . GLU A 1 94  ? -12.300 -28.146 -2.111  1.00 0.00 ? 94  GLU A HG2  1  
ATOM 1339  H HG3  . GLU A 1 94  ? -11.277 -26.726 -2.014  1.00 0.00 ? 94  GLU A HG3  1  
ATOM 1340  N N    . PRO A 1 95  ? -13.112 -30.291 0.624   1.00 0.00 ? 95  PRO A N    1  
ATOM 1341  C CA   . PRO A 1 95  ? -13.530 -31.640 0.965   1.00 0.00 ? 95  PRO A CA   1  
ATOM 1342  C C    . PRO A 1 95  ? -13.113 -32.635 -0.120  1.00 0.00 ? 95  PRO A C    1  
ATOM 1343  O O    . PRO A 1 95  ? -13.139 -32.311 -1.307  1.00 0.00 ? 95  PRO A O    1  
ATOM 1344  C CB   . PRO A 1 95  ? -15.038 -31.552 1.141   1.00 0.00 ? 95  PRO A CB   1  
ATOM 1345  C CG   . PRO A 1 95  ? -15.465 -30.271 0.442   1.00 0.00 ? 95  PRO A CG   1  
ATOM 1346  C CD   . PRO A 1 95  ? -14.216 -29.448 0.173   1.00 0.00 ? 95  PRO A CD   1  
ATOM 1347  H HA   . PRO A 1 95  ? -13.076 -31.943 1.803   1.00 0.00 ? 95  PRO A HA   1  
ATOM 1348  H HB2  . PRO A 1 95  ? -15.533 -32.419 0.705   1.00 0.00 ? 95  PRO A HB2  1  
ATOM 1349  H HB3  . PRO A 1 95  ? -15.307 -31.529 2.197   1.00 0.00 ? 95  PRO A HB3  1  
ATOM 1350  H HG2  . PRO A 1 95  ? -15.980 -30.500 -0.491  1.00 0.00 ? 95  PRO A HG2  1  
ATOM 1351  H HG3  . PRO A 1 95  ? -16.164 -29.712 1.064   1.00 0.00 ? 95  PRO A HG3  1  
ATOM 1352  H HD2  . PRO A 1 95  ? -14.122 -29.206 -0.885  1.00 0.00 ? 95  PRO A HD2  1  
ATOM 1353  H HD3  . PRO A 1 95  ? -14.239 -28.503 0.716   1.00 0.00 ? 95  PRO A HD3  1  
ATOM 1354  N N    . VAL A 1 96  ? -12.738 -33.825 0.325   1.00 0.00 ? 96  VAL A N    1  
ATOM 1355  C CA   . VAL A 1 96  ? -12.315 -34.868 -0.593  1.00 0.00 ? 96  VAL A CA   1  
ATOM 1356  C C    . VAL A 1 96  ? -13.546 -35.611 -1.115  1.00 0.00 ? 96  VAL A C    1  
ATOM 1357  O O    . VAL A 1 96  ? -14.532 -35.768 -0.397  1.00 0.00 ? 96  VAL A O    1  
ATOM 1358  C CB   . VAL A 1 96  ? -11.306 -35.792 0.093   1.00 0.00 ? 96  VAL A CB   1  
ATOM 1359  C CG1  . VAL A 1 96  ? -11.821 -36.248 1.460   1.00 0.00 ? 96  VAL A CG1  1  
ATOM 1360  C CG2  . VAL A 1 96  ? -10.970 -36.992 -0.794  1.00 0.00 ? 96  VAL A CG2  1  
ATOM 1361  H H    . VAL A 1 96  ? -12.719 -34.080 1.292   1.00 0.00 ? 96  VAL A H    1  
ATOM 1362  H HA   . VAL A 1 96  ? -11.814 -34.385 -1.432  1.00 0.00 ? 96  VAL A HA   1  
ATOM 1363  H HB   . VAL A 1 96  ? -10.388 -35.226 0.252   1.00 0.00 ? 96  VAL A HB   1  
ATOM 1364  H HG11 . VAL A 1 96  ? -11.641 -35.463 2.196   1.00 0.00 ? 96  VAL A HG11 1  
ATOM 1365  H HG12 . VAL A 1 96  ? -12.890 -36.448 1.397   1.00 0.00 ? 96  VAL A HG12 1  
ATOM 1366  H HG13 . VAL A 1 96  ? -11.298 -37.155 1.761   1.00 0.00 ? 96  VAL A HG13 1  
ATOM 1367  H HG21 . VAL A 1 96  ? -10.404 -36.654 -1.663  1.00 0.00 ? 96  VAL A HG21 1  
ATOM 1368  H HG22 . VAL A 1 96  ? -10.373 -37.707 -0.228  1.00 0.00 ? 96  VAL A HG22 1  
ATOM 1369  H HG23 . VAL A 1 96  ? -11.892 -37.470 -1.124  1.00 0.00 ? 96  VAL A HG23 1  
ATOM 1370  N N    . SER A 1 97  ? -13.449 -36.049 -2.362  1.00 0.00 ? 97  SER A N    1  
ATOM 1371  C CA   . SER A 1 97  ? -14.543 -36.771 -2.989  1.00 0.00 ? 97  SER A CA   1  
ATOM 1372  C C    . SER A 1 97  ? -14.081 -38.174 -3.390  1.00 0.00 ? 97  SER A C    1  
ATOM 1373  O O    . SER A 1 97  ? -12.919 -38.372 -3.741  1.00 0.00 ? 97  SER A O    1  
ATOM 1374  C CB   . SER A 1 97  ? -15.073 -36.017 -4.210  1.00 0.00 ? 97  SER A CB   1  
ATOM 1375  O OG   . SER A 1 97  ? -15.969 -34.972 -3.845  1.00 0.00 ? 97  SER A OG   1  
ATOM 1376  H H    . SER A 1 97  ? -12.644 -35.917 -2.940  1.00 0.00 ? 97  SER A H    1  
ATOM 1377  H HA   . SER A 1 97  ? -15.324 -36.828 -2.231  1.00 0.00 ? 97  SER A HA   1  
ATOM 1378  H HB2  . SER A 1 97  ? -14.235 -35.598 -4.769  1.00 0.00 ? 97  SER A HB2  1  
ATOM 1379  H HB3  . SER A 1 97  ? -15.581 -36.716 -4.875  1.00 0.00 ? 97  SER A HB3  1  
ATOM 1380  H HG   . SER A 1 97  ? -16.236 -34.452 -4.656  1.00 0.00 ? 97  SER A HG   1  
ATOM 1381  N N    . SER A 1 98  ? -15.016 -39.111 -3.324  1.00 0.00 ? 98  SER A N    1  
ATOM 1382  C CA   . SER A 1 98  ? -14.720 -40.489 -3.676  1.00 0.00 ? 98  SER A CA   1  
ATOM 1383  C C    . SER A 1 98  ? -16.011 -41.227 -4.035  1.00 0.00 ? 98  SER A C    1  
ATOM 1384  O O    . SER A 1 98  ? -17.100 -40.804 -3.647  1.00 0.00 ? 98  SER A O    1  
ATOM 1385  C CB   . SER A 1 98  ? -13.998 -41.207 -2.534  1.00 0.00 ? 98  SER A CB   1  
ATOM 1386  O OG   . SER A 1 98  ? -12.638 -41.486 -2.854  1.00 0.00 ? 98  SER A OG   1  
ATOM 1387  H H    . SER A 1 98  ? -15.959 -38.941 -3.038  1.00 0.00 ? 98  SER A H    1  
ATOM 1388  H HA   . SER A 1 98  ? -14.060 -40.431 -4.542  1.00 0.00 ? 98  SER A HA   1  
ATOM 1389  H HB2  . SER A 1 98  ? -14.040 -40.591 -1.635  1.00 0.00 ? 98  SER A HB2  1  
ATOM 1390  H HB3  . SER A 1 98  ? -14.516 -42.138 -2.306  1.00 0.00 ? 98  SER A HB3  1  
ATOM 1391  H HG   . SER A 1 98  ? -12.060 -41.338 -2.051  1.00 0.00 ? 98  SER A HG   1  
ATOM 1392  N N    . GLY A 1 99  ? -15.848 -42.317 -4.770  1.00 0.00 ? 99  GLY A N    1  
ATOM 1393  C CA   . GLY A 1 99  ? -16.988 -43.118 -5.184  1.00 0.00 ? 99  GLY A CA   1  
ATOM 1394  C C    . GLY A 1 99  ? -16.744 -44.603 -4.907  1.00 0.00 ? 99  GLY A C    1  
ATOM 1395  O O    . GLY A 1 99  ? -15.599 -45.039 -4.803  1.00 0.00 ? 99  GLY A O    1  
ATOM 1396  H H    . GLY A 1 99  ? -14.959 -42.654 -5.080  1.00 0.00 ? 99  GLY A H    1  
ATOM 1397  H HA2  . GLY A 1 99  ? -17.881 -42.787 -4.655  1.00 0.00 ? 99  GLY A HA2  1  
ATOM 1398  H HA3  . GLY A 1 99  ? -17.174 -42.968 -6.248  1.00 0.00 ? 99  GLY A HA3  1  
ATOM 1399  N N    . PRO A 1 100 ? -17.870 -45.358 -4.792  1.00 0.00 ? 100 PRO A N    1  
ATOM 1400  C CA   . PRO A 1 100 ? -17.790 -46.784 -4.528  1.00 0.00 ? 100 PRO A CA   1  
ATOM 1401  C C    . PRO A 1 100 ? -17.363 -47.550 -5.782  1.00 0.00 ? 100 PRO A C    1  
ATOM 1402  O O    . PRO A 1 100 ? -17.189 -46.958 -6.846  1.00 0.00 ? 100 PRO A O    1  
ATOM 1403  C CB   . PRO A 1 100 ? -19.176 -47.172 -4.039  1.00 0.00 ? 100 PRO A CB   1  
ATOM 1404  C CG   . PRO A 1 100 ? -20.103 -46.054 -4.485  1.00 0.00 ? 100 PRO A CG   1  
ATOM 1405  C CD   . PRO A 1 100 ? -19.243 -44.875 -4.908  1.00 0.00 ? 100 PRO A CD   1  
ATOM 1406  H HA   . PRO A 1 100 ? -17.088 -46.972 -3.841  1.00 0.00 ? 100 PRO A HA   1  
ATOM 1407  H HB2  . PRO A 1 100 ? -19.485 -48.128 -4.460  1.00 0.00 ? 100 PRO A HB2  1  
ATOM 1408  H HB3  . PRO A 1 100 ? -19.190 -47.282 -2.954  1.00 0.00 ? 100 PRO A HB3  1  
ATOM 1409  H HG2  . PRO A 1 100 ? -20.730 -46.385 -5.312  1.00 0.00 ? 100 PRO A HG2  1  
ATOM 1410  H HG3  . PRO A 1 100 ? -20.772 -45.766 -3.674  1.00 0.00 ? 100 PRO A HG3  1  
ATOM 1411  H HD2  . PRO A 1 100 ? -19.468 -44.566 -5.929  1.00 0.00 ? 100 PRO A HD2  1  
ATOM 1412  H HD3  . PRO A 1 100 ? -19.414 -44.010 -4.268  1.00 0.00 ? 100 PRO A HD3  1  
ATOM 1413  N N    . SER A 1 101 ? -17.207 -48.855 -5.615  1.00 0.00 ? 101 SER A N    1  
ATOM 1414  C CA   . SER A 1 101 ? -16.803 -49.708 -6.720  1.00 0.00 ? 101 SER A CA   1  
ATOM 1415  C C    . SER A 1 101 ? -17.862 -50.786 -6.962  1.00 0.00 ? 101 SER A C    1  
ATOM 1416  O O    . SER A 1 101 ? -18.533 -51.222 -6.029  1.00 0.00 ? 101 SER A O    1  
ATOM 1417  C CB   . SER A 1 101 ? -15.442 -50.352 -6.451  1.00 0.00 ? 101 SER A CB   1  
ATOM 1418  O OG   . SER A 1 101 ? -14.415 -49.790 -7.263  1.00 0.00 ? 101 SER A OG   1  
ATOM 1419  H H    . SER A 1 101 ? -17.350 -49.329 -4.746  1.00 0.00 ? 101 SER A H    1  
ATOM 1420  H HA   . SER A 1 101 ? -16.727 -49.046 -7.583  1.00 0.00 ? 101 SER A HA   1  
ATOM 1421  H HB2  . SER A 1 101 ? -15.183 -50.225 -5.400  1.00 0.00 ? 101 SER A HB2  1  
ATOM 1422  H HB3  . SER A 1 101 ? -15.505 -51.424 -6.636  1.00 0.00 ? 101 SER A HB3  1  
ATOM 1423  H HG   . SER A 1 101 ? -13.583 -50.339 -7.191  1.00 0.00 ? 101 SER A HG   1  
ATOM 1424  N N    . SER A 1 102 ? -17.977 -51.185 -8.221  1.00 0.00 ? 102 SER A N    1  
ATOM 1425  C CA   . SER A 1 102 ? -18.942 -52.203 -8.597  1.00 0.00 ? 102 SER A CA   1  
ATOM 1426  C C    . SER A 1 102 ? -18.358 -53.595 -8.350  1.00 0.00 ? 102 SER A C    1  
ATOM 1427  O O    . SER A 1 102 ? -17.157 -53.807 -8.517  1.00 0.00 ? 102 SER A O    1  
ATOM 1428  C CB   . SER A 1 102 ? -19.357 -52.055 -10.063 1.00 0.00 ? 102 SER A CB   1  
ATOM 1429  O OG   . SER A 1 102 ? -18.348 -52.524 -10.953 1.00 0.00 ? 102 SER A OG   1  
ATOM 1430  H H    . SER A 1 102 ? -17.427 -50.825 -8.974  1.00 0.00 ? 102 SER A H    1  
ATOM 1431  H HA   . SER A 1 102 ? -19.807 -52.032 -7.957  1.00 0.00 ? 102 SER A HA   1  
ATOM 1432  H HB2  . SER A 1 102 ? -20.280 -52.608 -10.236 1.00 0.00 ? 102 SER A HB2  1  
ATOM 1433  H HB3  . SER A 1 102 ? -19.569 -51.007 -10.275 1.00 0.00 ? 102 SER A HB3  1  
ATOM 1434  H HG   . SER A 1 102 ? -18.098 -51.801 -11.598 1.00 0.00 ? 102 SER A HG   1  
ATOM 1435  N N    . GLY A 1 103 ? -19.233 -54.509 -7.956  1.00 0.00 ? 103 GLY A N    1  
ATOM 1436  C CA   . GLY A 1 103 ? -18.818 -55.874 -7.684  1.00 0.00 ? 103 GLY A CA   1  
ATOM 1437  C C    . GLY A 1 103 ? -18.765 -56.698 -8.972  1.00 0.00 ? 103 GLY A C    1  
ATOM 1438  O O    . GLY A 1 103 ? -19.760 -56.801 -9.689  1.00 0.00 ? 103 GLY A O    1  
ATOM 1439  H H    . GLY A 1 103 ? -20.207 -54.328 -7.823  1.00 0.00 ? 103 GLY A H    1  
ATOM 1440  H HA2  . GLY A 1 103 ? -17.838 -55.873 -7.209  1.00 0.00 ? 103 GLY A HA2  1  
ATOM 1441  H HA3  . GLY A 1 103 ? -19.512 -56.336 -6.981  1.00 0.00 ? 103 GLY A HA3  1  
ATOM 1442  N N    . GLY A 1 1   ? -19.214 -0.641  16.122  1.00 0.00 ? 1   GLY A N    2  
ATOM 1443  C CA   . GLY A 1 1   ? -17.888 -0.739  16.708  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1444  C C    . GLY A 1 1   ? -17.656 -2.126  17.310  1.00 0.00 ? 1   GLY A C    2  
ATOM 1445  O O    . GLY A 1 1   ? -18.157 -2.428  18.393  1.00 0.00 ? 1   GLY A O    2  
ATOM 1446  H H1   . GLY A 1 1   ? -19.949 -1.041  16.670  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1447  H HA2  . GLY A 1 1   ? -17.134 -0.539  15.946  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1448  H HA3  . GLY A 1 1   ? -17.770 0.021   17.480  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1449  N N    . SER A 1 2   ? -16.898 -2.933  16.583  1.00 0.00 ? 2   SER A N    2  
ATOM 1450  C CA   . SER A 1 2   ? -16.594 -4.281  17.032  1.00 0.00 ? 2   SER A CA   2  
ATOM 1451  C C    . SER A 1 2   ? -15.078 -4.479  17.106  1.00 0.00 ? 2   SER A C    2  
ATOM 1452  O O    . SER A 1 2   ? -14.320 -3.724  16.499  1.00 0.00 ? 2   SER A O    2  
ATOM 1453  C CB   . SER A 1 2   ? -17.221 -5.325  16.106  1.00 0.00 ? 2   SER A CB   2  
ATOM 1454  O OG   . SER A 1 2   ? -18.066 -6.227  16.814  1.00 0.00 ? 2   SER A OG   2  
ATOM 1455  H H    . SER A 1 2   ? -16.495 -2.679  15.704  1.00 0.00 ? 2   SER A H    2  
ATOM 1456  H HA   . SER A 1 2   ? -17.039 -4.362  18.024  1.00 0.00 ? 2   SER A HA   2  
ATOM 1457  H HB2  . SER A 1 2   ? -17.797 -4.821  15.330  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1458  H HB3  . SER A 1 2   ? -16.432 -5.885  15.604  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1459  H HG   . SER A 1 2   ? -17.641 -7.132  16.855  1.00 0.00 ? 2   SER A HG   2  
ATOM 1460  N N    . SER A 1 3   ? -14.682 -5.497  17.855  1.00 0.00 ? 3   SER A N    2  
ATOM 1461  C CA   . SER A 1 3   ? -13.271 -5.804  18.016  1.00 0.00 ? 3   SER A CA   2  
ATOM 1462  C C    . SER A 1 3   ? -12.961 -7.175  17.413  1.00 0.00 ? 3   SER A C    2  
ATOM 1463  O O    . SER A 1 3   ? -13.212 -8.204  18.039  1.00 0.00 ? 3   SER A O    2  
ATOM 1464  C CB   . SER A 1 3   ? -12.864 -5.768  19.490  1.00 0.00 ? 3   SER A CB   2  
ATOM 1465  O OG   . SER A 1 3   ? -11.615 -5.111  19.684  1.00 0.00 ? 3   SER A OG   2  
ATOM 1466  H H    . SER A 1 3   ? -15.305 -6.106  18.346  1.00 0.00 ? 3   SER A H    2  
ATOM 1467  H HA   . SER A 1 3   ? -12.742 -5.019  17.475  1.00 0.00 ? 3   SER A HA   2  
ATOM 1468  H HB2  . SER A 1 3   ? -13.636 -5.257  20.067  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1469  H HB3  . SER A 1 3   ? -12.802 -6.786  19.874  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1470  H HG   . SER A 1 3   ? -10.863 -5.742  19.494  1.00 0.00 ? 3   SER A HG   2  
ATOM 1471  N N    . GLY A 1 4   ? -12.421 -7.146  16.203  1.00 0.00 ? 4   GLY A N    2  
ATOM 1472  C CA   . GLY A 1 4   ? -12.074 -8.374  15.509  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1473  C C    . GLY A 1 4   ? -10.640 -8.800  15.831  1.00 0.00 ? 4   GLY A C    2  
ATOM 1474  O O    . GLY A 1 4   ? -10.309 -9.049  16.989  1.00 0.00 ? 4   GLY A O    2  
ATOM 1475  H H    . GLY A 1 4   ? -12.220 -6.305  15.701  1.00 0.00 ? 4   GLY A H    2  
ATOM 1476  H HA2  . GLY A 1 4   ? -12.766 -9.166  15.795  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1477  H HA3  . GLY A 1 4   ? -12.182 -8.231  14.433  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1478  N N    . SER A 1 5   ? -9.829  -8.871  14.786  1.00 0.00 ? 5   SER A N    2  
ATOM 1479  C CA   . SER A 1 5   ? -8.439  -9.263  14.943  1.00 0.00 ? 5   SER A CA   2  
ATOM 1480  C C    . SER A 1 5   ? -7.547  -8.021  14.988  1.00 0.00 ? 5   SER A C    2  
ATOM 1481  O O    . SER A 1 5   ? -6.977  -7.699  16.029  1.00 0.00 ? 5   SER A O    2  
ATOM 1482  C CB   . SER A 1 5   ? -7.997  -10.193 13.812  1.00 0.00 ? 5   SER A CB   2  
ATOM 1483  O OG   . SER A 1 5   ? -7.254  -11.309 14.296  1.00 0.00 ? 5   SER A OG   2  
ATOM 1484  H H    . SER A 1 5   ? -10.107 -8.667  13.847  1.00 0.00 ? 5   SER A H    2  
ATOM 1485  H HA   . SER A 1 5   ? -8.396  -9.799  15.891  1.00 0.00 ? 5   SER A HA   2  
ATOM 1486  H HB2  . SER A 1 5   ? -8.875  -10.550 13.272  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1487  H HB3  . SER A 1 5   ? -7.390  -9.635  13.099  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1488  H HG   . SER A 1 5   ? -7.353  -12.083 13.672  1.00 0.00 ? 5   SER A HG   2  
ATOM 1489  N N    . SER A 1 6   ? -7.453  -7.358  13.845  1.00 0.00 ? 6   SER A N    2  
ATOM 1490  C CA   . SER A 1 6   ? -6.640  -6.158  13.740  1.00 0.00 ? 6   SER A CA   2  
ATOM 1491  C C    . SER A 1 6   ? -5.214  -6.449  14.213  1.00 0.00 ? 6   SER A C    2  
ATOM 1492  O O    . SER A 1 6   ? -4.945  -7.516  14.764  1.00 0.00 ? 6   SER A O    2  
ATOM 1493  C CB   . SER A 1 6   ? -7.244  -5.010  14.552  1.00 0.00 ? 6   SER A CB   2  
ATOM 1494  O OG   . SER A 1 6   ? -6.849  -5.058  15.920  1.00 0.00 ? 6   SER A OG   2  
ATOM 1495  H H    . SER A 1 6   ? -7.920  -7.627  13.002  1.00 0.00 ? 6   SER A H    2  
ATOM 1496  H HA   . SER A 1 6   ? -6.646  -5.896  12.682  1.00 0.00 ? 6   SER A HA   2  
ATOM 1497  H HB2  . SER A 1 6   ? -6.936  -4.059  14.119  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1498  H HB3  . SER A 1 6   ? -8.331  -5.053  14.487  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1499  H HG   . SER A 1 6   ? -6.429  -4.191  16.185  1.00 0.00 ? 6   SER A HG   2  
ATOM 1500  N N    . GLY A 1 7   ? -4.339  -5.482  13.981  1.00 0.00 ? 7   GLY A N    2  
ATOM 1501  C CA   . GLY A 1 7   ? -2.948  -5.622  14.376  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1502  C C    . GLY A 1 7   ? -2.032  -4.817  13.451  1.00 0.00 ? 7   GLY A C    2  
ATOM 1503  O O    . GLY A 1 7   ? -2.311  -4.680  12.261  1.00 0.00 ? 7   GLY A O    2  
ATOM 1504  H H    . GLY A 1 7   ? -4.566  -4.618  13.532  1.00 0.00 ? 7   GLY A H    2  
ATOM 1505  H HA2  . GLY A 1 7   ? -2.822  -5.281  15.404  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1506  H HA3  . GLY A 1 7   ? -2.662  -6.673  14.351  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1507  N N    . SER A 1 8   ? -0.957  -4.306  14.034  1.00 0.00 ? 8   SER A N    2  
ATOM 1508  C CA   . SER A 1 8   ? 0.002   -3.519  13.277  1.00 0.00 ? 8   SER A CA   2  
ATOM 1509  C C    . SER A 1 8   ? 1.134   -4.417  12.773  1.00 0.00 ? 8   SER A C    2  
ATOM 1510  O O    . SER A 1 8   ? 1.275   -5.554  13.220  1.00 0.00 ? 8   SER A O    2  
ATOM 1511  C CB   . SER A 1 8   ? 0.567   -2.377  14.123  1.00 0.00 ? 8   SER A CB   2  
ATOM 1512  O OG   . SER A 1 8   ? 1.411   -2.853  15.168  1.00 0.00 ? 8   SER A OG   2  
ATOM 1513  H H    . SER A 1 8   ? -0.737  -4.422  15.003  1.00 0.00 ? 8   SER A H    2  
ATOM 1514  H HA   . SER A 1 8   ? -0.561  -3.107  12.439  1.00 0.00 ? 8   SER A HA   2  
ATOM 1515  H HB2  . SER A 1 8   ? 1.129   -1.696  13.484  1.00 0.00 ? 8   SER A HB2  2  
ATOM 1516  H HB3  . SER A 1 8   ? -0.255  -1.804  14.553  1.00 0.00 ? 8   SER A HB3  2  
ATOM 1517  H HG   . SER A 1 8   ? 0.940   -3.563  15.691  1.00 0.00 ? 8   SER A HG   2  
ATOM 1518  N N    . VAL A 1 9   ? 1.912   -3.871  11.850  1.00 0.00 ? 9   VAL A N    2  
ATOM 1519  C CA   . VAL A 1 9   ? 3.028   -4.608  11.281  1.00 0.00 ? 9   VAL A CA   2  
ATOM 1520  C C    . VAL A 1 9   ? 4.190   -3.648  11.024  1.00 0.00 ? 9   VAL A C    2  
ATOM 1521  O O    . VAL A 1 9   ? 3.990   -2.438  10.927  1.00 0.00 ? 9   VAL A O    2  
ATOM 1522  C CB   . VAL A 1 9   ? 2.576   -5.351  10.022  1.00 0.00 ? 9   VAL A CB   2  
ATOM 1523  C CG1  . VAL A 1 9   ? 1.561   -4.523  9.232   1.00 0.00 ? 9   VAL A CG1  2  
ATOM 1524  C CG2  . VAL A 1 9   ? 3.774   -5.729  9.149   1.00 0.00 ? 9   VAL A CG2  2  
ATOM 1525  H H    . VAL A 1 9   ? 1.791   -2.946  11.492  1.00 0.00 ? 9   VAL A H    2  
ATOM 1526  H HA   . VAL A 1 9   ? 3.341   -5.350  12.016  1.00 0.00 ? 9   VAL A HA   2  
ATOM 1527  H HB   . VAL A 1 9   ? 2.086   -6.273  10.334  1.00 0.00 ? 9   VAL A HB   2  
ATOM 1528  H HG11 . VAL A 1 9   ? 0.562   -4.694  9.633   1.00 0.00 ? 9   VAL A HG11 2  
ATOM 1529  H HG12 . VAL A 1 9   ? 1.810   -3.466  9.315   1.00 0.00 ? 9   VAL A HG12 2  
ATOM 1530  H HG13 . VAL A 1 9   ? 1.586   -4.821  8.183   1.00 0.00 ? 9   VAL A HG13 2  
ATOM 1531  H HG21 . VAL A 1 9   ? 3.420   -6.182  8.223   1.00 0.00 ? 9   VAL A HG21 2  
ATOM 1532  H HG22 . VAL A 1 9   ? 4.351   -4.834  8.917   1.00 0.00 ? 9   VAL A HG22 2  
ATOM 1533  H HG23 . VAL A 1 9   ? 4.405   -6.439  9.684   1.00 0.00 ? 9   VAL A HG23 2  
ATOM 1534  N N    . SER A 1 10  ? 5.379   -4.222  10.920  1.00 0.00 ? 10  SER A N    2  
ATOM 1535  C CA   . SER A 1 10  ? 6.574   -3.432  10.676  1.00 0.00 ? 10  SER A CA   2  
ATOM 1536  C C    . SER A 1 10  ? 7.420   -4.087  9.583   1.00 0.00 ? 10  SER A C    2  
ATOM 1537  O O    . SER A 1 10  ? 7.797   -5.252  9.699   1.00 0.00 ? 10  SER A O    2  
ATOM 1538  C CB   . SER A 1 10  ? 7.396   -3.266  11.956  1.00 0.00 ? 10  SER A CB   2  
ATOM 1539  O OG   . SER A 1 10  ? 8.577   -2.500  11.736  1.00 0.00 ? 10  SER A OG   2  
ATOM 1540  H H    . SER A 1 10  ? 5.533   -5.207  11.000  1.00 0.00 ? 10  SER A H    2  
ATOM 1541  H HA   . SER A 1 10  ? 6.213   -2.457  10.348  1.00 0.00 ? 10  SER A HA   2  
ATOM 1542  H HB2  . SER A 1 10  ? 6.786   -2.781  12.718  1.00 0.00 ? 10  SER A HB2  2  
ATOM 1543  H HB3  . SER A 1 10  ? 7.667   -4.249  12.342  1.00 0.00 ? 10  SER A HB3  2  
ATOM 1544  H HG   . SER A 1 10  ? 8.698   -2.330  10.758  1.00 0.00 ? 10  SER A HG   2  
ATOM 1545  N N    . LEU A 1 11  ? 7.695   -3.309  8.546   1.00 0.00 ? 11  LEU A N    2  
ATOM 1546  C CA   . LEU A 1 11  ? 8.490   -3.800  7.433   1.00 0.00 ? 11  LEU A CA   2  
ATOM 1547  C C    . LEU A 1 11  ? 9.849   -3.097  7.434   1.00 0.00 ? 11  LEU A C    2  
ATOM 1548  O O    . LEU A 1 11  ? 9.956   -1.945  7.853   1.00 0.00 ? 11  LEU A O    2  
ATOM 1549  C CB   . LEU A 1 11  ? 7.722   -3.650  6.118   1.00 0.00 ? 11  LEU A CB   2  
ATOM 1550  C CG   . LEU A 1 11  ? 6.404   -4.421  6.020   1.00 0.00 ? 11  LEU A CG   2  
ATOM 1551  C CD1  . LEU A 1 11  ? 5.817   -4.326  4.611   1.00 0.00 ? 11  LEU A CD1  2  
ATOM 1552  C CD2  . LEU A 1 11  ? 6.583   -5.872  6.471   1.00 0.00 ? 11  LEU A CD2  2  
ATOM 1553  H H    . LEU A 1 11  ? 7.385   -2.363  8.459   1.00 0.00 ? 11  LEU A H    2  
ATOM 1554  H HA   . LEU A 1 11  ? 8.652   -4.866  7.591   1.00 0.00 ? 11  LEU A HA   2  
ATOM 1555  H HB2  . LEU A 1 11  ? 7.513   -2.591  5.961   1.00 0.00 ? 11  LEU A HB2  2  
ATOM 1556  H HB3  . LEU A 1 11  ? 8.369   -3.971  5.303   1.00 0.00 ? 11  LEU A HB3  2  
ATOM 1557  H HG   . LEU A 1 11  ? 5.687   -3.959  6.699   1.00 0.00 ? 11  LEU A HG   2  
ATOM 1558  H HD11 . LEU A 1 11  ? 5.765   -3.280  4.308   1.00 0.00 ? 11  LEU A HD11 2  
ATOM 1559  H HD12 . LEU A 1 11  ? 6.452   -4.875  3.915   1.00 0.00 ? 11  LEU A HD12 2  
ATOM 1560  H HD13 . LEU A 1 11  ? 4.815   -4.756  4.604   1.00 0.00 ? 11  LEU A HD13 2  
ATOM 1561  H HD21 . LEU A 1 11  ? 6.711   -5.903  7.553   1.00 0.00 ? 11  LEU A HD21 2  
ATOM 1562  H HD22 . LEU A 1 11  ? 5.701   -6.450  6.193   1.00 0.00 ? 11  LEU A HD22 2  
ATOM 1563  H HD23 . LEU A 1 11  ? 7.463   -6.296  5.987   1.00 0.00 ? 11  LEU A HD23 2  
ATOM 1564  N N    . VAL A 1 12  ? 10.854  -3.820  6.961   1.00 0.00 ? 12  VAL A N    2  
ATOM 1565  C CA   . VAL A 1 12  ? 12.202  -3.280  6.902   1.00 0.00 ? 12  VAL A CA   2  
ATOM 1566  C C    . VAL A 1 12  ? 12.641  -3.176  5.440   1.00 0.00 ? 12  VAL A C    2  
ATOM 1567  O O    . VAL A 1 12  ? 12.934  -4.186  4.803   1.00 0.00 ? 12  VAL A O    2  
ATOM 1568  C CB   . VAL A 1 12  ? 13.145  -4.135  7.751   1.00 0.00 ? 12  VAL A CB   2  
ATOM 1569  C CG1  . VAL A 1 12  ? 13.047  -5.611  7.361   1.00 0.00 ? 12  VAL A CG1  2  
ATOM 1570  C CG2  . VAL A 1 12  ? 14.586  -3.633  7.641   1.00 0.00 ? 12  VAL A CG2  2  
ATOM 1571  H H    . VAL A 1 12  ? 10.758  -4.756  6.622   1.00 0.00 ? 12  VAL A H    2  
ATOM 1572  H HA   . VAL A 1 12  ? 12.174  -2.279  7.332   1.00 0.00 ? 12  VAL A HA   2  
ATOM 1573  H HB   . VAL A 1 12  ? 12.836  -4.041  8.792   1.00 0.00 ? 12  VAL A HB   2  
ATOM 1574  H HG11 . VAL A 1 12  ? 12.380  -6.126  8.054   1.00 0.00 ? 12  VAL A HG11 2  
ATOM 1575  H HG12 . VAL A 1 12  ? 12.653  -5.694  6.348   1.00 0.00 ? 12  VAL A HG12 2  
ATOM 1576  H HG13 . VAL A 1 12  ? 14.037  -6.065  7.405   1.00 0.00 ? 12  VAL A HG13 2  
ATOM 1577  H HG21 . VAL A 1 12  ? 15.238  -4.268  8.242   1.00 0.00 ? 12  VAL A HG21 2  
ATOM 1578  H HG22 . VAL A 1 12  ? 14.905  -3.668  6.599   1.00 0.00 ? 12  VAL A HG22 2  
ATOM 1579  H HG23 . VAL A 1 12  ? 14.643  -2.607  8.004   1.00 0.00 ? 12  VAL A HG23 2  
ATOM 1580  N N    . GLY A 1 13  ? 12.674  -1.944  4.952   1.00 0.00 ? 13  GLY A N    2  
ATOM 1581  C CA   . GLY A 1 13  ? 13.073  -1.695  3.577   1.00 0.00 ? 13  GLY A CA   2  
ATOM 1582  C C    . GLY A 1 13  ? 13.149  -0.194  3.292   1.00 0.00 ? 13  GLY A C    2  
ATOM 1583  O O    . GLY A 1 13  ? 12.509  0.605   3.974   1.00 0.00 ? 13  GLY A O    2  
ATOM 1584  H H    . GLY A 1 13  ? 12.434  -1.128  5.477   1.00 0.00 ? 13  GLY A H    2  
ATOM 1585  H HA2  . GLY A 1 13  ? 14.043  -2.155  3.387   1.00 0.00 ? 13  GLY A HA2  2  
ATOM 1586  H HA3  . GLY A 1 13  ? 12.360  -2.162  2.897   1.00 0.00 ? 13  GLY A HA3  2  
ATOM 1587  N N    . PRO A 1 14  ? 13.959  0.154   2.256   1.00 0.00 ? 14  PRO A N    2  
ATOM 1588  C CA   . PRO A 1 14  ? 14.127  1.545   1.872   1.00 0.00 ? 14  PRO A CA   2  
ATOM 1589  C C    . PRO A 1 14  ? 12.895  2.061   1.127   1.00 0.00 ? 14  PRO A C    2  
ATOM 1590  O O    . PRO A 1 14  ? 12.803  3.249   0.819   1.00 0.00 ? 14  PRO A O    2  
ATOM 1591  C CB   . PRO A 1 14  ? 15.388  1.569   1.023   1.00 0.00 ? 14  PRO A CB   2  
ATOM 1592  C CG   . PRO A 1 14  ? 15.618  0.134   0.578   1.00 0.00 ? 14  PRO A CG   2  
ATOM 1593  C CD   . PRO A 1 14  ? 14.733  -0.765  1.426   1.00 0.00 ? 14  PRO A CD   2  
ATOM 1594  H HA   . PRO A 1 14  ? 14.217  2.121   2.685   1.00 0.00 ? 14  PRO A HA   2  
ATOM 1595  H HB2  . PRO A 1 14  ? 15.268  2.230   0.165   1.00 0.00 ? 14  PRO A HB2  2  
ATOM 1596  H HB3  . PRO A 1 14  ? 16.237  1.942   1.596   1.00 0.00 ? 14  PRO A HB3  2  
ATOM 1597  H HG2  . PRO A 1 14  ? 15.378  0.019   -0.479  1.00 0.00 ? 14  PRO A HG2  2  
ATOM 1598  H HG3  . PRO A 1 14  ? 16.666  -0.139  0.698   1.00 0.00 ? 14  PRO A HG3  2  
ATOM 1599  H HD2  . PRO A 1 14  ? 14.082  -1.380  0.804   1.00 0.00 ? 14  PRO A HD2  2  
ATOM 1600  H HD3  . PRO A 1 14  ? 15.327  -1.444  2.036   1.00 0.00 ? 14  PRO A HD3  2  
ATOM 1601  N N    . ALA A 1 15  ? 11.977  1.144   0.859   1.00 0.00 ? 15  ALA A N    2  
ATOM 1602  C CA   . ALA A 1 15  ? 10.754  1.492   0.156   1.00 0.00 ? 15  ALA A CA   2  
ATOM 1603  C C    . ALA A 1 15  ? 10.111  0.219   -0.400  1.00 0.00 ? 15  ALA A C    2  
ATOM 1604  O O    . ALA A 1 15  ? 8.922   -0.020  -0.195  1.00 0.00 ? 15  ALA A O    2  
ATOM 1605  C CB   . ALA A 1 15  ? 11.067  2.513   -0.939  1.00 0.00 ? 15  ALA A CB   2  
ATOM 1606  H H    . ALA A 1 15  ? 12.059  0.180   1.113   1.00 0.00 ? 15  ALA A H    2  
ATOM 1607  H HA   . ALA A 1 15  ? 10.075  1.947   0.877   1.00 0.00 ? 15  ALA A HA   2  
ATOM 1608  H HB1  . ALA A 1 15  ? 10.761  3.505   -0.609  1.00 0.00 ? 15  ALA A HB1  2  
ATOM 1609  H HB2  . ALA A 1 15  ? 12.138  2.512   -1.141  1.00 0.00 ? 15  ALA A HB2  2  
ATOM 1610  H HB3  . ALA A 1 15  ? 10.526  2.249   -1.847  1.00 0.00 ? 15  ALA A HB3  2  
ATOM 1611  N N    . PRO A 1 16  ? 10.947  -0.584  -1.111  1.00 0.00 ? 16  PRO A N    2  
ATOM 1612  C CA   . PRO A 1 16  ? 10.473  -1.826  -1.697  1.00 0.00 ? 16  PRO A CA   2  
ATOM 1613  C C    . PRO A 1 16  ? 10.292  -2.904  -0.627  1.00 0.00 ? 16  PRO A C    2  
ATOM 1614  O O    . PRO A 1 16  ? 11.133  -3.789  -0.484  1.00 0.00 ? 16  PRO A O    2  
ATOM 1615  C CB   . PRO A 1 16  ? 11.518  -2.193  -2.739  1.00 0.00 ? 16  PRO A CB   2  
ATOM 1616  C CG   . PRO A 1 16  ? 12.763  -1.400  -2.377  1.00 0.00 ? 16  PRO A CG   2  
ATOM 1617  C CD   . PRO A 1 16  ? 12.361  -0.332  -1.373  1.00 0.00 ? 16  PRO A CD   2  
ATOM 1618  H HA   . PRO A 1 16  ? 9.571   -1.693  -2.108  1.00 0.00 ? 16  PRO A HA   2  
ATOM 1619  H HB2  . PRO A 1 16  ? 11.719  -3.264  -2.729  1.00 0.00 ? 16  PRO A HB2  2  
ATOM 1620  H HB3  . PRO A 1 16  ? 11.173  -1.942  -3.742  1.00 0.00 ? 16  PRO A HB3  2  
ATOM 1621  H HG2  . PRO A 1 16  ? 13.523  -2.057  -1.952  1.00 0.00 ? 16  PRO A HG2  2  
ATOM 1622  H HG3  . PRO A 1 16  ? 13.198  -0.944  -3.267  1.00 0.00 ? 16  PRO A HG3  2  
ATOM 1623  H HD2  . PRO A 1 16  ? 12.953  -0.404  -0.461  1.00 0.00 ? 16  PRO A HD2  2  
ATOM 1624  H HD3  . PRO A 1 16  ? 12.517  0.669   -1.776  1.00 0.00 ? 16  PRO A HD3  2  
ATOM 1625  N N    . TRP A 1 17  ? 9.187   -2.794  0.097   1.00 0.00 ? 17  TRP A N    2  
ATOM 1626  C CA   . TRP A 1 17  ? 8.884   -3.748  1.150   1.00 0.00 ? 17  TRP A CA   2  
ATOM 1627  C C    . TRP A 1 17  ? 8.481   -5.068  0.490   1.00 0.00 ? 17  TRP A C    2  
ATOM 1628  O O    . TRP A 1 17  ? 8.616   -6.133  1.090   1.00 0.00 ? 17  TRP A O    2  
ATOM 1629  C CB   . TRP A 1 17  ? 7.813   -3.200  2.095   1.00 0.00 ? 17  TRP A CB   2  
ATOM 1630  C CG   . TRP A 1 17  ? 7.856   -1.681  2.270   1.00 0.00 ? 17  TRP A CG   2  
ATOM 1631  C CD1  . TRP A 1 17  ? 7.239   -0.748  1.532   1.00 0.00 ? 17  TRP A CD1  2  
ATOM 1632  C CD2  . TRP A 1 17  ? 8.581   -0.952  3.282   1.00 0.00 ? 17  TRP A CD2  2  
ATOM 1633  N NE1  . TRP A 1 17  ? 7.513   0.524   1.992   1.00 0.00 ? 17  TRP A NE1  2  
ATOM 1634  C CE2  . TRP A 1 17  ? 8.355   0.396   3.090   1.00 0.00 ? 17  TRP A CE2  2  
ATOM 1635  C CE3  . TRP A 1 17  ? 9.402   -1.416  4.325   1.00 0.00 ? 17  TRP A CE3  2  
ATOM 1636  C CZ2  . TRP A 1 17  ? 8.913   1.390   3.902   1.00 0.00 ? 17  TRP A CZ2  2  
ATOM 1637  C CZ3  . TRP A 1 17  ? 9.953   -0.409  5.128   1.00 0.00 ? 17  TRP A CZ3  2  
ATOM 1638  C CH2  . TRP A 1 17  ? 9.735   0.951   4.948   1.00 0.00 ? 17  TRP A CH2  2  
ATOM 1639  H H    . TRP A 1 17  ? 8.508   -2.070  -0.026  1.00 0.00 ? 17  TRP A H    2  
ATOM 1640  H HA   . TRP A 1 17  ? 9.789   -3.888  1.742   1.00 0.00 ? 17  TRP A HA   2  
ATOM 1641  H HB2  . TRP A 1 17  ? 6.831   -3.485  1.718   1.00 0.00 ? 17  TRP A HB2  2  
ATOM 1642  H HB3  . TRP A 1 17  ? 7.929   -3.671  3.071   1.00 0.00 ? 17  TRP A HB3  2  
ATOM 1643  H HD1  . TRP A 1 17  ? 6.600   -0.966  0.675   1.00 0.00 ? 17  TRP A HD1  2  
ATOM 1644  H HE1  . TRP A 1 17  ? 7.137   1.457   1.572   1.00 0.00 ? 17  TRP A HE1  2  
ATOM 1645  H HE3  . TRP A 1 17  ? 9.596   -2.474  4.497   1.00 0.00 ? 17  TRP A HE3  2  
ATOM 1646  H HZ2  . TRP A 1 17  ? 8.719   2.449   3.730   1.00 0.00 ? 17  TRP A HZ2  2  
ATOM 1647  H HZ3  . TRP A 1 17  ? 10.598  -0.715  5.952   1.00 0.00 ? 17  TRP A HZ3  2  
ATOM 1648  H HH2  . TRP A 1 17  ? 10.201  1.674   5.618   1.00 0.00 ? 17  TRP A HH2  2  
ATOM 1649  N N    . GLY A 1 18  ? 7.993   -4.955  -0.737  1.00 0.00 ? 18  GLY A N    2  
ATOM 1650  C CA   . GLY A 1 18  ? 7.569   -6.126  -1.485  1.00 0.00 ? 18  GLY A CA   2  
ATOM 1651  C C    . GLY A 1 18  ? 6.043   -6.197  -1.573  1.00 0.00 ? 18  GLY A C    2  
ATOM 1652  O O    . GLY A 1 18  ? 5.475   -7.281  -1.696  1.00 0.00 ? 18  GLY A O    2  
ATOM 1653  H H    . GLY A 1 18  ? 7.887   -4.084  -1.218  1.00 0.00 ? 18  GLY A H    2  
ATOM 1654  H HA2  . GLY A 1 18  ? 7.994   -6.094  -2.488  1.00 0.00 ? 18  GLY A HA2  2  
ATOM 1655  H HA3  . GLY A 1 18  ? 7.952   -7.026  -1.005  1.00 0.00 ? 18  GLY A HA3  2  
ATOM 1656  N N    . PHE A 1 19  ? 5.423   -5.028  -1.506  1.00 0.00 ? 19  PHE A N    2  
ATOM 1657  C CA   . PHE A 1 19  ? 3.974   -4.945  -1.577  1.00 0.00 ? 19  PHE A CA   2  
ATOM 1658  C C    . PHE A 1 19  ? 3.533   -3.648  -2.257  1.00 0.00 ? 19  PHE A C    2  
ATOM 1659  O O    . PHE A 1 19  ? 4.226   -2.635  -2.180  1.00 0.00 ? 19  PHE A O    2  
ATOM 1660  C CB   . PHE A 1 19  ? 3.455   -4.955  -0.138  1.00 0.00 ? 19  PHE A CB   2  
ATOM 1661  C CG   . PHE A 1 19  ? 3.499   -3.588  0.549   1.00 0.00 ? 19  PHE A CG   2  
ATOM 1662  C CD1  . PHE A 1 19  ? 2.681   -2.588  0.126   1.00 0.00 ? 19  PHE A CD1  2  
ATOM 1663  C CD2  . PHE A 1 19  ? 4.357   -3.374  1.582   1.00 0.00 ? 19  PHE A CD2  2  
ATOM 1664  C CE1  . PHE A 1 19  ? 2.722   -1.319  0.763   1.00 0.00 ? 19  PHE A CE1  2  
ATOM 1665  C CE2  . PHE A 1 19  ? 4.398   -2.105  2.220   1.00 0.00 ? 19  PHE A CE2  2  
ATOM 1666  C CZ   . PHE A 1 19  ? 3.579   -1.105  1.797   1.00 0.00 ? 19  PHE A CZ   2  
ATOM 1667  H H    . PHE A 1 19  ? 5.893   -4.151  -1.406  1.00 0.00 ? 19  PHE A H    2  
ATOM 1668  H HA   . PHE A 1 19  ? 3.629   -5.796  -2.164  1.00 0.00 ? 19  PHE A HA   2  
ATOM 1669  H HB2  . PHE A 1 19  ? 2.428   -5.318  -0.135  1.00 0.00 ? 19  PHE A HB2  2  
ATOM 1670  H HB3  . PHE A 1 19  ? 4.045   -5.662  0.446   1.00 0.00 ? 19  PHE A HB3  2  
ATOM 1671  H HD1  . PHE A 1 19  ? 1.993   -2.759  -0.702  1.00 0.00 ? 19  PHE A HD1  2  
ATOM 1672  H HD2  . PHE A 1 19  ? 5.013   -4.175  1.921   1.00 0.00 ? 19  PHE A HD2  2  
ATOM 1673  H HE1  . PHE A 1 19  ? 2.066   -0.518  0.424   1.00 0.00 ? 19  PHE A HE1  2  
ATOM 1674  H HE2  . PHE A 1 19  ? 5.085   -1.934  3.048   1.00 0.00 ? 19  PHE A HE2  2  
ATOM 1675  H HZ   . PHE A 1 19  ? 3.611   -0.131  2.286   1.00 0.00 ? 19  PHE A HZ   2  
ATOM 1676  N N    . ARG A 1 20  ? 2.381   -3.721  -2.908  1.00 0.00 ? 20  ARG A N    2  
ATOM 1677  C CA   . ARG A 1 20  ? 1.838   -2.565  -3.601  1.00 0.00 ? 20  ARG A CA   2  
ATOM 1678  C C    . ARG A 1 20  ? 0.504   -2.150  -2.977  1.00 0.00 ? 20  ARG A C    2  
ATOM 1679  O O    . ARG A 1 20  ? -0.034  -2.857  -2.127  1.00 0.00 ? 20  ARG A O    2  
ATOM 1680  C CB   . ARG A 1 20  ? 1.627   -2.863  -5.087  1.00 0.00 ? 20  ARG A CB   2  
ATOM 1681  C CG   . ARG A 1 20  ? 2.934   -2.707  -5.868  1.00 0.00 ? 20  ARG A CG   2  
ATOM 1682  C CD   . ARG A 1 20  ? 2.762   -1.733  -7.036  1.00 0.00 ? 20  ARG A CD   2  
ATOM 1683  N NE   . ARG A 1 20  ? 4.024   -1.634  -7.802  1.00 0.00 ? 20  ARG A NE   2  
ATOM 1684  C CZ   . ARG A 1 20  ? 4.181   -0.877  -8.897  1.00 0.00 ? 20  ARG A CZ   2  
ATOM 1685  N NH1  . ARG A 1 20  ? 3.156   -0.149  -9.360  1.00 0.00 ? 20  ARG A NH1  2  
ATOM 1686  N NH2  . ARG A 1 20  ? 5.362   -0.849  -9.528  1.00 0.00 ? 20  ARG A NH2  2  
ATOM 1687  H H    . ARG A 1 20  ? 1.823   -4.549  -2.966  1.00 0.00 ? 20  ARG A H    2  
ATOM 1688  H HA   . ARG A 1 20  ? 2.590   -1.786  -3.475  1.00 0.00 ? 20  ARG A HA   2  
ATOM 1689  H HB2  . ARG A 1 20  ? 1.246   -3.877  -5.208  1.00 0.00 ? 20  ARG A HB2  2  
ATOM 1690  H HB3  . ARG A 1 20  ? 0.874   -2.188  -5.494  1.00 0.00 ? 20  ARG A HB3  2  
ATOM 1691  H HG2  . ARG A 1 20  ? 3.719   -2.348  -5.203  1.00 0.00 ? 20  ARG A HG2  2  
ATOM 1692  H HG3  . ARG A 1 20  ? 3.255   -3.678  -6.244  1.00 0.00 ? 20  ARG A HG3  2  
ATOM 1693  H HD2  . ARG A 1 20  ? 1.957   -2.072  -7.687  1.00 0.00 ? 20  ARG A HD2  2  
ATOM 1694  H HD3  . ARG A 1 20  ? 2.476   -0.750  -6.661  1.00 0.00 ? 20  ARG A HD3  2  
ATOM 1695  H HE   . ARG A 1 20  ? 4.809   -2.166  -7.484  1.00 0.00 ? 20  ARG A HE   2  
ATOM 1696  H HH11 . ARG A 1 20  ? 2.274   -0.170  -8.889  1.00 0.00 ? 20  ARG A HH11 2  
ATOM 1697  H HH12 . ARG A 1 20  ? 3.273   0.416   -10.177 1.00 0.00 ? 20  ARG A HH12 2  
ATOM 1698  H HH21 . ARG A 1 20  ? 6.127   -1.393  -9.183  1.00 0.00 ? 20  ARG A HH21 2  
ATOM 1699  H HH22 . ARG A 1 20  ? 5.479   -0.284  -10.345 1.00 0.00 ? 20  ARG A HH22 2  
ATOM 1700  N N    . LEU A 1 21  ? 0.010   -1.004  -3.424  1.00 0.00 ? 21  LEU A N    2  
ATOM 1701  C CA   . LEU A 1 21  ? -1.251  -0.486  -2.920  1.00 0.00 ? 21  LEU A CA   2  
ATOM 1702  C C    . LEU A 1 21  ? -2.150  -0.108  -4.099  1.00 0.00 ? 21  LEU A C    2  
ATOM 1703  O O    . LEU A 1 21  ? -1.659  0.203   -5.183  1.00 0.00 ? 21  LEU A O    2  
ATOM 1704  C CB   . LEU A 1 21  ? -1.005  0.663   -1.940  1.00 0.00 ? 21  LEU A CB   2  
ATOM 1705  C CG   . LEU A 1 21  ? -0.403  0.275   -0.588  1.00 0.00 ? 21  LEU A CG   2  
ATOM 1706  C CD1  . LEU A 1 21  ? 0.042   1.514   0.190   1.00 0.00 ? 21  LEU A CD1  2  
ATOM 1707  C CD2  . LEU A 1 21  ? -1.376  -0.589  0.217   1.00 0.00 ? 21  LEU A CD2  2  
ATOM 1708  H H    . LEU A 1 21  ? 0.454   -0.435  -4.115  1.00 0.00 ? 21  LEU A H    2  
ATOM 1709  H HA   . LEU A 1 21  ? -1.733  -1.288  -2.361  1.00 0.00 ? 21  LEU A HA   2  
ATOM 1710  H HB2  . LEU A 1 21  ? -0.341  1.385   -2.417  1.00 0.00 ? 21  LEU A HB2  2  
ATOM 1711  H HB3  . LEU A 1 21  ? -1.952  1.171   -1.761  1.00 0.00 ? 21  LEU A HB3  2  
ATOM 1712  H HG   . LEU A 1 21  ? 0.487   -0.328  -0.771  1.00 0.00 ? 21  LEU A HG   2  
ATOM 1713  H HD11 . LEU A 1 21  ? 0.426   1.213   1.165   1.00 0.00 ? 21  LEU A HD11 2  
ATOM 1714  H HD12 . LEU A 1 21  ? 0.825   2.031   -0.366  1.00 0.00 ? 21  LEU A HD12 2  
ATOM 1715  H HD13 . LEU A 1 21  ? -0.808  2.183   0.326   1.00 0.00 ? 21  LEU A HD13 2  
ATOM 1716  H HD21 . LEU A 1 21  ? -1.825  0.011   1.008   1.00 0.00 ? 21  LEU A HD21 2  
ATOM 1717  H HD22 . LEU A 1 21  ? -2.158  -0.966  -0.442  1.00 0.00 ? 21  LEU A HD22 2  
ATOM 1718  H HD23 . LEU A 1 21  ? -0.837  -1.428  0.658   1.00 0.00 ? 21  LEU A HD23 2  
ATOM 1719  N N    . GLN A 1 22  ? -3.450  -0.147  -3.847  1.00 0.00 ? 22  GLN A N    2  
ATOM 1720  C CA   . GLN A 1 22  ? -4.421  0.188   -4.874  1.00 0.00 ? 22  GLN A CA   2  
ATOM 1721  C C    . GLN A 1 22  ? -5.723  0.677   -4.234  1.00 0.00 ? 22  GLN A C    2  
ATOM 1722  O O    . GLN A 1 22  ? -6.126  0.182   -3.183  1.00 0.00 ? 22  GLN A O    2  
ATOM 1723  C CB   . GLN A 1 22  ? -4.678  -1.005  -5.796  1.00 0.00 ? 22  GLN A CB   2  
ATOM 1724  C CG   . GLN A 1 22  ? -5.182  -2.213  -5.004  1.00 0.00 ? 22  GLN A CG   2  
ATOM 1725  C CD   . GLN A 1 22  ? -5.608  -3.344  -5.941  1.00 0.00 ? 22  GLN A CD   2  
ATOM 1726  O OE1  . GLN A 1 22  ? -5.632  -3.206  -7.153  1.00 0.00 ? 22  GLN A OE1  2  
ATOM 1727  N NE2  . GLN A 1 22  ? -5.944  -4.468  -5.314  1.00 0.00 ? 22  GLN A NE2  2  
ATOM 1728  H H    . GLN A 1 22  ? -3.841  -0.401  -2.962  1.00 0.00 ? 22  GLN A H    2  
ATOM 1729  H HA   . GLN A 1 22  ? -3.967  0.994   -5.450  1.00 0.00 ? 22  GLN A HA   2  
ATOM 1730  H HB2  . GLN A 1 22  ? -5.411  -0.732  -6.555  1.00 0.00 ? 22  GLN A HB2  2  
ATOM 1731  H HB3  . GLN A 1 22  ? -3.759  -1.267  -6.321  1.00 0.00 ? 22  GLN A HB3  2  
ATOM 1732  H HG2  . GLN A 1 22  ? -4.397  -2.566  -4.335  1.00 0.00 ? 22  GLN A HG2  2  
ATOM 1733  H HG3  . GLN A 1 22  ? -6.024  -1.916  -4.379  1.00 0.00 ? 22  GLN A HG3  2  
ATOM 1734  H HE21 . GLN A 1 22  ? -5.903  -4.515  -4.316  1.00 0.00 ? 22  GLN A HE21 2  
ATOM 1735  H HE22 . GLN A 1 22  ? -6.237  -5.266  -5.841  1.00 0.00 ? 22  GLN A HE22 2  
ATOM 1736  N N    . GLY A 1 23  ? -6.344  1.642   -4.896  1.00 0.00 ? 23  GLY A N    2  
ATOM 1737  C CA   . GLY A 1 23  ? -7.592  2.202   -4.405  1.00 0.00 ? 23  GLY A CA   2  
ATOM 1738  C C    . GLY A 1 23  ? -7.377  3.609   -3.844  1.00 0.00 ? 23  GLY A C    2  
ATOM 1739  O O    . GLY A 1 23  ? -6.384  4.262   -4.159  1.00 0.00 ? 23  GLY A O    2  
ATOM 1740  H H    . GLY A 1 23  ? -6.010  2.039   -5.751  1.00 0.00 ? 23  GLY A H    2  
ATOM 1741  H HA2  . GLY A 1 23  ? -8.322  2.237   -5.214  1.00 0.00 ? 23  GLY A HA2  2  
ATOM 1742  H HA3  . GLY A 1 23  ? -8.005  1.556   -3.630  1.00 0.00 ? 23  GLY A HA3  2  
ATOM 1743  N N    . GLY A 1 24  ? -8.326  4.034   -3.022  1.00 0.00 ? 24  GLY A N    2  
ATOM 1744  C CA   . GLY A 1 24  ? -8.253  5.352   -2.413  1.00 0.00 ? 24  GLY A CA   2  
ATOM 1745  C C    . GLY A 1 24  ? -9.544  6.138   -2.653  1.00 0.00 ? 24  GLY A C    2  
ATOM 1746  O O    . GLY A 1 24  ? -10.474 5.635   -3.280  1.00 0.00 ? 24  GLY A O    2  
ATOM 1747  H H    . GLY A 1 24  ? -9.130  3.497   -2.770  1.00 0.00 ? 24  GLY A H    2  
ATOM 1748  H HA2  . GLY A 1 24  ? -8.077  5.253   -1.342  1.00 0.00 ? 24  GLY A HA2  2  
ATOM 1749  H HA3  . GLY A 1 24  ? -7.407  5.901   -2.826  1.00 0.00 ? 24  GLY A HA3  2  
ATOM 1750  N N    . LYS A 1 25  ? -9.558  7.360   -2.141  1.00 0.00 ? 25  LYS A N    2  
ATOM 1751  C CA   . LYS A 1 25  ? -10.719 8.221   -2.291  1.00 0.00 ? 25  LYS A CA   2  
ATOM 1752  C C    . LYS A 1 25  ? -10.830 8.671   -3.749  1.00 0.00 ? 25  LYS A C    2  
ATOM 1753  O O    . LYS A 1 25  ? -11.924 8.955   -4.233  1.00 0.00 ? 25  LYS A O    2  
ATOM 1754  C CB   . LYS A 1 25  ? -10.660 9.379   -1.293  1.00 0.00 ? 25  LYS A CB   2  
ATOM 1755  C CG   . LYS A 1 25  ? -12.058 9.735   -0.783  1.00 0.00 ? 25  LYS A CG   2  
ATOM 1756  C CD   . LYS A 1 25  ? -11.985 10.414  0.587   1.00 0.00 ? 25  LYS A CD   2  
ATOM 1757  C CE   . LYS A 1 25  ? -11.683 11.907  0.443   1.00 0.00 ? 25  LYS A CE   2  
ATOM 1758  N NZ   . LYS A 1 25  ? -12.895 12.643  0.019   1.00 0.00 ? 25  LYS A NZ   2  
ATOM 1759  H H    . LYS A 1 25  ? -8.797  7.762   -1.632  1.00 0.00 ? 25  LYS A H    2  
ATOM 1760  H HA   . LYS A 1 25  ? -11.599 7.628   -2.044  1.00 0.00 ? 25  LYS A HA   2  
ATOM 1761  H HB2  . LYS A 1 25  ? -10.020 9.108   -0.453  1.00 0.00 ? 25  LYS A HB2  2  
ATOM 1762  H HB3  . LYS A 1 25  ? -10.209 10.251  -1.768  1.00 0.00 ? 25  LYS A HB3  2  
ATOM 1763  H HG2  . LYS A 1 25  ? -12.551 10.397  -1.495  1.00 0.00 ? 25  LYS A HG2  2  
ATOM 1764  H HG3  . LYS A 1 25  ? -12.664 8.832   -0.713  1.00 0.00 ? 25  LYS A HG3  2  
ATOM 1765  H HD2  . LYS A 1 25  ? -12.930 10.280  1.113   1.00 0.00 ? 25  LYS A HD2  2  
ATOM 1766  H HD3  . LYS A 1 25  ? -11.213 9.940   1.191   1.00 0.00 ? 25  LYS A HD3  2  
ATOM 1767  H HE2  . LYS A 1 25  ? -11.322 12.304  1.392   1.00 0.00 ? 25  LYS A HE2  2  
ATOM 1768  H HE3  . LYS A 1 25  ? -10.887 12.055  -0.287  1.00 0.00 ? 25  LYS A HE3  2  
ATOM 1769  H HZ1  . LYS A 1 25  ? -12.649 13.583  -0.219  1.00 0.00 ? 25  LYS A HZ1  2  
ATOM 1770  H HZ2  . LYS A 1 25  ? -13.298 12.192  -0.778  1.00 0.00 ? 25  LYS A HZ2  2  
ATOM 1771  H HZ3  . LYS A 1 25  ? -13.558 12.652  0.768   1.00 0.00 ? 25  LYS A HZ3  2  
ATOM 1772  N N    . ASP A 1 26  ? -9.682  8.721   -4.408  1.00 0.00 ? 26  ASP A N    2  
ATOM 1773  C CA   . ASP A 1 26  ? -9.636  9.131   -5.801  1.00 0.00 ? 26  ASP A CA   2  
ATOM 1774  C C    . ASP A 1 26  ? -10.137 7.985   -6.683  1.00 0.00 ? 26  ASP A C    2  
ATOM 1775  O O    . ASP A 1 26  ? -10.606 8.213   -7.797  1.00 0.00 ? 26  ASP A O    2  
ATOM 1776  C CB   . ASP A 1 26  ? -8.206  9.467   -6.230  1.00 0.00 ? 26  ASP A CB   2  
ATOM 1777  C CG   . ASP A 1 26  ? -8.032  9.769   -7.720  1.00 0.00 ? 26  ASP A CG   2  
ATOM 1778  O OD1  . ASP A 1 26  ? -7.905  8.789   -8.486  1.00 0.00 ? 26  ASP A OD1  2  
ATOM 1779  O OD2  . ASP A 1 26  ? -8.030  10.972  -8.059  1.00 0.00 ? 26  ASP A OD2  2  
ATOM 1780  H H    . ASP A 1 26  ? -8.796  8.488   -4.007  1.00 0.00 ? 26  ASP A H    2  
ATOM 1781  H HA   . ASP A 1 26  ? -10.274 10.013  -5.861  1.00 0.00 ? 26  ASP A HA   2  
ATOM 1782  H HB2  . ASP A 1 26  ? -7.864  10.329  -5.658  1.00 0.00 ? 26  ASP A HB2  2  
ATOM 1783  H HB3  . ASP A 1 26  ? -7.558  8.631   -5.966  1.00 0.00 ? 26  ASP A HB3  2  
ATOM 1784  N N    . PHE A 1 27  ? -10.021 6.777   -6.151  1.00 0.00 ? 27  PHE A N    2  
ATOM 1785  C CA   . PHE A 1 27  ? -10.456 5.595   -6.875  1.00 0.00 ? 27  PHE A CA   2  
ATOM 1786  C C    . PHE A 1 27  ? -11.859 5.170   -6.437  1.00 0.00 ? 27  PHE A C    2  
ATOM 1787  O O    . PHE A 1 27  ? -12.528 4.411   -7.137  1.00 0.00 ? 27  PHE A O    2  
ATOM 1788  C CB   . PHE A 1 27  ? -9.469  4.476   -6.539  1.00 0.00 ? 27  PHE A CB   2  
ATOM 1789  C CG   . PHE A 1 27  ? -8.121  4.600   -7.252  1.00 0.00 ? 27  PHE A CG   2  
ATOM 1790  C CD1  . PHE A 1 27  ? -7.337  5.691   -7.040  1.00 0.00 ? 27  PHE A CD1  2  
ATOM 1791  C CD2  . PHE A 1 27  ? -7.707  3.619   -8.099  1.00 0.00 ? 27  PHE A CD2  2  
ATOM 1792  C CE1  . PHE A 1 27  ? -6.086  5.806   -7.702  1.00 0.00 ? 27  PHE A CE1  2  
ATOM 1793  C CE2  . PHE A 1 27  ? -6.456  3.734   -8.761  1.00 0.00 ? 27  PHE A CE2  2  
ATOM 1794  C CZ   . PHE A 1 27  ? -5.672  4.825   -8.548  1.00 0.00 ? 27  PHE A CZ   2  
ATOM 1795  H H    . PHE A 1 27  ? -9.638  6.600   -5.244  1.00 0.00 ? 27  PHE A H    2  
ATOM 1796  H HA   . PHE A 1 27  ? -10.470 5.852   -7.934  1.00 0.00 ? 27  PHE A HA   2  
ATOM 1797  H HB2  . PHE A 1 27  ? -9.299  4.466   -5.462  1.00 0.00 ? 27  PHE A HB2  2  
ATOM 1798  H HB3  . PHE A 1 27  ? -9.919  3.518   -6.799  1.00 0.00 ? 27  PHE A HB3  2  
ATOM 1799  H HD1  . PHE A 1 27  ? -7.669  6.476   -6.361  1.00 0.00 ? 27  PHE A HD1  2  
ATOM 1800  H HD2  . PHE A 1 27  ? -8.336  2.745   -8.269  1.00 0.00 ? 27  PHE A HD2  2  
ATOM 1801  H HE1  . PHE A 1 27  ? -5.458  6.680   -7.531  1.00 0.00 ? 27  PHE A HE1  2  
ATOM 1802  H HE2  . PHE A 1 27  ? -6.125  2.948   -9.439  1.00 0.00 ? 27  PHE A HE2  2  
ATOM 1803  H HZ   . PHE A 1 27  ? -4.712  4.913   -9.057  1.00 0.00 ? 27  PHE A HZ   2  
ATOM 1804  N N    . ASN A 1 28  ? -12.264 5.678   -5.283  1.00 0.00 ? 28  ASN A N    2  
ATOM 1805  C CA   . ASN A 1 28  ? -13.575 5.361   -4.744  1.00 0.00 ? 28  ASN A CA   2  
ATOM 1806  C C    . ASN A 1 28  ? -13.545 3.958   -4.133  1.00 0.00 ? 28  ASN A C    2  
ATOM 1807  O O    . ASN A 1 28  ? -14.459 3.164   -4.347  1.00 0.00 ? 28  ASN A O    2  
ATOM 1808  C CB   . ASN A 1 28  ? -14.640 5.375   -5.842  1.00 0.00 ? 28  ASN A CB   2  
ATOM 1809  C CG   . ASN A 1 28  ? -16.009 5.756   -5.274  1.00 0.00 ? 28  ASN A CG   2  
ATOM 1810  O OD1  . ASN A 1 28  ? -16.818 4.916   -4.917  1.00 0.00 ? 28  ASN A OD1  2  
ATOM 1811  N ND2  . ASN A 1 28  ? -16.221 7.068   -5.210  1.00 0.00 ? 28  ASN A ND2  2  
ATOM 1812  H H    . ASN A 1 28  ? -11.714 6.295   -4.720  1.00 0.00 ? 28  ASN A H    2  
ATOM 1813  H HA   . ASN A 1 28  ? -13.775 6.134   -4.002  1.00 0.00 ? 28  ASN A HA   2  
ATOM 1814  H HB2  . ASN A 1 28  ? -14.356 6.082   -6.621  1.00 0.00 ? 28  ASN A HB2  2  
ATOM 1815  H HB3  . ASN A 1 28  ? -14.698 4.392   -6.310  1.00 0.00 ? 28  ASN A HB3  2  
ATOM 1816  H HD21 . ASN A 1 28  ? -15.515 7.704   -5.520  1.00 0.00 ? 28  ASN A HD21 2  
ATOM 1817  H HD22 . ASN A 1 28  ? -17.087 7.417   -4.853  1.00 0.00 ? 28  ASN A HD22 2  
ATOM 1818  N N    . MET A 1 29  ? -12.484 3.697   -3.384  1.00 0.00 ? 29  MET A N    2  
ATOM 1819  C CA   . MET A 1 29  ? -12.322 2.404   -2.740  1.00 0.00 ? 29  MET A CA   2  
ATOM 1820  C C    . MET A 1 29  ? -11.281 2.474   -1.622  1.00 0.00 ? 29  MET A C    2  
ATOM 1821  O O    . MET A 1 29  ? -10.507 3.428   -1.548  1.00 0.00 ? 29  MET A O    2  
ATOM 1822  C CB   . MET A 1 29  ? -11.887 1.367   -3.778  1.00 0.00 ? 29  MET A CB   2  
ATOM 1823  C CG   . MET A 1 29  ? -10.363 1.321   -3.902  1.00 0.00 ? 29  MET A CG   2  
ATOM 1824  S SD   . MET A 1 29  ? -9.889  0.175   -5.185  1.00 0.00 ? 29  MET A SD   2  
ATOM 1825  C CE   . MET A 1 29  ? -9.228  -1.150  -4.188  1.00 0.00 ? 29  MET A CE   2  
ATOM 1826  H H    . MET A 1 29  ? -11.744 4.348   -3.214  1.00 0.00 ? 29  MET A H    2  
ATOM 1827  H HA   . MET A 1 29  ? -13.299 2.161   -2.322  1.00 0.00 ? 29  MET A HA   2  
ATOM 1828  H HB2  . MET A 1 29  ? -12.263 0.384   -3.495  1.00 0.00 ? 29  MET A HB2  2  
ATOM 1829  H HB3  . MET A 1 29  ? -12.327 1.610   -4.746  1.00 0.00 ? 29  MET A HB3  2  
ATOM 1830  H HG2  . MET A 1 29  ? -9.978  2.315   -4.130  1.00 0.00 ? 29  MET A HG2  2  
ATOM 1831  H HG3  . MET A 1 29  ? -9.922  1.020   -2.952  1.00 0.00 ? 29  MET A HG3  2  
ATOM 1832  H HE1  . MET A 1 29  ? -9.630  -1.080  -3.177  1.00 0.00 ? 29  MET A HE1  2  
ATOM 1833  H HE2  . MET A 1 29  ? -9.508  -2.109  -4.625  1.00 0.00 ? 29  MET A HE2  2  
ATOM 1834  H HE3  . MET A 1 29  ? -8.141  -1.071  -4.153  1.00 0.00 ? 29  MET A HE3  2  
ATOM 1835  N N    . PRO A 1 30  ? -11.295 1.426   -0.756  1.00 0.00 ? 30  PRO A N    2  
ATOM 1836  C CA   . PRO A 1 30  ? -10.361 1.360   0.355   1.00 0.00 ? 30  PRO A CA   2  
ATOM 1837  C C    . PRO A 1 30  ? -8.959  0.986   -0.128  1.00 0.00 ? 30  PRO A C    2  
ATOM 1838  O O    . PRO A 1 30  ? -8.804  0.382   -1.189  1.00 0.00 ? 30  PRO A O    2  
ATOM 1839  C CB   . PRO A 1 30  ? -10.955 0.334   1.307   1.00 0.00 ? 30  PRO A CB   2  
ATOM 1840  C CG   . PRO A 1 30  ? -11.947 -0.472  0.485   1.00 0.00 ? 30  PRO A CG   2  
ATOM 1841  C CD   . PRO A 1 30  ? -12.197 0.279   -0.812  1.00 0.00 ? 30  PRO A CD   2  
ATOM 1842  H HA   . PRO A 1 30  ? -10.272 2.257   0.787   1.00 0.00 ? 30  PRO A HA   2  
ATOM 1843  H HB2  . PRO A 1 30  ? -10.178 -0.309  1.722   1.00 0.00 ? 30  PRO A HB2  2  
ATOM 1844  H HB3  . PRO A 1 30  ? -11.448 0.821   2.148   1.00 0.00 ? 30  PRO A HB3  2  
ATOM 1845  H HG2  . PRO A 1 30  ? -11.553 -1.468  0.280   1.00 0.00 ? 30  PRO A HG2  2  
ATOM 1846  H HG3  . PRO A 1 30  ? -12.879 -0.606  1.035   1.00 0.00 ? 30  PRO A HG3  2  
ATOM 1847  H HD2  . PRO A 1 30  ? -11.988 -0.347  -1.679  1.00 0.00 ? 30  PRO A HD2  2  
ATOM 1848  H HD3  . PRO A 1 30  ? -13.237 0.597   -0.891  1.00 0.00 ? 30  PRO A HD3  2  
ATOM 1849  N N    . LEU A 1 31  ? -7.972  1.360   0.673   1.00 0.00 ? 31  LEU A N    2  
ATOM 1850  C CA   . LEU A 1 31  ? -6.588  1.072   0.340   1.00 0.00 ? 31  LEU A CA   2  
ATOM 1851  C C    . LEU A 1 31  ? -6.303  -0.409  0.599   1.00 0.00 ? 31  LEU A C    2  
ATOM 1852  O O    . LEU A 1 31  ? -6.265  -0.846  1.748   1.00 0.00 ? 31  LEU A O    2  
ATOM 1853  C CB   . LEU A 1 31  ? -5.648  2.018   1.089   1.00 0.00 ? 31  LEU A CB   2  
ATOM 1854  C CG   . LEU A 1 31  ? -5.552  3.443   0.539   1.00 0.00 ? 31  LEU A CG   2  
ATOM 1855  C CD1  . LEU A 1 31  ? -5.417  4.461   1.673   1.00 0.00 ? 31  LEU A CD1  2  
ATOM 1856  C CD2  . LEU A 1 31  ? -4.414  3.563   -0.477  1.00 0.00 ? 31  LEU A CD2  2  
ATOM 1857  H H    . LEU A 1 31  ? -8.106  1.851   1.534   1.00 0.00 ? 31  LEU A H    2  
ATOM 1858  H HA   . LEU A 1 31  ? -6.460  1.267   -0.725  1.00 0.00 ? 31  LEU A HA   2  
ATOM 1859  H HB2  . LEU A 1 31  ? -5.972  2.073   2.129   1.00 0.00 ? 31  LEU A HB2  2  
ATOM 1860  H HB3  . LEU A 1 31  ? -4.649  1.582   1.089   1.00 0.00 ? 31  LEU A HB3  2  
ATOM 1861  H HG   . LEU A 1 31  ? -6.479  3.669   0.012   1.00 0.00 ? 31  LEU A HG   2  
ATOM 1862  H HD11 . LEU A 1 31  ? -6.118  5.280   1.512   1.00 0.00 ? 31  LEU A HD11 2  
ATOM 1863  H HD12 . LEU A 1 31  ? -5.637  3.976   2.624   1.00 0.00 ? 31  LEU A HD12 2  
ATOM 1864  H HD13 . LEU A 1 31  ? -4.400  4.852   1.691   1.00 0.00 ? 31  LEU A HD13 2  
ATOM 1865  H HD21 . LEU A 1 31  ? -4.375  4.582   -0.860  1.00 0.00 ? 31  LEU A HD21 2  
ATOM 1866  H HD22 . LEU A 1 31  ? -3.468  3.320   0.006   1.00 0.00 ? 31  LEU A HD22 2  
ATOM 1867  H HD23 . LEU A 1 31  ? -4.589  2.871   -1.302  1.00 0.00 ? 31  LEU A HD23 2  
ATOM 1868  N N    . THR A 1 32  ? -6.111  -1.141  -0.489  1.00 0.00 ? 32  THR A N    2  
ATOM 1869  C CA   . THR A 1 32  ? -5.831  -2.564  -0.394  1.00 0.00 ? 32  THR A CA   2  
ATOM 1870  C C    . THR A 1 32  ? -4.434  -2.870  -0.938  1.00 0.00 ? 32  THR A C    2  
ATOM 1871  O O    . THR A 1 32  ? -3.810  -2.019  -1.570  1.00 0.00 ? 32  THR A O    2  
ATOM 1872  C CB   . THR A 1 32  ? -6.946  -3.314  -1.126  1.00 0.00 ? 32  THR A CB   2  
ATOM 1873  O OG1  . THR A 1 32  ? -7.347  -2.419  -2.159  1.00 0.00 ? 32  THR A OG1  2  
ATOM 1874  C CG2  . THR A 1 32  ? -8.202  -3.479  -0.267  1.00 0.00 ? 32  THR A CG2  2  
ATOM 1875  H H    . THR A 1 32  ? -6.144  -0.778  -1.420  1.00 0.00 ? 32  THR A H    2  
ATOM 1876  H HA   . THR A 1 32  ? -5.833  -2.845  0.659   1.00 0.00 ? 32  THR A HA   2  
ATOM 1877  H HB   . THR A 1 32  ? -6.592  -4.280  -1.488  1.00 0.00 ? 32  THR A HB   2  
ATOM 1878  H HG1  . THR A 1 32  ? -8.060  -2.841  -2.719  1.00 0.00 ? 32  THR A HG1  2  
ATOM 1879  H HG21 . THR A 1 32  ? -9.075  -3.564  -0.914  1.00 0.00 ? 32  THR A HG21 2  
ATOM 1880  H HG22 . THR A 1 32  ? -8.111  -4.379  0.340   1.00 0.00 ? 32  THR A HG22 2  
ATOM 1881  H HG23 . THR A 1 32  ? -8.314  -2.612  0.383   1.00 0.00 ? 32  THR A HG23 2  
ATOM 1882  N N    . ILE A 1 33  ? -3.985  -4.087  -0.672  1.00 0.00 ? 33  ILE A N    2  
ATOM 1883  C CA   . ILE A 1 33  ? -2.673  -4.517  -1.127  1.00 0.00 ? 33  ILE A CA   2  
ATOM 1884  C C    . ILE A 1 33  ? -2.747  -4.885  -2.610  1.00 0.00 ? 33  ILE A C    2  
ATOM 1885  O O    . ILE A 1 33  ? -3.178  -5.983  -2.959  1.00 0.00 ? 33  ILE A O    2  
ATOM 1886  C CB   . ILE A 1 33  ? -2.140  -5.643  -0.239  1.00 0.00 ? 33  ILE A CB   2  
ATOM 1887  C CG1  . ILE A 1 33  ? -1.985  -5.173  1.209   1.00 0.00 ? 33  ILE A CG1  2  
ATOM 1888  C CG2  . ILE A 1 33  ? -0.836  -6.213  -0.799  1.00 0.00 ? 33  ILE A CG2  2  
ATOM 1889  C CD1  . ILE A 1 33  ? -0.818  -4.194  1.346   1.00 0.00 ? 33  ILE A CD1  2  
ATOM 1890  H H    . ILE A 1 33  ? -4.499  -4.773  -0.157  1.00 0.00 ? 33  ILE A H    2  
ATOM 1891  H HA   . ILE A 1 33  ? -1.995  -3.670  -1.015  1.00 0.00 ? 33  ILE A HA   2  
ATOM 1892  H HB   . ILE A 1 33  ? -2.871  -6.452  -0.238  1.00 0.00 ? 33  ILE A HB   2  
ATOM 1893  H HG12 . ILE A 1 33  ? -2.907  -4.695  1.540   1.00 0.00 ? 33  ILE A HG12 2  
ATOM 1894  H HG13 . ILE A 1 33  ? -1.821  -6.033  1.859   1.00 0.00 ? 33  ILE A HG13 2  
ATOM 1895  H HG21 . ILE A 1 33  ? -0.887  -7.301  -0.803  1.00 0.00 ? 33  ILE A HG21 2  
ATOM 1896  H HG22 . ILE A 1 33  ? -0.690  -5.852  -1.818  1.00 0.00 ? 33  ILE A HG22 2  
ATOM 1897  H HG23 . ILE A 1 33  ? -0.001  -5.890  -0.177  1.00 0.00 ? 33  ILE A HG23 2  
ATOM 1898  H HD11 . ILE A 1 33  ? -1.164  -3.281  1.830   1.00 0.00 ? 33  ILE A HD11 2  
ATOM 1899  H HD12 . ILE A 1 33  ? -0.031  -4.649  1.948   1.00 0.00 ? 33  ILE A HD12 2  
ATOM 1900  H HD13 . ILE A 1 33  ? -0.426  -3.955  0.357   1.00 0.00 ? 33  ILE A HD13 2  
ATOM 1901  N N    . SER A 1 34  ? -2.321  -3.947  -3.442  1.00 0.00 ? 34  SER A N    2  
ATOM 1902  C CA   . SER A 1 34  ? -2.334  -4.159  -4.879  1.00 0.00 ? 34  SER A CA   2  
ATOM 1903  C C    . SER A 1 34  ? -1.810  -5.559  -5.206  1.00 0.00 ? 34  SER A C    2  
ATOM 1904  O O    . SER A 1 34  ? -2.497  -6.347  -5.855  1.00 0.00 ? 34  SER A O    2  
ATOM 1905  C CB   . SER A 1 34  ? -1.500  -3.099  -5.601  1.00 0.00 ? 34  SER A CB   2  
ATOM 1906  O OG   . SER A 1 34  ? -0.536  -3.681  -6.474  1.00 0.00 ? 34  SER A OG   2  
ATOM 1907  H H    . SER A 1 34  ? -1.973  -3.056  -3.150  1.00 0.00 ? 34  SER A H    2  
ATOM 1908  H HA   . SER A 1 34  ? -3.378  -4.063  -5.176  1.00 0.00 ? 34  SER A HA   2  
ATOM 1909  H HB2  . SER A 1 34  ? -2.159  -2.446  -6.172  1.00 0.00 ? 34  SER A HB2  2  
ATOM 1910  H HB3  . SER A 1 34  ? -0.992  -2.475  -4.865  1.00 0.00 ? 34  SER A HB3  2  
ATOM 1911  H HG   . SER A 1 34  ? -0.988  -4.293  -7.123  1.00 0.00 ? 34  SER A HG   2  
ATOM 1912  N N    . SER A 1 35  ? -0.599  -5.826  -4.742  1.00 0.00 ? 35  SER A N    2  
ATOM 1913  C CA   . SER A 1 35  ? 0.025   -7.117  -4.976  1.00 0.00 ? 35  SER A CA   2  
ATOM 1914  C C    . SER A 1 35  ? 1.130   -7.360  -3.947  1.00 0.00 ? 35  SER A C    2  
ATOM 1915  O O    . SER A 1 35  ? 1.411   -6.496  -3.117  1.00 0.00 ? 35  SER A O    2  
ATOM 1916  C CB   . SER A 1 35  ? 0.593   -7.205  -6.395  1.00 0.00 ? 35  SER A CB   2  
ATOM 1917  O OG   . SER A 1 35  ? -0.088  -8.178  -7.183  1.00 0.00 ? 35  SER A OG   2  
ATOM 1918  H H    . SER A 1 35  ? -0.047  -5.180  -4.215  1.00 0.00 ? 35  SER A H    2  
ATOM 1919  H HA   . SER A 1 35  ? -0.774  -7.850  -4.860  1.00 0.00 ? 35  SER A HA   2  
ATOM 1920  H HB2  . SER A 1 35  ? 0.516   -6.231  -6.877  1.00 0.00 ? 35  SER A HB2  2  
ATOM 1921  H HB3  . SER A 1 35  ? 1.653   -7.455  -6.346  1.00 0.00 ? 35  SER A HB3  2  
ATOM 1922  H HG   . SER A 1 35  ? -0.252  -9.003  -6.641  1.00 0.00 ? 35  SER A HG   2  
ATOM 1923  N N    . LEU A 1 36  ? 1.727   -8.540  -4.033  1.00 0.00 ? 36  LEU A N    2  
ATOM 1924  C CA   . LEU A 1 36  ? 2.795   -8.907  -3.118  1.00 0.00 ? 36  LEU A CA   2  
ATOM 1925  C C    . LEU A 1 36  ? 4.057   -9.232  -3.920  1.00 0.00 ? 36  LEU A C    2  
ATOM 1926  O O    . LEU A 1 36  ? 4.001   -9.382  -5.139  1.00 0.00 ? 36  LEU A O    2  
ATOM 1927  C CB   . LEU A 1 36  ? 2.344   -10.039 -2.194  1.00 0.00 ? 36  LEU A CB   2  
ATOM 1928  C CG   . LEU A 1 36  ? 2.253   -9.695  -0.706  1.00 0.00 ? 36  LEU A CG   2  
ATOM 1929  C CD1  . LEU A 1 36  ? 3.616   -9.839  -0.026  1.00 0.00 ? 36  LEU A CD1  2  
ATOM 1930  C CD2  . LEU A 1 36  ? 1.654   -8.302  -0.501  1.00 0.00 ? 36  LEU A CD2  2  
ATOM 1931  H H    . LEU A 1 36  ? 1.492   -9.237  -4.710  1.00 0.00 ? 36  LEU A H    2  
ATOM 1932  H HA   . LEU A 1 36  ? 2.999   -8.040  -2.490  1.00 0.00 ? 36  LEU A HA   2  
ATOM 1933  H HB2  . LEU A 1 36  ? 1.365   -10.385 -2.527  1.00 0.00 ? 36  LEU A HB2  2  
ATOM 1934  H HB3  . LEU A 1 36  ? 3.034   -10.875 -2.312  1.00 0.00 ? 36  LEU A HB3  2  
ATOM 1935  H HG   . LEU A 1 36  ? 1.579   -10.408 -0.231  1.00 0.00 ? 36  LEU A HG   2  
ATOM 1936  H HD11 . LEU A 1 36  ? 4.314   -10.320 -0.710  1.00 0.00 ? 36  LEU A HD11 2  
ATOM 1937  H HD12 . LEU A 1 36  ? 3.992   -8.852  0.244   1.00 0.00 ? 36  LEU A HD12 2  
ATOM 1938  H HD13 . LEU A 1 36  ? 3.511   -10.446 0.873   1.00 0.00 ? 36  LEU A HD13 2  
ATOM 1939  H HD21 . LEU A 1 36  ? 2.450   -7.558  -0.519  1.00 0.00 ? 36  LEU A HD21 2  
ATOM 1940  H HD22 . LEU A 1 36  ? 0.942   -8.092  -1.299  1.00 0.00 ? 36  LEU A HD22 2  
ATOM 1941  H HD23 . LEU A 1 36  ? 1.143   -8.265  0.461   1.00 0.00 ? 36  LEU A HD23 2  
ATOM 1942  N N    . LYS A 1 37  ? 5.166   -9.333  -3.202  1.00 0.00 ? 37  LYS A N    2  
ATOM 1943  C CA   . LYS A 1 37  ? 6.440   -9.639  -3.831  1.00 0.00 ? 37  LYS A CA   2  
ATOM 1944  C C    . LYS A 1 37  ? 6.945   -10.989 -3.319  1.00 0.00 ? 37  LYS A C    2  
ATOM 1945  O O    . LYS A 1 37  ? 6.854   -11.279 -2.127  1.00 0.00 ? 37  LYS A O    2  
ATOM 1946  C CB   . LYS A 1 37  ? 7.430   -8.492  -3.620  1.00 0.00 ? 37  LYS A CB   2  
ATOM 1947  C CG   . LYS A 1 37  ? 8.810   -8.849  -4.176  1.00 0.00 ? 37  LYS A CG   2  
ATOM 1948  C CD   . LYS A 1 37  ? 9.619   -7.589  -4.489  1.00 0.00 ? 37  LYS A CD   2  
ATOM 1949  C CE   . LYS A 1 37  ? 11.117  -7.841  -4.311  1.00 0.00 ? 37  LYS A CE   2  
ATOM 1950  N NZ   . LYS A 1 37  ? 11.779  -7.979  -5.627  1.00 0.00 ? 37  LYS A NZ   2  
ATOM 1951  H H    . LYS A 1 37  ? 5.203   -9.211  -2.210  1.00 0.00 ? 37  LYS A H    2  
ATOM 1952  H HA   . LYS A 1 37  ? 6.263   -9.719  -4.903  1.00 0.00 ? 37  LYS A HA   2  
ATOM 1953  H HB2  . LYS A 1 37  ? 7.059   -7.591  -4.109  1.00 0.00 ? 37  LYS A HB2  2  
ATOM 1954  H HB3  . LYS A 1 37  ? 7.510   -8.266  -2.556  1.00 0.00 ? 37  LYS A HB3  2  
ATOM 1955  H HG2  . LYS A 1 37  ? 9.349   -9.462  -3.454  1.00 0.00 ? 37  LYS A HG2  2  
ATOM 1956  H HG3  . LYS A 1 37  ? 8.697   -9.447  -5.080  1.00 0.00 ? 37  LYS A HG3  2  
ATOM 1957  H HD2  . LYS A 1 37  ? 9.419   -7.269  -5.511  1.00 0.00 ? 37  LYS A HD2  2  
ATOM 1958  H HD3  . LYS A 1 37  ? 9.302   -6.778  -3.833  1.00 0.00 ? 37  LYS A HD3  2  
ATOM 1959  H HE2  . LYS A 1 37  ? 11.567  -7.018  -3.755  1.00 0.00 ? 37  LYS A HE2  2  
ATOM 1960  H HE3  . LYS A 1 37  ? 11.272  -8.745  -3.722  1.00 0.00 ? 37  LYS A HE3  2  
ATOM 1961  H HZ1  . LYS A 1 37  ? 12.175  -8.894  -5.707  1.00 0.00 ? 37  LYS A HZ1  2  
ATOM 1962  H HZ2  . LYS A 1 37  ? 11.107  -7.842  -6.355  1.00 0.00 ? 37  LYS A HZ2  2  
ATOM 1963  H HZ3  . LYS A 1 37  ? 12.503  -7.294  -5.709  1.00 0.00 ? 37  LYS A HZ3  2  
ATOM 1964  N N    . ASP A 1 38  ? 7.466   -11.780 -4.246  1.00 0.00 ? 38  ASP A N    2  
ATOM 1965  C CA   . ASP A 1 38  ? 7.986   -13.093 -3.904  1.00 0.00 ? 38  ASP A CA   2  
ATOM 1966  C C    . ASP A 1 38  ? 8.941   -12.965 -2.715  1.00 0.00 ? 38  ASP A C    2  
ATOM 1967  O O    . ASP A 1 38  ? 9.884   -12.176 -2.754  1.00 0.00 ? 38  ASP A O    2  
ATOM 1968  C CB   . ASP A 1 38  ? 8.766   -13.698 -5.073  1.00 0.00 ? 38  ASP A CB   2  
ATOM 1969  C CG   . ASP A 1 38  ? 8.258   -15.059 -5.554  1.00 0.00 ? 38  ASP A CG   2  
ATOM 1970  O OD1  . ASP A 1 38  ? 8.053   -15.929 -4.680  1.00 0.00 ? 38  ASP A OD1  2  
ATOM 1971  O OD2  . ASP A 1 38  ? 8.087   -15.199 -6.784  1.00 0.00 ? 38  ASP A OD2  2  
ATOM 1972  H H    . ASP A 1 38  ? 7.536   -11.536 -5.214  1.00 0.00 ? 38  ASP A H    2  
ATOM 1973  H HA   . ASP A 1 38  ? 7.109   -13.696 -3.672  1.00 0.00 ? 38  ASP A HA   2  
ATOM 1974  H HB2  . ASP A 1 38  ? 8.737   -13.000 -5.910  1.00 0.00 ? 38  ASP A HB2  2  
ATOM 1975  H HB3  . ASP A 1 38  ? 9.811   -13.800 -4.780  1.00 0.00 ? 38  ASP A HB3  2  
ATOM 1976  N N    . GLY A 1 39  ? 8.662   -13.752 -1.686  1.00 0.00 ? 39  GLY A N    2  
ATOM 1977  C CA   . GLY A 1 39  ? 9.484   -13.736 -0.488  1.00 0.00 ? 39  GLY A CA   2  
ATOM 1978  C C    . GLY A 1 39  ? 9.860   -12.305 -0.100  1.00 0.00 ? 39  GLY A C    2  
ATOM 1979  O O    . GLY A 1 39  ? 11.041  -11.980 0.017   1.00 0.00 ? 39  GLY A O    2  
ATOM 1980  H H    . GLY A 1 39  ? 7.893   -14.390 -1.663  1.00 0.00 ? 39  GLY A H    2  
ATOM 1981  H HA2  . GLY A 1 39  ? 8.945   -14.210 0.333   1.00 0.00 ? 39  GLY A HA2  2  
ATOM 1982  H HA3  . GLY A 1 39  ? 10.388  -14.321 -0.656  1.00 0.00 ? 39  GLY A HA3  2  
ATOM 1983  N N    . GLY A 1 40  ? 8.835   -11.488 0.089   1.00 0.00 ? 40  GLY A N    2  
ATOM 1984  C CA   . GLY A 1 40  ? 9.043   -10.099 0.462   1.00 0.00 ? 40  GLY A CA   2  
ATOM 1985  C C    . GLY A 1 40  ? 8.698   -9.869  1.935   1.00 0.00 ? 40  GLY A C    2  
ATOM 1986  O O    . GLY A 1 40  ? 8.000   -10.677 2.546   1.00 0.00 ? 40  GLY A O    2  
ATOM 1987  H H    . GLY A 1 40  ? 7.877   -11.760 -0.008  1.00 0.00 ? 40  GLY A H    2  
ATOM 1988  H HA2  . GLY A 1 40  ? 10.081  -9.822  0.281   1.00 0.00 ? 40  GLY A HA2  2  
ATOM 1989  H HA3  . GLY A 1 40  ? 8.427   -9.454  -0.165  1.00 0.00 ? 40  GLY A HA3  2  
ATOM 1990  N N    . LYS A 1 41  ? 9.203   -8.763  2.462   1.00 0.00 ? 41  LYS A N    2  
ATOM 1991  C CA   . LYS A 1 41  ? 8.956   -8.417  3.851   1.00 0.00 ? 41  LYS A CA   2  
ATOM 1992  C C    . LYS A 1 41  ? 7.455   -8.497  4.134   1.00 0.00 ? 41  LYS A C    2  
ATOM 1993  O O    . LYS A 1 41  ? 7.037   -9.107  5.117   1.00 0.00 ? 41  LYS A O    2  
ATOM 1994  C CB   . LYS A 1 41  ? 9.572   -7.056  4.181   1.00 0.00 ? 41  LYS A CB   2  
ATOM 1995  C CG   . LYS A 1 41  ? 11.099  -7.109  4.095   1.00 0.00 ? 41  LYS A CG   2  
ATOM 1996  C CD   . LYS A 1 41  ? 11.602  -6.405  2.832   1.00 0.00 ? 41  LYS A CD   2  
ATOM 1997  C CE   . LYS A 1 41  ? 12.458  -7.347  1.983   1.00 0.00 ? 41  LYS A CE   2  
ATOM 1998  N NZ   . LYS A 1 41  ? 12.502  -6.883  0.579   1.00 0.00 ? 41  LYS A NZ   2  
ATOM 1999  H H    . LYS A 1 41  ? 9.769   -8.112  1.958   1.00 0.00 ? 41  LYS A H    2  
ATOM 2000  H HA   . LYS A 1 41  ? 9.464   -9.158  4.468   1.00 0.00 ? 41  LYS A HA   2  
ATOM 2001  H HB2  . LYS A 1 41  ? 9.192   -6.302  3.491   1.00 0.00 ? 41  LYS A HB2  2  
ATOM 2002  H HB3  . LYS A 1 41  ? 9.272   -6.750  5.183   1.00 0.00 ? 41  LYS A HB3  2  
ATOM 2003  H HG2  . LYS A 1 41  ? 11.534  -6.637  4.976   1.00 0.00 ? 41  LYS A HG2  2  
ATOM 2004  H HG3  . LYS A 1 41  ? 11.431  -8.147  4.093   1.00 0.00 ? 41  LYS A HG3  2  
ATOM 2005  H HD2  . LYS A 1 41  ? 10.753  -6.052  2.246   1.00 0.00 ? 41  LYS A HD2  2  
ATOM 2006  H HD3  . LYS A 1 41  ? 12.185  -5.527  3.109   1.00 0.00 ? 41  LYS A HD3  2  
ATOM 2007  H HE2  . LYS A 1 41  ? 13.468  -7.394  2.389   1.00 0.00 ? 41  LYS A HE2  2  
ATOM 2008  H HE3  . LYS A 1 41  ? 12.050  -8.357  2.026   1.00 0.00 ? 41  LYS A HE3  2  
ATOM 2009  H HZ1  . LYS A 1 41  ? 12.021  -6.009  0.501   1.00 0.00 ? 41  LYS A HZ1  2  
ATOM 2010  H HZ2  . LYS A 1 41  ? 13.454  -6.765  0.297   1.00 0.00 ? 41  LYS A HZ2  2  
ATOM 2011  H HZ3  . LYS A 1 41  ? 12.061  -7.560  -0.010  1.00 0.00 ? 41  LYS A HZ3  2  
ATOM 2012  N N    . ALA A 1 42  ? 6.685   -7.872  3.255   1.00 0.00 ? 42  ALA A N    2  
ATOM 2013  C CA   . ALA A 1 42  ? 5.239   -7.865  3.398   1.00 0.00 ? 42  ALA A CA   2  
ATOM 2014  C C    . ALA A 1 42  ? 4.749   -9.293  3.644   1.00 0.00 ? 42  ALA A C    2  
ATOM 2015  O O    . ALA A 1 42  ? 4.228   -9.598  4.716   1.00 0.00 ? 42  ALA A O    2  
ATOM 2016  C CB   . ALA A 1 42  ? 4.606   -7.237  2.155   1.00 0.00 ? 42  ALA A CB   2  
ATOM 2017  H H    . ALA A 1 42  ? 7.034   -7.377  2.459   1.00 0.00 ? 42  ALA A H    2  
ATOM 2018  H HA   . ALA A 1 42  ? 4.995   -7.251  4.265   1.00 0.00 ? 42  ALA A HA   2  
ATOM 2019  H HB1  . ALA A 1 42  ? 3.677   -7.755  1.919   1.00 0.00 ? 42  ALA A HB1  2  
ATOM 2020  H HB2  . ALA A 1 42  ? 4.397   -6.184  2.346   1.00 0.00 ? 42  ALA A HB2  2  
ATOM 2021  H HB3  . ALA A 1 42  ? 5.294   -7.323  1.314   1.00 0.00 ? 42  ALA A HB3  2  
ATOM 2022  N N    . SER A 1 43  ? 4.932   -10.130 2.634   1.00 0.00 ? 43  SER A N    2  
ATOM 2023  C CA   . SER A 1 43  ? 4.515   -11.518 2.727   1.00 0.00 ? 43  SER A CA   2  
ATOM 2024  C C    . SER A 1 43  ? 4.982   -12.117 4.055   1.00 0.00 ? 43  SER A C    2  
ATOM 2025  O O    . SER A 1 43  ? 4.207   -12.769 4.753   1.00 0.00 ? 43  SER A O    2  
ATOM 2026  C CB   . SER A 1 43  ? 5.059   -12.337 1.555   1.00 0.00 ? 43  SER A CB   2  
ATOM 2027  O OG   . SER A 1 43  ? 6.405   -12.751 1.772   1.00 0.00 ? 43  SER A OG   2  
ATOM 2028  H H    . SER A 1 43  ? 5.357   -9.873  1.765   1.00 0.00 ? 43  SER A H    2  
ATOM 2029  H HA   . SER A 1 43  ? 3.426   -11.496 2.679   1.00 0.00 ? 43  SER A HA   2  
ATOM 2030  H HB2  . SER A 1 43  ? 4.430   -13.214 1.402   1.00 0.00 ? 43  SER A HB2  2  
ATOM 2031  H HB3  . SER A 1 43  ? 5.005   -11.743 0.642   1.00 0.00 ? 43  SER A HB3  2  
ATOM 2032  H HG   . SER A 1 43  ? 6.986   -11.955 1.937   1.00 0.00 ? 43  SER A HG   2  
ATOM 2033  N N    . GLN A 1 44  ? 6.247   -11.875 4.364   1.00 0.00 ? 44  GLN A N    2  
ATOM 2034  C CA   . GLN A 1 44  ? 6.827   -12.382 5.596   1.00 0.00 ? 44  GLN A CA   2  
ATOM 2035  C C    . GLN A 1 44  ? 6.001   -11.923 6.800   1.00 0.00 ? 44  GLN A C    2  
ATOM 2036  O O    . GLN A 1 44  ? 5.979   -12.591 7.833   1.00 0.00 ? 44  GLN A O    2  
ATOM 2037  C CB   . GLN A 1 44  ? 8.287   -11.947 5.735   1.00 0.00 ? 44  GLN A CB   2  
ATOM 2038  C CG   . GLN A 1 44  ? 9.212   -12.871 4.940   1.00 0.00 ? 44  GLN A CG   2  
ATOM 2039  C CD   . GLN A 1 44  ? 10.671  -12.424 5.064   1.00 0.00 ? 44  GLN A CD   2  
ATOM 2040  O OE1  . GLN A 1 44  ? 11.351  -12.700 6.039   1.00 0.00 ? 44  GLN A OE1  2  
ATOM 2041  N NE2  . GLN A 1 44  ? 11.111  -11.721 4.025   1.00 0.00 ? 44  GLN A NE2  2  
ATOM 2042  H H    . GLN A 1 44  ? 6.871   -11.344 3.791   1.00 0.00 ? 44  GLN A H    2  
ATOM 2043  H HA   . GLN A 1 44  ? 6.785   -13.468 5.511   1.00 0.00 ? 44  GLN A HA   2  
ATOM 2044  H HB2  . GLN A 1 44  ? 8.400   -10.922 5.382   1.00 0.00 ? 44  GLN A HB2  2  
ATOM 2045  H HB3  . GLN A 1 44  ? 8.574   -11.955 6.786   1.00 0.00 ? 44  GLN A HB3  2  
ATOM 2046  H HG2  . GLN A 1 44  ? 9.109   -13.894 5.302   1.00 0.00 ? 44  GLN A HG2  2  
ATOM 2047  H HG3  . GLN A 1 44  ? 8.917   -12.872 3.891   1.00 0.00 ? 44  GLN A HG3  2  
ATOM 2048  H HE21 . GLN A 1 44  ? 10.501  -11.530 3.256   1.00 0.00 ? 44  GLN A HE21 2  
ATOM 2049  H HE22 . GLN A 1 44  ? 12.053  -11.384 4.012   1.00 0.00 ? 44  GLN A HE22 2  
ATOM 2050  N N    . ALA A 1 45  ? 5.342   -10.787 6.626   1.00 0.00 ? 45  ALA A N    2  
ATOM 2051  C CA   . ALA A 1 45  ? 4.517   -10.231 7.685   1.00 0.00 ? 45  ALA A CA   2  
ATOM 2052  C C    . ALA A 1 45  ? 3.109   -10.822 7.592   1.00 0.00 ? 45  ALA A C    2  
ATOM 2053  O O    . ALA A 1 45  ? 2.188   -10.348 8.255   1.00 0.00 ? 45  ALA A O    2  
ATOM 2054  C CB   . ALA A 1 45  ? 4.517   -8.705  7.585   1.00 0.00 ? 45  ALA A CB   2  
ATOM 2055  H H    . ALA A 1 45  ? 5.365   -10.251 5.783   1.00 0.00 ? 45  ALA A H    2  
ATOM 2056  H HA   . ALA A 1 45  ? 4.961   -10.520 8.638   1.00 0.00 ? 45  ALA A HA   2  
ATOM 2057  H HB1  . ALA A 1 45  ? 4.220   -8.277  8.542   1.00 0.00 ? 45  ALA A HB1  2  
ATOM 2058  H HB2  . ALA A 1 45  ? 5.518   -8.358  7.327   1.00 0.00 ? 45  ALA A HB2  2  
ATOM 2059  H HB3  . ALA A 1 45  ? 3.814   -8.391  6.813   1.00 0.00 ? 45  ALA A HB3  2  
ATOM 2060  N N    . HIS A 1 46  ? 2.985   -11.848 6.762   1.00 0.00 ? 46  HIS A N    2  
ATOM 2061  C CA   . HIS A 1 46  ? 1.705   -12.508 6.574   1.00 0.00 ? 46  HIS A CA   2  
ATOM 2062  C C    . HIS A 1 46  ? 0.707   -11.525 5.958   1.00 0.00 ? 46  HIS A C    2  
ATOM 2063  O O    . HIS A 1 46  ? -0.449  -11.465 6.376   1.00 0.00 ? 46  HIS A O    2  
ATOM 2064  C CB   . HIS A 1 46  ? 1.207   -13.114 7.887   1.00 0.00 ? 46  HIS A CB   2  
ATOM 2065  C CG   . HIS A 1 46  ? 1.879   -14.415 8.257   1.00 0.00 ? 46  HIS A CG   2  
ATOM 2066  N ND1  . HIS A 1 46  ? 1.223   -15.633 8.224   1.00 0.00 ? 46  HIS A ND1  2  
ATOM 2067  C CD2  . HIS A 1 46  ? 3.154   -14.675 8.666   1.00 0.00 ? 46  HIS A CD2  2  
ATOM 2068  C CE1  . HIS A 1 46  ? 2.074   -16.577 8.599   1.00 0.00 ? 46  HIS A CE1  2  
ATOM 2069  N NE2  . HIS A 1 46  ? 3.270   -15.981 8.873   1.00 0.00 ? 46  HIS A NE2  2  
ATOM 2070  H H    . HIS A 1 46  ? 3.739   -12.227 6.226   1.00 0.00 ? 46  HIS A H    2  
ATOM 2071  H HA   . HIS A 1 46  ? 1.875   -13.326 5.873   1.00 0.00 ? 46  HIS A HA   2  
ATOM 2072  H HB2  . HIS A 1 46  ? 1.365   -12.394 8.691   1.00 0.00 ? 46  HIS A HB2  2  
ATOM 2073  H HB3  . HIS A 1 46  ? 0.132   -13.280 7.815   1.00 0.00 ? 46  HIS A HB3  2  
ATOM 2074  H HD1  . HIS A 1 46  ? 0.269   -15.777 7.962   1.00 0.00 ? 46  HIS A HD1  2  
ATOM 2075  H HD2  . HIS A 1 46  ? 3.944   -13.935 8.799   1.00 0.00 ? 46  HIS A HD2  2  
ATOM 2076  H HE1  . HIS A 1 46  ? 1.857   -17.642 8.676   1.00 0.00 ? 46  HIS A HE1  2  
ATOM 2077  N N    . VAL A 1 47  ? 1.189   -10.779 4.976   1.00 0.00 ? 47  VAL A N    2  
ATOM 2078  C CA   . VAL A 1 47  ? 0.353   -9.802  4.299   1.00 0.00 ? 47  VAL A CA   2  
ATOM 2079  C C    . VAL A 1 47  ? -0.206  -10.417 3.015   1.00 0.00 ? 47  VAL A C    2  
ATOM 2080  O O    . VAL A 1 47  ? 0.544   -10.715 2.087   1.00 0.00 ? 47  VAL A O    2  
ATOM 2081  C CB   . VAL A 1 47  ? 1.147   -8.518  4.049   1.00 0.00 ? 47  VAL A CB   2  
ATOM 2082  C CG1  . VAL A 1 47  ? 0.279   -7.460  3.365   1.00 0.00 ? 47  VAL A CG1  2  
ATOM 2083  C CG2  . VAL A 1 47  ? 1.742   -7.979  5.352   1.00 0.00 ? 47  VAL A CG2  2  
ATOM 2084  H H    . VAL A 1 47  ? 2.130   -10.834 4.642   1.00 0.00 ? 47  VAL A H    2  
ATOM 2085  H HA   . VAL A 1 47  ? -0.476  -9.562  4.964   1.00 0.00 ? 47  VAL A HA   2  
ATOM 2086  H HB   . VAL A 1 47  ? 1.972   -8.759  3.379   1.00 0.00 ? 47  VAL A HB   2  
ATOM 2087  H HG11 . VAL A 1 47  ? 0.598   -7.343  2.329   1.00 0.00 ? 47  VAL A HG11 2  
ATOM 2088  H HG12 . VAL A 1 47  ? -0.764  -7.775  3.389   1.00 0.00 ? 47  VAL A HG12 2  
ATOM 2089  H HG13 . VAL A 1 47  ? 0.384   -6.510  3.887   1.00 0.00 ? 47  VAL A HG13 2  
ATOM 2090  H HG21 . VAL A 1 47  ? 1.909   -8.804  6.044   1.00 0.00 ? 47  VAL A HG21 2  
ATOM 2091  H HG22 . VAL A 1 47  ? 2.690   -7.484  5.141   1.00 0.00 ? 47  VAL A HG22 2  
ATOM 2092  H HG23 . VAL A 1 47  ? 1.051   -7.264  5.799   1.00 0.00 ? 47  VAL A HG23 2  
ATOM 2093  N N    . ARG A 1 48  ? -1.520  -10.590 3.003   1.00 0.00 ? 48  ARG A N    2  
ATOM 2094  C CA   . ARG A 1 48  ? -2.188  -11.165 1.848   1.00 0.00 ? 48  ARG A CA   2  
ATOM 2095  C C    . ARG A 1 48  ? -2.871  -10.068 1.029   1.00 0.00 ? 48  ARG A C    2  
ATOM 2096  O O    . ARG A 1 48  ? -3.056  -8.952  1.512   1.00 0.00 ? 48  ARG A O    2  
ATOM 2097  C CB   . ARG A 1 48  ? -3.233  -12.199 2.275   1.00 0.00 ? 48  ARG A CB   2  
ATOM 2098  C CG   . ARG A 1 48  ? -2.616  -13.595 2.369   1.00 0.00 ? 48  ARG A CG   2  
ATOM 2099  C CD   . ARG A 1 48  ? -2.968  -14.262 3.700   1.00 0.00 ? 48  ARG A CD   2  
ATOM 2100  N NE   . ARG A 1 48  ? -2.530  -13.407 4.826   1.00 0.00 ? 48  ARG A NE   2  
ATOM 2101  C CZ   . ARG A 1 48  ? -2.915  -13.583 6.097   1.00 0.00 ? 48  ARG A CZ   2  
ATOM 2102  N NH1  . ARG A 1 48  ? -3.747  -14.584 6.412   1.00 0.00 ? 48  ARG A NH1  2  
ATOM 2103  N NH2  . ARG A 1 48  ? -2.467  -12.758 7.053   1.00 0.00 ? 48  ARG A NH2  2  
ATOM 2104  H H    . ARG A 1 48  ? -2.123  -10.345 3.762   1.00 0.00 ? 48  ARG A H    2  
ATOM 2105  H HA   . ARG A 1 48  ? -1.394  -11.644 1.276   1.00 0.00 ? 48  ARG A HA   2  
ATOM 2106  H HB2  . ARG A 1 48  ? -3.655  -11.918 3.240   1.00 0.00 ? 48  ARG A HB2  2  
ATOM 2107  H HB3  . ARG A 1 48  ? -4.054  -12.208 1.558   1.00 0.00 ? 48  ARG A HB3  2  
ATOM 2108  H HG2  . ARG A 1 48  ? -2.973  -14.211 1.544   1.00 0.00 ? 48  ARG A HG2  2  
ATOM 2109  H HG3  . ARG A 1 48  ? -1.533  -13.526 2.268   1.00 0.00 ? 48  ARG A HG3  2  
ATOM 2110  H HD2  . ARG A 1 48  ? -4.043  -14.431 3.758   1.00 0.00 ? 48  ARG A HD2  2  
ATOM 2111  H HD3  . ARG A 1 48  ? -2.488  -15.238 3.766   1.00 0.00 ? 48  ARG A HD3  2  
ATOM 2112  H HE   . ARG A 1 48  ? -1.908  -12.650 4.625   1.00 0.00 ? 48  ARG A HE   2  
ATOM 2113  H HH11 . ARG A 1 48  ? -4.082  -15.200 5.699   1.00 0.00 ? 48  ARG A HH11 2  
ATOM 2114  H HH12 . ARG A 1 48  ? -4.034  -14.716 7.361   1.00 0.00 ? 48  ARG A HH12 2  
ATOM 2115  H HH21 . ARG A 1 48  ? -1.845  -12.011 6.818   1.00 0.00 ? 48  ARG A HH21 2  
ATOM 2116  H HH22 . ARG A 1 48  ? -2.754  -12.890 8.002   1.00 0.00 ? 48  ARG A HH22 2  
ATOM 2117  N N    . ILE A 1 49  ? -3.228  -10.424 -0.196  1.00 0.00 ? 49  ILE A N    2  
ATOM 2118  C CA   . ILE A 1 49  ? -3.887  -9.483  -1.086  1.00 0.00 ? 49  ILE A CA   2  
ATOM 2119  C C    . ILE A 1 49  ? -5.309  -9.224  -0.586  1.00 0.00 ? 49  ILE A C    2  
ATOM 2120  O O    . ILE A 1 49  ? -6.027  -10.159 -0.235  1.00 0.00 ? 49  ILE A O    2  
ATOM 2121  C CB   . ILE A 1 49  ? -3.824  -9.980  -2.532  1.00 0.00 ? 49  ILE A CB   2  
ATOM 2122  C CG1  . ILE A 1 49  ? -2.393  -9.925  -3.069  1.00 0.00 ? 49  ILE A CG1  2  
ATOM 2123  C CG2  . ILE A 1 49  ? -4.800  -9.206  -3.421  1.00 0.00 ? 49  ILE A CG2  2  
ATOM 2124  C CD1  . ILE A 1 49  ? -2.383  -9.852  -4.597  1.00 0.00 ? 49  ILE A CD1  2  
ATOM 2125  H H    . ILE A 1 49  ? -3.075  -11.334 -0.581  1.00 0.00 ? 49  ILE A H    2  
ATOM 2126  H HA   . ILE A 1 49  ? -3.330  -8.547  -1.043  1.00 0.00 ? 49  ILE A HA   2  
ATOM 2127  H HB   . ILE A 1 49  ? -4.135  -11.025 -2.548  1.00 0.00 ? 49  ILE A HB   2  
ATOM 2128  H HG12 . ILE A 1 49  ? -1.879  -9.057  -2.657  1.00 0.00 ? 49  ILE A HG12 2  
ATOM 2129  H HG13 . ILE A 1 49  ? -1.843  -10.807 -2.740  1.00 0.00 ? 49  ILE A HG13 2  
ATOM 2130  H HG21 . ILE A 1 49  ? -4.513  -8.155  -3.446  1.00 0.00 ? 49  ILE A HG21 2  
ATOM 2131  H HG22 . ILE A 1 49  ? -4.773  -9.614  -4.431  1.00 0.00 ? 49  ILE A HG22 2  
ATOM 2132  H HG23 . ILE A 1 49  ? -5.809  -9.298  -3.018  1.00 0.00 ? 49  ILE A HG23 2  
ATOM 2133  H HD11 . ILE A 1 49  ? -3.028  -10.632 -5.003  1.00 0.00 ? 49  ILE A HD11 2  
ATOM 2134  H HD12 . ILE A 1 49  ? -2.749  -8.876  -4.917  1.00 0.00 ? 49  ILE A HD12 2  
ATOM 2135  H HD13 . ILE A 1 49  ? -1.366  -9.997  -4.962  1.00 0.00 ? 49  ILE A HD13 2  
ATOM 2136  N N    . GLY A 1 50  ? -5.674  -7.950  -0.570  1.00 0.00 ? 50  GLY A N    2  
ATOM 2137  C CA   . GLY A 1 50  ? -6.998  -7.557  -0.118  1.00 0.00 ? 50  GLY A CA   2  
ATOM 2138  C C    . GLY A 1 50  ? -6.929  -6.864  1.244   1.00 0.00 ? 50  GLY A C    2  
ATOM 2139  O O    . GLY A 1 50  ? -7.874  -6.188  1.649   1.00 0.00 ? 50  GLY A O    2  
ATOM 2140  H H    . GLY A 1 50  ? -5.084  -7.196  -0.857  1.00 0.00 ? 50  GLY A H    2  
ATOM 2141  H HA2  . GLY A 1 50  ? -7.451  -6.887  -0.849  1.00 0.00 ? 50  GLY A HA2  2  
ATOM 2142  H HA3  . GLY A 1 50  ? -7.639  -8.436  -0.051  1.00 0.00 ? 50  GLY A HA3  2  
ATOM 2143  N N    . ASP A 1 51  ? -5.802  -7.055  1.913   1.00 0.00 ? 51  ASP A N    2  
ATOM 2144  C CA   . ASP A 1 51  ? -5.597  -6.456  3.221   1.00 0.00 ? 51  ASP A CA   2  
ATOM 2145  C C    . ASP A 1 51  ? -5.825  -4.946  3.128   1.00 0.00 ? 51  ASP A C    2  
ATOM 2146  O O    . ASP A 1 51  ? -5.238  -4.278  2.279   1.00 0.00 ? 51  ASP A O    2  
ATOM 2147  C CB   . ASP A 1 51  ? -4.168  -6.689  3.716   1.00 0.00 ? 51  ASP A CB   2  
ATOM 2148  C CG   . ASP A 1 51  ? -3.834  -8.139  4.069   1.00 0.00 ? 51  ASP A CG   2  
ATOM 2149  O OD1  . ASP A 1 51  ? -4.744  -8.984  3.921   1.00 0.00 ? 51  ASP A OD1  2  
ATOM 2150  O OD2  . ASP A 1 51  ? -2.676  -8.371  4.480   1.00 0.00 ? 51  ASP A OD2  2  
ATOM 2151  H H    . ASP A 1 51  ? -5.038  -7.606  1.576   1.00 0.00 ? 51  ASP A H    2  
ATOM 2152  H HA   . ASP A 1 51  ? -6.317  -6.947  3.876   1.00 0.00 ? 51  ASP A HA   2  
ATOM 2153  H HB2  . ASP A 1 51  ? -3.474  -6.349  2.948   1.00 0.00 ? 51  ASP A HB2  2  
ATOM 2154  H HB3  . ASP A 1 51  ? -3.999  -6.068  4.596   1.00 0.00 ? 51  ASP A HB3  2  
ATOM 2155  N N    . VAL A 1 52  ? -6.680  -4.454  4.013   1.00 0.00 ? 52  VAL A N    2  
ATOM 2156  C CA   . VAL A 1 52  ? -6.993  -3.035  4.041   1.00 0.00 ? 52  VAL A CA   2  
ATOM 2157  C C    . VAL A 1 52  ? -6.094  -2.339  5.064   1.00 0.00 ? 52  VAL A C    2  
ATOM 2158  O O    . VAL A 1 52  ? -5.943  -2.814  6.189   1.00 0.00 ? 52  VAL A O    2  
ATOM 2159  C CB   . VAL A 1 52  ? -8.484  -2.834  4.320   1.00 0.00 ? 52  VAL A CB   2  
ATOM 2160  C CG1  . VAL A 1 52  ? -8.812  -1.350  4.504   1.00 0.00 ? 52  VAL A CG1  2  
ATOM 2161  C CG2  . VAL A 1 52  ? -9.337  -3.450  3.209   1.00 0.00 ? 52  VAL A CG2  2  
ATOM 2162  H H    . VAL A 1 52  ? -7.153  -5.004  4.700   1.00 0.00 ? 52  VAL A H    2  
ATOM 2163  H HA   . VAL A 1 52  ? -6.777  -2.631  3.052   1.00 0.00 ? 52  VAL A HA   2  
ATOM 2164  H HB   . VAL A 1 52  ? -8.723  -3.348  5.250   1.00 0.00 ? 52  VAL A HB   2  
ATOM 2165  H HG11 . VAL A 1 52  ? -9.646  -1.079  3.857   1.00 0.00 ? 52  VAL A HG11 2  
ATOM 2166  H HG12 . VAL A 1 52  ? -9.082  -1.165  5.544   1.00 0.00 ? 52  VAL A HG12 2  
ATOM 2167  H HG13 . VAL A 1 52  ? -7.940  -0.750  4.244   1.00 0.00 ? 52  VAL A HG13 2  
ATOM 2168  H HG21 . VAL A 1 52  ? -10.110 -4.078  3.652   1.00 0.00 ? 52  VAL A HG21 2  
ATOM 2169  H HG22 . VAL A 1 52  ? -9.804  -2.655  2.627   1.00 0.00 ? 52  VAL A HG22 2  
ATOM 2170  H HG23 . VAL A 1 52  ? -8.706  -4.054  2.558   1.00 0.00 ? 52  VAL A HG23 2  
ATOM 2171  N N    . VAL A 1 53  ? -5.520  -1.223  4.638   1.00 0.00 ? 53  VAL A N    2  
ATOM 2172  C CA   . VAL A 1 53  ? -4.639  -0.457  5.504   1.00 0.00 ? 53  VAL A CA   2  
ATOM 2173  C C    . VAL A 1 53  ? -5.471  0.535   6.320   1.00 0.00 ? 53  VAL A C    2  
ATOM 2174  O O    . VAL A 1 53  ? -5.972  1.521   5.781   1.00 0.00 ? 53  VAL A O    2  
ATOM 2175  C CB   . VAL A 1 53  ? -3.547  0.220   4.673   1.00 0.00 ? 53  VAL A CB   2  
ATOM 2176  C CG1  . VAL A 1 53  ? -2.560  0.969   5.570   1.00 0.00 ? 53  VAL A CG1  2  
ATOM 2177  C CG2  . VAL A 1 53  ? -2.822  -0.797  3.789   1.00 0.00 ? 53  VAL A CG2  2  
ATOM 2178  H H    . VAL A 1 53  ? -5.647  -0.843  3.722   1.00 0.00 ? 53  VAL A H    2  
ATOM 2179  H HA   . VAL A 1 53  ? -4.158  -1.157  6.187   1.00 0.00 ? 53  VAL A HA   2  
ATOM 2180  H HB   . VAL A 1 53  ? -4.027  0.949   4.020   1.00 0.00 ? 53  VAL A HB   2  
ATOM 2181  H HG11 . VAL A 1 53  ? -1.766  1.396   4.958   1.00 0.00 ? 53  VAL A HG11 2  
ATOM 2182  H HG12 . VAL A 1 53  ? -3.083  1.767   6.097   1.00 0.00 ? 53  VAL A HG12 2  
ATOM 2183  H HG13 . VAL A 1 53  ? -2.129  0.277   6.293   1.00 0.00 ? 53  VAL A HG13 2  
ATOM 2184  H HG21 . VAL A 1 53  ? -2.200  -0.271  3.065   1.00 0.00 ? 53  VAL A HG21 2  
ATOM 2185  H HG22 . VAL A 1 53  ? -2.195  -1.436  4.410   1.00 0.00 ? 53  VAL A HG22 2  
ATOM 2186  H HG23 . VAL A 1 53  ? -3.554  -1.409  3.262   1.00 0.00 ? 53  VAL A HG23 2  
ATOM 2187  N N    . LEU A 1 54  ? -5.591  0.240   7.606   1.00 0.00 ? 54  LEU A N    2  
ATOM 2188  C CA   . LEU A 1 54  ? -6.353  1.094   8.501   1.00 0.00 ? 54  LEU A CA   2  
ATOM 2189  C C    . LEU A 1 54  ? -5.558  2.371   8.780   1.00 0.00 ? 54  LEU A C    2  
ATOM 2190  O O    . LEU A 1 54  ? -6.134  3.451   8.900   1.00 0.00 ? 54  LEU A O    2  
ATOM 2191  C CB   . LEU A 1 54  ? -6.749  0.327   9.765   1.00 0.00 ? 54  LEU A CB   2  
ATOM 2192  C CG   . LEU A 1 54  ? -7.574  -0.943  9.548   1.00 0.00 ? 54  LEU A CG   2  
ATOM 2193  C CD1  . LEU A 1 54  ? -7.502  -1.859  10.771  1.00 0.00 ? 54  LEU A CD1  2  
ATOM 2194  C CD2  . LEU A 1 54  ? -9.017  -0.601  9.172   1.00 0.00 ? 54  LEU A CD2  2  
ATOM 2195  H H    . LEU A 1 54  ? -5.180  -0.564  8.036   1.00 0.00 ? 54  LEU A H    2  
ATOM 2196  H HA   . LEU A 1 54  ? -7.275  1.366   7.987   1.00 0.00 ? 54  LEU A HA   2  
ATOM 2197  H HB2  . LEU A 1 54  ? -5.839  0.058   10.302  1.00 0.00 ? 54  LEU A HB2  2  
ATOM 2198  H HB3  . LEU A 1 54  ? -7.314  0.999   10.411  1.00 0.00 ? 54  LEU A HB3  2  
ATOM 2199  H HG   . LEU A 1 54  ? -7.144  -1.491  8.710   1.00 0.00 ? 54  LEU A HG   2  
ATOM 2200  H HD11 . LEU A 1 54  ? -6.522  -1.765  11.238  1.00 0.00 ? 54  LEU A HD11 2  
ATOM 2201  H HD12 . LEU A 1 54  ? -8.274  -1.573  11.485  1.00 0.00 ? 54  LEU A HD12 2  
ATOM 2202  H HD13 . LEU A 1 54  ? -7.659  -2.892  10.461  1.00 0.00 ? 54  LEU A HD13 2  
ATOM 2203  H HD21 . LEU A 1 54  ? -9.279  -1.107  8.242   1.00 0.00 ? 54  LEU A HD21 2  
ATOM 2204  H HD22 . LEU A 1 54  ? -9.687  -0.930  9.966   1.00 0.00 ? 54  LEU A HD22 2  
ATOM 2205  H HD23 . LEU A 1 54  ? -9.112  0.477   9.039   1.00 0.00 ? 54  LEU A HD23 2  
ATOM 2206  N N    . SER A 1 55  ? -4.247  2.205   8.875   1.00 0.00 ? 55  SER A N    2  
ATOM 2207  C CA   . SER A 1 55  ? -3.367  3.331   9.138   1.00 0.00 ? 55  SER A CA   2  
ATOM 2208  C C    . SER A 1 55  ? -2.055  3.161   8.370   1.00 0.00 ? 55  SER A C    2  
ATOM 2209  O O    . SER A 1 55  ? -1.777  2.086   7.840   1.00 0.00 ? 55  SER A O    2  
ATOM 2210  C CB   . SER A 1 55  ? -3.090  3.476   10.636  1.00 0.00 ? 55  SER A CB   2  
ATOM 2211  O OG   . SER A 1 55  ? -2.847  2.217   11.258  1.00 0.00 ? 55  SER A OG   2  
ATOM 2212  H H    . SER A 1 55  ? -3.786  1.323   8.776   1.00 0.00 ? 55  SER A H    2  
ATOM 2213  H HA   . SER A 1 55  ? -3.907  4.208   8.783   1.00 0.00 ? 55  SER A HA   2  
ATOM 2214  H HB2  . SER A 1 55  ? -2.227  4.126   10.784  1.00 0.00 ? 55  SER A HB2  2  
ATOM 2215  H HB3  . SER A 1 55  ? -3.940  3.960   11.117  1.00 0.00 ? 55  SER A HB3  2  
ATOM 2216  H HG   . SER A 1 55  ? -2.505  1.563   10.583  1.00 0.00 ? 55  SER A HG   2  
ATOM 2217  N N    . ILE A 1 56  ? -1.283  4.237   8.333   1.00 0.00 ? 56  ILE A N    2  
ATOM 2218  C CA   . ILE A 1 56  ? -0.008  4.220   7.639   1.00 0.00 ? 56  ILE A CA   2  
ATOM 2219  C C    . ILE A 1 56  ? 1.005   5.059   8.421   1.00 0.00 ? 56  ILE A C    2  
ATOM 2220  O O    . ILE A 1 56  ? 1.053   6.279   8.273   1.00 0.00 ? 56  ILE A O    2  
ATOM 2221  C CB   . ILE A 1 56  ? -0.183  4.665   6.185   1.00 0.00 ? 56  ILE A CB   2  
ATOM 2222  C CG1  . ILE A 1 56  ? -0.851  3.569   5.353   1.00 0.00 ? 56  ILE A CG1  2  
ATOM 2223  C CG2  . ILE A 1 56  ? 1.152   5.110   5.583   1.00 0.00 ? 56  ILE A CG2  2  
ATOM 2224  C CD1  . ILE A 1 56  ? -1.179  4.073   3.946   1.00 0.00 ? 56  ILE A CD1  2  
ATOM 2225  H H    . ILE A 1 56  ? -1.517  5.107   8.767   1.00 0.00 ? 56  ILE A H    2  
ATOM 2226  H HA   . ILE A 1 56  ? 0.340   3.187   7.619   1.00 0.00 ? 56  ILE A HA   2  
ATOM 2227  H HB   . ILE A 1 56  ? -0.846  5.530   6.171   1.00 0.00 ? 56  ILE A HB   2  
ATOM 2228  H HG12 . ILE A 1 56  ? -0.192  2.704   5.288   1.00 0.00 ? 56  ILE A HG12 2  
ATOM 2229  H HG13 . ILE A 1 56  ? -1.764  3.238   5.847   1.00 0.00 ? 56  ILE A HG13 2  
ATOM 2230  H HG21 . ILE A 1 56  ? 1.969   4.755   6.210   1.00 0.00 ? 56  ILE A HG21 2  
ATOM 2231  H HG22 . ILE A 1 56  ? 1.255   4.692   4.581   1.00 0.00 ? 56  ILE A HG22 2  
ATOM 2232  H HG23 . ILE A 1 56  ? 1.181   6.198   5.528   1.00 0.00 ? 56  ILE A HG23 2  
ATOM 2233  H HD11 . ILE A 1 56  ? -1.572  5.088   4.006   1.00 0.00 ? 56  ILE A HD11 2  
ATOM 2234  H HD12 . ILE A 1 56  ? -0.275  4.068   3.338   1.00 0.00 ? 56  ILE A HD12 2  
ATOM 2235  H HD13 . ILE A 1 56  ? -1.926  3.421   3.492   1.00 0.00 ? 56  ILE A HD13 2  
ATOM 2236  N N    . ASP A 1 57  ? 1.791   4.371   9.236   1.00 0.00 ? 57  ASP A N    2  
ATOM 2237  C CA   . ASP A 1 57  ? 2.800   5.037   10.042  1.00 0.00 ? 57  ASP A CA   2  
ATOM 2238  C C    . ASP A 1 57  ? 2.115   5.833   11.154  1.00 0.00 ? 57  ASP A C    2  
ATOM 2239  O O    . ASP A 1 57  ? 2.475   6.980   11.414  1.00 0.00 ? 57  ASP A O    2  
ATOM 2240  C CB   . ASP A 1 57  ? 3.621   6.014   9.198   1.00 0.00 ? 57  ASP A CB   2  
ATOM 2241  C CG   . ASP A 1 57  ? 5.027   6.303   9.729   1.00 0.00 ? 57  ASP A CG   2  
ATOM 2242  O OD1  . ASP A 1 57  ? 5.630   5.358   10.282  1.00 0.00 ? 57  ASP A OD1  2  
ATOM 2243  O OD2  . ASP A 1 57  ? 5.466   7.462   9.570   1.00 0.00 ? 57  ASP A OD2  2  
ATOM 2244  H H    . ASP A 1 57  ? 1.746   3.378   9.351   1.00 0.00 ? 57  ASP A H    2  
ATOM 2245  H HA   . ASP A 1 57  ? 3.431   4.237   10.430  1.00 0.00 ? 57  ASP A HA   2  
ATOM 2246  H HB2  . ASP A 1 57  ? 3.706   5.616   8.187   1.00 0.00 ? 57  ASP A HB2  2  
ATOM 2247  H HB3  . ASP A 1 57  ? 3.076   6.955   9.125   1.00 0.00 ? 57  ASP A HB3  2  
ATOM 2248  N N    . GLY A 1 58  ? 1.139   5.193   11.782  1.00 0.00 ? 58  GLY A N    2  
ATOM 2249  C CA   . GLY A 1 58  ? 0.400   5.827   12.860  1.00 0.00 ? 58  GLY A CA   2  
ATOM 2250  C C    . GLY A 1 58  ? -0.562  6.885   12.317  1.00 0.00 ? 58  GLY A C    2  
ATOM 2251  O O    . GLY A 1 58  ? -1.251  7.556   13.085  1.00 0.00 ? 58  GLY A O    2  
ATOM 2252  H H    . GLY A 1 58  ? 0.852   4.260   11.564  1.00 0.00 ? 58  GLY A H    2  
ATOM 2253  H HA2  . GLY A 1 58  ? -0.158  5.073   13.415  1.00 0.00 ? 58  GLY A HA2  2  
ATOM 2254  H HA3  . GLY A 1 58  ? 1.096   6.288   13.560  1.00 0.00 ? 58  GLY A HA3  2  
ATOM 2255  N N    . ILE A 1 59  ? -0.579  7.002   10.997  1.00 0.00 ? 59  ILE A N    2  
ATOM 2256  C CA   . ILE A 1 59  ? -1.445  7.968   10.343  1.00 0.00 ? 59  ILE A CA   2  
ATOM 2257  C C    . ILE A 1 59  ? -2.769  7.293   9.977   1.00 0.00 ? 59  ILE A C    2  
ATOM 2258  O O    . ILE A 1 59  ? -2.785  6.140   9.550   1.00 0.00 ? 59  ILE A O    2  
ATOM 2259  C CB   . ILE A 1 59  ? -0.731  8.607   9.150   1.00 0.00 ? 59  ILE A CB   2  
ATOM 2260  C CG1  . ILE A 1 59  ? 0.603   9.223   9.576   1.00 0.00 ? 59  ILE A CG1  2  
ATOM 2261  C CG2  . ILE A 1 59  ? -1.634  9.624   8.451   1.00 0.00 ? 59  ILE A CG2  2  
ATOM 2262  C CD1  . ILE A 1 59  ? 0.383   10.505  10.382  1.00 0.00 ? 59  ILE A CD1  2  
ATOM 2263  H H    . ILE A 1 59  ? -0.016  6.453   10.380  1.00 0.00 ? 59  ILE A H    2  
ATOM 2264  H HA   . ILE A 1 59  ? -1.650  8.763   11.060  1.00 0.00 ? 59  ILE A HA   2  
ATOM 2265  H HB   . ILE A 1 59  ? -0.507  7.824   8.426   1.00 0.00 ? 59  ILE A HB   2  
ATOM 2266  H HG12 . ILE A 1 59  ? 1.165   8.505   10.175  1.00 0.00 ? 59  ILE A HG12 2  
ATOM 2267  H HG13 . ILE A 1 59  ? 1.205   9.442   8.694   1.00 0.00 ? 59  ILE A HG13 2  
ATOM 2268  H HG21 . ILE A 1 59  ? -1.372  9.677   7.394   1.00 0.00 ? 59  ILE A HG21 2  
ATOM 2269  H HG22 . ILE A 1 59  ? -2.675  9.316   8.552   1.00 0.00 ? 59  ILE A HG22 2  
ATOM 2270  H HG23 . ILE A 1 59  ? -1.500  10.605  8.908   1.00 0.00 ? 59  ILE A HG23 2  
ATOM 2271  H HD11 . ILE A 1 59  ? -0.616  10.492  10.819  1.00 0.00 ? 59  ILE A HD11 2  
ATOM 2272  H HD12 . ILE A 1 59  ? 1.126   10.566  11.177  1.00 0.00 ? 59  ILE A HD12 2  
ATOM 2273  H HD13 . ILE A 1 59  ? 0.482   11.368  9.725   1.00 0.00 ? 59  ILE A HD13 2  
ATOM 2274  N N    . SER A 1 60  ? -3.848  8.041   10.158  1.00 0.00 ? 60  SER A N    2  
ATOM 2275  C CA   . SER A 1 60  ? -5.173  7.529   9.852   1.00 0.00 ? 60  SER A CA   2  
ATOM 2276  C C    . SER A 1 60  ? -5.370  7.460   8.336   1.00 0.00 ? 60  SER A C    2  
ATOM 2277  O O    . SER A 1 60  ? -5.342  8.484   7.656   1.00 0.00 ? 60  SER A O    2  
ATOM 2278  C CB   . SER A 1 60  ? -6.259  8.398   10.489  1.00 0.00 ? 60  SER A CB   2  
ATOM 2279  O OG   . SER A 1 60  ? -7.019  7.678   11.457  1.00 0.00 ? 60  SER A OG   2  
ATOM 2280  H H    . SER A 1 60  ? -3.826  8.978   10.505  1.00 0.00 ? 60  SER A H    2  
ATOM 2281  H HA   . SER A 1 60  ? -5.204  6.531   10.288  1.00 0.00 ? 60  SER A HA   2  
ATOM 2282  H HB2  . SER A 1 60  ? -5.799  9.265   10.962  1.00 0.00 ? 60  SER A HB2  2  
ATOM 2283  H HB3  . SER A 1 60  ? -6.925  8.774   9.713   1.00 0.00 ? 60  SER A HB3  2  
ATOM 2284  H HG   . SER A 1 60  ? -7.187  8.254   12.257  1.00 0.00 ? 60  SER A HG   2  
ATOM 2285  N N    . ALA A 1 61  ? -5.566  6.242   7.852   1.00 0.00 ? 61  ALA A N    2  
ATOM 2286  C CA   . ALA A 1 61  ? -5.768  6.026   6.429   1.00 0.00 ? 61  ALA A CA   2  
ATOM 2287  C C    . ALA A 1 61  ? -7.267  6.043   6.123   1.00 0.00 ? 61  ALA A C    2  
ATOM 2288  O O    . ALA A 1 61  ? -7.724  5.363   5.206   1.00 0.00 ? 61  ALA A O    2  
ATOM 2289  C CB   . ALA A 1 61  ? -5.102  4.713   6.013   1.00 0.00 ? 61  ALA A CB   2  
ATOM 2290  H H    . ALA A 1 61  ? -5.587  5.415   8.413   1.00 0.00 ? 61  ALA A H    2  
ATOM 2291  H HA   . ALA A 1 61  ? -5.287  6.848   5.897   1.00 0.00 ? 61  ALA A HA   2  
ATOM 2292  H HB1  . ALA A 1 61  ? -5.565  3.885   6.549   1.00 0.00 ? 61  ALA A HB1  2  
ATOM 2293  H HB2  . ALA A 1 61  ? -5.228  4.567   4.940   1.00 0.00 ? 61  ALA A HB2  2  
ATOM 2294  H HB3  . ALA A 1 61  ? -4.040  4.752   6.252   1.00 0.00 ? 61  ALA A HB3  2  
ATOM 2295  N N    . GLN A 1 62  ? -7.990  6.828   6.909   1.00 0.00 ? 62  GLN A N    2  
ATOM 2296  C CA   . GLN A 1 62  ? -9.428  6.942   6.733   1.00 0.00 ? 62  GLN A CA   2  
ATOM 2297  C C    . GLN A 1 62  ? -9.759  8.131   5.828   1.00 0.00 ? 62  GLN A C    2  
ATOM 2298  O O    . GLN A 1 62  ? -9.910  9.255   6.304   1.00 0.00 ? 62  GLN A O    2  
ATOM 2299  C CB   . GLN A 1 62  ? -10.137 7.067   8.083   1.00 0.00 ? 62  GLN A CB   2  
ATOM 2300  C CG   . GLN A 1 62  ? -10.063 5.753   8.864   1.00 0.00 ? 62  GLN A CG   2  
ATOM 2301  C CD   . GLN A 1 62  ? -9.107  5.875   10.052  1.00 0.00 ? 62  GLN A CD   2  
ATOM 2302  O OE1  . GLN A 1 62  ? -9.323  6.636   10.981  1.00 0.00 ? 62  GLN A OE1  2  
ATOM 2303  N NE2  . GLN A 1 62  ? -8.040  5.084   9.971   1.00 0.00 ? 62  GLN A NE2  2  
ATOM 2304  H H    . GLN A 1 62  ? -7.610  7.378   7.652   1.00 0.00 ? 62  GLN A H    2  
ATOM 2305  H HA   . GLN A 1 62  ? -9.736  6.014   6.252   1.00 0.00 ? 62  GLN A HA   2  
ATOM 2306  H HB2  . GLN A 1 62  ? -9.680  7.866   8.665   1.00 0.00 ? 62  GLN A HB2  2  
ATOM 2307  H HB3  . GLN A 1 62  ? -11.180 7.342   7.926   1.00 0.00 ? 62  GLN A HB3  2  
ATOM 2308  H HG2  . GLN A 1 62  ? -11.057 5.481   9.219   1.00 0.00 ? 62  GLN A HG2  2  
ATOM 2309  H HG3  . GLN A 1 62  ? -9.730  4.952   8.205   1.00 0.00 ? 62  GLN A HG3  2  
ATOM 2310  H HE21 . GLN A 1 62  ? -7.922  4.483   9.181   1.00 0.00 ? 62  GLN A HE21 2  
ATOM 2311  H HE22 . GLN A 1 62  ? -7.356  5.092   10.700  1.00 0.00 ? 62  GLN A HE22 2  
ATOM 2312  N N    . GLY A 1 63  ? -9.862  7.841   4.539   1.00 0.00 ? 63  GLY A N    2  
ATOM 2313  C CA   . GLY A 1 63  ? -10.173 8.872   3.563   1.00 0.00 ? 63  GLY A CA   2  
ATOM 2314  C C    . GLY A 1 63  ? -8.895  9.477   2.979   1.00 0.00 ? 63  GLY A C    2  
ATOM 2315  O O    . GLY A 1 63  ? -8.822  10.684  2.753   1.00 0.00 ? 63  GLY A O    2  
ATOM 2316  H H    . GLY A 1 63  ? -9.738  6.924   4.160   1.00 0.00 ? 63  GLY A H    2  
ATOM 2317  H HA2  . GLY A 1 63  ? -10.779 8.449   2.762   1.00 0.00 ? 63  GLY A HA2  2  
ATOM 2318  H HA3  . GLY A 1 63  ? -10.768 9.655   4.033   1.00 0.00 ? 63  GLY A HA3  2  
ATOM 2319  N N    . MET A 1 64  ? -7.919  8.610   2.750   1.00 0.00 ? 64  MET A N    2  
ATOM 2320  C CA   . MET A 1 64  ? -6.648  9.044   2.196   1.00 0.00 ? 64  MET A CA   2  
ATOM 2321  C C    . MET A 1 64  ? -6.476  8.543   0.760   1.00 0.00 ? 64  MET A C    2  
ATOM 2322  O O    . MET A 1 64  ? -6.769  7.386   0.463   1.00 0.00 ? 64  MET A O    2  
ATOM 2323  C CB   . MET A 1 64  ? -5.505  8.511   3.063   1.00 0.00 ? 64  MET A CB   2  
ATOM 2324  C CG   . MET A 1 64  ? -5.256  9.425   4.264   1.00 0.00 ? 64  MET A CG   2  
ATOM 2325  S SD   . MET A 1 64  ? -3.514  9.785   4.407   1.00 0.00 ? 64  MET A SD   2  
ATOM 2326  C CE   . MET A 1 64  ? -2.967  8.329   5.283   1.00 0.00 ? 64  MET A CE   2  
ATOM 2327  H H    . MET A 1 64  ? -7.987  7.630   2.936   1.00 0.00 ? 64  MET A H    2  
ATOM 2328  H HA   . MET A 1 64  ? -6.680  10.133  2.207   1.00 0.00 ? 64  MET A HA   2  
ATOM 2329  H HB2  . MET A 1 64  ? -5.745  7.506   3.409   1.00 0.00 ? 64  MET A HB2  2  
ATOM 2330  H HB3  . MET A 1 64  ? -4.596  8.434   2.465   1.00 0.00 ? 64  MET A HB3  2  
ATOM 2331  H HG2  . MET A 1 64  ? -5.819  10.351  4.150   1.00 0.00 ? 64  MET A HG2  2  
ATOM 2332  H HG3  . MET A 1 64  ? -5.613  8.946   5.176   1.00 0.00 ? 64  MET A HG3  2  
ATOM 2333  H HE1  . MET A 1 64  ? -3.606  7.486   5.021   1.00 0.00 ? 64  MET A HE1  2  
ATOM 2334  H HE2  . MET A 1 64  ? -1.937  8.104   5.006   1.00 0.00 ? 64  MET A HE2  2  
ATOM 2335  H HE3  . MET A 1 64  ? -3.024  8.508   6.356   1.00 0.00 ? 64  MET A HE3  2  
ATOM 2336  N N    . THR A 1 65  ? -6.002  9.440   -0.092  1.00 0.00 ? 65  THR A N    2  
ATOM 2337  C CA   . THR A 1 65  ? -5.788  9.104   -1.489  1.00 0.00 ? 65  THR A CA   2  
ATOM 2338  C C    . THR A 1 65  ? -4.531  8.247   -1.645  1.00 0.00 ? 65  THR A C    2  
ATOM 2339  O O    . THR A 1 65  ? -3.642  8.281   -0.795  1.00 0.00 ? 65  THR A O    2  
ATOM 2340  C CB   . THR A 1 65  ? -5.736  10.409  -2.287  1.00 0.00 ? 65  THR A CB   2  
ATOM 2341  O OG1  . THR A 1 65  ? -4.998  11.297  -1.451  1.00 0.00 ? 65  THR A OG1  2  
ATOM 2342  C CG2  . THR A 1 65  ? -7.109  11.072  -2.415  1.00 0.00 ? 65  THR A CG2  2  
ATOM 2343  H H    . THR A 1 65  ? -5.767  10.379  0.158   1.00 0.00 ? 65  THR A H    2  
ATOM 2344  H HA   . THR A 1 65  ? -6.630  8.502   -1.831  1.00 0.00 ? 65  THR A HA   2  
ATOM 2345  H HB   . THR A 1 65  ? -5.288  10.248  -3.267  1.00 0.00 ? 65  THR A HB   2  
ATOM 2346  H HG1  . THR A 1 65  ? -4.172  10.845  -1.117  1.00 0.00 ? 65  THR A HG1  2  
ATOM 2347  H HG21 . THR A 1 65  ? -7.854  10.469  -1.895  1.00 0.00 ? 65  THR A HG21 2  
ATOM 2348  H HG22 . THR A 1 65  ? -7.074  12.068  -1.973  1.00 0.00 ? 65  THR A HG22 2  
ATOM 2349  H HG23 . THR A 1 65  ? -7.377  11.152  -3.469  1.00 0.00 ? 65  THR A HG23 2  
ATOM 2350  N N    . HIS A 1 66  ? -4.496  7.497   -2.737  1.00 0.00 ? 66  HIS A N    2  
ATOM 2351  C CA   . HIS A 1 66  ? -3.362  6.632   -3.015  1.00 0.00 ? 66  HIS A CA   2  
ATOM 2352  C C    . HIS A 1 66  ? -2.063  7.429   -2.881  1.00 0.00 ? 66  HIS A C    2  
ATOM 2353  O O    . HIS A 1 66  ? -1.146  7.013   -2.175  1.00 0.00 ? 66  HIS A O    2  
ATOM 2354  C CB   . HIS A 1 66  ? -3.510  5.965   -4.384  1.00 0.00 ? 66  HIS A CB   2  
ATOM 2355  C CG   . HIS A 1 66  ? -2.872  4.600   -4.475  1.00 0.00 ? 66  HIS A CG   2  
ATOM 2356  N ND1  . HIS A 1 66  ? -2.351  4.093   -5.652  1.00 0.00 ? 66  HIS A ND1  2  
ATOM 2357  C CD2  . HIS A 1 66  ? -2.677  3.642   -3.523  1.00 0.00 ? 66  HIS A CD2  2  
ATOM 2358  C CE1  . HIS A 1 66  ? -1.867  2.884   -5.409  1.00 0.00 ? 66  HIS A CE1  2  
ATOM 2359  N NE2  . HIS A 1 66  ? -2.070  2.606   -4.089  1.00 0.00 ? 66  HIS A NE2  2  
ATOM 2360  H H    . HIS A 1 66  ? -5.223  7.475   -3.423  1.00 0.00 ? 66  HIS A H    2  
ATOM 2361  H HA   . HIS A 1 66  ? -3.376  5.846   -2.260  1.00 0.00 ? 66  HIS A HA   2  
ATOM 2362  H HB2  . HIS A 1 66  ? -4.571  5.876   -4.621  1.00 0.00 ? 66  HIS A HB2  2  
ATOM 2363  H HB3  . HIS A 1 66  ? -3.068  6.613   -5.142  1.00 0.00 ? 66  HIS A HB3  2  
ATOM 2364  H HD1  . HIS A 1 66  ? -2.341  4.559   -6.537  1.00 0.00 ? 66  HIS A HD1  2  
ATOM 2365  H HD2  . HIS A 1 66  ? -2.969  3.716   -2.476  1.00 0.00 ? 66  HIS A HD2  2  
ATOM 2366  H HE1  . HIS A 1 66  ? -1.390  2.226   -6.136  1.00 0.00 ? 66  HIS A HE1  2  
ATOM 2367  N N    . LEU A 1 67  ? -2.027  8.560   -3.569  1.00 0.00 ? 67  LEU A N    2  
ATOM 2368  C CA   . LEU A 1 67  ? -0.856  9.419   -3.536  1.00 0.00 ? 67  LEU A CA   2  
ATOM 2369  C C    . LEU A 1 67  ? -0.464  9.684   -2.081  1.00 0.00 ? 67  LEU A C    2  
ATOM 2370  O O    . LEU A 1 67  ? 0.683   9.468   -1.693  1.00 0.00 ? 67  LEU A O    2  
ATOM 2371  C CB   . LEU A 1 67  ? -1.101  10.692  -4.348  1.00 0.00 ? 67  LEU A CB   2  
ATOM 2372  C CG   . LEU A 1 67  ? -0.153  11.860  -4.068  1.00 0.00 ? 67  LEU A CG   2  
ATOM 2373  C CD1  . LEU A 1 67  ? 1.297   11.472  -4.362  1.00 0.00 ? 67  LEU A CD1  2  
ATOM 2374  C CD2  . LEU A 1 67  ? -0.580  13.110  -4.841  1.00 0.00 ? 67  LEU A CD2  2  
ATOM 2375  H H    . LEU A 1 67  ? -2.777  8.891   -4.141  1.00 0.00 ? 67  LEU A H    2  
ATOM 2376  H HA   . LEU A 1 67  ? -0.041  8.880   -4.020  1.00 0.00 ? 67  LEU A HA   2  
ATOM 2377  H HB2  . LEU A 1 67  ? -1.035  10.442  -5.407  1.00 0.00 ? 67  LEU A HB2  2  
ATOM 2378  H HB3  . LEU A 1 67  ? -2.122  11.026  -4.163  1.00 0.00 ? 67  LEU A HB3  2  
ATOM 2379  H HG   . LEU A 1 67  ? -0.213  12.101  -3.007  1.00 0.00 ? 67  LEU A HG   2  
ATOM 2380  H HD11 . LEU A 1 67  ? 1.555   11.772  -5.378  1.00 0.00 ? 67  LEU A HD11 2  
ATOM 2381  H HD12 . LEU A 1 67  ? 1.958   11.974  -3.656  1.00 0.00 ? 67  LEU A HD12 2  
ATOM 2382  H HD13 . LEU A 1 67  ? 1.412   10.392  -4.262  1.00 0.00 ? 67  LEU A HD13 2  
ATOM 2383  H HD21 . LEU A 1 67  ? -1.550  13.448  -4.477  1.00 0.00 ? 67  LEU A HD21 2  
ATOM 2384  H HD22 . LEU A 1 67  ? 0.158   13.898  -4.693  1.00 0.00 ? 67  LEU A HD22 2  
ATOM 2385  H HD23 . LEU A 1 67  ? -0.652  12.874  -5.902  1.00 0.00 ? 67  LEU A HD23 2  
ATOM 2386  N N    . GLU A 1 68  ? -1.440  10.148  -1.314  1.00 0.00 ? 68  GLU A N    2  
ATOM 2387  C CA   . GLU A 1 68  ? -1.212  10.445  0.090   1.00 0.00 ? 68  GLU A CA   2  
ATOM 2388  C C    . GLU A 1 68  ? -0.514  9.269   0.775   1.00 0.00 ? 68  GLU A C    2  
ATOM 2389  O O    . GLU A 1 68  ? 0.661   9.360   1.129   1.00 0.00 ? 68  GLU A O    2  
ATOM 2390  C CB   . GLU A 1 68  ? -2.524  10.791  0.797   1.00 0.00 ? 68  GLU A CB   2  
ATOM 2391  C CG   . GLU A 1 68  ? -2.974  12.212  0.454   1.00 0.00 ? 68  GLU A CG   2  
ATOM 2392  C CD   . GLU A 1 68  ? -2.482  13.212  1.502   1.00 0.00 ? 68  GLU A CD   2  
ATOM 2393  O OE1  . GLU A 1 68  ? -1.251  13.418  1.556   1.00 0.00 ? 68  GLU A OE1  2  
ATOM 2394  O OE2  . GLU A 1 68  ? -3.349  13.747  2.227   1.00 0.00 ? 68  GLU A OE2  2  
ATOM 2395  H H    . GLU A 1 68  ? -2.371  10.321  -1.637  1.00 0.00 ? 68  GLU A H    2  
ATOM 2396  H HA   . GLU A 1 68  ? -0.561  11.319  0.099   1.00 0.00 ? 68  GLU A HA   2  
ATOM 2397  H HB2  . GLU A 1 68  ? -3.297  10.080  0.505   1.00 0.00 ? 68  GLU A HB2  2  
ATOM 2398  H HB3  . GLU A 1 68  ? -2.396  10.697  1.875   1.00 0.00 ? 68  GLU A HB3  2  
ATOM 2399  H HG2  . GLU A 1 68  ? -2.592  12.491  -0.528  1.00 0.00 ? 68  GLU A HG2  2  
ATOM 2400  H HG3  . GLU A 1 68  ? -4.062  12.248  0.394   1.00 0.00 ? 68  GLU A HG3  2  
ATOM 2401  N N    . ALA A 1 69  ? -1.265  8.190   0.940   1.00 0.00 ? 69  ALA A N    2  
ATOM 2402  C CA   . ALA A 1 69  ? -0.733  6.997   1.576   1.00 0.00 ? 69  ALA A CA   2  
ATOM 2403  C C    . ALA A 1 69  ? 0.673   6.722   1.038   1.00 0.00 ? 69  ALA A C    2  
ATOM 2404  O O    . ALA A 1 69  ? 1.607   6.512   1.811   1.00 0.00 ? 69  ALA A O    2  
ATOM 2405  C CB   . ALA A 1 69  ? -1.687  5.824   1.341   1.00 0.00 ? 69  ALA A CB   2  
ATOM 2406  H H    . ALA A 1 69  ? -2.220  8.124   0.649   1.00 0.00 ? 69  ALA A H    2  
ATOM 2407  H HA   . ALA A 1 69  ? -0.672  7.191   2.647   1.00 0.00 ? 69  ALA A HA   2  
ATOM 2408  H HB1  . ALA A 1 69  ? -2.297  5.668   2.230   1.00 0.00 ? 69  ALA A HB1  2  
ATOM 2409  H HB2  . ALA A 1 69  ? -2.333  6.046   0.491   1.00 0.00 ? 69  ALA A HB2  2  
ATOM 2410  H HB3  . ALA A 1 69  ? -1.110  4.923   1.133   1.00 0.00 ? 69  ALA A HB3  2  
ATOM 2411  N N    . GLN A 1 70  ? 0.779   6.733   -0.282  1.00 0.00 ? 70  GLN A N    2  
ATOM 2412  C CA   . GLN A 1 70  ? 2.056   6.487   -0.932  1.00 0.00 ? 70  GLN A CA   2  
ATOM 2413  C C    . GLN A 1 70  ? 3.118   7.447   -0.395  1.00 0.00 ? 70  GLN A C    2  
ATOM 2414  O O    . GLN A 1 70  ? 4.238   7.035   -0.095  1.00 0.00 ? 70  GLN A O    2  
ATOM 2415  C CB   . GLN A 1 70  ? 1.928   6.605   -2.452  1.00 0.00 ? 70  GLN A CB   2  
ATOM 2416  C CG   . GLN A 1 70  ? 1.132   5.433   -3.029  1.00 0.00 ? 70  GLN A CG   2  
ATOM 2417  C CD   . GLN A 1 70  ? 2.029   4.211   -3.239  1.00 0.00 ? 70  GLN A CD   2  
ATOM 2418  O OE1  . GLN A 1 70  ? 2.507   3.591   -2.302  1.00 0.00 ? 70  GLN A OE1  2  
ATOM 2419  N NE2  . GLN A 1 70  ? 2.231   3.901   -4.516  1.00 0.00 ? 70  GLN A NE2  2  
ATOM 2420  H H    . GLN A 1 70  ? 0.015   6.905   -0.904  1.00 0.00 ? 70  GLN A H    2  
ATOM 2421  H HA   . GLN A 1 70  ? 2.319   5.461   -0.675  1.00 0.00 ? 70  GLN A HA   2  
ATOM 2422  H HB2  . GLN A 1 70  ? 1.437   7.544   -2.708  1.00 0.00 ? 70  GLN A HB2  2  
ATOM 2423  H HB3  . GLN A 1 70  ? 2.921   6.632   -2.903  1.00 0.00 ? 70  GLN A HB3  2  
ATOM 2424  H HG2  . GLN A 1 70  ? 0.315   5.177   -2.354  1.00 0.00 ? 70  GLN A HG2  2  
ATOM 2425  H HG3  . GLN A 1 70  ? 0.683   5.726   -3.978  1.00 0.00 ? 70  GLN A HG3  2  
ATOM 2426  H HE21 . GLN A 1 70  ? 1.809   4.451   -5.237  1.00 0.00 ? 70  GLN A HE21 2  
ATOM 2427  H HE22 . GLN A 1 70  ? 2.804   3.117   -4.756  1.00 0.00 ? 70  GLN A HE22 2  
ATOM 2428  N N    . ASN A 1 71  ? 2.730   8.710   -0.288  1.00 0.00 ? 71  ASN A N    2  
ATOM 2429  C CA   . ASN A 1 71  ? 3.636   9.732   0.208   1.00 0.00 ? 71  ASN A CA   2  
ATOM 2430  C C    . ASN A 1 71  ? 4.201   9.293   1.560   1.00 0.00 ? 71  ASN A C    2  
ATOM 2431  O O    . ASN A 1 71  ? 5.407   9.377   1.790   1.00 0.00 ? 71  ASN A O    2  
ATOM 2432  C CB   . ASN A 1 71  ? 2.908   11.062  0.409   1.00 0.00 ? 71  ASN A CB   2  
ATOM 2433  C CG   . ASN A 1 71  ? 3.512   12.157  -0.473  1.00 0.00 ? 71  ASN A CG   2  
ATOM 2434  O OD1  . ASN A 1 71  ? 4.712   12.376  -0.500  1.00 0.00 ? 71  ASN A OD1  2  
ATOM 2435  N ND2  . ASN A 1 71  ? 2.617   12.829  -1.190  1.00 0.00 ? 71  ASN A ND2  2  
ATOM 2436  H H    . ASN A 1 71  ? 1.818   9.037   -0.534  1.00 0.00 ? 71  ASN A H    2  
ATOM 2437  H HA   . ASN A 1 71  ? 4.408   9.826   -0.556  1.00 0.00 ? 71  ASN A HA   2  
ATOM 2438  H HB2  . ASN A 1 71  ? 1.851   10.942  0.173   1.00 0.00 ? 71  ASN A HB2  2  
ATOM 2439  H HB3  . ASN A 1 71  ? 2.968   11.359  1.456   1.00 0.00 ? 71  ASN A HB3  2  
ATOM 2440  H HD21 . ASN A 1 71  ? 1.646   12.598  -1.122  1.00 0.00 ? 71  ASN A HD21 2  
ATOM 2441  H HD22 . ASN A 1 71  ? 2.914   13.565  -1.798  1.00 0.00 ? 71  ASN A HD22 2  
ATOM 2442  N N    . LYS A 1 72  ? 3.304   8.835   2.421   1.00 0.00 ? 72  LYS A N    2  
ATOM 2443  C CA   . LYS A 1 72  ? 3.698   8.383   3.744   1.00 0.00 ? 72  LYS A CA   2  
ATOM 2444  C C    . LYS A 1 72  ? 4.753   7.282   3.609   1.00 0.00 ? 72  LYS A C    2  
ATOM 2445  O O    . LYS A 1 72  ? 5.759   7.292   4.317   1.00 0.00 ? 72  LYS A O    2  
ATOM 2446  C CB   . LYS A 1 72  ? 2.470   7.962   4.554   1.00 0.00 ? 72  LYS A CB   2  
ATOM 2447  C CG   . LYS A 1 72  ? 1.670   9.183   5.010   1.00 0.00 ? 72  LYS A CG   2  
ATOM 2448  C CD   . LYS A 1 72  ? 2.399   9.930   6.130   1.00 0.00 ? 72  LYS A CD   2  
ATOM 2449  C CE   . LYS A 1 72  ? 1.466   10.927  6.821   1.00 0.00 ? 72  LYS A CE   2  
ATOM 2450  N NZ   . LYS A 1 72  ? 1.220   12.097  5.949   1.00 0.00 ? 72  LYS A NZ   2  
ATOM 2451  H H    . LYS A 1 72  ? 2.325   8.770   2.226   1.00 0.00 ? 72  LYS A H    2  
ATOM 2452  H HA   . LYS A 1 72  ? 4.149   9.231   4.258   1.00 0.00 ? 72  LYS A HA   2  
ATOM 2453  H HB2  . LYS A 1 72  ? 1.837   7.312   3.951   1.00 0.00 ? 72  LYS A HB2  2  
ATOM 2454  H HB3  . LYS A 1 72  ? 2.784   7.383   5.423   1.00 0.00 ? 72  LYS A HB3  2  
ATOM 2455  H HG2  . LYS A 1 72  ? 1.509   9.854   4.166   1.00 0.00 ? 72  LYS A HG2  2  
ATOM 2456  H HG3  . LYS A 1 72  ? 0.686   8.869   5.359   1.00 0.00 ? 72  LYS A HG3  2  
ATOM 2457  H HD2  . LYS A 1 72  ? 2.780   9.216   6.860   1.00 0.00 ? 72  LYS A HD2  2  
ATOM 2458  H HD3  . LYS A 1 72  ? 3.260   10.457  5.719   1.00 0.00 ? 72  LYS A HD3  2  
ATOM 2459  H HE2  . LYS A 1 72  ? 0.521   10.441  7.065   1.00 0.00 ? 72  LYS A HE2  2  
ATOM 2460  H HE3  . LYS A 1 72  ? 1.908   11.254  7.763   1.00 0.00 ? 72  LYS A HE3  2  
ATOM 2461  H HZ1  . LYS A 1 72  ? 1.527   12.928  6.412   1.00 0.00 ? 72  LYS A HZ1  2  
ATOM 2462  H HZ2  . LYS A 1 72  ? 1.724   11.986  5.093   1.00 0.00 ? 72  LYS A HZ2  2  
ATOM 2463  H HZ3  . LYS A 1 72  ? 0.241   12.166  5.754   1.00 0.00 ? 72  LYS A HZ3  2  
ATOM 2464  N N    . ILE A 1 73  ? 4.486   6.360   2.696   1.00 0.00 ? 73  ILE A N    2  
ATOM 2465  C CA   . ILE A 1 73  ? 5.399   5.255   2.459   1.00 0.00 ? 73  ILE A CA   2  
ATOM 2466  C C    . ILE A 1 73  ? 6.762   5.807   2.035   1.00 0.00 ? 73  ILE A C    2  
ATOM 2467  O O    . ILE A 1 73  ? 7.793   5.186   2.287   1.00 0.00 ? 73  ILE A O    2  
ATOM 2468  C CB   . ILE A 1 73  ? 4.797   4.267   1.458   1.00 0.00 ? 73  ILE A CB   2  
ATOM 2469  C CG1  . ILE A 1 73  ? 3.613   3.518   2.072   1.00 0.00 ? 73  ILE A CG1  2  
ATOM 2470  C CG2  . ILE A 1 73  ? 5.864   3.311   0.921   1.00 0.00 ? 73  ILE A CG2  2  
ATOM 2471  C CD1  . ILE A 1 73  ? 2.426   3.483   1.107   1.00 0.00 ? 73  ILE A CD1  2  
ATOM 2472  H H    . ILE A 1 73  ? 3.665   6.360   2.125   1.00 0.00 ? 73  ILE A H    2  
ATOM 2473  H HA   . ILE A 1 73  ? 5.520   4.724   3.403   1.00 0.00 ? 73  ILE A HA   2  
ATOM 2474  H HB   . ILE A 1 73  ? 4.415   4.833   0.608   1.00 0.00 ? 73  ILE A HB   2  
ATOM 2475  H HG12 . ILE A 1 73  ? 3.912   2.500   2.322   1.00 0.00 ? 73  ILE A HG12 2  
ATOM 2476  H HG13 . ILE A 1 73  ? 3.315   4.000   3.002   1.00 0.00 ? 73  ILE A HG13 2  
ATOM 2477  H HG21 . ILE A 1 73  ? 6.763   3.390   1.533   1.00 0.00 ? 73  ILE A HG21 2  
ATOM 2478  H HG22 . ILE A 1 73  ? 5.488   2.289   0.958   1.00 0.00 ? 73  ILE A HG22 2  
ATOM 2479  H HG23 . ILE A 1 73  ? 6.102   3.574   -0.110  1.00 0.00 ? 73  ILE A HG23 2  
ATOM 2480  H HD11 . ILE A 1 73  ? 2.784   3.276   0.098   1.00 0.00 ? 73  ILE A HD11 2  
ATOM 2481  H HD12 . ILE A 1 73  ? 1.730   2.702   1.413   1.00 0.00 ? 73  ILE A HD12 2  
ATOM 2482  H HD13 . ILE A 1 73  ? 1.918   4.448   1.121   1.00 0.00 ? 73  ILE A HD13 2  
ATOM 2483  N N    . LYS A 1 74  ? 6.722   6.968   1.398   1.00 0.00 ? 74  LYS A N    2  
ATOM 2484  C CA   . LYS A 1 74  ? 7.940   7.611   0.937   1.00 0.00 ? 74  LYS A CA   2  
ATOM 2485  C C    . LYS A 1 74  ? 8.618   8.314   2.114   1.00 0.00 ? 74  LYS A C    2  
ATOM 2486  O O    . LYS A 1 74  ? 9.789   8.682   2.032   1.00 0.00 ? 74  LYS A O    2  
ATOM 2487  C CB   . LYS A 1 74  ? 7.644   8.537   -0.244  1.00 0.00 ? 74  LYS A CB   2  
ATOM 2488  C CG   . LYS A 1 74  ? 7.835   7.806   -1.575  1.00 0.00 ? 74  LYS A CG   2  
ATOM 2489  C CD   . LYS A 1 74  ? 7.744   8.779   -2.753  1.00 0.00 ? 74  LYS A CD   2  
ATOM 2490  C CE   . LYS A 1 74  ? 7.706   8.026   -4.084  1.00 0.00 ? 74  LYS A CE   2  
ATOM 2491  N NZ   . LYS A 1 74  ? 6.396   8.209   -4.746  1.00 0.00 ? 74  LYS A NZ   2  
ATOM 2492  H H    . LYS A 1 74  ? 5.879   7.467   1.198   1.00 0.00 ? 74  LYS A H    2  
ATOM 2493  H HA   . LYS A 1 74  ? 8.605   6.827   0.573   1.00 0.00 ? 74  LYS A HA   2  
ATOM 2494  H HB2  . LYS A 1 74  ? 6.621   8.908   -0.173  1.00 0.00 ? 74  LYS A HB2  2  
ATOM 2495  H HB3  . LYS A 1 74  ? 8.301   9.405   -0.204  1.00 0.00 ? 74  LYS A HB3  2  
ATOM 2496  H HG2  . LYS A 1 74  ? 8.805   7.309   -1.584  1.00 0.00 ? 74  LYS A HG2  2  
ATOM 2497  H HG3  . LYS A 1 74  ? 7.078   7.030   -1.680  1.00 0.00 ? 74  LYS A HG3  2  
ATOM 2498  H HD2  . LYS A 1 74  ? 6.849   9.393   -2.653  1.00 0.00 ? 74  LYS A HD2  2  
ATOM 2499  H HD3  . LYS A 1 74  ? 8.598   9.456   -2.737  1.00 0.00 ? 74  LYS A HD3  2  
ATOM 2500  H HE2  . LYS A 1 74  ? 8.503   8.386   -4.735  1.00 0.00 ? 74  LYS A HE2  2  
ATOM 2501  H HE3  . LYS A 1 74  ? 7.889   6.965   -3.914  1.00 0.00 ? 74  LYS A HE3  2  
ATOM 2502  H HZ1  . LYS A 1 74  ? 5.984   9.067   -4.439  1.00 0.00 ? 74  LYS A HZ1  2  
ATOM 2503  H HZ2  . LYS A 1 74  ? 6.524   8.238   -5.738  1.00 0.00 ? 74  LYS A HZ2  2  
ATOM 2504  H HZ3  . LYS A 1 74  ? 5.793   7.447   -4.510  1.00 0.00 ? 74  LYS A HZ3  2  
ATOM 2505  N N    . ALA A 1 75  ? 7.853   8.480   3.183   1.00 0.00 ? 75  ALA A N    2  
ATOM 2506  C CA   . ALA A 1 75  ? 8.365   9.133   4.376   1.00 0.00 ? 75  ALA A CA   2  
ATOM 2507  C C    . ALA A 1 75  ? 8.880   8.073   5.352   1.00 0.00 ? 75  ALA A C    2  
ATOM 2508  O O    . ALA A 1 75  ? 9.118   8.364   6.523   1.00 0.00 ? 75  ALA A O    2  
ATOM 2509  C CB   . ALA A 1 75  ? 7.270   10.007  4.990   1.00 0.00 ? 75  ALA A CB   2  
ATOM 2510  H H    . ALA A 1 75  ? 6.902   8.178   3.243   1.00 0.00 ? 75  ALA A H    2  
ATOM 2511  H HA   . ALA A 1 75  ? 9.196   9.771   4.075   1.00 0.00 ? 75  ALA A HA   2  
ATOM 2512  H HB1  . ALA A 1 75  ? 7.725   10.767  5.625   1.00 0.00 ? 75  ALA A HB1  2  
ATOM 2513  H HB2  . ALA A 1 75  ? 6.703   10.491  4.195   1.00 0.00 ? 75  ALA A HB2  2  
ATOM 2514  H HB3  . ALA A 1 75  ? 6.602   9.387   5.587   1.00 0.00 ? 75  ALA A HB3  2  
ATOM 2515  N N    . CYS A 1 76  ? 9.037   6.863   4.833   1.00 0.00 ? 76  CYS A N    2  
ATOM 2516  C CA   . CYS A 1 76  ? 9.519   5.758   5.643   1.00 0.00 ? 76  CYS A CA   2  
ATOM 2517  C C    . CYS A 1 76  ? 10.975  6.038   6.021   1.00 0.00 ? 76  CYS A C    2  
ATOM 2518  O O    . CYS A 1 76  ? 11.887  5.742   5.252   1.00 0.00 ? 76  CYS A O    2  
ATOM 2519  C CB   . CYS A 1 76  ? 9.364   4.418   4.922   1.00 0.00 ? 76  CYS A CB   2  
ATOM 2520  S SG   . CYS A 1 76  ? 10.315  4.436   3.358   1.00 0.00 ? 76  CYS A SG   2  
ATOM 2521  H H    . CYS A 1 76  ? 8.841   6.634   3.879   1.00 0.00 ? 76  CYS A H    2  
ATOM 2522  H HA   . CYS A 1 76  ? 8.888   5.723   6.532   1.00 0.00 ? 76  CYS A HA   2  
ATOM 2523  H HB2  . CYS A 1 76  ? 9.716   3.608   5.561   1.00 0.00 ? 76  CYS A HB2  2  
ATOM 2524  H HB3  . CYS A 1 76  ? 8.311   4.226   4.715   1.00 0.00 ? 76  CYS A HB3  2  
ATOM 2525  H HG   . CYS A 1 76  ? 11.317  3.679   3.795   1.00 0.00 ? 76  CYS A HG   2  
ATOM 2526  N N    . THR A 1 77  ? 11.147  6.606   7.206   1.00 0.00 ? 77  THR A N    2  
ATOM 2527  C CA   . THR A 1 77  ? 12.476  6.930   7.695   1.00 0.00 ? 77  THR A CA   2  
ATOM 2528  C C    . THR A 1 77  ? 13.383  5.700   7.628   1.00 0.00 ? 77  THR A C    2  
ATOM 2529  O O    . THR A 1 77  ? 14.603  5.828   7.539   1.00 0.00 ? 77  THR A O    2  
ATOM 2530  C CB   . THR A 1 77  ? 12.334  7.504   9.106   1.00 0.00 ? 77  THR A CB   2  
ATOM 2531  O OG1  . THR A 1 77  ? 13.601  8.101   9.367   1.00 0.00 ? 77  THR A OG1  2  
ATOM 2532  C CG2  . THR A 1 77  ? 12.208  6.414   10.172  1.00 0.00 ? 77  THR A CG2  2  
ATOM 2533  H H    . THR A 1 77  ? 10.399  6.844   7.826   1.00 0.00 ? 77  THR A H    2  
ATOM 2534  H HA   . THR A 1 77  ? 12.910  7.683   7.037   1.00 0.00 ? 77  THR A HA   2  
ATOM 2535  H HB   . THR A 1 77  ? 11.497  8.200   9.160   1.00 0.00 ? 77  THR A HB   2  
ATOM 2536  H HG1  . THR A 1 77  ? 13.838  8.737   8.633   1.00 0.00 ? 77  THR A HG1  2  
ATOM 2537  H HG21 . THR A 1 77  ? 13.103  6.409   10.794  1.00 0.00 ? 77  THR A HG21 2  
ATOM 2538  H HG22 . THR A 1 77  ? 11.335  6.612   10.793  1.00 0.00 ? 77  THR A HG22 2  
ATOM 2539  H HG23 . THR A 1 77  ? 12.097  5.443   9.688   1.00 0.00 ? 77  THR A HG23 2  
ATOM 2540  N N    . GLY A 1 78  ? 12.752  4.536   7.673   1.00 0.00 ? 78  GLY A N    2  
ATOM 2541  C CA   . GLY A 1 78  ? 13.487  3.283   7.618   1.00 0.00 ? 78  GLY A CA   2  
ATOM 2542  C C    . GLY A 1 78  ? 12.533  2.093   7.503   1.00 0.00 ? 78  GLY A C    2  
ATOM 2543  O O    . GLY A 1 78  ? 12.616  1.316   6.553   1.00 0.00 ? 78  GLY A O    2  
ATOM 2544  H H    . GLY A 1 78  ? 11.759  4.440   7.745   1.00 0.00 ? 78  GLY A H    2  
ATOM 2545  H HA2  . GLY A 1 78  ? 14.166  3.293   6.766   1.00 0.00 ? 78  GLY A HA2  2  
ATOM 2546  H HA3  . GLY A 1 78  ? 14.099  3.178   8.513   1.00 0.00 ? 78  GLY A HA3  2  
ATOM 2547  N N    . SER A 1 79  ? 11.649  1.986   8.484   1.00 0.00 ? 79  SER A N    2  
ATOM 2548  C CA   . SER A 1 79  ? 10.680  0.904   8.505   1.00 0.00 ? 79  SER A CA   2  
ATOM 2549  C C    . SER A 1 79  ? 9.277   1.451   8.239   1.00 0.00 ? 79  SER A C    2  
ATOM 2550  O O    . SER A 1 79  ? 9.051   2.658   8.323   1.00 0.00 ? 79  SER A O    2  
ATOM 2551  C CB   . SER A 1 79  ? 10.715  0.159   9.841   1.00 0.00 ? 79  SER A CB   2  
ATOM 2552  O OG   . SER A 1 79  ? 10.970  1.037   10.935  1.00 0.00 ? 79  SER A OG   2  
ATOM 2553  H H    . SER A 1 79  ? 11.588  2.623   9.253   1.00 0.00 ? 79  SER A H    2  
ATOM 2554  H HA   . SER A 1 79  ? 10.985  0.228   7.706   1.00 0.00 ? 79  SER A HA   2  
ATOM 2555  H HB2  . SER A 1 79  ? 9.763   -0.348  9.998   1.00 0.00 ? 79  SER A HB2  2  
ATOM 2556  H HB3  . SER A 1 79  ? 11.485  -0.611  9.807   1.00 0.00 ? 79  SER A HB3  2  
ATOM 2557  H HG   . SER A 1 79  ? 11.332  0.520   11.711  1.00 0.00 ? 79  SER A HG   2  
ATOM 2558  N N    . LEU A 1 80  ? 8.370   0.539   7.923   1.00 0.00 ? 80  LEU A N    2  
ATOM 2559  C CA   . LEU A 1 80  ? 6.994   0.915   7.644   1.00 0.00 ? 80  LEU A CA   2  
ATOM 2560  C C    . LEU A 1 80  ? 6.076   0.295   8.699   1.00 0.00 ? 80  LEU A C    2  
ATOM 2561  O O    . LEU A 1 80  ? 5.974   -0.926  8.797   1.00 0.00 ? 80  LEU A O    2  
ATOM 2562  C CB   . LEU A 1 80  ? 6.618   0.545   6.208   1.00 0.00 ? 80  LEU A CB   2  
ATOM 2563  C CG   . LEU A 1 80  ? 5.513   1.387   5.566   1.00 0.00 ? 80  LEU A CG   2  
ATOM 2564  C CD1  . LEU A 1 80  ? 5.819   2.880   5.690   1.00 0.00 ? 80  LEU A CD1  2  
ATOM 2565  C CD2  . LEU A 1 80  ? 5.280   0.968   4.113   1.00 0.00 ? 80  LEU A CD2  2  
ATOM 2566  H H    . LEU A 1 80  ? 8.561   -0.441  7.857   1.00 0.00 ? 80  LEU A H    2  
ATOM 2567  H HA   . LEU A 1 80  ? 6.930   2.000   7.725   1.00 0.00 ? 80  LEU A HA   2  
ATOM 2568  H HB2  . LEU A 1 80  ? 7.512   0.622   5.588   1.00 0.00 ? 80  LEU A HB2  2  
ATOM 2569  H HB3  . LEU A 1 80  ? 6.308   -0.499  6.192   1.00 0.00 ? 80  LEU A HB3  2  
ATOM 2570  H HG   . LEU A 1 80  ? 4.585   1.202   6.107   1.00 0.00 ? 80  LEU A HG   2  
ATOM 2571  H HD11 . LEU A 1 80  ? 5.467   3.244   6.656   1.00 0.00 ? 80  LEU A HD11 2  
ATOM 2572  H HD12 . LEU A 1 80  ? 6.895   3.039   5.613   1.00 0.00 ? 80  LEU A HD12 2  
ATOM 2573  H HD13 . LEU A 1 80  ? 5.313   3.423   4.891   1.00 0.00 ? 80  LEU A HD13 2  
ATOM 2574  H HD21 . LEU A 1 80  ? 4.213   0.821   3.944   1.00 0.00 ? 80  LEU A HD21 2  
ATOM 2575  H HD22 . LEU A 1 80  ? 5.649   1.748   3.447   1.00 0.00 ? 80  LEU A HD22 2  
ATOM 2576  H HD23 . LEU A 1 80  ? 5.811   0.038   3.913   1.00 0.00 ? 80  LEU A HD23 2  
ATOM 2577  N N    . ASN A 1 81  ? 5.432   1.166   9.462   1.00 0.00 ? 81  ASN A N    2  
ATOM 2578  C CA   . ASN A 1 81  ? 4.526   0.720   10.507  1.00 0.00 ? 81  ASN A CA   2  
ATOM 2579  C C    . ASN A 1 81  ? 3.087   1.048   10.102  1.00 0.00 ? 81  ASN A C    2  
ATOM 2580  O O    . ASN A 1 81  ? 2.669   2.203   10.166  1.00 0.00 ? 81  ASN A O    2  
ATOM 2581  C CB   . ASN A 1 81  ? 4.819   1.429   11.830  1.00 0.00 ? 81  ASN A CB   2  
ATOM 2582  C CG   . ASN A 1 81  ? 5.633   0.532   12.764  1.00 0.00 ? 81  ASN A CG   2  
ATOM 2583  O OD1  . ASN A 1 81  ? 5.147   0.029   13.764  1.00 0.00 ? 81  ASN A OD1  2  
ATOM 2584  N ND2  . ASN A 1 81  ? 6.896   0.360   12.384  1.00 0.00 ? 81  ASN A ND2  2  
ATOM 2585  H H    . ASN A 1 81  ? 5.521   2.159   9.376   1.00 0.00 ? 81  ASN A H    2  
ATOM 2586  H HA   . ASN A 1 81  ? 4.699   -0.352  10.597  1.00 0.00 ? 81  ASN A HA   2  
ATOM 2587  H HB2  . ASN A 1 81  ? 5.365   2.353   11.639  1.00 0.00 ? 81  ASN A HB2  2  
ATOM 2588  H HB3  . ASN A 1 81  ? 3.882   1.707   12.313  1.00 0.00 ? 81  ASN A HB3  2  
ATOM 2589  H HD21 . ASN A 1 81  ? 7.232   0.802   11.552  1.00 0.00 ? 81  ASN A HD21 2  
ATOM 2590  H HD22 . ASN A 1 81  ? 7.509   -0.210  12.930  1.00 0.00 ? 81  ASN A HD22 2  
ATOM 2591  N N    . MET A 1 82  ? 2.370   0.011   9.695   1.00 0.00 ? 82  MET A N    2  
ATOM 2592  C CA   . MET A 1 82  ? 0.987   0.175   9.280   1.00 0.00 ? 82  MET A CA   2  
ATOM 2593  C C    . MET A 1 82  ? 0.093   -0.891  9.917   1.00 0.00 ? 82  MET A C    2  
ATOM 2594  O O    . MET A 1 82  ? 0.584   -1.914  10.394  1.00 0.00 ? 82  MET A O    2  
ATOM 2595  C CB   . MET A 1 82  ? 0.895   0.075   7.756   1.00 0.00 ? 82  MET A CB   2  
ATOM 2596  C CG   . MET A 1 82  ? 1.987   0.910   7.085   1.00 0.00 ? 82  MET A CG   2  
ATOM 2597  S SD   . MET A 1 82  ? 1.870   0.756   5.311   1.00 0.00 ? 82  MET A SD   2  
ATOM 2598  C CE   . MET A 1 82  ? 2.438   -0.924  5.107   1.00 0.00 ? 82  MET A CE   2  
ATOM 2599  H H    . MET A 1 82  ? 2.717   -0.925  9.646   1.00 0.00 ? 82  MET A H    2  
ATOM 2600  H HA   . MET A 1 82  ? 0.691   1.164   9.631   1.00 0.00 ? 82  MET A HA   2  
ATOM 2601  H HB2  . MET A 1 82  ? 0.990   -0.967  7.451   1.00 0.00 ? 82  MET A HB2  2  
ATOM 2602  H HB3  . MET A 1 82  ? -0.085  0.416   7.424   1.00 0.00 ? 82  MET A HB3  2  
ATOM 2603  H HG2  . MET A 1 82  ? 1.887   1.956   7.375   1.00 0.00 ? 82  MET A HG2  2  
ATOM 2604  H HG3  . MET A 1 82  ? 2.969   0.579   7.423   1.00 0.00 ? 82  MET A HG3  2  
ATOM 2605  H HE1  . MET A 1 82  ? 3.408   -0.922  4.611   1.00 0.00 ? 82  MET A HE1  2  
ATOM 2606  H HE2  . MET A 1 82  ? 2.531   -1.397  6.084   1.00 0.00 ? 82  MET A HE2  2  
ATOM 2607  H HE3  . MET A 1 82  ? 1.721   -1.479  4.501   1.00 0.00 ? 82  MET A HE3  2  
ATOM 2608  N N    . THR A 1 83  ? -1.203  -0.616  9.905   1.00 0.00 ? 83  THR A N    2  
ATOM 2609  C CA   . THR A 1 83  ? -2.169  -1.539  10.475  1.00 0.00 ? 83  THR A CA   2  
ATOM 2610  C C    . THR A 1 83  ? -3.049  -2.137  9.376   1.00 0.00 ? 83  THR A C    2  
ATOM 2611  O O    . THR A 1 83  ? -3.355  -1.469  8.389   1.00 0.00 ? 83  THR A O    2  
ATOM 2612  C CB   . THR A 1 83  ? -2.962  -0.790  11.548  1.00 0.00 ? 83  THR A CB   2  
ATOM 2613  O OG1  . THR A 1 83  ? -1.986  0.018   12.200  1.00 0.00 ? 83  THR A OG1  2  
ATOM 2614  C CG2  . THR A 1 83  ? -3.475  -1.718  12.652  1.00 0.00 ? 83  THR A CG2  2  
ATOM 2615  H H    . THR A 1 83  ? -1.594  0.218   9.516   1.00 0.00 ? 83  THR A H    2  
ATOM 2616  H HA   . THR A 1 83  ? -1.626  -2.365  10.934  1.00 0.00 ? 83  THR A HA   2  
ATOM 2617  H HB   . THR A 1 83  ? -3.780  -0.224  11.104  1.00 0.00 ? 83  THR A HB   2  
ATOM 2618  H HG1  . THR A 1 83  ? -2.436  0.689   12.790  1.00 0.00 ? 83  THR A HG1  2  
ATOM 2619  H HG21 . THR A 1 83  ? -3.992  -1.129  13.410  1.00 0.00 ? 83  THR A HG21 2  
ATOM 2620  H HG22 . THR A 1 83  ? -4.164  -2.445  12.224  1.00 0.00 ? 83  THR A HG22 2  
ATOM 2621  H HG23 . THR A 1 83  ? -2.633  -2.239  13.108  1.00 0.00 ? 83  THR A HG23 2  
ATOM 2622  N N    . LEU A 1 84  ? -3.431  -3.388  9.583   1.00 0.00 ? 84  LEU A N    2  
ATOM 2623  C CA   . LEU A 1 84  ? -4.270  -4.084  8.622   1.00 0.00 ? 84  LEU A CA   2  
ATOM 2624  C C    . LEU A 1 84  ? -5.638  -4.358  9.250   1.00 0.00 ? 84  LEU A C    2  
ATOM 2625  O O    . LEU A 1 84  ? -5.808  -4.222  10.460  1.00 0.00 ? 84  LEU A O    2  
ATOM 2626  C CB   . LEU A 1 84  ? -3.566  -5.341  8.107   1.00 0.00 ? 84  LEU A CB   2  
ATOM 2627  C CG   . LEU A 1 84  ? -2.229  -5.118  7.398   1.00 0.00 ? 84  LEU A CG   2  
ATOM 2628  C CD1  . LEU A 1 84  ? -1.763  -6.394  6.694   1.00 0.00 ? 84  LEU A CD1  2  
ATOM 2629  C CD2  . LEU A 1 84  ? -2.308  -3.929  6.439   1.00 0.00 ? 84  LEU A CD2  2  
ATOM 2630  H H    . LEU A 1 84  ? -3.178  -3.924  10.388  1.00 0.00 ? 84  LEU A H    2  
ATOM 2631  H HA   . LEU A 1 84  ? -4.408  -3.420  7.768   1.00 0.00 ? 84  LEU A HA   2  
ATOM 2632  H HB2  . LEU A 1 84  ? -3.401  -6.012  8.950   1.00 0.00 ? 84  LEU A HB2  2  
ATOM 2633  H HB3  . LEU A 1 84  ? -4.239  -5.853  7.419   1.00 0.00 ? 84  LEU A HB3  2  
ATOM 2634  H HG   . LEU A 1 84  ? -1.479  -4.875  8.151   1.00 0.00 ? 84  LEU A HG   2  
ATOM 2635  H HD11 . LEU A 1 84  ? -0.882  -6.174  6.090   1.00 0.00 ? 84  LEU A HD11 2  
ATOM 2636  H HD12 . LEU A 1 84  ? -1.513  -7.150  7.438   1.00 0.00 ? 84  LEU A HD12 2  
ATOM 2637  H HD13 . LEU A 1 84  ? -2.560  -6.766  6.051   1.00 0.00 ? 84  LEU A HD13 2  
ATOM 2638  H HD21 . LEU A 1 84  ? -3.252  -3.964  5.894   1.00 0.00 ? 84  LEU A HD21 2  
ATOM 2639  H HD22 . LEU A 1 84  ? -2.250  -3.000  7.005   1.00 0.00 ? 84  LEU A HD22 2  
ATOM 2640  H HD23 . LEU A 1 84  ? -1.479  -3.977  5.732   1.00 0.00 ? 84  LEU A HD23 2  
ATOM 2641  N N    . GLN A 1 85  ? -6.579  -4.740  8.398   1.00 0.00 ? 85  GLN A N    2  
ATOM 2642  C CA   . GLN A 1 85  ? -7.926  -5.034  8.854   1.00 0.00 ? 85  GLN A CA   2  
ATOM 2643  C C    . GLN A 1 85  ? -8.258  -6.508  8.611   1.00 0.00 ? 85  GLN A C    2  
ATOM 2644  O O    . GLN A 1 85  ? -7.905  -7.065  7.573   1.00 0.00 ? 85  GLN A O    2  
ATOM 2645  C CB   . GLN A 1 85  ? -8.948  -4.122  8.172   1.00 0.00 ? 85  GLN A CB   2  
ATOM 2646  C CG   . GLN A 1 85  ? -10.369 -4.659  8.353   1.00 0.00 ? 85  GLN A CG   2  
ATOM 2647  C CD   . GLN A 1 85  ? -10.870 -5.329  7.072   1.00 0.00 ? 85  GLN A CD   2  
ATOM 2648  O OE1  . GLN A 1 85  ? -10.357 -6.344  6.630   1.00 0.00 ? 85  GLN A OE1  2  
ATOM 2649  N NE2  . GLN A 1 85  ? -11.898 -4.706  6.502   1.00 0.00 ? 85  GLN A NE2  2  
ATOM 2650  H H    . GLN A 1 85  ? -6.432  -4.848  7.415   1.00 0.00 ? 85  GLN A H    2  
ATOM 2651  H HA   . GLN A 1 85  ? -7.922  -4.827  9.924   1.00 0.00 ? 85  GLN A HA   2  
ATOM 2652  H HB2  . GLN A 1 85  ? -8.879  -3.117  8.588   1.00 0.00 ? 85  GLN A HB2  2  
ATOM 2653  H HB3  . GLN A 1 85  ? -8.718  -4.044  7.109   1.00 0.00 ? 85  GLN A HB3  2  
ATOM 2654  H HG2  . GLN A 1 85  ? -10.389 -5.376  9.174   1.00 0.00 ? 85  GLN A HG2  2  
ATOM 2655  H HG3  . GLN A 1 85  ? -11.038 -3.843  8.626   1.00 0.00 ? 85  GLN A HG3  2  
ATOM 2656  H HE21 . GLN A 1 85  ? -12.272 -3.876  6.916   1.00 0.00 ? 85  GLN A HE21 2  
ATOM 2657  H HE22 . GLN A 1 85  ? -12.296 -5.067  5.659   1.00 0.00 ? 85  GLN A HE22 2  
ATOM 2658  N N    . ARG A 1 86  ? -8.934  -7.098  9.587   1.00 0.00 ? 86  ARG A N    2  
ATOM 2659  C CA   . ARG A 1 86  ? -9.317  -8.496  9.492   1.00 0.00 ? 86  ARG A CA   2  
ATOM 2660  C C    . ARG A 1 86  ? -10.510 -8.656  8.547   1.00 0.00 ? 86  ARG A C    2  
ATOM 2661  O O    . ARG A 1 86  ? -11.330 -7.749  8.417   1.00 0.00 ? 86  ARG A O    2  
ATOM 2662  C CB   . ARG A 1 86  ? -9.685  -9.060  10.866  1.00 0.00 ? 86  ARG A CB   2  
ATOM 2663  C CG   . ARG A 1 86  ? -11.122 -8.694  11.243  1.00 0.00 ? 86  ARG A CG   2  
ATOM 2664  C CD   . ARG A 1 86  ? -11.290 -7.177  11.353  1.00 0.00 ? 86  ARG A CD   2  
ATOM 2665  N NE   . ARG A 1 86  ? -12.575 -6.857  12.013  1.00 0.00 ? 86  ARG A NE   2  
ATOM 2666  C CZ   . ARG A 1 86  ? -13.771 -6.947  11.414  1.00 0.00 ? 86  ARG A CZ   2  
ATOM 2667  N NH1  . ARG A 1 86  ? -13.852 -7.348  10.138  1.00 0.00 ? 86  ARG A NH1  2  
ATOM 2668  N NH2  . ARG A 1 86  ? -14.884 -6.636  12.092  1.00 0.00 ? 86  ARG A NH2  2  
ATOM 2669  H H    . ARG A 1 86  ? -9.217  -6.638  10.428  1.00 0.00 ? 86  ARG A H    2  
ATOM 2670  H HA   . ARG A 1 86  ? -8.435  -9.001  9.100   1.00 0.00 ? 86  ARG A HA   2  
ATOM 2671  H HB2  . ARG A 1 86  ? -9.572  -10.145 10.860  1.00 0.00 ? 86  ARG A HB2  2  
ATOM 2672  H HB3  . ARG A 1 86  ? -8.998  -8.673  11.618  1.00 0.00 ? 86  ARG A HB3  2  
ATOM 2673  H HG2  . ARG A 1 86  ? -11.810 -9.086  10.493  1.00 0.00 ? 86  ARG A HG2  2  
ATOM 2674  H HG3  . ARG A 1 86  ? -11.384 -9.162  12.191  1.00 0.00 ? 86  ARG A HG3  2  
ATOM 2675  H HD2  . ARG A 1 86  ? -10.464 -6.752  11.922  1.00 0.00 ? 86  ARG A HD2  2  
ATOM 2676  H HD3  . ARG A 1 86  ? -11.260 -6.727  10.361  1.00 0.00 ? 86  ARG A HD3  2  
ATOM 2677  H HE   . ARG A 1 86  ? -12.550 -6.555  12.966  1.00 0.00 ? 86  ARG A HE   2  
ATOM 2678  H HH11 . ARG A 1 86  ? -13.021 -7.580  9.633   1.00 0.00 ? 86  ARG A HH11 2  
ATOM 2679  H HH12 . ARG A 1 86  ? -14.744 -7.415  9.692   1.00 0.00 ? 86  ARG A HH12 2  
ATOM 2680  H HH21 . ARG A 1 86  ? -14.824 -6.337  13.044  1.00 0.00 ? 86  ARG A HH21 2  
ATOM 2681  H HH22 . ARG A 1 86  ? -15.776 -6.703  11.645  1.00 0.00 ? 86  ARG A HH22 2  
ATOM 2682  N N    . ALA A 1 87  ? -10.568 -9.817  7.911   1.00 0.00 ? 87  ALA A N    2  
ATOM 2683  C CA   . ALA A 1 87  ? -11.646 -10.108 6.982   1.00 0.00 ? 87  ALA A CA   2  
ATOM 2684  C C    . ALA A 1 87  ? -12.329 -11.415 7.392   1.00 0.00 ? 87  ALA A C    2  
ATOM 2685  O O    . ALA A 1 87  ? -11.790 -12.498 7.167   1.00 0.00 ? 87  ALA A O    2  
ATOM 2686  C CB   . ALA A 1 87  ? -11.091 -10.163 5.557   1.00 0.00 ? 87  ALA A CB   2  
ATOM 2687  H H    . ALA A 1 87  ? -9.897  -10.550 8.023   1.00 0.00 ? 87  ALA A H    2  
ATOM 2688  H HA   . ALA A 1 87  ? -12.369 -9.295  7.046   1.00 0.00 ? 87  ALA A HA   2  
ATOM 2689  H HB1  . ALA A 1 87  ? -11.790 -10.700 4.915   1.00 0.00 ? 87  ALA A HB1  2  
ATOM 2690  H HB2  . ALA A 1 87  ? -10.958 -9.148  5.180   1.00 0.00 ? 87  ALA A HB2  2  
ATOM 2691  H HB3  . ALA A 1 87  ? -10.131 -10.678 5.560   1.00 0.00 ? 87  ALA A HB3  2  
ATOM 2692  N N    . SER A 1 88  ? -13.504 -11.270 7.986   1.00 0.00 ? 88  SER A N    2  
ATOM 2693  C CA   . SER A 1 88  ? -14.266 -12.425 8.429   1.00 0.00 ? 88  SER A CA   2  
ATOM 2694  C C    . SER A 1 88  ? -15.572 -12.525 7.639   1.00 0.00 ? 88  SER A C    2  
ATOM 2695  O O    . SER A 1 88  ? -16.080 -11.521 7.142   1.00 0.00 ? 88  SER A O    2  
ATOM 2696  C CB   . SER A 1 88  ? -14.557 -12.350 9.929   1.00 0.00 ? 88  SER A CB   2  
ATOM 2697  O OG   . SER A 1 88  ? -14.771 -13.640 10.497  1.00 0.00 ? 88  SER A OG   2  
ATOM 2698  H H    . SER A 1 88  ? -13.935 -10.386 8.164   1.00 0.00 ? 88  SER A H    2  
ATOM 2699  H HA   . SER A 1 88  ? -13.629 -13.286 8.226   1.00 0.00 ? 88  SER A HA   2  
ATOM 2700  H HB2  . SER A 1 88  ? -13.723 -11.865 10.437  1.00 0.00 ? 88  SER A HB2  2  
ATOM 2701  H HB3  . SER A 1 88  ? -15.437 -11.730 10.097  1.00 0.00 ? 88  SER A HB3  2  
ATOM 2702  H HG   . SER A 1 88  ? -14.550 -13.626 11.472  1.00 0.00 ? 88  SER A HG   2  
ATOM 2703  N N    . ALA A 1 89  ? -16.080 -13.746 7.549   1.00 0.00 ? 89  ALA A N    2  
ATOM 2704  C CA   . ALA A 1 89  ? -17.318 -13.990 6.828   1.00 0.00 ? 89  ALA A CA   2  
ATOM 2705  C C    . ALA A 1 89  ? -17.122 -13.635 5.353   1.00 0.00 ? 89  ALA A C    2  
ATOM 2706  O O    . ALA A 1 89  ? -17.692 -12.660 4.864   1.00 0.00 ? 89  ALA A O    2  
ATOM 2707  C CB   . ALA A 1 89  ? -18.451 -13.191 7.474   1.00 0.00 ? 89  ALA A CB   2  
ATOM 2708  H H    . ALA A 1 89  ? -15.661 -14.557 7.956   1.00 0.00 ? 89  ALA A H    2  
ATOM 2709  H HA   . ALA A 1 89  ? -17.546 -15.052 6.910   1.00 0.00 ? 89  ALA A HA   2  
ATOM 2710  H HB1  . ALA A 1 89  ? -19.314 -13.180 6.808   1.00 0.00 ? 89  ALA A HB1  2  
ATOM 2711  H HB2  . ALA A 1 89  ? -18.729 -13.655 8.421   1.00 0.00 ? 89  ALA A HB2  2  
ATOM 2712  H HB3  . ALA A 1 89  ? -18.118 -12.169 7.655   1.00 0.00 ? 89  ALA A HB3  2  
ATOM 2713  N N    . ALA A 1 90  ? -16.315 -14.445 4.684   1.00 0.00 ? 90  ALA A N    2  
ATOM 2714  C CA   . ALA A 1 90  ? -16.037 -14.229 3.274   1.00 0.00 ? 90  ALA A CA   2  
ATOM 2715  C C    . ALA A 1 90  ? -15.708 -15.569 2.613   1.00 0.00 ? 90  ALA A C    2  
ATOM 2716  O O    . ALA A 1 90  ? -14.551 -15.840 2.294   1.00 0.00 ? 90  ALA A O    2  
ATOM 2717  C CB   . ALA A 1 90  ? -14.904 -13.212 3.127   1.00 0.00 ? 90  ALA A CB   2  
ATOM 2718  H H    . ALA A 1 90  ? -15.856 -15.236 5.089   1.00 0.00 ? 90  ALA A H    2  
ATOM 2719  H HA   . ALA A 1 90  ? -16.938 -13.820 2.817   1.00 0.00 ? 90  ALA A HA   2  
ATOM 2720  H HB1  . ALA A 1 90  ? -13.973 -13.650 3.486   1.00 0.00 ? 90  ALA A HB1  2  
ATOM 2721  H HB2  . ALA A 1 90  ? -14.796 -12.938 2.078   1.00 0.00 ? 90  ALA A HB2  2  
ATOM 2722  H HB3  . ALA A 1 90  ? -15.136 -12.322 3.713   1.00 0.00 ? 90  ALA A HB3  2  
ATOM 2723  N N    . ALA A 1 91  ? -16.745 -16.371 2.425   1.00 0.00 ? 91  ALA A N    2  
ATOM 2724  C CA   . ALA A 1 91  ? -16.580 -17.676 1.807   1.00 0.00 ? 91  ALA A CA   2  
ATOM 2725  C C    . ALA A 1 91  ? -17.883 -18.073 1.110   1.00 0.00 ? 91  ALA A C    2  
ATOM 2726  O O    . ALA A 1 91  ? -18.898 -18.300 1.765   1.00 0.00 ? 91  ALA A O    2  
ATOM 2727  C CB   . ALA A 1 91  ? -16.153 -18.693 2.867   1.00 0.00 ? 91  ALA A CB   2  
ATOM 2728  H H    . ALA A 1 91  ? -17.683 -16.143 2.687   1.00 0.00 ? 91  ALA A H    2  
ATOM 2729  H HA   . ALA A 1 91  ? -15.789 -17.592 1.062   1.00 0.00 ? 91  ALA A HA   2  
ATOM 2730  H HB1  . ALA A 1 91  ? -15.284 -19.245 2.511   1.00 0.00 ? 91  ALA A HB1  2  
ATOM 2731  H HB2  . ALA A 1 91  ? -15.899 -18.171 3.790   1.00 0.00 ? 91  ALA A HB2  2  
ATOM 2732  H HB3  . ALA A 1 91  ? -16.972 -19.386 3.056   1.00 0.00 ? 91  ALA A HB3  2  
ATOM 2733  N N    . LYS A 1 92  ? -17.811 -18.145 -0.212  1.00 0.00 ? 92  LYS A N    2  
ATOM 2734  C CA   . LYS A 1 92  ? -18.972 -18.511 -1.005  1.00 0.00 ? 92  LYS A CA   2  
ATOM 2735  C C    . LYS A 1 92  ? -19.196 -20.021 -0.906  1.00 0.00 ? 92  LYS A C    2  
ATOM 2736  O O    . LYS A 1 92  ? -20.261 -20.519 -1.268  1.00 0.00 ? 92  LYS A O    2  
ATOM 2737  C CB   . LYS A 1 92  ? -18.820 -18.004 -2.441  1.00 0.00 ? 92  LYS A CB   2  
ATOM 2738  C CG   . LYS A 1 92  ? -17.596 -18.627 -3.116  1.00 0.00 ? 92  LYS A CG   2  
ATOM 2739  C CD   . LYS A 1 92  ? -16.412 -17.658 -3.104  1.00 0.00 ? 92  LYS A CD   2  
ATOM 2740  C CE   . LYS A 1 92  ? -16.253 -16.969 -4.460  1.00 0.00 ? 92  LYS A CE   2  
ATOM 2741  N NZ   . LYS A 1 92  ? -14.878 -17.150 -4.976  1.00 0.00 ? 92  LYS A NZ   2  
ATOM 2742  H H    . LYS A 1 92  ? -16.981 -17.958 -0.737  1.00 0.00 ? 92  LYS A H    2  
ATOM 2743  H HA   . LYS A 1 92  ? -19.835 -18.004 -0.574  1.00 0.00 ? 92  LYS A HA   2  
ATOM 2744  H HB2  . LYS A 1 92  ? -19.717 -18.245 -3.012  1.00 0.00 ? 92  LYS A HB2  2  
ATOM 2745  H HB3  . LYS A 1 92  ? -18.726 -16.918 -2.440  1.00 0.00 ? 92  LYS A HB3  2  
ATOM 2746  H HG2  . LYS A 1 92  ? -17.322 -19.548 -2.601  1.00 0.00 ? 92  LYS A HG2  2  
ATOM 2747  H HG3  . LYS A 1 92  ? -17.840 -18.896 -4.143  1.00 0.00 ? 92  LYS A HG3  2  
ATOM 2748  H HD2  . LYS A 1 92  ? -16.558 -16.909 -2.326  1.00 0.00 ? 92  LYS A HD2  2  
ATOM 2749  H HD3  . LYS A 1 92  ? -15.498 -18.199 -2.857  1.00 0.00 ? 92  LYS A HD3  2  
ATOM 2750  H HE2  . LYS A 1 92  ? -16.971 -17.380 -5.170  1.00 0.00 ? 92  LYS A HE2  2  
ATOM 2751  H HE3  . LYS A 1 92  ? -16.475 -15.906 -4.363  1.00 0.00 ? 92  LYS A HE3  2  
ATOM 2752  H HZ1  . LYS A 1 92  ? -14.642 -16.383 -5.574  1.00 0.00 ? 92  LYS A HZ1  2  
ATOM 2753  H HZ2  . LYS A 1 92  ? -14.236 -17.184 -4.210  1.00 0.00 ? 92  LYS A HZ2  2  
ATOM 2754  H HZ3  . LYS A 1 92  ? -14.825 -18.004 -5.493  1.00 0.00 ? 92  LYS A HZ3  2  
ATOM 2755  N N    . SER A 1 93  ? -18.176 -20.708 -0.414  1.00 0.00 ? 93  SER A N    2  
ATOM 2756  C CA   . SER A 1 93  ? -18.249 -22.151 -0.263  1.00 0.00 ? 93  SER A CA   2  
ATOM 2757  C C    . SER A 1 93  ? -18.167 -22.527 1.218   1.00 0.00 ? 93  SER A C    2  
ATOM 2758  O O    . SER A 1 93  ? -17.355 -21.974 1.959   1.00 0.00 ? 93  SER A O    2  
ATOM 2759  C CB   . SER A 1 93  ? -17.134 -22.844 -1.048  1.00 0.00 ? 93  SER A CB   2  
ATOM 2760  O OG   . SER A 1 93  ? -15.844 -22.546 -0.521  1.00 0.00 ? 93  SER A OG   2  
ATOM 2761  H H    . SER A 1 93  ? -17.313 -20.295 -0.122  1.00 0.00 ? 93  SER A H    2  
ATOM 2762  H HA   . SER A 1 93  ? -19.216 -22.436 -0.677  1.00 0.00 ? 93  SER A HA   2  
ATOM 2763  H HB2  . SER A 1 93  ? -17.293 -23.922 -1.029  1.00 0.00 ? 93  SER A HB2  2  
ATOM 2764  H HB3  . SER A 1 93  ? -17.179 -22.534 -2.092  1.00 0.00 ? 93  SER A HB3  2  
ATOM 2765  H HG   . SER A 1 93  ? -15.136 -22.950 -1.099  1.00 0.00 ? 93  SER A HG   2  
ATOM 2766  N N    . GLU A 1 94  ? -19.020 -23.464 1.606   1.00 0.00 ? 94  GLU A N    2  
ATOM 2767  C CA   . GLU A 1 94  ? -19.054 -23.920 2.985   1.00 0.00 ? 94  GLU A CA   2  
ATOM 2768  C C    . GLU A 1 94  ? -18.421 -25.308 3.101   1.00 0.00 ? 94  GLU A C    2  
ATOM 2769  O O    . GLU A 1 94  ? -18.473 -26.099 2.160   1.00 0.00 ? 94  GLU A O    2  
ATOM 2770  C CB   . GLU A 1 94  ? -20.485 -23.923 3.526   1.00 0.00 ? 94  GLU A CB   2  
ATOM 2771  C CG   . GLU A 1 94  ? -21.048 -22.502 3.596   1.00 0.00 ? 94  GLU A CG   2  
ATOM 2772  C CD   . GLU A 1 94  ? -22.545 -22.521 3.915   1.00 0.00 ? 94  GLU A CD   2  
ATOM 2773  O OE1  . GLU A 1 94  ? -22.871 -22.785 5.092   1.00 0.00 ? 94  GLU A OE1  2  
ATOM 2774  O OE2  . GLU A 1 94  ? -23.328 -22.269 2.974   1.00 0.00 ? 94  GLU A OE2  2  
ATOM 2775  H H    . GLU A 1 94  ? -19.677 -23.909 0.997   1.00 0.00 ? 94  GLU A H    2  
ATOM 2776  H HA   . GLU A 1 94  ? -18.463 -23.196 3.545   1.00 0.00 ? 94  GLU A HA   2  
ATOM 2777  H HB2  . GLU A 1 94  ? -21.118 -24.538 2.886   1.00 0.00 ? 94  GLU A HB2  2  
ATOM 2778  H HB3  . GLU A 1 94  ? -20.502 -24.374 4.518   1.00 0.00 ? 94  GLU A HB3  2  
ATOM 2779  H HG2  . GLU A 1 94  ? -20.517 -21.934 4.359   1.00 0.00 ? 94  GLU A HG2  2  
ATOM 2780  H HG3  . GLU A 1 94  ? -20.881 -21.994 2.646   1.00 0.00 ? 94  GLU A HG3  2  
ATOM 2781  N N    . PRO A 1 95  ? -17.822 -25.569 4.294   1.00 0.00 ? 95  PRO A N    2  
ATOM 2782  C CA   . PRO A 1 95  ? -17.179 -26.848 4.545   1.00 0.00 ? 95  PRO A CA   2  
ATOM 2783  C C    . PRO A 1 95  ? -18.218 -27.945 4.788   1.00 0.00 ? 95  PRO A C    2  
ATOM 2784  O O    . PRO A 1 95  ? -18.831 -28.000 5.853   1.00 0.00 ? 95  PRO A O    2  
ATOM 2785  C CB   . PRO A 1 95  ? -16.279 -26.606 5.746   1.00 0.00 ? 95  PRO A CB   2  
ATOM 2786  C CG   . PRO A 1 95  ? -16.796 -25.339 6.407   1.00 0.00 ? 95  PRO A CG   2  
ATOM 2787  C CD   . PRO A 1 95  ? -17.741 -24.656 5.431   1.00 0.00 ? 95  PRO A CD   2  
ATOM 2788  H HA   . PRO A 1 95  ? -16.658 -27.138 3.743   1.00 0.00 ? 95  PRO A HA   2  
ATOM 2789  H HB2  . PRO A 1 95  ? -16.314 -27.449 6.436   1.00 0.00 ? 95  PRO A HB2  2  
ATOM 2790  H HB3  . PRO A 1 95  ? -15.240 -26.490 5.437   1.00 0.00 ? 95  PRO A HB3  2  
ATOM 2791  H HG2  . PRO A 1 95  ? -17.314 -25.577 7.336   1.00 0.00 ? 95  PRO A HG2  2  
ATOM 2792  H HG3  . PRO A 1 95  ? -15.969 -24.677 6.663   1.00 0.00 ? 95  PRO A HG3  2  
ATOM 2793  H HD2  . PRO A 1 95  ? -18.721 -24.492 5.878   1.00 0.00 ? 95  PRO A HD2  2  
ATOM 2794  H HD3  . PRO A 1 95  ? -17.361 -23.680 5.129   1.00 0.00 ? 95  PRO A HD3  2  
ATOM 2795  N N    . VAL A 1 96  ? -18.384 -28.791 3.782   1.00 0.00 ? 96  VAL A N    2  
ATOM 2796  C CA   . VAL A 1 96  ? -19.337 -29.884 3.872   1.00 0.00 ? 96  VAL A CA   2  
ATOM 2797  C C    . VAL A 1 96  ? -18.619 -31.143 4.360   1.00 0.00 ? 96  VAL A C    2  
ATOM 2798  O O    . VAL A 1 96  ? -17.632 -31.570 3.762   1.00 0.00 ? 96  VAL A O    2  
ATOM 2799  C CB   . VAL A 1 96  ? -20.039 -30.079 2.527   1.00 0.00 ? 96  VAL A CB   2  
ATOM 2800  C CG1  . VAL A 1 96  ? -20.915 -31.333 2.542   1.00 0.00 ? 96  VAL A CG1  2  
ATOM 2801  C CG2  . VAL A 1 96  ? -20.858 -28.842 2.151   1.00 0.00 ? 96  VAL A CG2  2  
ATOM 2802  H H    . VAL A 1 96  ? -17.881 -28.739 2.919   1.00 0.00 ? 96  VAL A H    2  
ATOM 2803  H HA   . VAL A 1 96  ? -20.091 -29.602 4.608   1.00 0.00 ? 96  VAL A HA   2  
ATOM 2804  H HB   . VAL A 1 96  ? -19.271 -30.215 1.765   1.00 0.00 ? 96  VAL A HB   2  
ATOM 2805  H HG11 . VAL A 1 96  ? -21.859 -31.123 2.040   1.00 0.00 ? 96  VAL A HG11 2  
ATOM 2806  H HG12 . VAL A 1 96  ? -20.400 -32.142 2.023   1.00 0.00 ? 96  VAL A HG12 2  
ATOM 2807  H HG13 . VAL A 1 96  ? -21.109 -31.628 3.573   1.00 0.00 ? 96  VAL A HG13 2  
ATOM 2808  H HG21 . VAL A 1 96  ? -20.883 -28.738 1.067   1.00 0.00 ? 96  VAL A HG21 2  
ATOM 2809  H HG22 . VAL A 1 96  ? -21.875 -28.952 2.529   1.00 0.00 ? 96  VAL A HG22 2  
ATOM 2810  H HG23 . VAL A 1 96  ? -20.401 -27.956 2.591   1.00 0.00 ? 96  VAL A HG23 2  
ATOM 2811  N N    . SER A 1 97  ? -19.141 -31.703 5.441   1.00 0.00 ? 97  SER A N    2  
ATOM 2812  C CA   . SER A 1 97  ? -18.562 -32.905 6.015   1.00 0.00 ? 97  SER A CA   2  
ATOM 2813  C C    . SER A 1 97  ? -18.928 -34.122 5.163   1.00 0.00 ? 97  SER A C    2  
ATOM 2814  O O    . SER A 1 97  ? -19.910 -34.092 4.422   1.00 0.00 ? 97  SER A O    2  
ATOM 2815  C CB   . SER A 1 97  ? -19.031 -33.108 7.458   1.00 0.00 ? 97  SER A CB   2  
ATOM 2816  O OG   . SER A 1 97  ? -18.513 -32.109 8.332   1.00 0.00 ? 97  SER A OG   2  
ATOM 2817  H H    . SER A 1 97  ? -19.944 -31.350 5.921   1.00 0.00 ? 97  SER A H    2  
ATOM 2818  H HA   . SER A 1 97  ? -17.485 -32.741 6.004   1.00 0.00 ? 97  SER A HA   2  
ATOM 2819  H HB2  . SER A 1 97  ? -20.120 -33.089 7.491   1.00 0.00 ? 97  SER A HB2  2  
ATOM 2820  H HB3  . SER A 1 97  ? -18.719 -34.092 7.806   1.00 0.00 ? 97  SER A HB3  2  
ATOM 2821  H HG   . SER A 1 97  ? -19.226 -31.445 8.555   1.00 0.00 ? 97  SER A HG   2  
ATOM 2822  N N    . SER A 1 98  ? -18.120 -35.163 5.296   1.00 0.00 ? 98  SER A N    2  
ATOM 2823  C CA   . SER A 1 98  ? -18.347 -36.387 4.547   1.00 0.00 ? 98  SER A CA   2  
ATOM 2824  C C    . SER A 1 98  ? -17.649 -37.561 5.239   1.00 0.00 ? 98  SER A C    2  
ATOM 2825  O O    . SER A 1 98  ? -16.421 -37.615 5.290   1.00 0.00 ? 98  SER A O    2  
ATOM 2826  C CB   . SER A 1 98  ? -17.852 -36.251 3.106   1.00 0.00 ? 98  SER A CB   2  
ATOM 2827  O OG   . SER A 1 98  ? -18.417 -37.242 2.252   1.00 0.00 ? 98  SER A OG   2  
ATOM 2828  H H    . SER A 1 98  ? -17.324 -35.179 5.901   1.00 0.00 ? 98  SER A H    2  
ATOM 2829  H HA   . SER A 1 98  ? -19.427 -36.530 4.548   1.00 0.00 ? 98  SER A HA   2  
ATOM 2830  H HB2  . SER A 1 98  ? -18.104 -35.260 2.728   1.00 0.00 ? 98  SER A HB2  2  
ATOM 2831  H HB3  . SER A 1 98  ? -16.765 -36.332 3.086   1.00 0.00 ? 98  SER A HB3  2  
ATOM 2832  H HG   . SER A 1 98  ? -18.146 -38.154 2.560   1.00 0.00 ? 98  SER A HG   2  
ATOM 2833  N N    . GLY A 1 99  ? -18.463 -38.471 5.753   1.00 0.00 ? 99  GLY A N    2  
ATOM 2834  C CA   . GLY A 1 99  ? -17.939 -39.640 6.439   1.00 0.00 ? 99  GLY A CA   2  
ATOM 2835  C C    . GLY A 1 99  ? -16.834 -40.308 5.619   1.00 0.00 ? 99  GLY A C    2  
ATOM 2836  O O    . GLY A 1 99  ? -17.111 -40.979 4.627   1.00 0.00 ? 99  GLY A O    2  
ATOM 2837  H H    . GLY A 1 99  ? -19.460 -38.420 5.707   1.00 0.00 ? 99  GLY A H    2  
ATOM 2838  H HA2  . GLY A 1 99  ? -17.549 -39.349 7.415   1.00 0.00 ? 99  GLY A HA2  2  
ATOM 2839  H HA3  . GLY A 1 99  ? -18.745 -40.352 6.618   1.00 0.00 ? 99  GLY A HA3  2  
ATOM 2840  N N    . PRO A 1 100 ? -15.571 -40.096 6.077   1.00 0.00 ? 100 PRO A N    2  
ATOM 2841  C CA   . PRO A 1 100 ? -14.422 -40.669 5.397   1.00 0.00 ? 100 PRO A CA   2  
ATOM 2842  C C    . PRO A 1 100 ? -14.310 -42.169 5.680   1.00 0.00 ? 100 PRO A C    2  
ATOM 2843  O O    . PRO A 1 100 ? -15.103 -42.722 6.439   1.00 0.00 ? 100 PRO A O    2  
ATOM 2844  C CB   . PRO A 1 100 ? -13.228 -39.878 5.905   1.00 0.00 ? 100 PRO A CB   2  
ATOM 2845  C CG   . PRO A 1 100 ? -13.689 -39.207 7.189   1.00 0.00 ? 100 PRO A CG   2  
ATOM 2846  C CD   . PRO A 1 100 ? -15.204 -39.307 7.250   1.00 0.00 ? 100 PRO A CD   2  
ATOM 2847  H HA   . PRO A 1 100 ? -14.528 -40.585 4.406   1.00 0.00 ? 100 PRO A HA   2  
ATOM 2848  H HB2  . PRO A 1 100 ? -12.376 -40.531 6.090   1.00 0.00 ? 100 PRO A HB2  2  
ATOM 2849  H HB3  . PRO A 1 100 ? -12.909 -39.138 5.171   1.00 0.00 ? 100 PRO A HB3  2  
ATOM 2850  H HG2  . PRO A 1 100 ? -13.240 -39.693 8.056   1.00 0.00 ? 100 PRO A HG2  2  
ATOM 2851  H HG3  . PRO A 1 100 ? -13.373 -38.164 7.210   1.00 0.00 ? 100 PRO A HG3  2  
ATOM 2852  H HD2  . PRO A 1 100 ? -15.533 -39.789 8.170   1.00 0.00 ? 100 PRO A HD2  2  
ATOM 2853  H HD3  . PRO A 1 100 ? -15.667 -38.320 7.224   1.00 0.00 ? 100 PRO A HD3  2  
ATOM 2854  N N    . SER A 1 101 ? -13.317 -42.784 5.054   1.00 0.00 ? 101 SER A N    2  
ATOM 2855  C CA   . SER A 1 101 ? -13.090 -44.208 5.230   1.00 0.00 ? 101 SER A CA   2  
ATOM 2856  C C    . SER A 1 101 ? -12.480 -44.475 6.607   1.00 0.00 ? 101 SER A C    2  
ATOM 2857  O O    . SER A 1 101 ? -11.793 -43.619 7.162   1.00 0.00 ? 101 SER A O    2  
ATOM 2858  C CB   . SER A 1 101 ? -12.181 -44.761 4.130   1.00 0.00 ? 101 SER A CB   2  
ATOM 2859  O OG   . SER A 1 101 ? -12.495 -46.113 3.807   1.00 0.00 ? 101 SER A OG   2  
ATOM 2860  H H    . SER A 1 101 ? -12.675 -42.326 4.438   1.00 0.00 ? 101 SER A H    2  
ATOM 2861  H HA   . SER A 1 101 ? -14.075 -44.669 5.152   1.00 0.00 ? 101 SER A HA   2  
ATOM 2862  H HB2  . SER A 1 101 ? -12.277 -44.143 3.236   1.00 0.00 ? 101 SER A HB2  2  
ATOM 2863  H HB3  . SER A 1 101 ? -11.142 -44.696 4.452   1.00 0.00 ? 101 SER A HB3  2  
ATOM 2864  H HG   . SER A 1 101 ? -13.420 -46.332 4.115   1.00 0.00 ? 101 SER A HG   2  
ATOM 2865  N N    . SER A 1 102 ? -12.752 -45.667 7.118   1.00 0.00 ? 102 SER A N    2  
ATOM 2866  C CA   . SER A 1 102 ? -12.238 -46.058 8.420   1.00 0.00 ? 102 SER A CA   2  
ATOM 2867  C C    . SER A 1 102 ? -11.088 -47.052 8.252   1.00 0.00 ? 102 SER A C    2  
ATOM 2868  O O    . SER A 1 102 ? -11.064 -47.822 7.293   1.00 0.00 ? 102 SER A O    2  
ATOM 2869  C CB   . SER A 1 102 ? -13.342 -46.665 9.288   1.00 0.00 ? 102 SER A CB   2  
ATOM 2870  O OG   . SER A 1 102 ? -13.794 -47.917 8.779   1.00 0.00 ? 102 SER A OG   2  
ATOM 2871  H H    . SER A 1 102 ? -13.312 -46.357 6.660   1.00 0.00 ? 102 SER A H    2  
ATOM 2872  H HA   . SER A 1 102 ? -11.882 -45.135 8.879   1.00 0.00 ? 102 SER A HA   2  
ATOM 2873  H HB2  . SER A 1 102 ? -12.971 -46.800 10.304  1.00 0.00 ? 102 SER A HB2  2  
ATOM 2874  H HB3  . SER A 1 102 ? -14.181 -45.972 9.345   1.00 0.00 ? 102 SER A HB3  2  
ATOM 2875  H HG   . SER A 1 102 ? -13.649 -47.956 7.790   1.00 0.00 ? 102 SER A HG   2  
ATOM 2876  N N    . GLY A 1 103 ? -10.162 -47.003 9.198   1.00 0.00 ? 103 GLY A N    2  
ATOM 2877  C CA   . GLY A 1 103 ? -9.012  -47.890 9.166   1.00 0.00 ? 103 GLY A CA   2  
ATOM 2878  C C    . GLY A 1 103 ? -8.732  -48.475 10.552  1.00 0.00 ? 103 GLY A C    2  
ATOM 2879  O O    . GLY A 1 103 ? -9.018  -47.841 11.567  1.00 0.00 ? 103 GLY A O    2  
ATOM 2880  H H    . GLY A 1 103 ? -10.189 -46.373 9.974   1.00 0.00 ? 103 GLY A H    2  
ATOM 2881  H HA2  . GLY A 1 103 ? -9.190  -48.697 8.456   1.00 0.00 ? 103 GLY A HA2  2  
ATOM 2882  H HA3  . GLY A 1 103 ? -8.136  -47.344 8.815   1.00 0.00 ? 103 GLY A HA3  2  
ATOM 2883  N N    . GLY A 1 1   ? -19.547 -7.738  21.936  1.00 0.00 ? 1   GLY A N    3  
ATOM 2884  C CA   . GLY A 1 1   ? -19.298 -9.108  22.351  1.00 0.00 ? 1   GLY A CA   3  
ATOM 2885  C C    . GLY A 1 1   ? -18.613 -9.902  21.236  1.00 0.00 ? 1   GLY A C    3  
ATOM 2886  O O    . GLY A 1 1   ? -19.280 -10.558 20.437  1.00 0.00 ? 1   GLY A O    3  
ATOM 2887  H H1   . GLY A 1 1   ? -19.269 -7.039  22.595  1.00 0.00 ? 1   GLY A H1   3  
ATOM 2888  H HA2  . GLY A 1 1   ? -18.671 -9.113  23.243  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 2889  H HA3  . GLY A 1 1   ? -20.239 -9.588  22.619  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 2890  N N    . SER A 1 2   ? -17.291 -9.817  21.218  1.00 0.00 ? 2   SER A N    3  
ATOM 2891  C CA   . SER A 1 2   ? -16.510 -10.519 20.215  1.00 0.00 ? 2   SER A CA   3  
ATOM 2892  C C    . SER A 1 2   ? -16.734 -9.887  18.839  1.00 0.00 ? 2   SER A C    3  
ATOM 2893  O O    . SER A 1 2   ? -17.580 -10.344 18.073  1.00 0.00 ? 2   SER A O    3  
ATOM 2894  C CB   . SER A 1 2   ? -16.867 -12.006 20.180  1.00 0.00 ? 2   SER A CB   3  
ATOM 2895  O OG   . SER A 1 2   ? -15.802 -12.823 20.659  1.00 0.00 ? 2   SER A OG   3  
ATOM 2896  H H    . SER A 1 2   ? -16.757 -9.281  21.871  1.00 0.00 ? 2   SER A H    3  
ATOM 2897  H HA   . SER A 1 2   ? -15.471 -10.403 20.524  1.00 0.00 ? 2   SER A HA   3  
ATOM 2898  H HB2  . SER A 1 2   ? -17.757 -12.179 20.785  1.00 0.00 ? 2   SER A HB2  3  
ATOM 2899  H HB3  . SER A 1 2   ? -17.115 -12.296 19.159  1.00 0.00 ? 2   SER A HB3  3  
ATOM 2900  H HG   . SER A 1 2   ? -15.169 -12.274 21.204  1.00 0.00 ? 2   SER A HG   3  
ATOM 2901  N N    . SER A 1 3   ? -15.961 -8.846  18.569  1.00 0.00 ? 3   SER A N    3  
ATOM 2902  C CA   . SER A 1 3   ? -16.064 -8.146  17.300  1.00 0.00 ? 3   SER A CA   3  
ATOM 2903  C C    . SER A 1 3   ? -14.907 -7.157  17.152  1.00 0.00 ? 3   SER A C    3  
ATOM 2904  O O    . SER A 1 3   ? -14.708 -6.296  18.008  1.00 0.00 ? 3   SER A O    3  
ATOM 2905  C CB   . SER A 1 3   ? -17.404 -7.417  17.180  1.00 0.00 ? 3   SER A CB   3  
ATOM 2906  O OG   . SER A 1 3   ? -17.445 -6.241  17.983  1.00 0.00 ? 3   SER A OG   3  
ATOM 2907  H H    . SER A 1 3   ? -15.275 -8.480  19.198  1.00 0.00 ? 3   SER A H    3  
ATOM 2908  H HA   . SER A 1 3   ? -16.004 -8.922  16.537  1.00 0.00 ? 3   SER A HA   3  
ATOM 2909  H HB2  . SER A 1 3   ? -17.580 -7.152  16.138  1.00 0.00 ? 3   SER A HB2  3  
ATOM 2910  H HB3  . SER A 1 3   ? -18.210 -8.088  17.478  1.00 0.00 ? 3   SER A HB3  3  
ATOM 2911  H HG   . SER A 1 3   ? -18.026 -5.551  17.550  1.00 0.00 ? 3   SER A HG   3  
ATOM 2912  N N    . GLY A 1 4   ? -14.173 -7.312  16.059  1.00 0.00 ? 4   GLY A N    3  
ATOM 2913  C CA   . GLY A 1 4   ? -13.041 -6.443  15.788  1.00 0.00 ? 4   GLY A CA   3  
ATOM 2914  C C    . GLY A 1 4   ? -11.781 -6.947  16.496  1.00 0.00 ? 4   GLY A C    3  
ATOM 2915  O O    . GLY A 1 4   ? -11.866 -7.748  17.425  1.00 0.00 ? 4   GLY A O    3  
ATOM 2916  H H    . GLY A 1 4   ? -14.342 -8.015  15.368  1.00 0.00 ? 4   GLY A H    3  
ATOM 2917  H HA2  . GLY A 1 4   ? -12.864 -6.395  14.713  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 2918  H HA3  . GLY A 1 4   ? -13.268 -5.430  16.119  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 2919  N N    . SER A 1 5   ? -10.643 -6.456  16.029  1.00 0.00 ? 5   SER A N    3  
ATOM 2920  C CA   . SER A 1 5   ? -9.367  -6.846  16.606  1.00 0.00 ? 5   SER A CA   3  
ATOM 2921  C C    . SER A 1 5   ? -8.239  -6.017  15.989  1.00 0.00 ? 5   SER A C    3  
ATOM 2922  O O    . SER A 1 5   ? -7.521  -5.314  16.699  1.00 0.00 ? 5   SER A O    3  
ATOM 2923  C CB   . SER A 1 5   ? -9.103  -8.338  16.400  1.00 0.00 ? 5   SER A CB   3  
ATOM 2924  O OG   . SER A 1 5   ? -7.989  -8.794  17.163  1.00 0.00 ? 5   SER A OG   3  
ATOM 2925  H H    . SER A 1 5   ? -10.583 -5.804  15.273  1.00 0.00 ? 5   SER A H    3  
ATOM 2926  H HA   . SER A 1 5   ? -9.457  -6.637  17.672  1.00 0.00 ? 5   SER A HA   3  
ATOM 2927  H HB2  . SER A 1 5   ? -9.991  -8.906  16.681  1.00 0.00 ? 5   SER A HB2  3  
ATOM 2928  H HB3  . SER A 1 5   ? -8.922  -8.532  15.343  1.00 0.00 ? 5   SER A HB3  3  
ATOM 2929  H HG   . SER A 1 5   ? -7.138  -8.463  16.756  1.00 0.00 ? 5   SER A HG   3  
ATOM 2930  N N    . SER A 1 6   ? -8.118  -6.127  14.674  1.00 0.00 ? 6   SER A N    3  
ATOM 2931  C CA   . SER A 1 6   ? -7.089  -5.396  13.954  1.00 0.00 ? 6   SER A CA   3  
ATOM 2932  C C    . SER A 1 6   ? -5.703  -5.844  14.424  1.00 0.00 ? 6   SER A C    3  
ATOM 2933  O O    . SER A 1 6   ? -5.578  -6.522  15.442  1.00 0.00 ? 6   SER A O    3  
ATOM 2934  C CB   . SER A 1 6   ? -7.250  -3.887  14.143  1.00 0.00 ? 6   SER A CB   3  
ATOM 2935  O OG   . SER A 1 6   ? -6.206  -3.154  13.508  1.00 0.00 ? 6   SER A OG   3  
ATOM 2936  H H    . SER A 1 6   ? -8.706  -6.700  14.105  1.00 0.00 ? 6   SER A H    3  
ATOM 2937  H HA   . SER A 1 6   ? -7.237  -5.649  12.904  1.00 0.00 ? 6   SER A HA   3  
ATOM 2938  H HB2  . SER A 1 6   ? -8.212  -3.572  13.738  1.00 0.00 ? 6   SER A HB2  3  
ATOM 2939  H HB3  . SER A 1 6   ? -7.261  -3.653  15.207  1.00 0.00 ? 6   SER A HB3  3  
ATOM 2940  H HG   . SER A 1 6   ? -5.328  -3.373  13.933  1.00 0.00 ? 6   SER A HG   3  
ATOM 2941  N N    . GLY A 1 7   ? -4.697  -5.448  13.658  1.00 0.00 ? 7   GLY A N    3  
ATOM 2942  C CA   . GLY A 1 7   ? -3.325  -5.800  13.983  1.00 0.00 ? 7   GLY A CA   3  
ATOM 2943  C C    . GLY A 1 7   ? -2.338  -5.010  13.122  1.00 0.00 ? 7   GLY A C    3  
ATOM 2944  O O    . GLY A 1 7   ? -2.491  -4.936  11.904  1.00 0.00 ? 7   GLY A O    3  
ATOM 2945  H H    . GLY A 1 7   ? -4.807  -4.897  12.831  1.00 0.00 ? 7   GLY A H    3  
ATOM 2946  H HA2  . GLY A 1 7   ? -3.135  -5.601  15.037  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 2947  H HA3  . GLY A 1 7   ? -3.174  -6.868  13.828  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 2948  N N    . SER A 1 8   ? -1.346  -4.439  13.790  1.00 0.00 ? 8   SER A N    3  
ATOM 2949  C CA   . SER A 1 8   ? -0.333  -3.656  13.101  1.00 0.00 ? 8   SER A CA   3  
ATOM 2950  C C    . SER A 1 8   ? 0.832   -4.557  12.687  1.00 0.00 ? 8   SER A C    3  
ATOM 2951  O O    . SER A 1 8   ? 1.049   -5.611  13.284  1.00 0.00 ? 8   SER A O    3  
ATOM 2952  C CB   . SER A 1 8   ? 0.169   -2.509  13.981  1.00 0.00 ? 8   SER A CB   3  
ATOM 2953  O OG   . SER A 1 8   ? -0.897  -1.677  14.433  1.00 0.00 ? 8   SER A OG   3  
ATOM 2954  H H    . SER A 1 8   ? -1.228  -4.503  14.781  1.00 0.00 ? 8   SER A H    3  
ATOM 2955  H HA   . SER A 1 8   ? -0.832  -3.248  12.222  1.00 0.00 ? 8   SER A HA   3  
ATOM 2956  H HB2  . SER A 1 8   ? 0.700   -2.917  14.841  1.00 0.00 ? 8   SER A HB2  3  
ATOM 2957  H HB3  . SER A 1 8   ? 0.884   -1.909  13.419  1.00 0.00 ? 8   SER A HB3  3  
ATOM 2958  H HG   . SER A 1 8   ? -1.196  -1.968  15.341  1.00 0.00 ? 8   SER A HG   3  
ATOM 2959  N N    . VAL A 1 9   ? 1.551   -4.109  11.669  1.00 0.00 ? 9   VAL A N    3  
ATOM 2960  C CA   . VAL A 1 9   ? 2.689   -4.862  11.168  1.00 0.00 ? 9   VAL A CA   3  
ATOM 2961  C C    . VAL A 1 9   ? 3.895   -3.929  11.038  1.00 0.00 ? 9   VAL A C    3  
ATOM 2962  O O    . VAL A 1 9   ? 3.747   -2.708  11.082  1.00 0.00 ? 9   VAL A O    3  
ATOM 2963  C CB   . VAL A 1 9   ? 2.322   -5.552  9.853   1.00 0.00 ? 9   VAL A CB   3  
ATOM 2964  C CG1  . VAL A 1 9   ? 1.559   -4.601  8.929   1.00 0.00 ? 9   VAL A CG1  3  
ATOM 2965  C CG2  . VAL A 1 9   ? 3.568   -6.108  9.160   1.00 0.00 ? 9   VAL A CG2  3  
ATOM 2966  H H    . VAL A 1 9   ? 1.368   -3.251  11.189  1.00 0.00 ? 9   VAL A H    3  
ATOM 2967  H HA   . VAL A 1 9   ? 2.921   -5.634  11.902  1.00 0.00 ? 9   VAL A HA   3  
ATOM 2968  H HB   . VAL A 1 9   ? 1.667   -6.391  10.086  1.00 0.00 ? 9   VAL A HB   3  
ATOM 2969  H HG11 . VAL A 1 9   ? 0.529   -4.508  9.274   1.00 0.00 ? 9   VAL A HG11 3  
ATOM 2970  H HG12 . VAL A 1 9   ? 2.036   -3.621  8.942   1.00 0.00 ? 9   VAL A HG12 3  
ATOM 2971  H HG13 . VAL A 1 9   ? 1.568   -4.996  7.913   1.00 0.00 ? 9   VAL A HG13 3  
ATOM 2972  H HG21 . VAL A 1 9   ? 4.230   -5.286  8.888   1.00 0.00 ? 9   VAL A HG21 3  
ATOM 2973  H HG22 . VAL A 1 9   ? 4.089   -6.785  9.837   1.00 0.00 ? 9   VAL A HG22 3  
ATOM 2974  H HG23 . VAL A 1 9   ? 3.272   -6.649  8.261   1.00 0.00 ? 9   VAL A HG23 3  
ATOM 2975  N N    . SER A 1 10  ? 5.060   -4.538  10.880  1.00 0.00 ? 10  SER A N    3  
ATOM 2976  C CA   . SER A 1 10  ? 6.291   -3.777  10.743  1.00 0.00 ? 10  SER A CA   3  
ATOM 2977  C C    . SER A 1 10  ? 7.168   -4.393  9.652   1.00 0.00 ? 10  SER A C    3  
ATOM 2978  O O    . SER A 1 10  ? 7.524   -5.568  9.726   1.00 0.00 ? 10  SER A O    3  
ATOM 2979  C CB   . SER A 1 10  ? 7.053   -3.720  12.068  1.00 0.00 ? 10  SER A CB   3  
ATOM 2980  O OG   . SER A 1 10  ? 8.259   -2.968  11.959  1.00 0.00 ? 10  SER A OG   3  
ATOM 2981  H H    . SER A 1 10  ? 5.172   -5.532  10.846  1.00 0.00 ? 10  SER A H    3  
ATOM 2982  H HA   . SER A 1 10  ? 5.978   -2.772  10.461  1.00 0.00 ? 10  SER A HA   3  
ATOM 2983  H HB2  . SER A 1 10  ? 6.417   -3.276  12.834  1.00 0.00 ? 10  SER A HB2  3  
ATOM 2984  H HB3  . SER A 1 10  ? 7.287   -4.733  12.396  1.00 0.00 ? 10  SER A HB3  3  
ATOM 2985  H HG   . SER A 1 10  ? 8.510   -2.863  10.996  1.00 0.00 ? 10  SER A HG   3  
ATOM 2986  N N    . LEU A 1 11  ? 7.491   -3.572  8.663   1.00 0.00 ? 11  LEU A N    3  
ATOM 2987  C CA   . LEU A 1 11  ? 8.320   -4.022  7.558   1.00 0.00 ? 11  LEU A CA   3  
ATOM 2988  C C    . LEU A 1 11  ? 9.681   -3.325  7.630   1.00 0.00 ? 11  LEU A C    3  
ATOM 2989  O O    . LEU A 1 11  ? 9.781   -2.201  8.120   1.00 0.00 ? 11  LEU A O    3  
ATOM 2990  C CB   . LEU A 1 11  ? 7.595   -3.817  6.227   1.00 0.00 ? 11  LEU A CB   3  
ATOM 2991  C CG   . LEU A 1 11  ? 6.155   -4.330  6.162   1.00 0.00 ? 11  LEU A CG   3  
ATOM 2992  C CD1  . LEU A 1 11  ? 5.559   -4.118  4.768   1.00 0.00 ? 11  LEU A CD1  3  
ATOM 2993  C CD2  . LEU A 1 11  ? 6.073   -5.792  6.604   1.00 0.00 ? 11  LEU A CD2  3  
ATOM 2994  H H    . LEU A 1 11  ? 7.197   -2.618  8.611   1.00 0.00 ? 11  LEU A H    3  
ATOM 2995  H HA   . LEU A 1 11  ? 8.474   -5.094  7.680   1.00 0.00 ? 11  LEU A HA   3  
ATOM 2996  H HB2  . LEU A 1 11  ? 7.591   -2.752  5.997   1.00 0.00 ? 11  LEU A HB2  3  
ATOM 2997  H HB3  . LEU A 1 11  ? 8.170   -4.310  5.443   1.00 0.00 ? 11  LEU A HB3  3  
ATOM 2998  H HG   . LEU A 1 11  ? 5.553   -3.748  6.861   1.00 0.00 ? 11  LEU A HG   3  
ATOM 2999  H HD11 . LEU A 1 11  ? 4.623   -3.566  4.854   1.00 0.00 ? 11  LEU A HD11 3  
ATOM 3000  H HD12 . LEU A 1 11  ? 6.261   -3.551  4.156   1.00 0.00 ? 11  LEU A HD12 3  
ATOM 3001  H HD13 . LEU A 1 11  ? 5.370   -5.085  4.303   1.00 0.00 ? 11  LEU A HD13 3  
ATOM 3002  H HD21 . LEU A 1 11  ? 5.027   -6.083  6.706   1.00 0.00 ? 11  LEU A HD21 3  
ATOM 3003  H HD22 . LEU A 1 11  ? 6.554   -6.425  5.858   1.00 0.00 ? 11  LEU A HD22 3  
ATOM 3004  H HD23 . LEU A 1 11  ? 6.579   -5.911  7.562   1.00 0.00 ? 11  LEU A HD23 3  
ATOM 3005  N N    . VAL A 1 12  ? 10.694  -4.022  7.136   1.00 0.00 ? 12  VAL A N    3  
ATOM 3006  C CA   . VAL A 1 12  ? 12.043  -3.484  7.139   1.00 0.00 ? 12  VAL A CA   3  
ATOM 3007  C C    . VAL A 1 12  ? 12.529  -3.330  5.696   1.00 0.00 ? 12  VAL A C    3  
ATOM 3008  O O    . VAL A 1 12  ? 12.834  -4.318  5.031   1.00 0.00 ? 12  VAL A O    3  
ATOM 3009  C CB   . VAL A 1 12  ? 12.958  -4.372  7.985   1.00 0.00 ? 12  VAL A CB   3  
ATOM 3010  C CG1  . VAL A 1 12  ? 14.413  -3.909  7.889   1.00 0.00 ? 12  VAL A CG1  3  
ATOM 3011  C CG2  . VAL A 1 12  ? 12.490  -4.410  9.441   1.00 0.00 ? 12  VAL A CG2  3  
ATOM 3012  H H    . VAL A 1 12  ? 10.603  -4.936  6.740   1.00 0.00 ? 12  VAL A H    3  
ATOM 3013  H HA   . VAL A 1 12  ? 12.004  -2.499  7.603   1.00 0.00 ? 12  VAL A HA   3  
ATOM 3014  H HB   . VAL A 1 12  ? 12.903  -5.385  7.589   1.00 0.00 ? 12  VAL A HB   3  
ATOM 3015  H HG11 . VAL A 1 12  ? 15.071  -4.778  7.871   1.00 0.00 ? 12  VAL A HG11 3  
ATOM 3016  H HG12 . VAL A 1 12  ? 14.551  -3.331  6.975   1.00 0.00 ? 12  VAL A HG12 3  
ATOM 3017  H HG13 . VAL A 1 12  ? 14.655  -3.288  8.751   1.00 0.00 ? 12  VAL A HG13 3  
ATOM 3018  H HG21 . VAL A 1 12  ? 11.736  -5.188  9.560   1.00 0.00 ? 12  VAL A HG21 3  
ATOM 3019  H HG22 . VAL A 1 12  ? 13.340  -4.625  10.090  1.00 0.00 ? 12  VAL A HG22 3  
ATOM 3020  H HG23 . VAL A 1 12  ? 12.062  -3.445  9.711   1.00 0.00 ? 12  VAL A HG23 3  
ATOM 3021  N N    . GLY A 1 13  ? 12.585  -2.082  5.255   1.00 0.00 ? 13  GLY A N    3  
ATOM 3022  C CA   . GLY A 1 13  ? 13.028  -1.785  3.903   1.00 0.00 ? 13  GLY A CA   3  
ATOM 3023  C C    . GLY A 1 13  ? 13.115  -0.275  3.674   1.00 0.00 ? 13  GLY A C    3  
ATOM 3024  O O    . GLY A 1 13  ? 12.429  0.499   4.341   1.00 0.00 ? 13  GLY A O    3  
ATOM 3025  H H    . GLY A 1 13  ? 12.334  -1.283  5.802   1.00 0.00 ? 13  GLY A H    3  
ATOM 3026  H HA2  . GLY A 1 13  ? 14.002  -2.240  3.728   1.00 0.00 ? 13  GLY A HA2  3  
ATOM 3027  H HA3  . GLY A 1 13  ? 12.336  -2.226  3.185   1.00 0.00 ? 13  GLY A HA3  3  
ATOM 3028  N N    . PRO A 1 14  ? 13.986  0.110   2.703   1.00 0.00 ? 14  PRO A N    3  
ATOM 3029  C CA   . PRO A 1 14  ? 14.172  1.514   2.378   1.00 0.00 ? 14  PRO A CA   3  
ATOM 3030  C C    . PRO A 1 14  ? 12.986  2.052   1.574   1.00 0.00 ? 14  PRO A C    3  
ATOM 3031  O O    . PRO A 1 14  ? 12.915  3.247   1.290   1.00 0.00 ? 14  PRO A O    3  
ATOM 3032  C CB   . PRO A 1 14  ? 15.483  1.570   1.610   1.00 0.00 ? 14  PRO A CB   3  
ATOM 3033  C CG   . PRO A 1 14  ? 15.747  0.151   1.133   1.00 0.00 ? 14  PRO A CG   3  
ATOM 3034  C CD   . PRO A 1 14  ? 14.815  -0.778  1.893   1.00 0.00 ? 14  PRO A CD   3  
ATOM 3035  H HA   . PRO A 1 14  ? 14.207  2.062   3.213   1.00 0.00 ? 14  PRO A HA   3  
ATOM 3036  H HB2  . PRO A 1 14  ? 15.414  2.259   0.769   1.00 0.00 ? 14  PRO A HB2  3  
ATOM 3037  H HB3  . PRO A 1 14  ? 16.293  1.925   2.247   1.00 0.00 ? 14  PRO A HB3  3  
ATOM 3038  H HG2  . PRO A 1 14  ? 15.574  0.071   0.059   1.00 0.00 ? 14  PRO A HG2  3  
ATOM 3039  H HG3  . PRO A 1 14  ? 16.787  -0.124  1.309   1.00 0.00 ? 14  PRO A HG3  3  
ATOM 3040  H HD2  . PRO A 1 14  ? 14.207  -1.374  1.211   1.00 0.00 ? 14  PRO A HD2  3  
ATOM 3041  H HD3  . PRO A 1 14  ? 15.373  -1.477  2.516   1.00 0.00 ? 14  PRO A HD3  3  
ATOM 3042  N N    . ALA A 1 15  ? 12.084  1.144   1.232   1.00 0.00 ? 15  ALA A N    3  
ATOM 3043  C CA   . ALA A 1 15  ? 10.904  1.513   0.467   1.00 0.00 ? 15  ALA A CA   3  
ATOM 3044  C C    . ALA A 1 15  ? 10.301  0.258   -0.168  1.00 0.00 ? 15  ALA A C    3  
ATOM 3045  O O    . ALA A 1 15  ? 9.102   0.012   -0.047  1.00 0.00 ? 15  ALA A O    3  
ATOM 3046  C CB   . ALA A 1 15  ? 11.280  2.570   -0.573  1.00 0.00 ? 15  ALA A CB   3  
ATOM 3047  H H    . ALA A 1 15  ? 12.149  0.175   1.467   1.00 0.00 ? 15  ALA A H    3  
ATOM 3048  H HA   . ALA A 1 15  ? 10.181  1.943   1.160   1.00 0.00 ? 15  ALA A HA   3  
ATOM 3049  H HB1  . ALA A 1 15  ? 10.953  3.551   -0.228  1.00 0.00 ? 15  ALA A HB1  3  
ATOM 3050  H HB2  . ALA A 1 15  ? 12.361  2.575   -0.712  1.00 0.00 ? 15  ALA A HB2  3  
ATOM 3051  H HB3  . ALA A 1 15  ? 10.793  2.337   -1.520  1.00 0.00 ? 15  ALA A HB3  3  
ATOM 3052  N N    . PRO A 1 16  ? 11.183  -0.522  -0.849  1.00 0.00 ? 16  PRO A N    3  
ATOM 3053  C CA   . PRO A 1 16  ? 10.750  -1.745  -1.504  1.00 0.00 ? 16  PRO A CA   3  
ATOM 3054  C C    . PRO A 1 16  ? 10.503  -2.856  -0.481  1.00 0.00 ? 16  PRO A C    3  
ATOM 3055  O O    . PRO A 1 16  ? 11.324  -3.760  -0.331  1.00 0.00 ? 16  PRO A O    3  
ATOM 3056  C CB   . PRO A 1 16  ? 11.860  -2.078  -2.487  1.00 0.00 ? 16  PRO A CB   3  
ATOM 3057  C CG   . PRO A 1 16  ? 13.078  -1.297  -2.022  1.00 0.00 ? 16  PRO A CG   3  
ATOM 3058  C CD   . PRO A 1 16  ? 12.610  -0.261  -1.013  1.00 0.00 ? 16  PRO A CD   3  
ATOM 3059  H HA   . PRO A 1 16  ? 9.876   -1.600  -1.967  1.00 0.00 ? 16  PRO A HA   3  
ATOM 3060  H HB2  . PRO A 1 16  ? 12.063  -3.149  -2.498  1.00 0.00 ? 16  PRO A HB2  3  
ATOM 3061  H HB3  . PRO A 1 16  ? 11.580  -1.797  -3.503  1.00 0.00 ? 16  PRO A HB3  3  
ATOM 3062  H HG2  . PRO A 1 16  ? 13.811  -1.966  -1.571  1.00 0.00 ? 16  PRO A HG2  3  
ATOM 3063  H HG3  . PRO A 1 16  ? 13.567  -0.814  -2.868  1.00 0.00 ? 16  PRO A HG3  3  
ATOM 3064  H HD2  . PRO A 1 16  ? 13.142  -0.361  -0.067  1.00 0.00 ? 16  PRO A HD2  3  
ATOM 3065  H HD3  . PRO A 1 16  ? 12.789  0.752   -1.374  1.00 0.00 ? 16  PRO A HD3  3  
ATOM 3066  N N    . TRP A 1 17  ? 9.369   -2.752  0.195   1.00 0.00 ? 17  TRP A N    3  
ATOM 3067  C CA   . TRP A 1 17  ? 9.003   -3.737  1.199   1.00 0.00 ? 17  TRP A CA   3  
ATOM 3068  C C    . TRP A 1 17  ? 8.653   -5.040  0.478   1.00 0.00 ? 17  TRP A C    3  
ATOM 3069  O O    . TRP A 1 17  ? 8.753   -6.120  1.057   1.00 0.00 ? 17  TRP A O    3  
ATOM 3070  C CB   . TRP A 1 17  ? 7.868   -3.221  2.086   1.00 0.00 ? 17  TRP A CB   3  
ATOM 3071  C CG   . TRP A 1 17  ? 7.911   -1.713  2.337   1.00 0.00 ? 17  TRP A CG   3  
ATOM 3072  C CD1  . TRP A 1 17  ? 7.341   -0.739  1.614   1.00 0.00 ? 17  TRP A CD1  3  
ATOM 3073  C CD2  . TRP A 1 17  ? 8.587   -1.040  3.421   1.00 0.00 ? 17  TRP A CD2  3  
ATOM 3074  N NE1  . TRP A 1 17  ? 7.598   0.506   2.150   1.00 0.00 ? 17  TRP A NE1  3  
ATOM 3075  C CE2  . TRP A 1 17  ? 8.380   0.317   3.284   1.00 0.00 ? 17  TRP A CE2  3  
ATOM 3076  C CE3  . TRP A 1 17  ? 9.347   -1.562  4.482   1.00 0.00 ? 17  TRP A CE3  3  
ATOM 3077  C CZ2  . TRP A 1 17  ? 8.900   1.266   4.173   1.00 0.00 ? 17  TRP A CZ2  3  
ATOM 3078  C CZ3  . TRP A 1 17  ? 9.860   -0.601  5.362   1.00 0.00 ? 17  TRP A CZ3  3  
ATOM 3079  C CH2  . TRP A 1 17  ? 9.661   0.769   5.238   1.00 0.00 ? 17  TRP A CH2  3  
ATOM 3080  H H    . TRP A 1 17  ? 8.707   -2.014  0.067   1.00 0.00 ? 17  TRP A H    3  
ATOM 3081  H HA   . TRP A 1 17  ? 9.867   -3.890  1.846   1.00 0.00 ? 17  TRP A HA   3  
ATOM 3082  H HB2  . TRP A 1 17  ? 6.915   -3.475  1.622   1.00 0.00 ? 17  TRP A HB2  3  
ATOM 3083  H HB3  . TRP A 1 17  ? 7.905   -3.740  3.044   1.00 0.00 ? 17  TRP A HB3  3  
ATOM 3084  H HD1  . TRP A 1 17  ? 6.749   -0.910  0.715   1.00 0.00 ? 17  TRP A HD1  3  
ATOM 3085  H HE1  . TRP A 1 17  ? 7.253   1.462   1.757   1.00 0.00 ? 17  TRP A HE1  3  
ATOM 3086  H HE3  . TRP A 1 17  ? 9.524   -2.630  4.613   1.00 0.00 ? 17  TRP A HE3  3  
ATOM 3087  H HZ2  . TRP A 1 17  ? 8.722   2.333   4.042   1.00 0.00 ? 17  TRP A HZ2  3  
ATOM 3088  H HZ3  . TRP A 1 17  ? 10.457  -0.952  6.203   1.00 0.00 ? 17  TRP A HZ3  3  
ATOM 3089  H HH2  . TRP A 1 17  ? 10.095  1.453   5.966   1.00 0.00 ? 17  TRP A HH2  3  
ATOM 3090  N N    . GLY A 1 18  ? 8.251   -4.895  -0.776  1.00 0.00 ? 18  GLY A N    3  
ATOM 3091  C CA   . GLY A 1 18  ? 7.886   -6.047  -1.583  1.00 0.00 ? 18  GLY A CA   3  
ATOM 3092  C C    . GLY A 1 18  ? 6.366   -6.162  -1.719  1.00 0.00 ? 18  GLY A C    3  
ATOM 3093  O O    . GLY A 1 18  ? 5.832   -7.262  -1.849  1.00 0.00 ? 18  GLY A O    3  
ATOM 3094  H H    . GLY A 1 18  ? 8.173   -4.012  -1.240  1.00 0.00 ? 18  GLY A H    3  
ATOM 3095  H HA2  . GLY A 1 18  ? 8.337   -5.961  -2.571  1.00 0.00 ? 18  GLY A HA2  3  
ATOM 3096  H HA3  . GLY A 1 18  ? 8.284   -6.954  -1.129  1.00 0.00 ? 18  GLY A HA3  3  
ATOM 3097  N N    . PHE A 1 19  ? 5.712   -5.010  -1.683  1.00 0.00 ? 19  PHE A N    3  
ATOM 3098  C CA   . PHE A 1 19  ? 4.265   -4.967  -1.801  1.00 0.00 ? 19  PHE A CA   3  
ATOM 3099  C C    . PHE A 1 19  ? 3.803   -3.645  -2.417  1.00 0.00 ? 19  PHE A C    3  
ATOM 3100  O O    . PHE A 1 19  ? 4.453   -2.615  -2.245  1.00 0.00 ? 19  PHE A O    3  
ATOM 3101  C CB   . PHE A 1 19  ? 3.698   -5.081  -0.384  1.00 0.00 ? 19  PHE A CB   3  
ATOM 3102  C CG   . PHE A 1 19  ? 3.704   -3.765  0.396   1.00 0.00 ? 19  PHE A CG   3  
ATOM 3103  C CD1  . PHE A 1 19  ? 2.883   -2.748  0.021   1.00 0.00 ? 19  PHE A CD1  3  
ATOM 3104  C CD2  . PHE A 1 19  ? 4.531   -3.613  1.465   1.00 0.00 ? 19  PHE A CD2  3  
ATOM 3105  C CE1  . PHE A 1 19  ? 2.889   -1.527  0.746   1.00 0.00 ? 19  PHE A CE1  3  
ATOM 3106  C CE2  . PHE A 1 19  ? 4.537   -2.392  2.190   1.00 0.00 ? 19  PHE A CE2  3  
ATOM 3107  C CZ   . PHE A 1 19  ? 3.716   -1.375  1.815   1.00 0.00 ? 19  PHE A CZ   3  
ATOM 3108  H H    . PHE A 1 19  ? 6.154   -4.119  -1.577  1.00 0.00 ? 19  PHE A H    3  
ATOM 3109  H HA   . PHE A 1 19  ? 3.968   -5.791  -2.449  1.00 0.00 ? 19  PHE A HA   3  
ATOM 3110  H HB2  . PHE A 1 19  ? 2.674   -5.452  -0.442  1.00 0.00 ? 19  PHE A HB2  3  
ATOM 3111  H HB3  . PHE A 1 19  ? 4.274   -5.823  0.168   1.00 0.00 ? 19  PHE A HB3  3  
ATOM 3112  H HD1  . PHE A 1 19  ? 2.220   -2.870  -0.835  1.00 0.00 ? 19  PHE A HD1  3  
ATOM 3113  H HD2  . PHE A 1 19  ? 5.189   -4.428  1.766   1.00 0.00 ? 19  PHE A HD2  3  
ATOM 3114  H HE1  . PHE A 1 19  ? 2.231   -0.712  0.446   1.00 0.00 ? 19  PHE A HE1  3  
ATOM 3115  H HE2  . PHE A 1 19  ? 5.200   -2.270  3.046   1.00 0.00 ? 19  PHE A HE2  3  
ATOM 3116  H HZ   . PHE A 1 19  ? 3.721   -0.437  2.371   1.00 0.00 ? 19  PHE A HZ   3  
ATOM 3117  N N    . ARG A 1 20  ? 2.685   -3.717  -3.124  1.00 0.00 ? 20  ARG A N    3  
ATOM 3118  C CA   . ARG A 1 20  ? 2.129   -2.539  -3.767  1.00 0.00 ? 20  ARG A CA   3  
ATOM 3119  C C    . ARG A 1 20  ? 0.809   -2.143  -3.100  1.00 0.00 ? 20  ARG A C    3  
ATOM 3120  O O    . ARG A 1 20  ? 0.323   -2.844  -2.215  1.00 0.00 ? 20  ARG A O    3  
ATOM 3121  C CB   . ARG A 1 20  ? 1.885   -2.787  -5.257  1.00 0.00 ? 20  ARG A CB   3  
ATOM 3122  C CG   . ARG A 1 20  ? 3.198   -2.745  -6.041  1.00 0.00 ? 20  ARG A CG   3  
ATOM 3123  C CD   . ARG A 1 20  ? 3.558   -1.310  -6.431  1.00 0.00 ? 20  ARG A CD   3  
ATOM 3124  N NE   . ARG A 1 20  ? 5.025   -1.124  -6.375  1.00 0.00 ? 20  ARG A NE   3  
ATOM 3125  C CZ   . ARG A 1 20  ? 5.872   -1.543  -7.326  1.00 0.00 ? 20  ARG A CZ   3  
ATOM 3126  N NH1  . ARG A 1 20  ? 5.402   -2.174  -8.411  1.00 0.00 ? 20  ARG A NH1  3  
ATOM 3127  N NH2  . ARG A 1 20  ? 7.188   -1.330  -7.191  1.00 0.00 ? 20  ARG A NH2  3  
ATOM 3128  H H    . ARG A 1 20  ? 2.162   -4.559  -3.259  1.00 0.00 ? 20  ARG A H    3  
ATOM 3129  H HA   . ARG A 1 20  ? 2.884   -1.765  -3.631  1.00 0.00 ? 20  ARG A HA   3  
ATOM 3130  H HB2  . ARG A 1 20  ? 1.406   -3.757  -5.393  1.00 0.00 ? 20  ARG A HB2  3  
ATOM 3131  H HB3  . ARG A 1 20  ? 1.199   -2.036  -5.647  1.00 0.00 ? 20  ARG A HB3  3  
ATOM 3132  H HG2  . ARG A 1 20  ? 3.999   -3.175  -5.440  1.00 0.00 ? 20  ARG A HG2  3  
ATOM 3133  H HG3  . ARG A 1 20  ? 3.109   -3.358  -6.939  1.00 0.00 ? 20  ARG A HG3  3  
ATOM 3134  H HD2  . ARG A 1 20  ? 3.193   -1.095  -7.435  1.00 0.00 ? 20  ARG A HD2  3  
ATOM 3135  H HD3  . ARG A 1 20  ? 3.068   -0.608  -5.756  1.00 0.00 ? 20  ARG A HD3  3  
ATOM 3136  H HE   . ARG A 1 20  ? 5.409   -0.657  -5.579  1.00 0.00 ? 20  ARG A HE   3  
ATOM 3137  H HH11 . ARG A 1 20  ? 4.420   -2.332  -8.511  1.00 0.00 ? 20  ARG A HH11 3  
ATOM 3138  H HH12 . ARG A 1 20  ? 6.034   -2.486  -9.120  1.00 0.00 ? 20  ARG A HH12 3  
ATOM 3139  H HH21 . ARG A 1 20  ? 7.539   -0.859  -6.382  1.00 0.00 ? 20  ARG A HH21 3  
ATOM 3140  H HH22 . ARG A 1 20  ? 7.820   -1.643  -7.901  1.00 0.00 ? 20  ARG A HH22 3  
ATOM 3141  N N    . LEU A 1 21  ? 0.268   -1.021  -3.552  1.00 0.00 ? 21  LEU A N    3  
ATOM 3142  C CA   . LEU A 1 21  ? -0.985  -0.523  -3.011  1.00 0.00 ? 21  LEU A CA   3  
ATOM 3143  C C    . LEU A 1 21  ? -1.869  -0.028  -4.157  1.00 0.00 ? 21  LEU A C    3  
ATOM 3144  O O    . LEU A 1 21  ? -1.369  0.508   -5.144  1.00 0.00 ? 21  LEU A O    3  
ATOM 3145  C CB   . LEU A 1 21  ? -0.722  0.533   -1.935  1.00 0.00 ? 21  LEU A CB   3  
ATOM 3146  C CG   . LEU A 1 21  ? 0.136   0.085   -0.751  1.00 0.00 ? 21  LEU A CG   3  
ATOM 3147  C CD1  . LEU A 1 21  ? 0.505   1.273   0.140   1.00 0.00 ? 21  LEU A CD1  3  
ATOM 3148  C CD2  . LEU A 1 21  ? -0.556  -1.029  0.038   1.00 0.00 ? 21  LEU A CD2  3  
ATOM 3149  H H    . LEU A 1 21  ? 0.671   -0.457  -4.273  1.00 0.00 ? 21  LEU A H    3  
ATOM 3150  H HA   . LEU A 1 21  ? -1.486  -1.361  -2.525  1.00 0.00 ? 21  LEU A HA   3  
ATOM 3151  H HB2  . LEU A 1 21  ? -0.239  1.389   -2.406  1.00 0.00 ? 21  LEU A HB2  3  
ATOM 3152  H HB3  . LEU A 1 21  ? -1.682  0.879   -1.553  1.00 0.00 ? 21  LEU A HB3  3  
ATOM 3153  H HG   . LEU A 1 21  ? 1.067   -0.327  -1.140  1.00 0.00 ? 21  LEU A HG   3  
ATOM 3154  H HD11 . LEU A 1 21  ? 0.540   0.950   1.180   1.00 0.00 ? 21  LEU A HD11 3  
ATOM 3155  H HD12 . LEU A 1 21  ? 1.481   1.659   -0.155  1.00 0.00 ? 21  LEU A HD12 3  
ATOM 3156  H HD13 . LEU A 1 21  ? -0.244  2.057   0.028   1.00 0.00 ? 21  LEU A HD13 3  
ATOM 3157  H HD21 . LEU A 1 21  ? -0.975  -0.618  0.956   1.00 0.00 ? 21  LEU A HD21 3  
ATOM 3158  H HD22 . LEU A 1 21  ? -1.356  -1.458  -0.566  1.00 0.00 ? 21  LEU A HD22 3  
ATOM 3159  H HD23 . LEU A 1 21  ? 0.169   -1.804  0.284   1.00 0.00 ? 21  LEU A HD23 3  
ATOM 3160  N N    . GLN A 1 22  ? -3.168  -0.225  -3.987  1.00 0.00 ? 22  GLN A N    3  
ATOM 3161  C CA   . GLN A 1 22  ? -4.127  0.195   -4.994  1.00 0.00 ? 22  GLN A CA   3  
ATOM 3162  C C    . GLN A 1 22  ? -5.429  0.651   -4.331  1.00 0.00 ? 22  GLN A C    3  
ATOM 3163  O O    . GLN A 1 22  ? -5.782  0.173   -3.254  1.00 0.00 ? 22  GLN A O    3  
ATOM 3164  C CB   . GLN A 1 22  ? -4.389  -0.925  -6.003  1.00 0.00 ? 22  GLN A CB   3  
ATOM 3165  C CG   . GLN A 1 22  ? -5.060  -2.124  -5.330  1.00 0.00 ? 22  GLN A CG   3  
ATOM 3166  C CD   . GLN A 1 22  ? -5.575  -3.120  -6.370  1.00 0.00 ? 22  GLN A CD   3  
ATOM 3167  O OE1  . GLN A 1 22  ? -5.906  -2.771  -7.491  1.00 0.00 ? 22  GLN A OE1  3  
ATOM 3168  N NE2  . GLN A 1 22  ? -5.623  -4.377  -5.938  1.00 0.00 ? 22  GLN A NE2  3  
ATOM 3169  H H    . GLN A 1 22  ? -3.567  -0.662  -3.180  1.00 0.00 ? 22  GLN A H    3  
ATOM 3170  H HA   . GLN A 1 22  ? -3.659  1.035   -5.507  1.00 0.00 ? 22  GLN A HA   3  
ATOM 3171  H HB2  . GLN A 1 22  ? -5.023  -0.553  -6.808  1.00 0.00 ? 22  GLN A HB2  3  
ATOM 3172  H HB3  . GLN A 1 22  ? -3.449  -1.238  -6.457  1.00 0.00 ? 22  GLN A HB3  3  
ATOM 3173  H HG2  . GLN A 1 22  ? -4.350  -2.618  -4.667  1.00 0.00 ? 22  GLN A HG2  3  
ATOM 3174  H HG3  . GLN A 1 22  ? -5.888  -1.780  -4.709  1.00 0.00 ? 22  GLN A HG3  3  
ATOM 3175  H HE21 . GLN A 1 22  ? -5.337  -4.596  -5.006  1.00 0.00 ? 22  GLN A HE21 3  
ATOM 3176  H HE22 . GLN A 1 22  ? -5.946  -5.102  -6.546  1.00 0.00 ? 22  GLN A HE22 3  
ATOM 3177  N N    . GLY A 1 23  ? -6.107  1.571   -5.002  1.00 0.00 ? 23  GLY A N    3  
ATOM 3178  C CA   . GLY A 1 23  ? -7.361  2.096   -4.492  1.00 0.00 ? 23  GLY A CA   3  
ATOM 3179  C C    . GLY A 1 23  ? -7.160  3.472   -3.853  1.00 0.00 ? 23  GLY A C    3  
ATOM 3180  O O    . GLY A 1 23  ? -6.171  4.150   -4.129  1.00 0.00 ? 23  GLY A O    3  
ATOM 3181  H H    . GLY A 1 23  ? -5.813  1.954   -5.878  1.00 0.00 ? 23  GLY A H    3  
ATOM 3182  H HA2  . GLY A 1 23  ? -8.086  2.171   -5.303  1.00 0.00 ? 23  GLY A HA2  3  
ATOM 3183  H HA3  . GLY A 1 23  ? -7.776  1.407   -3.756  1.00 0.00 ? 23  GLY A HA3  3  
ATOM 3184  N N    . GLY A 1 24  ? -8.113  3.843   -3.011  1.00 0.00 ? 24  GLY A N    3  
ATOM 3185  C CA   . GLY A 1 24  ? -8.053  5.125   -2.330  1.00 0.00 ? 24  GLY A CA   3  
ATOM 3186  C C    . GLY A 1 24  ? -9.296  5.965   -2.632  1.00 0.00 ? 24  GLY A C    3  
ATOM 3187  O O    . GLY A 1 24  ? -10.214 5.501   -3.306  1.00 0.00 ? 24  GLY A O    3  
ATOM 3188  H H    . GLY A 1 24  ? -8.914  3.286   -2.792  1.00 0.00 ? 24  GLY A H    3  
ATOM 3189  H HA2  . GLY A 1 24  ? -7.968  4.967   -1.255  1.00 0.00 ? 24  GLY A HA2  3  
ATOM 3190  H HA3  . GLY A 1 24  ? -7.160  5.666   -2.644  1.00 0.00 ? 24  GLY A HA3  3  
ATOM 3191  N N    . LYS A 1 25  ? -9.285  7.186   -2.117  1.00 0.00 ? 25  LYS A N    3  
ATOM 3192  C CA   . LYS A 1 25  ? -10.399 8.095   -2.323  1.00 0.00 ? 25  LYS A CA   3  
ATOM 3193  C C    . LYS A 1 25  ? -10.509 8.433   -3.811  1.00 0.00 ? 25  LYS A C    3  
ATOM 3194  O O    . LYS A 1 25  ? -11.603 8.431   -4.374  1.00 0.00 ? 25  LYS A O    3  
ATOM 3195  C CB   . LYS A 1 25  ? -10.262 9.324   -1.422  1.00 0.00 ? 25  LYS A CB   3  
ATOM 3196  C CG   . LYS A 1 25  ? -11.488 9.481   -0.519  1.00 0.00 ? 25  LYS A CG   3  
ATOM 3197  C CD   . LYS A 1 25  ? -11.184 10.405  0.662   1.00 0.00 ? 25  LYS A CD   3  
ATOM 3198  C CE   . LYS A 1 25  ? -11.345 11.874  0.265   1.00 0.00 ? 25  LYS A CE   3  
ATOM 3199  N NZ   . LYS A 1 25  ? -10.452 12.731  1.077   1.00 0.00 ? 25  LYS A NZ   3  
ATOM 3200  H H    . LYS A 1 25  ? -8.533  7.556   -1.570  1.00 0.00 ? 25  LYS A H    3  
ATOM 3201  H HA   . LYS A 1 25  ? -11.307 7.573   -2.020  1.00 0.00 ? 25  LYS A HA   3  
ATOM 3202  H HB2  . LYS A 1 25  ? -9.365  9.233   -0.810  1.00 0.00 ? 25  LYS A HB2  3  
ATOM 3203  H HB3  . LYS A 1 25  ? -10.140 10.217  -2.035  1.00 0.00 ? 25  LYS A HB3  3  
ATOM 3204  H HG2  . LYS A 1 25  ? -12.320 9.885   -1.097  1.00 0.00 ? 25  LYS A HG2  3  
ATOM 3205  H HG3  . LYS A 1 25  ? -11.800 8.505   -0.151  1.00 0.00 ? 25  LYS A HG3  3  
ATOM 3206  H HD2  . LYS A 1 25  ? -11.852 10.173  1.491   1.00 0.00 ? 25  LYS A HD2  3  
ATOM 3207  H HD3  . LYS A 1 25  ? -10.167 10.229  1.013   1.00 0.00 ? 25  LYS A HD3  3  
ATOM 3208  H HE2  . LYS A 1 25  ? -11.114 11.998  -0.793  1.00 0.00 ? 25  LYS A HE2  3  
ATOM 3209  H HE3  . LYS A 1 25  ? -12.381 12.183  0.404   1.00 0.00 ? 25  LYS A HE3  3  
ATOM 3210  H HZ1  . LYS A 1 25  ? -9.900  12.158  1.682   1.00 0.00 ? 25  LYS A HZ1  3  
ATOM 3211  H HZ2  . LYS A 1 25  ? -9.851  13.253  0.472   1.00 0.00 ? 25  LYS A HZ2  3  
ATOM 3212  H HZ3  . LYS A 1 25  ? -11.003 13.361  1.625   1.00 0.00 ? 25  LYS A HZ3  3  
ATOM 3213  N N    . ASP A 1 26  ? -9.359  8.715   -4.407  1.00 0.00 ? 26  ASP A N    3  
ATOM 3214  C CA   . ASP A 1 26  ? -9.312  9.054   -5.819  1.00 0.00 ? 26  ASP A CA   3  
ATOM 3215  C C    . ASP A 1 26  ? -9.774  7.851   -6.644  1.00 0.00 ? 26  ASP A C    3  
ATOM 3216  O O    . ASP A 1 26  ? -10.239 8.009   -7.772  1.00 0.00 ? 26  ASP A O    3  
ATOM 3217  C CB   . ASP A 1 26  ? -7.888  9.406   -6.254  1.00 0.00 ? 26  ASP A CB   3  
ATOM 3218  C CG   . ASP A 1 26  ? -7.641  9.355   -7.763  1.00 0.00 ? 26  ASP A CG   3  
ATOM 3219  O OD1  . ASP A 1 26  ? -8.494  9.901   -8.496  1.00 0.00 ? 26  ASP A OD1  3  
ATOM 3220  O OD2  . ASP A 1 26  ? -6.605  8.772   -8.149  1.00 0.00 ? 26  ASP A OD2  3  
ATOM 3221  H H    . ASP A 1 26  ? -8.474  8.714   -3.943  1.00 0.00 ? 26  ASP A H    3  
ATOM 3222  H HA   . ASP A 1 26  ? -9.973  9.914   -5.930  1.00 0.00 ? 26  ASP A HA   3  
ATOM 3223  H HB2  . ASP A 1 26  ? -7.652  10.408  -5.896  1.00 0.00 ? 26  ASP A HB2  3  
ATOM 3224  H HB3  . ASP A 1 26  ? -7.195  8.722   -5.764  1.00 0.00 ? 26  ASP A HB3  3  
ATOM 3225  N N    . PHE A 1 27  ? -9.630  6.676   -6.049  1.00 0.00 ? 27  PHE A N    3  
ATOM 3226  C CA   . PHE A 1 27  ? -10.027 5.447   -6.715  1.00 0.00 ? 27  PHE A CA   3  
ATOM 3227  C C    . PHE A 1 27  ? -11.433 5.021   -6.287  1.00 0.00 ? 27  PHE A C    3  
ATOM 3228  O O    . PHE A 1 27  ? -11.969 4.037   -6.794  1.00 0.00 ? 27  PHE A O    3  
ATOM 3229  C CB   . PHE A 1 27  ? -9.029  4.367   -6.292  1.00 0.00 ? 27  PHE A CB   3  
ATOM 3230  C CG   . PHE A 1 27  ? -7.667  4.476   -6.980  1.00 0.00 ? 27  PHE A CG   3  
ATOM 3231  C CD1  . PHE A 1 27  ? -6.815  5.482   -6.646  1.00 0.00 ? 27  PHE A CD1  3  
ATOM 3232  C CD2  . PHE A 1 27  ? -7.307  3.566   -7.925  1.00 0.00 ? 27  PHE A CD2  3  
ATOM 3233  C CE1  . PHE A 1 27  ? -5.550  5.583   -7.284  1.00 0.00 ? 27  PHE A CE1  3  
ATOM 3234  C CE2  . PHE A 1 27  ? -6.043  3.667   -8.563  1.00 0.00 ? 27  PHE A CE2  3  
ATOM 3235  C CZ   . PHE A 1 27  ? -5.191  4.673   -8.229  1.00 0.00 ? 27  PHE A CZ   3  
ATOM 3236  H H    . PHE A 1 27  ? -9.251  6.556   -5.132  1.00 0.00 ? 27  PHE A H    3  
ATOM 3237  H HA   . PHE A 1 27  ? -10.020 5.642   -7.787  1.00 0.00 ? 27  PHE A HA   3  
ATOM 3238  H HB2  . PHE A 1 27  ? -8.885  4.421   -5.213  1.00 0.00 ? 27  PHE A HB2  3  
ATOM 3239  H HB3  . PHE A 1 27  ? -9.456  3.387   -6.508  1.00 0.00 ? 27  PHE A HB3  3  
ATOM 3240  H HD1  . PHE A 1 27  ? -7.102  6.211   -5.888  1.00 0.00 ? 27  PHE A HD1  3  
ATOM 3241  H HD2  . PHE A 1 27  ? -7.990  2.760   -8.193  1.00 0.00 ? 27  PHE A HD2  3  
ATOM 3242  H HE1  . PHE A 1 27  ? -4.867  6.389   -7.016  1.00 0.00 ? 27  PHE A HE1  3  
ATOM 3243  H HE2  . PHE A 1 27  ? -5.755  2.938   -9.321  1.00 0.00 ? 27  PHE A HE2  3  
ATOM 3244  H HZ   . PHE A 1 27  ? -4.220  4.751   -8.719  1.00 0.00 ? 27  PHE A HZ   3  
ATOM 3245  N N    . ASN A 1 28  ? -11.990 5.783   -5.357  1.00 0.00 ? 28  ASN A N    3  
ATOM 3246  C CA   . ASN A 1 28  ? -13.323 5.496   -4.855  1.00 0.00 ? 28  ASN A CA   3  
ATOM 3247  C C    . ASN A 1 28  ? -13.328 4.118   -4.191  1.00 0.00 ? 28  ASN A C    3  
ATOM 3248  O O    . ASN A 1 28  ? -14.311 3.384   -4.283  1.00 0.00 ? 28  ASN A O    3  
ATOM 3249  C CB   . ASN A 1 28  ? -14.348 5.477   -5.991  1.00 0.00 ? 28  ASN A CB   3  
ATOM 3250  C CG   . ASN A 1 28  ? -14.915 6.876   -6.241  1.00 0.00 ? 28  ASN A CG   3  
ATOM 3251  O OD1  . ASN A 1 28  ? -14.203 7.817   -6.552  1.00 0.00 ? 28  ASN A OD1  3  
ATOM 3252  N ND2  . ASN A 1 28  ? -16.234 6.960   -6.089  1.00 0.00 ? 28  ASN A ND2  3  
ATOM 3253  H H    . ASN A 1 28  ? -11.548 6.581   -4.950  1.00 0.00 ? 28  ASN A H    3  
ATOM 3254  H HA   . ASN A 1 28  ? -13.543 6.299   -4.151  1.00 0.00 ? 28  ASN A HA   3  
ATOM 3255  H HB2  . ASN A 1 28  ? -13.879 5.103   -6.902  1.00 0.00 ? 28  ASN A HB2  3  
ATOM 3256  H HB3  . ASN A 1 28  ? -15.158 4.791   -5.744  1.00 0.00 ? 28  ASN A HB3  3  
ATOM 3257  H HD21 . ASN A 1 28  ? -16.760 6.149   -5.833  1.00 0.00 ? 28  ASN A HD21 3  
ATOM 3258  H HD22 . ASN A 1 28  ? -16.699 7.833   -6.231  1.00 0.00 ? 28  ASN A HD22 3  
ATOM 3259  N N    . MET A 1 29  ? -12.219 3.808   -3.537  1.00 0.00 ? 29  MET A N    3  
ATOM 3260  C CA   . MET A 1 29  ? -12.083 2.530   -2.857  1.00 0.00 ? 29  MET A CA   3  
ATOM 3261  C C    . MET A 1 29  ? -11.033 2.608   -1.748  1.00 0.00 ? 29  MET A C    3  
ATOM 3262  O O    . MET A 1 29  ? -10.232 3.542   -1.710  1.00 0.00 ? 29  MET A O    3  
ATOM 3263  C CB   . MET A 1 29  ? -11.680 1.455   -3.868  1.00 0.00 ? 29  MET A CB   3  
ATOM 3264  C CG   . MET A 1 29  ? -10.158 1.369   -3.999  1.00 0.00 ? 29  MET A CG   3  
ATOM 3265  S SD   . MET A 1 29  ? -9.719  0.158   -5.235  1.00 0.00 ? 29  MET A SD   3  
ATOM 3266  C CE   . MET A 1 29  ? -8.980  -1.092  -4.196  1.00 0.00 ? 29  MET A CE   3  
ATOM 3267  H H    . MET A 1 29  ? -11.424 4.410   -3.466  1.00 0.00 ? 29  MET A H    3  
ATOM 3268  H HA   . MET A 1 29  ? -13.062 2.323   -2.426  1.00 0.00 ? 29  MET A HA   3  
ATOM 3269  H HB2  . MET A 1 29  ? -12.077 0.489   -3.555  1.00 0.00 ? 29  MET A HB2  3  
ATOM 3270  H HB3  . MET A 1 29  ? -12.120 1.680   -4.839  1.00 0.00 ? 29  MET A HB3  3  
ATOM 3271  H HG2  . MET A 1 29  ? -9.752  2.343   -4.272  1.00 0.00 ? 29  MET A HG2  3  
ATOM 3272  H HG3  . MET A 1 29  ? -9.717  1.097   -3.039  1.00 0.00 ? 29  MET A HG3  3  
ATOM 3273  H HE1  . MET A 1 29  ? -9.467  -1.088  -3.221  1.00 0.00 ? 29  MET A HE1  3  
ATOM 3274  H HE2  . MET A 1 29  ? -9.104  -2.070  -4.661  1.00 0.00 ? 29  MET A HE2  3  
ATOM 3275  H HE3  . MET A 1 29  ? -7.918  -0.880  -4.072  1.00 0.00 ? 29  MET A HE3  3  
ATOM 3276  N N    . PRO A 1 30  ? -11.070 1.589   -0.848  1.00 0.00 ? 30  PRO A N    3  
ATOM 3277  C CA   . PRO A 1 30  ? -10.131 1.533   0.259   1.00 0.00 ? 30  PRO A CA   3  
ATOM 3278  C C    . PRO A 1 30  ? -8.742  1.106   -0.220  1.00 0.00 ? 30  PRO A C    3  
ATOM 3279  O O    . PRO A 1 30  ? -8.612  0.462   -1.260  1.00 0.00 ? 30  PRO A O    3  
ATOM 3280  C CB   . PRO A 1 30  ? -10.745 0.555   1.247   1.00 0.00 ? 30  PRO A CB   3  
ATOM 3281  C CG   . PRO A 1 30  ? -11.765 -0.249  0.458   1.00 0.00 ? 30  PRO A CG   3  
ATOM 3282  C CD   . PRO A 1 30  ? -12.003 0.467   -0.862  1.00 0.00 ? 30  PRO A CD   3  
ATOM 3283  H HA   . PRO A 1 30  ? -10.013 2.442   0.661   1.00 0.00 ? 30  PRO A HA   3  
ATOM 3284  H HB2  . PRO A 1 30  ? -9.984  -0.095  1.678   1.00 0.00 ? 30  PRO A HB2  3  
ATOM 3285  H HB3  . PRO A 1 30  ? -11.220 1.083   2.075   1.00 0.00 ? 30  PRO A HB3  3  
ATOM 3286  H HG2  . PRO A 1 30  ? -11.400 -1.261  0.283   1.00 0.00 ? 30  PRO A HG2  3  
ATOM 3287  H HG3  . PRO A 1 30  ? -12.696 -0.339  1.017   1.00 0.00 ? 30  PRO A HG3  3  
ATOM 3288  H HD2  . PRO A 1 30  ? -11.817 -0.193  -1.709  1.00 0.00 ? 30  PRO A HD2  3  
ATOM 3289  H HD3  . PRO A 1 30  ? -13.034 0.810   -0.945  1.00 0.00 ? 30  PRO A HD3  3  
ATOM 3290  N N    . LEU A 1 31  ? -7.740  1.480   0.561   1.00 0.00 ? 31  LEU A N    3  
ATOM 3291  C CA   . LEU A 1 31  ? -6.366  1.144   0.229   1.00 0.00 ? 31  LEU A CA   3  
ATOM 3292  C C    . LEU A 1 31  ? -6.120  -0.336  0.532   1.00 0.00 ? 31  LEU A C    3  
ATOM 3293  O O    . LEU A 1 31  ? -6.172  -0.753  1.689   1.00 0.00 ? 31  LEU A O    3  
ATOM 3294  C CB   . LEU A 1 31  ? -5.396  2.087   0.942   1.00 0.00 ? 31  LEU A CB   3  
ATOM 3295  C CG   . LEU A 1 31  ? -5.387  3.537   0.452   1.00 0.00 ? 31  LEU A CG   3  
ATOM 3296  C CD1  . LEU A 1 31  ? -5.393  4.514   1.629   1.00 0.00 ? 31  LEU A CD1  3  
ATOM 3297  C CD2  . LEU A 1 31  ? -4.212  3.788   -0.495  1.00 0.00 ? 31  LEU A CD2  3  
ATOM 3298  H H    . LEU A 1 31  ? -7.854  2.004   1.405   1.00 0.00 ? 31  LEU A H    3  
ATOM 3299  H HA   . LEU A 1 31  ? -6.240  1.302   -0.842  1.00 0.00 ? 31  LEU A HA   3  
ATOM 3300  H HB2  . LEU A 1 31  ? -5.634  2.086   2.006   1.00 0.00 ? 31  LEU A HB2  3  
ATOM 3301  H HB3  . LEU A 1 31  ? -4.388  1.684   0.841   1.00 0.00 ? 31  LEU A HB3  3  
ATOM 3302  H HG   . LEU A 1 31  ? -6.301  3.711   -0.116  1.00 0.00 ? 31  LEU A HG   3  
ATOM 3303  H HD11 . LEU A 1 31  ? -6.422  4.720   1.925   1.00 0.00 ? 31  LEU A HD11 3  
ATOM 3304  H HD12 . LEU A 1 31  ? -4.855  4.075   2.469   1.00 0.00 ? 31  LEU A HD12 3  
ATOM 3305  H HD13 . LEU A 1 31  ? -4.907  5.443   1.332   1.00 0.00 ? 31  LEU A HD13 3  
ATOM 3306  H HD21 . LEU A 1 31  ? -4.483  4.561   -1.214  1.00 0.00 ? 31  LEU A HD21 3  
ATOM 3307  H HD22 . LEU A 1 31  ? -3.345  4.114   0.079   1.00 0.00 ? 31  LEU A HD22 3  
ATOM 3308  H HD23 . LEU A 1 31  ? -3.969  2.867   -1.026  1.00 0.00 ? 31  LEU A HD23 3  
ATOM 3309  N N    . THR A 1 32  ? -5.858  -1.088  -0.526  1.00 0.00 ? 32  THR A N    3  
ATOM 3310  C CA   . THR A 1 32  ? -5.604  -2.512  -0.387  1.00 0.00 ? 32  THR A CA   3  
ATOM 3311  C C    . THR A 1 32  ? -4.241  -2.872  -0.981  1.00 0.00 ? 32  THR A C    3  
ATOM 3312  O O    . THR A 1 32  ? -3.626  -2.059  -1.669  1.00 0.00 ? 32  THR A O    3  
ATOM 3313  C CB   . THR A 1 32  ? -6.768  -3.265  -1.035  1.00 0.00 ? 32  THR A CB   3  
ATOM 3314  O OG1  . THR A 1 32  ? -7.250  -2.368  -2.032  1.00 0.00 ? 32  THR A OG1  3  
ATOM 3315  C CG2  . THR A 1 32  ? -7.954  -3.440  -0.086  1.00 0.00 ? 32  THR A CG2  3  
ATOM 3316  H H    . THR A 1 32  ? -5.818  -0.742  -1.463  1.00 0.00 ? 32  THR A H    3  
ATOM 3317  H HA   . THR A 1 32  ? -5.563  -2.752  0.676   1.00 0.00 ? 32  THR A HA   3  
ATOM 3318  H HB   . THR A 1 32  ? -6.438  -4.227  -1.428  1.00 0.00 ? 32  THR A HB   3  
ATOM 3319  H HG1  . THR A 1 32  ? -6.583  -2.289  -2.773  1.00 0.00 ? 32  THR A HG1  3  
ATOM 3320  H HG21 . THR A 1 32  ? -8.263  -2.466  0.293   1.00 0.00 ? 32  THR A HG21 3  
ATOM 3321  H HG22 . THR A 1 32  ? -8.784  -3.902  -0.622  1.00 0.00 ? 32  THR A HG22 3  
ATOM 3322  H HG23 . THR A 1 32  ? -7.661  -4.078  0.748   1.00 0.00 ? 32  THR A HG23 3  
ATOM 3323  N N    . ILE A 1 33  ? -3.809  -4.091  -0.694  1.00 0.00 ? 33  ILE A N    3  
ATOM 3324  C CA   . ILE A 1 33  ? -2.530  -4.568  -1.191  1.00 0.00 ? 33  ILE A CA   3  
ATOM 3325  C C    . ILE A 1 33  ? -2.677  -4.973  -2.659  1.00 0.00 ? 33  ILE A C    3  
ATOM 3326  O O    . ILE A 1 33  ? -3.138  -6.073  -2.960  1.00 0.00 ? 33  ILE A O    3  
ATOM 3327  C CB   . ILE A 1 33  ? -1.990  -5.685  -0.296  1.00 0.00 ? 33  ILE A CB   3  
ATOM 3328  C CG1  . ILE A 1 33  ? -1.827  -5.202  1.146   1.00 0.00 ? 33  ILE A CG1  3  
ATOM 3329  C CG2  . ILE A 1 33  ? -0.687  -6.258  -0.859  1.00 0.00 ? 33  ILE A CG2  3  
ATOM 3330  C CD1  . ILE A 1 33  ? -0.832  -4.042  1.227   1.00 0.00 ? 33  ILE A CD1  3  
ATOM 3331  H H    . ILE A 1 33  ? -4.315  -4.746  -0.133  1.00 0.00 ? 33  ILE A H    3  
ATOM 3332  H HA   . ILE A 1 33  ? -1.826  -3.738  -1.130  1.00 0.00 ? 33  ILE A HA   3  
ATOM 3333  H HB   . ILE A 1 33  ? -2.719  -6.495  -0.284  1.00 0.00 ? 33  ILE A HB   3  
ATOM 3334  H HG12 . ILE A 1 33  ? -2.793  -4.885  1.539   1.00 0.00 ? 33  ILE A HG12 3  
ATOM 3335  H HG13 . ILE A 1 33  ? -1.483  -6.025  1.773   1.00 0.00 ? 33  ILE A HG13 3  
ATOM 3336  H HG21 . ILE A 1 33  ? -0.811  -7.325  -1.046  1.00 0.00 ? 33  ILE A HG21 3  
ATOM 3337  H HG22 . ILE A 1 33  ? -0.442  -5.752  -1.793  1.00 0.00 ? 33  ILE A HG22 3  
ATOM 3338  H HG23 . ILE A 1 33  ? 0.118   -6.105  -0.141  1.00 0.00 ? 33  ILE A HG23 3  
ATOM 3339  H HD11 . ILE A 1 33  ? 0.028   -4.256  0.592   1.00 0.00 ? 33  ILE A HD11 3  
ATOM 3340  H HD12 . ILE A 1 33  ? -1.314  -3.125  0.888   1.00 0.00 ? 33  ILE A HD12 3  
ATOM 3341  H HD13 . ILE A 1 33  ? -0.501  -3.919  2.258   1.00 0.00 ? 33  ILE A HD13 3  
ATOM 3342  N N    . SER A 1 34  ? -2.277  -4.062  -3.534  1.00 0.00 ? 34  SER A N    3  
ATOM 3343  C CA   . SER A 1 34  ? -2.359  -4.310  -4.963  1.00 0.00 ? 34  SER A CA   3  
ATOM 3344  C C    . SER A 1 34  ? -1.765  -5.682  -5.291  1.00 0.00 ? 34  SER A C    3  
ATOM 3345  O O    . SER A 1 34  ? -2.467  -6.564  -5.783  1.00 0.00 ? 34  SER A O    3  
ATOM 3346  C CB   . SER A 1 34  ? -1.637  -3.217  -5.755  1.00 0.00 ? 34  SER A CB   3  
ATOM 3347  O OG   . SER A 1 34  ? -2.099  -3.139  -7.100  1.00 0.00 ? 34  SER A OG   3  
ATOM 3348  H H    . SER A 1 34  ? -1.903  -3.169  -3.281  1.00 0.00 ? 34  SER A H    3  
ATOM 3349  H HA   . SER A 1 34  ? -3.422  -4.287  -5.200  1.00 0.00 ? 34  SER A HA   3  
ATOM 3350  H HB2  . SER A 1 34  ? -1.787  -2.256  -5.264  1.00 0.00 ? 34  SER A HB2  3  
ATOM 3351  H HB3  . SER A 1 34  ? -0.565  -3.414  -5.750  1.00 0.00 ? 34  SER A HB3  3  
ATOM 3352  H HG   . SER A 1 34  ? -1.430  -2.655  -7.664  1.00 0.00 ? 34  SER A HG   3  
ATOM 3353  N N    . SER A 1 35  ? -0.479  -5.819  -5.004  1.00 0.00 ? 35  SER A N    3  
ATOM 3354  C CA   . SER A 1 35  ? 0.216   -7.068  -5.262  1.00 0.00 ? 35  SER A CA   3  
ATOM 3355  C C    . SER A 1 35  ? 1.275   -7.310  -4.184  1.00 0.00 ? 35  SER A C    3  
ATOM 3356  O O    . SER A 1 35  ? 1.515   -6.448  -3.341  1.00 0.00 ? 35  SER A O    3  
ATOM 3357  C CB   . SER A 1 35  ? 0.863   -7.063  -6.649  1.00 0.00 ? 35  SER A CB   3  
ATOM 3358  O OG   . SER A 1 35  ? 0.152   -7.883  -7.573  1.00 0.00 ? 35  SER A OG   3  
ATOM 3359  H H    . SER A 1 35  ? 0.085   -5.096  -4.604  1.00 0.00 ? 35  SER A H    3  
ATOM 3360  H HA   . SER A 1 35  ? -0.553  -7.840  -5.224  1.00 0.00 ? 35  SER A HA   3  
ATOM 3361  H HB2  . SER A 1 35  ? 0.901   -6.041  -7.027  1.00 0.00 ? 35  SER A HB2  3  
ATOM 3362  H HB3  . SER A 1 35  ? 1.892   -7.412  -6.571  1.00 0.00 ? 35  SER A HB3  3  
ATOM 3363  H HG   . SER A 1 35  ? -0.518  -7.334  -8.072  1.00 0.00 ? 35  SER A HG   3  
ATOM 3364  N N    . LEU A 1 36  ? 1.880   -8.487  -4.248  1.00 0.00 ? 36  LEU A N    3  
ATOM 3365  C CA   . LEU A 1 36  ? 2.907   -8.853  -3.287  1.00 0.00 ? 36  LEU A CA   3  
ATOM 3366  C C    . LEU A 1 36  ? 4.208   -9.160  -4.031  1.00 0.00 ? 36  LEU A C    3  
ATOM 3367  O O    . LEU A 1 36  ? 4.213   -9.286  -5.255  1.00 0.00 ? 36  LEU A O    3  
ATOM 3368  C CB   . LEU A 1 36  ? 2.423   -9.999  -2.396  1.00 0.00 ? 36  LEU A CB   3  
ATOM 3369  C CG   . LEU A 1 36  ? 2.189   -9.652  -0.925  1.00 0.00 ? 36  LEU A CG   3  
ATOM 3370  C CD1  . LEU A 1 36  ? 3.504   -9.662  -0.143  1.00 0.00 ? 36  LEU A CD1  3  
ATOM 3371  C CD2  . LEU A 1 36  ? 1.451   -8.319  -0.787  1.00 0.00 ? 36  LEU A CD2  3  
ATOM 3372  H H    . LEU A 1 36  ? 1.678   -9.183  -4.937  1.00 0.00 ? 36  LEU A H    3  
ATOM 3373  H HA   . LEU A 1 36  ? 3.073   -7.991  -2.642  1.00 0.00 ? 36  LEU A HA   3  
ATOM 3374  H HB2  . LEU A 1 36  ? 1.492   -10.387 -2.810  1.00 0.00 ? 36  LEU A HB2  3  
ATOM 3375  H HB3  . LEU A 1 36  ? 3.154   -10.806 -2.447  1.00 0.00 ? 36  LEU A HB3  3  
ATOM 3376  H HG   . LEU A 1 36  ? 1.550   -10.420 -0.490  1.00 0.00 ? 36  LEU A HG   3  
ATOM 3377  H HD11 . LEU A 1 36  ? 3.880   -8.644  -0.050  1.00 0.00 ? 36  LEU A HD11 3  
ATOM 3378  H HD12 . LEU A 1 36  ? 3.334   -10.079 0.850   1.00 0.00 ? 36  LEU A HD12 3  
ATOM 3379  H HD13 . LEU A 1 36  ? 4.237   -10.273 -0.672  1.00 0.00 ? 36  LEU A HD13 3  
ATOM 3380  H HD21 . LEU A 1 36  ? 0.653   -8.420  -0.052  1.00 0.00 ? 36  LEU A HD21 3  
ATOM 3381  H HD22 . LEU A 1 36  ? 2.150   -7.549  -0.460  1.00 0.00 ? 36  LEU A HD22 3  
ATOM 3382  H HD23 . LEU A 1 36  ? 1.025   -8.038  -1.750  1.00 0.00 ? 36  LEU A HD23 3  
ATOM 3383  N N    . LYS A 1 37  ? 5.281   -9.271  -3.261  1.00 0.00 ? 37  LYS A N    3  
ATOM 3384  C CA   . LYS A 1 37  ? 6.585   -9.560  -3.832  1.00 0.00 ? 37  LYS A CA   3  
ATOM 3385  C C    . LYS A 1 37  ? 7.077   -10.911 -3.309  1.00 0.00 ? 37  LYS A C    3  
ATOM 3386  O O    . LYS A 1 37  ? 6.935   -11.212 -2.125  1.00 0.00 ? 37  LYS A O    3  
ATOM 3387  C CB   . LYS A 1 37  ? 7.555   -8.407  -3.564  1.00 0.00 ? 37  LYS A CB   3  
ATOM 3388  C CG   . LYS A 1 37  ? 8.913   -8.671  -4.216  1.00 0.00 ? 37  LYS A CG   3  
ATOM 3389  C CD   . LYS A 1 37  ? 9.564   -7.364  -4.675  1.00 0.00 ? 37  LYS A CD   3  
ATOM 3390  C CE   . LYS A 1 37  ? 10.915  -7.629  -5.342  1.00 0.00 ? 37  LYS A CE   3  
ATOM 3391  N NZ   . LYS A 1 37  ? 10.772  -7.639  -6.815  1.00 0.00 ? 37  LYS A NZ   3  
ATOM 3392  H H    . LYS A 1 37  ? 5.268   -9.166  -2.266  1.00 0.00 ? 37  LYS A H    3  
ATOM 3393  H HA   . LYS A 1 37  ? 6.460   -9.632  -4.912  1.00 0.00 ? 37  LYS A HA   3  
ATOM 3394  H HB2  . LYS A 1 37  ? 7.136   -7.477  -3.950  1.00 0.00 ? 37  LYS A HB2  3  
ATOM 3395  H HB3  . LYS A 1 37  ? 7.682   -8.276  -2.489  1.00 0.00 ? 37  LYS A HB3  3  
ATOM 3396  H HG2  . LYS A 1 37  ? 9.568   -9.178  -3.508  1.00 0.00 ? 37  LYS A HG2  3  
ATOM 3397  H HG3  . LYS A 1 37  ? 8.788   -9.338  -5.069  1.00 0.00 ? 37  LYS A HG3  3  
ATOM 3398  H HD2  . LYS A 1 37  ? 8.904   -6.850  -5.373  1.00 0.00 ? 37  LYS A HD2  3  
ATOM 3399  H HD3  . LYS A 1 37  ? 9.701   -6.702  -3.820  1.00 0.00 ? 37  LYS A HD3  3  
ATOM 3400  H HE2  . LYS A 1 37  ? 11.631  -6.863  -5.046  1.00 0.00 ? 37  LYS A HE2  3  
ATOM 3401  H HE3  . LYS A 1 37  ? 11.313  -8.586  -5.003  1.00 0.00 ? 37  LYS A HE3  3  
ATOM 3402  H HZ1  . LYS A 1 37  ? 10.200  -6.870  -7.100  1.00 0.00 ? 37  LYS A HZ1  3  
ATOM 3403  H HZ2  . LYS A 1 37  ? 11.675  -7.558  -7.238  1.00 0.00 ? 37  LYS A HZ2  3  
ATOM 3404  H HZ3  . LYS A 1 37  ? 10.345  -8.497  -7.103  1.00 0.00 ? 37  LYS A HZ3  3  
ATOM 3405  N N    . ASP A 1 38  ? 7.646   -11.690 -4.218  1.00 0.00 ? 38  ASP A N    3  
ATOM 3406  C CA   . ASP A 1 38  ? 8.160   -13.002 -3.864  1.00 0.00 ? 38  ASP A CA   3  
ATOM 3407  C C    . ASP A 1 38  ? 9.083   -12.872 -2.650  1.00 0.00 ? 38  ASP A C    3  
ATOM 3408  O O    . ASP A 1 38  ? 10.036  -12.096 -2.672  1.00 0.00 ? 38  ASP A O    3  
ATOM 3409  C CB   . ASP A 1 38  ? 8.970   -13.604 -5.013  1.00 0.00 ? 38  ASP A CB   3  
ATOM 3410  C CG   . ASP A 1 38  ? 8.139   -14.275 -6.108  1.00 0.00 ? 38  ASP A CG   3  
ATOM 3411  O OD1  . ASP A 1 38  ? 7.224   -13.596 -6.622  1.00 0.00 ? 38  ASP A OD1  3  
ATOM 3412  O OD2  . ASP A 1 38  ? 8.439   -15.451 -6.408  1.00 0.00 ? 38  ASP A OD2  3  
ATOM 3413  H H    . ASP A 1 38  ? 7.757   -11.437 -5.179  1.00 0.00 ? 38  ASP A H    3  
ATOM 3414  H HA   . ASP A 1 38  ? 7.278   -13.607 -3.654  1.00 0.00 ? 38  ASP A HA   3  
ATOM 3415  H HB2  . ASP A 1 38  ? 9.572   -12.816 -5.465  1.00 0.00 ? 38  ASP A HB2  3  
ATOM 3416  H HB3  . ASP A 1 38  ? 9.664   -14.339 -4.602  1.00 0.00 ? 38  ASP A HB3  3  
ATOM 3417  N N    . GLY A 1 39  ? 8.767   -13.645 -1.622  1.00 0.00 ? 39  GLY A N    3  
ATOM 3418  C CA   . GLY A 1 39  ? 9.556   -13.627 -0.402  1.00 0.00 ? 39  GLY A CA   3  
ATOM 3419  C C    . GLY A 1 39  ? 9.899   -12.193 0.008   1.00 0.00 ? 39  GLY A C    3  
ATOM 3420  O O    . GLY A 1 39  ? 11.067  -11.864 0.212   1.00 0.00 ? 39  GLY A O    3  
ATOM 3421  H H    . GLY A 1 39  ? 7.990   -14.274 -1.613  1.00 0.00 ? 39  GLY A H    3  
ATOM 3422  H HA2  . GLY A 1 39  ? 9.004   -14.116 0.400   1.00 0.00 ? 39  GLY A HA2  3  
ATOM 3423  H HA3  . GLY A 1 39  ? 10.474  -14.196 -0.550  1.00 0.00 ? 39  GLY A HA3  3  
ATOM 3424  N N    . GLY A 1 40  ? 8.860   -11.378 0.116   1.00 0.00 ? 40  GLY A N    3  
ATOM 3425  C CA   . GLY A 1 40  ? 9.036   -9.987  0.498   1.00 0.00 ? 40  GLY A CA   3  
ATOM 3426  C C    . GLY A 1 40  ? 8.605   -9.758  1.948   1.00 0.00 ? 40  GLY A C    3  
ATOM 3427  O O    . GLY A 1 40  ? 7.766   -10.488 2.472   1.00 0.00 ? 40  GLY A O    3  
ATOM 3428  H H    . GLY A 1 40  ? 7.913   -11.654 -0.052  1.00 0.00 ? 40  GLY A H    3  
ATOM 3429  H HA2  . GLY A 1 40  ? 10.082  -9.703  0.376   1.00 0.00 ? 40  GLY A HA2  3  
ATOM 3430  H HA3  . GLY A 1 40  ? 8.453   -9.348  -0.165  1.00 0.00 ? 40  GLY A HA3  3  
ATOM 3431  N N    . LYS A 1 41  ? 9.198   -8.740  2.554   1.00 0.00 ? 41  LYS A N    3  
ATOM 3432  C CA   . LYS A 1 41  ? 8.886   -8.405  3.933   1.00 0.00 ? 41  LYS A CA   3  
ATOM 3433  C C    . LYS A 1 41  ? 7.373   -8.490  4.143   1.00 0.00 ? 41  LYS A C    3  
ATOM 3434  O O    . LYS A 1 41  ? 6.903   -9.232  5.005   1.00 0.00 ? 41  LYS A O    3  
ATOM 3435  C CB   . LYS A 1 41  ? 9.483   -7.046  4.303   1.00 0.00 ? 41  LYS A CB   3  
ATOM 3436  C CG   . LYS A 1 41  ? 11.010  -7.118  4.371   1.00 0.00 ? 41  LYS A CG   3  
ATOM 3437  C CD   . LYS A 1 41  ? 11.644  -6.524  3.112   1.00 0.00 ? 41  LYS A CD   3  
ATOM 3438  C CE   . LYS A 1 41  ? 12.571  -7.535  2.435   1.00 0.00 ? 41  LYS A CE   3  
ATOM 3439  N NZ   . LYS A 1 41  ? 12.496  -7.403  0.963   1.00 0.00 ? 41  LYS A NZ   3  
ATOM 3440  H H    . LYS A 1 41  ? 9.880   -8.151  2.120   1.00 0.00 ? 41  LYS A H    3  
ATOM 3441  H HA   . LYS A 1 41  ? 9.365   -9.151  4.567   1.00 0.00 ? 41  LYS A HA   3  
ATOM 3442  H HB2  . LYS A 1 41  ? 9.183   -6.300  3.566   1.00 0.00 ? 41  LYS A HB2  3  
ATOM 3443  H HB3  . LYS A 1 41  ? 9.087   -6.720  5.264   1.00 0.00 ? 41  LYS A HB3  3  
ATOM 3444  H HG2  . LYS A 1 41  ? 11.363  -6.579  5.250   1.00 0.00 ? 41  LYS A HG2  3  
ATOM 3445  H HG3  . LYS A 1 41  ? 11.324  -8.155  4.486   1.00 0.00 ? 41  LYS A HG3  3  
ATOM 3446  H HD2  . LYS A 1 41  ? 10.862  -6.219  2.416   1.00 0.00 ? 41  LYS A HD2  3  
ATOM 3447  H HD3  . LYS A 1 41  ? 12.206  -5.627  3.372   1.00 0.00 ? 41  LYS A HD3  3  
ATOM 3448  H HE2  . LYS A 1 41  ? 13.596  -7.378  2.769   1.00 0.00 ? 41  LYS A HE2  3  
ATOM 3449  H HE3  . LYS A 1 41  ? 12.292  -8.547  2.730   1.00 0.00 ? 41  LYS A HE3  3  
ATOM 3450  H HZ1  . LYS A 1 41  ? 13.038  -6.615  0.671   1.00 0.00 ? 41  LYS A HZ1  3  
ATOM 3451  H HZ2  . LYS A 1 41  ? 12.857  -8.232  0.535   1.00 0.00 ? 41  LYS A HZ2  3  
ATOM 3452  H HZ3  . LYS A 1 41  ? 11.543  -7.273  0.688   1.00 0.00 ? 41  LYS A HZ3  3  
ATOM 3453  N N    . ALA A 1 42  ? 6.652   -7.720  3.342   1.00 0.00 ? 42  ALA A N    3  
ATOM 3454  C CA   . ALA A 1 42  ? 5.202   -7.699  3.430   1.00 0.00 ? 42  ALA A CA   3  
ATOM 3455  C C    . ALA A 1 42  ? 4.684   -9.128  3.601   1.00 0.00 ? 42  ALA A C    3  
ATOM 3456  O O    . ALA A 1 42  ? 4.162   -9.481  4.657   1.00 0.00 ? 42  ALA A O    3  
ATOM 3457  C CB   . ALA A 1 42  ? 4.625   -7.015  2.189   1.00 0.00 ? 42  ALA A CB   3  
ATOM 3458  H H    . ALA A 1 42  ? 7.042   -7.119  2.644   1.00 0.00 ? 42  ALA A H    3  
ATOM 3459  H HA   . ALA A 1 42  ? 4.931   -7.115  4.310   1.00 0.00 ? 42  ALA A HA   3  
ATOM 3460  H HB1  . ALA A 1 42  ? 3.898   -7.674  1.715   1.00 0.00 ? 42  ALA A HB1  3  
ATOM 3461  H HB2  . ALA A 1 42  ? 4.136   -6.085  2.480   1.00 0.00 ? 42  ALA A HB2  3  
ATOM 3462  H HB3  . ALA A 1 42  ? 5.430   -6.797  1.487   1.00 0.00 ? 42  ALA A HB3  3  
ATOM 3463  N N    . SER A 1 43  ? 4.848   -9.913  2.546   1.00 0.00 ? 43  SER A N    3  
ATOM 3464  C CA   . SER A 1 43  ? 4.405   -11.297 2.566   1.00 0.00 ? 43  SER A CA   3  
ATOM 3465  C C    . SER A 1 43  ? 4.884   -11.981 3.847   1.00 0.00 ? 43  SER A C    3  
ATOM 3466  O O    . SER A 1 43  ? 4.102   -12.636 4.535   1.00 0.00 ? 43  SER A O    3  
ATOM 3467  C CB   . SER A 1 43  ? 4.911   -12.055 1.337   1.00 0.00 ? 43  SER A CB   3  
ATOM 3468  O OG   . SER A 1 43  ? 5.028   -13.454 1.585   1.00 0.00 ? 43  SER A OG   3  
ATOM 3469  H H    . SER A 1 43  ? 5.275   -9.619  1.690   1.00 0.00 ? 43  SER A H    3  
ATOM 3470  H HA   . SER A 1 43  ? 3.316   -11.251 2.541   1.00 0.00 ? 43  SER A HA   3  
ATOM 3471  H HB2  . SER A 1 43  ? 4.229   -11.890 0.503   1.00 0.00 ? 43  SER A HB2  3  
ATOM 3472  H HB3  . SER A 1 43  ? 5.881   -11.657 1.040   1.00 0.00 ? 43  SER A HB3  3  
ATOM 3473  H HG   . SER A 1 43  ? 5.719   -13.620 2.288   1.00 0.00 ? 43  SER A HG   3  
ATOM 3474  N N    . GLN A 1 44  ? 6.167   -11.806 4.130   1.00 0.00 ? 44  GLN A N    3  
ATOM 3475  C CA   . GLN A 1 44  ? 6.759   -12.399 5.316   1.00 0.00 ? 44  GLN A CA   3  
ATOM 3476  C C    . GLN A 1 44  ? 6.083   -11.855 6.576   1.00 0.00 ? 44  GLN A C    3  
ATOM 3477  O O    . GLN A 1 44  ? 6.147   -12.474 7.637   1.00 0.00 ? 44  GLN A O    3  
ATOM 3478  C CB   . GLN A 1 44  ? 8.269   -12.155 5.356   1.00 0.00 ? 44  GLN A CB   3  
ATOM 3479  C CG   . GLN A 1 44  ? 8.978   -12.920 4.236   1.00 0.00 ? 44  GLN A CG   3  
ATOM 3480  C CD   . GLN A 1 44  ? 10.274  -13.557 4.742   1.00 0.00 ? 44  GLN A CD   3  
ATOM 3481  O OE1  . GLN A 1 44  ? 10.453  -14.763 4.721   1.00 0.00 ? 44  GLN A OE1  3  
ATOM 3482  N NE2  . GLN A 1 44  ? 11.165  -12.680 5.196   1.00 0.00 ? 44  GLN A NE2  3  
ATOM 3483  H H    . GLN A 1 44  ? 6.796   -11.272 3.565   1.00 0.00 ? 44  GLN A H    3  
ATOM 3484  H HA   . GLN A 1 44  ? 6.573   -13.470 5.229   1.00 0.00 ? 44  GLN A HA   3  
ATOM 3485  H HB2  . GLN A 1 44  ? 8.471   -11.089 5.257   1.00 0.00 ? 44  GLN A HB2  3  
ATOM 3486  H HB3  . GLN A 1 44  ? 8.667   -12.467 6.322   1.00 0.00 ? 44  GLN A HB3  3  
ATOM 3487  H HG2  . GLN A 1 44  ? 8.317   -13.694 3.845   1.00 0.00 ? 44  GLN A HG2  3  
ATOM 3488  H HG3  . GLN A 1 44  ? 9.199   -12.243 3.411   1.00 0.00 ? 44  GLN A HG3  3  
ATOM 3489  H HE21 . GLN A 1 44  ? 10.956  -11.703 5.184   1.00 0.00 ? 44  GLN A HE21 3  
ATOM 3490  H HE22 . GLN A 1 44  ? 12.045  -12.999 5.548   1.00 0.00 ? 44  GLN A HE22 3  
ATOM 3491  N N    . ALA A 1 45  ? 5.450   -10.702 6.418   1.00 0.00 ? 45  ALA A N    3  
ATOM 3492  C CA   . ALA A 1 45  ? 4.762   -10.067 7.529   1.00 0.00 ? 45  ALA A CA   3  
ATOM 3493  C C    . ALA A 1 45  ? 3.288   -10.475 7.511   1.00 0.00 ? 45  ALA A C    3  
ATOM 3494  O O    . ALA A 1 45  ? 2.444   -9.795  8.094   1.00 0.00 ? 45  ALA A O    3  
ATOM 3495  C CB   . ALA A 1 45  ? 4.948   -8.551  7.446   1.00 0.00 ? 45  ALA A CB   3  
ATOM 3496  H H    . ALA A 1 45  ? 5.402   -10.204 5.552   1.00 0.00 ? 45  ALA A H    3  
ATOM 3497  H HA   . ALA A 1 45  ? 5.219   -10.426 8.451   1.00 0.00 ? 45  ALA A HA   3  
ATOM 3498  H HB1  . ALA A 1 45  ? 4.908   -8.124  8.448   1.00 0.00 ? 45  ALA A HB1  3  
ATOM 3499  H HB2  . ALA A 1 45  ? 5.915   -8.327  6.994   1.00 0.00 ? 45  ALA A HB2  3  
ATOM 3500  H HB3  . ALA A 1 45  ? 4.154   -8.120  6.835   1.00 0.00 ? 45  ALA A HB3  3  
ATOM 3501  N N    . HIS A 1 46  ? 3.022   -11.584 6.837   1.00 0.00 ? 46  HIS A N    3  
ATOM 3502  C CA   . HIS A 1 46  ? 1.664   -12.092 6.736   1.00 0.00 ? 46  HIS A CA   3  
ATOM 3503  C C    . HIS A 1 46  ? 0.766   -11.030 6.098   1.00 0.00 ? 46  HIS A C    3  
ATOM 3504  O O    . HIS A 1 46  ? -0.296  -10.708 6.629   1.00 0.00 ? 46  HIS A O    3  
ATOM 3505  C CB   . HIS A 1 46  ? 1.154   -12.556 8.101   1.00 0.00 ? 46  HIS A CB   3  
ATOM 3506  C CG   . HIS A 1 46  ? 2.092   -13.497 8.819   1.00 0.00 ? 46  HIS A CG   3  
ATOM 3507  N ND1  . HIS A 1 46  ? 1.834   -14.849 8.963   1.00 0.00 ? 46  HIS A ND1  3  
ATOM 3508  C CD2  . HIS A 1 46  ? 3.290   -13.267 9.431   1.00 0.00 ? 46  HIS A CD2  3  
ATOM 3509  C CE1  . HIS A 1 46  ? 2.836   -15.398 9.633   1.00 0.00 ? 46  HIS A CE1  3  
ATOM 3510  N NE2  . HIS A 1 46  ? 3.737   -14.415 9.923   1.00 0.00 ? 46  HIS A NE2  3  
ATOM 3511  H H    . HIS A 1 46  ? 3.714   -12.132 6.366   1.00 0.00 ? 46  HIS A H    3  
ATOM 3512  H HA   . HIS A 1 46  ? 1.703   -12.963 6.082   1.00 0.00 ? 46  HIS A HA   3  
ATOM 3513  H HB2  . HIS A 1 46  ? 0.981   -11.682 8.730   1.00 0.00 ? 46  HIS A HB2  3  
ATOM 3514  H HB3  . HIS A 1 46  ? 0.192   -13.050 7.970   1.00 0.00 ? 46  HIS A HB3  3  
ATOM 3515  H HD1  . HIS A 1 46  ? 1.027   -15.330 8.619   1.00 0.00 ? 46  HIS A HD1  3  
ATOM 3516  H HD2  . HIS A 1 46  ? 3.793   -12.303 9.504   1.00 0.00 ? 46  HIS A HD2  3  
ATOM 3517  H HE1  . HIS A 1 46  ? 2.925   -16.449 9.905   1.00 0.00 ? 46  HIS A HE1  3  
ATOM 3518  N N    . VAL A 1 47  ? 1.225   -10.515 4.966   1.00 0.00 ? 47  VAL A N    3  
ATOM 3519  C CA   . VAL A 1 47  ? 0.476   -9.496  4.250   1.00 0.00 ? 47  VAL A CA   3  
ATOM 3520  C C    . VAL A 1 47  ? -0.110  -10.103 2.974   1.00 0.00 ? 47  VAL A C    3  
ATOM 3521  O O    . VAL A 1 47  ? 0.585   -10.232 1.967   1.00 0.00 ? 47  VAL A O    3  
ATOM 3522  C CB   . VAL A 1 47  ? 1.370   -8.283  3.980   1.00 0.00 ? 47  VAL A CB   3  
ATOM 3523  C CG1  . VAL A 1 47  ? 0.740   -7.361  2.935   1.00 0.00 ? 47  VAL A CG1  3  
ATOM 3524  C CG2  . VAL A 1 47  ? 1.668   -7.523  5.274   1.00 0.00 ? 47  VAL A CG2  3  
ATOM 3525  H H    . VAL A 1 47  ? 2.089   -10.781 4.541   1.00 0.00 ? 47  VAL A H    3  
ATOM 3526  H HA   . VAL A 1 47  ? -0.342  -9.175  4.895   1.00 0.00 ? 47  VAL A HA   3  
ATOM 3527  H HB   . VAL A 1 47  ? 2.316   -8.647  3.579   1.00 0.00 ? 47  VAL A HB   3  
ATOM 3528  H HG11 . VAL A 1 47  ? -0.309  -7.627  2.800   1.00 0.00 ? 47  VAL A HG11 3  
ATOM 3529  H HG12 . VAL A 1 47  ? 0.812   -6.327  3.272   1.00 0.00 ? 47  VAL A HG12 3  
ATOM 3530  H HG13 . VAL A 1 47  ? 1.267   -7.471  1.987   1.00 0.00 ? 47  VAL A HG13 3  
ATOM 3531  H HG21 . VAL A 1 47  ? 2.060   -6.535  5.032   1.00 0.00 ? 47  VAL A HG21 3  
ATOM 3532  H HG22 . VAL A 1 47  ? 0.751   -7.418  5.853   1.00 0.00 ? 47  VAL A HG22 3  
ATOM 3533  H HG23 . VAL A 1 47  ? 2.406   -8.074  5.857   1.00 0.00 ? 47  VAL A HG23 3  
ATOM 3534  N N    . ARG A 1 48  ? -1.383  -10.459 3.057   1.00 0.00 ? 48  ARG A N    3  
ATOM 3535  C CA   . ARG A 1 48  ? -2.071  -11.049 1.922   1.00 0.00 ? 48  ARG A CA   3  
ATOM 3536  C C    . ARG A 1 48  ? -2.711  -9.957  1.063   1.00 0.00 ? 48  ARG A C    3  
ATOM 3537  O O    . ARG A 1 48  ? -2.813  -8.807  1.488   1.00 0.00 ? 48  ARG A O    3  
ATOM 3538  C CB   . ARG A 1 48  ? -3.154  -12.027 2.381   1.00 0.00 ? 48  ARG A CB   3  
ATOM 3539  C CG   . ARG A 1 48  ? -2.533  -13.290 2.983   1.00 0.00 ? 48  ARG A CG   3  
ATOM 3540  C CD   . ARG A 1 48  ? -1.414  -13.829 2.091   1.00 0.00 ? 48  ARG A CD   3  
ATOM 3541  N NE   . ARG A 1 48  ? -0.106  -13.314 2.552   1.00 0.00 ? 48  ARG A NE   3  
ATOM 3542  C CZ   . ARG A 1 48  ? 0.660   -13.921 3.469   1.00 0.00 ? 48  ARG A CZ   3  
ATOM 3543  N NH1  . ARG A 1 48  ? 0.253   -15.069 4.028   1.00 0.00 ? 48  ARG A NH1  3  
ATOM 3544  N NH2  . ARG A 1 48  ? 1.833   -13.380 3.827   1.00 0.00 ? 48  ARG A NH2  3  
ATOM 3545  H H    . ARG A 1 48  ? -1.942  -10.351 3.880   1.00 0.00 ? 48  ARG A H    3  
ATOM 3546  H HA   . ARG A 1 48  ? -1.294  -11.578 1.369   1.00 0.00 ? 48  ARG A HA   3  
ATOM 3547  H HB2  . ARG A 1 48  ? -3.795  -11.545 3.119   1.00 0.00 ? 48  ARG A HB2  3  
ATOM 3548  H HB3  . ARG A 1 48  ? -3.788  -12.297 1.536   1.00 0.00 ? 48  ARG A HB3  3  
ATOM 3549  H HG2  . ARG A 1 48  ? -2.138  -13.068 3.974   1.00 0.00 ? 48  ARG A HG2  3  
ATOM 3550  H HG3  . ARG A 1 48  ? -3.302  -14.052 3.110   1.00 0.00 ? 48  ARG A HG3  3  
ATOM 3551  H HD2  . ARG A 1 48  ? -1.413  -14.919 2.113   1.00 0.00 ? 48  ARG A HD2  3  
ATOM 3552  H HD3  . ARG A 1 48  ? -1.587  -13.532 1.056   1.00 0.00 ? 48  ARG A HD3  3  
ATOM 3553  H HE   . ARG A 1 48  ? 0.228   -12.458 2.155   1.00 0.00 ? 48  ARG A HE   3  
ATOM 3554  H HH11 . ARG A 1 48  ? -0.622  -15.472 3.761   1.00 0.00 ? 48  ARG A HH11 3  
ATOM 3555  H HH12 . ARG A 1 48  ? 0.824   -15.522 4.712   1.00 0.00 ? 48  ARG A HH12 3  
ATOM 3556  H HH21 . ARG A 1 48  ? 2.136   -12.524 3.410   1.00 0.00 ? 48  ARG A HH21 3  
ATOM 3557  H HH22 . ARG A 1 48  ? 2.404   -13.834 4.512   1.00 0.00 ? 48  ARG A HH22 3  
ATOM 3558  N N    . ILE A 1 49  ? -3.126  -10.355 -0.131  1.00 0.00 ? 49  ILE A N    3  
ATOM 3559  C CA   . ILE A 1 49  ? -3.754  -9.424  -1.054  1.00 0.00 ? 49  ILE A CA   3  
ATOM 3560  C C    . ILE A 1 49  ? -5.184  -9.140  -0.590  1.00 0.00 ? 49  ILE A C    3  
ATOM 3561  O O    . ILE A 1 49  ? -5.919  -10.059 -0.233  1.00 0.00 ? 49  ILE A O    3  
ATOM 3562  C CB   . ILE A 1 49  ? -3.665  -9.949  -2.488  1.00 0.00 ? 49  ILE A CB   3  
ATOM 3563  C CG1  . ILE A 1 49  ? -2.216  -9.957  -2.980  1.00 0.00 ? 49  ILE A CG1  3  
ATOM 3564  C CG2  . ILE A 1 49  ? -4.582  -9.155  -3.420  1.00 0.00 ? 49  ILE A CG2  3  
ATOM 3565  C CD1  . ILE A 1 49  ? -2.155  -9.893  -4.507  1.00 0.00 ? 49  ILE A CD1  3  
ATOM 3566  H H    . ILE A 1 49  ? -3.040  -11.292 -0.470  1.00 0.00 ? 49  ILE A H    3  
ATOM 3567  H HA   . ILE A 1 49  ? -3.187  -8.494  -1.015  1.00 0.00 ? 49  ILE A HA   3  
ATOM 3568  H HB   . ILE A 1 49  ? -4.014  -10.982 -2.496  1.00 0.00 ? 49  ILE A HB   3  
ATOM 3569  H HG12 . ILE A 1 49  ? -1.679  -9.109  -2.555  1.00 0.00 ? 49  ILE A HG12 3  
ATOM 3570  H HG13 . ILE A 1 49  ? -1.715  -10.860 -2.630  1.00 0.00 ? 49  ILE A HG13 3  
ATOM 3571  H HG21 . ILE A 1 49  ? -5.559  -9.035  -2.953  1.00 0.00 ? 49  ILE A HG21 3  
ATOM 3572  H HG22 . ILE A 1 49  ? -4.147  -8.174  -3.610  1.00 0.00 ? 49  ILE A HG22 3  
ATOM 3573  H HG23 . ILE A 1 49  ? -4.694  -9.691  -4.363  1.00 0.00 ? 49  ILE A HG23 3  
ATOM 3574  H HD11 . ILE A 1 49  ? -2.378  -8.879  -4.837  1.00 0.00 ? 49  ILE A HD11 3  
ATOM 3575  H HD12 . ILE A 1 49  ? -1.157  -10.174 -4.843  1.00 0.00 ? 49  ILE A HD12 3  
ATOM 3576  H HD13 . ILE A 1 49  ? -2.887  -10.582 -4.929  1.00 0.00 ? 49  ILE A HD13 3  
ATOM 3577  N N    . GLY A 1 50  ? -5.537  -7.863  -0.612  1.00 0.00 ? 50  GLY A N    3  
ATOM 3578  C CA   . GLY A 1 50  ? -6.866  -7.446  -0.199  1.00 0.00 ? 50  GLY A CA   3  
ATOM 3579  C C    . GLY A 1 50  ? -6.826  -6.766  1.171   1.00 0.00 ? 50  GLY A C    3  
ATOM 3580  O O    . GLY A 1 50  ? -7.789  -6.115  1.573   1.00 0.00 ? 50  GLY A O    3  
ATOM 3581  H H    . GLY A 1 50  ? -4.933  -7.121  -0.905  1.00 0.00 ? 50  GLY A H    3  
ATOM 3582  H HA2  . GLY A 1 50  ? -7.282  -6.760  -0.937  1.00 0.00 ? 50  GLY A HA2  3  
ATOM 3583  H HA3  . GLY A 1 50  ? -7.527  -8.312  -0.161  1.00 0.00 ? 50  GLY A HA3  3  
ATOM 3584  N N    . ASP A 1 51  ? -5.702  -6.942  1.851   1.00 0.00 ? 51  ASP A N    3  
ATOM 3585  C CA   . ASP A 1 51  ? -5.525  -6.354  3.168   1.00 0.00 ? 51  ASP A CA   3  
ATOM 3586  C C    . ASP A 1 51  ? -5.740  -4.842  3.079   1.00 0.00 ? 51  ASP A C    3  
ATOM 3587  O O    . ASP A 1 51  ? -5.077  -4.161  2.298   1.00 0.00 ? 51  ASP A O    3  
ATOM 3588  C CB   . ASP A 1 51  ? -4.109  -6.600  3.694   1.00 0.00 ? 51  ASP A CB   3  
ATOM 3589  C CG   . ASP A 1 51  ? -3.783  -8.061  4.013   1.00 0.00 ? 51  ASP A CG   3  
ATOM 3590  O OD1  . ASP A 1 51  ? -4.677  -8.904  3.787   1.00 0.00 ? 51  ASP A OD1  3  
ATOM 3591  O OD2  . ASP A 1 51  ? -2.646  -8.300  4.474   1.00 0.00 ? 51  ASP A OD2  3  
ATOM 3592  H H    . ASP A 1 51  ? -4.924  -7.473  1.517   1.00 0.00 ? 51  ASP A H    3  
ATOM 3593  H HA   . ASP A 1 51  ? -6.263  -6.844  3.802   1.00 0.00 ? 51  ASP A HA   3  
ATOM 3594  H HB2  . ASP A 1 51  ? -3.395  -6.236  2.956   1.00 0.00 ? 51  ASP A HB2  3  
ATOM 3595  H HB3  . ASP A 1 51  ? -3.966  -6.006  4.597   1.00 0.00 ? 51  ASP A HB3  3  
ATOM 3596  N N    . VAL A 1 52  ? -6.669  -4.360  3.892   1.00 0.00 ? 52  VAL A N    3  
ATOM 3597  C CA   . VAL A 1 52  ? -6.980  -2.941  3.915   1.00 0.00 ? 52  VAL A CA   3  
ATOM 3598  C C    . VAL A 1 52  ? -6.093  -2.246  4.951   1.00 0.00 ? 52  VAL A C    3  
ATOM 3599  O O    . VAL A 1 52  ? -5.927  -2.743  6.064   1.00 0.00 ? 52  VAL A O    3  
ATOM 3600  C CB   . VAL A 1 52  ? -8.474  -2.736  4.173   1.00 0.00 ? 52  VAL A CB   3  
ATOM 3601  C CG1  . VAL A 1 52  ? -8.796  -1.256  4.386   1.00 0.00 ? 52  VAL A CG1  3  
ATOM 3602  C CG2  . VAL A 1 52  ? -9.312  -3.322  3.036   1.00 0.00 ? 52  VAL A CG2  3  
ATOM 3603  H H    . VAL A 1 52  ? -7.203  -4.920  4.525   1.00 0.00 ? 52  VAL A H    3  
ATOM 3604  H HA   . VAL A 1 52  ? -6.749  -2.537  2.929   1.00 0.00 ? 52  VAL A HA   3  
ATOM 3605  H HB   . VAL A 1 52  ? -8.732  -3.270  5.088   1.00 0.00 ? 52  VAL A HB   3  
ATOM 3606  H HG11 . VAL A 1 52  ? -7.870  -0.700  4.530   1.00 0.00 ? 52  VAL A HG11 3  
ATOM 3607  H HG12 . VAL A 1 52  ? -9.319  -0.869  3.512   1.00 0.00 ? 52  VAL A HG12 3  
ATOM 3608  H HG13 . VAL A 1 52  ? -9.428  -1.144  5.267   1.00 0.00 ? 52  VAL A HG13 3  
ATOM 3609  H HG21 . VAL A 1 52  ? -10.159 -3.867  3.452   1.00 0.00 ? 52  VAL A HG21 3  
ATOM 3610  H HG22 . VAL A 1 52  ? -9.676  -2.515  2.400   1.00 0.00 ? 52  VAL A HG22 3  
ATOM 3611  H HG23 . VAL A 1 52  ? -8.698  -4.002  2.445   1.00 0.00 ? 52  VAL A HG23 3  
ATOM 3612  N N    . VAL A 1 53  ? -5.548  -1.108  4.548   1.00 0.00 ? 53  VAL A N    3  
ATOM 3613  C CA   . VAL A 1 53  ? -4.683  -0.340  5.428   1.00 0.00 ? 53  VAL A CA   3  
ATOM 3614  C C    . VAL A 1 53  ? -5.531  0.638   6.243   1.00 0.00 ? 53  VAL A C    3  
ATOM 3615  O O    . VAL A 1 53  ? -5.909  1.699   5.748   1.00 0.00 ? 53  VAL A O    3  
ATOM 3616  C CB   . VAL A 1 53  ? -3.589  0.353   4.612   1.00 0.00 ? 53  VAL A CB   3  
ATOM 3617  C CG1  . VAL A 1 53  ? -2.671  1.178   5.515   1.00 0.00 ? 53  VAL A CG1  3  
ATOM 3618  C CG2  . VAL A 1 53  ? -2.787  -0.663  3.796   1.00 0.00 ? 53  VAL A CG2  3  
ATOM 3619  H H    . VAL A 1 53  ? -5.688  -0.711  3.641   1.00 0.00 ? 53  VAL A H    3  
ATOM 3620  H HA   . VAL A 1 53  ? -4.202  -1.041  6.110   1.00 0.00 ? 53  VAL A HA   3  
ATOM 3621  H HB   . VAL A 1 53  ? -4.074  1.035   3.914   1.00 0.00 ? 53  VAL A HB   3  
ATOM 3622  H HG11 . VAL A 1 53  ? -1.934  1.700   4.905   1.00 0.00 ? 53  VAL A HG11 3  
ATOM 3623  H HG12 . VAL A 1 53  ? -3.264  1.905   6.069   1.00 0.00 ? 53  VAL A HG12 3  
ATOM 3624  H HG13 . VAL A 1 53  ? -2.160  0.517   6.215   1.00 0.00 ? 53  VAL A HG13 3  
ATOM 3625  H HG21 . VAL A 1 53  ? -3.472  -1.303  3.239   1.00 0.00 ? 53  VAL A HG21 3  
ATOM 3626  H HG22 . VAL A 1 53  ? -2.135  -0.136  3.100   1.00 0.00 ? 53  VAL A HG22 3  
ATOM 3627  H HG23 . VAL A 1 53  ? -2.184  -1.274  4.467   1.00 0.00 ? 53  VAL A HG23 3  
ATOM 3628  N N    . LEU A 1 54  ? -5.805  0.246   7.479   1.00 0.00 ? 54  LEU A N    3  
ATOM 3629  C CA   . LEU A 1 54  ? -6.601  1.075   8.367   1.00 0.00 ? 54  LEU A CA   3  
ATOM 3630  C C    . LEU A 1 54  ? -5.868  2.394   8.621   1.00 0.00 ? 54  LEU A C    3  
ATOM 3631  O O    . LEU A 1 54  ? -6.464  3.466   8.537   1.00 0.00 ? 54  LEU A O    3  
ATOM 3632  C CB   . LEU A 1 54  ? -6.950  0.310   9.645   1.00 0.00 ? 54  LEU A CB   3  
ATOM 3633  C CG   . LEU A 1 54  ? -7.850  -0.915  9.468   1.00 0.00 ? 54  LEU A CG   3  
ATOM 3634  C CD1  . LEU A 1 54  ? -7.702  -1.879  10.648  1.00 0.00 ? 54  LEU A CD1  3  
ATOM 3635  C CD2  . LEU A 1 54  ? -9.305  -0.499  9.247   1.00 0.00 ? 54  LEU A CD2  3  
ATOM 3636  H H    . LEU A 1 54  ? -5.494  -0.618  7.873   1.00 0.00 ? 54  LEU A H    3  
ATOM 3637  H HA   . LEU A 1 54  ? -7.539  1.295   7.857   1.00 0.00 ? 54  LEU A HA   3  
ATOM 3638  H HB2  . LEU A 1 54  ? -6.022  -0.011  10.118  1.00 0.00 ? 54  LEU A HB2  3  
ATOM 3639  H HB3  . LEU A 1 54  ? -7.438  0.998   10.335  1.00 0.00 ? 54  LEU A HB3  3  
ATOM 3640  H HG   . LEU A 1 54  ? -7.528  -1.449  8.574   1.00 0.00 ? 54  LEU A HG   3  
ATOM 3641  H HD11 . LEU A 1 54  ? -8.126  -2.847  10.381  1.00 0.00 ? 54  LEU A HD11 3  
ATOM 3642  H HD12 . LEU A 1 54  ? -6.646  -1.998  10.889  1.00 0.00 ? 54  LEU A HD12 3  
ATOM 3643  H HD13 . LEU A 1 54  ? -8.230  -1.477  11.513  1.00 0.00 ? 54  LEU A HD13 3  
ATOM 3644  H HD21 . LEU A 1 54  ? -9.335  0.493   8.795   1.00 0.00 ? 54  LEU A HD21 3  
ATOM 3645  H HD22 . LEU A 1 54  ? -9.791  -1.215  8.584   1.00 0.00 ? 54  LEU A HD22 3  
ATOM 3646  H HD23 . LEU A 1 54  ? -9.827  -0.478  10.204  1.00 0.00 ? 54  LEU A HD23 3  
ATOM 3647  N N    . SER A 1 55  ? -4.584  2.271   8.927   1.00 0.00 ? 55  SER A N    3  
ATOM 3648  C CA   . SER A 1 55  ? -3.763  3.439   9.194   1.00 0.00 ? 55  SER A CA   3  
ATOM 3649  C C    . SER A 1 55  ? -2.402  3.289   8.513   1.00 0.00 ? 55  SER A C    3  
ATOM 3650  O O    . SER A 1 55  ? -2.097  2.238   7.951   1.00 0.00 ? 55  SER A O    3  
ATOM 3651  C CB   . SER A 1 55  ? -3.583  3.654   10.698  1.00 0.00 ? 55  SER A CB   3  
ATOM 3652  O OG   . SER A 1 55  ? -3.366  2.427   11.390  1.00 0.00 ? 55  SER A OG   3  
ATOM 3653  H H    . SER A 1 55  ? -4.107  1.395   8.994   1.00 0.00 ? 55  SER A H    3  
ATOM 3654  H HA   . SER A 1 55  ? -4.312  4.281   8.771   1.00 0.00 ? 55  SER A HA   3  
ATOM 3655  H HB2  . SER A 1 55  ? -2.738  4.321   10.871  1.00 0.00 ? 55  SER A HB2  3  
ATOM 3656  H HB3  . SER A 1 55  ? -4.466  4.147   11.103  1.00 0.00 ? 55  SER A HB3  3  
ATOM 3657  H HG   . SER A 1 55  ? -4.238  2.054   11.707  1.00 0.00 ? 55  SER A HG   3  
ATOM 3658  N N    . ILE A 1 56  ? -1.619  4.356   8.584   1.00 0.00 ? 56  ILE A N    3  
ATOM 3659  C CA   . ILE A 1 56  ? -0.297  4.355   7.981   1.00 0.00 ? 56  ILE A CA   3  
ATOM 3660  C C    . ILE A 1 56  ? 0.656   5.177   8.851   1.00 0.00 ? 56  ILE A C    3  
ATOM 3661  O O    . ILE A 1 56  ? 0.852   6.368   8.610   1.00 0.00 ? 56  ILE A O    3  
ATOM 3662  C CB   . ILE A 1 56  ? -0.371  4.833   6.529   1.00 0.00 ? 56  ILE A CB   3  
ATOM 3663  C CG1  . ILE A 1 56  ? -1.100  3.812   5.653   1.00 0.00 ? 56  ILE A CG1  3  
ATOM 3664  C CG2  . ILE A 1 56  ? 1.023   5.161   5.989   1.00 0.00 ? 56  ILE A CG2  3  
ATOM 3665  C CD1  . ILE A 1 56  ? -1.436  4.406   4.283   1.00 0.00 ? 56  ILE A CD1  3  
ATOM 3666  H H    . ILE A 1 56  ? -1.874  5.207   9.043   1.00 0.00 ? 56  ILE A H    3  
ATOM 3667  H HA   . ILE A 1 56  ? 0.054   3.324   7.963   1.00 0.00 ? 56  ILE A HA   3  
ATOM 3668  H HB   . ILE A 1 56  ? -0.952  5.754   6.502   1.00 0.00 ? 56  ILE A HB   3  
ATOM 3669  H HG12 . ILE A 1 56  ? -0.477  2.926   5.526   1.00 0.00 ? 56  ILE A HG12 3  
ATOM 3670  H HG13 . ILE A 1 56  ? -2.015  3.490   6.148   1.00 0.00 ? 56  ILE A HG13 3  
ATOM 3671  H HG21 . ILE A 1 56  ? 1.218   4.561   5.100   1.00 0.00 ? 56  ILE A HG21 3  
ATOM 3672  H HG22 . ILE A 1 56  ? 1.072   6.219   5.731   1.00 0.00 ? 56  ILE A HG22 3  
ATOM 3673  H HG23 . ILE A 1 56  ? 1.770   4.937   6.750   1.00 0.00 ? 56  ILE A HG23 3  
ATOM 3674  H HD11 . ILE A 1 56  ? -2.271  3.860   3.845   1.00 0.00 ? 56  ILE A HD11 3  
ATOM 3675  H HD12 . ILE A 1 56  ? -1.710  5.455   4.400   1.00 0.00 ? 56  ILE A HD12 3  
ATOM 3676  H HD13 . ILE A 1 56  ? -0.567  4.328   3.630   1.00 0.00 ? 56  ILE A HD13 3  
ATOM 3677  N N    . ASP A 1 57  ? 1.224   4.510   9.845   1.00 0.00 ? 57  ASP A N    3  
ATOM 3678  C CA   . ASP A 1 57  ? 2.151   5.164   10.752  1.00 0.00 ? 57  ASP A CA   3  
ATOM 3679  C C    . ASP A 1 57  ? 1.372   6.074   11.703  1.00 0.00 ? 57  ASP A C    3  
ATOM 3680  O O    . ASP A 1 57  ? 1.644   7.271   11.784  1.00 0.00 ? 57  ASP A O    3  
ATOM 3681  C CB   . ASP A 1 57  ? 3.154   6.028   9.985   1.00 0.00 ? 57  ASP A CB   3  
ATOM 3682  C CG   . ASP A 1 57  ? 4.504   6.221   10.678  1.00 0.00 ? 57  ASP A CG   3  
ATOM 3683  O OD1  . ASP A 1 57  ? 4.563   5.938   11.895  1.00 0.00 ? 57  ASP A OD1  3  
ATOM 3684  O OD2  . ASP A 1 57  ? 5.447   6.646   9.976   1.00 0.00 ? 57  ASP A OD2  3  
ATOM 3685  H H    . ASP A 1 57  ? 1.059   3.542   10.034  1.00 0.00 ? 57  ASP A H    3  
ATOM 3686  H HA   . ASP A 1 57  ? 2.660   4.354   11.274  1.00 0.00 ? 57  ASP A HA   3  
ATOM 3687  H HB2  . ASP A 1 57  ? 3.326   5.578   9.007   1.00 0.00 ? 57  ASP A HB2  3  
ATOM 3688  H HB3  . ASP A 1 57  ? 2.709   7.008   9.812   1.00 0.00 ? 57  ASP A HB3  3  
ATOM 3689  N N    . GLY A 1 58  ? 0.417   5.473   12.398  1.00 0.00 ? 58  GLY A N    3  
ATOM 3690  C CA   . GLY A 1 58  ? -0.403  6.215   13.339  1.00 0.00 ? 58  GLY A CA   3  
ATOM 3691  C C    . GLY A 1 58  ? -1.238  7.277   12.621  1.00 0.00 ? 58  GLY A C    3  
ATOM 3692  O O    . GLY A 1 58  ? -1.833  8.142   13.262  1.00 0.00 ? 58  GLY A O    3  
ATOM 3693  H H    . GLY A 1 58  ? 0.202   4.499   12.325  1.00 0.00 ? 58  GLY A H    3  
ATOM 3694  H HA2  . GLY A 1 58  ? -1.062  5.529   13.872  1.00 0.00 ? 58  GLY A HA2  3  
ATOM 3695  H HA3  . GLY A 1 58  ? 0.233   6.690   14.086  1.00 0.00 ? 58  GLY A HA3  3  
ATOM 3696  N N    . ILE A 1 59  ? -1.254  7.178   11.300  1.00 0.00 ? 59  ILE A N    3  
ATOM 3697  C CA   . ILE A 1 59  ? -2.005  8.120   10.488  1.00 0.00 ? 59  ILE A CA   3  
ATOM 3698  C C    . ILE A 1 59  ? -3.241  7.421   9.917   1.00 0.00 ? 59  ILE A C    3  
ATOM 3699  O O    . ILE A 1 59  ? -3.158  6.285   9.454   1.00 0.00 ? 59  ILE A O    3  
ATOM 3700  C CB   . ILE A 1 59  ? -1.104  8.745   9.421   1.00 0.00 ? 59  ILE A CB   3  
ATOM 3701  C CG1  . ILE A 1 59  ? 0.049   9.520   10.062  1.00 0.00 ? 59  ILE A CG1  3  
ATOM 3702  C CG2  . ILE A 1 59  ? -1.916  9.616   8.459   1.00 0.00 ? 59  ILE A CG2  3  
ATOM 3703  C CD1  . ILE A 1 59  ? -0.348  10.973  10.327  1.00 0.00 ? 59  ILE A CD1  3  
ATOM 3704  H H    . ILE A 1 59  ? -0.766  6.472   10.786  1.00 0.00 ? 59  ILE A H    3  
ATOM 3705  H HA   . ILE A 1 59  ? -2.336  8.925   11.143  1.00 0.00 ? 59  ILE A HA   3  
ATOM 3706  H HB   . ILE A 1 59  ? -0.664  7.940   8.832   1.00 0.00 ? 59  ILE A HB   3  
ATOM 3707  H HG12 . ILE A 1 59  ? 0.337   9.041   10.998  1.00 0.00 ? 59  ILE A HG12 3  
ATOM 3708  H HG13 . ILE A 1 59  ? 0.920   9.491   9.407   1.00 0.00 ? 59  ILE A HG13 3  
ATOM 3709  H HG21 . ILE A 1 59  ? -2.273  9.006   7.630   1.00 0.00 ? 59  ILE A HG21 3  
ATOM 3710  H HG22 . ILE A 1 59  ? -2.767  10.044  8.988   1.00 0.00 ? 59  ILE A HG22 3  
ATOM 3711  H HG23 . ILE A 1 59  ? -1.285  10.418  8.075   1.00 0.00 ? 59  ILE A HG23 3  
ATOM 3712  H HD11 . ILE A 1 59  ? -1.401  11.017  10.608  1.00 0.00 ? 59  ILE A HD11 3  
ATOM 3713  H HD12 . ILE A 1 59  ? 0.261   11.374  11.138  1.00 0.00 ? 59  ILE A HD12 3  
ATOM 3714  H HD13 . ILE A 1 59  ? -0.188  11.564  9.426   1.00 0.00 ? 59  ILE A HD13 3  
ATOM 3715  N N    . SER A 1 60  ? -4.359  8.131   9.968   1.00 0.00 ? 60  SER A N    3  
ATOM 3716  C CA   . SER A 1 60  ? -5.610  7.593   9.462   1.00 0.00 ? 60  SER A CA   3  
ATOM 3717  C C    . SER A 1 60  ? -5.573  7.530   7.934   1.00 0.00 ? 60  SER A C    3  
ATOM 3718  O O    . SER A 1 60  ? -5.278  8.525   7.275   1.00 0.00 ? 60  SER A O    3  
ATOM 3719  C CB   . SER A 1 60  ? -6.800  8.434   9.929   1.00 0.00 ? 60  SER A CB   3  
ATOM 3720  O OG   . SER A 1 60  ? -7.644  7.715   10.823  1.00 0.00 ? 60  SER A OG   3  
ATOM 3721  H H    . SER A 1 60  ? -4.418  9.055   10.346  1.00 0.00 ? 60  SER A H    3  
ATOM 3722  H HA   . SER A 1 60  ? -5.686  6.591   9.885   1.00 0.00 ? 60  SER A HA   3  
ATOM 3723  H HB2  . SER A 1 60  ? -6.436  9.336   10.421  1.00 0.00 ? 60  SER A HB2  3  
ATOM 3724  H HB3  . SER A 1 60  ? -7.379  8.756   9.063   1.00 0.00 ? 60  SER A HB3  3  
ATOM 3725  H HG   . SER A 1 60  ? -7.837  6.805   10.455  1.00 0.00 ? 60  SER A HG   3  
ATOM 3726  N N    . ALA A 1 61  ? -5.875  6.349   7.415   1.00 0.00 ? 61  ALA A N    3  
ATOM 3727  C CA   . ALA A 1 61  ? -5.880  6.142   5.977   1.00 0.00 ? 61  ALA A CA   3  
ATOM 3728  C C    . ALA A 1 61  ? -7.324  6.122   5.473   1.00 0.00 ? 61  ALA A C    3  
ATOM 3729  O O    . ALA A 1 61  ? -7.618  5.517   4.443   1.00 0.00 ? 61  ALA A O    3  
ATOM 3730  C CB   . ALA A 1 61  ? -5.128  4.852   5.644   1.00 0.00 ? 61  ALA A CB   3  
ATOM 3731  H H    . ALA A 1 61  ? -6.114  5.544   7.958   1.00 0.00 ? 61  ALA A H    3  
ATOM 3732  H HA   . ALA A 1 61  ? -5.356  6.981   5.519   1.00 0.00 ? 61  ALA A HA   3  
ATOM 3733  H HB1  . ALA A 1 61  ? -4.402  4.641   6.429   1.00 0.00 ? 61  ALA A HB1  3  
ATOM 3734  H HB2  . ALA A 1 61  ? -5.837  4.027   5.573   1.00 0.00 ? 61  ALA A HB2  3  
ATOM 3735  H HB3  . ALA A 1 61  ? -4.610  4.968   4.692   1.00 0.00 ? 61  ALA A HB3  3  
ATOM 3736  N N    . GLN A 1 62  ? -8.188  6.792   6.222   1.00 0.00 ? 62  GLN A N    3  
ATOM 3737  C CA   . GLN A 1 62  ? -9.594  6.859   5.864   1.00 0.00 ? 62  GLN A CA   3  
ATOM 3738  C C    . GLN A 1 62  ? -9.827  7.962   4.830   1.00 0.00 ? 62  GLN A C    3  
ATOM 3739  O O    . GLN A 1 62  ? -10.484 7.737   3.815   1.00 0.00 ? 62  GLN A O    3  
ATOM 3740  C CB   . GLN A 1 62  ? -10.465 7.076   7.103   1.00 0.00 ? 62  GLN A CB   3  
ATOM 3741  C CG   . GLN A 1 62  ? -10.938 5.741   7.682   1.00 0.00 ? 62  GLN A CG   3  
ATOM 3742  C CD   . GLN A 1 62  ? -10.584 5.631   9.167   1.00 0.00 ? 62  GLN A CD   3  
ATOM 3743  O OE1  . GLN A 1 62  ? -9.776  6.377   9.695   1.00 0.00 ? 62  GLN A OE1  3  
ATOM 3744  N NE2  . GLN A 1 62  ? -11.231 4.661   9.807   1.00 0.00 ? 62  GLN A NE2  3  
ATOM 3745  H H    . GLN A 1 62  ? -7.940  7.282   7.058   1.00 0.00 ? 62  GLN A H    3  
ATOM 3746  H HA   . GLN A 1 62  ? -9.829  5.888   5.429   1.00 0.00 ? 62  GLN A HA   3  
ATOM 3747  H HB2  . GLN A 1 62  ? -9.901  7.624   7.858   1.00 0.00 ? 62  GLN A HB2  3  
ATOM 3748  H HB3  . GLN A 1 62  ? -11.328 7.690   6.843   1.00 0.00 ? 62  GLN A HB3  3  
ATOM 3749  H HG2  . GLN A 1 62  ? -12.016 5.647   7.554   1.00 0.00 ? 62  GLN A HG2  3  
ATOM 3750  H HG3  . GLN A 1 62  ? -10.479 4.920   7.133   1.00 0.00 ? 62  GLN A HG3  3  
ATOM 3751  H HE21 . GLN A 1 62  ? -11.882 4.084   9.313   1.00 0.00 ? 62  GLN A HE21 3  
ATOM 3752  H HE22 . GLN A 1 62  ? -11.067 4.510   10.781  1.00 0.00 ? 62  GLN A HE22 3  
ATOM 3753  N N    . GLY A 1 63  ? -9.276  9.130   5.124   1.00 0.00 ? 63  GLY A N    3  
ATOM 3754  C CA   . GLY A 1 63  ? -9.415  10.269  4.232   1.00 0.00 ? 63  GLY A CA   3  
ATOM 3755  C C    . GLY A 1 63  ? -8.084  10.600  3.553   1.00 0.00 ? 63  GLY A C    3  
ATOM 3756  O O    . GLY A 1 63  ? -7.664  11.756  3.533   1.00 0.00 ? 63  GLY A O    3  
ATOM 3757  H H    . GLY A 1 63  ? -8.743  9.305   5.952   1.00 0.00 ? 63  GLY A H    3  
ATOM 3758  H HA2  . GLY A 1 63  ? -10.169 10.053  3.475   1.00 0.00 ? 63  GLY A HA2  3  
ATOM 3759  H HA3  . GLY A 1 63  ? -9.766  11.135  4.793   1.00 0.00 ? 63  GLY A HA3  3  
ATOM 3760  N N    . MET A 1 64  ? -7.457  9.565   3.014   1.00 0.00 ? 64  MET A N    3  
ATOM 3761  C CA   . MET A 1 64  ? -6.183  9.731   2.337   1.00 0.00 ? 64  MET A CA   3  
ATOM 3762  C C    . MET A 1 64  ? -6.196  9.047   0.969   1.00 0.00 ? 64  MET A C    3  
ATOM 3763  O O    . MET A 1 64  ? -6.658  7.914   0.842   1.00 0.00 ? 64  MET A O    3  
ATOM 3764  C CB   . MET A 1 64  ? -5.066  9.135   3.196   1.00 0.00 ? 64  MET A CB   3  
ATOM 3765  C CG   . MET A 1 64  ? -4.754  10.036  4.393   1.00 0.00 ? 64  MET A CG   3  
ATOM 3766  S SD   . MET A 1 64  ? -2.994  10.074  4.686   1.00 0.00 ? 64  MET A SD   3  
ATOM 3767  C CE   . MET A 1 64  ? -2.745  8.414   5.293   1.00 0.00 ? 64  MET A CE   3  
ATOM 3768  H H    . MET A 1 64  ? -7.806  8.628   3.035   1.00 0.00 ? 64  MET A H    3  
ATOM 3769  H HA   . MET A 1 64  ? -6.056  10.807  2.212   1.00 0.00 ? 64  MET A HA   3  
ATOM 3770  H HB2  . MET A 1 64  ? -5.362  8.146   3.548   1.00 0.00 ? 64  MET A HB2  3  
ATOM 3771  H HB3  . MET A 1 64  ? -4.169  9.003   2.592   1.00 0.00 ? 64  MET A HB3  3  
ATOM 3772  H HG2  . MET A 1 64  ? -5.122  11.044  4.205   1.00 0.00 ? 64  MET A HG2  3  
ATOM 3773  H HG3  . MET A 1 64  ? -5.271  9.669   5.279   1.00 0.00 ? 64  MET A HG3  3  
ATOM 3774  H HE1  . MET A 1 64  ? -3.438  8.218   6.111   1.00 0.00 ? 64  MET A HE1  3  
ATOM 3775  H HE2  . MET A 1 64  ? -2.923  7.702   4.487   1.00 0.00 ? 64  MET A HE2  3  
ATOM 3776  H HE3  . MET A 1 64  ? -1.721  8.308   5.652   1.00 0.00 ? 64  MET A HE3  3  
ATOM 3777  N N    . THR A 1 65  ? -5.683  9.763   -0.021  1.00 0.00 ? 65  THR A N    3  
ATOM 3778  C CA   . THR A 1 65  ? -5.629  9.239   -1.375  1.00 0.00 ? 65  THR A CA   3  
ATOM 3779  C C    . THR A 1 65  ? -4.384  8.370   -1.561  1.00 0.00 ? 65  THR A C    3  
ATOM 3780  O O    . THR A 1 65  ? -3.464  8.413   -0.746  1.00 0.00 ? 65  THR A O    3  
ATOM 3781  C CB   . THR A 1 65  ? -5.695  10.422  -2.343  1.00 0.00 ? 65  THR A CB   3  
ATOM 3782  O OG1  . THR A 1 65  ? -4.530  11.184  -2.039  1.00 0.00 ? 65  THR A OG1  3  
ATOM 3783  C CG2  . THR A 1 65  ? -6.853  11.371  -2.030  1.00 0.00 ? 65  THR A CG2  3  
ATOM 3784  H H    . THR A 1 65  ? -5.309  10.684  0.091   1.00 0.00 ? 65  THR A H    3  
ATOM 3785  H HA   . THR A 1 65  ? -6.495  8.595   -1.528  1.00 0.00 ? 65  THR A HA   3  
ATOM 3786  H HB   . THR A 1 65  ? -5.742  10.078  -3.376  1.00 0.00 ? 65  THR A HB   3  
ATOM 3787  H HG1  . THR A 1 65  ? -4.535  12.039  -2.558  1.00 0.00 ? 65  THR A HG1  3  
ATOM 3788  H HG21 . THR A 1 65  ? -7.682  10.805  -1.606  1.00 0.00 ? 65  THR A HG21 3  
ATOM 3789  H HG22 . THR A 1 65  ? -6.523  12.124  -1.313  1.00 0.00 ? 65  THR A HG22 3  
ATOM 3790  H HG23 . THR A 1 65  ? -7.179  11.861  -2.947  1.00 0.00 ? 65  THR A HG23 3  
ATOM 3791  N N    . HIS A 1 66  ? -4.395  7.600   -2.640  1.00 0.00 ? 66  HIS A N    3  
ATOM 3792  C CA   . HIS A 1 66  ? -3.278  6.722   -2.944  1.00 0.00 ? 66  HIS A CA   3  
ATOM 3793  C C    . HIS A 1 66  ? -1.963  7.483   -2.767  1.00 0.00 ? 66  HIS A C    3  
ATOM 3794  O O    . HIS A 1 66  ? -1.064  7.022   -2.065  1.00 0.00 ? 66  HIS A O    3  
ATOM 3795  C CB   . HIS A 1 66  ? -3.429  6.115   -4.340  1.00 0.00 ? 66  HIS A CB   3  
ATOM 3796  C CG   . HIS A 1 66  ? -2.802  4.750   -4.488  1.00 0.00 ? 66  HIS A CG   3  
ATOM 3797  N ND1  . HIS A 1 66  ? -2.244  4.304   -5.674  1.00 0.00 ? 66  HIS A ND1  3  
ATOM 3798  C CD2  . HIS A 1 66  ? -2.649  3.737   -3.587  1.00 0.00 ? 66  HIS A CD2  3  
ATOM 3799  C CE1  . HIS A 1 66  ? -1.781  3.078   -5.484  1.00 0.00 ? 66  HIS A CE1  3  
ATOM 3800  N NE2  . HIS A 1 66  ? -2.033  2.728   -4.190  1.00 0.00 ? 66  HIS A NE2  3  
ATOM 3801  H H    . HIS A 1 66  ? -5.147  7.570   -3.298  1.00 0.00 ? 66  HIS A H    3  
ATOM 3802  H HA   . HIS A 1 66  ? -3.316  5.906   -2.222  1.00 0.00 ? 66  HIS A HA   3  
ATOM 3803  H HB2  . HIS A 1 66  ? -4.489  6.045   -4.583  1.00 0.00 ? 66  HIS A HB2  3  
ATOM 3804  H HB3  . HIS A 1 66  ? -2.980  6.790   -5.069  1.00 0.00 ? 66  HIS A HB3  3  
ATOM 3805  H HD1  . HIS A 1 66  ? -2.199  4.821   -6.529  1.00 0.00 ? 66  HIS A HD1  3  
ATOM 3806  H HD2  . HIS A 1 66  ? -2.977  3.754   -2.547  1.00 0.00 ? 66  HIS A HD2  3  
ATOM 3807  H HE1  . HIS A 1 66  ? -1.285  2.457   -6.230  1.00 0.00 ? 66  HIS A HE1  3  
ATOM 3808  N N    . LEU A 1 67  ? -1.893  8.637   -3.415  1.00 0.00 ? 67  LEU A N    3  
ATOM 3809  C CA   . LEU A 1 67  ? -0.703  9.467   -3.338  1.00 0.00 ? 67  LEU A CA   3  
ATOM 3810  C C    . LEU A 1 67  ? -0.398  9.779   -1.871  1.00 0.00 ? 67  LEU A C    3  
ATOM 3811  O O    . LEU A 1 67  ? 0.717   9.553   -1.403  1.00 0.00 ? 67  LEU A O    3  
ATOM 3812  C CB   . LEU A 1 67  ? -0.861  10.713  -4.211  1.00 0.00 ? 67  LEU A CB   3  
ATOM 3813  C CG   . LEU A 1 67  ? 0.148   11.836  -3.966  1.00 0.00 ? 67  LEU A CG   3  
ATOM 3814  C CD1  . LEU A 1 67  ? 1.579   11.350  -4.204  1.00 0.00 ? 67  LEU A CD1  3  
ATOM 3815  C CD2  . LEU A 1 67  ? -0.186  13.067  -4.811  1.00 0.00 ? 67  LEU A CD2  3  
ATOM 3816  H H    . LEU A 1 67  ? -2.629  9.005   -3.983  1.00 0.00 ? 67  LEU A H    3  
ATOM 3817  H HA   . LEU A 1 67  ? 0.126   8.889   -3.747  1.00 0.00 ? 67  LEU A HA   3  
ATOM 3818  H HB2  . LEU A 1 67  ? -0.792  10.411  -5.256  1.00 0.00 ? 67  LEU A HB2  3  
ATOM 3819  H HB3  . LEU A 1 67  ? -1.864  11.113  -4.061  1.00 0.00 ? 67  LEU A HB3  3  
ATOM 3820  H HG   . LEU A 1 67  ? 0.079   12.136  -2.921  1.00 0.00 ? 67  LEU A HG   3  
ATOM 3821  H HD11 . LEU A 1 67  ? 1.611   10.263  -4.122  1.00 0.00 ? 67  LEU A HD11 3  
ATOM 3822  H HD12 . LEU A 1 67  ? 1.904   11.648  -5.201  1.00 0.00 ? 67  LEU A HD12 3  
ATOM 3823  H HD13 . LEU A 1 67  ? 2.241   11.790  -3.459  1.00 0.00 ? 67  LEU A HD13 3  
ATOM 3824  H HD21 . LEU A 1 67  ? -0.967  13.646  -4.318  1.00 0.00 ? 67  LEU A HD21 3  
ATOM 3825  H HD22 . LEU A 1 67  ? 0.706   13.684  -4.924  1.00 0.00 ? 67  LEU A HD22 3  
ATOM 3826  H HD23 . LEU A 1 67  ? -0.535  12.750  -5.794  1.00 0.00 ? 67  LEU A HD23 3  
ATOM 3827  N N    . GLU A 1 68  ? -1.409  10.294  -1.186  1.00 0.00 ? 68  GLU A N    3  
ATOM 3828  C CA   . GLU A 1 68  ? -1.263  10.639  0.218   1.00 0.00 ? 68  GLU A CA   3  
ATOM 3829  C C    . GLU A 1 68  ? -0.671  9.462   0.995   1.00 0.00 ? 68  GLU A C    3  
ATOM 3830  O O    . GLU A 1 68  ? 0.367   9.600   1.642   1.00 0.00 ? 68  GLU A O    3  
ATOM 3831  C CB   . GLU A 1 68  ? -2.602  11.074  0.817   1.00 0.00 ? 68  GLU A CB   3  
ATOM 3832  C CG   . GLU A 1 68  ? -2.992  12.471  0.332   1.00 0.00 ? 68  GLU A CG   3  
ATOM 3833  C CD   . GLU A 1 68  ? -3.277  13.402  1.512   1.00 0.00 ? 68  GLU A CD   3  
ATOM 3834  O OE1  . GLU A 1 68  ? -4.454  13.441  1.932   1.00 0.00 ? 68  GLU A OE1  3  
ATOM 3835  O OE2  . GLU A 1 68  ? -2.312  14.053  1.967   1.00 0.00 ? 68  GLU A OE2  3  
ATOM 3836  H H    . GLU A 1 68  ? -2.313  10.474  -1.574  1.00 0.00 ? 68  GLU A H    3  
ATOM 3837  H HA   . GLU A 1 68  ? -0.572  11.482  0.238   1.00 0.00 ? 68  GLU A HA   3  
ATOM 3838  H HB2  . GLU A 1 68  ? -3.377  10.359  0.541   1.00 0.00 ? 68  GLU A HB2  3  
ATOM 3839  H HB3  . GLU A 1 68  ? -2.536  11.068  1.905   1.00 0.00 ? 68  GLU A HB3  3  
ATOM 3840  H HG2  . GLU A 1 68  ? -2.189  12.886  -0.277  1.00 0.00 ? 68  GLU A HG2  3  
ATOM 3841  H HG3  . GLU A 1 68  ? -3.874  12.405  -0.306  1.00 0.00 ? 68  GLU A HG3  3  
ATOM 3842  N N    . ALA A 1 69  ? -1.355  8.331   0.906   1.00 0.00 ? 69  ALA A N    3  
ATOM 3843  C CA   . ALA A 1 69  ? -0.909  7.131   1.593   1.00 0.00 ? 69  ALA A CA   3  
ATOM 3844  C C    . ALA A 1 69  ? 0.513   6.790   1.145   1.00 0.00 ? 69  ALA A C    3  
ATOM 3845  O O    . ALA A 1 69  ? 1.388   6.549   1.975   1.00 0.00 ? 69  ALA A O    3  
ATOM 3846  C CB   . ALA A 1 69  ? -1.894  5.992   1.322   1.00 0.00 ? 69  ALA A CB   3  
ATOM 3847  H H    . ALA A 1 69  ? -2.198  8.227   0.378   1.00 0.00 ? 69  ALA A H    3  
ATOM 3848  H HA   . ALA A 1 69  ? -0.904  7.343   2.662   1.00 0.00 ? 69  ALA A HA   3  
ATOM 3849  H HB1  . ALA A 1 69  ? -2.493  5.809   2.214   1.00 0.00 ? 69  ALA A HB1  3  
ATOM 3850  H HB2  . ALA A 1 69  ? -2.549  6.266   0.495   1.00 0.00 ? 69  ALA A HB2  3  
ATOM 3851  H HB3  . ALA A 1 69  ? -1.342  5.088   1.064   1.00 0.00 ? 69  ALA A HB3  3  
ATOM 3852  N N    . GLN A 1 70  ? 0.701   6.782   -0.166  1.00 0.00 ? 70  GLN A N    3  
ATOM 3853  C CA   . GLN A 1 70  ? 2.002   6.475   -0.735  1.00 0.00 ? 70  GLN A CA   3  
ATOM 3854  C C    . GLN A 1 70  ? 3.064   7.423   -0.172  1.00 0.00 ? 70  GLN A C    3  
ATOM 3855  O O    . GLN A 1 70  ? 4.159   6.992   0.184   1.00 0.00 ? 70  GLN A O    3  
ATOM 3856  C CB   . GLN A 1 70  ? 1.963   6.542   -2.263  1.00 0.00 ? 70  GLN A CB   3  
ATOM 3857  C CG   . GLN A 1 70  ? 1.234   5.329   -2.846  1.00 0.00 ? 70  GLN A CG   3  
ATOM 3858  C CD   . GLN A 1 70  ? 2.196   4.156   -3.046  1.00 0.00 ? 70  GLN A CD   3  
ATOM 3859  O OE1  . GLN A 1 70  ? 2.859   3.699   -2.129  1.00 0.00 ? 70  GLN A OE1  3  
ATOM 3860  N NE2  . GLN A 1 70  ? 2.235   3.695   -4.293  1.00 0.00 ? 70  GLN A NE2  3  
ATOM 3861  H H    . GLN A 1 70  ? -0.016  6.980   -0.835  1.00 0.00 ? 70  GLN A H    3  
ATOM 3862  H HA   . GLN A 1 70  ? 2.219   5.452   -0.427  1.00 0.00 ? 70  GLN A HA   3  
ATOM 3863  H HB2  . GLN A 1 70  ? 1.462   7.457   -2.578  1.00 0.00 ? 70  GLN A HB2  3  
ATOM 3864  H HB3  . GLN A 1 70  ? 2.979   6.583   -2.655  1.00 0.00 ? 70  GLN A HB3  3  
ATOM 3865  H HG2  . GLN A 1 70  ? 0.425   5.031   -2.179  1.00 0.00 ? 70  GLN A HG2  3  
ATOM 3866  H HG3  . GLN A 1 70  ? 0.779   5.597   -3.799  1.00 0.00 ? 70  GLN A HG3  3  
ATOM 3867  H HE21 . GLN A 1 70  ? 1.665   4.115   -4.999  1.00 0.00 ? 70  GLN A HE21 3  
ATOM 3868  H HE22 . GLN A 1 70  ? 2.834   2.928   -4.524  1.00 0.00 ? 70  GLN A HE22 3  
ATOM 3869  N N    . ASN A 1 71  ? 2.701   8.696   -0.109  1.00 0.00 ? 71  ASN A N    3  
ATOM 3870  C CA   . ASN A 1 71  ? 3.609   9.707   0.404   1.00 0.00 ? 71  ASN A CA   3  
ATOM 3871  C C    . ASN A 1 71  ? 4.152   9.258   1.762   1.00 0.00 ? 71  ASN A C    3  
ATOM 3872  O O    . ASN A 1 71  ? 5.364   9.227   1.971   1.00 0.00 ? 71  ASN A O    3  
ATOM 3873  C CB   . ASN A 1 71  ? 2.890   11.043  0.601   1.00 0.00 ? 71  ASN A CB   3  
ATOM 3874  C CG   . ASN A 1 71  ? 3.462   12.116  -0.327  1.00 0.00 ? 71  ASN A CG   3  
ATOM 3875  O OD1  . ASN A 1 71  ? 4.591   12.557  -0.188  1.00 0.00 ? 71  ASN A OD1  3  
ATOM 3876  N ND2  . ASN A 1 71  ? 2.622   12.511  -1.280  1.00 0.00 ? 71  ASN A ND2  3  
ATOM 3877  H H    . ASN A 1 71  ? 1.808   9.038   -0.401  1.00 0.00 ? 71  ASN A H    3  
ATOM 3878  H HA   . ASN A 1 71  ? 4.392   9.798   -0.349  1.00 0.00 ? 71  ASN A HA   3  
ATOM 3879  H HB2  . ASN A 1 71  ? 1.825   10.919  0.407   1.00 0.00 ? 71  ASN A HB2  3  
ATOM 3880  H HB3  . ASN A 1 71  ? 2.989   11.364  1.638   1.00 0.00 ? 71  ASN A HB3  3  
ATOM 3881  H HD21 . ASN A 1 71  ? 1.708   12.109  -1.339  1.00 0.00 ? 71  ASN A HD21 3  
ATOM 3882  H HD22 . ASN A 1 71  ? 2.904   13.210  -1.937  1.00 0.00 ? 71  ASN A HD22 3  
ATOM 3883  N N    . LYS A 1 72  ? 3.229   8.920   2.650   1.00 0.00 ? 72  LYS A N    3  
ATOM 3884  C CA   . LYS A 1 72  ? 3.599   8.473   3.982   1.00 0.00 ? 72  LYS A CA   3  
ATOM 3885  C C    . LYS A 1 72  ? 4.657   7.373   3.871   1.00 0.00 ? 72  LYS A C    3  
ATOM 3886  O O    . LYS A 1 72  ? 5.779   7.536   4.348   1.00 0.00 ? 72  LYS A O    3  
ATOM 3887  C CB   . LYS A 1 72  ? 2.358   8.054   4.772   1.00 0.00 ? 72  LYS A CB   3  
ATOM 3888  C CG   . LYS A 1 72  ? 1.584   9.278   5.268   1.00 0.00 ? 72  LYS A CG   3  
ATOM 3889  C CD   . LYS A 1 72  ? 2.311   9.950   6.434   1.00 0.00 ? 72  LYS A CD   3  
ATOM 3890  C CE   . LYS A 1 72  ? 2.685   8.928   7.509   1.00 0.00 ? 72  LYS A CE   3  
ATOM 3891  N NZ   . LYS A 1 72  ? 4.016   8.344   7.229   1.00 0.00 ? 72  LYS A NZ   3  
ATOM 3892  H H    . LYS A 1 72  ? 2.245   8.947   2.472   1.00 0.00 ? 72  LYS A H    3  
ATOM 3893  H HA   . LYS A 1 72  ? 4.039   9.324   4.502   1.00 0.00 ? 72  LYS A HA   3  
ATOM 3894  H HB2  . LYS A 1 72  ? 1.712   7.441   4.143   1.00 0.00 ? 72  LYS A HB2  3  
ATOM 3895  H HB3  . LYS A 1 72  ? 2.653   7.437   5.621   1.00 0.00 ? 72  LYS A HB3  3  
ATOM 3896  H HG2  . LYS A 1 72  ? 1.462   9.990   4.452   1.00 0.00 ? 72  LYS A HG2  3  
ATOM 3897  H HG3  . LYS A 1 72  ? 0.585   8.978   5.582   1.00 0.00 ? 72  LYS A HG3  3  
ATOM 3898  H HD2  . LYS A 1 72  ? 3.211   10.446  6.069   1.00 0.00 ? 72  LYS A HD2  3  
ATOM 3899  H HD3  . LYS A 1 72  ? 1.675   10.722  6.867   1.00 0.00 ? 72  LYS A HD3  3  
ATOM 3900  H HE2  . LYS A 1 72  ? 2.691   9.407   8.488   1.00 0.00 ? 72  LYS A HE2  3  
ATOM 3901  H HE3  . LYS A 1 72  ? 1.935   8.138   7.545   1.00 0.00 ? 72  LYS A HE3  3  
ATOM 3902  H HZ1  . LYS A 1 72  ? 4.670   8.661   7.915   1.00 0.00 ? 72  LYS A HZ1  3  
ATOM 3903  H HZ2  . LYS A 1 72  ? 3.956   7.346   7.261   1.00 0.00 ? 72  LYS A HZ2  3  
ATOM 3904  H HZ3  . LYS A 1 72  ? 4.321   8.630   6.320   1.00 0.00 ? 72  LYS A HZ3  3  
ATOM 3905  N N    . ILE A 1 73  ? 4.262   6.279   3.237   1.00 0.00 ? 73  ILE A N    3  
ATOM 3906  C CA   . ILE A 1 73  ? 5.163   5.153   3.057   1.00 0.00 ? 73  ILE A CA   3  
ATOM 3907  C C    . ILE A 1 73  ? 6.522   5.664   2.577   1.00 0.00 ? 73  ILE A C    3  
ATOM 3908  O O    . ILE A 1 73  ? 7.553   5.344   3.167   1.00 0.00 ? 73  ILE A O    3  
ATOM 3909  C CB   . ILE A 1 73  ? 4.536   4.109   2.130   1.00 0.00 ? 73  ILE A CB   3  
ATOM 3910  C CG1  . ILE A 1 73  ? 3.332   3.438   2.794   1.00 0.00 ? 73  ILE A CG1  3  
ATOM 3911  C CG2  . ILE A 1 73  ? 5.579   3.088   1.670   1.00 0.00 ? 73  ILE A CG2  3  
ATOM 3912  C CD1  . ILE A 1 73  ? 2.123   3.430   1.855   1.00 0.00 ? 73  ILE A CD1  3  
ATOM 3913  H H    . ILE A 1 73  ? 3.348   6.155   2.852   1.00 0.00 ? 73  ILE A H    3  
ATOM 3914  H HA   . ILE A 1 73  ? 5.295   4.681   4.031   1.00 0.00 ? 73  ILE A HA   3  
ATOM 3915  H HB   . ILE A 1 73  ? 4.170   4.619   1.239   1.00 0.00 ? 73  ILE A HB   3  
ATOM 3916  H HG12 . ILE A 1 73  ? 3.588   2.416   3.072   1.00 0.00 ? 73  ILE A HG12 3  
ATOM 3917  H HG13 . ILE A 1 73  ? 3.079   3.966   3.713   1.00 0.00 ? 73  ILE A HG13 3  
ATOM 3918  H HG21 . ILE A 1 73  ? 6.447   3.135   2.326   1.00 0.00 ? 73  ILE A HG21 3  
ATOM 3919  H HG22 . ILE A 1 73  ? 5.148   2.087   1.707   1.00 0.00 ? 73  ILE A HG22 3  
ATOM 3920  H HG23 . ILE A 1 73  ? 5.883   3.315   0.648   1.00 0.00 ? 73  ILE A HG23 3  
ATOM 3921  H HD11 . ILE A 1 73  ? 1.407   4.185   2.179   1.00 0.00 ? 73  ILE A HD11 3  
ATOM 3922  H HD12 . ILE A 1 73  ? 2.450   3.651   0.839   1.00 0.00 ? 73  ILE A HD12 3  
ATOM 3923  H HD13 . ILE A 1 73  ? 1.651   2.447   1.880   1.00 0.00 ? 73  ILE A HD13 3  
ATOM 3924  N N    . LYS A 1 74  ? 6.481   6.450   1.511   1.00 0.00 ? 74  LYS A N    3  
ATOM 3925  C CA   . LYS A 1 74  ? 7.697   7.009   0.946   1.00 0.00 ? 74  LYS A CA   3  
ATOM 3926  C C    . LYS A 1 74  ? 8.514   7.670   2.057   1.00 0.00 ? 74  LYS A C    3  
ATOM 3927  O O    . LYS A 1 74  ? 9.742   7.596   2.057   1.00 0.00 ? 74  LYS A O    3  
ATOM 3928  C CB   . LYS A 1 74  ? 7.365   7.948   -0.216  1.00 0.00 ? 74  LYS A CB   3  
ATOM 3929  C CG   . LYS A 1 74  ? 7.779   7.332   -1.554  1.00 0.00 ? 74  LYS A CG   3  
ATOM 3930  C CD   . LYS A 1 74  ? 7.103   8.053   -2.722  1.00 0.00 ? 74  LYS A CD   3  
ATOM 3931  C CE   . LYS A 1 74  ? 5.625   7.672   -2.821  1.00 0.00 ? 74  LYS A CE   3  
ATOM 3932  N NZ   . LYS A 1 74  ? 4.825   8.818   -3.307  1.00 0.00 ? 74  LYS A NZ   3  
ATOM 3933  H H    . LYS A 1 74  ? 5.638   6.705   1.037   1.00 0.00 ? 74  LYS A H    3  
ATOM 3934  H HA   . LYS A 1 74  ? 8.277   6.181   0.536   1.00 0.00 ? 74  LYS A HA   3  
ATOM 3935  H HB2  . LYS A 1 74  ? 6.296   8.160   -0.224  1.00 0.00 ? 74  LYS A HB2  3  
ATOM 3936  H HB3  . LYS A 1 74  ? 7.877   8.900   -0.076  1.00 0.00 ? 74  LYS A HB3  3  
ATOM 3937  H HG2  . LYS A 1 74  ? 8.862   7.387   -1.665  1.00 0.00 ? 74  LYS A HG2  3  
ATOM 3938  H HG3  . LYS A 1 74  ? 7.510   6.275   -1.571  1.00 0.00 ? 74  LYS A HG3  3  
ATOM 3939  H HD2  . LYS A 1 74  ? 7.196   9.131   -2.591  1.00 0.00 ? 74  LYS A HD2  3  
ATOM 3940  H HD3  . LYS A 1 74  ? 7.611   7.801   -3.653  1.00 0.00 ? 74  LYS A HD3  3  
ATOM 3941  H HE2  . LYS A 1 74  ? 5.506   6.825   -3.497  1.00 0.00 ? 74  LYS A HE2  3  
ATOM 3942  H HE3  . LYS A 1 74  ? 5.259   7.354   -1.845  1.00 0.00 ? 74  LYS A HE3  3  
ATOM 3943  H HZ1  . LYS A 1 74  ? 4.386   9.272   -2.531  1.00 0.00 ? 74  LYS A HZ1  3  
ATOM 3944  H HZ2  . LYS A 1 74  ? 5.424   9.467   -3.776  1.00 0.00 ? 74  LYS A HZ2  3  
ATOM 3945  H HZ3  . LYS A 1 74  ? 4.125   8.491   -3.941  1.00 0.00 ? 74  LYS A HZ3  3  
ATOM 3946  N N    . ALA A 1 75  ? 7.800   8.301   2.977   1.00 0.00 ? 75  ALA A N    3  
ATOM 3947  C CA   . ALA A 1 75  ? 8.444   8.975   4.092   1.00 0.00 ? 75  ALA A CA   3  
ATOM 3948  C C    . ALA A 1 75  ? 9.144   7.939   4.974   1.00 0.00 ? 75  ALA A C    3  
ATOM 3949  O O    . ALA A 1 75  ? 10.236  8.187   5.482   1.00 0.00 ? 75  ALA A O    3  
ATOM 3950  C CB   . ALA A 1 75  ? 7.405   9.792   4.864   1.00 0.00 ? 75  ALA A CB   3  
ATOM 3951  H H    . ALA A 1 75  ? 6.802   8.357   2.970   1.00 0.00 ? 75  ALA A H    3  
ATOM 3952  H HA   . ALA A 1 75  ? 9.191   9.655   3.682   1.00 0.00 ? 75  ALA A HA   3  
ATOM 3953  H HB1  . ALA A 1 75  ? 6.981   9.180   5.660   1.00 0.00 ? 75  ALA A HB1  3  
ATOM 3954  H HB2  . ALA A 1 75  ? 7.882   10.671  5.296   1.00 0.00 ? 75  ALA A HB2  3  
ATOM 3955  H HB3  . ALA A 1 75  ? 6.612   10.105  4.185   1.00 0.00 ? 75  ALA A HB3  3  
ATOM 3956  N N    . CYS A 1 76  ? 8.486   6.800   5.128   1.00 0.00 ? 76  CYS A N    3  
ATOM 3957  C CA   . CYS A 1 76  ? 9.031   5.725   5.940   1.00 0.00 ? 76  CYS A CA   3  
ATOM 3958  C C    . CYS A 1 76  ? 10.372  5.301   5.337   1.00 0.00 ? 76  CYS A C    3  
ATOM 3959  O O    . CYS A 1 76  ? 10.410  4.637   4.303   1.00 0.00 ? 76  CYS A O    3  
ATOM 3960  C CB   . CYS A 1 76  ? 8.058   4.549   6.049   1.00 0.00 ? 76  CYS A CB   3  
ATOM 3961  S SG   . CYS A 1 76  ? 6.591   5.040   7.026   1.00 0.00 ? 76  CYS A SG   3  
ATOM 3962  H H    . CYS A 1 76  ? 7.597   6.606   4.712   1.00 0.00 ? 76  CYS A H    3  
ATOM 3963  H HA   . CYS A 1 76  ? 9.167   6.128   6.943   1.00 0.00 ? 76  CYS A HA   3  
ATOM 3964  H HB2  . CYS A 1 76  ? 7.751   4.226   5.055   1.00 0.00 ? 76  CYS A HB2  3  
ATOM 3965  H HB3  . CYS A 1 76  ? 8.552   3.700   6.522   1.00 0.00 ? 76  CYS A HB3  3  
ATOM 3966  H HG   . CYS A 1 76  ? 5.694   4.465   6.230   1.00 0.00 ? 76  CYS A HG   3  
ATOM 3967  N N    . THR A 1 77  ? 11.440  5.703   6.011   1.00 0.00 ? 77  THR A N    3  
ATOM 3968  C CA   . THR A 1 77  ? 12.780  5.373   5.555   1.00 0.00 ? 77  THR A CA   3  
ATOM 3969  C C    . THR A 1 77  ? 13.477  4.460   6.565   1.00 0.00 ? 77  THR A C    3  
ATOM 3970  O O    . THR A 1 77  ? 14.124  4.938   7.496   1.00 0.00 ? 77  THR A O    3  
ATOM 3971  C CB   . THR A 1 77  ? 13.529  6.683   5.301   1.00 0.00 ? 77  THR A CB   3  
ATOM 3972  O OG1  . THR A 1 77  ? 14.830  6.267   4.898   1.00 0.00 ? 77  THR A OG1  3  
ATOM 3973  C CG2  . THR A 1 77  ? 13.773  7.476   6.587   1.00 0.00 ? 77  THR A CG2  3  
ATOM 3974  H H    . THR A 1 77  ? 11.401  6.243   6.851   1.00 0.00 ? 77  THR A H    3  
ATOM 3975  H HA   . THR A 1 77  ? 12.698  4.815   4.622   1.00 0.00 ? 77  THR A HA   3  
ATOM 3976  H HB   . THR A 1 77  ? 13.009  7.292   4.561   1.00 0.00 ? 77  THR A HB   3  
ATOM 3977  H HG1  . THR A 1 77  ? 15.218  6.929   4.257   1.00 0.00 ? 77  THR A HG1  3  
ATOM 3978  H HG21 . THR A 1 77  ? 14.823  7.398   6.868   1.00 0.00 ? 77  THR A HG21 3  
ATOM 3979  H HG22 . THR A 1 77  ? 13.518  8.523   6.422   1.00 0.00 ? 77  THR A HG22 3  
ATOM 3980  H HG23 . THR A 1 77  ? 13.152  7.073   7.386   1.00 0.00 ? 77  THR A HG23 3  
ATOM 3981  N N    . GLY A 1 78  ? 13.323  3.163   6.347   1.00 0.00 ? 78  GLY A N    3  
ATOM 3982  C CA   . GLY A 1 78  ? 13.930  2.179   7.227   1.00 0.00 ? 78  GLY A CA   3  
ATOM 3983  C C    . GLY A 1 78  ? 12.931  1.078   7.590   1.00 0.00 ? 78  GLY A C    3  
ATOM 3984  O O    . GLY A 1 78  ? 13.173  -0.098  7.322   1.00 0.00 ? 78  GLY A O    3  
ATOM 3985  H H    . GLY A 1 78  ? 12.796  2.782   5.588   1.00 0.00 ? 78  GLY A H    3  
ATOM 3986  H HA2  . GLY A 1 78  ? 14.800  1.738   6.741   1.00 0.00 ? 78  GLY A HA2  3  
ATOM 3987  H HA3  . GLY A 1 78  ? 14.285  2.667   8.135   1.00 0.00 ? 78  GLY A HA3  3  
ATOM 3988  N N    . SER A 1 79  ? 11.830  1.499   8.195   1.00 0.00 ? 79  SER A N    3  
ATOM 3989  C CA   . SER A 1 79  ? 10.793  0.564   8.598   1.00 0.00 ? 79  SER A CA   3  
ATOM 3990  C C    . SER A 1 79  ? 9.414   1.139   8.273   1.00 0.00 ? 79  SER A C    3  
ATOM 3991  O O    . SER A 1 79  ? 9.254   2.354   8.164   1.00 0.00 ? 79  SER A O    3  
ATOM 3992  C CB   . SER A 1 79  ? 10.895  0.238   10.090  1.00 0.00 ? 79  SER A CB   3  
ATOM 3993  O OG   . SER A 1 79  ? 11.375  1.346   10.846  1.00 0.00 ? 79  SER A OG   3  
ATOM 3994  H H    . SER A 1 79  ? 11.641  2.457   8.410   1.00 0.00 ? 79  SER A H    3  
ATOM 3995  H HA   . SER A 1 79  ? 10.978  -0.340  8.017   1.00 0.00 ? 79  SER A HA   3  
ATOM 3996  H HB2  . SER A 1 79  ? 9.915   -0.058  10.464  1.00 0.00 ? 79  SER A HB2  3  
ATOM 3997  H HB3  . SER A 1 79  ? 11.561  -0.613  10.231  1.00 0.00 ? 79  SER A HB3  3  
ATOM 3998  H HG   . SER A 1 79  ? 10.622  1.768   11.351  1.00 0.00 ? 79  SER A HG   3  
ATOM 3999  N N    . LEU A 1 80  ? 8.452   0.240   8.128   1.00 0.00 ? 80  LEU A N    3  
ATOM 4000  C CA   . LEU A 1 80  ? 7.091   0.644   7.818   1.00 0.00 ? 80  LEU A CA   3  
ATOM 4001  C C    . LEU A 1 80  ? 6.171   0.254   8.976   1.00 0.00 ? 80  LEU A C    3  
ATOM 4002  O O    . LEU A 1 80  ? 6.347   -0.800  9.586   1.00 0.00 ? 80  LEU A O    3  
ATOM 4003  C CB   . LEU A 1 80  ? 6.656   0.069   6.468   1.00 0.00 ? 80  LEU A CB   3  
ATOM 4004  C CG   . LEU A 1 80  ? 5.308   0.557   5.934   1.00 0.00 ? 80  LEU A CG   3  
ATOM 4005  C CD1  . LEU A 1 80  ? 5.247   2.086   5.914   1.00 0.00 ? 80  LEU A CD1  3  
ATOM 4006  C CD2  . LEU A 1 80  ? 5.012   -0.046  4.559   1.00 0.00 ? 80  LEU A CD2  3  
ATOM 4007  H H    . LEU A 1 80  ? 8.590   -0.746  8.219   1.00 0.00 ? 80  LEU A H    3  
ATOM 4008  H HA   . LEU A 1 80  ? 7.086   1.729   7.723   1.00 0.00 ? 80  LEU A HA   3  
ATOM 4009  H HB2  . LEU A 1 80  ? 7.424   0.306   5.730   1.00 0.00 ? 80  LEU A HB2  3  
ATOM 4010  H HB3  . LEU A 1 80  ? 6.620   -1.017  6.552   1.00 0.00 ? 80  LEU A HB3  3  
ATOM 4011  H HG   . LEU A 1 80  ? 4.527   0.212   6.612   1.00 0.00 ? 80  LEU A HG   3  
ATOM 4012  H HD11 . LEU A 1 80  ? 4.574   2.432   6.698   1.00 0.00 ? 80  LEU A HD11 3  
ATOM 4013  H HD12 . LEU A 1 80  ? 6.244   2.492   6.085   1.00 0.00 ? 80  LEU A HD12 3  
ATOM 4014  H HD13 . LEU A 1 80  ? 4.879   2.422   4.944   1.00 0.00 ? 80  LEU A HD13 3  
ATOM 4015  H HD21 . LEU A 1 80  ? 4.578   -1.039  4.684   1.00 0.00 ? 80  LEU A HD21 3  
ATOM 4016  H HD22 . LEU A 1 80  ? 4.308   0.593   4.026   1.00 0.00 ? 80  LEU A HD22 3  
ATOM 4017  H HD23 . LEU A 1 80  ? 5.937   -0.123  3.989   1.00 0.00 ? 80  LEU A HD23 3  
ATOM 4018  N N    . ASN A 1 81  ? 5.210   1.125   9.246   1.00 0.00 ? 81  ASN A N    3  
ATOM 4019  C CA   . ASN A 1 81  ? 4.262   0.885   10.321  1.00 0.00 ? 81  ASN A CA   3  
ATOM 4020  C C    . ASN A 1 81  ? 2.851   1.220   9.835   1.00 0.00 ? 81  ASN A C    3  
ATOM 4021  O O    . ASN A 1 81  ? 2.508   2.390   9.671   1.00 0.00 ? 81  ASN A O    3  
ATOM 4022  C CB   . ASN A 1 81  ? 4.568   1.768   11.532  1.00 0.00 ? 81  ASN A CB   3  
ATOM 4023  C CG   . ASN A 1 81  ? 5.116   0.937   12.693  1.00 0.00 ? 81  ASN A CG   3  
ATOM 4024  O OD1  . ASN A 1 81  ? 4.469   0.739   13.709  1.00 0.00 ? 81  ASN A OD1  3  
ATOM 4025  N ND2  . ASN A 1 81  ? 6.341   0.462   12.488  1.00 0.00 ? 81  ASN A ND2  3  
ATOM 4026  H H    . ASN A 1 81  ? 5.074   1.980   8.746   1.00 0.00 ? 81  ASN A H    3  
ATOM 4027  H HA   . ASN A 1 81  ? 4.377   -0.169  10.574  1.00 0.00 ? 81  ASN A HA   3  
ATOM 4028  H HB2  . ASN A 1 81  ? 5.292   2.534   11.255  1.00 0.00 ? 81  ASN A HB2  3  
ATOM 4029  H HB3  . ASN A 1 81  ? 3.661   2.286   11.847  1.00 0.00 ? 81  ASN A HB3  3  
ATOM 4030  H HD21 . ASN A 1 81  ? 6.817   0.662   11.631  1.00 0.00 ? 81  ASN A HD21 3  
ATOM 4031  H HD22 . ASN A 1 81  ? 6.786   -0.094  13.190  1.00 0.00 ? 81  ASN A HD22 3  
ATOM 4032  N N    . MET A 1 82  ? 2.069   0.173   9.618   1.00 0.00 ? 82  MET A N    3  
ATOM 4033  C CA   . MET A 1 82  ? 0.703   0.341   9.154   1.00 0.00 ? 82  MET A CA   3  
ATOM 4034  C C    . MET A 1 82  ? -0.211  -0.739  9.735   1.00 0.00 ? 82  MET A C    3  
ATOM 4035  O O    . MET A 1 82  ? 0.226   -1.864  9.976   1.00 0.00 ? 82  MET A O    3  
ATOM 4036  C CB   . MET A 1 82  ? 0.670   0.270   7.626   1.00 0.00 ? 82  MET A CB   3  
ATOM 4037  C CG   . MET A 1 82  ? 1.732   1.184   7.011   1.00 0.00 ? 82  MET A CG   3  
ATOM 4038  S SD   . MET A 1 82  ? 1.516   1.267   5.241   1.00 0.00 ? 82  MET A SD   3  
ATOM 4039  C CE   . MET A 1 82  ? 1.794   -0.444  4.815   1.00 0.00 ? 82  MET A CE   3  
ATOM 4040  H H    . MET A 1 82  ? 2.355   -0.776  9.753   1.00 0.00 ? 82  MET A H    3  
ATOM 4041  H HA   . MET A 1 82  ? 0.391   1.322   9.512   1.00 0.00 ? 82  MET A HA   3  
ATOM 4042  H HB2  . MET A 1 82  ? 0.838   -0.757  7.302   1.00 0.00 ? 82  MET A HB2  3  
ATOM 4043  H HB3  . MET A 1 82  ? -0.317  0.561   7.266   1.00 0.00 ? 82  MET A HB3  3  
ATOM 4044  H HG2  . MET A 1 82  ? 1.658   2.183   7.442   1.00 0.00 ? 82  MET A HG2  3  
ATOM 4045  H HG3  . MET A 1 82  ? 2.728   0.808   7.247   1.00 0.00 ? 82  MET A HG3  3  
ATOM 4046  H HE1  . MET A 1 82  ? 2.640   -0.515  4.131   1.00 0.00 ? 82  MET A HE1  3  
ATOM 4047  H HE2  . MET A 1 82  ? 2.009   -1.014  5.719   1.00 0.00 ? 82  MET A HE2  3  
ATOM 4048  H HE3  . MET A 1 82  ? 0.903   -0.848  4.334   1.00 0.00 ? 82  MET A HE3  3  
ATOM 4049  N N    . THR A 1 83  ? -1.463  -0.360  9.945   1.00 0.00 ? 83  THR A N    3  
ATOM 4050  C CA   . THR A 1 83  ? -2.443  -1.283  10.493  1.00 0.00 ? 83  THR A CA   3  
ATOM 4051  C C    . THR A 1 83  ? -3.249  -1.936  9.369   1.00 0.00 ? 83  THR A C    3  
ATOM 4052  O O    . THR A 1 83  ? -3.497  -1.315  8.336   1.00 0.00 ? 83  THR A O    3  
ATOM 4053  C CB   . THR A 1 83  ? -3.308  -0.514  11.494  1.00 0.00 ? 83  THR A CB   3  
ATOM 4054  O OG1  . THR A 1 83  ? -2.382  0.322   12.183  1.00 0.00 ? 83  THR A OG1  3  
ATOM 4055  C CG2  . THR A 1 83  ? -3.880  -1.417  12.588  1.00 0.00 ? 83  THR A CG2  3  
ATOM 4056  H H    . THR A 1 83  ? -1.811  0.556   9.746   1.00 0.00 ? 83  THR A H    3  
ATOM 4057  H HA   . THR A 1 83  ? -1.910  -2.081  11.010  1.00 0.00 ? 83  THR A HA   3  
ATOM 4058  H HB   . THR A 1 83  ? -4.102  0.031   10.984  1.00 0.00 ? 83  THR A HB   3  
ATOM 4059  H HG1  . THR A 1 83  ? -2.216  1.156   11.656  1.00 0.00 ? 83  THR A HG1  3  
ATOM 4060  H HG21 . THR A 1 83  ? -4.627  -0.866  13.161  1.00 0.00 ? 83  THR A HG21 3  
ATOM 4061  H HG22 . THR A 1 83  ? -4.345  -2.291  12.132  1.00 0.00 ? 83  THR A HG22 3  
ATOM 4062  H HG23 . THR A 1 83  ? -3.077  -1.738  13.252  1.00 0.00 ? 83  THR A HG23 3  
ATOM 4063  N N    . LEU A 1 84  ? -3.636  -3.180  9.607   1.00 0.00 ? 84  LEU A N    3  
ATOM 4064  C CA   . LEU A 1 84  ? -4.409  -3.924  8.628   1.00 0.00 ? 84  LEU A CA   3  
ATOM 4065  C C    . LEU A 1 84  ? -5.791  -4.237  9.205   1.00 0.00 ? 84  LEU A C    3  
ATOM 4066  O O    . LEU A 1 84  ? -6.008  -4.106  10.409  1.00 0.00 ? 84  LEU A O    3  
ATOM 4067  C CB   . LEU A 1 84  ? -3.640  -5.164  8.167   1.00 0.00 ? 84  LEU A CB   3  
ATOM 4068  C CG   . LEU A 1 84  ? -2.259  -4.910  7.560   1.00 0.00 ? 84  LEU A CG   3  
ATOM 4069  C CD1  . LEU A 1 84  ? -1.659  -6.202  7.002   1.00 0.00 ? 84  LEU A CD1  3  
ATOM 4070  C CD2  . LEU A 1 84  ? -2.320  -3.804  6.504   1.00 0.00 ? 84  LEU A CD2  3  
ATOM 4071  H H    . LEU A 1 84  ? -3.430  -3.678  10.450  1.00 0.00 ? 84  LEU A H    3  
ATOM 4072  H HA   . LEU A 1 84  ? -4.536  -3.282  7.756   1.00 0.00 ? 84  LEU A HA   3  
ATOM 4073  H HB2  . LEU A 1 84  ? -3.522  -5.832  9.021   1.00 0.00 ? 84  LEU A HB2  3  
ATOM 4074  H HB3  . LEU A 1 84  ? -4.247  -5.692  7.432   1.00 0.00 ? 84  LEU A HB3  3  
ATOM 4075  H HG   . LEU A 1 84  ? -1.596  -4.562  8.352   1.00 0.00 ? 84  LEU A HG   3  
ATOM 4076  H HD11 . LEU A 1 84  ? -0.651  -6.005  6.635   1.00 0.00 ? 84  LEU A HD11 3  
ATOM 4077  H HD12 . LEU A 1 84  ? -1.618  -6.953  7.791   1.00 0.00 ? 84  LEU A HD12 3  
ATOM 4078  H HD13 . LEU A 1 84  ? -2.279  -6.567  6.184   1.00 0.00 ? 84  LEU A HD13 3  
ATOM 4079  H HD21 . LEU A 1 84  ? -1.352  -3.719  6.011   1.00 0.00 ? 84  LEU A HD21 3  
ATOM 4080  H HD22 . LEU A 1 84  ? -3.084  -4.048  5.766   1.00 0.00 ? 84  LEU A HD22 3  
ATOM 4081  H HD23 . LEU A 1 84  ? -2.568  -2.857  6.984   1.00 0.00 ? 84  LEU A HD23 3  
ATOM 4082  N N    . GLN A 1 85  ? -6.689  -4.645  8.320   1.00 0.00 ? 85  GLN A N    3  
ATOM 4083  C CA   . GLN A 1 85  ? -8.043  -4.977  8.728   1.00 0.00 ? 85  GLN A CA   3  
ATOM 4084  C C    . GLN A 1 85  ? -8.317  -6.465  8.496   1.00 0.00 ? 85  GLN A C    3  
ATOM 4085  O O    . GLN A 1 85  ? -8.135  -6.967  7.388   1.00 0.00 ? 85  GLN A O    3  
ATOM 4086  C CB   . GLN A 1 85  ? -9.066  -4.110  7.991   1.00 0.00 ? 85  GLN A CB   3  
ATOM 4087  C CG   . GLN A 1 85  ? -10.473 -4.698  8.113   1.00 0.00 ? 85  GLN A CG   3  
ATOM 4088  C CD   . GLN A 1 85  ? -11.483 -3.875  7.311   1.00 0.00 ? 85  GLN A CD   3  
ATOM 4089  O OE1  . GLN A 1 85  ? -12.157 -2.998  7.825   1.00 0.00 ? 85  GLN A OE1  3  
ATOM 4090  N NE2  . GLN A 1 85  ? -11.549 -4.205  6.024   1.00 0.00 ? 85  GLN A NE2  3  
ATOM 4091  H H    . GLN A 1 85  ? -6.503  -4.748  7.343   1.00 0.00 ? 85  GLN A H    3  
ATOM 4092  H HA   . GLN A 1 85  ? -8.088  -4.755  9.794   1.00 0.00 ? 85  GLN A HA   3  
ATOM 4093  H HB2  . GLN A 1 85  ? -9.053  -3.100  8.400   1.00 0.00 ? 85  GLN A HB2  3  
ATOM 4094  H HB3  . GLN A 1 85  ? -8.791  -4.031  6.939   1.00 0.00 ? 85  GLN A HB3  3  
ATOM 4095  H HG2  . GLN A 1 85  ? -10.473 -5.728  7.757   1.00 0.00 ? 85  GLN A HG2  3  
ATOM 4096  H HG3  . GLN A 1 85  ? -10.770 -4.723  9.162   1.00 0.00 ? 85  GLN A HG3  3  
ATOM 4097  H HE21 . GLN A 1 85  ? -10.968 -4.935  5.665   1.00 0.00 ? 85  GLN A HE21 3  
ATOM 4098  H HE22 . GLN A 1 85  ? -12.181 -3.724  5.416   1.00 0.00 ? 85  GLN A HE22 3  
ATOM 4099  N N    . ARG A 1 86  ? -8.750  -7.127  9.558   1.00 0.00 ? 86  ARG A N    3  
ATOM 4100  C CA   . ARG A 1 86  ? -9.051  -8.546  9.484   1.00 0.00 ? 86  ARG A CA   3  
ATOM 4101  C C    . ARG A 1 86  ? -10.392 -8.769  8.782   1.00 0.00 ? 86  ARG A C    3  
ATOM 4102  O O    . ARG A 1 86  ? -11.414 -8.228  9.201   1.00 0.00 ? 86  ARG A O    3  
ATOM 4103  C CB   . ARG A 1 86  ? -9.104  -9.172  10.880  1.00 0.00 ? 86  ARG A CB   3  
ATOM 4104  C CG   . ARG A 1 86  ? -7.728  -9.691  11.301  1.00 0.00 ? 86  ARG A CG   3  
ATOM 4105  C CD   . ARG A 1 86  ? -6.622  -8.727  10.867  1.00 0.00 ? 86  ARG A CD   3  
ATOM 4106  N NE   . ARG A 1 86  ? -5.376  -9.019  11.609  1.00 0.00 ? 86  ARG A NE   3  
ATOM 4107  C CZ   . ARG A 1 86  ? -4.160  -8.601  11.231  1.00 0.00 ? 86  ARG A CZ   3  
ATOM 4108  N NH1  . ARG A 1 86  ? -4.020  -7.870  10.117  1.00 0.00 ? 86  ARG A NH1  3  
ATOM 4109  N NH2  . ARG A 1 86  ? -3.085  -8.914  11.967  1.00 0.00 ? 86  ARG A NH2  3  
ATOM 4110  H H    . ARG A 1 86  ? -8.895  -6.710  10.456  1.00 0.00 ? 86  ARG A H    3  
ATOM 4111  H HA   . ARG A 1 86  ? -8.231  -8.975  8.909   1.00 0.00 ? 86  ARG A HA   3  
ATOM 4112  H HB2  . ARG A 1 86  ? -9.454  -8.432  11.600  1.00 0.00 ? 86  ARG A HB2  3  
ATOM 4113  H HB3  . ARG A 1 86  ? -9.824  -9.990  10.888  1.00 0.00 ? 86  ARG A HB3  3  
ATOM 4114  H HG2  . ARG A 1 86  ? -7.699  -9.819  12.383  1.00 0.00 ? 86  ARG A HG2  3  
ATOM 4115  H HG3  . ARG A 1 86  ? -7.555  -10.672 10.859  1.00 0.00 ? 86  ARG A HG3  3  
ATOM 4116  H HD2  . ARG A 1 86  ? -6.447  -8.820  9.795   1.00 0.00 ? 86  ARG A HD2  3  
ATOM 4117  H HD3  . ARG A 1 86  ? -6.932  -7.698  11.051  1.00 0.00 ? 86  ARG A HD3  3  
ATOM 4118  H HE   . ARG A 1 86  ? -5.445  -9.563  12.446  1.00 0.00 ? 86  ARG A HE   3  
ATOM 4119  H HH11 . ARG A 1 86  ? -4.822  -7.636  9.568   1.00 0.00 ? 86  ARG A HH11 3  
ATOM 4120  H HH12 . ARG A 1 86  ? -3.113  -7.558  9.835   1.00 0.00 ? 86  ARG A HH12 3  
ATOM 4121  H HH21 . ARG A 1 86  ? -3.189  -9.460  12.798  1.00 0.00 ? 86  ARG A HH21 3  
ATOM 4122  H HH22 . ARG A 1 86  ? -2.178  -8.602  11.684  1.00 0.00 ? 86  ARG A HH22 3  
ATOM 4123  N N    . ALA A 1 87  ? -10.344 -9.566  7.724   1.00 0.00 ? 87  ALA A N    3  
ATOM 4124  C CA   . ALA A 1 87  ? -11.542 -9.867  6.960   1.00 0.00 ? 87  ALA A CA   3  
ATOM 4125  C C    . ALA A 1 87  ? -11.606 -11.371 6.690   1.00 0.00 ? 87  ALA A C    3  
ATOM 4126  O O    . ALA A 1 87  ? -11.316 -11.820 5.582   1.00 0.00 ? 87  ALA A O    3  
ATOM 4127  C CB   . ALA A 1 87  ? -11.546 -9.043  5.671   1.00 0.00 ? 87  ALA A CB   3  
ATOM 4128  H H    . ALA A 1 87  ? -9.509  -10.002 7.390   1.00 0.00 ? 87  ALA A H    3  
ATOM 4129  H HA   . ALA A 1 87  ? -12.403 -9.578  7.563   1.00 0.00 ? 87  ALA A HA   3  
ATOM 4130  H HB1  . ALA A 1 87  ? -12.160 -8.153  5.810   1.00 0.00 ? 87  ALA A HB1  3  
ATOM 4131  H HB2  . ALA A 1 87  ? -10.526 -8.746  5.427   1.00 0.00 ? 87  ALA A HB2  3  
ATOM 4132  H HB3  . ALA A 1 87  ? -11.954 -9.642  4.857   1.00 0.00 ? 87  ALA A HB3  3  
ATOM 4133  N N    . SER A 1 88  ? -11.987 -12.110 7.722   1.00 0.00 ? 88  SER A N    3  
ATOM 4134  C CA   . SER A 1 88  ? -12.092 -13.555 7.610   1.00 0.00 ? 88  SER A CA   3  
ATOM 4135  C C    . SER A 1 88  ? -13.494 -14.011 8.020   1.00 0.00 ? 88  SER A C    3  
ATOM 4136  O O    . SER A 1 88  ? -13.709 -14.415 9.162   1.00 0.00 ? 88  SER A O    3  
ATOM 4137  C CB   . SER A 1 88  ? -11.035 -14.252 8.468   1.00 0.00 ? 88  SER A CB   3  
ATOM 4138  O OG   . SER A 1 88  ? -10.344 -15.266 7.744   1.00 0.00 ? 88  SER A OG   3  
ATOM 4139  H H    . SER A 1 88  ? -12.221 -11.737 8.620   1.00 0.00 ? 88  SER A H    3  
ATOM 4140  H HA   . SER A 1 88  ? -11.910 -13.777 6.558   1.00 0.00 ? 88  SER A HA   3  
ATOM 4141  H HB2  . SER A 1 88  ? -10.319 -13.514 8.831   1.00 0.00 ? 88  SER A HB2  3  
ATOM 4142  H HB3  . SER A 1 88  ? -11.511 -14.692 9.344   1.00 0.00 ? 88  SER A HB3  3  
ATOM 4143  H HG   . SER A 1 88  ? -10.738 -16.162 7.949   1.00 0.00 ? 88  SER A HG   3  
ATOM 4144  N N    . ALA A 1 89  ? -14.410 -13.930 7.067   1.00 0.00 ? 89  ALA A N    3  
ATOM 4145  C CA   . ALA A 1 89  ? -15.785 -14.330 7.315   1.00 0.00 ? 89  ALA A CA   3  
ATOM 4146  C C    . ALA A 1 89  ? -16.511 -14.501 5.979   1.00 0.00 ? 89  ALA A C    3  
ATOM 4147  O O    . ALA A 1 89  ? -16.252 -13.764 5.029   1.00 0.00 ? 89  ALA A O    3  
ATOM 4148  C CB   . ALA A 1 89  ? -16.462 -13.297 8.218   1.00 0.00 ? 89  ALA A CB   3  
ATOM 4149  H H    . ALA A 1 89  ? -14.227 -13.600 6.141   1.00 0.00 ? 89  ALA A H    3  
ATOM 4150  H HA   . ALA A 1 89  ? -15.764 -15.289 7.833   1.00 0.00 ? 89  ALA A HA   3  
ATOM 4151  H HB1  . ALA A 1 89  ? -17.295 -13.764 8.743   1.00 0.00 ? 89  ALA A HB1  3  
ATOM 4152  H HB2  . ALA A 1 89  ? -15.741 -12.920 8.943   1.00 0.00 ? 89  ALA A HB2  3  
ATOM 4153  H HB3  . ALA A 1 89  ? -16.832 -12.471 7.611   1.00 0.00 ? 89  ALA A HB3  3  
ATOM 4154  N N    . ALA A 1 90  ? -17.406 -15.478 5.949   1.00 0.00 ? 90  ALA A N    3  
ATOM 4155  C CA   . ALA A 1 90  ? -18.171 -15.755 4.745   1.00 0.00 ? 90  ALA A CA   3  
ATOM 4156  C C    . ALA A 1 90  ? -19.260 -16.781 5.064   1.00 0.00 ? 90  ALA A C    3  
ATOM 4157  O O    . ALA A 1 90  ? -19.206 -17.916 4.593   1.00 0.00 ? 90  ALA A O    3  
ATOM 4158  C CB   . ALA A 1 90  ? -17.227 -16.230 3.639   1.00 0.00 ? 90  ALA A CB   3  
ATOM 4159  H H    . ALA A 1 90  ? -17.611 -16.072 6.726   1.00 0.00 ? 90  ALA A H    3  
ATOM 4160  H HA   . ALA A 1 90  ? -18.641 -14.824 4.429   1.00 0.00 ? 90  ALA A HA   3  
ATOM 4161  H HB1  . ALA A 1 90  ? -17.609 -17.157 3.209   1.00 0.00 ? 90  ALA A HB1  3  
ATOM 4162  H HB2  . ALA A 1 90  ? -17.165 -15.468 2.862   1.00 0.00 ? 90  ALA A HB2  3  
ATOM 4163  H HB3  . ALA A 1 90  ? -16.236 -16.405 4.057   1.00 0.00 ? 90  ALA A HB3  3  
ATOM 4164  N N    . ALA A 1 91  ? -20.224 -16.345 5.861   1.00 0.00 ? 91  ALA A N    3  
ATOM 4165  C CA   . ALA A 1 91  ? -21.325 -17.211 6.248   1.00 0.00 ? 91  ALA A CA   3  
ATOM 4166  C C    . ALA A 1 91  ? -22.632 -16.416 6.211   1.00 0.00 ? 91  ALA A C    3  
ATOM 4167  O O    . ALA A 1 91  ? -22.630 -15.228 5.894   1.00 0.00 ? 91  ALA A O    3  
ATOM 4168  C CB   . ALA A 1 91  ? -21.044 -17.808 7.628   1.00 0.00 ? 91  ALA A CB   3  
ATOM 4169  H H    . ALA A 1 91  ? -20.261 -15.420 6.240   1.00 0.00 ? 91  ALA A H    3  
ATOM 4170  H HA   . ALA A 1 91  ? -21.381 -18.021 5.520   1.00 0.00 ? 91  ALA A HA   3  
ATOM 4171  H HB1  . ALA A 1 91  ? -21.854 -17.546 8.309   1.00 0.00 ? 91  ALA A HB1  3  
ATOM 4172  H HB2  . ALA A 1 91  ? -20.974 -18.893 7.548   1.00 0.00 ? 91  ALA A HB2  3  
ATOM 4173  H HB3  . ALA A 1 91  ? -20.105 -17.410 8.012   1.00 0.00 ? 91  ALA A HB3  3  
ATOM 4174  N N    . LYS A 1 92  ? -23.715 -17.105 6.538   1.00 0.00 ? 92  LYS A N    3  
ATOM 4175  C CA   . LYS A 1 92  ? -25.026 -16.478 6.547   1.00 0.00 ? 92  LYS A CA   3  
ATOM 4176  C C    . LYS A 1 92  ? -25.493 -16.301 7.993   1.00 0.00 ? 92  LYS A C    3  
ATOM 4177  O O    . LYS A 1 92  ? -24.900 -16.861 8.913   1.00 0.00 ? 92  LYS A O    3  
ATOM 4178  C CB   . LYS A 1 92  ? -26.004 -17.270 5.677   1.00 0.00 ? 92  LYS A CB   3  
ATOM 4179  C CG   . LYS A 1 92  ? -25.355 -17.676 4.352   1.00 0.00 ? 92  LYS A CG   3  
ATOM 4180  C CD   . LYS A 1 92  ? -25.261 -16.483 3.399   1.00 0.00 ? 92  LYS A CD   3  
ATOM 4181  C CE   . LYS A 1 92  ? -26.558 -16.310 2.606   1.00 0.00 ? 92  LYS A CE   3  
ATOM 4182  N NZ   . LYS A 1 92  ? -26.574 -15.001 1.916   1.00 0.00 ? 92  LYS A NZ   3  
ATOM 4183  H H    . LYS A 1 92  ? -23.708 -18.071 6.795   1.00 0.00 ? 92  LYS A H    3  
ATOM 4184  H HA   . LYS A 1 92  ? -24.919 -15.491 6.095   1.00 0.00 ? 92  LYS A HA   3  
ATOM 4185  H HB2  . LYS A 1 92  ? -26.334 -18.160 6.212   1.00 0.00 ? 92  LYS A HB2  3  
ATOM 4186  H HB3  . LYS A 1 92  ? -26.892 -16.668 5.482   1.00 0.00 ? 92  LYS A HB3  3  
ATOM 4187  H HG2  . LYS A 1 92  ? -24.359 -18.076 4.539   1.00 0.00 ? 92  LYS A HG2  3  
ATOM 4188  H HG3  . LYS A 1 92  ? -25.936 -18.472 3.887   1.00 0.00 ? 92  LYS A HG3  3  
ATOM 4189  H HD2  . LYS A 1 92  ? -25.054 -15.575 3.966   1.00 0.00 ? 92  LYS A HD2  3  
ATOM 4190  H HD3  . LYS A 1 92  ? -24.427 -16.626 2.712   1.00 0.00 ? 92  LYS A HD3  3  
ATOM 4191  H HE2  . LYS A 1 92  ? -26.655 -17.114 1.877   1.00 0.00 ? 92  LYS A HE2  3  
ATOM 4192  H HE3  . LYS A 1 92  ? -27.414 -16.385 3.277   1.00 0.00 ? 92  LYS A HE3  3  
ATOM 4193  H HZ1  . LYS A 1 92  ? -26.623 -14.268 2.594   1.00 0.00 ? 92  LYS A HZ1  3  
ATOM 4194  H HZ2  . LYS A 1 92  ? -25.739 -14.900 1.375   1.00 0.00 ? 92  LYS A HZ2  3  
ATOM 4195  H HZ3  . LYS A 1 92  ? -27.370 -14.952 1.314   1.00 0.00 ? 92  LYS A HZ3  3  
ATOM 4196  N N    . SER A 1 93  ? -26.552 -15.520 8.148   1.00 0.00 ? 93  SER A N    3  
ATOM 4197  C CA   . SER A 1 93  ? -27.106 -15.263 9.466   1.00 0.00 ? 93  SER A CA   3  
ATOM 4198  C C    . SER A 1 93  ? -28.465 -15.950 9.607   1.00 0.00 ? 93  SER A C    3  
ATOM 4199  O O    . SER A 1 93  ? -29.427 -15.572 8.940   1.00 0.00 ? 93  SER A O    3  
ATOM 4200  C CB   . SER A 1 93  ? -27.241 -13.761 9.723   1.00 0.00 ? 93  SER A CB   3  
ATOM 4201  O OG   . SER A 1 93  ? -26.042 -13.199 10.249  1.00 0.00 ? 93  SER A OG   3  
ATOM 4202  H H    . SER A 1 93  ? -27.029 -15.068 7.394   1.00 0.00 ? 93  SER A H    3  
ATOM 4203  H HA   . SER A 1 93  ? -26.388 -15.688 10.169  1.00 0.00 ? 93  SER A HA   3  
ATOM 4204  H HB2  . SER A 1 93  ? -27.501 -13.256 8.793   1.00 0.00 ? 93  SER A HB2  3  
ATOM 4205  H HB3  . SER A 1 93  ? -28.060 -13.585 10.421  1.00 0.00 ? 93  SER A HB3  3  
ATOM 4206  H HG   . SER A 1 93  ? -25.281 -13.370 9.624   1.00 0.00 ? 93  SER A HG   3  
ATOM 4207  N N    . GLU A 1 94  ? -28.502 -16.947 10.478  1.00 0.00 ? 94  GLU A N    3  
ATOM 4208  C CA   . GLU A 1 94  ? -29.728 -17.691 10.714  1.00 0.00 ? 94  GLU A CA   3  
ATOM 4209  C C    . GLU A 1 94  ? -30.643 -16.916 11.664  1.00 0.00 ? 94  GLU A C    3  
ATOM 4210  O O    . GLU A 1 94  ? -30.169 -16.155 12.506  1.00 0.00 ? 94  GLU A O    3  
ATOM 4211  C CB   . GLU A 1 94  ? -29.425 -19.087 11.261  1.00 0.00 ? 94  GLU A CB   3  
ATOM 4212  C CG   . GLU A 1 94  ? -29.050 -20.049 10.132  1.00 0.00 ? 94  GLU A CG   3  
ATOM 4213  C CD   . GLU A 1 94  ? -27.612 -20.548 10.291  1.00 0.00 ? 94  GLU A CD   3  
ATOM 4214  O OE1  . GLU A 1 94  ? -26.770 -19.726 10.713  1.00 0.00 ? 94  GLU A OE1  3  
ATOM 4215  O OE2  . GLU A 1 94  ? -27.388 -21.739 9.988   1.00 0.00 ? 94  GLU A OE2  3  
ATOM 4216  H H    . GLU A 1 94  ? -27.715 -17.248 11.017  1.00 0.00 ? 94  GLU A H    3  
ATOM 4217  H HA   . GLU A 1 94  ? -30.202 -17.785 9.737   1.00 0.00 ? 94  GLU A HA   3  
ATOM 4218  H HB2  . GLU A 1 94  ? -28.609 -19.031 11.982  1.00 0.00 ? 94  GLU A HB2  3  
ATOM 4219  H HB3  . GLU A 1 94  ? -30.296 -19.469 11.794  1.00 0.00 ? 94  GLU A HB3  3  
ATOM 4220  H HG2  . GLU A 1 94  ? -29.735 -20.897 10.129  1.00 0.00 ? 94  GLU A HG2  3  
ATOM 4221  H HG3  . GLU A 1 94  ? -29.160 -19.547 9.170   1.00 0.00 ? 94  GLU A HG3  3  
ATOM 4222  N N    . PRO A 1 95  ? -31.973 -17.144 11.493  1.00 0.00 ? 95  PRO A N    3  
ATOM 4223  C CA   . PRO A 1 95  ? -32.960 -16.476 12.325  1.00 0.00 ? 95  PRO A CA   3  
ATOM 4224  C C    . PRO A 1 95  ? -33.000 -17.089 13.727  1.00 0.00 ? 95  PRO A C    3  
ATOM 4225  O O    . PRO A 1 95  ? -33.520 -18.188 13.913  1.00 0.00 ? 95  PRO A O    3  
ATOM 4226  C CB   . PRO A 1 95  ? -34.273 -16.625 11.574  1.00 0.00 ? 95  PRO A CB   3  
ATOM 4227  C CG   . PRO A 1 95  ? -34.063 -17.762 10.588  1.00 0.00 ? 95  PRO A CG   3  
ATOM 4228  C CD   . PRO A 1 95  ? -32.571 -18.039 10.507  1.00 0.00 ? 95  PRO A CD   3  
ATOM 4229  H HA   . PRO A 1 95  ? -32.713 -15.516 12.454  1.00 0.00 ? 95  PRO A HA   3  
ATOM 4230  H HB2  . PRO A 1 95  ? -35.091 -16.847 12.259  1.00 0.00 ? 95  PRO A HB2  3  
ATOM 4231  H HB3  . PRO A 1 95  ? -34.533 -15.701 11.056  1.00 0.00 ? 95  PRO A HB3  3  
ATOM 4232  H HG2  . PRO A 1 95  ? -34.600 -18.653 10.914  1.00 0.00 ? 95  PRO A HG2  3  
ATOM 4233  H HG3  . PRO A 1 95  ? -34.456 -17.494 9.607   1.00 0.00 ? 95  PRO A HG3  3  
ATOM 4234  H HD2  . PRO A 1 95  ? -32.349 -19.082 10.733  1.00 0.00 ? 95  PRO A HD2  3  
ATOM 4235  H HD3  . PRO A 1 95  ? -32.185 -17.840 9.507   1.00 0.00 ? 95  PRO A HD3  3  
ATOM 4236  N N    . VAL A 1 96  ? -32.444 -16.352 14.676  1.00 0.00 ? 96  VAL A N    3  
ATOM 4237  C CA   . VAL A 1 96  ? -32.410 -16.809 16.055  1.00 0.00 ? 96  VAL A CA   3  
ATOM 4238  C C    . VAL A 1 96  ? -33.776 -16.570 16.701  1.00 0.00 ? 96  VAL A C    3  
ATOM 4239  O O    . VAL A 1 96  ? -34.222 -15.429 16.815  1.00 0.00 ? 96  VAL A O    3  
ATOM 4240  C CB   . VAL A 1 96  ? -31.265 -16.124 16.805  1.00 0.00 ? 96  VAL A CB   3  
ATOM 4241  C CG1  . VAL A 1 96  ? -31.333 -16.427 18.304  1.00 0.00 ? 96  VAL A CG1  3  
ATOM 4242  C CG2  . VAL A 1 96  ? -29.909 -16.529 16.225  1.00 0.00 ? 96  VAL A CG2  3  
ATOM 4243  H H    . VAL A 1 96  ? -32.023 -15.459 14.517  1.00 0.00 ? 96  VAL A H    3  
ATOM 4244  H HA   . VAL A 1 96  ? -32.211 -17.881 16.042  1.00 0.00 ? 96  VAL A HA   3  
ATOM 4245  H HB   . VAL A 1 96  ? -31.377 -15.048 16.676  1.00 0.00 ? 96  VAL A HB   3  
ATOM 4246  H HG11 . VAL A 1 96  ? -30.481 -15.969 18.806  1.00 0.00 ? 96  VAL A HG11 3  
ATOM 4247  H HG12 . VAL A 1 96  ? -32.258 -16.023 18.715  1.00 0.00 ? 96  VAL A HG12 3  
ATOM 4248  H HG13 . VAL A 1 96  ? -31.308 -17.506 18.457  1.00 0.00 ? 96  VAL A HG13 3  
ATOM 4249  H HG21 . VAL A 1 96  ? -29.288 -16.952 17.014  1.00 0.00 ? 96  VAL A HG21 3  
ATOM 4250  H HG22 . VAL A 1 96  ? -30.057 -17.271 15.440  1.00 0.00 ? 96  VAL A HG22 3  
ATOM 4251  H HG23 . VAL A 1 96  ? -29.417 -15.651 15.806  1.00 0.00 ? 96  VAL A HG23 3  
ATOM 4252  N N    . SER A 1 97  ? -34.402 -17.664 17.108  1.00 0.00 ? 97  SER A N    3  
ATOM 4253  C CA   . SER A 1 97  ? -35.708 -17.588 17.740  1.00 0.00 ? 97  SER A CA   3  
ATOM 4254  C C    . SER A 1 97  ? -35.589 -17.917 19.230  1.00 0.00 ? 97  SER A C    3  
ATOM 4255  O O    . SER A 1 97  ? -35.036 -18.952 19.598  1.00 0.00 ? 97  SER A O    3  
ATOM 4256  C CB   . SER A 1 97  ? -36.702 -18.535 17.066  1.00 0.00 ? 97  SER A CB   3  
ATOM 4257  O OG   . SER A 1 97  ? -38.028 -18.013 17.075  1.00 0.00 ? 97  SER A OG   3  
ATOM 4258  H H    . SER A 1 97  ? -34.032 -18.589 17.013  1.00 0.00 ? 97  SER A H    3  
ATOM 4259  H HA   . SER A 1 97  ? -36.036 -16.558 17.601  1.00 0.00 ? 97  SER A HA   3  
ATOM 4260  H HB2  . SER A 1 97  ? -36.391 -18.715 16.037  1.00 0.00 ? 97  SER A HB2  3  
ATOM 4261  H HB3  . SER A 1 97  ? -36.689 -19.499 17.576  1.00 0.00 ? 97  SER A HB3  3  
ATOM 4262  H HG   . SER A 1 97  ? -38.604 -18.530 16.443  1.00 0.00 ? 97  SER A HG   3  
ATOM 4263  N N    . SER A 1 98  ? -36.116 -17.016 20.046  1.00 0.00 ? 98  SER A N    3  
ATOM 4264  C CA   . SER A 1 98  ? -36.076 -17.197 21.487  1.00 0.00 ? 98  SER A CA   3  
ATOM 4265  C C    . SER A 1 98  ? -36.544 -18.607 21.850  1.00 0.00 ? 98  SER A C    3  
ATOM 4266  O O    . SER A 1 98  ? -37.734 -18.910 21.770  1.00 0.00 ? 98  SER A O    3  
ATOM 4267  C CB   . SER A 1 98  ? -36.937 -16.151 22.198  1.00 0.00 ? 98  SER A CB   3  
ATOM 4268  O OG   . SER A 1 98  ? -36.483 -15.897 23.524  1.00 0.00 ? 98  SER A OG   3  
ATOM 4269  H H    . SER A 1 98  ? -36.564 -16.176 19.738  1.00 0.00 ? 98  SER A H    3  
ATOM 4270  H HA   . SER A 1 98  ? -35.032 -17.057 21.766  1.00 0.00 ? 98  SER A HA   3  
ATOM 4271  H HB2  . SER A 1 98  ? -36.926 -15.223 21.627  1.00 0.00 ? 98  SER A HB2  3  
ATOM 4272  H HB3  . SER A 1 98  ? -37.972 -16.494 22.229  1.00 0.00 ? 98  SER A HB3  3  
ATOM 4273  H HG   . SER A 1 98  ? -37.103 -16.320 24.185  1.00 0.00 ? 98  SER A HG   3  
ATOM 4274  N N    . GLY A 1 99  ? -35.585 -19.432 22.243  1.00 0.00 ? 99  GLY A N    3  
ATOM 4275  C CA   . GLY A 1 99  ? -35.885 -20.803 22.619  1.00 0.00 ? 99  GLY A CA   3  
ATOM 4276  C C    . GLY A 1 99  ? -35.396 -21.102 24.038  1.00 0.00 ? 99  GLY A C    3  
ATOM 4277  O O    . GLY A 1 99  ? -35.318 -20.203 24.874  1.00 0.00 ? 99  GLY A O    3  
ATOM 4278  H H    . GLY A 1 99  ? -34.620 -19.178 22.306  1.00 0.00 ? 99  GLY A H    3  
ATOM 4279  H HA2  . GLY A 1 99  ? -36.959 -20.975 22.557  1.00 0.00 ? 99  GLY A HA2  3  
ATOM 4280  H HA3  . GLY A 1 99  ? -35.411 -21.489 21.916  1.00 0.00 ? 99  GLY A HA3  3  
ATOM 4281  N N    . PRO A 1 100 ? -35.072 -22.402 24.273  1.00 0.00 ? 100 PRO A N    3  
ATOM 4282  C CA   . PRO A 1 100 ? -34.593 -22.830 25.576  1.00 0.00 ? 100 PRO A CA   3  
ATOM 4283  C C    . PRO A 1 100 ? -33.144 -22.392 25.799  1.00 0.00 ? 100 PRO A C    3  
ATOM 4284  O O    . PRO A 1 100 ? -32.269 -23.224 26.032  1.00 0.00 ? 100 PRO A O    3  
ATOM 4285  C CB   . PRO A 1 100 ? -34.764 -24.340 25.581  1.00 0.00 ? 100 PRO A CB   3  
ATOM 4286  C CG   . PRO A 1 100 ? -34.894 -24.750 24.123  1.00 0.00 ? 100 PRO A CG   3  
ATOM 4287  C CD   . PRO A 1 100 ? -35.151 -23.494 23.307  1.00 0.00 ? 100 PRO A CD   3  
ATOM 4288  H HA   . PRO A 1 100 ? -35.126 -22.394 26.302  1.00 0.00 ? 100 PRO A HA   3  
ATOM 4289  H HB2  . PRO A 1 100 ? -33.910 -24.829 26.050  1.00 0.00 ? 100 PRO A HB2  3  
ATOM 4290  H HB3  . PRO A 1 100 ? -35.648 -24.631 26.149  1.00 0.00 ? 100 PRO A HB3  3  
ATOM 4291  H HG2  . PRO A 1 100 ? -33.985 -25.246 23.784  1.00 0.00 ? 100 PRO A HG2  3  
ATOM 4292  H HG3  . PRO A 1 100 ? -35.711 -25.461 23.998  1.00 0.00 ? 100 PRO A HG3  3  
ATOM 4293  H HD2  . PRO A 1 100 ? -34.411 -23.377 22.516  1.00 0.00 ? 100 PRO A HD2  3  
ATOM 4294  H HD3  . PRO A 1 100 ? -36.129 -23.527 22.827  1.00 0.00 ? 100 PRO A HD3  3  
ATOM 4295  N N    . SER A 1 101 ? -32.936 -21.086 25.721  1.00 0.00 ? 101 SER A N    3  
ATOM 4296  C CA   . SER A 1 101 ? -31.608 -20.527 25.911  1.00 0.00 ? 101 SER A CA   3  
ATOM 4297  C C    . SER A 1 101 ? -31.527 -19.822 27.266  1.00 0.00 ? 101 SER A C    3  
ATOM 4298  O O    . SER A 1 101 ? -32.172 -18.795 27.476  1.00 0.00 ? 101 SER A O    3  
ATOM 4299  C CB   . SER A 1 101 ? -31.253 -19.555 24.785  1.00 0.00 ? 101 SER A CB   3  
ATOM 4300  O OG   . SER A 1 101 ? -30.389 -20.148 23.820  1.00 0.00 ? 101 SER A OG   3  
ATOM 4301  H H    . SER A 1 101 ? -33.653 -20.415 25.531  1.00 0.00 ? 101 SER A H    3  
ATOM 4302  H HA   . SER A 1 101 ? -30.930 -21.379 25.882  1.00 0.00 ? 101 SER A HA   3  
ATOM 4303  H HB2  . SER A 1 101 ? -32.167 -19.218 24.295  1.00 0.00 ? 101 SER A HB2  3  
ATOM 4304  H HB3  . SER A 1 101 ? -30.774 -18.671 25.206  1.00 0.00 ? 101 SER A HB3  3  
ATOM 4305  H HG   . SER A 1 101 ? -30.435 -21.145 23.887  1.00 0.00 ? 101 SER A HG   3  
ATOM 4306  N N    . SER A 1 102 ? -30.729 -20.400 28.152  1.00 0.00 ? 102 SER A N    3  
ATOM 4307  C CA   . SER A 1 102 ? -30.555 -19.840 29.481  1.00 0.00 ? 102 SER A CA   3  
ATOM 4308  C C    . SER A 1 102 ? -29.141 -19.275 29.630  1.00 0.00 ? 102 SER A C    3  
ATOM 4309  O O    . SER A 1 102 ? -28.169 -20.028 29.672  1.00 0.00 ? 102 SER A O    3  
ATOM 4310  C CB   . SER A 1 102 ? -30.824 -20.890 30.561  1.00 0.00 ? 102 SER A CB   3  
ATOM 4311  O OG   . SER A 1 102 ? -32.147 -20.795 31.081  1.00 0.00 ? 102 SER A OG   3  
ATOM 4312  H H    . SER A 1 102 ? -30.208 -21.235 27.974  1.00 0.00 ? 102 SER A H    3  
ATOM 4313  H HA   . SER A 1 102 ? -31.295 -19.043 29.558  1.00 0.00 ? 102 SER A HA   3  
ATOM 4314  H HB2  . SER A 1 102 ? -30.669 -21.886 30.145  1.00 0.00 ? 102 SER A HB2  3  
ATOM 4315  H HB3  . SER A 1 102 ? -30.106 -20.768 31.372  1.00 0.00 ? 102 SER A HB3  3  
ATOM 4316  H HG   . SER A 1 102 ? -32.603 -21.683 31.022  1.00 0.00 ? 102 SER A HG   3  
ATOM 4317  N N    . GLY A 1 103 ? -29.071 -17.954 29.706  1.00 0.00 ? 103 GLY A N    3  
ATOM 4318  C CA   . GLY A 1 103 ? -27.791 -17.280 29.849  1.00 0.00 ? 103 GLY A CA   3  
ATOM 4319  C C    . GLY A 1 103 ? -27.709 -16.539 31.185  1.00 0.00 ? 103 GLY A C    3  
ATOM 4320  O O    . GLY A 1 103 ? -28.436 -15.573 31.409  1.00 0.00 ? 103 GLY A O    3  
ATOM 4321  H H    . GLY A 1 103 ? -29.866 -17.349 29.670  1.00 0.00 ? 103 GLY A H    3  
ATOM 4322  H HA2  . GLY A 1 103 ? -26.983 -18.008 29.782  1.00 0.00 ? 103 GLY A HA2  3  
ATOM 4323  H HA3  . GLY A 1 103 ? -27.654 -16.575 29.029  1.00 0.00 ? 103 GLY A HA3  3  
ATOM 4324  N N    . GLY A 1 1   ? -2.499  -13.813 25.073  1.00 0.00 ? 1   GLY A N    4  
ATOM 4325  C CA   . GLY A 1 1   ? -2.232  -12.474 24.574  1.00 0.00 ? 1   GLY A CA   4  
ATOM 4326  C C    . GLY A 1 1   ? -3.358  -11.512 24.956  1.00 0.00 ? 1   GLY A C    4  
ATOM 4327  O O    . GLY A 1 1   ? -4.226  -11.853 25.758  1.00 0.00 ? 1   GLY A O    4  
ATOM 4328  H H1   . GLY A 1 1   ? -3.384  -14.194 24.807  1.00 0.00 ? 1   GLY A H1   4  
ATOM 4329  H HA2  . GLY A 1 1   ? -1.287  -12.113 24.979  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 4330  H HA3  . GLY A 1 1   ? -2.125  -12.502 23.490  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 4331  N N    . SER A 1 2   ? -3.308  -10.328 24.364  1.00 0.00 ? 2   SER A N    4  
ATOM 4332  C CA   . SER A 1 2   ? -4.313  -9.313  24.633  1.00 0.00 ? 2   SER A CA   4  
ATOM 4333  C C    . SER A 1 2   ? -5.021  -8.922  23.334  1.00 0.00 ? 2   SER A C    4  
ATOM 4334  O O    . SER A 1 2   ? -4.380  -8.480  22.382  1.00 0.00 ? 2   SER A O    4  
ATOM 4335  C CB   . SER A 1 2   ? -3.689  -8.080  25.289  1.00 0.00 ? 2   SER A CB   4  
ATOM 4336  O OG   . SER A 1 2   ? -4.657  -7.300  25.987  1.00 0.00 ? 2   SER A OG   4  
ATOM 4337  H H    . SER A 1 2   ? -2.599  -10.058 23.713  1.00 0.00 ? 2   SER A H    4  
ATOM 4338  H HA   . SER A 1 2   ? -5.014  -9.778  25.326  1.00 0.00 ? 2   SER A HA   4  
ATOM 4339  H HB2  . SER A 1 2   ? -2.908  -8.394  25.982  1.00 0.00 ? 2   SER A HB2  4  
ATOM 4340  H HB3  . SER A 1 2   ? -3.211  -7.466  24.526  1.00 0.00 ? 2   SER A HB3  4  
ATOM 4341  H HG   . SER A 1 2   ? -5.578  -7.621  25.767  1.00 0.00 ? 2   SER A HG   4  
ATOM 4342  N N    . SER A 1 3   ? -6.335  -9.099  23.337  1.00 0.00 ? 3   SER A N    4  
ATOM 4343  C CA   . SER A 1 3   ? -7.137  -8.770  22.172  1.00 0.00 ? 3   SER A CA   4  
ATOM 4344  C C    . SER A 1 3   ? -7.141  -7.256  21.949  1.00 0.00 ? 3   SER A C    4  
ATOM 4345  O O    . SER A 1 3   ? -6.893  -6.488  22.878  1.00 0.00 ? 3   SER A O    4  
ATOM 4346  C CB   . SER A 1 3   ? -8.568  -9.288  22.324  1.00 0.00 ? 3   SER A CB   4  
ATOM 4347  O OG   . SER A 1 3   ? -8.650  -10.698 22.132  1.00 0.00 ? 3   SER A OG   4  
ATOM 4348  H H    . SER A 1 3   ? -6.848  -9.459  24.116  1.00 0.00 ? 3   SER A H    4  
ATOM 4349  H HA   . SER A 1 3   ? -6.655  -9.278  21.337  1.00 0.00 ? 3   SER A HA   4  
ATOM 4350  H HB2  . SER A 1 3   ? -8.942  -9.035  23.317  1.00 0.00 ? 3   SER A HB2  4  
ATOM 4351  H HB3  . SER A 1 3   ? -9.214  -8.786  21.604  1.00 0.00 ? 3   SER A HB3  4  
ATOM 4352  H HG   . SER A 1 3   ? -8.430  -10.927 21.184  1.00 0.00 ? 3   SER A HG   4  
ATOM 4353  N N    . GLY A 1 4   ? -7.425  -6.873  20.713  1.00 0.00 ? 4   GLY A N    4  
ATOM 4354  C CA   . GLY A 1 4   ? -7.465  -5.464  20.358  1.00 0.00 ? 4   GLY A CA   4  
ATOM 4355  C C    . GLY A 1 4   ? -8.591  -5.182  19.361  1.00 0.00 ? 4   GLY A C    4  
ATOM 4356  O O    . GLY A 1 4   ? -9.752  -5.492  19.627  1.00 0.00 ? 4   GLY A O    4  
ATOM 4357  H H    . GLY A 1 4   ? -7.625  -7.504  19.964  1.00 0.00 ? 4   GLY A H    4  
ATOM 4358  H HA2  . GLY A 1 4   ? -7.609  -4.863  21.255  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 4359  H HA3  . GLY A 1 4   ? -6.509  -5.168  19.925  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 4360  N N    . SER A 1 5   ? -8.210  -4.596  18.236  1.00 0.00 ? 5   SER A N    4  
ATOM 4361  C CA   . SER A 1 5   ? -9.173  -4.269  17.199  1.00 0.00 ? 5   SER A CA   4  
ATOM 4362  C C    . SER A 1 5   ? -8.826  -5.014  15.908  1.00 0.00 ? 5   SER A C    4  
ATOM 4363  O O    . SER A 1 5   ? -9.644  -5.769  15.384  1.00 0.00 ? 5   SER A O    4  
ATOM 4364  C CB   . SER A 1 5   ? -9.218  -2.761  16.945  1.00 0.00 ? 5   SER A CB   4  
ATOM 4365  O OG   . SER A 1 5   ? -10.161 -2.105  17.790  1.00 0.00 ? 5   SER A OG   4  
ATOM 4366  H H    . SER A 1 5   ? -7.264  -4.347  18.028  1.00 0.00 ? 5   SER A H    4  
ATOM 4367  H HA   . SER A 1 5   ? -10.137 -4.601  17.585  1.00 0.00 ? 5   SER A HA   4  
ATOM 4368  H HB2  . SER A 1 5   ? -8.228  -2.336  17.110  1.00 0.00 ? 5   SER A HB2  4  
ATOM 4369  H HB3  . SER A 1 5   ? -9.475  -2.576  15.903  1.00 0.00 ? 5   SER A HB3  4  
ATOM 4370  H HG   . SER A 1 5   ? -10.678 -1.429  17.265  1.00 0.00 ? 5   SER A HG   4  
ATOM 4371  N N    . SER A 1 6   ? -7.613  -4.775  15.433  1.00 0.00 ? 6   SER A N    4  
ATOM 4372  C CA   . SER A 1 6   ? -7.148  -5.414  14.213  1.00 0.00 ? 6   SER A CA   4  
ATOM 4373  C C    . SER A 1 6   ? -5.751  -5.998  14.429  1.00 0.00 ? 6   SER A C    4  
ATOM 4374  O O    . SER A 1 6   ? -5.612  -7.155  14.824  1.00 0.00 ? 6   SER A O    4  
ATOM 4375  C CB   . SER A 1 6   ? -7.136  -4.427  13.044  1.00 0.00 ? 6   SER A CB   4  
ATOM 4376  O OG   . SER A 1 6   ? -8.257  -4.606  12.183  1.00 0.00 ? 6   SER A OG   4  
ATOM 4377  H H    . SER A 1 6   ? -6.954  -4.159  15.865  1.00 0.00 ? 6   SER A H    4  
ATOM 4378  H HA   . SER A 1 6   ? -7.867  -6.207  14.011  1.00 0.00 ? 6   SER A HA   4  
ATOM 4379  H HB2  . SER A 1 6   ? -7.135  -3.407  13.431  1.00 0.00 ? 6   SER A HB2  4  
ATOM 4380  H HB3  . SER A 1 6   ? -6.217  -4.552  12.473  1.00 0.00 ? 6   SER A HB3  4  
ATOM 4381  H HG   . SER A 1 6   ? -8.427  -3.768  11.664  1.00 0.00 ? 6   SER A HG   4  
ATOM 4382  N N    . GLY A 1 7   ? -4.751  -5.172  14.159  1.00 0.00 ? 7   GLY A N    4  
ATOM 4383  C CA   . GLY A 1 7   ? -3.369  -5.592  14.319  1.00 0.00 ? 7   GLY A CA   4  
ATOM 4384  C C    . GLY A 1 7   ? -2.453  -4.846  13.346  1.00 0.00 ? 7   GLY A C    4  
ATOM 4385  O O    . GLY A 1 7   ? -2.694  -4.844  12.140  1.00 0.00 ? 7   GLY A O    4  
ATOM 4386  H H    . GLY A 1 7   ? -4.872  -4.233  13.838  1.00 0.00 ? 7   GLY A H    4  
ATOM 4387  H HA2  . GLY A 1 7   ? -3.045  -5.408  15.343  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 4388  H HA3  . GLY A 1 7   ? -3.290  -6.666  14.148  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 4389  N N    . SER A 1 8   ? -1.422  -4.232  13.907  1.00 0.00 ? 8   SER A N    4  
ATOM 4390  C CA   . SER A 1 8   ? -0.469  -3.484  13.104  1.00 0.00 ? 8   SER A CA   4  
ATOM 4391  C C    . SER A 1 8   ? 0.743   -4.360  12.780  1.00 0.00 ? 8   SER A C    4  
ATOM 4392  O O    . SER A 1 8   ? 1.052   -5.295  13.517  1.00 0.00 ? 8   SER A O    4  
ATOM 4393  C CB   . SER A 1 8   ? -0.025  -2.208  13.823  1.00 0.00 ? 8   SER A CB   4  
ATOM 4394  O OG   . SER A 1 8   ? 0.177   -2.423  15.217  1.00 0.00 ? 8   SER A OG   4  
ATOM 4395  H H    . SER A 1 8   ? -1.234  -4.239  14.889  1.00 0.00 ? 8   SER A H    4  
ATOM 4396  H HA   . SER A 1 8   ? -1.005  -3.220  12.193  1.00 0.00 ? 8   SER A HA   4  
ATOM 4397  H HB2  . SER A 1 8   ? 0.898   -1.842  13.374  1.00 0.00 ? 8   SER A HB2  4  
ATOM 4398  H HB3  . SER A 1 8   ? -0.777  -1.432  13.681  1.00 0.00 ? 8   SER A HB3  4  
ATOM 4399  H HG   . SER A 1 8   ? 0.500   -3.356  15.375  1.00 0.00 ? 8   SER A HG   4  
ATOM 4400  N N    . VAL A 1 9   ? 1.397   -4.025  11.678  1.00 0.00 ? 9   VAL A N    4  
ATOM 4401  C CA   . VAL A 1 9   ? 2.568   -4.769  11.247  1.00 0.00 ? 9   VAL A CA   4  
ATOM 4402  C C    . VAL A 1 9   ? 3.759   -3.815  11.132  1.00 0.00 ? 9   VAL A C    4  
ATOM 4403  O O    . VAL A 1 9   ? 3.582   -2.599  11.078  1.00 0.00 ? 9   VAL A O    4  
ATOM 4404  C CB   . VAL A 1 9   ? 2.267   -5.510  9.943   1.00 0.00 ? 9   VAL A CB   4  
ATOM 4405  C CG1  . VAL A 1 9   ? 1.389   -4.662  9.021   1.00 0.00 ? 9   VAL A CG1  4  
ATOM 4406  C CG2  . VAL A 1 9   ? 3.560   -5.926  9.238   1.00 0.00 ? 9   VAL A CG2  4  
ATOM 4407  H H    . VAL A 1 9   ? 1.139   -3.262  11.085  1.00 0.00 ? 9   VAL A H    4  
ATOM 4408  H HA   . VAL A 1 9   ? 2.786   -5.512  12.015  1.00 0.00 ? 9   VAL A HA   4  
ATOM 4409  H HB   . VAL A 1 9   ? 1.715   -6.416  10.192  1.00 0.00 ? 9   VAL A HB   4  
ATOM 4410  H HG11 . VAL A 1 9   ? 0.346   -4.761  9.321   1.00 0.00 ? 9   VAL A HG11 4  
ATOM 4411  H HG12 . VAL A 1 9   ? 1.690   -3.617  9.093   1.00 0.00 ? 9   VAL A HG12 4  
ATOM 4412  H HG13 . VAL A 1 9   ? 1.506   -5.004  7.992   1.00 0.00 ? 9   VAL A HG13 4  
ATOM 4413  H HG21 . VAL A 1 9   ? 4.124   -6.600  9.883   1.00 0.00 ? 9   VAL A HG21 4  
ATOM 4414  H HG22 . VAL A 1 9   ? 3.317   -6.435  8.305   1.00 0.00 ? 9   VAL A HG22 4  
ATOM 4415  H HG23 . VAL A 1 9   ? 4.159   -5.041  9.025   1.00 0.00 ? 9   VAL A HG23 4  
ATOM 4416  N N    . SER A 1 10  ? 4.946   -4.403  11.099  1.00 0.00 ? 10  SER A N    4  
ATOM 4417  C CA   . SER A 1 10  ? 6.166   -3.621  10.991  1.00 0.00 ? 10  SER A CA   4  
ATOM 4418  C C    . SER A 1 10  ? 7.078   -4.219  9.918   1.00 0.00 ? 10  SER A C    4  
ATOM 4419  O O    . SER A 1 10  ? 7.548   -5.347  10.056  1.00 0.00 ? 10  SER A O    4  
ATOM 4420  C CB   . SER A 1 10  ? 6.898   -3.554  12.333  1.00 0.00 ? 10  SER A CB   4  
ATOM 4421  O OG   . SER A 1 10  ? 8.099   -2.792  12.249  1.00 0.00 ? 10  SER A OG   4  
ATOM 4422  H H    . SER A 1 10  ? 5.081   -5.393  11.144  1.00 0.00 ? 10  SER A H    4  
ATOM 4423  H HA   . SER A 1 10  ? 5.843   -2.620  10.705  1.00 0.00 ? 10  SER A HA   4  
ATOM 4424  H HB2  . SER A 1 10  ? 6.241   -3.114  13.083  1.00 0.00 ? 10  SER A HB2  4  
ATOM 4425  H HB3  . SER A 1 10  ? 7.132   -4.565  12.669  1.00 0.00 ? 10  SER A HB3  4  
ATOM 4426  H HG   . SER A 1 10  ? 8.786   -3.294  11.724  1.00 0.00 ? 10  SER A HG   4  
ATOM 4427  N N    . LEU A 1 11  ? 7.301   -3.435  8.873   1.00 0.00 ? 11  LEU A N    4  
ATOM 4428  C CA   . LEU A 1 11  ? 8.148   -3.873  7.777   1.00 0.00 ? 11  LEU A CA   4  
ATOM 4429  C C    . LEU A 1 11  ? 9.504   -3.171  7.874   1.00 0.00 ? 11  LEU A C    4  
ATOM 4430  O O    . LEU A 1 11  ? 9.590   -2.045  8.361   1.00 0.00 ? 11  LEU A O    4  
ATOM 4431  C CB   . LEU A 1 11  ? 7.441   -3.663  6.436   1.00 0.00 ? 11  LEU A CB   4  
ATOM 4432  C CG   . LEU A 1 11  ? 5.950   -4.005  6.403   1.00 0.00 ? 11  LEU A CG   4  
ATOM 4433  C CD1  . LEU A 1 11  ? 5.339   -3.661  5.043   1.00 0.00 ? 11  LEU A CD1  4  
ATOM 4434  C CD2  . LEU A 1 11  ? 5.715   -5.468  6.784   1.00 0.00 ? 11  LEU A CD2  4  
ATOM 4435  H H    . LEU A 1 11  ? 6.914   -2.519  8.768   1.00 0.00 ? 11  LEU A H    4  
ATOM 4436  H HA   . LEU A 1 11  ? 8.305   -4.946  7.894   1.00 0.00 ? 11  LEU A HA   4  
ATOM 4437  H HB2  . LEU A 1 11  ? 7.561   -2.620  6.145   1.00 0.00 ? 11  LEU A HB2  4  
ATOM 4438  H HB3  . LEU A 1 11  ? 7.949   -4.265  5.682   1.00 0.00 ? 11  LEU A HB3  4  
ATOM 4439  H HG   . LEU A 1 11  ? 5.443   -3.393  7.148   1.00 0.00 ? 11  LEU A HG   4  
ATOM 4440  H HD11 . LEU A 1 11  ? 4.507   -4.335  4.838   1.00 0.00 ? 11  LEU A HD11 4  
ATOM 4441  H HD12 . LEU A 1 11  ? 4.978   -2.632  5.057   1.00 0.00 ? 11  LEU A HD12 4  
ATOM 4442  H HD13 . LEU A 1 11  ? 6.096   -3.770  4.267   1.00 0.00 ? 11  LEU A HD13 4  
ATOM 4443  H HD21 . LEU A 1 11  ? 4.643   -5.663  6.830   1.00 0.00 ? 11  LEU A HD21 4  
ATOM 4444  H HD22 . LEU A 1 11  ? 6.170   -6.116  6.035   1.00 0.00 ? 11  LEU A HD22 4  
ATOM 4445  H HD23 . LEU A 1 11  ? 6.163   -5.667  7.757   1.00 0.00 ? 11  LEU A HD23 4  
ATOM 4446  N N    . VAL A 1 12  ? 10.529  -3.866  7.403   1.00 0.00 ? 12  VAL A N    4  
ATOM 4447  C CA   . VAL A 1 12  ? 11.877  -3.323  7.431   1.00 0.00 ? 12  VAL A CA   4  
ATOM 4448  C C    . VAL A 1 12  ? 12.390  -3.169  5.998   1.00 0.00 ? 12  VAL A C    4  
ATOM 4449  O O    . VAL A 1 12  ? 12.706  -4.159  5.339   1.00 0.00 ? 12  VAL A O    4  
ATOM 4450  C CB   . VAL A 1 12  ? 12.778  -4.204  8.298   1.00 0.00 ? 12  VAL A CB   4  
ATOM 4451  C CG1  . VAL A 1 12  ? 12.718  -5.664  7.844   1.00 0.00 ? 12  VAL A CG1  4  
ATOM 4452  C CG2  . VAL A 1 12  ? 14.218  -3.688  8.293   1.00 0.00 ? 12  VAL A CG2  4  
ATOM 4453  H H    . VAL A 1 12  ? 10.451  -4.781  7.009   1.00 0.00 ? 12  VAL A H    4  
ATOM 4454  H HA   . VAL A 1 12  ? 11.824  -2.337  7.893   1.00 0.00 ? 12  VAL A HA   4  
ATOM 4455  H HB   . VAL A 1 12  ? 12.409  -4.156  9.322   1.00 0.00 ? 12  VAL A HB   4  
ATOM 4456  H HG11 . VAL A 1 12  ? 13.718  -6.095  7.872   1.00 0.00 ? 12  VAL A HG11 4  
ATOM 4457  H HG12 . VAL A 1 12  ? 12.062  -6.225  8.510   1.00 0.00 ? 12  VAL A HG12 4  
ATOM 4458  H HG13 . VAL A 1 12  ? 12.330  -5.712  6.826   1.00 0.00 ? 12  VAL A HG13 4  
ATOM 4459  H HG21 . VAL A 1 12  ? 14.891  -4.486  8.607   1.00 0.00 ? 12  VAL A HG21 4  
ATOM 4460  H HG22 . VAL A 1 12  ? 14.484  -3.363  7.287   1.00 0.00 ? 12  VAL A HG22 4  
ATOM 4461  H HG23 . VAL A 1 12  ? 14.305  -2.847  8.981   1.00 0.00 ? 12  VAL A HG23 4  
ATOM 4462  N N    . GLY A 1 13  ? 12.456  -1.922  5.558   1.00 0.00 ? 13  GLY A N    4  
ATOM 4463  C CA   . GLY A 1 13  ? 12.925  -1.626  4.214   1.00 0.00 ? 13  GLY A CA   4  
ATOM 4464  C C    . GLY A 1 13  ? 13.017  -0.116  3.986   1.00 0.00 ? 13  GLY A C    4  
ATOM 4465  O O    . GLY A 1 13  ? 12.333  0.659   4.652   1.00 0.00 ? 13  GLY A O    4  
ATOM 4466  H H    . GLY A 1 13  ? 12.196  -1.123  6.100   1.00 0.00 ? 13  GLY A H    4  
ATOM 4467  H HA2  . GLY A 1 13  ? 13.903  -2.081  4.059   1.00 0.00 ? 13  GLY A HA2  4  
ATOM 4468  H HA3  . GLY A 1 13  ? 12.248  -2.068  3.483   1.00 0.00 ? 13  GLY A HA3  4  
ATOM 4469  N N    . PRO A 1 14  ? 13.891  0.266   3.016   1.00 0.00 ? 14  PRO A N    4  
ATOM 4470  C CA   . PRO A 1 14  ? 14.081  1.670   2.691   1.00 0.00 ? 14  PRO A CA   4  
ATOM 4471  C C    . PRO A 1 14  ? 12.898  2.211   1.887   1.00 0.00 ? 14  PRO A C    4  
ATOM 4472  O O    . PRO A 1 14  ? 12.822  3.409   1.617   1.00 0.00 ? 14  PRO A O    4  
ATOM 4473  C CB   . PRO A 1 14  ? 15.393  1.722   1.926   1.00 0.00 ? 14  PRO A CB   4  
ATOM 4474  C CG   . PRO A 1 14  ? 15.654  0.303   1.448   1.00 0.00 ? 14  PRO A CG   4  
ATOM 4475  C CD   . PRO A 1 14  ? 14.718  -0.624  2.207   1.00 0.00 ? 14  PRO A CD   4  
ATOM 4476  H HA   . PRO A 1 14  ? 14.117  2.218   3.527   1.00 0.00 ? 14  PRO A HA   4  
ATOM 4477  H HB2  . PRO A 1 14  ? 15.328  2.411   1.085   1.00 0.00 ? 14  PRO A HB2  4  
ATOM 4478  H HB3  . PRO A 1 14  ? 16.204  2.074   2.564   1.00 0.00 ? 14  PRO A HB3  4  
ATOM 4479  H HG2  . PRO A 1 14  ? 15.482  0.224   0.375   1.00 0.00 ? 14  PRO A HG2  4  
ATOM 4480  H HG3  . PRO A 1 14  ? 16.693  0.025   1.626   1.00 0.00 ? 14  PRO A HG3  4  
ATOM 4481  H HD2  . PRO A 1 14  ? 14.110  -1.218  1.525   1.00 0.00 ? 14  PRO A HD2  4  
ATOM 4482  H HD3  . PRO A 1 14  ? 15.273  -1.324  2.831   1.00 0.00 ? 14  PRO A HD3  4  
ATOM 4483  N N    . ALA A 1 15  ? 12.004  1.303   1.526   1.00 0.00 ? 15  ALA A N    4  
ATOM 4484  C CA   . ALA A 1 15  ? 10.828  1.675   0.757   1.00 0.00 ? 15  ALA A CA   4  
ATOM 4485  C C    . ALA A 1 15  ? 10.229  0.423   0.112   1.00 0.00 ? 15  ALA A C    4  
ATOM 4486  O O    . ALA A 1 15  ? 9.029   0.175   0.228   1.00 0.00 ? 15  ALA A O    4  
ATOM 4487  C CB   . ALA A 1 15  ? 11.207  2.738   -0.276  1.00 0.00 ? 15  ALA A CB   4  
ATOM 4488  H H    . ALA A 1 15  ? 12.072  0.331   1.749   1.00 0.00 ? 15  ALA A H    4  
ATOM 4489  H HA   . ALA A 1 15  ? 10.101  2.101   1.449   1.00 0.00 ? 15  ALA A HA   4  
ATOM 4490  H HB1  . ALA A 1 15  ? 10.871  3.716   0.069   1.00 0.00 ? 15  ALA A HB1  4  
ATOM 4491  H HB2  . ALA A 1 15  ? 12.290  2.750   -0.403  1.00 0.00 ? 15  ALA A HB2  4  
ATOM 4492  H HB3  . ALA A 1 15  ? 10.732  2.505   -1.228  1.00 0.00 ? 15  ALA A HB3  4  
ATOM 4493  N N    . PRO A 1 16  ? 11.114  -0.351  -0.570  1.00 0.00 ? 16  PRO A N    4  
ATOM 4494  C CA   . PRO A 1 16  ? 10.685  -1.571  -1.233  1.00 0.00 ? 16  PRO A CA   4  
ATOM 4495  C C    . PRO A 1 16  ? 10.436  -2.689  -0.219  1.00 0.00 ? 16  PRO A C    4  
ATOM 4496  O O    . PRO A 1 16  ? 11.252  -3.598  -0.079  1.00 0.00 ? 16  PRO A O    4  
ATOM 4497  C CB   . PRO A 1 16  ? 11.798  -1.897  -2.215  1.00 0.00 ? 16  PRO A CB   4  
ATOM 4498  C CG   . PRO A 1 16  ? 13.014  -1.117  -1.741  1.00 0.00 ? 16  PRO A CG   4  
ATOM 4499  C CD   . PRO A 1 16  ? 12.541  -0.088  -0.728  1.00 0.00 ? 16  PRO A CD   4  
ATOM 4500  H HA   . PRO A 1 16  ? 9.812   -1.425  -1.698  1.00 0.00 ? 16  PRO A HA   4  
ATOM 4501  H HB2  . PRO A 1 16  ? 12.003  -2.968  -2.232  1.00 0.00 ? 16  PRO A HB2  4  
ATOM 4502  H HB3  . PRO A 1 16  ? 11.521  -1.610  -3.230  1.00 0.00 ? 16  PRO A HB3  4  
ATOM 4503  H HG2  . PRO A 1 16  ? 13.746  -1.788  -1.291  1.00 0.00 ? 16  PRO A HG2  4  
ATOM 4504  H HG3  . PRO A 1 16  ? 13.505  -0.628  -2.582  1.00 0.00 ? 16  PRO A HG3  4  
ATOM 4505  H HD2  . PRO A 1 16  ? 13.070  -0.193  0.219   1.00 0.00 ? 16  PRO A HD2  4  
ATOM 4506  H HD3  . PRO A 1 16  ? 12.720  0.927   -1.082  1.00 0.00 ? 16  PRO A HD3  4  
ATOM 4507  N N    . TRP A 1 17  ? 9.305   -2.584  0.464   1.00 0.00 ? 17  TRP A N    4  
ATOM 4508  C CA   . TRP A 1 17  ? 8.938   -3.575  1.461   1.00 0.00 ? 17  TRP A CA   4  
ATOM 4509  C C    . TRP A 1 17  ? 8.594   -4.875  0.733   1.00 0.00 ? 17  TRP A C    4  
ATOM 4510  O O    . TRP A 1 17  ? 8.704   -5.959  1.304   1.00 0.00 ? 17  TRP A O    4  
ATOM 4511  C CB   . TRP A 1 17  ? 7.799   -3.066  2.346   1.00 0.00 ? 17  TRP A CB   4  
ATOM 4512  C CG   . TRP A 1 17  ? 7.828   -1.556  2.592   1.00 0.00 ? 17  TRP A CG   4  
ATOM 4513  C CD1  . TRP A 1 17  ? 7.258   -0.590  1.859   1.00 0.00 ? 17  TRP A CD1  4  
ATOM 4514  C CD2  . TRP A 1 17  ? 8.488   -0.874  3.679   1.00 0.00 ? 17  TRP A CD2  4  
ATOM 4515  N NE1  . TRP A 1 17  ? 7.500   0.659   2.392   1.00 0.00 ? 17  TRP A NE1  4  
ATOM 4516  C CE2  . TRP A 1 17  ? 8.272   0.481   3.535   1.00 0.00 ? 17  TRP A CE2  4  
ATOM 4517  C CE3  . TRP A 1 17  ? 9.242   -1.386  4.750   1.00 0.00 ? 17  TRP A CE3  4  
ATOM 4518  C CZ2  . TRP A 1 17  ? 8.777   1.437   4.424   1.00 0.00 ? 17  TRP A CZ2  4  
ATOM 4519  C CZ3  . TRP A 1 17  ? 9.739   -0.418  5.630   1.00 0.00 ? 17  TRP A CZ3  4  
ATOM 4520  C CH2  . TRP A 1 17  ? 9.531   0.950   5.499   1.00 0.00 ? 17  TRP A CH2  4  
ATOM 4521  H H    . TRP A 1 17  ? 8.646   -1.841  0.344   1.00 0.00 ? 17  TRP A H    4  
ATOM 4522  H HA   . TRP A 1 17  ? 9.800   -3.728  2.111   1.00 0.00 ? 17  TRP A HA   4  
ATOM 4523  H HB2  . TRP A 1 17  ? 6.848   -3.330  1.884   1.00 0.00 ? 17  TRP A HB2  4  
ATOM 4524  H HB3  . TRP A 1 17  ? 7.841   -3.581  3.307   1.00 0.00 ? 17  TRP A HB3  4  
ATOM 4525  H HD1  . TRP A 1 17  ? 6.675   -0.769  0.955   1.00 0.00 ? 17  TRP A HD1  4  
ATOM 4526  H HE1  . TRP A 1 17  ? 7.151   1.611   1.992   1.00 0.00 ? 17  TRP A HE1  4  
ATOM 4527  H HE3  . TRP A 1 17  ? 9.426   -2.451  4.886   1.00 0.00 ? 17  TRP A HE3  4  
ATOM 4528  H HZ2  . TRP A 1 17  ? 8.592   2.503   4.288   1.00 0.00 ? 17  TRP A HZ2  4  
ATOM 4529  H HZ3  . TRP A 1 17  ? 10.331  -0.761  6.479   1.00 0.00 ? 17  TRP A HZ3  4  
ATOM 4530  H HH2  . TRP A 1 17  ? 9.953   1.641   6.229   1.00 0.00 ? 17  TRP A HH2  4  
ATOM 4531  N N    . GLY A 1 18  ? 8.185   -4.724  -0.519  1.00 0.00 ? 18  GLY A N    4  
ATOM 4532  C CA   . GLY A 1 18  ? 7.824   -5.873  -1.332  1.00 0.00 ? 18  GLY A CA   4  
ATOM 4533  C C    . GLY A 1 18  ? 6.307   -5.967  -1.506  1.00 0.00 ? 18  GLY A C    4  
ATOM 4534  O O    . GLY A 1 18  ? 5.766   -7.057  -1.687  1.00 0.00 ? 18  GLY A O    4  
ATOM 4535  H H    . GLY A 1 18  ? 8.099   -3.839  -0.976  1.00 0.00 ? 18  GLY A H    4  
ATOM 4536  H HA2  . GLY A 1 18  ? 8.302   -5.796  -2.308  1.00 0.00 ? 18  GLY A HA2  4  
ATOM 4537  H HA3  . GLY A 1 18  ? 8.198   -6.785  -0.865  1.00 0.00 ? 18  GLY A HA3  4  
ATOM 4538  N N    . PHE A 1 19  ? 5.664   -4.810  -1.444  1.00 0.00 ? 19  PHE A N    4  
ATOM 4539  C CA   . PHE A 1 19  ? 4.220   -4.748  -1.592  1.00 0.00 ? 19  PHE A CA   4  
ATOM 4540  C C    . PHE A 1 19  ? 3.793   -3.438  -2.257  1.00 0.00 ? 19  PHE A C    4  
ATOM 4541  O O    . PHE A 1 19  ? 4.409   -2.396  -2.037  1.00 0.00 ? 19  PHE A O    4  
ATOM 4542  C CB   . PHE A 1 19  ? 3.622   -4.810  -0.185  1.00 0.00 ? 19  PHE A CB   4  
ATOM 4543  C CG   . PHE A 1 19  ? 3.630   -3.471  0.554   1.00 0.00 ? 19  PHE A CG   4  
ATOM 4544  C CD1  . PHE A 1 19  ? 2.838   -2.453  0.125   1.00 0.00 ? 19  PHE A CD1  4  
ATOM 4545  C CD2  . PHE A 1 19  ? 4.431   -3.298  1.640   1.00 0.00 ? 19  PHE A CD2  4  
ATOM 4546  C CE1  . PHE A 1 19  ? 2.845   -1.209  0.811   1.00 0.00 ? 19  PHE A CE1  4  
ATOM 4547  C CE2  . PHE A 1 19  ? 4.438   -2.055  2.326   1.00 0.00 ? 19  PHE A CE2  4  
ATOM 4548  C CZ   . PHE A 1 19  ? 3.645   -1.037  1.897   1.00 0.00 ? 19  PHE A CZ   4  
ATOM 4549  H H    . PHE A 1 19  ? 6.112   -3.929  -1.296  1.00 0.00 ? 19  PHE A H    4  
ATOM 4550  H HA   . PHE A 1 19  ? 3.923   -5.587  -2.222  1.00 0.00 ? 19  PHE A HA   4  
ATOM 4551  H HB2  . PHE A 1 19  ? 2.596   -5.170  -0.253  1.00 0.00 ? 19  PHE A HB2  4  
ATOM 4552  H HB3  . PHE A 1 19  ? 4.178   -5.541  0.402   1.00 0.00 ? 19  PHE A HB3  4  
ATOM 4553  H HD1  . PHE A 1 19  ? 2.196   -2.591  -0.746  1.00 0.00 ? 19  PHE A HD1  4  
ATOM 4554  H HD2  . PHE A 1 19  ? 5.066   -4.114  1.984   1.00 0.00 ? 19  PHE A HD2  4  
ATOM 4555  H HE1  . PHE A 1 19  ? 2.210   -0.393  0.467   1.00 0.00 ? 19  PHE A HE1  4  
ATOM 4556  H HE2  . PHE A 1 19  ? 5.079   -1.917  3.197   1.00 0.00 ? 19  PHE A HE2  4  
ATOM 4557  H HZ   . PHE A 1 19  ? 3.651   -0.083  2.424   1.00 0.00 ? 19  PHE A HZ   4  
ATOM 4558  N N    . ARG A 1 20  ? 2.741   -3.533  -3.058  1.00 0.00 ? 20  ARG A N    4  
ATOM 4559  C CA   . ARG A 1 20  ? 2.225   -2.369  -3.756  1.00 0.00 ? 20  ARG A CA   4  
ATOM 4560  C C    . ARG A 1 20  ? 0.887   -1.938  -3.153  1.00 0.00 ? 20  ARG A C    4  
ATOM 4561  O O    . ARG A 1 20  ? 0.339   -2.627  -2.293  1.00 0.00 ? 20  ARG A O    4  
ATOM 4562  C CB   . ARG A 1 20  ? 2.034   -2.660  -5.246  1.00 0.00 ? 20  ARG A CB   4  
ATOM 4563  C CG   . ARG A 1 20  ? 3.360   -2.547  -6.001  1.00 0.00 ? 20  ARG A CG   4  
ATOM 4564  C CD   . ARG A 1 20  ? 3.658   -1.093  -6.373  1.00 0.00 ? 20  ARG A CD   4  
ATOM 4565  N NE   . ARG A 1 20  ? 4.546   -1.045  -7.556  1.00 0.00 ? 20  ARG A NE   4  
ATOM 4566  C CZ   . ARG A 1 20  ? 5.262   0.029   -7.915  1.00 0.00 ? 20  ARG A CZ   4  
ATOM 4567  N NH1  . ARG A 1 20  ? 5.198   1.151   -7.185  1.00 0.00 ? 20  ARG A NH1  4  
ATOM 4568  N NH2  . ARG A 1 20  ? 6.041   -0.018  -9.004  1.00 0.00 ? 20  ARG A NH2  4  
ATOM 4569  H H    . ARG A 1 20  ? 2.246   -4.384  -3.232  1.00 0.00 ? 20  ARG A H    4  
ATOM 4570  H HA   . ARG A 1 20  ? 2.984   -1.600  -3.616  1.00 0.00 ? 20  ARG A HA   4  
ATOM 4571  H HB2  . ARG A 1 20  ? 1.622   -3.660  -5.375  1.00 0.00 ? 20  ARG A HB2  4  
ATOM 4572  H HB3  . ARG A 1 20  ? 1.312   -1.961  -5.668  1.00 0.00 ? 20  ARG A HB3  4  
ATOM 4573  H HG2  . ARG A 1 20  ? 4.168   -2.941  -5.384  1.00 0.00 ? 20  ARG A HG2  4  
ATOM 4574  H HG3  . ARG A 1 20  ? 3.322   -3.157  -6.904  1.00 0.00 ? 20  ARG A HG3  4  
ATOM 4575  H HD2  . ARG A 1 20  ? 2.728   -0.566  -6.585  1.00 0.00 ? 20  ARG A HD2  4  
ATOM 4576  H HD3  . ARG A 1 20  ? 4.129   -0.583  -5.533  1.00 0.00 ? 20  ARG A HD3  4  
ATOM 4577  H HE   . ARG A 1 20  ? 4.617   -1.866  -8.123  1.00 0.00 ? 20  ARG A HE   4  
ATOM 4578  H HH11 . ARG A 1 20  ? 4.616   1.187   -6.372  1.00 0.00 ? 20  ARG A HH11 4  
ATOM 4579  H HH12 . ARG A 1 20  ? 5.732   1.953   -7.453  1.00 0.00 ? 20  ARG A HH12 4  
ATOM 4580  H HH21 . ARG A 1 20  ? 6.089   -0.855  -9.549  1.00 0.00 ? 20  ARG A HH21 4  
ATOM 4581  H HH22 . ARG A 1 20  ? 6.575   0.784   -9.272  1.00 0.00 ? 20  ARG A HH22 4  
ATOM 4582  N N    . LEU A 1 21  ? 0.399   -0.801  -3.626  1.00 0.00 ? 21  LEU A N    4  
ATOM 4583  C CA   . LEU A 1 21  ? -0.865  -0.270  -3.144  1.00 0.00 ? 21  LEU A CA   4  
ATOM 4584  C C    . LEU A 1 21  ? -1.741  0.115   -4.338  1.00 0.00 ? 21  LEU A C    4  
ATOM 4585  O O    . LEU A 1 21  ? -1.233  0.357   -5.432  1.00 0.00 ? 21  LEU A O    4  
ATOM 4586  C CB   . LEU A 1 21  ? -0.624  0.879   -2.163  1.00 0.00 ? 21  LEU A CB   4  
ATOM 4587  C CG   . LEU A 1 21  ? 0.041   0.502   -0.837  1.00 0.00 ? 21  LEU A CG   4  
ATOM 4588  C CD1  . LEU A 1 21  ? 0.321   1.745   0.009   1.00 0.00 ? 21  LEU A CD1  4  
ATOM 4589  C CD2  . LEU A 1 21  ? -0.796  -0.531  -0.080  1.00 0.00 ? 21  LEU A CD2  4  
ATOM 4590  H H    . LEU A 1 21  ? 0.851   -0.246  -4.325  1.00 0.00 ? 21  LEU A H    4  
ATOM 4591  H HA   . LEU A 1 21  ? -1.364  -1.066  -2.591  1.00 0.00 ? 21  LEU A HA   4  
ATOM 4592  H HB2  . LEU A 1 21  ? -0.004  1.628   -2.657  1.00 0.00 ? 21  LEU A HB2  4  
ATOM 4593  H HB3  . LEU A 1 21  ? -1.582  1.351   -1.945  1.00 0.00 ? 21  LEU A HB3  4  
ATOM 4594  H HG   . LEU A 1 21  ? 1.002   0.038   -1.057  1.00 0.00 ? 21  LEU A HG   4  
ATOM 4595  H HD11 . LEU A 1 21  ? 1.050   2.375   -0.501  1.00 0.00 ? 21  LEU A HD11 4  
ATOM 4596  H HD12 . LEU A 1 21  ? -0.604  2.303   0.153   1.00 0.00 ? 21  LEU A HD12 4  
ATOM 4597  H HD13 . LEU A 1 21  ? 0.717   1.442   0.979   1.00 0.00 ? 21  LEU A HD13 4  
ATOM 4598  H HD21 . LEU A 1 21  ? -0.893  -1.434  -0.683  1.00 0.00 ? 21  LEU A HD21 4  
ATOM 4599  H HD22 . LEU A 1 21  ? -0.305  -0.775  0.863   1.00 0.00 ? 21  LEU A HD22 4  
ATOM 4600  H HD23 . LEU A 1 21  ? -1.785  -0.121  0.121   1.00 0.00 ? 21  LEU A HD23 4  
ATOM 4601  N N    . GLN A 1 22  ? -3.041  0.158   -4.088  1.00 0.00 ? 22  GLN A N    4  
ATOM 4602  C CA   . GLN A 1 22  ? -3.992  0.509   -5.129  1.00 0.00 ? 22  GLN A CA   4  
ATOM 4603  C C    . GLN A 1 22  ? -5.294  1.021   -4.508  1.00 0.00 ? 22  GLN A C    4  
ATOM 4604  O O    . GLN A 1 22  ? -5.667  0.608   -3.411  1.00 0.00 ? 22  GLN A O    4  
ATOM 4605  C CB   . GLN A 1 22  ? -4.256  -0.681  -6.054  1.00 0.00 ? 22  GLN A CB   4  
ATOM 4606  C CG   . GLN A 1 22  ? -4.883  -1.845  -5.284  1.00 0.00 ? 22  GLN A CG   4  
ATOM 4607  C CD   . GLN A 1 22  ? -5.495  -2.869  -6.242  1.00 0.00 ? 22  GLN A CD   4  
ATOM 4608  O OE1  . GLN A 1 22  ? -6.090  -2.534  -7.253  1.00 0.00 ? 22  GLN A OE1  4  
ATOM 4609  N NE2  . GLN A 1 22  ? -5.316  -4.133  -5.868  1.00 0.00 ? 22  GLN A NE2  4  
ATOM 4610  H H    . GLN A 1 22  ? -3.446  -0.040  -3.195  1.00 0.00 ? 22  GLN A H    4  
ATOM 4611  H HA   . GLN A 1 22  ? -3.516  1.307   -5.699  1.00 0.00 ? 22  GLN A HA   4  
ATOM 4612  H HB2  . GLN A 1 22  ? -4.919  -0.376  -6.863  1.00 0.00 ? 22  GLN A HB2  4  
ATOM 4613  H HB3  . GLN A 1 22  ? -3.322  -1.004  -6.512  1.00 0.00 ? 22  GLN A HB3  4  
ATOM 4614  H HG2  . GLN A 1 22  ? -4.125  -2.327  -4.666  1.00 0.00 ? 22  GLN A HG2  4  
ATOM 4615  H HG3  . GLN A 1 22  ? -5.652  -1.468  -4.610  1.00 0.00 ? 22  GLN A HG3  4  
ATOM 4616  H HE21 . GLN A 1 22  ? -4.818  -4.340  -5.026  1.00 0.00 ? 22  GLN A HE21 4  
ATOM 4617  H HE22 . GLN A 1 22  ? -5.680  -4.876  -6.430  1.00 0.00 ? 22  GLN A HE22 4  
ATOM 4618  N N    . GLY A 1 23  ? -5.949  1.912   -5.237  1.00 0.00 ? 23  GLY A N    4  
ATOM 4619  C CA   . GLY A 1 23  ? -7.201  2.484   -4.771  1.00 0.00 ? 23  GLY A CA   4  
ATOM 4620  C C    . GLY A 1 23  ? -6.978  3.871   -4.165  1.00 0.00 ? 23  GLY A C    4  
ATOM 4621  O O    . GLY A 1 23  ? -5.968  4.517   -4.439  1.00 0.00 ? 23  GLY A O    4  
ATOM 4622  H H    . GLY A 1 23  ? -5.639  2.243   -6.128  1.00 0.00 ? 23  GLY A H    4  
ATOM 4623  H HA2  . GLY A 1 23  ? -7.904  2.555   -5.602  1.00 0.00 ? 23  GLY A HA2  4  
ATOM 4624  H HA3  . GLY A 1 23  ? -7.651  1.827   -4.028  1.00 0.00 ? 23  GLY A HA3  4  
ATOM 4625  N N    . GLY A 1 24  ? -7.939  4.288   -3.353  1.00 0.00 ? 24  GLY A N    4  
ATOM 4626  C CA   . GLY A 1 24  ? -7.860  5.587   -2.706  1.00 0.00 ? 24  GLY A CA   4  
ATOM 4627  C C    . GLY A 1 24  ? -9.106  6.423   -3.002  1.00 0.00 ? 24  GLY A C    4  
ATOM 4628  O O    . GLY A 1 24  ? -10.095 5.908   -3.520  1.00 0.00 ? 24  GLY A O    4  
ATOM 4629  H H    . GLY A 1 24  ? -8.757  3.756   -3.135  1.00 0.00 ? 24  GLY A H    4  
ATOM 4630  H HA2  . GLY A 1 24  ? -7.754  5.455   -1.629  1.00 0.00 ? 24  GLY A HA2  4  
ATOM 4631  H HA3  . GLY A 1 24  ? -6.972  6.116   -3.051  1.00 0.00 ? 24  GLY A HA3  4  
ATOM 4632  N N    . LYS A 1 25  ? -9.017  7.701   -2.661  1.00 0.00 ? 25  LYS A N    4  
ATOM 4633  C CA   . LYS A 1 25  ? -10.125 8.614   -2.885  1.00 0.00 ? 25  LYS A CA   4  
ATOM 4634  C C    . LYS A 1 25  ? -10.273 8.872   -4.386  1.00 0.00 ? 25  LYS A C    4  
ATOM 4635  O O    . LYS A 1 25  ? -11.350 8.683   -4.949  1.00 0.00 ? 25  LYS A O    4  
ATOM 4636  C CB   . LYS A 1 25  ? -9.945  9.887   -2.056  1.00 0.00 ? 25  LYS A CB   4  
ATOM 4637  C CG   . LYS A 1 25  ? -11.295 10.427  -1.579  1.00 0.00 ? 25  LYS A CG   4  
ATOM 4638  C CD   . LYS A 1 25  ? -11.164 11.101  -0.212  1.00 0.00 ? 25  LYS A CD   4  
ATOM 4639  C CE   . LYS A 1 25  ? -11.440 12.603  -0.313  1.00 0.00 ? 25  LYS A CE   4  
ATOM 4640  N NZ   . LYS A 1 25  ? -12.266 13.055  0.828   1.00 0.00 ? 25  LYS A NZ   4  
ATOM 4641  H H    . LYS A 1 25  ? -8.209  8.112   -2.241  1.00 0.00 ? 25  LYS A H    4  
ATOM 4642  H HA   . LYS A 1 25  ? -11.030 8.123   -2.528  1.00 0.00 ? 25  LYS A HA   4  
ATOM 4643  H HB2  . LYS A 1 25  ? -9.308  9.680   -1.197  1.00 0.00 ? 25  LYS A HB2  4  
ATOM 4644  H HB3  . LYS A 1 25  ? -9.437  10.645  -2.653  1.00 0.00 ? 25  LYS A HB3  4  
ATOM 4645  H HG2  . LYS A 1 25  ? -11.683 11.141  -2.306  1.00 0.00 ? 25  LYS A HG2  4  
ATOM 4646  H HG3  . LYS A 1 25  ? -12.015 9.611   -1.518  1.00 0.00 ? 25  LYS A HG3  4  
ATOM 4647  H HD2  . LYS A 1 25  ? -11.861 10.646  0.491   1.00 0.00 ? 25  LYS A HD2  4  
ATOM 4648  H HD3  . LYS A 1 25  ? -10.161 10.939  0.183   1.00 0.00 ? 25  LYS A HD3  4  
ATOM 4649  H HE2  . LYS A 1 25  ? -10.499 13.152  -0.329  1.00 0.00 ? 25  LYS A HE2  4  
ATOM 4650  H HE3  . LYS A 1 25  ? -11.953 12.822  -1.250  1.00 0.00 ? 25  LYS A HE3  4  
ATOM 4651  H HZ1  . LYS A 1 25  ? -11.872 13.889  1.216   1.00 0.00 ? 25  LYS A HZ1  4  
ATOM 4652  H HZ2  . LYS A 1 25  ? -13.197 13.242  0.513   1.00 0.00 ? 25  LYS A HZ2  4  
ATOM 4653  H HZ3  . LYS A 1 25  ? -12.289 12.341  1.528   1.00 0.00 ? 25  LYS A HZ3  4  
ATOM 4654  N N    . ASP A 1 26  ? -9.175  9.301   -4.991  1.00 0.00 ? 26  ASP A N    4  
ATOM 4655  C CA   . ASP A 1 26  ? -9.168  9.587   -6.415  1.00 0.00 ? 26  ASP A CA   4  
ATOM 4656  C C    . ASP A 1 26  ? -9.541  8.320   -7.187  1.00 0.00 ? 26  ASP A C    4  
ATOM 4657  O O    . ASP A 1 26  ? -9.911  8.389   -8.358  1.00 0.00 ? 26  ASP A O    4  
ATOM 4658  C CB   . ASP A 1 26  ? -7.781  10.034  -6.881  1.00 0.00 ? 26  ASP A CB   4  
ATOM 4659  C CG   . ASP A 1 26  ? -7.611  10.138  -8.398  1.00 0.00 ? 26  ASP A CG   4  
ATOM 4660  O OD1  . ASP A 1 26  ? -8.278  11.017  -8.985  1.00 0.00 ? 26  ASP A OD1  4  
ATOM 4661  O OD2  . ASP A 1 26  ? -6.818  9.336   -8.937  1.00 0.00 ? 26  ASP A OD2  4  
ATOM 4662  H H    . ASP A 1 26  ? -8.303  9.452   -4.525  1.00 0.00 ? 26  ASP A H    4  
ATOM 4663  H HA   . ASP A 1 26  ? -9.897  10.387  -6.550  1.00 0.00 ? 26  ASP A HA   4  
ATOM 4664  H HB2  . ASP A 1 26  ? -7.561  11.005  -6.438  1.00 0.00 ? 26  ASP A HB2  4  
ATOM 4665  H HB3  . ASP A 1 26  ? -7.041  9.333   -6.495  1.00 0.00 ? 26  ASP A HB3  4  
ATOM 4666  N N    . PHE A 1 27  ? -9.431  7.193   -6.500  1.00 0.00 ? 27  PHE A N    4  
ATOM 4667  C CA   . PHE A 1 27  ? -9.752  5.912   -7.107  1.00 0.00 ? 27  PHE A CA   4  
ATOM 4668  C C    . PHE A 1 27  ? -11.181 5.486   -6.765  1.00 0.00 ? 27  PHE A C    4  
ATOM 4669  O O    . PHE A 1 27  ? -11.739 4.598   -7.409  1.00 0.00 ? 27  PHE A O    4  
ATOM 4670  C CB   . PHE A 1 27  ? -8.775  4.886   -6.528  1.00 0.00 ? 27  PHE A CB   4  
ATOM 4671  C CG   . PHE A 1 27  ? -7.363  4.973   -7.112  1.00 0.00 ? 27  PHE A CG   4  
ATOM 4672  C CD1  . PHE A 1 27  ? -6.682  6.149   -7.071  1.00 0.00 ? 27  PHE A CD1  4  
ATOM 4673  C CD2  . PHE A 1 27  ? -6.790  3.874   -7.671  1.00 0.00 ? 27  PHE A CD2  4  
ATOM 4674  C CE1  . PHE A 1 27  ? -5.372  6.230   -7.613  1.00 0.00 ? 27  PHE A CE1  4  
ATOM 4675  C CE2  . PHE A 1 27  ? -5.480  3.955   -8.213  1.00 0.00 ? 27  PHE A CE2  4  
ATOM 4676  C CZ   . PHE A 1 27  ? -4.798  5.131   -8.172  1.00 0.00 ? 27  PHE A CZ   4  
ATOM 4677  H H    . PHE A 1 27  ? -9.129  7.145   -5.548  1.00 0.00 ? 27  PHE A H    4  
ATOM 4678  H HA   . PHE A 1 27  ? -9.658  6.033   -8.186  1.00 0.00 ? 27  PHE A HA   4  
ATOM 4679  H HB2  . PHE A 1 27  ? -8.720  5.021   -5.448  1.00 0.00 ? 27  PHE A HB2  4  
ATOM 4680  H HB3  . PHE A 1 27  ? -9.169  3.885   -6.705  1.00 0.00 ? 27  PHE A HB3  4  
ATOM 4681  H HD1  . PHE A 1 27  ? -7.142  7.030   -6.623  1.00 0.00 ? 27  PHE A HD1  4  
ATOM 4682  H HD2  . PHE A 1 27  ? -7.336  2.931   -7.704  1.00 0.00 ? 27  PHE A HD2  4  
ATOM 4683  H HE1  . PHE A 1 27  ? -4.826  7.173   -7.580  1.00 0.00 ? 27  PHE A HE1  4  
ATOM 4684  H HE2  . PHE A 1 27  ? -5.020  3.074   -8.661  1.00 0.00 ? 27  PHE A HE2  4  
ATOM 4685  H HZ   . PHE A 1 27  ? -3.793  5.193   -8.588  1.00 0.00 ? 27  PHE A HZ   4  
ATOM 4686  N N    . ASN A 1 28  ? -11.734 6.140   -5.754  1.00 0.00 ? 28  ASN A N    4  
ATOM 4687  C CA   . ASN A 1 28  ? -13.087 5.840   -5.319  1.00 0.00 ? 28  ASN A CA   4  
ATOM 4688  C C    . ASN A 1 28  ? -13.123 4.439   -4.707  1.00 0.00 ? 28  ASN A C    4  
ATOM 4689  O O    . ASN A 1 28  ? -14.059 3.677   -4.946  1.00 0.00 ? 28  ASN A O    4  
ATOM 4690  C CB   . ASN A 1 28  ? -14.062 5.867   -6.498  1.00 0.00 ? 28  ASN A CB   4  
ATOM 4691  C CG   . ASN A 1 28  ? -15.342 6.622   -6.134  1.00 0.00 ? 28  ASN A CG   4  
ATOM 4692  O OD1  . ASN A 1 28  ? -16.160 6.170   -5.350  1.00 0.00 ? 28  ASN A OD1  4  
ATOM 4693  N ND2  . ASN A 1 28  ? -15.469 7.796   -6.746  1.00 0.00 ? 28  ASN A ND2  4  
ATOM 4694  H H    . ASN A 1 28  ? -11.273 6.861   -5.236  1.00 0.00 ? 28  ASN A H    4  
ATOM 4695  H HA   . ASN A 1 28  ? -13.335 6.618   -4.597  1.00 0.00 ? 28  ASN A HA   4  
ATOM 4696  H HB2  . ASN A 1 28  ? -13.588 6.340   -7.357  1.00 0.00 ? 28  ASN A HB2  4  
ATOM 4697  H HB3  . ASN A 1 28  ? -14.310 4.847   -6.793  1.00 0.00 ? 28  ASN A HB3  4  
ATOM 4698  H HD21 . ASN A 1 28  ? -14.761 8.110   -7.379  1.00 0.00 ? 28  ASN A HD21 4  
ATOM 4699  H HD22 . ASN A 1 28  ? -16.273 8.366   -6.574  1.00 0.00 ? 28  ASN A HD22 4  
ATOM 4700  N N    . MET A 1 29  ? -12.094 4.142   -3.928  1.00 0.00 ? 29  MET A N    4  
ATOM 4701  C CA   . MET A 1 29  ? -11.996 2.845   -3.279  1.00 0.00 ? 29  MET A CA   4  
ATOM 4702  C C    . MET A 1 29  ? -11.004 2.888   -2.115  1.00 0.00 ? 29  MET A C    4  
ATOM 4703  O O    . MET A 1 29  ? -10.217 3.826   -2.000  1.00 0.00 ? 29  MET A O    4  
ATOM 4704  C CB   . MET A 1 29  ? -11.543 1.797   -4.298  1.00 0.00 ? 29  MET A CB   4  
ATOM 4705  C CG   . MET A 1 29  ? -10.017 1.708   -4.351  1.00 0.00 ? 29  MET A CG   4  
ATOM 4706  S SD   . MET A 1 29  ? -9.517  0.528   -5.593  1.00 0.00 ? 29  MET A SD   4  
ATOM 4707  C CE   . MET A 1 29  ? -8.876  -0.770  -4.549  1.00 0.00 ? 29  MET A CE   4  
ATOM 4708  H H    . MET A 1 29  ? -11.337 4.767   -3.738  1.00 0.00 ? 29  MET A H    4  
ATOM 4709  H HA   . MET A 1 29  ? -12.997 2.629   -2.905  1.00 0.00 ? 29  MET A HA   4  
ATOM 4710  H HB2  . MET A 1 29  ? -11.959 0.825   -4.034  1.00 0.00 ? 29  MET A HB2  4  
ATOM 4711  H HB3  . MET A 1 29  ? -11.930 2.053   -5.284  1.00 0.00 ? 29  MET A HB3  4  
ATOM 4712  H HG2  . MET A 1 29  ? -9.594  2.687   -4.576  1.00 0.00 ? 29  MET A HG2  4  
ATOM 4713  H HG3  . MET A 1 29  ? -9.628  1.409   -3.377  1.00 0.00 ? 29  MET A HG3  4  
ATOM 4714  H HE1  . MET A 1 29  ? -7.805  -0.878  -4.719  1.00 0.00 ? 29  MET A HE1  4  
ATOM 4715  H HE2  . MET A 1 29  ? -9.054  -0.517  -3.504  1.00 0.00 ? 29  MET A HE2  4  
ATOM 4716  H HE3  . MET A 1 29  ? -9.378  -1.708  -4.786  1.00 0.00 ? 29  MET A HE3  4  
ATOM 4717  N N    . PRO A 1 30  ? -11.076 1.833   -1.259  1.00 0.00 ? 30  PRO A N    4  
ATOM 4718  C CA   . PRO A 1 30  ? -10.194 1.742   -0.108  1.00 0.00 ? 30  PRO A CA   4  
ATOM 4719  C C    . PRO A 1 30  ? -8.779  1.345   -0.532  1.00 0.00 ? 30  PRO A C    4  
ATOM 4720  O O    . PRO A 1 30  ? -8.589  0.746   -1.590  1.00 0.00 ? 30  PRO A O    4  
ATOM 4721  C CB   . PRO A 1 30  ? -10.848 0.720   0.808   1.00 0.00 ? 30  PRO A CB   4  
ATOM 4722  C CG   . PRO A 1 30  ? -11.818 -0.061  -0.063  1.00 0.00 ? 30  PRO A CG   4  
ATOM 4723  C CD   . PRO A 1 30  ? -11.996 0.704   -1.364  1.00 0.00 ? 30  PRO A CD   4  
ATOM 4724  H HA   . PRO A 1 30  ? -10.107 2.634   0.334   1.00 0.00 ? 30  PRO A HA   4  
ATOM 4725  H HB2  . PRO A 1 30  ? -10.103 0.060   1.252   1.00 0.00 ? 30  PRO A HB2  4  
ATOM 4726  H HB3  . PRO A 1 30  ? -11.370 1.210   1.630   1.00 0.00 ? 30  PRO A HB3  4  
ATOM 4727  H HG2  . PRO A 1 30  ? -11.434 -1.062  -0.259  1.00 0.00 ? 30  PRO A HG2  4  
ATOM 4728  H HG3  . PRO A 1 30  ? -12.775 -0.181  0.443   1.00 0.00 ? 30  PRO A HG3  4  
ATOM 4729  H HD2  . PRO A 1 30  ? -11.760 0.081   -2.227  1.00 0.00 ? 30  PRO A HD2  4  
ATOM 4730  H HD3  . PRO A 1 30  ? -13.025 1.042   -1.487  1.00 0.00 ? 30  PRO A HD3  4  
ATOM 4731  N N    . LEU A 1 31  ? -7.822  1.695   0.315   1.00 0.00 ? 31  LEU A N    4  
ATOM 4732  C CA   . LEU A 1 31  ? -6.429  1.383   0.041   1.00 0.00 ? 31  LEU A CA   4  
ATOM 4733  C C    . LEU A 1 31  ? -6.186  -0.107  0.293   1.00 0.00 ? 31  LEU A C    4  
ATOM 4734  O O    . LEU A 1 31  ? -6.339  -0.583  1.417   1.00 0.00 ? 31  LEU A O    4  
ATOM 4735  C CB   . LEU A 1 31  ? -5.506  2.301   0.844   1.00 0.00 ? 31  LEU A CB   4  
ATOM 4736  C CG   . LEU A 1 31  ? -5.403  3.746   0.352   1.00 0.00 ? 31  LEU A CG   4  
ATOM 4737  C CD1  . LEU A 1 31  ? -5.405  4.727   1.525   1.00 0.00 ? 31  LEU A CD1  4  
ATOM 4738  C CD2  . LEU A 1 31  ? -4.181  3.932   -0.550  1.00 0.00 ? 31  LEU A CD2  4  
ATOM 4739  H H    . LEU A 1 31  ? -7.985  2.182   1.173   1.00 0.00 ? 31  LEU A H    4  
ATOM 4740  H HA   . LEU A 1 31  ? -6.250  1.588   -1.014  1.00 0.00 ? 31  LEU A HA   4  
ATOM 4741  H HB2  . LEU A 1 31  ? -5.850  2.314   1.879   1.00 0.00 ? 31  LEU A HB2  4  
ATOM 4742  H HB3  . LEU A 1 31  ? -4.507  1.867   0.846   1.00 0.00 ? 31  LEU A HB3  4  
ATOM 4743  H HG   . LEU A 1 31  ? -6.284  3.965   -0.252  1.00 0.00 ? 31  LEU A HG   4  
ATOM 4744  H HD11 . LEU A 1 31  ? -5.246  4.181   2.455   1.00 0.00 ? 31  LEU A HD11 4  
ATOM 4745  H HD12 . LEU A 1 31  ? -4.606  5.456   1.391   1.00 0.00 ? 31  LEU A HD12 4  
ATOM 4746  H HD13 . LEU A 1 31  ? -6.364  5.243   1.567   1.00 0.00 ? 31  LEU A HD13 4  
ATOM 4747  H HD21 . LEU A 1 31  ? -4.127  4.970   -0.878  1.00 0.00 ? 31  LEU A HD21 4  
ATOM 4748  H HD22 . LEU A 1 31  ? -3.278  3.679   0.006   1.00 0.00 ? 31  LEU A HD22 4  
ATOM 4749  H HD23 . LEU A 1 31  ? -4.268  3.280   -1.419  1.00 0.00 ? 31  LEU A HD23 4  
ATOM 4750  N N    . THR A 1 32  ? -5.811  -0.801  -0.772  1.00 0.00 ? 32  THR A N    4  
ATOM 4751  C CA   . THR A 1 32  ? -5.545  -2.226  -0.680  1.00 0.00 ? 32  THR A CA   4  
ATOM 4752  C C    . THR A 1 32  ? -4.148  -2.544  -1.219  1.00 0.00 ? 32  THR A C    4  
ATOM 4753  O O    . THR A 1 32  ? -3.515  -1.699  -1.849  1.00 0.00 ? 32  THR A O    4  
ATOM 4754  C CB   . THR A 1 32  ? -6.663  -2.964  -1.418  1.00 0.00 ? 32  THR A CB   4  
ATOM 4755  O OG1  . THR A 1 32  ? -7.092  -2.039  -2.414  1.00 0.00 ? 32  THR A OG1  4  
ATOM 4756  C CG2  . THR A 1 32  ? -7.902  -3.174  -0.546  1.00 0.00 ? 32  THR A CG2  4  
ATOM 4757  H H    . THR A 1 32  ? -5.689  -0.406  -1.682  1.00 0.00 ? 32  THR A H    4  
ATOM 4758  H HA   . THR A 1 32  ? -5.554  -2.511  0.372   1.00 0.00 ? 32  THR A HA   4  
ATOM 4759  H HB   . THR A 1 32  ? -6.305  -3.912  -1.820  1.00 0.00 ? 32  THR A HB   4  
ATOM 4760  H HG1  . THR A 1 32  ? -7.470  -1.221  -1.980  1.00 0.00 ? 32  THR A HG1  4  
ATOM 4761  H HG21 . THR A 1 32  ? -8.744  -3.467  -1.174  1.00 0.00 ? 32  THR A HG21 4  
ATOM 4762  H HG22 . THR A 1 32  ? -7.704  -3.958  0.185   1.00 0.00 ? 32  THR A HG22 4  
ATOM 4763  H HG23 . THR A 1 32  ? -8.142  -2.246  -0.027  1.00 0.00 ? 32  THR A HG23 4  
ATOM 4764  N N    . ILE A 1 33  ? -3.709  -3.765  -0.950  1.00 0.00 ? 33  ILE A N    4  
ATOM 4765  C CA   . ILE A 1 33  ? -2.399  -4.204  -1.400  1.00 0.00 ? 33  ILE A CA   4  
ATOM 4766  C C    . ILE A 1 33  ? -2.472  -4.575  -2.882  1.00 0.00 ? 33  ILE A C    4  
ATOM 4767  O O    . ILE A 1 33  ? -2.984  -5.636  -3.236  1.00 0.00 ? 33  ILE A O    4  
ATOM 4768  C CB   . ILE A 1 33  ? -1.878  -5.333  -0.508  1.00 0.00 ? 33  ILE A CB   4  
ATOM 4769  C CG1  . ILE A 1 33  ? -1.727  -4.864  0.940   1.00 0.00 ? 33  ILE A CG1  4  
ATOM 4770  C CG2  . ILE A 1 33  ? -0.574  -5.911  -1.062  1.00 0.00 ? 33  ILE A CG2  4  
ATOM 4771  C CD1  . ILE A 1 33  ? -0.859  -3.607  1.021   1.00 0.00 ? 33  ILE A CD1  4  
ATOM 4772  H H    . ILE A 1 33  ? -4.230  -4.446  -0.436  1.00 0.00 ? 33  ILE A H    4  
ATOM 4773  H HA   . ILE A 1 33  ? -1.716  -3.363  -1.287  1.00 0.00 ? 33  ILE A HA   4  
ATOM 4774  H HB   . ILE A 1 33  ? -2.613  -6.138  -0.511  1.00 0.00 ? 33  ILE A HB   4  
ATOM 4775  H HG12 . ILE A 1 33  ? -2.711  -4.659  1.364   1.00 0.00 ? 33  ILE A HG12 4  
ATOM 4776  H HG13 . ILE A 1 33  ? -1.281  -5.658  1.539   1.00 0.00 ? 33  ILE A HG13 4  
ATOM 4777  H HG21 . ILE A 1 33  ? -0.581  -6.996  -0.951  1.00 0.00 ? 33  ILE A HG21 4  
ATOM 4778  H HG22 . ILE A 1 33  ? -0.482  -5.655  -2.117  1.00 0.00 ? 33  ILE A HG22 4  
ATOM 4779  H HG23 . ILE A 1 33  ? 0.270   -5.495  -0.512  1.00 0.00 ? 33  ILE A HG23 4  
ATOM 4780  H HD11 . ILE A 1 33  ? -0.004  -3.712  0.354   1.00 0.00 ? 33  ILE A HD11 4  
ATOM 4781  H HD12 . ILE A 1 33  ? -1.448  -2.739  0.723   1.00 0.00 ? 33  ILE A HD12 4  
ATOM 4782  H HD13 . ILE A 1 33  ? -0.508  -3.473  2.044   1.00 0.00 ? 33  ILE A HD13 4  
ATOM 4783  N N    . SER A 1 34  ? -1.952  -3.680  -3.709  1.00 0.00 ? 34  SER A N    4  
ATOM 4784  C CA   . SER A 1 34  ? -1.951  -3.899  -5.146  1.00 0.00 ? 34  SER A CA   4  
ATOM 4785  C C    . SER A 1 34  ? -1.449  -5.310  -5.459  1.00 0.00 ? 34  SER A C    4  
ATOM 4786  O O    . SER A 1 34  ? -2.163  -6.107  -6.066  1.00 0.00 ? 34  SER A O    4  
ATOM 4787  C CB   . SER A 1 34  ? -1.089  -2.858  -5.862  1.00 0.00 ? 34  SER A CB   4  
ATOM 4788  O OG   . SER A 1 34  ? -0.114  -3.462  -6.707  1.00 0.00 ? 34  SER A OG   4  
ATOM 4789  H H    . SER A 1 34  ? -1.537  -2.819  -3.413  1.00 0.00 ? 34  SER A H    4  
ATOM 4790  H HA   . SER A 1 34  ? -2.990  -3.785  -5.455  1.00 0.00 ? 34  SER A HA   4  
ATOM 4791  H HB2  . SER A 1 34  ? -1.728  -2.204  -6.455  1.00 0.00 ? 34  SER A HB2  4  
ATOM 4792  H HB3  . SER A 1 34  ? -0.589  -2.231  -5.123  1.00 0.00 ? 34  SER A HB3  4  
ATOM 4793  H HG   . SER A 1 34  ? -0.549  -3.808  -7.538  1.00 0.00 ? 34  SER A HG   4  
ATOM 4794  N N    . SER A 1 35  ? -0.224  -5.577  -5.031  1.00 0.00 ? 35  SER A N    4  
ATOM 4795  C CA   . SER A 1 35  ? 0.382   -6.877  -5.258  1.00 0.00 ? 35  SER A CA   4  
ATOM 4796  C C    . SER A 1 35  ? 1.434   -7.160  -4.184  1.00 0.00 ? 35  SER A C    4  
ATOM 4797  O O    . SER A 1 35  ? 1.705   -6.310  -3.337  1.00 0.00 ? 35  SER A O    4  
ATOM 4798  C CB   . SER A 1 35  ? 1.011   -6.956  -6.651  1.00 0.00 ? 35  SER A CB   4  
ATOM 4799  O OG   . SER A 1 35  ? 0.364   -7.921  -7.475  1.00 0.00 ? 35  SER A OG   4  
ATOM 4800  H H    . SER A 1 35  ? 0.351   -4.923  -4.538  1.00 0.00 ? 35  SER A H    4  
ATOM 4801  H HA   . SER A 1 35  ? -0.437  -7.593  -5.189  1.00 0.00 ? 35  SER A HA   4  
ATOM 4802  H HB2  . SER A 1 35  ? 0.959   -5.978  -7.128  1.00 0.00 ? 35  SER A HB2  4  
ATOM 4803  H HB3  . SER A 1 35  ? 2.067   -7.209  -6.558  1.00 0.00 ? 35  SER A HB3  4  
ATOM 4804  H HG   . SER A 1 35  ? -0.525  -7.574  -7.775  1.00 0.00 ? 35  SER A HG   4  
ATOM 4805  N N    . LEU A 1 36  ? 1.999   -8.356  -4.254  1.00 0.00 ? 36  LEU A N    4  
ATOM 4806  C CA   . LEU A 1 36  ? 3.015   -8.761  -3.298  1.00 0.00 ? 36  LEU A CA   4  
ATOM 4807  C C    . LEU A 1 36  ? 4.310   -9.089  -4.044  1.00 0.00 ? 36  LEU A C    4  
ATOM 4808  O O    . LEU A 1 36  ? 4.277   -9.472  -5.212  1.00 0.00 ? 36  LEU A O    4  
ATOM 4809  C CB   . LEU A 1 36  ? 2.502   -9.907  -2.424  1.00 0.00 ? 36  LEU A CB   4  
ATOM 4810  C CG   . LEU A 1 36  ? 2.368   -9.604  -0.930  1.00 0.00 ? 36  LEU A CG   4  
ATOM 4811  C CD1  . LEU A 1 36  ? 3.693   -9.838  -0.201  1.00 0.00 ? 36  LEU A CD1  4  
ATOM 4812  C CD2  . LEU A 1 36  ? 1.832   -8.189  -0.704  1.00 0.00 ? 36  LEU A CD2  4  
ATOM 4813  H H    . LEU A 1 36  ? 1.773   -9.042  -4.946  1.00 0.00 ? 36  LEU A H    4  
ATOM 4814  H HA   . LEU A 1 36  ? 3.201   -7.912  -2.639  1.00 0.00 ? 36  LEU A HA   4  
ATOM 4815  H HB2  . LEU A 1 36  ? 1.528   -10.217 -2.800  1.00 0.00 ? 36  LEU A HB2  4  
ATOM 4816  H HB3  . LEU A 1 36  ? 3.175   -10.757 -2.542  1.00 0.00 ? 36  LEU A HB3  4  
ATOM 4817  H HG   . LEU A 1 36  ? 1.640   -10.295 -0.505  1.00 0.00 ? 36  LEU A HG   4  
ATOM 4818  H HD11 . LEU A 1 36  ? 3.521   -10.469 0.670   1.00 0.00 ? 36  LEU A HD11 4  
ATOM 4819  H HD12 . LEU A 1 36  ? 4.395   -10.329 -0.874  1.00 0.00 ? 36  LEU A HD12 4  
ATOM 4820  H HD13 . LEU A 1 36  ? 4.105   -8.881  0.119   1.00 0.00 ? 36  LEU A HD13 4  
ATOM 4821  H HD21 . LEU A 1 36  ? 2.659   -7.479  -0.726  1.00 0.00 ? 36  LEU A HD21 4  
ATOM 4822  H HD22 . LEU A 1 36  ? 1.119   -7.940  -1.491  1.00 0.00 ? 36  LEU A HD22 4  
ATOM 4823  H HD23 . LEU A 1 36  ? 1.335   -8.138  0.265   1.00 0.00 ? 36  LEU A HD23 4  
ATOM 4824  N N    . LYS A 1 37  ? 5.420   -8.926  -3.338  1.00 0.00 ? 37  LYS A N    4  
ATOM 4825  C CA   . LYS A 1 37  ? 6.723   -9.200  -3.920  1.00 0.00 ? 37  LYS A CA   4  
ATOM 4826  C C    . LYS A 1 37  ? 7.207   -10.574 -3.451  1.00 0.00 ? 37  LYS A C    4  
ATOM 4827  O O    . LYS A 1 37  ? 7.046   -10.928 -2.284  1.00 0.00 ? 37  LYS A O    4  
ATOM 4828  C CB   . LYS A 1 37  ? 7.699   -8.064  -3.606  1.00 0.00 ? 37  LYS A CB   4  
ATOM 4829  C CG   . LYS A 1 37  ? 9.078   -8.344  -4.207  1.00 0.00 ? 37  LYS A CG   4  
ATOM 4830  C CD   . LYS A 1 37  ? 9.499   -7.222  -5.158  1.00 0.00 ? 37  LYS A CD   4  
ATOM 4831  C CE   . LYS A 1 37  ? 9.174   -7.582  -6.609  1.00 0.00 ? 37  LYS A CE   4  
ATOM 4832  N NZ   . LYS A 1 37  ? 8.372   -6.511  -7.242  1.00 0.00 ? 37  LYS A NZ   4  
ATOM 4833  H H    . LYS A 1 37  ? 5.438   -8.614  -2.388  1.00 0.00 ? 37  LYS A H    4  
ATOM 4834  H HA   . LYS A 1 37  ? 6.599   -9.228  -5.002  1.00 0.00 ? 37  LYS A HA   4  
ATOM 4835  H HB2  . LYS A 1 37  ? 7.310   -7.126  -4.001  1.00 0.00 ? 37  LYS A HB2  4  
ATOM 4836  H HB3  . LYS A 1 37  ? 7.787   -7.943  -2.526  1.00 0.00 ? 37  LYS A HB3  4  
ATOM 4837  H HG2  . LYS A 1 37  ? 9.813   -8.444  -3.409  1.00 0.00 ? 37  LYS A HG2  4  
ATOM 4838  H HG3  . LYS A 1 37  ? 9.059   -9.293  -4.744  1.00 0.00 ? 37  LYS A HG3  4  
ATOM 4839  H HD2  . LYS A 1 37  ? 8.989   -6.299  -4.886  1.00 0.00 ? 37  LYS A HD2  4  
ATOM 4840  H HD3  . LYS A 1 37  ? 10.569  -7.037  -5.056  1.00 0.00 ? 37  LYS A HD3  4  
ATOM 4841  H HE2  . LYS A 1 37  ? 10.098  -7.732  -7.168  1.00 0.00 ? 37  LYS A HE2  4  
ATOM 4842  H HE3  . LYS A 1 37  ? 8.625   -8.523  -6.642  1.00 0.00 ? 37  LYS A HE3  4  
ATOM 4843  H HZ1  . LYS A 1 37  ? 7.891   -6.881  -8.036  1.00 0.00 ? 37  LYS A HZ1  4  
ATOM 4844  H HZ2  . LYS A 1 37  ? 7.707   -6.159  -6.583  1.00 0.00 ? 37  LYS A HZ2  4  
ATOM 4845  H HZ3  . LYS A 1 37  ? 8.977   -5.770  -7.533  1.00 0.00 ? 37  LYS A HZ3  4  
ATOM 4846  N N    . ASP A 1 38  ? 7.791   -11.310 -4.385  1.00 0.00 ? 38  ASP A N    4  
ATOM 4847  C CA   . ASP A 1 38  ? 8.299   -12.637 -4.083  1.00 0.00 ? 38  ASP A CA   4  
ATOM 4848  C C    . ASP A 1 38  ? 9.146   -12.576 -2.810  1.00 0.00 ? 38  ASP A C    4  
ATOM 4849  O O    . ASP A 1 38  ? 10.106  -11.810 -2.735  1.00 0.00 ? 38  ASP A O    4  
ATOM 4850  C CB   . ASP A 1 38  ? 9.185   -13.159 -5.216  1.00 0.00 ? 38  ASP A CB   4  
ATOM 4851  C CG   . ASP A 1 38  ? 8.469   -14.034 -6.246  1.00 0.00 ? 38  ASP A CG   4  
ATOM 4852  O OD1  . ASP A 1 38  ? 8.084   -15.161 -5.864  1.00 0.00 ? 38  ASP A OD1  4  
ATOM 4853  O OD2  . ASP A 1 38  ? 8.321   -13.557 -7.392  1.00 0.00 ? 38  ASP A OD2  4  
ATOM 4854  H H    . ASP A 1 38  ? 7.918   -11.015 -5.332  1.00 0.00 ? 38  ASP A H    4  
ATOM 4855  H HA   . ASP A 1 38  ? 7.415   -13.263 -3.965  1.00 0.00 ? 38  ASP A HA   4  
ATOM 4856  H HB2  . ASP A 1 38  ? 9.630   -12.308 -5.731  1.00 0.00 ? 38  ASP A HB2  4  
ATOM 4857  H HB3  . ASP A 1 38  ? 10.005  -13.732 -4.781  1.00 0.00 ? 38  ASP A HB3  4  
ATOM 4858  N N    . GLY A 1 39  ? 8.762   -13.394 -1.841  1.00 0.00 ? 39  GLY A N    4  
ATOM 4859  C CA   . GLY A 1 39  ? 9.474   -13.442 -0.576  1.00 0.00 ? 39  GLY A CA   4  
ATOM 4860  C C    . GLY A 1 39  ? 9.849   -12.036 -0.103  1.00 0.00 ? 39  GLY A C    4  
ATOM 4861  O O    . GLY A 1 39  ? 11.020  -11.753 0.146   1.00 0.00 ? 39  GLY A O    4  
ATOM 4862  H H    . GLY A 1 39  ? 7.980   -14.014 -1.910  1.00 0.00 ? 39  GLY A H    4  
ATOM 4863  H HA2  . GLY A 1 39  ? 8.853   -13.929 0.177   1.00 0.00 ? 39  GLY A HA2  4  
ATOM 4864  H HA3  . GLY A 1 39  ? 10.375  -14.046 -0.684  1.00 0.00 ? 39  GLY A HA3  4  
ATOM 4865  N N    . GLY A 1 40  ? 8.833   -11.192 0.005   1.00 0.00 ? 40  GLY A N    4  
ATOM 4866  C CA   . GLY A 1 40  ? 9.042   -9.822  0.443   1.00 0.00 ? 40  GLY A CA   4  
ATOM 4867  C C    . GLY A 1 40  ? 8.610   -9.641  1.900   1.00 0.00 ? 40  GLY A C    4  
ATOM 4868  O O    . GLY A 1 40  ? 7.882   -10.470 2.443   1.00 0.00 ? 40  GLY A O    4  
ATOM 4869  H H    . GLY A 1 40  ? 7.884   -11.431 -0.200  1.00 0.00 ? 40  GLY A H    4  
ATOM 4870  H HA2  . GLY A 1 40  ? 10.094  -9.559  0.336   1.00 0.00 ? 40  GLY A HA2  4  
ATOM 4871  H HA3  . GLY A 1 40  ? 8.476   -9.143  -0.195  1.00 0.00 ? 40  GLY A HA3  4  
ATOM 4872  N N    . LYS A 1 41  ? 9.077   -8.550  2.490   1.00 0.00 ? 41  LYS A N    4  
ATOM 4873  C CA   . LYS A 1 41  ? 8.748   -8.249  3.873   1.00 0.00 ? 41  LYS A CA   4  
ATOM 4874  C C    . LYS A 1 41  ? 7.245   -8.438  4.088   1.00 0.00 ? 41  LYS A C    4  
ATOM 4875  O O    . LYS A 1 41  ? 6.830   -9.151  5.000   1.00 0.00 ? 41  LYS A O    4  
ATOM 4876  C CB   . LYS A 1 41  ? 9.254   -6.856  4.253   1.00 0.00 ? 41  LYS A CB   4  
ATOM 4877  C CG   . LYS A 1 41  ? 10.777  -6.845  4.391   1.00 0.00 ? 41  LYS A CG   4  
ATOM 4878  C CD   . LYS A 1 41  ? 11.431  -6.136  3.203   1.00 0.00 ? 41  LYS A CD   4  
ATOM 4879  C CE   . LYS A 1 41  ? 12.469  -7.037  2.531   1.00 0.00 ? 41  LYS A CE   4  
ATOM 4880  N NZ   . LYS A 1 41  ? 12.501  -6.792  1.072   1.00 0.00 ? 41  LYS A NZ   4  
ATOM 4881  H H    . LYS A 1 41  ? 9.668   -7.881  2.041   1.00 0.00 ? 41  LYS A H    4  
ATOM 4882  H HA   . LYS A 1 41  ? 9.279   -8.966  4.499   1.00 0.00 ? 41  LYS A HA   4  
ATOM 4883  H HB2  . LYS A 1 41  ? 8.949   -6.135  3.494   1.00 0.00 ? 41  LYS A HB2  4  
ATOM 4884  H HB3  . LYS A 1 41  ? 8.797   -6.543  5.191   1.00 0.00 ? 41  LYS A HB3  4  
ATOM 4885  H HG2  . LYS A 1 41  ? 11.058  -6.343  5.318   1.00 0.00 ? 41  LYS A HG2  4  
ATOM 4886  H HG3  . LYS A 1 41  ? 11.148  -7.867  4.458   1.00 0.00 ? 41  LYS A HG3  4  
ATOM 4887  H HD2  . LYS A 1 41  ? 10.667  -5.853  2.479   1.00 0.00 ? 41  LYS A HD2  4  
ATOM 4888  H HD3  . LYS A 1 41  ? 11.907  -5.216  3.541   1.00 0.00 ? 41  LYS A HD3  4  
ATOM 4889  H HE2  . LYS A 1 41  ? 13.454  -6.850  2.959   1.00 0.00 ? 41  LYS A HE2  4  
ATOM 4890  H HE3  . LYS A 1 41  ? 12.231  -8.083  2.725   1.00 0.00 ? 41  LYS A HE3  4  
ATOM 4891  H HZ1  . LYS A 1 41  ? 11.585  -6.921  0.692   1.00 0.00 ? 41  LYS A HZ1  4  
ATOM 4892  H HZ2  . LYS A 1 41  ? 12.805  -5.856  0.898   1.00 0.00 ? 41  LYS A HZ2  4  
ATOM 4893  H HZ3  . LYS A 1 41  ? 13.135  -7.434  0.640   1.00 0.00 ? 41  LYS A HZ3  4  
ATOM 4894  N N    . ALA A 1 42  ? 6.471   -7.786  3.233   1.00 0.00 ? 42  ALA A N    4  
ATOM 4895  C CA   . ALA A 1 42  ? 5.023   -7.873  3.318   1.00 0.00 ? 42  ALA A CA   4  
ATOM 4896  C C    . ALA A 1 42  ? 4.613   -9.338  3.482   1.00 0.00 ? 42  ALA A C    4  
ATOM 4897  O O    . ALA A 1 42  ? 4.049   -9.717  4.507   1.00 0.00 ? 42  ALA A O    4  
ATOM 4898  C CB   . ALA A 1 42  ? 4.399   -7.228  2.079   1.00 0.00 ? 42  ALA A CB   4  
ATOM 4899  H H    . ALA A 1 42  ? 6.817   -7.208  2.494   1.00 0.00 ? 42  ALA A H    4  
ATOM 4900  H HA   . ALA A 1 42  ? 4.708   -7.315  4.200   1.00 0.00 ? 42  ALA A HA   4  
ATOM 4901  H HB1  . ALA A 1 42  ? 5.148   -7.154  1.291   1.00 0.00 ? 42  ALA A HB1  4  
ATOM 4902  H HB2  . ALA A 1 42  ? 3.565   -7.839  1.732   1.00 0.00 ? 42  ALA A HB2  4  
ATOM 4903  H HB3  . ALA A 1 42  ? 4.038   -6.230  2.331   1.00 0.00 ? 42  ALA A HB3  4  
ATOM 4904  N N    . SER A 1 43  ? 4.913   -10.121 2.456   1.00 0.00 ? 43  SER A N    4  
ATOM 4905  C CA   . SER A 1 43  ? 4.583   -11.536 2.473   1.00 0.00 ? 43  SER A CA   4  
ATOM 4906  C C    . SER A 1 43  ? 5.011   -12.157 3.805   1.00 0.00 ? 43  SER A C    4  
ATOM 4907  O O    . SER A 1 43  ? 4.234   -12.868 4.440   1.00 0.00 ? 43  SER A O    4  
ATOM 4908  C CB   . SER A 1 43  ? 5.246   -12.271 1.307   1.00 0.00 ? 43  SER A CB   4  
ATOM 4909  O OG   . SER A 1 43  ? 6.662   -12.343 1.458   1.00 0.00 ? 43  SER A OG   4  
ATOM 4910  H H    . SER A 1 43  ? 5.372   -9.804  1.626   1.00 0.00 ? 43  SER A H    4  
ATOM 4911  H HA   . SER A 1 43  ? 3.499   -11.581 2.361   1.00 0.00 ? 43  SER A HA   4  
ATOM 4912  H HB2  . SER A 1 43  ? 4.838   -13.279 1.234   1.00 0.00 ? 43  SER A HB2  4  
ATOM 4913  H HB3  . SER A 1 43  ? 5.007   -11.761 0.374   1.00 0.00 ? 43  SER A HB3  4  
ATOM 4914  H HG   . SER A 1 43  ? 7.015   -13.151 0.987   1.00 0.00 ? 43  SER A HG   4  
ATOM 4915  N N    . GLN A 1 44  ? 6.245   -11.866 4.187   1.00 0.00 ? 44  GLN A N    4  
ATOM 4916  C CA   . GLN A 1 44  ? 6.786   -12.387 5.431   1.00 0.00 ? 44  GLN A CA   4  
ATOM 4917  C C    . GLN A 1 44  ? 5.899   -11.977 6.608   1.00 0.00 ? 44  GLN A C    4  
ATOM 4918  O O    . GLN A 1 44  ? 5.895   -12.637 7.646   1.00 0.00 ? 44  GLN A O    4  
ATOM 4919  C CB   . GLN A 1 44  ? 8.227   -11.919 5.641   1.00 0.00 ? 44  GLN A CB   4  
ATOM 4920  C CG   . GLN A 1 44  ? 9.220   -12.906 5.023   1.00 0.00 ? 44  GLN A CG   4  
ATOM 4921  C CD   . GLN A 1 44  ? 10.652  -12.589 5.461   1.00 0.00 ? 44  GLN A CD   4  
ATOM 4922  O OE1  . GLN A 1 44  ? 11.044  -12.806 6.596   1.00 0.00 ? 44  GLN A OE1  4  
ATOM 4923  N NE2  . GLN A 1 44  ? 11.408  -12.066 4.500   1.00 0.00 ? 44  GLN A NE2  4  
ATOM 4924  H H    . GLN A 1 44  ? 6.871   -11.287 3.664   1.00 0.00 ? 44  GLN A H    4  
ATOM 4925  H HA   . GLN A 1 44  ? 6.775   -13.472 5.320   1.00 0.00 ? 44  GLN A HA   4  
ATOM 4926  H HB2  . GLN A 1 44  ? 8.362   -10.934 5.194   1.00 0.00 ? 44  GLN A HB2  4  
ATOM 4927  H HB3  . GLN A 1 44  ? 8.428   -11.815 6.707   1.00 0.00 ? 44  GLN A HB3  4  
ATOM 4928  H HG2  . GLN A 1 44  ? 8.961   -13.922 5.321   1.00 0.00 ? 44  GLN A HG2  4  
ATOM 4929  H HG3  . GLN A 1 44  ? 9.151   -12.864 3.936   1.00 0.00 ? 44  GLN A HG3  4  
ATOM 4930  H HE21 . GLN A 1 44  ? 11.024  -11.913 3.589   1.00 0.00 ? 44  GLN A HE21 4  
ATOM 4931  H HE22 . GLN A 1 44  ? 12.360  -11.825 4.689   1.00 0.00 ? 44  GLN A HE22 4  
ATOM 4932  N N    . ALA A 1 45  ? 5.168   -10.891 6.407   1.00 0.00 ? 45  ALA A N    4  
ATOM 4933  C CA   . ALA A 1 45  ? 4.279   -10.385 7.438   1.00 0.00 ? 45  ALA A CA   4  
ATOM 4934  C C    . ALA A 1 45  ? 2.889   -10.997 7.253   1.00 0.00 ? 45  ALA A C    4  
ATOM 4935  O O    . ALA A 1 45  ? 1.903   -10.474 7.769   1.00 0.00 ? 45  ALA A O    4  
ATOM 4936  C CB   . ALA A 1 45  ? 4.254   -8.856  7.387   1.00 0.00 ? 45  ALA A CB   4  
ATOM 4937  H H    . ALA A 1 45  ? 5.177   -10.360 5.559   1.00 0.00 ? 45  ALA A H    4  
ATOM 4938  H HA   . ALA A 1 45  ? 4.678   -10.697 8.403   1.00 0.00 ? 45  ALA A HA   4  
ATOM 4939  H HB1  . ALA A 1 45  ? 3.875   -8.531  6.418   1.00 0.00 ? 45  ALA A HB1  4  
ATOM 4940  H HB2  . ALA A 1 45  ? 3.606   -8.476  8.177   1.00 0.00 ? 45  ALA A HB2  4  
ATOM 4941  H HB3  . ALA A 1 45  ? 5.264   -8.471  7.529   1.00 0.00 ? 45  ALA A HB3  4  
ATOM 4942  N N    . HIS A 1 46  ? 2.855   -12.096 6.514   1.00 0.00 ? 46  HIS A N    4  
ATOM 4943  C CA   . HIS A 1 46  ? 1.603   -12.785 6.253   1.00 0.00 ? 46  HIS A CA   4  
ATOM 4944  C C    . HIS A 1 46  ? 0.582   -11.797 5.687   1.00 0.00 ? 46  HIS A C    4  
ATOM 4945  O O    . HIS A 1 46  ? -0.600  -11.856 6.025   1.00 0.00 ? 46  HIS A O    4  
ATOM 4946  C CB   . HIS A 1 46  ? 1.103   -13.498 7.512   1.00 0.00 ? 46  HIS A CB   4  
ATOM 4947  C CG   . HIS A 1 46  ? 1.991   -14.629 7.970   1.00 0.00 ? 46  HIS A CG   4  
ATOM 4948  N ND1  . HIS A 1 46  ? 1.503   -15.884 8.289   1.00 0.00 ? 46  HIS A ND1  4  
ATOM 4949  C CD2  . HIS A 1 46  ? 3.341   -14.682 8.160   1.00 0.00 ? 46  HIS A CD2  4  
ATOM 4950  C CE1  . HIS A 1 46  ? 2.521   -16.649 8.653   1.00 0.00 ? 46  HIS A CE1  4  
ATOM 4951  N NE2  . HIS A 1 46  ? 3.659   -15.903 8.573   1.00 0.00 ? 46  HIS A NE2  4  
ATOM 4952  H H    . HIS A 1 46  ? 3.662   -12.515 6.097   1.00 0.00 ? 46  HIS A H    4  
ATOM 4953  H HA   . HIS A 1 46  ? 1.814   -13.546 5.502   1.00 0.00 ? 46  HIS A HA   4  
ATOM 4954  H HB2  . HIS A 1 46  ? 1.014   -12.770 8.318   1.00 0.00 ? 46  HIS A HB2  4  
ATOM 4955  H HB3  . HIS A 1 46  ? 0.103   -13.888 7.323   1.00 0.00 ? 46  HIS A HB3  4  
ATOM 4956  H HD1  . HIS A 1 46  ? 0.544   -16.165 8.251   1.00 0.00 ? 46  HIS A HD1  4  
ATOM 4957  H HD2  . HIS A 1 46  ? 4.040   -13.861 7.999   1.00 0.00 ? 46  HIS A HD2  4  
ATOM 4958  H HE1  . HIS A 1 46  ? 2.460   -17.693 8.963   1.00 0.00 ? 46  HIS A HE1  4  
ATOM 4959  N N    . VAL A 1 47  ? 1.074   -10.910 4.835   1.00 0.00 ? 47  VAL A N    4  
ATOM 4960  C CA   . VAL A 1 47  ? 0.219   -9.910  4.218   1.00 0.00 ? 47  VAL A CA   4  
ATOM 4961  C C    . VAL A 1 47  ? -0.336  -10.461 2.903   1.00 0.00 ? 47  VAL A C    4  
ATOM 4962  O O    . VAL A 1 47  ? 0.418   -10.722 1.967   1.00 0.00 ? 47  VAL A O    4  
ATOM 4963  C CB   . VAL A 1 47  ? 0.991   -8.601  4.039   1.00 0.00 ? 47  VAL A CB   4  
ATOM 4964  C CG1  . VAL A 1 47  ? 0.283   -7.679  3.043   1.00 0.00 ? 47  VAL A CG1  4  
ATOM 4965  C CG2  . VAL A 1 47  ? 1.200   -7.899  5.382   1.00 0.00 ? 47  VAL A CG2  4  
ATOM 4966  H H    . VAL A 1 47  ? 2.036   -10.868 4.565   1.00 0.00 ? 47  VAL A H    4  
ATOM 4967  H HA   . VAL A 1 47  ? -0.611  -9.722  4.898   1.00 0.00 ? 47  VAL A HA   4  
ATOM 4968  H HB   . VAL A 1 47  ? 1.972   -8.843  3.631   1.00 0.00 ? 47  VAL A HB   4  
ATOM 4969  H HG11 . VAL A 1 47  ? 0.713   -6.679  3.105   1.00 0.00 ? 47  VAL A HG11 4  
ATOM 4970  H HG12 . VAL A 1 47  ? 0.412   -8.068  2.033   1.00 0.00 ? 47  VAL A HG12 4  
ATOM 4971  H HG13 . VAL A 1 47  ? -0.779  -7.634  3.282   1.00 0.00 ? 47  VAL A HG13 4  
ATOM 4972  H HG21 . VAL A 1 47  ? 1.927   -8.455  5.973   1.00 0.00 ? 47  VAL A HG21 4  
ATOM 4973  H HG22 . VAL A 1 47  ? 1.568   -6.887  5.210   1.00 0.00 ? 47  VAL A HG22 4  
ATOM 4974  H HG23 . VAL A 1 47  ? 0.253   -7.854  5.920   1.00 0.00 ? 47  VAL A HG23 4  
ATOM 4975  N N    . ARG A 1 48  ? -1.651  -10.622 2.875   1.00 0.00 ? 48  ARG A N    4  
ATOM 4976  C CA   . ARG A 1 48  ? -2.317  -11.137 1.690   1.00 0.00 ? 48  ARG A CA   4  
ATOM 4977  C C    . ARG A 1 48  ? -2.917  -9.988  0.877   1.00 0.00 ? 48  ARG A C    4  
ATOM 4978  O O    . ARG A 1 48  ? -3.213  -8.926  1.421   1.00 0.00 ? 48  ARG A O    4  
ATOM 4979  C CB   . ARG A 1 48  ? -3.426  -12.121 2.066   1.00 0.00 ? 48  ARG A CB   4  
ATOM 4980  C CG   . ARG A 1 48  ? -2.897  -13.556 2.103   1.00 0.00 ? 48  ARG A CG   4  
ATOM 4981  C CD   . ARG A 1 48  ? -3.366  -14.281 3.367   1.00 0.00 ? 48  ARG A CD   4  
ATOM 4982  N NE   . ARG A 1 48  ? -2.734  -13.676 4.561   1.00 0.00 ? 48  ARG A NE   4  
ATOM 4983  C CZ   . ARG A 1 48  ? -2.875  -14.149 5.807   1.00 0.00 ? 48  ARG A CZ   4  
ATOM 4984  N NH1  . ARG A 1 48  ? -3.628  -15.235 6.029   1.00 0.00 ? 48  ARG A NH1  4  
ATOM 4985  N NH2  . ARG A 1 48  ? -2.265  -13.536 6.830   1.00 0.00 ? 48  ARG A NH2  4  
ATOM 4986  H H    . ARG A 1 48  ? -2.257  -10.407 3.640   1.00 0.00 ? 48  ARG A H    4  
ATOM 4987  H HA   . ARG A 1 48  ? -1.533  -11.647 1.130   1.00 0.00 ? 48  ARG A HA   4  
ATOM 4988  H HB2  . ARG A 1 48  ? -3.838  -11.856 3.040   1.00 0.00 ? 48  ARG A HB2  4  
ATOM 4989  H HB3  . ARG A 1 48  ? -4.241  -12.049 1.346   1.00 0.00 ? 48  ARG A HB3  4  
ATOM 4990  H HG2  . ARG A 1 48  ? -3.240  -14.097 1.221   1.00 0.00 ? 48  ARG A HG2  4  
ATOM 4991  H HG3  . ARG A 1 48  ? -1.808  -13.547 2.068   1.00 0.00 ? 48  ARG A HG3  4  
ATOM 4992  H HD2  . ARG A 1 48  ? -4.451  -14.220 3.450   1.00 0.00 ? 48  ARG A HD2  4  
ATOM 4993  H HD3  . ARG A 1 48  ? -3.109  -15.338 3.306   1.00 0.00 ? 48  ARG A HD3  4  
ATOM 4994  H HE   . ARG A 1 48  ? -2.165  -12.864 4.430   1.00 0.00 ? 48  ARG A HE   4  
ATOM 4995  H HH11 . ARG A 1 48  ? -4.084  -15.693 5.266   1.00 0.00 ? 48  ARG A HH11 4  
ATOM 4996  H HH12 . ARG A 1 48  ? -3.734  -15.588 6.959   1.00 0.00 ? 48  ARG A HH12 4  
ATOM 4997  H HH21 . ARG A 1 48  ? -1.703  -12.725 6.663   1.00 0.00 ? 48  ARG A HH21 4  
ATOM 4998  H HH22 . ARG A 1 48  ? -2.371  -13.888 7.759   1.00 0.00 ? 48  ARG A HH22 4  
ATOM 4999  N N    . ILE A 1 49  ? -3.078  -10.241 -0.414  1.00 0.00 ? 49  ILE A N    4  
ATOM 5000  C CA   . ILE A 1 49  ? -3.638  -9.242  -1.308  1.00 0.00 ? 49  ILE A CA   4  
ATOM 5001  C C    . ILE A 1 49  ? -5.078  -8.939  -0.890  1.00 0.00 ? 49  ILE A C    4  
ATOM 5002  O O    . ILE A 1 49  ? -5.817  -9.841  -0.499  1.00 0.00 ? 49  ILE A O    4  
ATOM 5003  C CB   . ILE A 1 49  ? -3.501  -9.689  -2.765  1.00 0.00 ? 49  ILE A CB   4  
ATOM 5004  C CG1  . ILE A 1 49  ? -2.032  -9.890  -3.141  1.00 0.00 ? 49  ILE A CG1  4  
ATOM 5005  C CG2  . ILE A 1 49  ? -4.205  -8.711  -3.707  1.00 0.00 ? 49  ILE A CG2  4  
ATOM 5006  C CD1  . ILE A 1 49  ? -1.192  -8.675  -2.743  1.00 0.00 ? 49  ILE A CD1  4  
ATOM 5007  H H    . ILE A 1 49  ? -2.834  -11.108 -0.849  1.00 0.00 ? 49  ILE A H    4  
ATOM 5008  H HA   . ILE A 1 49  ? -3.046  -8.333  -1.193  1.00 0.00 ? 49  ILE A HA   4  
ATOM 5009  H HB   . ILE A 1 49  ? -3.996  -10.654 -2.873  1.00 0.00 ? 49  ILE A HB   4  
ATOM 5010  H HG12 . ILE A 1 49  ? -1.645  -10.781 -2.647  1.00 0.00 ? 49  ILE A HG12 4  
ATOM 5011  H HG13 . ILE A 1 49  ? -1.947  -10.059 -4.215  1.00 0.00 ? 49  ILE A HG13 4  
ATOM 5012  H HG21 . ILE A 1 49  ? -3.854  -7.699  -3.509  1.00 0.00 ? 49  ILE A HG21 4  
ATOM 5013  H HG22 . ILE A 1 49  ? -3.982  -8.978  -4.740  1.00 0.00 ? 49  ILE A HG22 4  
ATOM 5014  H HG23 . ILE A 1 49  ? -5.282  -8.761  -3.544  1.00 0.00 ? 49  ILE A HG23 4  
ATOM 5015  H HD11 . ILE A 1 49  ? -0.365  -8.559  -3.444  1.00 0.00 ? 49  ILE A HD11 4  
ATOM 5016  H HD12 . ILE A 1 49  ? -1.815  -7.780  -2.765  1.00 0.00 ? 49  ILE A HD12 4  
ATOM 5017  H HD13 . ILE A 1 49  ? -0.799  -8.819  -1.737  1.00 0.00 ? 49  ILE A HD13 4  
ATOM 5018  N N    . GLY A 1 50  ? -5.434  -7.666  -0.988  1.00 0.00 ? 50  GLY A N    4  
ATOM 5019  C CA   . GLY A 1 50  ? -6.772  -7.234  -0.624  1.00 0.00 ? 50  GLY A CA   4  
ATOM 5020  C C    . GLY A 1 50  ? -6.780  -6.575  0.757   1.00 0.00 ? 50  GLY A C    4  
ATOM 5021  O O    . GLY A 1 50  ? -7.758  -5.934  1.137   1.00 0.00 ? 50  GLY A O    4  
ATOM 5022  H H    . GLY A 1 50  ? -4.826  -6.939  -1.307  1.00 0.00 ? 50  GLY A H    4  
ATOM 5023  H HA2  . GLY A 1 50  ? -7.145  -6.530  -1.369  1.00 0.00 ? 50  GLY A HA2  4  
ATOM 5024  H HA3  . GLY A 1 50  ? -7.448  -8.089  -0.627  1.00 0.00 ? 50  GLY A HA3  4  
ATOM 5025  N N    . ASP A 1 51  ? -5.678  -6.756  1.469   1.00 0.00 ? 51  ASP A N    4  
ATOM 5026  C CA   . ASP A 1 51  ? -5.545  -6.188  2.800   1.00 0.00 ? 51  ASP A CA   4  
ATOM 5027  C C    . ASP A 1 51  ? -5.771  -4.676  2.729   1.00 0.00 ? 51  ASP A C    4  
ATOM 5028  O O    . ASP A 1 51  ? -5.129  -3.985  1.940   1.00 0.00 ? 51  ASP A O    4  
ATOM 5029  C CB   . ASP A 1 51  ? -4.145  -6.430  3.366   1.00 0.00 ? 51  ASP A CB   4  
ATOM 5030  C CG   . ASP A 1 51  ? -3.853  -7.876  3.771   1.00 0.00 ? 51  ASP A CG   4  
ATOM 5031  O OD1  . ASP A 1 51  ? -4.780  -8.703  3.632   1.00 0.00 ? 51  ASP A OD1  4  
ATOM 5032  O OD2  . ASP A 1 51  ? -2.709  -8.122  4.212   1.00 0.00 ? 51  ASP A OD2  4  
ATOM 5033  H H    . ASP A 1 51  ? -4.886  -7.279  1.152   1.00 0.00 ? 51  ASP A H    4  
ATOM 5034  H HA   . ASP A 1 51  ? -6.298  -6.694  3.404   1.00 0.00 ? 51  ASP A HA   4  
ATOM 5035  H HB2  . ASP A 1 51  ? -3.410  -6.122  2.621   1.00 0.00 ? 51  ASP A HB2  4  
ATOM 5036  H HB3  . ASP A 1 51  ? -4.004  -5.789  4.236   1.00 0.00 ? 51  ASP A HB3  4  
ATOM 5037  N N    . VAL A 1 52  ? -6.686  -4.207  3.564   1.00 0.00 ? 52  VAL A N    4  
ATOM 5038  C CA   . VAL A 1 52  ? -7.005  -2.790  3.606   1.00 0.00 ? 52  VAL A CA   4  
ATOM 5039  C C    . VAL A 1 52  ? -6.167  -2.115  4.694   1.00 0.00 ? 52  VAL A C    4  
ATOM 5040  O O    . VAL A 1 52  ? -6.067  -2.622  5.810   1.00 0.00 ? 52  VAL A O    4  
ATOM 5041  C CB   . VAL A 1 52  ? -8.510  -2.598  3.806   1.00 0.00 ? 52  VAL A CB   4  
ATOM 5042  C CG1  . VAL A 1 52  ? -8.852  -1.120  4.009   1.00 0.00 ? 52  VAL A CG1  4  
ATOM 5043  C CG2  . VAL A 1 52  ? -9.298  -3.188  2.635   1.00 0.00 ? 52  VAL A CG2  4  
ATOM 5044  H H    . VAL A 1 52  ? -7.205  -4.776  4.203   1.00 0.00 ? 52  VAL A H    4  
ATOM 5045  H HA   . VAL A 1 52  ? -6.736  -2.364  2.640   1.00 0.00 ? 52  VAL A HA   4  
ATOM 5046  H HB   . VAL A 1 52  ? -8.799  -3.135  4.709   1.00 0.00 ? 52  VAL A HB   4  
ATOM 5047  H HG11 . VAL A 1 52  ? -8.052  -0.636  4.569   1.00 0.00 ? 52  VAL A HG11 4  
ATOM 5048  H HG12 . VAL A 1 52  ? -8.960  -0.636  3.038   1.00 0.00 ? 52  VAL A HG12 4  
ATOM 5049  H HG13 . VAL A 1 52  ? -9.786  -1.036  4.563   1.00 0.00 ? 52  VAL A HG13 4  
ATOM 5050  H HG21 . VAL A 1 52  ? -10.150 -3.750  3.018   1.00 0.00 ? 52  VAL A HG21 4  
ATOM 5051  H HG22 . VAL A 1 52  ? -9.654  -2.381  1.994   1.00 0.00 ? 52  VAL A HG22 4  
ATOM 5052  H HG23 . VAL A 1 52  ? -8.653  -3.852  2.060   1.00 0.00 ? 52  VAL A HG23 4  
ATOM 5053  N N    . VAL A 1 53  ? -5.585  -0.982  4.329   1.00 0.00 ? 53  VAL A N    4  
ATOM 5054  C CA   . VAL A 1 53  ? -4.758  -0.232  5.260   1.00 0.00 ? 53  VAL A CA   4  
ATOM 5055  C C    . VAL A 1 53  ? -5.642  0.721   6.066   1.00 0.00 ? 53  VAL A C    4  
ATOM 5056  O O    . VAL A 1 53  ? -6.067  1.758   5.559   1.00 0.00 ? 53  VAL A O    4  
ATOM 5057  C CB   . VAL A 1 53  ? -3.638  0.486   4.503   1.00 0.00 ? 53  VAL A CB   4  
ATOM 5058  C CG1  . VAL A 1 53  ? -2.755  1.287   5.463   1.00 0.00 ? 53  VAL A CG1  4  
ATOM 5059  C CG2  . VAL A 1 53  ? -2.805  -0.504  3.687   1.00 0.00 ? 53  VAL A CG2  4  
ATOM 5060  H H    . VAL A 1 53  ? -5.671  -0.576  3.419   1.00 0.00 ? 53  VAL A H    4  
ATOM 5061  H HA   . VAL A 1 53  ? -4.299  -0.948  5.942   1.00 0.00 ? 53  VAL A HA   4  
ATOM 5062  H HB   . VAL A 1 53  ? -4.100  1.188   3.809   1.00 0.00 ? 53  VAL A HB   4  
ATOM 5063  H HG11 . VAL A 1 53  ? -3.365  2.018   5.993   1.00 0.00 ? 53  VAL A HG11 4  
ATOM 5064  H HG12 . VAL A 1 53  ? -2.292  0.610   6.181   1.00 0.00 ? 53  VAL A HG12 4  
ATOM 5065  H HG13 . VAL A 1 53  ? -1.979  1.802   4.897   1.00 0.00 ? 53  VAL A HG13 4  
ATOM 5066  H HG21 . VAL A 1 53  ? -2.089  0.043   3.074   1.00 0.00 ? 53  VAL A HG21 4  
ATOM 5067  H HG22 . VAL A 1 53  ? -2.270  -1.172  4.363   1.00 0.00 ? 53  VAL A HG22 4  
ATOM 5068  H HG23 . VAL A 1 53  ? -3.463  -1.089  3.044   1.00 0.00 ? 53  VAL A HG23 4  
ATOM 5069  N N    . LEU A 1 54  ? -5.892  0.336   7.309   1.00 0.00 ? 54  LEU A N    4  
ATOM 5070  C CA   . LEU A 1 54  ? -6.717  1.144   8.191   1.00 0.00 ? 54  LEU A CA   4  
ATOM 5071  C C    . LEU A 1 54  ? -5.951  2.410   8.582   1.00 0.00 ? 54  LEU A C    4  
ATOM 5072  O O    . LEU A 1 54  ? -6.526  3.496   8.634   1.00 0.00 ? 54  LEU A O    4  
ATOM 5073  C CB   . LEU A 1 54  ? -7.190  0.317   9.389   1.00 0.00 ? 54  LEU A CB   4  
ATOM 5074  C CG   . LEU A 1 54  ? -8.093  -0.875  9.066   1.00 0.00 ? 54  LEU A CG   4  
ATOM 5075  C CD1  . LEU A 1 54  ? -8.218  -1.810  10.270  1.00 0.00 ? 54  LEU A CD1  4  
ATOM 5076  C CD2  . LEU A 1 54  ? -9.459  -0.407  8.559   1.00 0.00 ? 54  LEU A CD2  4  
ATOM 5077  H H    . LEU A 1 54  ? -5.542  -0.509  7.714   1.00 0.00 ? 54  LEU A H    4  
ATOM 5078  H HA   . LEU A 1 54  ? -7.605  1.436   7.631   1.00 0.00 ? 54  LEU A HA   4  
ATOM 5079  H HB2  . LEU A 1 54  ? -6.312  -0.051  9.920   1.00 0.00 ? 54  LEU A HB2  4  
ATOM 5080  H HB3  . LEU A 1 54  ? -7.724  0.977   10.072  1.00 0.00 ? 54  LEU A HB3  4  
ATOM 5081  H HG   . LEU A 1 54  ? -7.630  -1.446  8.261   1.00 0.00 ? 54  LEU A HG   4  
ATOM 5082  H HD11 . LEU A 1 54  ? -8.838  -2.666  10.003  1.00 0.00 ? 54  LEU A HD11 4  
ATOM 5083  H HD12 . LEU A 1 54  ? -7.227  -2.158  10.564  1.00 0.00 ? 54  LEU A HD12 4  
ATOM 5084  H HD13 . LEU A 1 54  ? -8.676  -1.274  11.101  1.00 0.00 ? 54  LEU A HD13 4  
ATOM 5085  H HD21 . LEU A 1 54  ? -9.627  -0.796  7.555   1.00 0.00 ? 54  LEU A HD21 4  
ATOM 5086  H HD22 . LEU A 1 54  ? -10.239 -0.774  9.226   1.00 0.00 ? 54  LEU A HD22 4  
ATOM 5087  H HD23 . LEU A 1 54  ? -9.484  0.682   8.536   1.00 0.00 ? 54  LEU A HD23 4  
ATOM 5088  N N    . SER A 1 55  ? -4.666  2.227   8.847   1.00 0.00 ? 55  SER A N    4  
ATOM 5089  C CA   . SER A 1 55  ? -3.816  3.341   9.231   1.00 0.00 ? 55  SER A CA   4  
ATOM 5090  C C    . SER A 1 55  ? -2.483  3.264   8.483   1.00 0.00 ? 55  SER A C    4  
ATOM 5091  O O    . SER A 1 55  ? -2.190  2.264   7.830   1.00 0.00 ? 55  SER A O    4  
ATOM 5092  C CB   . SER A 1 55  ? -3.576  3.355   10.742  1.00 0.00 ? 55  SER A CB   4  
ATOM 5093  O OG   . SER A 1 55  ? -3.204  2.071   11.236  1.00 0.00 ? 55  SER A OG   4  
ATOM 5094  H H    . SER A 1 55  ? -4.206  1.340   8.802   1.00 0.00 ? 55  SER A H    4  
ATOM 5095  H HA   . SER A 1 55  ? -4.365  4.237   8.943   1.00 0.00 ? 55  SER A HA   4  
ATOM 5096  H HB2  . SER A 1 55  ? -2.793  4.076   10.978  1.00 0.00 ? 55  SER A HB2  4  
ATOM 5097  H HB3  . SER A 1 55  ? -4.481  3.690   11.249  1.00 0.00 ? 55  SER A HB3  4  
ATOM 5098  H HG   . SER A 1 55  ? -2.231  1.910   11.070  1.00 0.00 ? 55  SER A HG   4  
ATOM 5099  N N    . ILE A 1 56  ? -1.711  4.335   8.603   1.00 0.00 ? 56  ILE A N    4  
ATOM 5100  C CA   . ILE A 1 56  ? -0.417  4.401   7.947   1.00 0.00 ? 56  ILE A CA   4  
ATOM 5101  C C    . ILE A 1 56  ? 0.558   5.182   8.830   1.00 0.00 ? 56  ILE A C    4  
ATOM 5102  O O    . ILE A 1 56  ? 0.319   6.347   9.146   1.00 0.00 ? 56  ILE A O    4  
ATOM 5103  C CB   . ILE A 1 56  ? -0.561  4.973   6.535   1.00 0.00 ? 56  ILE A CB   4  
ATOM 5104  C CG1  . ILE A 1 56  ? -1.215  3.957   5.596   1.00 0.00 ? 56  ILE A CG1  4  
ATOM 5105  C CG2  . ILE A 1 56  ? 0.787   5.462   6.001   1.00 0.00 ? 56  ILE A CG2  4  
ATOM 5106  C CD1  . ILE A 1 56  ? -1.527  4.588   4.237   1.00 0.00 ? 56  ILE A CD1  4  
ATOM 5107  H H    . ILE A 1 56  ? -1.957  5.144   9.136   1.00 0.00 ? 56  ILE A H    4  
ATOM 5108  H HA   . ILE A 1 56  ? -0.049  3.380   7.845   1.00 0.00 ? 56  ILE A HA   4  
ATOM 5109  H HB   . ILE A 1 56  ? -1.222  5.839   6.583   1.00 0.00 ? 56  ILE A HB   4  
ATOM 5110  H HG12 . ILE A 1 56  ? -0.551  3.103   5.461   1.00 0.00 ? 56  ILE A HG12 4  
ATOM 5111  H HG13 . ILE A 1 56  ? -2.133  3.580   6.045   1.00 0.00 ? 56  ILE A HG13 4  
ATOM 5112  H HG21 . ILE A 1 56  ? 1.584   5.129   6.666   1.00 0.00 ? 56  ILE A HG21 4  
ATOM 5113  H HG22 . ILE A 1 56  ? 0.952   5.055   5.004   1.00 0.00 ? 56  ILE A HG22 4  
ATOM 5114  H HG23 . ILE A 1 56  ? 0.785   6.551   5.954   1.00 0.00 ? 56  ILE A HG23 4  
ATOM 5115  H HD11 . ILE A 1 56  ? -2.308  4.012   3.740   1.00 0.00 ? 56  ILE A HD11 4  
ATOM 5116  H HD12 . ILE A 1 56  ? -1.868  5.613   4.383   1.00 0.00 ? 56  ILE A HD12 4  
ATOM 5117  H HD13 . ILE A 1 56  ? -0.628  4.588   3.622   1.00 0.00 ? 56  ILE A HD13 4  
ATOM 5118  N N    . ASP A 1 57  ? 1.637   4.509   9.203   1.00 0.00 ? 57  ASP A N    4  
ATOM 5119  C CA   . ASP A 1 57  ? 2.650   5.126   10.044  1.00 0.00 ? 57  ASP A CA   4  
ATOM 5120  C C    . ASP A 1 57  ? 2.012   5.567   11.363  1.00 0.00 ? 57  ASP A C    4  
ATOM 5121  O O    . ASP A 1 57  ? 2.479   6.512   11.997  1.00 0.00 ? 57  ASP A O    4  
ATOM 5122  C CB   . ASP A 1 57  ? 3.246   6.363   9.370   1.00 0.00 ? 57  ASP A CB   4  
ATOM 5123  C CG   . ASP A 1 57  ? 4.416   7.006   10.118  1.00 0.00 ? 57  ASP A CG   4  
ATOM 5124  O OD1  . ASP A 1 57  ? 5.057   6.276   10.904  1.00 0.00 ? 57  ASP A OD1  4  
ATOM 5125  O OD2  . ASP A 1 57  ? 4.642   8.214   9.887   1.00 0.00 ? 57  ASP A OD2  4  
ATOM 5126  H H    . ASP A 1 57  ? 1.824   3.562   8.942   1.00 0.00 ? 57  ASP A H    4  
ATOM 5127  H HA   . ASP A 1 57  ? 3.411   4.358   10.185  1.00 0.00 ? 57  ASP A HA   4  
ATOM 5128  H HB2  . ASP A 1 57  ? 3.582   6.087   8.370   1.00 0.00 ? 57  ASP A HB2  4  
ATOM 5129  H HB3  . ASP A 1 57  ? 2.459   7.107   9.248   1.00 0.00 ? 57  ASP A HB3  4  
ATOM 5130  N N    . GLY A 1 58  ? 0.954   4.862   11.737  1.00 0.00 ? 58  GLY A N    4  
ATOM 5131  C CA   . GLY A 1 58  ? 0.248   5.169   12.969  1.00 0.00 ? 58  GLY A CA   4  
ATOM 5132  C C    . GLY A 1 58  ? -0.754  6.306   12.757  1.00 0.00 ? 58  GLY A C    4  
ATOM 5133  O O    . GLY A 1 58  ? -1.344  6.804   13.715  1.00 0.00 ? 58  GLY A O    4  
ATOM 5134  H H    . GLY A 1 58  ? 0.580   4.095   11.215  1.00 0.00 ? 58  GLY A H    4  
ATOM 5135  H HA2  . GLY A 1 58  ? -0.274  4.281   13.324  1.00 0.00 ? 58  GLY A HA2  4  
ATOM 5136  H HA3  . GLY A 1 58  ? 0.963   5.449   13.742  1.00 0.00 ? 58  GLY A HA3  4  
ATOM 5137  N N    . ILE A 1 59  ? -0.916  6.682   11.497  1.00 0.00 ? 59  ILE A N    4  
ATOM 5138  C CA   . ILE A 1 59  ? -1.837  7.751   11.148  1.00 0.00 ? 59  ILE A CA   4  
ATOM 5139  C C    . ILE A 1 59  ? -3.084  7.151   10.497  1.00 0.00 ? 59  ILE A C    4  
ATOM 5140  O O    . ILE A 1 59  ? -3.029  6.062   9.927   1.00 0.00 ? 59  ILE A O    4  
ATOM 5141  C CB   . ILE A 1 59  ? -1.136  8.801   10.283  1.00 0.00 ? 59  ILE A CB   4  
ATOM 5142  C CG1  . ILE A 1 59  ? 0.197   9.223   10.906  1.00 0.00 ? 59  ILE A CG1  4  
ATOM 5143  C CG2  . ILE A 1 59  ? -2.052  9.998   10.024  1.00 0.00 ? 59  ILE A CG2  4  
ATOM 5144  C CD1  . ILE A 1 59  ? 0.461   10.712  10.677  1.00 0.00 ? 59  ILE A CD1  4  
ATOM 5145  H H    . ILE A 1 59  ? -0.433  6.272   10.724  1.00 0.00 ? 59  ILE A H    4  
ATOM 5146  H HA   . ILE A 1 59  ? -2.133  8.243   12.075  1.00 0.00 ? 59  ILE A HA   4  
ATOM 5147  H HB   . ILE A 1 59  ? -0.912  8.352   9.316   1.00 0.00 ? 59  ILE A HB   4  
ATOM 5148  H HG12 . ILE A 1 59  ? 0.186   9.012   11.975  1.00 0.00 ? 59  ILE A HG12 4  
ATOM 5149  H HG13 . ILE A 1 59  ? 1.006   8.635   10.473  1.00 0.00 ? 59  ILE A HG13 4  
ATOM 5150  H HG21 . ILE A 1 59  ? -3.021  9.645   9.670   1.00 0.00 ? 59  ILE A HG21 4  
ATOM 5151  H HG22 . ILE A 1 59  ? -2.186  10.560  10.949  1.00 0.00 ? 59  ILE A HG22 4  
ATOM 5152  H HG23 . ILE A 1 59  ? -1.603  10.643  9.269   1.00 0.00 ? 59  ILE A HG23 4  
ATOM 5153  H HD11 . ILE A 1 59  ? 0.408   10.931  9.610   1.00 0.00 ? 59  ILE A HD11 4  
ATOM 5154  H HD12 . ILE A 1 59  ? -0.289  11.300  11.206  1.00 0.00 ? 59  ILE A HD12 4  
ATOM 5155  H HD13 . ILE A 1 59  ? 1.453   10.967  11.051  1.00 0.00 ? 59  ILE A HD13 4  
ATOM 5156  N N    . SER A 1 60  ? -4.181  7.887   10.603  1.00 0.00 ? 60  SER A N    4  
ATOM 5157  C CA   . SER A 1 60  ? -5.440  7.442   10.031  1.00 0.00 ? 60  SER A CA   4  
ATOM 5158  C C    . SER A 1 60  ? -5.359  7.468   8.503   1.00 0.00 ? 60  SER A C    4  
ATOM 5159  O O    . SER A 1 60  ? -5.064  8.504   7.911   1.00 0.00 ? 60  SER A O    4  
ATOM 5160  C CB   . SER A 1 60  ? -6.603  8.309   10.516  1.00 0.00 ? 60  SER A CB   4  
ATOM 5161  O OG   . SER A 1 60  ? -7.678  8.332   9.581   1.00 0.00 ? 60  SER A OG   4  
ATOM 5162  H H    . SER A 1 60  ? -4.217  8.772   11.068  1.00 0.00 ? 60  SER A H    4  
ATOM 5163  H HA   . SER A 1 60  ? -5.574  6.421   10.390  1.00 0.00 ? 60  SER A HA   4  
ATOM 5164  H HB2  . SER A 1 60  ? -6.962  7.932   11.473  1.00 0.00 ? 60  SER A HB2  4  
ATOM 5165  H HB3  . SER A 1 60  ? -6.250  9.326   10.687  1.00 0.00 ? 60  SER A HB3  4  
ATOM 5166  H HG   . SER A 1 60  ? -8.428  7.756   9.908   1.00 0.00 ? 60  SER A HG   4  
ATOM 5167  N N    . ALA A 1 61  ? -5.627  6.314   7.909   1.00 0.00 ? 61  ALA A N    4  
ATOM 5168  C CA   . ALA A 1 61  ? -5.589  6.192   6.461   1.00 0.00 ? 61  ALA A CA   4  
ATOM 5169  C C    . ALA A 1 61  ? -7.018  6.096   5.924   1.00 0.00 ? 61  ALA A C    4  
ATOM 5170  O O    . ALA A 1 61  ? -7.269  5.407   4.936   1.00 0.00 ? 61  ALA A O    4  
ATOM 5171  C CB   . ALA A 1 61  ? -4.738  4.981   6.074   1.00 0.00 ? 61  ALA A CB   4  
ATOM 5172  H H    . ALA A 1 61  ? -5.867  5.475   8.397   1.00 0.00 ? 61  ALA A H    4  
ATOM 5173  H HA   . ALA A 1 61  ? -5.120  7.092   6.064   1.00 0.00 ? 61  ALA A HA   4  
ATOM 5174  H HB1  . ALA A 1 61  ? -4.169  5.210   5.172   1.00 0.00 ? 61  ALA A HB1  4  
ATOM 5175  H HB2  . ALA A 1 61  ? -4.051  4.744   6.886   1.00 0.00 ? 61  ALA A HB2  4  
ATOM 5176  H HB3  . ALA A 1 61  ? -5.387  4.126   5.886   1.00 0.00 ? 61  ALA A HB3  4  
ATOM 5177  N N    . GLN A 1 62  ? -7.918  6.797   6.598   1.00 0.00 ? 62  GLN A N    4  
ATOM 5178  C CA   . GLN A 1 62  ? -9.315  6.800   6.200   1.00 0.00 ? 62  GLN A CA   4  
ATOM 5179  C C    . GLN A 1 62  ? -9.638  8.066   5.403   1.00 0.00 ? 62  GLN A C    4  
ATOM 5180  O O    . GLN A 1 62  ? -10.176 9.027   5.950   1.00 0.00 ? 62  GLN A O    4  
ATOM 5181  C CB   . GLN A 1 62  ? -10.232 6.670   7.418   1.00 0.00 ? 62  GLN A CB   4  
ATOM 5182  C CG   . GLN A 1 62  ? -10.755 5.239   7.560   1.00 0.00 ? 62  GLN A CG   4  
ATOM 5183  C CD   . GLN A 1 62  ? -11.698 5.117   8.759   1.00 0.00 ? 62  GLN A CD   4  
ATOM 5184  O OE1  . GLN A 1 62  ? -11.702 5.934   9.665   1.00 0.00 ? 62  GLN A OE1  4  
ATOM 5185  N NE2  . GLN A 1 62  ? -12.494 4.053   8.715   1.00 0.00 ? 62  GLN A NE2  4  
ATOM 5186  H H    . GLN A 1 62  ? -7.706  7.355   7.400   1.00 0.00 ? 62  GLN A H    4  
ATOM 5187  H HA   . GLN A 1 62  ? -9.438  5.922   5.565   1.00 0.00 ? 62  GLN A HA   4  
ATOM 5188  H HB2  . GLN A 1 62  ? -9.688  6.953   8.319   1.00 0.00 ? 62  GLN A HB2  4  
ATOM 5189  H HB3  . GLN A 1 62  ? -11.071 7.360   7.321   1.00 0.00 ? 62  GLN A HB3  4  
ATOM 5190  H HG2  . GLN A 1 62  ? -11.279 4.948   6.650   1.00 0.00 ? 62  GLN A HG2  4  
ATOM 5191  H HG3  . GLN A 1 62  ? -9.918  4.552   7.680   1.00 0.00 ? 62  GLN A HG3  4  
ATOM 5192  H HE21 . GLN A 1 62  ? -12.441 3.420   7.942   1.00 0.00 ? 62  GLN A HE21 4  
ATOM 5193  H HE22 . GLN A 1 62  ? -13.147 3.885   9.454   1.00 0.00 ? 62  GLN A HE22 4  
ATOM 5194  N N    . GLY A 1 63  ? -9.296  8.025   4.124   1.00 0.00 ? 63  GLY A N    4  
ATOM 5195  C CA   . GLY A 1 63  ? -9.542  9.156   3.246   1.00 0.00 ? 63  GLY A CA   4  
ATOM 5196  C C    . GLY A 1 63  ? -8.325  9.442   2.365   1.00 0.00 ? 63  GLY A C    4  
ATOM 5197  O O    . GLY A 1 63  ? -8.458  9.624   1.156   1.00 0.00 ? 63  GLY A O    4  
ATOM 5198  H H    . GLY A 1 63  ? -8.859  7.238   3.687   1.00 0.00 ? 63  GLY A H    4  
ATOM 5199  H HA2  . GLY A 1 63  ? -10.410 8.952   2.619   1.00 0.00 ? 63  GLY A HA2  4  
ATOM 5200  H HA3  . GLY A 1 63  ? -9.780  10.038  3.842   1.00 0.00 ? 63  GLY A HA3  4  
ATOM 5201  N N    . MET A 1 64  ? -7.165  9.473   3.005   1.00 0.00 ? 64  MET A N    4  
ATOM 5202  C CA   . MET A 1 64  ? -5.925  9.733   2.295   1.00 0.00 ? 64  MET A CA   4  
ATOM 5203  C C    . MET A 1 64  ? -5.912  9.027   0.937   1.00 0.00 ? 64  MET A C    4  
ATOM 5204  O O    . MET A 1 64  ? -6.156  7.824   0.857   1.00 0.00 ? 64  MET A O    4  
ATOM 5205  C CB   . MET A 1 64  ? -4.743  9.246   3.135   1.00 0.00 ? 64  MET A CB   4  
ATOM 5206  C CG   . MET A 1 64  ? -4.445  10.220  4.278   1.00 0.00 ? 64  MET A CG   4  
ATOM 5207  S SD   . MET A 1 64  ? -2.701  10.200  4.657   1.00 0.00 ? 64  MET A SD   4  
ATOM 5208  C CE   . MET A 1 64  ? -2.572  8.600   5.438   1.00 0.00 ? 64  MET A CE   4  
ATOM 5209  H H    . MET A 1 64  ? -7.065  9.323   3.989   1.00 0.00 ? 64  MET A H    4  
ATOM 5210  H HA   . MET A 1 64  ? -5.891  10.813  2.151   1.00 0.00 ? 64  MET A HA   4  
ATOM 5211  H HB2  . MET A 1 64  ? -4.963  8.259   3.542   1.00 0.00 ? 64  MET A HB2  4  
ATOM 5212  H HB3  . MET A 1 64  ? -3.861  9.141   2.503   1.00 0.00 ? 64  MET A HB3  4  
ATOM 5213  H HG2  . MET A 1 64  ? -4.753  11.227  3.998   1.00 0.00 ? 64  MET A HG2  4  
ATOM 5214  H HG3  . MET A 1 64  ? -5.021  9.944   5.161   1.00 0.00 ? 64  MET A HG3  4  
ATOM 5215  H HE1  . MET A 1 64  ? -1.792  8.628   6.199   1.00 0.00 ? 64  MET A HE1  4  
ATOM 5216  H HE2  . MET A 1 64  ? -3.524  8.344   5.903   1.00 0.00 ? 64  MET A HE2  4  
ATOM 5217  H HE3  . MET A 1 64  ? -2.320  7.849   4.688   1.00 0.00 ? 64  MET A HE3  4  
ATOM 5218  N N    . THR A 1 65  ? -5.624  9.805   -0.096  1.00 0.00 ? 65  THR A N    4  
ATOM 5219  C CA   . THR A 1 65  ? -5.575  9.269   -1.446  1.00 0.00 ? 65  THR A CA   4  
ATOM 5220  C C    . THR A 1 65  ? -4.337  8.389   -1.626  1.00 0.00 ? 65  THR A C    4  
ATOM 5221  O O    . THR A 1 65  ? -3.468  8.348   -0.756  1.00 0.00 ? 65  THR A O    4  
ATOM 5222  C CB   . THR A 1 65  ? -5.633  10.445  -2.423  1.00 0.00 ? 65  THR A CB   4  
ATOM 5223  O OG1  . THR A 1 65  ? -4.518  11.254  -2.060  1.00 0.00 ? 65  THR A OG1  4  
ATOM 5224  C CG2  . THR A 1 65  ? -6.844  11.349  -2.181  1.00 0.00 ? 65  THR A CG2  4  
ATOM 5225  H H    . THR A 1 65  ? -5.426  10.783  -0.022  1.00 0.00 ? 65  THR A H    4  
ATOM 5226  H HA   . THR A 1 65  ? -6.446  8.630   -1.593  1.00 0.00 ? 65  THR A HA   4  
ATOM 5227  H HB   . THR A 1 65  ? -5.609  10.094  -3.455  1.00 0.00 ? 65  THR A HB   4  
ATOM 5228  H HG1  . THR A 1 65  ? -3.822  11.219  -2.778  1.00 0.00 ? 65  THR A HG1  4  
ATOM 5229  H HG21 . THR A 1 65  ? -7.527  11.275  -3.027  1.00 0.00 ? 65  THR A HG21 4  
ATOM 5230  H HG22 . THR A 1 65  ? -7.356  11.034  -1.272  1.00 0.00 ? 65  THR A HG22 4  
ATOM 5231  H HG23 . THR A 1 65  ? -6.511  12.381  -2.072  1.00 0.00 ? 65  THR A HG23 4  
ATOM 5232  N N    . HIS A 1 66  ? -4.295  7.707   -2.761  1.00 0.00 ? 66  HIS A N    4  
ATOM 5233  C CA   . HIS A 1 66  ? -3.178  6.830   -3.067  1.00 0.00 ? 66  HIS A CA   4  
ATOM 5234  C C    . HIS A 1 66  ? -1.864  7.598   -2.904  1.00 0.00 ? 66  HIS A C    4  
ATOM 5235  O O    . HIS A 1 66  ? -1.015  7.219   -2.099  1.00 0.00 ? 66  HIS A O    4  
ATOM 5236  C CB   . HIS A 1 66  ? -3.336  6.213   -4.458  1.00 0.00 ? 66  HIS A CB   4  
ATOM 5237  C CG   . HIS A 1 66  ? -2.657  4.874   -4.616  1.00 0.00 ? 66  HIS A CG   4  
ATOM 5238  N ND1  . HIS A 1 66  ? -2.064  4.469   -5.799  1.00 0.00 ? 66  HIS A ND1  4  
ATOM 5239  C CD2  . HIS A 1 66  ? -2.483  3.852   -3.729  1.00 0.00 ? 66  HIS A CD2  4  
ATOM 5240  C CE1  . HIS A 1 66  ? -1.560  3.257   -5.621  1.00 0.00 ? 66  HIS A CE1  4  
ATOM 5241  N NE2  . HIS A 1 66  ? -1.821  2.876   -4.338  1.00 0.00 ? 66  HIS A NE2  4  
ATOM 5242  H H    . HIS A 1 66  ? -5.006  7.746   -3.463  1.00 0.00 ? 66  HIS A H    4  
ATOM 5243  H HA   . HIS A 1 66  ? -3.208  6.020   -2.338  1.00 0.00 ? 66  HIS A HA   4  
ATOM 5244  H HB2  . HIS A 1 66  ? -4.398  6.099   -4.675  1.00 0.00 ? 66  HIS A HB2  4  
ATOM 5245  H HB3  . HIS A 1 66  ? -2.932  6.904   -5.198  1.00 0.00 ? 66  HIS A HB3  4  
ATOM 5246  H HD1  . HIS A 1 66  ? -2.023  5.001   -6.645  1.00 0.00 ? 66  HIS A HD1  4  
ATOM 5247  H HD2  . HIS A 1 66  ? -2.830  3.840   -2.696  1.00 0.00 ? 66  HIS A HD2  4  
ATOM 5248  H HE1  . HIS A 1 66  ? -1.030  2.667   -6.369  1.00 0.00 ? 66  HIS A HE1  4  
ATOM 5249  N N    . LEU A 1 67  ? -1.738  8.663   -3.682  1.00 0.00 ? 67  LEU A N    4  
ATOM 5250  C CA   . LEU A 1 67  ? -0.542  9.487   -3.635  1.00 0.00 ? 67  LEU A CA   4  
ATOM 5251  C C    . LEU A 1 67  ? -0.230  9.841   -2.179  1.00 0.00 ? 67  LEU A C    4  
ATOM 5252  O O    . LEU A 1 67  ? 0.874   9.588   -1.699  1.00 0.00 ? 67  LEU A O    4  
ATOM 5253  C CB   . LEU A 1 67  ? -0.696  10.707  -4.545  1.00 0.00 ? 67  LEU A CB   4  
ATOM 5254  C CG   . LEU A 1 67  ? 0.280   11.858  -4.294  1.00 0.00 ? 67  LEU A CG   4  
ATOM 5255  C CD1  . LEU A 1 67  ? 1.728   11.398  -4.474  1.00 0.00 ? 67  LEU A CD1  4  
ATOM 5256  C CD2  . LEU A 1 67  ? -0.052  13.061  -5.179  1.00 0.00 ? 67  LEU A CD2  4  
ATOM 5257  H H    . LEU A 1 67  ? -2.434  8.964   -4.334  1.00 0.00 ? 67  LEU A H    4  
ATOM 5258  H HA   . LEU A 1 67  ? 0.281   8.891   -4.030  1.00 0.00 ? 67  LEU A HA   4  
ATOM 5259  H HB2  . LEU A 1 67  ? -0.584  10.381  -5.579  1.00 0.00 ? 67  LEU A HB2  4  
ATOM 5260  H HB3  . LEU A 1 67  ? -1.712  11.089  -4.439  1.00 0.00 ? 67  LEU A HB3  4  
ATOM 5261  H HG   . LEU A 1 67  ? 0.171   12.180  -3.259  1.00 0.00 ? 67  LEU A HG   4  
ATOM 5262  H HD11 . LEU A 1 67  ? 2.362   11.897  -3.741  1.00 0.00 ? 67  LEU A HD11 4  
ATOM 5263  H HD12 . LEU A 1 67  ? 1.787   10.319  -4.330  1.00 0.00 ? 67  LEU A HD12 4  
ATOM 5264  H HD13 . LEU A 1 67  ? 2.068   11.649  -5.479  1.00 0.00 ? 67  LEU A HD13 4  
ATOM 5265  H HD21 . LEU A 1 67  ? -1.061  13.408  -4.956  1.00 0.00 ? 67  LEU A HD21 4  
ATOM 5266  H HD22 . LEU A 1 67  ? 0.659   13.864  -4.983  1.00 0.00 ? 67  LEU A HD22 4  
ATOM 5267  H HD23 . LEU A 1 67  ? 0.009   12.770  -6.227  1.00 0.00 ? 67  LEU A HD23 4  
ATOM 5268  N N    . GLU A 1 68  ? -1.221  10.420  -1.519  1.00 0.00 ? 68  GLU A N    4  
ATOM 5269  C CA   . GLU A 1 68  ? -1.065  10.812  -0.128  1.00 0.00 ? 68  GLU A CA   4  
ATOM 5270  C C    . GLU A 1 68  ? -0.514  9.644   0.693   1.00 0.00 ? 68  GLU A C    4  
ATOM 5271  O O    . GLU A 1 68  ? 0.549   9.757   1.302   1.00 0.00 ? 68  GLU A O    4  
ATOM 5272  C CB   . GLU A 1 68  ? -2.389  11.313  0.452   1.00 0.00 ? 68  GLU A CB   4  
ATOM 5273  C CG   . GLU A 1 68  ? -2.765  12.675  -0.136  1.00 0.00 ? 68  GLU A CG   4  
ATOM 5274  C CD   . GLU A 1 68  ? -2.578  13.788  0.897   1.00 0.00 ? 68  GLU A CD   4  
ATOM 5275  O OE1  . GLU A 1 68  ? -3.026  13.578  2.045   1.00 0.00 ? 68  GLU A OE1  4  
ATOM 5276  O OE2  . GLU A 1 68  ? -1.992  14.824  0.514   1.00 0.00 ? 68  GLU A OE2  4  
ATOM 5277  H H    . GLU A 1 68  ? -2.116  10.622  -1.917  1.00 0.00 ? 68  GLU A H    4  
ATOM 5278  H HA   . GLU A 1 68  ? -0.346  11.631  -0.136  1.00 0.00 ? 68  GLU A HA   4  
ATOM 5279  H HB2  . GLU A 1 68  ? -3.179  10.592  0.242   1.00 0.00 ? 68  GLU A HB2  4  
ATOM 5280  H HB3  . GLU A 1 68  ? -2.310  11.391  1.536   1.00 0.00 ? 68  GLU A HB3  4  
ATOM 5281  H HG2  . GLU A 1 68  ? -2.149  12.879  -1.012  1.00 0.00 ? 68  GLU A HG2  4  
ATOM 5282  H HG3  . GLU A 1 68  ? -3.802  12.656  -0.472  1.00 0.00 ? 68  GLU A HG3  4  
ATOM 5283  N N    . ALA A 1 69  ? -1.261  8.550   0.683   1.00 0.00 ? 69  ALA A N    4  
ATOM 5284  C CA   . ALA A 1 69  ? -0.861  7.364   1.420   1.00 0.00 ? 69  ALA A CA   4  
ATOM 5285  C C    . ALA A 1 69  ? 0.578   7.000   1.048   1.00 0.00 ? 69  ALA A C    4  
ATOM 5286  O O    . ALA A 1 69  ? 1.420   6.809   1.924   1.00 0.00 ? 69  ALA A O    4  
ATOM 5287  C CB   . ALA A 1 69  ? -1.843  6.227   1.130   1.00 0.00 ? 69  ALA A CB   4  
ATOM 5288  H H    . ALA A 1 69  ? -2.125  8.467   0.185   1.00 0.00 ? 69  ALA A H    4  
ATOM 5289  H HA   . ALA A 1 69  ? -0.903  7.602   2.483   1.00 0.00 ? 69  ALA A HA   4  
ATOM 5290  H HB1  . ALA A 1 69  ? -2.315  5.909   2.060   1.00 0.00 ? 69  ALA A HB1  4  
ATOM 5291  H HB2  . ALA A 1 69  ? -2.607  6.575   0.435   1.00 0.00 ? 69  ALA A HB2  4  
ATOM 5292  H HB3  . ALA A 1 69  ? -1.307  5.387   0.689   1.00 0.00 ? 69  ALA A HB3  4  
ATOM 5293  N N    . GLN A 1 70  ? 0.816   6.914   -0.253  1.00 0.00 ? 70  GLN A N    4  
ATOM 5294  C CA   . GLN A 1 70  ? 2.138   6.576   -0.751  1.00 0.00 ? 70  GLN A CA   4  
ATOM 5295  C C    . GLN A 1 70  ? 3.187   7.517   -0.154  1.00 0.00 ? 70  GLN A C    4  
ATOM 5296  O O    . GLN A 1 70  ? 4.250   7.073   0.277   1.00 0.00 ? 70  GLN A O    4  
ATOM 5297  C CB   . GLN A 1 70  ? 2.174   6.615   -2.280  1.00 0.00 ? 70  GLN A CB   4  
ATOM 5298  C CG   . GLN A 1 70  ? 1.469   5.395   -2.876  1.00 0.00 ? 70  GLN A CG   4  
ATOM 5299  C CD   . GLN A 1 70  ? 2.459   4.255   -3.123  1.00 0.00 ? 70  GLN A CD   4  
ATOM 5300  O OE1  . GLN A 1 70  ? 3.220   3.860   -2.254  1.00 0.00 ? 70  GLN A OE1  4  
ATOM 5301  N NE2  . GLN A 1 70  ? 2.407   3.750   -4.352  1.00 0.00 ? 70  GLN A NE2  4  
ATOM 5302  H H    . GLN A 1 70  ? 0.125   7.071   -0.959  1.00 0.00 ? 70  GLN A H    4  
ATOM 5303  H HA   . GLN A 1 70  ? 2.322   5.556   -0.415  1.00 0.00 ? 70  GLN A HA   4  
ATOM 5304  H HB2  . GLN A 1 70  ? 1.694   7.527   -2.636  1.00 0.00 ? 70  GLN A HB2  4  
ATOM 5305  H HB3  . GLN A 1 70  ? 3.208   6.644   -2.622  1.00 0.00 ? 70  GLN A HB3  4  
ATOM 5306  H HG2  . GLN A 1 70  ? 0.682   5.059   -2.200  1.00 0.00 ? 70  GLN A HG2  4  
ATOM 5307  H HG3  . GLN A 1 70  ? 0.986   5.672   -3.814  1.00 0.00 ? 70  GLN A HG3  4  
ATOM 5308  H HE21 . GLN A 1 70  ? 1.759   4.120   -5.018  1.00 0.00 ? 70  GLN A HE21 4  
ATOM 5309  H HE22 . GLN A 1 70  ? 3.016   3.000   -4.610  1.00 0.00 ? 70  GLN A HE22 4  
ATOM 5310  N N    . ASN A 1 71  ? 2.850   8.798   -0.147  1.00 0.00 ? 71  ASN A N    4  
ATOM 5311  C CA   . ASN A 1 71  ? 3.750   9.805   0.390   1.00 0.00 ? 71  ASN A CA   4  
ATOM 5312  C C    . ASN A 1 71  ? 4.211   9.378   1.785   1.00 0.00 ? 71  ASN A C    4  
ATOM 5313  O O    . ASN A 1 71  ? 5.410   9.323   2.056   1.00 0.00 ? 71  ASN A O    4  
ATOM 5314  C CB   . ASN A 1 71  ? 3.048   11.159  0.518   1.00 0.00 ? 71  ASN A CB   4  
ATOM 5315  C CG   . ASN A 1 71  ? 3.709   12.206  -0.379  1.00 0.00 ? 71  ASN A CG   4  
ATOM 5316  O OD1  . ASN A 1 71  ? 4.806   12.676  -0.125  1.00 0.00 ? 71  ASN A OD1  4  
ATOM 5317  N ND2  . ASN A 1 71  ? 2.983   12.545  -1.441  1.00 0.00 ? 71  ASN A ND2  4  
ATOM 5318  H H    . ASN A 1 71  ? 1.983   9.151   -0.499  1.00 0.00 ? 71  ASN A H    4  
ATOM 5319  H HA   . ASN A 1 71  ? 4.573   9.863   -0.322  1.00 0.00 ? 71  ASN A HA   4  
ATOM 5320  H HB2  . ASN A 1 71  ? 1.997   11.054  0.248   1.00 0.00 ? 71  ASN A HB2  4  
ATOM 5321  H HB3  . ASN A 1 71  ? 3.078   11.492  1.556   1.00 0.00 ? 71  ASN A HB3  4  
ATOM 5322  H HD21 . ASN A 1 71  ? 2.090   12.122  -1.592  1.00 0.00 ? 71  ASN A HD21 4  
ATOM 5323  H HD22 . ASN A 1 71  ? 3.331   13.224  -2.088  1.00 0.00 ? 71  ASN A HD22 4  
ATOM 5324  N N    . LYS A 1 72  ? 3.236   9.087   2.633   1.00 0.00 ? 72  LYS A N    4  
ATOM 5325  C CA   . LYS A 1 72  ? 3.527   8.667   3.993   1.00 0.00 ? 72  LYS A CA   4  
ATOM 5326  C C    . LYS A 1 72  ? 4.541   7.521   3.962   1.00 0.00 ? 72  LYS A C    4  
ATOM 5327  O O    . LYS A 1 72  ? 5.647   7.652   4.486   1.00 0.00 ? 72  LYS A O    4  
ATOM 5328  C CB   . LYS A 1 72  ? 2.235   8.324   4.737   1.00 0.00 ? 72  LYS A CB   4  
ATOM 5329  C CG   . LYS A 1 72  ? 1.376   9.573   4.948   1.00 0.00 ? 72  LYS A CG   4  
ATOM 5330  C CD   . LYS A 1 72  ? 2.021   10.515  5.966   1.00 0.00 ? 72  LYS A CD   4  
ATOM 5331  C CE   . LYS A 1 72  ? 1.260   10.493  7.293   1.00 0.00 ? 72  LYS A CE   4  
ATOM 5332  N NZ   . LYS A 1 72  ? -0.003  11.257  7.180   1.00 0.00 ? 72  LYS A NZ   4  
ATOM 5333  H H    . LYS A 1 72  ? 2.264   9.134   2.404   1.00 0.00 ? 72  LYS A H    4  
ATOM 5334  H HA   . LYS A 1 72  ? 3.980   9.515   4.507   1.00 0.00 ? 72  LYS A HA   4  
ATOM 5335  H HB2  . LYS A 1 72  ? 1.671   7.582   4.171   1.00 0.00 ? 72  LYS A HB2  4  
ATOM 5336  H HB3  . LYS A 1 72  ? 2.474   7.875   5.701   1.00 0.00 ? 72  LYS A HB3  4  
ATOM 5337  H HG2  . LYS A 1 72  ? 1.244   10.092  3.999   1.00 0.00 ? 72  LYS A HG2  4  
ATOM 5338  H HG3  . LYS A 1 72  ? 0.384   9.282   5.293   1.00 0.00 ? 72  LYS A HG3  4  
ATOM 5339  H HD2  . LYS A 1 72  ? 3.058   10.223  6.132   1.00 0.00 ? 72  LYS A HD2  4  
ATOM 5340  H HD3  . LYS A 1 72  ? 2.035   11.530  5.568   1.00 0.00 ? 72  LYS A HD3  4  
ATOM 5341  H HE2  . LYS A 1 72  ? 1.044   9.463   7.577   1.00 0.00 ? 72  LYS A HE2  4  
ATOM 5342  H HE3  . LYS A 1 72  ? 1.880   10.918  8.082   1.00 0.00 ? 72  LYS A HE3  4  
ATOM 5343  H HZ1  . LYS A 1 72  ? -0.154  11.511  6.224   1.00 0.00 ? 72  LYS A HZ1  4  
ATOM 5344  H HZ2  . LYS A 1 72  ? -0.764  10.692  7.499   1.00 0.00 ? 72  LYS A HZ2  4  
ATOM 5345  H HZ3  . LYS A 1 72  ? 0.057   12.083  7.739   1.00 0.00 ? 72  LYS A HZ3  4  
ATOM 5346  N N    . ILE A 1 73  ? 4.129   6.425   3.343   1.00 0.00 ? 73  ILE A N    4  
ATOM 5347  C CA   . ILE A 1 73  ? 4.987   5.257   3.237   1.00 0.00 ? 73  ILE A CA   4  
ATOM 5348  C C    . ILE A 1 73  ? 6.379   5.693   2.775   1.00 0.00 ? 73  ILE A C    4  
ATOM 5349  O O    . ILE A 1 73  ? 7.387   5.180   3.258   1.00 0.00 ? 73  ILE A O    4  
ATOM 5350  C CB   . ILE A 1 73  ? 4.344   4.199   2.339   1.00 0.00 ? 73  ILE A CB   4  
ATOM 5351  C CG1  . ILE A 1 73  ? 3.050   3.667   2.957   1.00 0.00 ? 73  ILE A CG1  4  
ATOM 5352  C CG2  . ILE A 1 73  ? 5.332   3.075   2.022   1.00 0.00 ? 73  ILE A CG2  4  
ATOM 5353  C CD1  . ILE A 1 73  ? 1.906   3.691   1.941   1.00 0.00 ? 73  ILE A CD1  4  
ATOM 5354  H H    . ILE A 1 73  ? 3.228   6.327   2.920   1.00 0.00 ? 73  ILE A H    4  
ATOM 5355  H HA   . ILE A 1 73  ? 5.074   4.824   4.234   1.00 0.00 ? 73  ILE A HA   4  
ATOM 5356  H HB   . ILE A 1 73  ? 4.079   4.671   1.392   1.00 0.00 ? 73  ILE A HB   4  
ATOM 5357  H HG12 . ILE A 1 73  ? 3.204   2.648   3.312   1.00 0.00 ? 73  ILE A HG12 4  
ATOM 5358  H HG13 . ILE A 1 73  ? 2.783   4.270   3.825   1.00 0.00 ? 73  ILE A HG13 4  
ATOM 5359  H HG21 . ILE A 1 73  ? 6.170   3.121   2.718   1.00 0.00 ? 73  ILE A HG21 4  
ATOM 5360  H HG22 . ILE A 1 73  ? 4.831   2.112   2.120   1.00 0.00 ? 73  ILE A HG22 4  
ATOM 5361  H HG23 . ILE A 1 73  ? 5.700   3.191   1.002   1.00 0.00 ? 73  ILE A HG23 4  
ATOM 5362  H HD11 . ILE A 1 73  ? 2.055   2.899   1.208   1.00 0.00 ? 73  ILE A HD11 4  
ATOM 5363  H HD12 . ILE A 1 73  ? 0.959   3.536   2.457   1.00 0.00 ? 73  ILE A HD12 4  
ATOM 5364  H HD13 . ILE A 1 73  ? 1.890   4.657   1.435   1.00 0.00 ? 73  ILE A HD13 4  
ATOM 5365  N N    . LYS A 1 74  ? 6.390   6.637   1.845   1.00 0.00 ? 74  LYS A N    4  
ATOM 5366  C CA   . LYS A 1 74  ? 7.642   7.148   1.312   1.00 0.00 ? 74  LYS A CA   4  
ATOM 5367  C C    . LYS A 1 74  ? 8.475   7.735   2.454   1.00 0.00 ? 74  LYS A C    4  
ATOM 5368  O O    . LYS A 1 74  ? 9.684   7.519   2.519   1.00 0.00 ? 74  LYS A O    4  
ATOM 5369  C CB   . LYS A 1 74  ? 7.376   8.135   0.174   1.00 0.00 ? 74  LYS A CB   4  
ATOM 5370  C CG   . LYS A 1 74  ? 8.048   7.673   -1.121  1.00 0.00 ? 74  LYS A CG   4  
ATOM 5371  C CD   . LYS A 1 74  ? 7.517   8.455   -2.323  1.00 0.00 ? 74  LYS A CD   4  
ATOM 5372  C CE   . LYS A 1 74  ? 6.336   7.730   -2.971  1.00 0.00 ? 74  LYS A CE   4  
ATOM 5373  N NZ   . LYS A 1 74  ? 6.808   6.821   -4.039  1.00 0.00 ? 74  LYS A NZ   4  
ATOM 5374  H H    . LYS A 1 74  ? 5.566   7.050   1.458   1.00 0.00 ? 74  LYS A H    4  
ATOM 5375  H HA   . LYS A 1 74  ? 8.184   6.304   0.887   1.00 0.00 ? 74  LYS A HA   4  
ATOM 5376  H HB2  . LYS A 1 74  ? 6.302   8.234   0.016   1.00 0.00 ? 74  LYS A HB2  4  
ATOM 5377  H HB3  . LYS A 1 74  ? 7.749   9.122   0.449   1.00 0.00 ? 74  LYS A HB3  4  
ATOM 5378  H HG2  . LYS A 1 74  ? 9.127   7.807   -1.043  1.00 0.00 ? 74  LYS A HG2  4  
ATOM 5379  H HG3  . LYS A 1 74  ? 7.868   6.608   -1.267  1.00 0.00 ? 74  LYS A HG3  4  
ATOM 5380  H HD2  . LYS A 1 74  ? 7.207   9.451   -2.006  1.00 0.00 ? 74  LYS A HD2  4  
ATOM 5381  H HD3  . LYS A 1 74  ? 8.313   8.588   -3.056  1.00 0.00 ? 74  LYS A HD3  4  
ATOM 5382  H HE2  . LYS A 1 74  ? 5.792   7.162   -2.217  1.00 0.00 ? 74  LYS A HE2  4  
ATOM 5383  H HE3  . LYS A 1 74  ? 5.639   8.457   -3.387  1.00 0.00 ? 74  LYS A HE3  4  
ATOM 5384  H HZ1  . LYS A 1 74  ? 6.984   7.347   -4.871  1.00 0.00 ? 74  LYS A HZ1  4  
ATOM 5385  H HZ2  . LYS A 1 74  ? 7.652   6.371   -3.745  1.00 0.00 ? 74  LYS A HZ2  4  
ATOM 5386  H HZ3  . LYS A 1 74  ? 6.109   6.130   -4.222  1.00 0.00 ? 74  LYS A HZ3  4  
ATOM 5387  N N    . ALA A 1 75  ? 7.795   8.466   3.325   1.00 0.00 ? 75  ALA A N    4  
ATOM 5388  C CA   . ALA A 1 75  ? 8.458   9.086   4.460   1.00 0.00 ? 75  ALA A CA   4  
ATOM 5389  C C    . ALA A 1 75  ? 9.186   8.010   5.269   1.00 0.00 ? 75  ALA A C    4  
ATOM 5390  O O    . ALA A 1 75  ? 10.221  8.281   5.877   1.00 0.00 ? 75  ALA A O    4  
ATOM 5391  C CB   . ALA A 1 75  ? 7.429   9.848   5.297   1.00 0.00 ? 75  ALA A CB   4  
ATOM 5392  H H    . ALA A 1 75  ? 6.812   8.637   3.264   1.00 0.00 ? 75  ALA A H    4  
ATOM 5393  H HA   . ALA A 1 75  ? 9.189   9.794   4.071   1.00 0.00 ? 75  ALA A HA   4  
ATOM 5394  H HB1  . ALA A 1 75  ? 6.839   9.141   5.880   1.00 0.00 ? 75  ALA A HB1  4  
ATOM 5395  H HB2  . ALA A 1 75  ? 7.945   10.533  5.970   1.00 0.00 ? 75  ALA A HB2  4  
ATOM 5396  H HB3  . ALA A 1 75  ? 6.771   10.414  4.638   1.00 0.00 ? 75  ALA A HB3  4  
ATOM 5397  N N    . CYS A 1 76  ? 8.617   6.814   5.250   1.00 0.00 ? 76  CYS A N    4  
ATOM 5398  C CA   . CYS A 1 76  ? 9.200   5.697   5.974   1.00 0.00 ? 76  CYS A CA   4  
ATOM 5399  C C    . CYS A 1 76  ? 10.423  5.206   5.197   1.00 0.00 ? 76  CYS A C    4  
ATOM 5400  O O    . CYS A 1 76  ? 10.285  4.526   4.181   1.00 0.00 ? 76  CYS A O    4  
ATOM 5401  C CB   . CYS A 1 76  ? 8.181   4.578   6.203   1.00 0.00 ? 76  CYS A CB   4  
ATOM 5402  S SG   . CYS A 1 76  ? 7.337   4.819   7.808   1.00 0.00 ? 76  CYS A SG   4  
ATOM 5403  H H    . CYS A 1 76  ? 7.776   6.603   4.753   1.00 0.00 ? 76  CYS A H    4  
ATOM 5404  H HA   . CYS A 1 76  ? 9.491   6.076   6.954   1.00 0.00 ? 76  CYS A HA   4  
ATOM 5405  H HB2  . CYS A 1 76  ? 7.450   4.571   5.395   1.00 0.00 ? 76  CYS A HB2  4  
ATOM 5406  H HB3  . CYS A 1 76  ? 8.683   3.610   6.188   1.00 0.00 ? 76  CYS A HB3  4  
ATOM 5407  H HG   . CYS A 1 76  ? 6.847   6.023   7.528   1.00 0.00 ? 76  CYS A HG   4  
ATOM 5408  N N    . THR A 1 77  ? 11.591  5.569   5.704   1.00 0.00 ? 77  THR A N    4  
ATOM 5409  C CA   . THR A 1 77  ? 12.838  5.174   5.070   1.00 0.00 ? 77  THR A CA   4  
ATOM 5410  C C    . THR A 1 77  ? 13.527  4.079   5.886   1.00 0.00 ? 77  THR A C    4  
ATOM 5411  O O    . THR A 1 77  ? 14.589  3.590   5.503   1.00 0.00 ? 77  THR A O    4  
ATOM 5412  C CB   . THR A 1 77  ? 13.695  6.428   4.890   1.00 0.00 ? 77  THR A CB   4  
ATOM 5413  O OG1  . THR A 1 77  ? 13.468  7.179   6.080   1.00 0.00 ? 77  THR A OG1  4  
ATOM 5414  C CG2  . THR A 1 77  ? 13.177  7.336   3.772   1.00 0.00 ? 77  THR A CG2  4  
ATOM 5415  H H    . THR A 1 77  ? 11.695  6.123   6.531   1.00 0.00 ? 77  THR A H    4  
ATOM 5416  H HA   . THR A 1 77  ? 12.606  4.748   4.094   1.00 0.00 ? 77  THR A HA   4  
ATOM 5417  H HB   . THR A 1 77  ? 14.740  6.165   4.725   1.00 0.00 ? 77  THR A HB   4  
ATOM 5418  H HG1  . THR A 1 77  ? 14.186  6.986   6.748   1.00 0.00 ? 77  THR A HG1  4  
ATOM 5419  H HG21 . THR A 1 77  ? 13.895  8.137   3.592   1.00 0.00 ? 77  THR A HG21 4  
ATOM 5420  H HG22 . THR A 1 77  ? 13.047  6.753   2.861   1.00 0.00 ? 77  THR A HG22 4  
ATOM 5421  H HG23 . THR A 1 77  ? 12.220  7.766   4.068   1.00 0.00 ? 77  THR A HG23 4  
ATOM 5422  N N    . GLY A 1 78  ? 12.895  3.726   6.995   1.00 0.00 ? 78  GLY A N    4  
ATOM 5423  C CA   . GLY A 1 78  ? 13.435  2.697   7.869   1.00 0.00 ? 78  GLY A CA   4  
ATOM 5424  C C    . GLY A 1 78  ? 12.456  1.530   8.011   1.00 0.00 ? 78  GLY A C    4  
ATOM 5425  O O    . GLY A 1 78  ? 12.690  0.449   7.472   1.00 0.00 ? 78  GLY A O    4  
ATOM 5426  H H    . GLY A 1 78  ? 12.032  4.128   7.300   1.00 0.00 ? 78  GLY A H    4  
ATOM 5427  H HA2  . GLY A 1 78  ? 14.382  2.335   7.468   1.00 0.00 ? 78  GLY A HA2  4  
ATOM 5428  H HA3  . GLY A 1 78  ? 13.645  3.122   8.850   1.00 0.00 ? 78  GLY A HA3  4  
ATOM 5429  N N    . SER A 1 79  ? 11.379  1.788   8.740   1.00 0.00 ? 79  SER A N    4  
ATOM 5430  C CA   . SER A 1 79  ? 10.364  0.772   8.960   1.00 0.00 ? 79  SER A CA   4  
ATOM 5431  C C    . SER A 1 79  ? 8.988   1.314   8.568   1.00 0.00 ? 79  SER A C    4  
ATOM 5432  O O    . SER A 1 79  ? 8.804   2.525   8.449   1.00 0.00 ? 79  SER A O    4  
ATOM 5433  C CB   . SER A 1 79  ? 10.356  0.308   10.418  1.00 0.00 ? 79  SER A CB   4  
ATOM 5434  O OG   . SER A 1 79  ? 10.648  1.373   11.318  1.00 0.00 ? 79  SER A OG   4  
ATOM 5435  H H    . SER A 1 79  ? 11.196  2.670   9.174   1.00 0.00 ? 79  SER A H    4  
ATOM 5436  H HA   . SER A 1 79  ? 10.645  -0.061  8.316   1.00 0.00 ? 79  SER A HA   4  
ATOM 5437  H HB2  . SER A 1 79  ? 9.380   -0.113  10.659  1.00 0.00 ? 79  SER A HB2  4  
ATOM 5438  H HB3  . SER A 1 79  ? 11.088  -0.489  10.549  1.00 0.00 ? 79  SER A HB3  4  
ATOM 5439  H HG   . SER A 1 79  ? 10.350  1.132   12.242  1.00 0.00 ? 79  SER A HG   4  
ATOM 5440  N N    . LEU A 1 80  ? 8.056   0.392   8.376   1.00 0.00 ? 80  LEU A N    4  
ATOM 5441  C CA   . LEU A 1 80  ? 6.703   0.762   8.000   1.00 0.00 ? 80  LEU A CA   4  
ATOM 5442  C C    . LEU A 1 80  ? 5.722   0.218   9.040   1.00 0.00 ? 80  LEU A C    4  
ATOM 5443  O O    . LEU A 1 80  ? 5.634   -0.992  9.243   1.00 0.00 ? 80  LEU A O    4  
ATOM 5444  C CB   . LEU A 1 80  ? 6.400   0.305   6.571   1.00 0.00 ? 80  LEU A CB   4  
ATOM 5445  C CG   . LEU A 1 80  ? 5.312   1.088   5.833   1.00 0.00 ? 80  LEU A CG   4  
ATOM 5446  C CD1  . LEU A 1 80  ? 5.788   2.503   5.497   1.00 0.00 ? 80  LEU A CD1  4  
ATOM 5447  C CD2  . LEU A 1 80  ? 4.839   0.331   4.591   1.00 0.00 ? 80  LEU A CD2  4  
ATOM 5448  H H    . LEU A 1 80  ? 8.214   -0.591  8.475   1.00 0.00 ? 80  LEU A H    4  
ATOM 5449  H HA   . LEU A 1 80  ? 6.647   1.850   8.009   1.00 0.00 ? 80  LEU A HA   4  
ATOM 5450  H HB2  . LEU A 1 80  ? 7.320   0.364   5.990   1.00 0.00 ? 80  LEU A HB2  4  
ATOM 5451  H HB3  . LEU A 1 80  ? 6.108   -0.744  6.601   1.00 0.00 ? 80  LEU A HB3  4  
ATOM 5452  H HG   . LEU A 1 80  ? 4.453   1.187   6.496   1.00 0.00 ? 80  LEU A HG   4  
ATOM 5453  H HD11 . LEU A 1 80  ? 6.436   2.469   4.621   1.00 0.00 ? 80  LEU A HD11 4  
ATOM 5454  H HD12 . LEU A 1 80  ? 4.925   3.135   5.286   1.00 0.00 ? 80  LEU A HD12 4  
ATOM 5455  H HD13 . LEU A 1 80  ? 6.340   2.912   6.343   1.00 0.00 ? 80  LEU A HD13 4  
ATOM 5456  H HD21 . LEU A 1 80  ? 3.996   0.858   4.143   1.00 0.00 ? 80  LEU A HD21 4  
ATOM 5457  H HD22 . LEU A 1 80  ? 5.655   0.272   3.870   1.00 0.00 ? 80  LEU A HD22 4  
ATOM 5458  H HD23 . LEU A 1 80  ? 4.531   -0.675  4.874   1.00 0.00 ? 80  LEU A HD23 4  
ATOM 5459  N N    . ASN A 1 81  ? 5.008   1.138   9.673   1.00 0.00 ? 81  ASN A N    4  
ATOM 5460  C CA   . ASN A 1 81  ? 4.037   0.766   10.687  1.00 0.00 ? 81  ASN A CA   4  
ATOM 5461  C C    . ASN A 1 81  ? 2.632   1.117   10.195  1.00 0.00 ? 81  ASN A C    4  
ATOM 5462  O O    . ASN A 1 81  ? 2.249   2.286   10.181  1.00 0.00 ? 81  ASN A O    4  
ATOM 5463  C CB   . ASN A 1 81  ? 4.284   1.526   11.992  1.00 0.00 ? 81  ASN A CB   4  
ATOM 5464  C CG   . ASN A 1 81  ? 5.021   0.648   13.006  1.00 0.00 ? 81  ASN A CG   4  
ATOM 5465  O OD1  . ASN A 1 81  ? 4.464   0.194   13.993  1.00 0.00 ? 81  ASN A OD1  4  
ATOM 5466  N ND2  . ASN A 1 81  ? 6.300   0.436   12.710  1.00 0.00 ? 81  ASN A ND2  4  
ATOM 5467  H H    . ASN A 1 81  ? 5.086   2.120   9.502   1.00 0.00 ? 81  ASN A H    4  
ATOM 5468  H HA   . ASN A 1 81  ? 4.172   -0.306  10.834  1.00 0.00 ? 81  ASN A HA   4  
ATOM 5469  H HB2  . ASN A 1 81  ? 4.870   2.423   11.789  1.00 0.00 ? 81  ASN A HB2  4  
ATOM 5470  H HB3  . ASN A 1 81  ? 3.334   1.854   12.412  1.00 0.00 ? 81  ASN A HB3  4  
ATOM 5471  H HD21 . ASN A 1 81  ? 6.695   0.839   11.885  1.00 0.00 ? 81  ASN A HD21 4  
ATOM 5472  H HD22 . ASN A 1 81  ? 6.866   -0.125  13.314  1.00 0.00 ? 81  ASN A HD22 4  
ATOM 5473  N N    . MET A 1 82  ? 1.901   0.083   9.803   1.00 0.00 ? 82  MET A N    4  
ATOM 5474  C CA   . MET A 1 82  ? 0.547   0.268   9.311   1.00 0.00 ? 82  MET A CA   4  
ATOM 5475  C C    . MET A 1 82  ? -0.382  -0.827  9.839   1.00 0.00 ? 82  MET A C    4  
ATOM 5476  O O    . MET A 1 82  ? 0.071   -1.916  10.187  1.00 0.00 ? 82  MET A O    4  
ATOM 5477  C CB   . MET A 1 82  ? 0.551   0.239   7.781   1.00 0.00 ? 82  MET A CB   4  
ATOM 5478  C CG   . MET A 1 82  ? 1.677   1.110   7.219   1.00 0.00 ? 82  MET A CG   4  
ATOM 5479  S SD   . MET A 1 82  ? 1.520   1.242   5.446   1.00 0.00 ? 82  MET A SD   4  
ATOM 5480  C CE   . MET A 1 82  ? 1.740   -0.468  4.987   1.00 0.00 ? 82  MET A CE   4  
ATOM 5481  H H    . MET A 1 82  ? 2.220   -0.865  9.817   1.00 0.00 ? 82  MET A H    4  
ATOM 5482  H HA   . MET A 1 82  ? 0.228   1.239   9.689   1.00 0.00 ? 82  MET A HA   4  
ATOM 5483  H HB2  . MET A 1 82  ? 0.671   -0.786  7.433   1.00 0.00 ? 82  MET A HB2  4  
ATOM 5484  H HB3  . MET A 1 82  ? -0.409  0.593   7.405   1.00 0.00 ? 82  MET A HB3  4  
ATOM 5485  H HG2  . MET A 1 82  ? 1.641   2.102   7.671   1.00 0.00 ? 82  MET A HG2  4  
ATOM 5486  H HG3  . MET A 1 82  ? 2.644   0.678   7.476   1.00 0.00 ? 82  MET A HG3  4  
ATOM 5487  H HE1  . MET A 1 82  ? 0.849   -0.824  4.471   1.00 0.00 ? 82  MET A HE1  4  
ATOM 5488  H HE2  . MET A 1 82  ? 2.603   -0.559  4.326   1.00 0.00 ? 82  MET A HE2  4  
ATOM 5489  H HE3  . MET A 1 82  ? 1.905   -1.067  5.883   1.00 0.00 ? 82  MET A HE3  4  
ATOM 5490  N N    . THR A 1 83  ? -1.665  -0.499  9.883   1.00 0.00 ? 83  THR A N    4  
ATOM 5491  C CA   . THR A 1 83  ? -2.662  -1.441  10.363  1.00 0.00 ? 83  THR A CA   4  
ATOM 5492  C C    . THR A 1 83  ? -3.423  -2.058  9.188   1.00 0.00 ? 83  THR A C    4  
ATOM 5493  O O    . THR A 1 83  ? -3.577  -1.427  8.144   1.00 0.00 ? 83  THR A O    4  
ATOM 5494  C CB   . THR A 1 83  ? -3.567  -0.707  11.354  1.00 0.00 ? 83  THR A CB   4  
ATOM 5495  O OG1  . THR A 1 83  ? -2.659  -0.044  12.229  1.00 0.00 ? 83  THR A OG1  4  
ATOM 5496  C CG2  . THR A 1 83  ? -4.333  -1.665  12.269  1.00 0.00 ? 83  THR A CG2  4  
ATOM 5497  H H    . THR A 1 83  ? -2.026  0.389   9.598   1.00 0.00 ? 83  THR A H    4  
ATOM 5498  H HA   . THR A 1 83  ? -2.148  -2.255  10.874  1.00 0.00 ? 83  THR A HA   4  
ATOM 5499  H HB   . THR A 1 83  ? -4.251  -0.036  10.834  1.00 0.00 ? 83  THR A HB   4  
ATOM 5500  H HG1  . THR A 1 83  ? -3.069  0.800   12.574  1.00 0.00 ? 83  THR A HG1  4  
ATOM 5501  H HG21 . THR A 1 83  ? -3.672  -2.473  12.583  1.00 0.00 ? 83  THR A HG21 4  
ATOM 5502  H HG22 . THR A 1 83  ? -4.688  -1.124  13.146  1.00 0.00 ? 83  THR A HG22 4  
ATOM 5503  H HG23 . THR A 1 83  ? -5.184  -2.081  11.729  1.00 0.00 ? 83  THR A HG23 4  
ATOM 5504  N N    . LEU A 1 84  ? -3.878  -3.285  9.398   1.00 0.00 ? 84  LEU A N    4  
ATOM 5505  C CA   . LEU A 1 84  ? -4.619  -3.994  8.369   1.00 0.00 ? 84  LEU A CA   4  
ATOM 5506  C C    . LEU A 1 84  ? -6.015  -4.335  8.895   1.00 0.00 ? 84  LEU A C    4  
ATOM 5507  O O    . LEU A 1 84  ? -6.248  -4.318  10.102  1.00 0.00 ? 84  LEU A O    4  
ATOM 5508  C CB   . LEU A 1 84  ? -3.830  -5.212  7.884   1.00 0.00 ? 84  LEU A CB   4  
ATOM 5509  C CG   . LEU A 1 84  ? -2.402  -4.939  7.407   1.00 0.00 ? 84  LEU A CG   4  
ATOM 5510  C CD1  . LEU A 1 84  ? -1.743  -6.220  6.891   1.00 0.00 ? 84  LEU A CD1  4  
ATOM 5511  C CD2  . LEU A 1 84  ? -2.377  -3.821  6.362   1.00 0.00 ? 84  LEU A CD2  4  
ATOM 5512  H H    . LEU A 1 84  ? -3.749  -3.791  10.250  1.00 0.00 ? 84  LEU A H    4  
ATOM 5513  H HA   . LEU A 1 84  ? -4.725  -3.320  7.519   1.00 0.00 ? 84  LEU A HA   4  
ATOM 5514  H HB2  . LEU A 1 84  ? -3.788  -5.939  8.695   1.00 0.00 ? 84  LEU A HB2  4  
ATOM 5515  H HB3  . LEU A 1 84  ? -4.383  -5.676  7.067   1.00 0.00 ? 84  LEU A HB3  4  
ATOM 5516  H HG   . LEU A 1 84  ? -1.817  -4.597  8.259   1.00 0.00 ? 84  LEU A HG   4  
ATOM 5517  H HD11 . LEU A 1 84  ? -0.670  -6.059  6.785   1.00 0.00 ? 84  LEU A HD11 4  
ATOM 5518  H HD12 . LEU A 1 84  ? -1.921  -7.030  7.598   1.00 0.00 ? 84  LEU A HD12 4  
ATOM 5519  H HD13 . LEU A 1 84  ? -2.168  -6.483  5.922   1.00 0.00 ? 84  LEU A HD13 4  
ATOM 5520  H HD21 . LEU A 1 84  ? -3.212  -3.949  5.673   1.00 0.00 ? 84  LEU A HD21 4  
ATOM 5521  H HD22 . LEU A 1 84  ? -2.462  -2.856  6.862   1.00 0.00 ? 84  LEU A HD22 4  
ATOM 5522  H HD23 . LEU A 1 84  ? -1.439  -3.862  5.808   1.00 0.00 ? 84  LEU A HD23 4  
ATOM 5523  N N    . GLN A 1 85  ? -6.906  -4.637  7.962   1.00 0.00 ? 85  GLN A N    4  
ATOM 5524  C CA   . GLN A 1 85  ? -8.273  -4.981  8.316   1.00 0.00 ? 85  GLN A CA   4  
ATOM 5525  C C    . GLN A 1 85  ? -8.534  -6.464  8.044   1.00 0.00 ? 85  GLN A C    4  
ATOM 5526  O O    . GLN A 1 85  ? -8.420  -6.919  6.907   1.00 0.00 ? 85  GLN A O    4  
ATOM 5527  C CB   . GLN A 1 85  ? -9.273  -4.101  7.565   1.00 0.00 ? 85  GLN A CB   4  
ATOM 5528  C CG   . GLN A 1 85  ? -10.676 -4.711  7.600   1.00 0.00 ? 85  GLN A CG   4  
ATOM 5529  C CD   . GLN A 1 85  ? -11.664 -3.860  6.800   1.00 0.00 ? 85  GLN A CD   4  
ATOM 5530  O OE1  . GLN A 1 85  ? -11.620 -3.791  5.583   1.00 0.00 ? 85  GLN A OE1  4  
ATOM 5531  N NE2  . GLN A 1 85  ? -12.556 -3.218  7.549   1.00 0.00 ? 85  GLN A NE2  4  
ATOM 5532  H H    . GLN A 1 85  ? -6.708  -4.648  6.982   1.00 0.00 ? 85  GLN A H    4  
ATOM 5533  H HA   . GLN A 1 85  ? -8.354  -4.782  9.385   1.00 0.00 ? 85  GLN A HA   4  
ATOM 5534  H HB2  . GLN A 1 85  ? -9.294  -3.106  8.010   1.00 0.00 ? 85  GLN A HB2  4  
ATOM 5535  H HB3  . GLN A 1 85  ? -8.951  -3.980  6.530   1.00 0.00 ? 85  GLN A HB3  4  
ATOM 5536  H HG2  . GLN A 1 85  ? -10.647 -5.721  7.192   1.00 0.00 ? 85  GLN A HG2  4  
ATOM 5537  H HG3  . GLN A 1 85  ? -11.014 -4.793  8.633   1.00 0.00 ? 85  GLN A HG3  4  
ATOM 5538  H HE21 . GLN A 1 85  ? -12.537 -3.318  8.544   1.00 0.00 ? 85  GLN A HE21 4  
ATOM 5539  H HE22 . GLN A 1 85  ? -13.245 -2.636  7.118   1.00 0.00 ? 85  GLN A HE22 4  
ATOM 5540  N N    . ARG A 1 86  ? -8.880  -7.176  9.106   1.00 0.00 ? 86  ARG A N    4  
ATOM 5541  C CA   . ARG A 1 86  ? -9.159  -8.598  8.995   1.00 0.00 ? 86  ARG A CA   4  
ATOM 5542  C C    . ARG A 1 86  ? -10.551 -8.821  8.402   1.00 0.00 ? 86  ARG A C    4  
ATOM 5543  O O    . ARG A 1 86  ? -11.446 -7.996  8.580   1.00 0.00 ? 86  ARG A O    4  
ATOM 5544  C CB   . ARG A 1 86  ? -9.078  -9.283  10.361  1.00 0.00 ? 86  ARG A CB   4  
ATOM 5545  C CG   . ARG A 1 86  ? -10.378 -9.097  11.145  1.00 0.00 ? 86  ARG A CG   4  
ATOM 5546  C CD   . ARG A 1 86  ? -10.639 -7.617  11.432  1.00 0.00 ? 86  ARG A CD   4  
ATOM 5547  N NE   . ARG A 1 86  ? -11.738 -7.477  12.414  1.00 0.00 ? 86  ARG A NE   4  
ATOM 5548  C CZ   . ARG A 1 86  ? -11.586 -7.627  13.737  1.00 0.00 ? 86  ARG A CZ   4  
ATOM 5549  N NH1  . ARG A 1 86  ? -10.382 -7.921  14.244  1.00 0.00 ? 86  ARG A NH1  4  
ATOM 5550  N NH2  . ARG A 1 86  ? -12.640 -7.482  14.552  1.00 0.00 ? 86  ARG A NH2  4  
ATOM 5551  H H    . ARG A 1 86  ? -8.971  -6.798  10.027  1.00 0.00 ? 86  ARG A H    4  
ATOM 5552  H HA   . ARG A 1 86  ? -8.384  -8.983  8.333   1.00 0.00 ? 86  ARG A HA   4  
ATOM 5553  H HB2  . ARG A 1 86  ? -8.879  -10.346 10.227  1.00 0.00 ? 86  ARG A HB2  4  
ATOM 5554  H HB3  . ARG A 1 86  ? -8.244  -8.871  10.929  1.00 0.00 ? 86  ARG A HB3  4  
ATOM 5555  H HG2  . ARG A 1 86  ? -11.211 -9.514  10.580  1.00 0.00 ? 86  ARG A HG2  4  
ATOM 5556  H HG3  . ARG A 1 86  ? -10.323 -9.649  12.084  1.00 0.00 ? 86  ARG A HG3  4  
ATOM 5557  H HD2  . ARG A 1 86  ? -9.734  -7.148  11.818  1.00 0.00 ? 86  ARG A HD2  4  
ATOM 5558  H HD3  . ARG A 1 86  ? -10.898 -7.099  10.508  1.00 0.00 ? 86  ARG A HD3  4  
ATOM 5559  H HE   . ARG A 1 86  ? -12.650 -7.258  12.068  1.00 0.00 ? 86  ARG A HE   4  
ATOM 5560  H HH11 . ARG A 1 86  ? -9.596  -8.030  13.636  1.00 0.00 ? 86  ARG A HH11 4  
ATOM 5561  H HH12 . ARG A 1 86  ? -10.269 -8.033  15.232  1.00 0.00 ? 86  ARG A HH12 4  
ATOM 5562  H HH21 . ARG A 1 86  ? -13.539 -7.262  14.173  1.00 0.00 ? 86  ARG A HH21 4  
ATOM 5563  H HH22 . ARG A 1 86  ? -12.527 -7.593  15.540  1.00 0.00 ? 86  ARG A HH22 4  
ATOM 5564  N N    . ALA A 1 87  ? -10.691 -9.942  7.708   1.00 0.00 ? 87  ALA A N    4  
ATOM 5565  C CA   . ALA A 1 87  ? -11.960 -10.284 7.088   1.00 0.00 ? 87  ALA A CA   4  
ATOM 5566  C C    . ALA A 1 87  ? -12.620 -11.416 7.878   1.00 0.00 ? 87  ALA A C    4  
ATOM 5567  O O    . ALA A 1 87  ? -12.474 -12.587 7.532   1.00 0.00 ? 87  ALA A O    4  
ATOM 5568  C CB   . ALA A 1 87  ? -11.728 -10.655 5.622   1.00 0.00 ? 87  ALA A CB   4  
ATOM 5569  H H    . ALA A 1 87  ? -9.959  -10.607 7.568   1.00 0.00 ? 87  ALA A H    4  
ATOM 5570  H HA   . ALA A 1 87  ? -12.599 -9.402  7.130   1.00 0.00 ? 87  ALA A HA   4  
ATOM 5571  H HB1  . ALA A 1 87  ? -11.486 -11.715 5.549   1.00 0.00 ? 87  ALA A HB1  4  
ATOM 5572  H HB2  . ALA A 1 87  ? -12.630 -10.447 5.047   1.00 0.00 ? 87  ALA A HB2  4  
ATOM 5573  H HB3  . ALA A 1 87  ? -10.901 -10.065 5.225   1.00 0.00 ? 87  ALA A HB3  4  
ATOM 5574  N N    . SER A 1 88  ? -13.333 -11.026 8.924   1.00 0.00 ? 88  SER A N    4  
ATOM 5575  C CA   . SER A 1 88  ? -14.016 -11.993 9.766   1.00 0.00 ? 88  SER A CA   4  
ATOM 5576  C C    . SER A 1 88  ? -15.286 -12.488 9.070   1.00 0.00 ? 88  SER A C    4  
ATOM 5577  O O    . SER A 1 88  ? -16.362 -11.923 9.260   1.00 0.00 ? 88  SER A O    4  
ATOM 5578  C CB   . SER A 1 88  ? -14.359 -11.391 11.130  1.00 0.00 ? 88  SER A CB   4  
ATOM 5579  O OG   . SER A 1 88  ? -14.613 -12.396 12.109  1.00 0.00 ? 88  SER A OG   4  
ATOM 5580  H H    . SER A 1 88  ? -13.447 -10.071 9.199   1.00 0.00 ? 88  SER A H    4  
ATOM 5581  H HA   . SER A 1 88  ? -13.309 -12.812 9.898   1.00 0.00 ? 88  SER A HA   4  
ATOM 5582  H HB2  . SER A 1 88  ? -13.536 -10.759 11.465  1.00 0.00 ? 88  SER A HB2  4  
ATOM 5583  H HB3  . SER A 1 88  ? -15.235 -10.750 11.034  1.00 0.00 ? 88  SER A HB3  4  
ATOM 5584  H HG   . SER A 1 88  ? -15.595 -12.568 12.175  1.00 0.00 ? 88  SER A HG   4  
ATOM 5585  N N    . ALA A 1 89  ? -15.118 -13.538 8.280   1.00 0.00 ? 89  ALA A N    4  
ATOM 5586  C CA   . ALA A 1 89  ? -16.237 -14.115 7.555   1.00 0.00 ? 89  ALA A CA   4  
ATOM 5587  C C    . ALA A 1 89  ? -15.807 -15.448 6.939   1.00 0.00 ? 89  ALA A C    4  
ATOM 5588  O O    . ALA A 1 89  ? -15.521 -15.521 5.745   1.00 0.00 ? 89  ALA A O    4  
ATOM 5589  C CB   . ALA A 1 89  ? -16.733 -13.120 6.504   1.00 0.00 ? 89  ALA A CB   4  
ATOM 5590  H H    . ALA A 1 89  ? -14.239 -13.992 8.131   1.00 0.00 ? 89  ALA A H    4  
ATOM 5591  H HA   . ALA A 1 89  ? -17.038 -14.297 8.271   1.00 0.00 ? 89  ALA A HA   4  
ATOM 5592  H HB1  . ALA A 1 89  ? -17.783 -13.315 6.286   1.00 0.00 ? 89  ALA A HB1  4  
ATOM 5593  H HB2  . ALA A 1 89  ? -16.623 -12.105 6.884   1.00 0.00 ? 89  ALA A HB2  4  
ATOM 5594  H HB3  . ALA A 1 89  ? -16.146 -13.232 5.592   1.00 0.00 ? 89  ALA A HB3  4  
ATOM 5595  N N    . ALA A 1 90  ? -15.776 -16.470 7.782   1.00 0.00 ? 90  ALA A N    4  
ATOM 5596  C CA   . ALA A 1 90  ? -15.386 -17.797 7.335   1.00 0.00 ? 90  ALA A CA   4  
ATOM 5597  C C    . ALA A 1 90  ? -16.454 -18.345 6.386   1.00 0.00 ? 90  ALA A C    4  
ATOM 5598  O O    . ALA A 1 90  ? -17.589 -18.584 6.795   1.00 0.00 ? 90  ALA A O    4  
ATOM 5599  C CB   . ALA A 1 90  ? -15.165 -18.700 8.550   1.00 0.00 ? 90  ALA A CB   4  
ATOM 5600  H H    . ALA A 1 90  ? -16.011 -16.403 8.751   1.00 0.00 ? 90  ALA A H    4  
ATOM 5601  H HA   . ALA A 1 90  ? -14.445 -17.701 6.793   1.00 0.00 ? 90  ALA A HA   4  
ATOM 5602  H HB1  . ALA A 1 90  ? -14.850 -18.096 9.400   1.00 0.00 ? 90  ALA A HB1  4  
ATOM 5603  H HB2  . ALA A 1 90  ? -16.095 -19.214 8.794   1.00 0.00 ? 90  ALA A HB2  4  
ATOM 5604  H HB3  . ALA A 1 90  ? -14.394 -19.435 8.320   1.00 0.00 ? 90  ALA A HB3  4  
ATOM 5605  N N    . ALA A 1 91  ? -16.052 -18.529 5.137   1.00 0.00 ? 91  ALA A N    4  
ATOM 5606  C CA   . ALA A 1 91  ? -16.960 -19.045 4.127   1.00 0.00 ? 91  ALA A CA   4  
ATOM 5607  C C    . ALA A 1 91  ? -16.502 -20.441 3.701   1.00 0.00 ? 91  ALA A C    4  
ATOM 5608  O O    . ALA A 1 91  ? -15.332 -20.788 3.854   1.00 0.00 ? 91  ALA A O    4  
ATOM 5609  C CB   . ALA A 1 91  ? -17.024 -18.068 2.951   1.00 0.00 ? 91  ALA A CB   4  
ATOM 5610  H H    . ALA A 1 91  ? -15.127 -18.332 4.812   1.00 0.00 ? 91  ALA A H    4  
ATOM 5611  H HA   . ALA A 1 91  ? -17.950 -19.118 4.577   1.00 0.00 ? 91  ALA A HA   4  
ATOM 5612  H HB1  . ALA A 1 91  ? -16.269 -18.338 2.213   1.00 0.00 ? 91  ALA A HB1  4  
ATOM 5613  H HB2  . ALA A 1 91  ? -18.012 -18.115 2.494   1.00 0.00 ? 91  ALA A HB2  4  
ATOM 5614  H HB3  . ALA A 1 91  ? -16.837 -17.056 3.309   1.00 0.00 ? 91  ALA A HB3  4  
ATOM 5615  N N    . LYS A 1 92  ? -17.449 -21.205 3.175   1.00 0.00 ? 92  LYS A N    4  
ATOM 5616  C CA   . LYS A 1 92  ? -17.157 -22.555 2.726   1.00 0.00 ? 92  LYS A CA   4  
ATOM 5617  C C    . LYS A 1 92  ? -16.243 -22.495 1.501   1.00 0.00 ? 92  LYS A C    4  
ATOM 5618  O O    . LYS A 1 92  ? -16.714 -22.313 0.379   1.00 0.00 ? 92  LYS A O    4  
ATOM 5619  C CB   . LYS A 1 92  ? -18.453 -23.333 2.488   1.00 0.00 ? 92  LYS A CB   4  
ATOM 5620  C CG   . LYS A 1 92  ? -19.138 -23.676 3.813   1.00 0.00 ? 92  LYS A CG   4  
ATOM 5621  C CD   . LYS A 1 92  ? -20.119 -22.576 4.224   1.00 0.00 ? 92  LYS A CD   4  
ATOM 5622  C CE   . LYS A 1 92  ? -21.322 -23.163 4.964   1.00 0.00 ? 92  LYS A CE   4  
ATOM 5623  N NZ   . LYS A 1 92  ? -22.540 -23.072 4.127   1.00 0.00 ? 92  LYS A NZ   4  
ATOM 5624  H H    . LYS A 1 92  ? -18.398 -20.915 3.055   1.00 0.00 ? 92  LYS A H    4  
ATOM 5625  H HA   . LYS A 1 92  ? -16.623 -23.059 3.531   1.00 0.00 ? 92  LYS A HA   4  
ATOM 5626  H HB2  . LYS A 1 92  ? -19.128 -22.742 1.869   1.00 0.00 ? 92  LYS A HB2  4  
ATOM 5627  H HB3  . LYS A 1 92  ? -18.237 -24.249 1.939   1.00 0.00 ? 92  LYS A HB3  4  
ATOM 5628  H HG2  . LYS A 1 92  ? -19.668 -24.623 3.717   1.00 0.00 ? 92  LYS A HG2  4  
ATOM 5629  H HG3  . LYS A 1 92  ? -18.387 -23.808 4.591   1.00 0.00 ? 92  LYS A HG3  4  
ATOM 5630  H HD2  . LYS A 1 92  ? -19.612 -21.853 4.864   1.00 0.00 ? 92  LYS A HD2  4  
ATOM 5631  H HD3  . LYS A 1 92  ? -20.458 -22.036 3.340   1.00 0.00 ? 92  LYS A HD3  4  
ATOM 5632  H HE2  . LYS A 1 92  ? -21.127 -24.204 5.220   1.00 0.00 ? 92  LYS A HE2  4  
ATOM 5633  H HE3  . LYS A 1 92  ? -21.478 -22.628 5.901   1.00 0.00 ? 92  LYS A HE3  4  
ATOM 5634  H HZ1  . LYS A 1 92  ? -22.501 -23.764 3.406   1.00 0.00 ? 92  LYS A HZ1  4  
ATOM 5635  H HZ2  . LYS A 1 92  ? -23.348 -23.227 4.695   1.00 0.00 ? 92  LYS A HZ2  4  
ATOM 5636  H HZ3  . LYS A 1 92  ? -22.593 -22.163 3.713   1.00 0.00 ? 92  LYS A HZ3  4  
ATOM 5637  N N    . SER A 1 93  ? -14.952 -22.651 1.757   1.00 0.00 ? 93  SER A N    4  
ATOM 5638  C CA   . SER A 1 93  ? -13.968 -22.616 0.689   1.00 0.00 ? 93  SER A CA   4  
ATOM 5639  C C    . SER A 1 93  ? -13.113 -23.884 0.724   1.00 0.00 ? 93  SER A C    4  
ATOM 5640  O O    . SER A 1 93  ? -12.985 -24.522 1.768   1.00 0.00 ? 93  SER A O    4  
ATOM 5641  C CB   . SER A 1 93  ? -13.081 -21.374 0.798   1.00 0.00 ? 93  SER A CB   4  
ATOM 5642  O OG   . SER A 1 93  ? -12.484 -21.255 2.086   1.00 0.00 ? 93  SER A OG   4  
ATOM 5643  H H    . SER A 1 93  ? -14.578 -22.798 2.672   1.00 0.00 ? 93  SER A H    4  
ATOM 5644  H HA   . SER A 1 93  ? -14.545 -22.569 -0.235  1.00 0.00 ? 93  SER A HA   4  
ATOM 5645  H HB2  . SER A 1 93  ? -12.299 -21.419 0.039   1.00 0.00 ? 93  SER A HB2  4  
ATOM 5646  H HB3  . SER A 1 93  ? -13.675 -20.484 0.590   1.00 0.00 ? 93  SER A HB3  4  
ATOM 5647  H HG   . SER A 1 93  ? -13.078 -20.724 2.691   1.00 0.00 ? 93  SER A HG   4  
ATOM 5648  N N    . GLU A 1 94  ? -12.549 -24.211 -0.430  1.00 0.00 ? 94  GLU A N    4  
ATOM 5649  C CA   . GLU A 1 94  ? -11.709 -25.392 -0.544  1.00 0.00 ? 94  GLU A CA   4  
ATOM 5650  C C    . GLU A 1 94  ? -10.280 -24.992 -0.917  1.00 0.00 ? 94  GLU A C    4  
ATOM 5651  O O    . GLU A 1 94  ? -10.075 -24.135 -1.775  1.00 0.00 ? 94  GLU A O    4  
ATOM 5652  C CB   . GLU A 1 94  ? -12.286 -26.378 -1.562  1.00 0.00 ? 94  GLU A CB   4  
ATOM 5653  C CG   . GLU A 1 94  ? -12.580 -25.684 -2.893  1.00 0.00 ? 94  GLU A CG   4  
ATOM 5654  C CD   . GLU A 1 94  ? -13.055 -26.690 -3.943  1.00 0.00 ? 94  GLU A CD   4  
ATOM 5655  O OE1  . GLU A 1 94  ? -12.433 -27.772 -4.014  1.00 0.00 ? 94  GLU A OE1  4  
ATOM 5656  O OE2  . GLU A 1 94  ? -14.029 -26.354 -4.651  1.00 0.00 ? 94  GLU A OE2  4  
ATOM 5657  H H    . GLU A 1 94  ? -12.658 -23.687 -1.274  1.00 0.00 ? 94  GLU A H    4  
ATOM 5658  H HA   . GLU A 1 94  ? -11.720 -25.851 0.444   1.00 0.00 ? 94  GLU A HA   4  
ATOM 5659  H HB2  . GLU A 1 94  ? -11.582 -27.195 -1.721  1.00 0.00 ? 94  GLU A HB2  4  
ATOM 5660  H HB3  . GLU A 1 94  ? -13.202 -26.819 -1.168  1.00 0.00 ? 94  GLU A HB3  4  
ATOM 5661  H HG2  . GLU A 1 94  ? -13.341 -24.918 -2.747  1.00 0.00 ? 94  GLU A HG2  4  
ATOM 5662  H HG3  . GLU A 1 94  ? -11.682 -25.178 -3.249  1.00 0.00 ? 94  GLU A HG3  4  
ATOM 5663  N N    . PRO A 1 95  ? -9.304  -25.650 -0.236  1.00 0.00 ? 95  PRO A N    4  
ATOM 5664  C CA   . PRO A 1 95  ? -7.900  -25.372 -0.487  1.00 0.00 ? 95  PRO A CA   4  
ATOM 5665  C C    . PRO A 1 95  ? -7.445  -25.995 -1.808  1.00 0.00 ? 95  PRO A C    4  
ATOM 5666  O O    . PRO A 1 95  ? -7.859  -27.101 -2.152  1.00 0.00 ? 95  PRO A O    4  
ATOM 5667  C CB   . PRO A 1 95  ? -7.166  -25.936 0.719   1.00 0.00 ? 95  PRO A CB   4  
ATOM 5668  C CG   . PRO A 1 95  ? -8.128  -26.914 1.373   1.00 0.00 ? 95  PRO A CG   4  
ATOM 5669  C CD   . PRO A 1 95  ? -9.510  -26.671 0.787   1.00 0.00 ? 95  PRO A CD   4  
ATOM 5670  H HA   . PRO A 1 95  ? -7.752  -24.388 -0.583  1.00 0.00 ? 95  PRO A HA   4  
ATOM 5671  H HB2  . PRO A 1 95  ? -6.246  -26.437 0.417   1.00 0.00 ? 95  PRO A HB2  4  
ATOM 5672  H HB3  . PRO A 1 95  ? -6.885  -25.143 1.412   1.00 0.00 ? 95  PRO A HB3  4  
ATOM 5673  H HG2  . PRO A 1 95  ? -7.812  -27.941 1.191   1.00 0.00 ? 95  PRO A HG2  4  
ATOM 5674  H HG3  . PRO A 1 95  ? -8.142  -26.772 2.454   1.00 0.00 ? 95  PRO A HG3  4  
ATOM 5675  H HD2  . PRO A 1 95  ? -9.924  -27.583 0.358   1.00 0.00 ? 95  PRO A HD2  4  
ATOM 5676  H HD3  . PRO A 1 95  ? -10.209 -26.331 1.550   1.00 0.00 ? 95  PRO A HD3  4  
ATOM 5677  N N    . VAL A 1 96  ? -6.600  -25.257 -2.513  1.00 0.00 ? 96  VAL A N    4  
ATOM 5678  C CA   . VAL A 1 96  ? -6.085  -25.723 -3.789  1.00 0.00 ? 96  VAL A CA   4  
ATOM 5679  C C    . VAL A 1 96  ? -4.588  -26.010 -3.656  1.00 0.00 ? 96  VAL A C    4  
ATOM 5680  O O    . VAL A 1 96  ? -3.859  -25.245 -3.027  1.00 0.00 ? 96  VAL A O    4  
ATOM 5681  C CB   . VAL A 1 96  ? -6.403  -24.704 -4.886  1.00 0.00 ? 96  VAL A CB   4  
ATOM 5682  C CG1  . VAL A 1 96  ? -5.693  -25.065 -6.192  1.00 0.00 ? 96  VAL A CG1  4  
ATOM 5683  C CG2  . VAL A 1 96  ? -7.913  -24.581 -5.098  1.00 0.00 ? 96  VAL A CG2  4  
ATOM 5684  H H    . VAL A 1 96  ? -6.268  -24.359 -2.226  1.00 0.00 ? 96  VAL A H    4  
ATOM 5685  H HA   . VAL A 1 96  ? -6.600  -26.652 -4.033  1.00 0.00 ? 96  VAL A HA   4  
ATOM 5686  H HB   . VAL A 1 96  ? -6.031  -23.733 -4.559  1.00 0.00 ? 96  VAL A HB   4  
ATOM 5687  H HG11 . VAL A 1 96  ? -5.836  -24.263 -6.917  1.00 0.00 ? 96  VAL A HG11 4  
ATOM 5688  H HG12 . VAL A 1 96  ? -4.628  -25.197 -6.002  1.00 0.00 ? 96  VAL A HG12 4  
ATOM 5689  H HG13 . VAL A 1 96  ? -6.109  -25.991 -6.588  1.00 0.00 ? 96  VAL A HG13 4  
ATOM 5690  H HG21 . VAL A 1 96  ? -8.433  -25.234 -4.397  1.00 0.00 ? 96  VAL A HG21 4  
ATOM 5691  H HG22 . VAL A 1 96  ? -8.221  -23.549 -4.930  1.00 0.00 ? 96  VAL A HG22 4  
ATOM 5692  H HG23 . VAL A 1 96  ? -8.162  -24.873 -6.119  1.00 0.00 ? 96  VAL A HG23 4  
ATOM 5693  N N    . SER A 1 97  ? -4.174  -27.115 -4.259  1.00 0.00 ? 97  SER A N    4  
ATOM 5694  C CA   . SER A 1 97  ? -2.777  -27.512 -4.216  1.00 0.00 ? 97  SER A CA   4  
ATOM 5695  C C    . SER A 1 97  ? -2.122  -27.272 -5.578  1.00 0.00 ? 97  SER A C    4  
ATOM 5696  O O    . SER A 1 97  ? -2.710  -27.574 -6.615  1.00 0.00 ? 97  SER A O    4  
ATOM 5697  C CB   . SER A 1 97  ? -2.634  -28.980 -3.810  1.00 0.00 ? 97  SER A CB   4  
ATOM 5698  O OG   . SER A 1 97  ? -3.285  -29.854 -4.729  1.00 0.00 ? 97  SER A OG   4  
ATOM 5699  H H    . SER A 1 97  ? -4.773  -27.732 -4.770  1.00 0.00 ? 97  SER A H    4  
ATOM 5700  H HA   . SER A 1 97  ? -2.320  -26.879 -3.455  1.00 0.00 ? 97  SER A HA   4  
ATOM 5701  H HB2  . SER A 1 97  ? -1.577  -29.239 -3.750  1.00 0.00 ? 97  SER A HB2  4  
ATOM 5702  H HB3  . SER A 1 97  ? -3.054  -29.124 -2.814  1.00 0.00 ? 97  SER A HB3  4  
ATOM 5703  H HG   . SER A 1 97  ? -3.589  -29.341 -5.531  1.00 0.00 ? 97  SER A HG   4  
ATOM 5704  N N    . SER A 1 98  ? -0.913  -26.731 -5.530  1.00 0.00 ? 98  SER A N    4  
ATOM 5705  C CA   . SER A 1 98  ? -0.172  -26.447 -6.748  1.00 0.00 ? 98  SER A CA   4  
ATOM 5706  C C    . SER A 1 98  ? 1.271   -26.071 -6.406  1.00 0.00 ? 98  SER A C    4  
ATOM 5707  O O    . SER A 1 98  ? 1.508   -25.172 -5.601  1.00 0.00 ? 98  SER A O    4  
ATOM 5708  C CB   . SER A 1 98  ? -0.837  -25.326 -7.548  1.00 0.00 ? 98  SER A CB   4  
ATOM 5709  O OG   . SER A 1 98  ? -0.646  -25.485 -8.951  1.00 0.00 ? 98  SER A OG   4  
ATOM 5710  H H    . SER A 1 98  ? -0.442  -26.488 -4.682  1.00 0.00 ? 98  SER A H    4  
ATOM 5711  H HA   . SER A 1 98  ? -0.201  -27.371 -7.325  1.00 0.00 ? 98  SER A HA   4  
ATOM 5712  H HB2  . SER A 1 98  ? -1.905  -25.307 -7.328  1.00 0.00 ? 98  SER A HB2  4  
ATOM 5713  H HB3  . SER A 1 98  ? -0.430  -24.365 -7.234  1.00 0.00 ? 98  SER A HB3  4  
ATOM 5714  H HG   . SER A 1 98  ? -0.015  -24.788 -9.292  1.00 0.00 ? 98  SER A HG   4  
ATOM 5715  N N    . GLY A 1 99  ? 2.198   -26.779 -7.035  1.00 0.00 ? 99  GLY A N    4  
ATOM 5716  C CA   . GLY A 1 99  ? 3.611   -26.532 -6.807  1.00 0.00 ? 99  GLY A CA   4  
ATOM 5717  C C    . GLY A 1 99  ? 4.282   -25.985 -8.069  1.00 0.00 ? 99  GLY A C    4  
ATOM 5718  O O    . GLY A 1 99  ? 4.659   -26.748 -8.956  1.00 0.00 ? 99  GLY A O    4  
ATOM 5719  H H    . GLY A 1 99  ? 1.996   -27.510 -7.688  1.00 0.00 ? 99  GLY A H    4  
ATOM 5720  H HA2  . GLY A 1 99  ? 3.732   -25.821 -5.989  1.00 0.00 ? 99  GLY A HA2  4  
ATOM 5721  H HA3  . GLY A 1 99  ? 4.102   -27.456 -6.502  1.00 0.00 ? 99  GLY A HA3  4  
ATOM 5722  N N    . PRO A 1 100 ? 4.414   -24.632 -8.109  1.00 0.00 ? 100 PRO A N    4  
ATOM 5723  C CA   . PRO A 1 100 ? 5.032   -23.974 -9.247  1.00 0.00 ? 100 PRO A CA   4  
ATOM 5724  C C    . PRO A 1 100 ? 6.551   -24.156 -9.227  1.00 0.00 ? 100 PRO A C    4  
ATOM 5725  O O    . PRO A 1 100 ? 7.268   -23.353 -8.631  1.00 0.00 ? 100 PRO A O    4  
ATOM 5726  C CB   . PRO A 1 100 ? 4.607   -22.518 -9.139  1.00 0.00 ? 100 PRO A CB   4  
ATOM 5727  C CG   . PRO A 1 100 ? 4.155   -22.322 -7.701  1.00 0.00 ? 100 PRO A CG   4  
ATOM 5728  C CD   . PRO A 1 100 ? 3.979   -23.696 -7.076  1.00 0.00 ? 100 PRO A CD   4  
ATOM 5729  H HA   . PRO A 1 100 ? 4.719   -24.389 -10.101 1.00 0.00 ? 100 PRO A HA   4  
ATOM 5730  H HB2  . PRO A 1 100 ? 5.433   -21.851 -9.384  1.00 0.00 ? 100 PRO A HB2  4  
ATOM 5731  H HB3  . PRO A 1 100 ? 3.800   -22.295 -9.837  1.00 0.00 ? 100 PRO A HB3  4  
ATOM 5732  H HG2  . PRO A 1 100 ? 4.891   -21.741 -7.146  1.00 0.00 ? 100 PRO A HG2  4  
ATOM 5733  H HG3  . PRO A 1 100 ? 3.219   -21.765 -7.668  1.00 0.00 ? 100 PRO A HG3  4  
ATOM 5734  H HD2  . PRO A 1 100 ? 4.578   -23.799 -6.171  1.00 0.00 ? 100 PRO A HD2  4  
ATOM 5735  H HD3  . PRO A 1 100 ? 2.941   -23.872 -6.793  1.00 0.00 ? 100 PRO A HD3  4  
ATOM 5736  N N    . SER A 1 101 ? 6.997   -25.216 -9.885  1.00 0.00 ? 101 SER A N    4  
ATOM 5737  C CA   . SER A 1 101 ? 8.418   -25.513 -9.950  1.00 0.00 ? 101 SER A CA   4  
ATOM 5738  C C    . SER A 1 101 ? 8.889   -25.501 -11.405 1.00 0.00 ? 101 SER A C    4  
ATOM 5739  O O    . SER A 1 101 ? 8.315   -26.182 -12.253 1.00 0.00 ? 101 SER A O    4  
ATOM 5740  C CB   . SER A 1 101 ? 8.727   -26.865 -9.304  1.00 0.00 ? 101 SER A CB   4  
ATOM 5741  O OG   . SER A 1 101 ? 9.499   -26.724 -8.114  1.00 0.00 ? 101 SER A OG   4  
ATOM 5742  H H    . SER A 1 101 ? 6.407   -25.864 -10.367 1.00 0.00 ? 101 SER A H    4  
ATOM 5743  H HA   . SER A 1 101 ? 8.905   -24.720 -9.383  1.00 0.00 ? 101 SER A HA   4  
ATOM 5744  H HB2  . SER A 1 101 ? 7.794   -27.378 -9.071  1.00 0.00 ? 101 SER A HB2  4  
ATOM 5745  H HB3  . SER A 1 101 ? 9.267   -27.491 -10.014 1.00 0.00 ? 101 SER A HB3  4  
ATOM 5746  H HG   . SER A 1 101 ? 9.105   -27.281 -7.383  1.00 0.00 ? 101 SER A HG   4  
ATOM 5747  N N    . SER A 1 102 ? 9.930   -24.718 -11.650 1.00 0.00 ? 102 SER A N    4  
ATOM 5748  C CA   . SER A 1 102 ? 10.485  -24.607 -12.988 1.00 0.00 ? 102 SER A CA   4  
ATOM 5749  C C    . SER A 1 102 ? 11.988  -24.889 -12.956 1.00 0.00 ? 102 SER A C    4  
ATOM 5750  O O    . SER A 1 102 ? 12.658  -24.594 -11.967 1.00 0.00 ? 102 SER A O    4  
ATOM 5751  C CB   . SER A 1 102 ? 10.217  -23.224 -13.583 1.00 0.00 ? 102 SER A CB   4  
ATOM 5752  O OG   . SER A 1 102 ? 9.072   -23.220 -14.432 1.00 0.00 ? 102 SER A OG   4  
ATOM 5753  H H    . SER A 1 102 ? 10.391  -24.167 -10.955 1.00 0.00 ? 102 SER A H    4  
ATOM 5754  H HA   . SER A 1 102 ? 9.967   -25.363 -13.579 1.00 0.00 ? 102 SER A HA   4  
ATOM 5755  H HB2  . SER A 1 102 ? 10.072  -22.504 -12.777 1.00 0.00 ? 102 SER A HB2  4  
ATOM 5756  H HB3  . SER A 1 102 ? 11.089  -22.897 -14.149 1.00 0.00 ? 102 SER A HB3  4  
ATOM 5757  H HG   . SER A 1 102 ? 9.074   -24.035 -15.012 1.00 0.00 ? 102 SER A HG   4  
ATOM 5758  N N    . GLY A 1 103 ? 12.475  -25.456 -14.050 1.00 0.00 ? 103 GLY A N    4  
ATOM 5759  C CA   . GLY A 1 103 ? 13.887  -25.781 -14.160 1.00 0.00 ? 103 GLY A CA   4  
ATOM 5760  C C    . GLY A 1 103 ? 14.461  -25.292 -15.491 1.00 0.00 ? 103 GLY A C    4  
ATOM 5761  O O    . GLY A 1 103 ? 13.995  -25.693 -16.557 1.00 0.00 ? 103 GLY A O    4  
ATOM 5762  H H    . GLY A 1 103 ? 11.924  -25.693 -14.850 1.00 0.00 ? 103 GLY A H    4  
ATOM 5763  H HA2  . GLY A 1 103 ? 14.434  -25.324 -13.335 1.00 0.00 ? 103 GLY A HA2  4  
ATOM 5764  H HA3  . GLY A 1 103 ? 14.024  -26.859 -14.075 1.00 0.00 ? 103 GLY A HA3  4  
ATOM 5765  N N    . GLY A 1 1   ? -16.739 -1.713  23.495  1.00 0.00 ? 1   GLY A N    5  
ATOM 5766  C CA   . GLY A 1 1   ? -15.847 -2.541  22.701  1.00 0.00 ? 1   GLY A CA   5  
ATOM 5767  C C    . GLY A 1 1   ? -14.799 -3.220  23.584  1.00 0.00 ? 1   GLY A C    5  
ATOM 5768  O O    . GLY A 1 1   ? -14.375 -2.660  24.594  1.00 0.00 ? 1   GLY A O    5  
ATOM 5769  H H1   . GLY A 1 1   ? -16.715 -0.737  23.278  1.00 0.00 ? 1   GLY A H1   5  
ATOM 5770  H HA2  . GLY A 1 1   ? -16.425 -3.297  22.169  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 5771  H HA3  . GLY A 1 1   ? -15.352 -1.929  21.947  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 5772  N N    . SER A 1 2   ? -14.410 -4.418  23.171  1.00 0.00 ? 2   SER A N    5  
ATOM 5773  C CA   . SER A 1 2   ? -13.419 -5.179  23.912  1.00 0.00 ? 2   SER A CA   5  
ATOM 5774  C C    . SER A 1 2   ? -12.813 -6.261  23.016  1.00 0.00 ? 2   SER A C    5  
ATOM 5775  O O    . SER A 1 2   ? -13.498 -7.207  22.628  1.00 0.00 ? 2   SER A O    5  
ATOM 5776  C CB   . SER A 1 2   ? -14.031 -5.809  25.164  1.00 0.00 ? 2   SER A CB   5  
ATOM 5777  O OG   . SER A 1 2   ? -14.924 -6.873  24.845  1.00 0.00 ? 2   SER A OG   5  
ATOM 5778  H H    . SER A 1 2   ? -14.759 -4.867  22.349  1.00 0.00 ? 2   SER A H    5  
ATOM 5779  H HA   . SER A 1 2   ? -12.658 -4.455  24.205  1.00 0.00 ? 2   SER A HA   5  
ATOM 5780  H HB2  . SER A 1 2   ? -13.235 -6.185  25.807  1.00 0.00 ? 2   SER A HB2  5  
ATOM 5781  H HB3  . SER A 1 2   ? -14.565 -5.046  25.731  1.00 0.00 ? 2   SER A HB3  5  
ATOM 5782  H HG   . SER A 1 2   ? -14.445 -7.576  24.321  1.00 0.00 ? 2   SER A HG   5  
ATOM 5783  N N    . SER A 1 3   ? -11.535 -6.086  22.712  1.00 0.00 ? 3   SER A N    5  
ATOM 5784  C CA   . SER A 1 3   ? -10.829 -7.036  21.869  1.00 0.00 ? 3   SER A CA   5  
ATOM 5785  C C    . SER A 1 3   ? -11.504 -7.121  20.498  1.00 0.00 ? 3   SER A C    5  
ATOM 5786  O O    . SER A 1 3   ? -12.652 -6.706  20.341  1.00 0.00 ? 3   SER A O    5  
ATOM 5787  C CB   . SER A 1 3   ? -10.776 -8.419  22.521  1.00 0.00 ? 3   SER A CB   5  
ATOM 5788  O OG   . SER A 1 3   ? -9.514  -9.051  22.329  1.00 0.00 ? 3   SER A OG   5  
ATOM 5789  H H    . SER A 1 3   ? -10.985 -5.314  23.031  1.00 0.00 ? 3   SER A H    5  
ATOM 5790  H HA   . SER A 1 3   ? -9.818  -6.641  21.773  1.00 0.00 ? 3   SER A HA   5  
ATOM 5791  H HB2  . SER A 1 3   ? -10.975 -8.324  23.589  1.00 0.00 ? 3   SER A HB2  5  
ATOM 5792  H HB3  . SER A 1 3   ? -11.564 -9.046  22.105  1.00 0.00 ? 3   SER A HB3  5  
ATOM 5793  H HG   . SER A 1 3   ? -9.309  -9.648  23.105  1.00 0.00 ? 3   SER A HG   5  
ATOM 5794  N N    . GLY A 1 4   ? -10.764 -7.661  19.542  1.00 0.00 ? 4   GLY A N    5  
ATOM 5795  C CA   . GLY A 1 4   ? -11.276 -7.806  18.190  1.00 0.00 ? 4   GLY A CA   5  
ATOM 5796  C C    . GLY A 1 4   ? -10.193 -8.333  17.247  1.00 0.00 ? 4   GLY A C    5  
ATOM 5797  O O    . GLY A 1 4   ? -9.389  -9.181  17.631  1.00 0.00 ? 4   GLY A O    5  
ATOM 5798  H H    . GLY A 1 4   ? -9.831  -7.996  19.679  1.00 0.00 ? 4   GLY A H    5  
ATOM 5799  H HA2  . GLY A 1 4   ? -12.126 -8.489  18.191  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 5800  H HA3  . GLY A 1 4   ? -11.640 -6.844  17.830  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 5801  N N    . SER A 1 5   ? -10.208 -7.810  16.030  1.00 0.00 ? 5   SER A N    5  
ATOM 5802  C CA   . SER A 1 5   ? -9.237  -8.216  15.028  1.00 0.00 ? 5   SER A CA   5  
ATOM 5803  C C    . SER A 1 5   ? -8.462  -6.997  14.525  1.00 0.00 ? 5   SER A C    5  
ATOM 5804  O O    . SER A 1 5   ? -9.039  -6.100  13.913  1.00 0.00 ? 5   SER A O    5  
ATOM 5805  C CB   . SER A 1 5   ? -9.918  -8.932  13.860  1.00 0.00 ? 5   SER A CB   5  
ATOM 5806  O OG   . SER A 1 5   ? -11.113 -8.272  13.452  1.00 0.00 ? 5   SER A OG   5  
ATOM 5807  H H    . SER A 1 5   ? -10.866 -7.121  15.725  1.00 0.00 ? 5   SER A H    5  
ATOM 5808  H HA   . SER A 1 5   ? -8.569  -8.910  15.539  1.00 0.00 ? 5   SER A HA   5  
ATOM 5809  H HB2  . SER A 1 5   ? -9.228  -8.987  13.017  1.00 0.00 ? 5   SER A HB2  5  
ATOM 5810  H HB3  . SER A 1 5   ? -10.150 -9.957  14.148  1.00 0.00 ? 5   SER A HB3  5  
ATOM 5811  H HG   . SER A 1 5   ? -11.771 -8.261  14.204  1.00 0.00 ? 5   SER A HG   5  
ATOM 5812  N N    . SER A 1 6   ? -7.166  -7.004  14.801  1.00 0.00 ? 6   SER A N    5  
ATOM 5813  C CA   . SER A 1 6   ? -6.306  -5.909  14.383  1.00 0.00 ? 6   SER A CA   5  
ATOM 5814  C C    . SER A 1 6   ? -4.856  -6.206  14.770  1.00 0.00 ? 6   SER A C    5  
ATOM 5815  O O    . SER A 1 6   ? -4.586  -7.169  15.486  1.00 0.00 ? 6   SER A O    5  
ATOM 5816  C CB   . SER A 1 6   ? -6.760  -4.586  15.002  1.00 0.00 ? 6   SER A CB   5  
ATOM 5817  O OG   . SER A 1 6   ? -6.723  -4.621  16.426  1.00 0.00 ? 6   SER A OG   5  
ATOM 5818  H H    . SER A 1 6   ? -6.704  -7.738  15.299  1.00 0.00 ? 6   SER A H    5  
ATOM 5819  H HA   . SER A 1 6   ? -6.410  -5.858  13.300  1.00 0.00 ? 6   SER A HA   5  
ATOM 5820  H HB2  . SER A 1 6   ? -6.121  -3.779  14.642  1.00 0.00 ? 6   SER A HB2  5  
ATOM 5821  H HB3  . SER A 1 6   ? -7.774  -4.360  14.671  1.00 0.00 ? 6   SER A HB3  5  
ATOM 5822  H HG   . SER A 1 6   ? -6.864  -3.703  16.795  1.00 0.00 ? 6   SER A HG   5  
ATOM 5823  N N    . GLY A 1 7   ? -3.962  -5.362  14.279  1.00 0.00 ? 7   GLY A N    5  
ATOM 5824  C CA   . GLY A 1 7   ? -2.546  -5.521  14.565  1.00 0.00 ? 7   GLY A CA   5  
ATOM 5825  C C    . GLY A 1 7   ? -1.692  -4.766  13.544  1.00 0.00 ? 7   GLY A C    5  
ATOM 5826  O O    . GLY A 1 7   ? -2.056  -4.673  12.373  1.00 0.00 ? 7   GLY A O    5  
ATOM 5827  H H    . GLY A 1 7   ? -4.190  -4.581  13.698  1.00 0.00 ? 7   GLY A H    5  
ATOM 5828  H HA2  . GLY A 1 7   ? -2.330  -5.154  15.568  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 5829  H HA3  . GLY A 1 7   ? -2.285  -6.580  14.550  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 5830  N N    . SER A 1 8   ? -0.573  -4.246  14.026  1.00 0.00 ? 8   SER A N    5  
ATOM 5831  C CA   . SER A 1 8   ? 0.336   -3.502  13.171  1.00 0.00 ? 8   SER A CA   5  
ATOM 5832  C C    . SER A 1 8   ? 1.524   -4.382  12.778  1.00 0.00 ? 8   SER A C    5  
ATOM 5833  O O    . SER A 1 8   ? 1.889   -5.301  13.509  1.00 0.00 ? 8   SER A O    5  
ATOM 5834  C CB   . SER A 1 8   ? 0.825   -2.228  13.863  1.00 0.00 ? 8   SER A CB   5  
ATOM 5835  O OG   . SER A 1 8   ? 1.195   -2.465  15.218  1.00 0.00 ? 8   SER A OG   5  
ATOM 5836  H H    . SER A 1 8   ? -0.284  -4.327  14.980  1.00 0.00 ? 8   SER A H    5  
ATOM 5837  H HA   . SER A 1 8   ? -0.250  -3.235  12.291  1.00 0.00 ? 8   SER A HA   5  
ATOM 5838  H HB2  . SER A 1 8   ? 1.679   -1.825  13.319  1.00 0.00 ? 8   SER A HB2  5  
ATOM 5839  H HB3  . SER A 1 8   ? 0.040   -1.472  13.828  1.00 0.00 ? 8   SER A HB3  5  
ATOM 5840  H HG   . SER A 1 8   ? 1.828   -3.238  15.270  1.00 0.00 ? 8   SER A HG   5  
ATOM 5841  N N    . VAL A 1 9   ? 2.095   -4.070  11.624  1.00 0.00 ? 9   VAL A N    5  
ATOM 5842  C CA   . VAL A 1 9   ? 3.234   -4.821  11.125  1.00 0.00 ? 9   VAL A CA   5  
ATOM 5843  C C    . VAL A 1 9   ? 4.411   -3.868  10.904  1.00 0.00 ? 9   VAL A C    5  
ATOM 5844  O O    . VAL A 1 9   ? 4.232   -2.651  10.881  1.00 0.00 ? 9   VAL A O    5  
ATOM 5845  C CB   . VAL A 1 9   ? 2.842   -5.590  9.862   1.00 0.00 ? 9   VAL A CB   5  
ATOM 5846  C CG1  . VAL A 1 9   ? 2.028   -4.707  8.913   1.00 0.00 ? 9   VAL A CG1  5  
ATOM 5847  C CG2  . VAL A 1 9   ? 4.077   -6.157  9.159   1.00 0.00 ? 9   VAL A CG2  5  
ATOM 5848  H H    . VAL A 1 9   ? 1.792   -3.321  11.035  1.00 0.00 ? 9   VAL A H    5  
ATOM 5849  H HA   . VAL A 1 9   ? 3.510   -5.547  11.890  1.00 0.00 ? 9   VAL A HA   5  
ATOM 5850  H HB   . VAL A 1 9   ? 2.213   -6.428  10.161  1.00 0.00 ? 9   VAL A HB   5  
ATOM 5851  H HG11 . VAL A 1 9   ? 2.204   -3.658  9.153   1.00 0.00 ? 9   VAL A HG11 5  
ATOM 5852  H HG12 . VAL A 1 9   ? 2.334   -4.900  7.885   1.00 0.00 ? 9   VAL A HG12 5  
ATOM 5853  H HG13 . VAL A 1 9   ? 0.968   -4.933  9.026   1.00 0.00 ? 9   VAL A HG13 5  
ATOM 5854  H HG21 . VAL A 1 9   ? 4.708   -5.337  8.816   1.00 0.00 ? 9   VAL A HG21 5  
ATOM 5855  H HG22 . VAL A 1 9   ? 4.638   -6.779  9.856   1.00 0.00 ? 9   VAL A HG22 5  
ATOM 5856  H HG23 . VAL A 1 9   ? 3.766   -6.757  8.305   1.00 0.00 ? 9   VAL A HG23 5  
ATOM 5857  N N    . SER A 1 10  ? 5.587   -4.457  10.746  1.00 0.00 ? 10  SER A N    5  
ATOM 5858  C CA   . SER A 1 10  ? 6.792   -3.676  10.528  1.00 0.00 ? 10  SER A CA   5  
ATOM 5859  C C    . SER A 1 10  ? 7.570   -4.236  9.336   1.00 0.00 ? 10  SER A C    5  
ATOM 5860  O O    . SER A 1 10  ? 7.903   -5.420  9.309   1.00 0.00 ? 10  SER A O    5  
ATOM 5861  C CB   . SER A 1 10  ? 7.674   -3.661  11.778  1.00 0.00 ? 10  SER A CB   5  
ATOM 5862  O OG   . SER A 1 10  ? 8.889   -2.948  11.566  1.00 0.00 ? 10  SER A OG   5  
ATOM 5863  H H    . SER A 1 10  ? 5.723   -5.448  10.766  1.00 0.00 ? 10  SER A H    5  
ATOM 5864  H HA   . SER A 1 10  ? 6.446   -2.664  10.316  1.00 0.00 ? 10  SER A HA   5  
ATOM 5865  H HB2  . SER A 1 10  ? 7.125   -3.207  12.603  1.00 0.00 ? 10  SER A HB2  5  
ATOM 5866  H HB3  . SER A 1 10  ? 7.901   -4.686  12.073  1.00 0.00 ? 10  SER A HB3  5  
ATOM 5867  H HG   . SER A 1 10  ? 8.710   -2.115  11.042  1.00 0.00 ? 10  SER A HG   5  
ATOM 5868  N N    . LEU A 1 11  ? 7.838   -3.360  8.379   1.00 0.00 ? 11  LEU A N    5  
ATOM 5869  C CA   . LEU A 1 11  ? 8.571   -3.753  7.188   1.00 0.00 ? 11  LEU A CA   5  
ATOM 5870  C C    . LEU A 1 11  ? 9.943   -3.075  7.191   1.00 0.00 ? 11  LEU A C    5  
ATOM 5871  O O    . LEU A 1 11  ? 10.092  -1.970  7.711   1.00 0.00 ? 11  LEU A O    5  
ATOM 5872  C CB   . LEU A 1 11  ? 7.746   -3.464  5.932   1.00 0.00 ? 11  LEU A CB   5  
ATOM 5873  C CG   . LEU A 1 11  ? 6.276   -3.882  5.984   1.00 0.00 ? 11  LEU A CG   5  
ATOM 5874  C CD1  . LEU A 1 11  ? 5.500   -3.310  4.797   1.00 0.00 ? 11  LEU A CD1  5  
ATOM 5875  C CD2  . LEU A 1 11  ? 6.141   -5.404  6.077   1.00 0.00 ? 11  LEU A CD2  5  
ATOM 5876  H H    . LEU A 1 11  ? 7.564   -2.399  8.409   1.00 0.00 ? 11  LEU A H    5  
ATOM 5877  H HA   . LEU A 1 11  ? 8.718   -4.832  7.236   1.00 0.00 ? 11  LEU A HA   5  
ATOM 5878  H HB2  . LEU A 1 11  ? 7.792   -2.394  5.729   1.00 0.00 ? 11  LEU A HB2  5  
ATOM 5879  H HB3  . LEU A 1 11  ? 8.217   -3.969  5.088   1.00 0.00 ? 11  LEU A HB3  5  
ATOM 5880  H HG   . LEU A 1 11  ? 5.834   -3.464  6.889   1.00 0.00 ? 11  LEU A HG   5  
ATOM 5881  H HD11 . LEU A 1 11  ? 5.404   -2.230  4.912   1.00 0.00 ? 11  LEU A HD11 5  
ATOM 5882  H HD12 . LEU A 1 11  ? 6.035   -3.530  3.873   1.00 0.00 ? 11  LEU A HD12 5  
ATOM 5883  H HD13 . LEU A 1 11  ? 4.508   -3.761  4.758   1.00 0.00 ? 11  LEU A HD13 5  
ATOM 5884  H HD21 . LEU A 1 11  ? 5.087   -5.679  6.035   1.00 0.00 ? 11  LEU A HD21 5  
ATOM 5885  H HD22 . LEU A 1 11  ? 6.671   -5.866  5.244   1.00 0.00 ? 11  LEU A HD22 5  
ATOM 5886  H HD23 . LEU A 1 11  ? 6.570   -5.750  7.018   1.00 0.00 ? 11  LEU A HD23 5  
ATOM 5887  N N    . VAL A 1 12  ? 10.910  -3.766  6.606   1.00 0.00 ? 12  VAL A N    5  
ATOM 5888  C CA   . VAL A 1 12  ? 12.265  -3.245  6.536   1.00 0.00 ? 12  VAL A CA   5  
ATOM 5889  C C    . VAL A 1 12  ? 12.647  -3.027  5.070   1.00 0.00 ? 12  VAL A C    5  
ATOM 5890  O O    . VAL A 1 12  ? 12.896  -3.986  4.341   1.00 0.00 ? 12  VAL A O    5  
ATOM 5891  C CB   . VAL A 1 12  ? 13.225  -4.182  7.271   1.00 0.00 ? 12  VAL A CB   5  
ATOM 5892  C CG1  . VAL A 1 12  ? 13.055  -5.626  6.793   1.00 0.00 ? 12  VAL A CG1  5  
ATOM 5893  C CG2  . VAL A 1 12  ? 14.674  -3.719  7.111   1.00 0.00 ? 12  VAL A CG2  5  
ATOM 5894  H H    . VAL A 1 12  ? 10.781  -4.664  6.186   1.00 0.00 ? 12  VAL A H    5  
ATOM 5895  H HA   . VAL A 1 12  ? 12.274  -2.283  7.048   1.00 0.00 ? 12  VAL A HA   5  
ATOM 5896  H HB   . VAL A 1 12  ? 12.978  -4.150  8.332   1.00 0.00 ? 12  VAL A HB   5  
ATOM 5897  H HG11 . VAL A 1 12  ? 12.305  -6.126  7.407   1.00 0.00 ? 12  VAL A HG11 5  
ATOM 5898  H HG12 . VAL A 1 12  ? 12.733  -5.629  5.752   1.00 0.00 ? 12  VAL A HG12 5  
ATOM 5899  H HG13 . VAL A 1 12  ? 14.006  -6.152  6.881   1.00 0.00 ? 12  VAL A HG13 5  
ATOM 5900  H HG21 . VAL A 1 12  ? 14.739  -2.651  7.321   1.00 0.00 ? 12  VAL A HG21 5  
ATOM 5901  H HG22 . VAL A 1 12  ? 15.310  -4.265  7.808   1.00 0.00 ? 12  VAL A HG22 5  
ATOM 5902  H HG23 . VAL A 1 12  ? 15.006  -3.909  6.090   1.00 0.00 ? 12  VAL A HG23 5  
ATOM 5903  N N    . GLY A 1 13  ? 12.682  -1.761  4.683   1.00 0.00 ? 13  GLY A N    5  
ATOM 5904  C CA   . GLY A 1 13  ? 13.029  -1.405  3.318   1.00 0.00 ? 13  GLY A CA   5  
ATOM 5905  C C    . GLY A 1 13  ? 13.062  0.115   3.139   1.00 0.00 ? 13  GLY A C    5  
ATOM 5906  O O    . GLY A 1 13  ? 12.393  0.844   3.869   1.00 0.00 ? 13  GLY A O    5  
ATOM 5907  H H    . GLY A 1 13  ? 12.478  -0.987  5.283   1.00 0.00 ? 13  GLY A H    5  
ATOM 5908  H HA2  . GLY A 1 13  ? 14.002  -1.825  3.065   1.00 0.00 ? 13  GLY A HA2  5  
ATOM 5909  H HA3  . GLY A 1 13  ? 12.305  -1.840  2.629   1.00 0.00 ? 13  GLY A HA3  5  
ATOM 5910  N N    . PRO A 1 14  ? 13.869  0.558   2.138   1.00 0.00 ? 14  PRO A N    5  
ATOM 5911  C CA   . PRO A 1 14  ? 13.999  1.977   1.854   1.00 0.00 ? 14  PRO A CA   5  
ATOM 5912  C C    . PRO A 1 14  ? 12.757  2.507   1.135   1.00 0.00 ? 14  PRO A C    5  
ATOM 5913  O O    . PRO A 1 14  ? 12.636  3.709   0.900   1.00 0.00 ? 14  PRO A O    5  
ATOM 5914  C CB   . PRO A 1 14  ? 15.264  2.098   1.021   1.00 0.00 ? 14  PRO A CB   5  
ATOM 5915  C CG   . PRO A 1 14  ? 15.541  0.705   0.479   1.00 0.00 ? 14  PRO A CG   5  
ATOM 5916  C CD   . PRO A 1 14  ? 14.677  -0.277  1.253   1.00 0.00 ? 14  PRO A CD   5  
ATOM 5917  H HA   . PRO A 1 14  ? 14.064  2.497   2.705   1.00 0.00 ? 14  PRO A HA   5  
ATOM 5918  H HB2  . PRO A 1 14  ? 15.131  2.813   0.209   1.00 0.00 ? 14  PRO A HB2  5  
ATOM 5919  H HB3  . PRO A 1 14  ? 16.098  2.454   1.626   1.00 0.00 ? 14  PRO A HB3  5  
ATOM 5920  H HG2  . PRO A 1 14  ? 15.312  0.657   -0.586  1.00 0.00 ? 14  PRO A HG2  5  
ATOM 5921  H HG3  . PRO A 1 14  ? 16.596  0.455   0.590   1.00 0.00 ? 14  PRO A HG3  5  
ATOM 5922  H HD2  . PRO A 1 14  ? 14.050  -0.867  0.584   1.00 0.00 ? 14  PRO A HD2  5  
ATOM 5923  H HD3  . PRO A 1 14  ? 15.287  -0.980  1.820   1.00 0.00 ? 14  PRO A HD3  5  
ATOM 5924  N N    . ALA A 1 15  ? 11.864  1.586   0.805   1.00 0.00 ? 15  ALA A N    5  
ATOM 5925  C CA   . ALA A 1 15  ? 10.636  1.945   0.117   1.00 0.00 ? 15  ALA A CA   5  
ATOM 5926  C C    . ALA A 1 15  ? 10.036  0.697   -0.534  1.00 0.00 ? 15  ALA A C    5  
ATOM 5927  O O    . ALA A 1 15  ? 8.852   0.411   -0.363  1.00 0.00 ? 15  ALA A O    5  
ATOM 5928  C CB   . ALA A 1 15  ? 10.925  3.052   -0.900  1.00 0.00 ? 15  ALA A CB   5  
ATOM 5929  H H    . ALA A 1 15  ? 11.969  0.610   0.999   1.00 0.00 ? 15  ALA A H    5  
ATOM 5930  H HA   . ALA A 1 15  ? 9.938   2.327   0.862   1.00 0.00 ? 15  ALA A HA   5  
ATOM 5931  H HB1  . ALA A 1 15  ? 11.996  3.092   -1.098  1.00 0.00 ? 15  ALA A HB1  5  
ATOM 5932  H HB2  . ALA A 1 15  ? 10.392  2.841   -1.827  1.00 0.00 ? 15  ALA A HB2  5  
ATOM 5933  H HB3  . ALA A 1 15  ? 10.593  4.009   -0.499  1.00 0.00 ? 15  ALA A HB3  5  
ATOM 5934  N N    . PRO A 1 16  ? 10.904  -0.031  -1.287  1.00 0.00 ? 16  PRO A N    5  
ATOM 5935  C CA   . PRO A 1 16  ? 10.472  -1.242  -1.964  1.00 0.00 ? 16  PRO A CA   5  
ATOM 5936  C C    . PRO A 1 16  ? 10.309  -2.396  -0.973  1.00 0.00 ? 16  PRO A C    5  
ATOM 5937  O O    . PRO A 1 16  ? 11.168  -3.272  -0.888  1.00 0.00 ? 16  PRO A O    5  
ATOM 5938  C CB   . PRO A 1 16  ? 11.539  -1.507  -3.014  1.00 0.00 ? 16  PRO A CB   5  
ATOM 5939  C CG   . PRO A 1 16  ? 12.757  -0.708  -2.581  1.00 0.00 ? 16  PRO A CG   5  
ATOM 5940  C CD   . PRO A 1 16  ? 12.313  0.277   -1.512  1.00 0.00 ? 16  PRO A CD   5  
ATOM 5941  H HA   . PRO A 1 16  ? 9.572   -1.107  -2.377  1.00 0.00 ? 16  PRO A HA   5  
ATOM 5942  H HB2  . PRO A 1 16  ? 11.771  -2.570  -3.075  1.00 0.00 ? 16  PRO A HB2  5  
ATOM 5943  H HB3  . PRO A 1 16  ? 11.200  -1.198  -4.002  1.00 0.00 ? 16  PRO A HB3  5  
ATOM 5944  H HG2  . PRO A 1 16  ? 13.530  -1.370  -2.192  1.00 0.00 ? 16  PRO A HG2  5  
ATOM 5945  H HG3  . PRO A 1 16  ? 13.189  -0.179  -3.431  1.00 0.00 ? 16  PRO A HG3  5  
ATOM 5946  H HD2  . PRO A 1 16  ? 12.895  0.159   -0.598  1.00 0.00 ? 16  PRO A HD2  5  
ATOM 5947  H HD3  . PRO A 1 16  ? 12.445  1.307   -1.843  1.00 0.00 ? 16  PRO A HD3  5  
ATOM 5948  N N    . TRP A 1 17  ? 9.200   -2.360  -0.249  1.00 0.00 ? 17  TRP A N    5  
ATOM 5949  C CA   . TRP A 1 17  ? 8.913   -3.392  0.733   1.00 0.00 ? 17  TRP A CA   5  
ATOM 5950  C C    . TRP A 1 17  ? 8.556   -4.675  -0.020  1.00 0.00 ? 17  TRP A C    5  
ATOM 5951  O O    . TRP A 1 17  ? 8.703   -5.773  0.513   1.00 0.00 ? 17  TRP A O    5  
ATOM 5952  C CB   . TRP A 1 17  ? 7.814   -2.940  1.698   1.00 0.00 ? 17  TRP A CB   5  
ATOM 5953  C CG   . TRP A 1 17  ? 7.828   -1.440  1.998   1.00 0.00 ? 17  TRP A CG   5  
ATOM 5954  C CD1  . TRP A 1 17  ? 7.197   -0.460  1.336   1.00 0.00 ? 17  TRP A CD1  5  
ATOM 5955  C CD2  . TRP A 1 17  ? 8.536   -0.784  3.071   1.00 0.00 ? 17  TRP A CD2  5  
ATOM 5956  N NE1  . TRP A 1 17  ? 7.446   0.774   1.902   1.00 0.00 ? 17  TRP A NE1  5  
ATOM 5957  C CE2  . TRP A 1 17  ? 8.285   0.570   2.990   1.00 0.00 ? 17  TRP A CE2  5  
ATOM 5958  C CE3  . TRP A 1 17  ? 9.360   -1.318  4.077   1.00 0.00 ? 17  TRP A CE3  5  
ATOM 5959  C CZ2  . TRP A 1 17  ? 8.822   1.504   3.885   1.00 0.00 ? 17  TRP A CZ2  5  
ATOM 5960  C CZ3  . TRP A 1 17  ? 9.889   -0.372  4.964   1.00 0.00 ? 17  TRP A CZ3  5  
ATOM 5961  C CH2  . TRP A 1 17  ? 9.646   0.995   4.896   1.00 0.00 ? 17  TRP A CH2  5  
ATOM 5962  H H    . TRP A 1 17  ? 8.506   -1.643  -0.324  1.00 0.00 ? 17  TRP A H    5  
ATOM 5963  H HA   . TRP A 1 17  ? 9.813   -3.546  1.327   1.00 0.00 ? 17  TRP A HA   5  
ATOM 5964  H HB2  . TRP A 1 17  ? 6.844   -3.208  1.279   1.00 0.00 ? 17  TRP A HB2  5  
ATOM 5965  H HB3  . TRP A 1 17  ? 7.919   -3.489  2.634   1.00 0.00 ? 17  TRP A HB3  5  
ATOM 5966  H HD1  . TRP A 1 17  ? 6.567   -0.618  0.461   1.00 0.00 ? 17  TRP A HD1  5  
ATOM 5967  H HE1  . TRP A 1 17  ? 7.055   1.731   1.558   1.00 0.00 ? 17  TRP A HE1  5  
ATOM 5968  H HE3  . TRP A 1 17  ? 9.573   -2.384  4.162   1.00 0.00 ? 17  TRP A HE3  5  
ATOM 5969  H HZ2  . TRP A 1 17  ? 8.609   2.569   3.800   1.00 0.00 ? 17  TRP A HZ2  5  
ATOM 5970  H HZ3  . TRP A 1 17  ? 10.535  -0.733  5.763   1.00 0.00 ? 17  TRP A HZ3  5  
ATOM 5971  H HH2  . TRP A 1 17  ? 10.096  1.667   5.626   1.00 0.00 ? 17  TRP A HH2  5  
ATOM 5972  N N    . GLY A 1 18  ? 8.095   -4.493  -1.249  1.00 0.00 ? 18  GLY A N    5  
ATOM 5973  C CA   . GLY A 1 18  ? 7.716   -5.622  -2.081  1.00 0.00 ? 18  GLY A CA   5  
ATOM 5974  C C    . GLY A 1 18  ? 6.197   -5.694  -2.250  1.00 0.00 ? 18  GLY A C    5  
ATOM 5975  O O    . GLY A 1 18  ? 5.693   -6.508  -3.022  1.00 0.00 ? 18  GLY A O    5  
ATOM 5976  H H    . GLY A 1 18  ? 7.979   -3.596  -1.676  1.00 0.00 ? 18  GLY A H    5  
ATOM 5977  H HA2  . GLY A 1 18  ? 8.190   -5.534  -3.059  1.00 0.00 ? 18  GLY A HA2  5  
ATOM 5978  H HA3  . GLY A 1 18  ? 8.080   -6.547  -1.633  1.00 0.00 ? 18  GLY A HA3  5  
ATOM 5979  N N    . PHE A 1 19  ? 5.511   -4.832  -1.514  1.00 0.00 ? 19  PHE A N    5  
ATOM 5980  C CA   . PHE A 1 19  ? 4.060   -4.788  -1.573  1.00 0.00 ? 19  PHE A CA   5  
ATOM 5981  C C    . PHE A 1 19  ? 3.578   -3.516  -2.273  1.00 0.00 ? 19  PHE A C    5  
ATOM 5982  O O    . PHE A 1 19  ? 4.255   -2.490  -2.240  1.00 0.00 ? 19  PHE A O    5  
ATOM 5983  C CB   . PHE A 1 19  ? 3.554   -4.784  -0.129  1.00 0.00 ? 19  PHE A CB   5  
ATOM 5984  C CG   . PHE A 1 19  ? 3.612   -3.412  0.547   1.00 0.00 ? 19  PHE A CG   5  
ATOM 5985  C CD1  . PHE A 1 19  ? 2.785   -2.415  0.133   1.00 0.00 ? 19  PHE A CD1  5  
ATOM 5986  C CD2  . PHE A 1 19  ? 4.491   -3.190  1.561   1.00 0.00 ? 19  PHE A CD2  5  
ATOM 5987  C CE1  . PHE A 1 19  ? 2.839   -1.142  0.760   1.00 0.00 ? 19  PHE A CE1  5  
ATOM 5988  C CE2  . PHE A 1 19  ? 4.545   -1.917  2.188   1.00 0.00 ? 19  PHE A CE2  5  
ATOM 5989  C CZ   . PHE A 1 19  ? 3.718   -0.920  1.775   1.00 0.00 ? 19  PHE A CZ   5  
ATOM 5990  H H    . PHE A 1 19  ? 5.929   -4.174  -0.889  1.00 0.00 ? 19  PHE A H    5  
ATOM 5991  H HA   . PHE A 1 19  ? 3.732   -5.659  -2.140  1.00 0.00 ? 19  PHE A HA   5  
ATOM 5992  H HB2  . PHE A 1 19  ? 2.524   -5.141  -0.114  1.00 0.00 ? 19  PHE A HB2  5  
ATOM 5993  H HB3  . PHE A 1 19  ? 4.145   -5.490  0.455   1.00 0.00 ? 19  PHE A HB3  5  
ATOM 5994  H HD1  . PHE A 1 19  ? 2.081   -2.592  -0.679  1.00 0.00 ? 19  PHE A HD1  5  
ATOM 5995  H HD2  . PHE A 1 19  ? 5.154   -3.990  1.892   1.00 0.00 ? 19  PHE A HD2  5  
ATOM 5996  H HE1  . PHE A 1 19  ? 2.176   -0.342  0.429   1.00 0.00 ? 19  PHE A HE1  5  
ATOM 5997  H HE2  . PHE A 1 19  ? 5.249   -1.740  3.001   1.00 0.00 ? 19  PHE A HE2  5  
ATOM 5998  H HZ   . PHE A 1 19  ? 3.759   0.057   2.256   1.00 0.00 ? 19  PHE A HZ   5  
ATOM 5999  N N    . ARG A 1 20  ? 2.411   -3.625  -2.892  1.00 0.00 ? 20  ARG A N    5  
ATOM 6000  C CA   . ARG A 1 20  ? 1.830   -2.497  -3.599  1.00 0.00 ? 20  ARG A CA   5  
ATOM 6001  C C    . ARG A 1 20  ? 0.527   -2.062  -2.926  1.00 0.00 ? 20  ARG A C    5  
ATOM 6002  O O    . ARG A 1 20  ? 0.068   -2.703  -1.981  1.00 0.00 ? 20  ARG A O    5  
ATOM 6003  C CB   . ARG A 1 20  ? 1.549   -2.849  -5.061  1.00 0.00 ? 20  ARG A CB   5  
ATOM 6004  C CG   . ARG A 1 20  ? 2.851   -2.978  -5.855  1.00 0.00 ? 20  ARG A CG   5  
ATOM 6005  C CD   . ARG A 1 20  ? 3.028   -1.798  -6.813  1.00 0.00 ? 20  ARG A CD   5  
ATOM 6006  N NE   . ARG A 1 20  ? 3.243   -2.293  -8.191  1.00 0.00 ? 20  ARG A NE   5  
ATOM 6007  C CZ   . ARG A 1 20  ? 2.259   -2.683  -9.011  1.00 0.00 ? 20  ARG A CZ   5  
ATOM 6008  N NH1  . ARG A 1 20  ? 0.985   -2.639  -8.598  1.00 0.00 ? 20  ARG A NH1  5  
ATOM 6009  N NH2  . ARG A 1 20  ? 2.548   -3.118  -10.245 1.00 0.00 ? 20  ARG A NH2  5  
ATOM 6010  H H    . ARG A 1 20  ? 1.866   -4.464  -2.914  1.00 0.00 ? 20  ARG A H    5  
ATOM 6011  H HA   . ARG A 1 20  ? 2.584   -1.712  -3.538  1.00 0.00 ? 20  ARG A HA   5  
ATOM 6012  H HB2  . ARG A 1 20  ? 0.994   -3.785  -5.113  1.00 0.00 ? 20  ARG A HB2  5  
ATOM 6013  H HB3  . ARG A 1 20  ? 0.920   -2.080  -5.510  1.00 0.00 ? 20  ARG A HB3  5  
ATOM 6014  H HG2  . ARG A 1 20  ? 3.696   -3.023  -5.168  1.00 0.00 ? 20  ARG A HG2  5  
ATOM 6015  H HG3  . ARG A 1 20  ? 2.847   -3.911  -6.418  1.00 0.00 ? 20  ARG A HG3  5  
ATOM 6016  H HD2  . ARG A 1 20  ? 2.146   -1.158  -6.781  1.00 0.00 ? 20  ARG A HD2  5  
ATOM 6017  H HD3  . ARG A 1 20  ? 3.876   -1.189  -6.500  1.00 0.00 ? 20  ARG A HD3  5  
ATOM 6018  H HE   . ARG A 1 20  ? 4.183   -2.339  -8.531  1.00 0.00 ? 20  ARG A HE   5  
ATOM 6019  H HH11 . ARG A 1 20  ? 0.769   -2.315  -7.677  1.00 0.00 ? 20  ARG A HH11 5  
ATOM 6020  H HH12 . ARG A 1 20  ? 0.250   -2.931  -9.210  1.00 0.00 ? 20  ARG A HH12 5  
ATOM 6021  H HH21 . ARG A 1 20  ? 3.498   -3.151  -10.554 1.00 0.00 ? 20  ARG A HH21 5  
ATOM 6022  H HH22 . ARG A 1 20  ? 1.813   -3.410  -10.858 1.00 0.00 ? 20  ARG A HH22 5  
ATOM 6023  N N    . LEU A 1 21  ? -0.033  -0.977  -3.440  1.00 0.00 ? 21  LEU A N    5  
ATOM 6024  C CA   . LEU A 1 21  ? -1.275  -0.449  -2.900  1.00 0.00 ? 21  LEU A CA   5  
ATOM 6025  C C    . LEU A 1 21  ? -2.194  -0.039  -4.053  1.00 0.00 ? 21  LEU A C    5  
ATOM 6026  O O    . LEU A 1 21  ? -1.722  0.393   -5.104  1.00 0.00 ? 21  LEU A O    5  
ATOM 6027  C CB   . LEU A 1 21  ? -0.991  0.681   -1.909  1.00 0.00 ? 21  LEU A CB   5  
ATOM 6028  C CG   . LEU A 1 21  ? -0.297  0.273   -0.608  1.00 0.00 ? 21  LEU A CG   5  
ATOM 6029  C CD1  . LEU A 1 21  ? -0.014  1.494   0.269   1.00 0.00 ? 21  LEU A CD1  5  
ATOM 6030  C CD2  . LEU A 1 21  ? -1.106  -0.792  0.135   1.00 0.00 ? 21  LEU A CD2  5  
ATOM 6031  H H    . LEU A 1 21  ? 0.346   -0.462  -4.208  1.00 0.00 ? 21  LEU A H    5  
ATOM 6032  H HA   . LEU A 1 21  ? -1.757  -1.253  -2.344  1.00 0.00 ? 21  LEU A HA   5  
ATOM 6033  H HB2  . LEU A 1 21  ? -0.375  1.429   -2.407  1.00 0.00 ? 21  LEU A HB2  5  
ATOM 6034  H HB3  . LEU A 1 21  ? -1.936  1.162   -1.657  1.00 0.00 ? 21  LEU A HB3  5  
ATOM 6035  H HG   . LEU A 1 21  ? 0.666   -0.172  -0.860  1.00 0.00 ? 21  LEU A HG   5  
ATOM 6036  H HD11 . LEU A 1 21  ? 0.527   1.183   1.163   1.00 0.00 ? 21  LEU A HD11 5  
ATOM 6037  H HD12 . LEU A 1 21  ? 0.588   2.211   -0.289  1.00 0.00 ? 21  LEU A HD12 5  
ATOM 6038  H HD13 . LEU A 1 21  ? -0.957  1.959   0.559   1.00 0.00 ? 21  LEU A HD13 5  
ATOM 6039  H HD21 . LEU A 1 21  ? -1.180  -1.688  -0.481  1.00 0.00 ? 21  LEU A HD21 5  
ATOM 6040  H HD22 . LEU A 1 21  ? -0.608  -1.037  1.073   1.00 0.00 ? 21  LEU A HD22 5  
ATOM 6041  H HD23 . LEU A 1 21  ? -2.105  -0.410  0.343   1.00 0.00 ? 21  LEU A HD23 5  
ATOM 6042  N N    . GLN A 1 22  ? -3.489  -0.190  -3.818  1.00 0.00 ? 22  GLN A N    5  
ATOM 6043  C CA   . GLN A 1 22  ? -4.477  0.159   -4.824  1.00 0.00 ? 22  GLN A CA   5  
ATOM 6044  C C    . GLN A 1 22  ? -5.749  0.689   -4.158  1.00 0.00 ? 22  GLN A C    5  
ATOM 6045  O O    . GLN A 1 22  ? -6.105  0.258   -3.062  1.00 0.00 ? 22  GLN A O    5  
ATOM 6046  C CB   . GLN A 1 22  ? -4.789  -1.038  -5.726  1.00 0.00 ? 22  GLN A CB   5  
ATOM 6047  C CG   . GLN A 1 22  ? -5.227  -2.248  -4.898  1.00 0.00 ? 22  GLN A CG   5  
ATOM 6048  C CD   . GLN A 1 22  ? -5.636  -3.412  -5.804  1.00 0.00 ? 22  GLN A CD   5  
ATOM 6049  O OE1  . GLN A 1 22  ? -5.861  -3.257  -6.993  1.00 0.00 ? 22  GLN A OE1  5  
ATOM 6050  N NE2  . GLN A 1 22  ? -5.720  -4.581  -5.176  1.00 0.00 ? 22  GLN A NE2  5  
ATOM 6051  H H    . GLN A 1 22  ? -3.864  -0.543  -2.961  1.00 0.00 ? 22  GLN A H    5  
ATOM 6052  H HA   . GLN A 1 22  ? -4.017  0.946   -5.422  1.00 0.00 ? 22  GLN A HA   5  
ATOM 6053  H HB2  . GLN A 1 22  ? -5.575  -0.771  -6.431  1.00 0.00 ? 22  GLN A HB2  5  
ATOM 6054  H HB3  . GLN A 1 22  ? -3.907  -1.294  -6.313  1.00 0.00 ? 22  GLN A HB3  5  
ATOM 6055  H HG2  . GLN A 1 22  ? -4.412  -2.560  -4.245  1.00 0.00 ? 22  GLN A HG2  5  
ATOM 6056  H HG3  . GLN A 1 22  ? -6.063  -1.971  -4.256  1.00 0.00 ? 22  GLN A HG3  5  
ATOM 6057  H HE21 . GLN A 1 22  ? -5.523  -4.639  -4.198  1.00 0.00 ? 22  GLN A HE21 5  
ATOM 6058  H HE22 . GLN A 1 22  ? -5.981  -5.403  -5.683  1.00 0.00 ? 22  GLN A HE22 5  
ATOM 6059  N N    . GLY A 1 23  ? -6.398  1.615   -4.847  1.00 0.00 ? 23  GLY A N    5  
ATOM 6060  C CA   . GLY A 1 23  ? -7.622  2.208   -4.335  1.00 0.00 ? 23  GLY A CA   5  
ATOM 6061  C C    . GLY A 1 23  ? -7.363  3.614   -3.788  1.00 0.00 ? 23  GLY A C    5  
ATOM 6062  O O    . GLY A 1 23  ? -6.320  4.206   -4.058  1.00 0.00 ? 23  GLY A O    5  
ATOM 6063  H H    . GLY A 1 23  ? -6.101  1.960   -5.737  1.00 0.00 ? 23  GLY A H    5  
ATOM 6064  H HA2  . GLY A 1 23  ? -8.367  2.255   -5.129  1.00 0.00 ? 23  GLY A HA2  5  
ATOM 6065  H HA3  . GLY A 1 23  ? -8.034  1.578   -3.548  1.00 0.00 ? 23  GLY A HA3  5  
ATOM 6066  N N    . GLY A 1 24  ? -8.331  4.105   -3.028  1.00 0.00 ? 24  GLY A N    5  
ATOM 6067  C CA   . GLY A 1 24  ? -8.221  5.430   -2.441  1.00 0.00 ? 24  GLY A CA   5  
ATOM 6068  C C    . GLY A 1 24  ? -9.531  6.206   -2.588  1.00 0.00 ? 24  GLY A C    5  
ATOM 6069  O O    . GLY A 1 24  ? -10.496 5.699   -3.159  1.00 0.00 ? 24  GLY A O    5  
ATOM 6070  H H    . GLY A 1 24  ? -9.176  3.617   -2.814  1.00 0.00 ? 24  GLY A H    5  
ATOM 6071  H HA2  . GLY A 1 24  ? -7.963  5.343   -1.385  1.00 0.00 ? 24  GLY A HA2  5  
ATOM 6072  H HA3  . GLY A 1 24  ? -7.412  5.979   -2.922  1.00 0.00 ? 24  GLY A HA3  5  
ATOM 6073  N N    . LYS A 1 25  ? -9.523  7.423   -2.064  1.00 0.00 ? 25  LYS A N    5  
ATOM 6074  C CA   . LYS A 1 25  ? -10.699 8.273   -2.130  1.00 0.00 ? 25  LYS A CA   5  
ATOM 6075  C C    . LYS A 1 25  ? -10.968 8.652   -3.588  1.00 0.00 ? 25  LYS A C    5  
ATOM 6076  O O    . LYS A 1 25  ? -12.115 8.645   -4.034  1.00 0.00 ? 25  LYS A O    5  
ATOM 6077  C CB   . LYS A 1 25  ? -10.542 9.479   -1.201  1.00 0.00 ? 25  LYS A CB   5  
ATOM 6078  C CG   . LYS A 1 25  ? -11.893 10.146  -0.935  1.00 0.00 ? 25  LYS A CG   5  
ATOM 6079  C CD   . LYS A 1 25  ? -12.030 10.538  0.538   1.00 0.00 ? 25  LYS A CD   5  
ATOM 6080  C CE   . LYS A 1 25  ? -11.194 11.780  0.854   1.00 0.00 ? 25  LYS A CE   5  
ATOM 6081  N NZ   . LYS A 1 25  ? -11.845 12.587  1.911   1.00 0.00 ? 25  LYS A NZ   5  
ATOM 6082  H H    . LYS A 1 25  ? -8.734  7.827   -1.602  1.00 0.00 ? 25  LYS A H    5  
ATOM 6083  H HA   . LYS A 1 25  ? -11.545 7.692   -1.763  1.00 0.00 ? 25  LYS A HA   5  
ATOM 6084  H HB2  . LYS A 1 25  ? -10.097 9.160   -0.258  1.00 0.00 ? 25  LYS A HB2  5  
ATOM 6085  H HB3  . LYS A 1 25  ? -9.857  10.200  -1.648  1.00 0.00 ? 25  LYS A HB3  5  
ATOM 6086  H HG2  . LYS A 1 25  ? -11.994 11.032  -1.562  1.00 0.00 ? 25  LYS A HG2  5  
ATOM 6087  H HG3  . LYS A 1 25  ? -12.699 9.466   -1.210  1.00 0.00 ? 25  LYS A HG3  5  
ATOM 6088  H HD2  . LYS A 1 25  ? -13.077 10.730  0.771   1.00 0.00 ? 25  LYS A HD2  5  
ATOM 6089  H HD3  . LYS A 1 25  ? -11.709 9.710   1.170   1.00 0.00 ? 25  LYS A HD3  5  
ATOM 6090  H HE2  . LYS A 1 25  ? -10.197 11.483  1.178   1.00 0.00 ? 25  LYS A HE2  5  
ATOM 6091  H HE3  . LYS A 1 25  ? -11.071 12.382  -0.046  1.00 0.00 ? 25  LYS A HE3  5  
ATOM 6092  H HZ1  . LYS A 1 25  ? -12.813 12.710  1.688   1.00 0.00 ? 25  LYS A HZ1  5  
ATOM 6093  H HZ2  . LYS A 1 25  ? -11.763 12.115  2.789   1.00 0.00 ? 25  LYS A HZ2  5  
ATOM 6094  H HZ3  . LYS A 1 25  ? -11.401 13.481  1.969   1.00 0.00 ? 25  LYS A HZ3  5  
ATOM 6095  N N    . ASP A 1 26  ? -9.892  8.974   -4.291  1.00 0.00 ? 26  ASP A N    5  
ATOM 6096  C CA   . ASP A 1 26  ? -9.997  9.355   -5.689  1.00 0.00 ? 26  ASP A CA   5  
ATOM 6097  C C    . ASP A 1 26  ? -10.380 8.128   -6.520  1.00 0.00 ? 26  ASP A C    5  
ATOM 6098  O O    . ASP A 1 26  ? -10.834 8.260   -7.655  1.00 0.00 ? 26  ASP A O    5  
ATOM 6099  C CB   . ASP A 1 26  ? -8.663  9.885   -6.217  1.00 0.00 ? 26  ASP A CB   5  
ATOM 6100  C CG   . ASP A 1 26  ? -7.428  9.112   -5.750  1.00 0.00 ? 26  ASP A CG   5  
ATOM 6101  O OD1  . ASP A 1 26  ? -7.379  8.799   -4.540  1.00 0.00 ? 26  ASP A OD1  5  
ATOM 6102  O OD2  . ASP A 1 26  ? -6.562  8.850   -6.612  1.00 0.00 ? 26  ASP A OD2  5  
ATOM 6103  H H    . ASP A 1 26  ? -8.963  8.977   -3.921  1.00 0.00 ? 26  ASP A H    5  
ATOM 6104  H HA   . ASP A 1 26  ? -10.760 10.133  -5.717  1.00 0.00 ? 26  ASP A HA   5  
ATOM 6105  H HB2  . ASP A 1 26  ? -8.690  9.873   -7.307  1.00 0.00 ? 26  ASP A HB2  5  
ATOM 6106  H HB3  . ASP A 1 26  ? -8.557  10.927  -5.913  1.00 0.00 ? 26  ASP A HB3  5  
ATOM 6107  N N    . PHE A 1 27  ? -10.184 6.963   -5.921  1.00 0.00 ? 27  PHE A N    5  
ATOM 6108  C CA   . PHE A 1 27  ? -10.503 5.714   -6.591  1.00 0.00 ? 27  PHE A CA   5  
ATOM 6109  C C    . PHE A 1 27  ? -11.914 5.244   -6.231  1.00 0.00 ? 27  PHE A C    5  
ATOM 6110  O O    . PHE A 1 27  ? -12.546 4.521   -7.000  1.00 0.00 ? 27  PHE A O    5  
ATOM 6111  C CB   . PHE A 1 27  ? -9.493  4.674   -6.104  1.00 0.00 ? 27  PHE A CB   5  
ATOM 6112  C CG   . PHE A 1 27  ? -8.111  4.799   -6.750  1.00 0.00 ? 27  PHE A CG   5  
ATOM 6113  C CD1  . PHE A 1 27  ? -7.378  5.931   -6.574  1.00 0.00 ? 27  PHE A CD1  5  
ATOM 6114  C CD2  . PHE A 1 27  ? -7.616  3.778   -7.500  1.00 0.00 ? 27  PHE A CD2  5  
ATOM 6115  C CE1  . PHE A 1 27  ? -6.096  6.047   -7.173  1.00 0.00 ? 27  PHE A CE1  5  
ATOM 6116  C CE2  . PHE A 1 27  ? -6.334  3.894   -8.099  1.00 0.00 ? 27  PHE A CE2  5  
ATOM 6117  C CZ   . PHE A 1 27  ? -5.601  5.026   -7.923  1.00 0.00 ? 27  PHE A CZ   5  
ATOM 6118  H H    . PHE A 1 27  ? -9.815  6.864   -4.997  1.00 0.00 ? 27  PHE A H    5  
ATOM 6119  H HA   . PHE A 1 27  ? -10.446 5.899   -7.664  1.00 0.00 ? 27  PHE A HA   5  
ATOM 6120  H HB2  . PHE A 1 27  ? -9.386  4.763   -5.023  1.00 0.00 ? 27  PHE A HB2  5  
ATOM 6121  H HB3  . PHE A 1 27  ? -9.887  3.677   -6.304  1.00 0.00 ? 27  PHE A HB3  5  
ATOM 6122  H HD1  . PHE A 1 27  ? -7.775  6.749   -5.972  1.00 0.00 ? 27  PHE A HD1  5  
ATOM 6123  H HD2  . PHE A 1 27  ? -8.204  2.871   -7.641  1.00 0.00 ? 27  PHE A HD2  5  
ATOM 6124  H HE1  . PHE A 1 27  ? -5.509  6.954   -7.032  1.00 0.00 ? 27  PHE A HE1  5  
ATOM 6125  H HE2  . PHE A 1 27  ? -5.937  3.076   -8.701  1.00 0.00 ? 27  PHE A HE2  5  
ATOM 6126  H HZ   . PHE A 1 27  ? -4.617  5.115   -8.383  1.00 0.00 ? 27  PHE A HZ   5  
ATOM 6127  N N    . ASN A 1 28  ? -12.367 5.673   -5.063  1.00 0.00 ? 28  ASN A N    5  
ATOM 6128  C CA   . ASN A 1 28  ? -13.691 5.306   -4.592  1.00 0.00 ? 28  ASN A CA   5  
ATOM 6129  C C    . ASN A 1 28  ? -13.636 3.910   -3.967  1.00 0.00 ? 28  ASN A C    5  
ATOM 6130  O O    . ASN A 1 28  ? -14.567 3.120   -4.120  1.00 0.00 ? 28  ASN A O    5  
ATOM 6131  C CB   . ASN A 1 28  ? -14.695 5.268   -5.745  1.00 0.00 ? 28  ASN A CB   5  
ATOM 6132  C CG   . ASN A 1 28  ? -16.114 5.553   -5.248  1.00 0.00 ? 28  ASN A CG   5  
ATOM 6133  O OD1  . ASN A 1 28  ? -16.869 4.660   -4.900  1.00 0.00 ? 28  ASN A OD1  5  
ATOM 6134  N ND2  . ASN A 1 28  ? -16.432 6.845   -5.233  1.00 0.00 ? 28  ASN A ND2  5  
ATOM 6135  H H    . ASN A 1 28  ? -11.846 6.261   -4.443  1.00 0.00 ? 28  ASN A H    5  
ATOM 6136  H HA   . ASN A 1 28  ? -13.962 6.076   -3.869  1.00 0.00 ? 28  ASN A HA   5  
ATOM 6137  H HB2  . ASN A 1 28  ? -14.416 6.004   -6.500  1.00 0.00 ? 28  ASN A HB2  5  
ATOM 6138  H HB3  . ASN A 1 28  ? -14.665 4.291   -6.227  1.00 0.00 ? 28  ASN A HB3  5  
ATOM 6139  H HD21 . ASN A 1 28  ? -15.765 7.528   -5.531  1.00 0.00 ? 28  ASN A HD21 5  
ATOM 6140  H HD22 . ASN A 1 28  ? -17.338 7.132   -4.923  1.00 0.00 ? 28  ASN A HD22 5  
ATOM 6141  N N    . MET A 1 29  ? -12.536 3.649   -3.276  1.00 0.00 ? 29  MET A N    5  
ATOM 6142  C CA   . MET A 1 29  ? -12.348 2.362   -2.628  1.00 0.00 ? 29  MET A CA   5  
ATOM 6143  C C    . MET A 1 29  ? -11.298 2.455   -1.519  1.00 0.00 ? 29  MET A C    5  
ATOM 6144  O O    . MET A 1 29  ? -10.533 3.417   -1.463  1.00 0.00 ? 29  MET A O    5  
ATOM 6145  C CB   . MET A 1 29  ? -11.906 1.328   -3.664  1.00 0.00 ? 29  MET A CB   5  
ATOM 6146  C CG   . MET A 1 29  ? -10.382 1.307   -3.804  1.00 0.00 ? 29  MET A CG   5  
ATOM 6147  S SD   . MET A 1 29  ? -9.901  0.159   -5.082  1.00 0.00 ? 29  MET A SD   5  
ATOM 6148  C CE   . MET A 1 29  ? -9.357  -1.213  -4.078  1.00 0.00 ? 29  MET A CE   5  
ATOM 6149  H H    . MET A 1 29  ? -11.784 4.297   -3.156  1.00 0.00 ? 29  MET A H    5  
ATOM 6150  H HA   . MET A 1 29  ? -13.317 2.106   -2.199  1.00 0.00 ? 29  MET A HA   5  
ATOM 6151  H HB2  . MET A 1 29  ? -12.261 0.340   -3.372  1.00 0.00 ? 29  MET A HB2  5  
ATOM 6152  H HB3  . MET A 1 29  ? -12.360 1.557   -4.629  1.00 0.00 ? 29  MET A HB3  5  
ATOM 6153  H HG2  . MET A 1 29  ? -10.018 2.306   -4.044  1.00 0.00 ? 29  MET A HG2  5  
ATOM 6154  H HG3  . MET A 1 29  ? -9.926  1.021   -2.856  1.00 0.00 ? 29  MET A HG3  5  
ATOM 6155  H HE1  . MET A 1 29  ? -9.520  -0.980  -3.026  1.00 0.00 ? 29  MET A HE1  5  
ATOM 6156  H HE2  . MET A 1 29  ? -9.922  -2.106  -4.345  1.00 0.00 ? 29  MET A HE2  5  
ATOM 6157  H HE3  . MET A 1 29  ? -8.295  -1.390  -4.251  1.00 0.00 ? 29  MET A HE3  5  
ATOM 6158  N N    . PRO A 1 30  ? -11.294 1.416   -0.642  1.00 0.00 ? 30  PRO A N    5  
ATOM 6159  C CA   . PRO A 1 30  ? -10.350 1.372   0.462   1.00 0.00 ? 30  PRO A CA   5  
ATOM 6160  C C    . PRO A 1 30  ? -8.948  1.006   -0.030  1.00 0.00 ? 30  PRO A C    5  
ATOM 6161  O O    . PRO A 1 30  ? -8.797  0.398   -1.088  1.00 0.00 ? 30  PRO A O    5  
ATOM 6162  C CB   . PRO A 1 30  ? -10.925 0.351   1.430   1.00 0.00 ? 30  PRO A CB   5  
ATOM 6163  C CG   . PRO A 1 30  ? -11.917 -0.474  0.626   1.00 0.00 ? 30  PRO A CG   5  
ATOM 6164  C CD   . PRO A 1 30  ? -12.186 0.261   -0.677  1.00 0.00 ? 30  PRO A CD   5  
ATOM 6165  H HA   . PRO A 1 30  ? -10.265 2.275   0.883   1.00 0.00 ? 30  PRO A HA   5  
ATOM 6166  H HB2  . PRO A 1 30  ? -10.139 -0.279  1.846   1.00 0.00 ? 30  PRO A HB2  5  
ATOM 6167  H HB3  . PRO A 1 30  ? -11.416 0.843   2.270   1.00 0.00 ? 30  PRO A HB3  5  
ATOM 6168  H HG2  . PRO A 1 30  ? -11.515 -1.468  0.429   1.00 0.00 ? 30  PRO A HG2  5  
ATOM 6169  H HG3  . PRO A 1 30  ? -12.842 -0.610  1.186   1.00 0.00 ? 30  PRO A HG3  5  
ATOM 6170  H HD2  . PRO A 1 30  ? -11.978 -0.373  -1.539  1.00 0.00 ? 30  PRO A HD2  5  
ATOM 6171  H HD3  . PRO A 1 30  ? -13.229 0.567   -0.751  1.00 0.00 ? 30  PRO A HD3  5  
ATOM 6172  N N    . LEU A 1 31  ? -7.959  1.393   0.762   1.00 0.00 ? 31  LEU A N    5  
ATOM 6173  C CA   . LEU A 1 31  ? -6.574  1.114   0.420   1.00 0.00 ? 31  LEU A CA   5  
ATOM 6174  C C    . LEU A 1 31  ? -6.275  -0.362  0.689   1.00 0.00 ? 31  LEU A C    5  
ATOM 6175  O O    . LEU A 1 31  ? -6.183  -0.780  1.843   1.00 0.00 ? 31  LEU A O    5  
ATOM 6176  C CB   . LEU A 1 31  ? -5.637  2.075   1.154   1.00 0.00 ? 31  LEU A CB   5  
ATOM 6177  C CG   . LEU A 1 31  ? -5.576  3.502   0.604   1.00 0.00 ? 31  LEU A CG   5  
ATOM 6178  C CD1  . LEU A 1 31  ? -5.445  4.521   1.738   1.00 0.00 ? 31  LEU A CD1  5  
ATOM 6179  C CD2  . LEU A 1 31  ? -4.454  3.645   -0.426  1.00 0.00 ? 31  LEU A CD2  5  
ATOM 6180  H H    . LEU A 1 31  ? -8.090  1.888   1.621   1.00 0.00 ? 31  LEU A H    5  
ATOM 6181  H HA   . LEU A 1 31  ? -6.457  1.301   -0.647  1.00 0.00 ? 31  LEU A HA   5  
ATOM 6182  H HB2  . LEU A 1 31  ? -5.942  2.122   2.199   1.00 0.00 ? 31  LEU A HB2  5  
ATOM 6183  H HB3  . LEU A 1 31  ? -4.631  1.656   1.134   1.00 0.00 ? 31  LEU A HB3  5  
ATOM 6184  H HG   . LEU A 1 31  ? -6.514  3.711   0.090   1.00 0.00 ? 31  LEU A HG   5  
ATOM 6185  H HD11 . LEU A 1 31  ? -6.438  4.797   2.095   1.00 0.00 ? 31  LEU A HD11 5  
ATOM 6186  H HD12 . LEU A 1 31  ? -4.874  4.082   2.557   1.00 0.00 ? 31  LEU A HD12 5  
ATOM 6187  H HD13 . LEU A 1 31  ? -4.931  5.409   1.371   1.00 0.00 ? 31  LEU A HD13 5  
ATOM 6188  H HD21 . LEU A 1 31  ? -3.680  2.903   -0.226  1.00 0.00 ? 31  LEU A HD21 5  
ATOM 6189  H HD22 . LEU A 1 31  ? -4.858  3.488   -1.427  1.00 0.00 ? 31  LEU A HD22 5  
ATOM 6190  H HD23 . LEU A 1 31  ? -4.025  4.645   -0.360  1.00 0.00 ? 31  LEU A HD23 5  
ATOM 6191  N N    . THR A 1 32  ? -6.131  -1.111  -0.394  1.00 0.00 ? 32  THR A N    5  
ATOM 6192  C CA   . THR A 1 32  ? -5.844  -2.532  -0.289  1.00 0.00 ? 32  THR A CA   5  
ATOM 6193  C C    . THR A 1 32  ? -4.453  -2.837  -0.847  1.00 0.00 ? 32  THR A C    5  
ATOM 6194  O O    . THR A 1 32  ? -3.843  -1.993  -1.501  1.00 0.00 ? 32  THR A O    5  
ATOM 6195  C CB   . THR A 1 32  ? -6.965  -3.294  -1.000  1.00 0.00 ? 32  THR A CB   5  
ATOM 6196  O OG1  . THR A 1 32  ? -7.389  -2.406  -2.031  1.00 0.00 ? 32  THR A OG1  5  
ATOM 6197  C CG2  . THR A 1 32  ? -8.205  -3.465  -0.121  1.00 0.00 ? 32  THR A CG2  5  
ATOM 6198  H H    . THR A 1 32  ? -6.208  -0.763  -1.328  1.00 0.00 ? 32  THR A H    5  
ATOM 6199  H HA   . THR A 1 32  ? -5.833  -2.803  0.766   1.00 0.00 ? 32  THR A HA   5  
ATOM 6200  H HB   . THR A 1 32  ? -6.609  -4.258  -1.364  1.00 0.00 ? 32  THR A HB   5  
ATOM 6201  H HG1  . THR A 1 32  ? -7.616  -2.924  -2.855  1.00 0.00 ? 32  THR A HG1  5  
ATOM 6202  H HG21 . THR A 1 32  ? -8.328  -2.585  0.510   1.00 0.00 ? 32  THR A HG21 5  
ATOM 6203  H HG22 . THR A 1 32  ? -9.085  -3.583  -0.754  1.00 0.00 ? 32  THR A HG22 5  
ATOM 6204  H HG23 . THR A 1 32  ? -8.088  -4.348  0.506   1.00 0.00 ? 32  THR A HG23 5  
ATOM 6205  N N    . ILE A 1 33  ? -3.991  -4.047  -0.567  1.00 0.00 ? 33  ILE A N    5  
ATOM 6206  C CA   . ILE A 1 33  ? -2.682  -4.474  -1.032  1.00 0.00 ? 33  ILE A CA   5  
ATOM 6207  C C    . ILE A 1 33  ? -2.774  -4.866  -2.508  1.00 0.00 ? 33  ILE A C    5  
ATOM 6208  O O    . ILE A 1 33  ? -3.190  -5.977  -2.835  1.00 0.00 ? 33  ILE A O    5  
ATOM 6209  C CB   . ILE A 1 33  ? -2.130  -5.584  -0.134  1.00 0.00 ? 33  ILE A CB   5  
ATOM 6210  C CG1  . ILE A 1 33  ? -2.047  -5.120  1.321   1.00 0.00 ? 33  ILE A CG1  5  
ATOM 6211  C CG2  . ILE A 1 33  ? -0.783  -6.089  -0.653  1.00 0.00 ? 33  ILE A CG2  5  
ATOM 6212  C CD1  . ILE A 1 33  ? -1.075  -3.948  1.469   1.00 0.00 ? 33  ILE A CD1  5  
ATOM 6213  H H    . ILE A 1 33  ? -4.493  -4.728  -0.034  1.00 0.00 ? 33  ILE A H    5  
ATOM 6214  H HA   . ILE A 1 33  ? -2.009  -3.622  -0.942  1.00 0.00 ? 33  ILE A HA   5  
ATOM 6215  H HB   . ILE A 1 33  ? -2.823  -6.424  -0.166  1.00 0.00 ? 33  ILE A HB   5  
ATOM 6216  H HG12 . ILE A 1 33  ? -3.036  -4.823  1.669   1.00 0.00 ? 33  ILE A HG12 5  
ATOM 6217  H HG13 . ILE A 1 33  ? -1.723  -5.948  1.952   1.00 0.00 ? 33  ILE A HG13 5  
ATOM 6218  H HG21 . ILE A 1 33  ? -0.476  -5.491  -1.511  1.00 0.00 ? 33  ILE A HG21 5  
ATOM 6219  H HG22 . ILE A 1 33  ? -0.035  -6.003  0.135   1.00 0.00 ? 33  ILE A HG22 5  
ATOM 6220  H HG23 . ILE A 1 33  ? -0.877  -7.133  -0.953  1.00 0.00 ? 33  ILE A HG23 5  
ATOM 6221  H HD11 . ILE A 1 33  ? -1.499  -3.063  0.995   1.00 0.00 ? 33  ILE A HD11 5  
ATOM 6222  H HD12 . ILE A 1 33  ? -0.905  -3.747  2.527   1.00 0.00 ? 33  ILE A HD12 5  
ATOM 6223  H HD13 . ILE A 1 33  ? -0.128  -4.199  0.990   1.00 0.00 ? 33  ILE A HD13 5  
ATOM 6224  N N    . SER A 1 34  ? -2.378  -3.933  -3.361  1.00 0.00 ? 34  SER A N    5  
ATOM 6225  C CA   . SER A 1 34  ? -2.410  -4.167  -4.795  1.00 0.00 ? 34  SER A CA   5  
ATOM 6226  C C    . SER A 1 34  ? -1.857  -5.558  -5.110  1.00 0.00 ? 34  SER A C    5  
ATOM 6227  O O    . SER A 1 34  ? -2.540  -6.378  -5.721  1.00 0.00 ? 34  SER A O    5  
ATOM 6228  C CB   . SER A 1 34  ? -1.615  -3.097  -5.546  1.00 0.00 ? 34  SER A CB   5  
ATOM 6229  O OG   . SER A 1 34  ? -0.996  -3.617  -6.719  1.00 0.00 ? 34  SER A OG   5  
ATOM 6230  H H    . SER A 1 34  ? -2.040  -3.032  -3.087  1.00 0.00 ? 34  SER A H    5  
ATOM 6231  H HA   . SER A 1 34  ? -3.461  -4.101  -5.075  1.00 0.00 ? 34  SER A HA   5  
ATOM 6232  H HB2  . SER A 1 34  ? -2.279  -2.277  -5.819  1.00 0.00 ? 34  SER A HB2  5  
ATOM 6233  H HB3  . SER A 1 34  ? -0.852  -2.682  -4.886  1.00 0.00 ? 34  SER A HB3  5  
ATOM 6234  H HG   . SER A 1 34  ? -0.338  -4.328  -6.472  1.00 0.00 ? 34  SER A HG   5  
ATOM 6235  N N    . SER A 1 35  ? -0.624  -5.781  -4.680  1.00 0.00 ? 35  SER A N    5  
ATOM 6236  C CA   . SER A 1 35  ? 0.029   -7.059  -4.909  1.00 0.00 ? 35  SER A CA   5  
ATOM 6237  C C    . SER A 1 35  ? 1.163   -7.255  -3.901  1.00 0.00 ? 35  SER A C    5  
ATOM 6238  O O    . SER A 1 35  ? 1.414   -6.388  -3.066  1.00 0.00 ? 35  SER A O    5  
ATOM 6239  C CB   . SER A 1 35  ? 0.567   -7.154  -6.338  1.00 0.00 ? 35  SER A CB   5  
ATOM 6240  O OG   . SER A 1 35  ? -0.163  -8.095  -7.122  1.00 0.00 ? 35  SER A OG   5  
ATOM 6241  H H    . SER A 1 35  ? -0.074  -5.109  -4.184  1.00 0.00 ? 35  SER A H    5  
ATOM 6242  H HA   . SER A 1 35  ? -0.747  -7.810  -4.763  1.00 0.00 ? 35  SER A HA   5  
ATOM 6243  H HB2  . SER A 1 35  ? 0.517   -6.173  -6.811  1.00 0.00 ? 35  SER A HB2  5  
ATOM 6244  H HB3  . SER A 1 35  ? 1.618   -7.443  -6.312  1.00 0.00 ? 35  SER A HB3  5  
ATOM 6245  H HG   . SER A 1 35  ? -0.167  -8.987  -6.670  1.00 0.00 ? 35  SER A HG   5  
ATOM 6246  N N    . LEU A 1 36  ? 1.819   -8.401  -4.013  1.00 0.00 ? 36  LEU A N    5  
ATOM 6247  C CA   . LEU A 1 36  ? 2.921   -8.722  -3.121  1.00 0.00 ? 36  LEU A CA   5  
ATOM 6248  C C    . LEU A 1 36  ? 4.146   -9.111  -3.951  1.00 0.00 ? 36  LEU A C    5  
ATOM 6249  O O    . LEU A 1 36  ? 4.039   -9.333  -5.157  1.00 0.00 ? 36  LEU A O    5  
ATOM 6250  C CB   . LEU A 1 36  ? 2.499   -9.790  -2.111  1.00 0.00 ? 36  LEU A CB   5  
ATOM 6251  C CG   . LEU A 1 36  ? 2.479   -9.355  -0.644  1.00 0.00 ? 36  LEU A CG   5  
ATOM 6252  C CD1  . LEU A 1 36  ? 3.843   -8.811  -0.215  1.00 0.00 ? 36  LEU A CD1  5  
ATOM 6253  C CD2  . LEU A 1 36  ? 1.354   -8.351  -0.385  1.00 0.00 ? 36  LEU A CD2  5  
ATOM 6254  H H    . LEU A 1 36  ? 1.610   -9.101  -4.695  1.00 0.00 ? 36  LEU A H    5  
ATOM 6255  H HA   . LEU A 1 36  ? 3.159   -7.820  -2.557  1.00 0.00 ? 36  LEU A HA   5  
ATOM 6256  H HB2  . LEU A 1 36  ? 1.502   -10.142 -2.378  1.00 0.00 ? 36  LEU A HB2  5  
ATOM 6257  H HB3  . LEU A 1 36  ? 3.174   -10.641 -2.207  1.00 0.00 ? 36  LEU A HB3  5  
ATOM 6258  H HG   . LEU A 1 36  ? 2.275   -10.232 -0.030  1.00 0.00 ? 36  LEU A HG   5  
ATOM 6259  H HD11 . LEU A 1 36  ? 4.069   -7.909  -0.783  1.00 0.00 ? 36  LEU A HD11 5  
ATOM 6260  H HD12 . LEU A 1 36  ? 3.822   -8.575  0.849   1.00 0.00 ? 36  LEU A HD12 5  
ATOM 6261  H HD13 . LEU A 1 36  ? 4.610   -9.562  -0.405  1.00 0.00 ? 36  LEU A HD13 5  
ATOM 6262  H HD21 . LEU A 1 36  ? 1.782   -7.368  -0.187  1.00 0.00 ? 36  LEU A HD21 5  
ATOM 6263  H HD22 . LEU A 1 36  ? 0.708   -8.296  -1.261  1.00 0.00 ? 36  LEU A HD22 5  
ATOM 6264  H HD23 . LEU A 1 36  ? 0.770   -8.673  0.477   1.00 0.00 ? 36  LEU A HD23 5  
ATOM 6265  N N    . LYS A 1 37  ? 5.282   -9.182  -3.274  1.00 0.00 ? 37  LYS A N    5  
ATOM 6266  C CA   . LYS A 1 37  ? 6.526   -9.540  -3.933  1.00 0.00 ? 37  LYS A CA   5  
ATOM 6267  C C    . LYS A 1 37  ? 7.028   -10.875 -3.377  1.00 0.00 ? 37  LYS A C    5  
ATOM 6268  O O    . LYS A 1 37  ? 7.023   -11.087 -2.166  1.00 0.00 ? 37  LYS A O    5  
ATOM 6269  C CB   . LYS A 1 37  ? 7.543   -8.403  -3.814  1.00 0.00 ? 37  LYS A CB   5  
ATOM 6270  C CG   . LYS A 1 37  ? 8.888   -8.804  -4.423  1.00 0.00 ? 37  LYS A CG   5  
ATOM 6271  C CD   . LYS A 1 37  ? 9.099   -8.129  -5.780  1.00 0.00 ? 37  LYS A CD   5  
ATOM 6272  C CE   . LYS A 1 37  ? 8.985   -9.143  -6.920  1.00 0.00 ? 37  LYS A CE   5  
ATOM 6273  N NZ   . LYS A 1 37  ? 10.242  -9.189  -7.701  1.00 0.00 ? 37  LYS A NZ   5  
ATOM 6274  H H    . LYS A 1 37  ? 5.361   -9.000  -2.294  1.00 0.00 ? 37  LYS A H    5  
ATOM 6275  H HA   . LYS A 1 37  ? 6.309   -9.668  -4.994  1.00 0.00 ? 37  LYS A HA   5  
ATOM 6276  H HB2  . LYS A 1 37  ? 7.162   -7.515  -4.318  1.00 0.00 ? 37  LYS A HB2  5  
ATOM 6277  H HB3  . LYS A 1 37  ? 7.679   -8.141  -2.765  1.00 0.00 ? 37  LYS A HB3  5  
ATOM 6278  H HG2  . LYS A 1 37  ? 9.696   -8.526  -3.746  1.00 0.00 ? 37  LYS A HG2  5  
ATOM 6279  H HG3  . LYS A 1 37  ? 8.930   -9.887  -4.541  1.00 0.00 ? 37  LYS A HG3  5  
ATOM 6280  H HD2  . LYS A 1 37  ? 8.360   -7.340  -5.916  1.00 0.00 ? 37  LYS A HD2  5  
ATOM 6281  H HD3  . LYS A 1 37  ? 10.080  -7.656  -5.806  1.00 0.00 ? 37  LYS A HD3  5  
ATOM 6282  H HE2  . LYS A 1 37  ? 8.765   -10.131 -6.516  1.00 0.00 ? 37  LYS A HE2  5  
ATOM 6283  H HE3  . LYS A 1 37  ? 8.154   -8.874  -7.573  1.00 0.00 ? 37  LYS A HE3  5  
ATOM 6284  H HZ1  . LYS A 1 37  ? 10.714  -10.052 -7.522  1.00 0.00 ? 37  LYS A HZ1  5  
ATOM 6285  H HZ2  . LYS A 1 37  ? 10.031  -9.120  -8.676  1.00 0.00 ? 37  LYS A HZ2  5  
ATOM 6286  H HZ3  . LYS A 1 37  ? 10.829  -8.425  -7.432  1.00 0.00 ? 37  LYS A HZ3  5  
ATOM 6287  N N    . ASP A 1 38  ? 7.448   -11.739 -4.289  1.00 0.00 ? 38  ASP A N    5  
ATOM 6288  C CA   . ASP A 1 38  ? 7.952   -13.047 -3.905  1.00 0.00 ? 38  ASP A CA   5  
ATOM 6289  C C    . ASP A 1 38  ? 8.825   -12.905 -2.657  1.00 0.00 ? 38  ASP A C    5  
ATOM 6290  O O    . ASP A 1 38  ? 9.853   -12.229 -2.687  1.00 0.00 ? 38  ASP A O    5  
ATOM 6291  C CB   . ASP A 1 38  ? 8.810   -13.655 -5.016  1.00 0.00 ? 38  ASP A CB   5  
ATOM 6292  C CG   . ASP A 1 38  ? 10.162  -12.973 -5.236  1.00 0.00 ? 38  ASP A CG   5  
ATOM 6293  O OD1  . ASP A 1 38  ? 10.218  -11.742 -5.024  1.00 0.00 ? 38  ASP A OD1  5  
ATOM 6294  O OD2  . ASP A 1 38  ? 11.109  -13.698 -5.609  1.00 0.00 ? 38  ASP A OD2  5  
ATOM 6295  H H    . ASP A 1 38  ? 7.449   -11.558 -5.273  1.00 0.00 ? 38  ASP A H    5  
ATOM 6296  H HA   . ASP A 1 38  ? 7.065   -13.654 -3.727  1.00 0.00 ? 38  ASP A HA   5  
ATOM 6297  H HB2  . ASP A 1 38  ? 8.983   -14.706 -4.787  1.00 0.00 ? 38  ASP A HB2  5  
ATOM 6298  H HB3  . ASP A 1 38  ? 8.247   -13.620 -5.949  1.00 0.00 ? 38  ASP A HB3  5  
ATOM 6299  N N    . GLY A 1 39  ? 8.385   -13.554 -1.589  1.00 0.00 ? 39  GLY A N    5  
ATOM 6300  C CA   . GLY A 1 39  ? 9.114   -13.510 -0.333  1.00 0.00 ? 39  GLY A CA   5  
ATOM 6301  C C    . GLY A 1 39  ? 9.418   -12.066 0.073   1.00 0.00 ? 39  GLY A C    5  
ATOM 6302  O O    . GLY A 1 39  ? 10.525  -11.762 0.514   1.00 0.00 ? 39  GLY A O    5  
ATOM 6303  H H    . GLY A 1 39  ? 7.548   -14.102 -1.573  1.00 0.00 ? 39  GLY A H    5  
ATOM 6304  H HA2  . GLY A 1 39  ? 8.529   -13.996 0.448   1.00 0.00 ? 39  GLY A HA2  5  
ATOM 6305  H HA3  . GLY A 1 39  ? 10.045  -14.068 -0.429  1.00 0.00 ? 39  GLY A HA3  5  
ATOM 6306  N N    . GLY A 1 40  ? 8.415   -11.216 -0.089  1.00 0.00 ? 40  GLY A N    5  
ATOM 6307  C CA   . GLY A 1 40  ? 8.562   -9.812  0.255   1.00 0.00 ? 40  GLY A CA   5  
ATOM 6308  C C    . GLY A 1 40  ? 8.290   -9.581  1.743   1.00 0.00 ? 40  GLY A C    5  
ATOM 6309  O O    . GLY A 1 40  ? 7.634   -10.395 2.392   1.00 0.00 ? 40  GLY A O    5  
ATOM 6310  H H    . GLY A 1 40  ? 7.518   -11.471 -0.448  1.00 0.00 ? 40  GLY A H    5  
ATOM 6311  H HA2  . GLY A 1 40  ? 9.569   -9.477  0.010   1.00 0.00 ? 40  GLY A HA2  5  
ATOM 6312  H HA3  . GLY A 1 40  ? 7.873   -9.214  -0.341  1.00 0.00 ? 40  GLY A HA3  5  
ATOM 6313  N N    . LYS A 1 41  ? 8.808   -8.468  2.241   1.00 0.00 ? 41  LYS A N    5  
ATOM 6314  C CA   . LYS A 1 41  ? 8.629   -8.120  3.640   1.00 0.00 ? 41  LYS A CA   5  
ATOM 6315  C C    . LYS A 1 41  ? 7.168   -8.344  4.035   1.00 0.00 ? 41  LYS A C    5  
ATOM 6316  O O    . LYS A 1 41  ? 6.866   -9.232  4.831   1.00 0.00 ? 41  LYS A O    5  
ATOM 6317  C CB   . LYS A 1 41  ? 9.127   -6.697  3.906   1.00 0.00 ? 41  LYS A CB   5  
ATOM 6318  C CG   . LYS A 1 41  ? 10.655  -6.654  3.973   1.00 0.00 ? 41  LYS A CG   5  
ATOM 6319  C CD   . LYS A 1 41  ? 11.246  -6.122  2.666   1.00 0.00 ? 41  LYS A CD   5  
ATOM 6320  C CE   . LYS A 1 41  ? 12.371  -7.029  2.164   1.00 0.00 ? 41  LYS A CE   5  
ATOM 6321  N NZ   . LYS A 1 41  ? 12.524  -6.903  0.697   1.00 0.00 ? 41  LYS A NZ   5  
ATOM 6322  H H    . LYS A 1 41  ? 9.340   -7.811  1.707   1.00 0.00 ? 41  LYS A H    5  
ATOM 6323  H HA   . LYS A 1 41  ? 9.253   -8.794  4.227   1.00 0.00 ? 41  LYS A HA   5  
ATOM 6324  H HB2  . LYS A 1 41  ? 8.774   -6.031  3.119   1.00 0.00 ? 41  LYS A HB2  5  
ATOM 6325  H HB3  . LYS A 1 41  ? 8.708   -6.331  4.844   1.00 0.00 ? 41  LYS A HB3  5  
ATOM 6326  H HG2  . LYS A 1 41  ? 10.968  -6.020  4.803   1.00 0.00 ? 41  LYS A HG2  5  
ATOM 6327  H HG3  . LYS A 1 41  ? 11.042  -7.654  4.171   1.00 0.00 ? 41  LYS A HG3  5  
ATOM 6328  H HD2  . LYS A 1 41  ? 10.463  -6.055  1.910   1.00 0.00 ? 41  LYS A HD2  5  
ATOM 6329  H HD3  . LYS A 1 41  ? 11.628  -5.113  2.819   1.00 0.00 ? 41  LYS A HD3  5  
ATOM 6330  H HE2  . LYS A 1 41  ? 13.307  -6.764  2.657   1.00 0.00 ? 41  LYS A HE2  5  
ATOM 6331  H HE3  . LYS A 1 41  ? 12.155  -8.065  2.425   1.00 0.00 ? 41  LYS A HE3  5  
ATOM 6332  H HZ1  . LYS A 1 41  ? 13.026  -7.693  0.345   1.00 0.00 ? 41  LYS A HZ1  5  
ATOM 6333  H HZ2  . LYS A 1 41  ? 11.620  -6.865  0.270   1.00 0.00 ? 41  LYS A HZ2  5  
ATOM 6334  H HZ3  . LYS A 1 41  ? 13.028  -6.066  0.485   1.00 0.00 ? 41  LYS A HZ3  5  
ATOM 6335  N N    . ALA A 1 42  ? 6.301   -7.524  3.460   1.00 0.00 ? 42  ALA A N    5  
ATOM 6336  C CA   . ALA A 1 42  ? 4.879   -7.622  3.742   1.00 0.00 ? 42  ALA A CA   5  
ATOM 6337  C C    . ALA A 1 42  ? 4.478   -9.097  3.815   1.00 0.00 ? 42  ALA A C    5  
ATOM 6338  O O    . ALA A 1 42  ? 3.941   -9.548  4.826   1.00 0.00 ? 42  ALA A O    5  
ATOM 6339  C CB   . ALA A 1 42  ? 4.093   -6.857  2.675   1.00 0.00 ? 42  ALA A CB   5  
ATOM 6340  H H    . ALA A 1 42  ? 6.555   -6.805  2.814   1.00 0.00 ? 42  ALA A H    5  
ATOM 6341  H HA   . ALA A 1 42  ? 4.699   -7.156  4.711   1.00 0.00 ? 42  ALA A HA   5  
ATOM 6342  H HB1  . ALA A 1 42  ? 4.593   -6.960  1.712   1.00 0.00 ? 42  ALA A HB1  5  
ATOM 6343  H HB2  . ALA A 1 42  ? 3.084   -7.263  2.605   1.00 0.00 ? 42  ALA A HB2  5  
ATOM 6344  H HB3  . ALA A 1 42  ? 4.042   -5.803  2.947   1.00 0.00 ? 42  ALA A HB3  5  
ATOM 6345  N N    . SER A 1 43  ? 4.754   -9.807  2.731   1.00 0.00 ? 43  SER A N    5  
ATOM 6346  C CA   . SER A 1 43  ? 4.429   -11.221 2.661   1.00 0.00 ? 43  SER A CA   5  
ATOM 6347  C C    . SER A 1 43  ? 5.003   -11.951 3.877   1.00 0.00 ? 43  SER A C    5  
ATOM 6348  O O    . SER A 1 43  ? 4.314   -12.754 4.505   1.00 0.00 ? 43  SER A O    5  
ATOM 6349  C CB   . SER A 1 43  ? 4.961   -11.844 1.368   1.00 0.00 ? 43  SER A CB   5  
ATOM 6350  O OG   . SER A 1 43  ? 4.904   -13.268 1.399   1.00 0.00 ? 43  SER A OG   5  
ATOM 6351  H H    . SER A 1 43  ? 5.191   -9.432  1.914   1.00 0.00 ? 43  SER A H    5  
ATOM 6352  H HA   . SER A 1 43  ? 3.340   -11.268 2.664   1.00 0.00 ? 43  SER A HA   5  
ATOM 6353  H HB2  . SER A 1 43  ? 4.380   -11.477 0.523   1.00 0.00 ? 43  SER A HB2  5  
ATOM 6354  H HB3  . SER A 1 43  ? 5.991   -11.526 1.209   1.00 0.00 ? 43  SER A HB3  5  
ATOM 6355  H HG   . SER A 1 43  ? 3.957   -13.570 1.510   1.00 0.00 ? 43  SER A HG   5  
ATOM 6356  N N    . GLN A 1 44  ? 6.257   -11.647 4.173   1.00 0.00 ? 44  GLN A N    5  
ATOM 6357  C CA   . GLN A 1 44  ? 6.931   -12.264 5.303   1.00 0.00 ? 44  GLN A CA   5  
ATOM 6358  C C    . GLN A 1 44  ? 6.177   -11.962 6.600   1.00 0.00 ? 44  GLN A C    5  
ATOM 6359  O O    . GLN A 1 44  ? 6.309   -12.690 7.582   1.00 0.00 ? 44  GLN A O    5  
ATOM 6360  C CB   . GLN A 1 44  ? 8.386   -11.800 5.394   1.00 0.00 ? 44  GLN A CB   5  
ATOM 6361  C CG   . GLN A 1 44  ? 9.230   -12.420 4.279   1.00 0.00 ? 44  GLN A CG   5  
ATOM 6362  C CD   . GLN A 1 44  ? 10.654  -11.860 4.294   1.00 0.00 ? 44  GLN A CD   5  
ATOM 6363  O OE1  . GLN A 1 44  ? 10.892  -10.707 4.612   1.00 0.00 ? 44  GLN A OE1  5  
ATOM 6364  N NE2  . GLN A 1 44  ? 11.585  -12.740 3.933   1.00 0.00 ? 44  GLN A NE2  5  
ATOM 6365  H H    . GLN A 1 44  ? 6.811   -10.992 3.657   1.00 0.00 ? 44  GLN A H    5  
ATOM 6366  H HA   . GLN A 1 44  ? 6.910   -13.335 5.103   1.00 0.00 ? 44  GLN A HA   5  
ATOM 6367  H HB2  . GLN A 1 44  ? 8.430   -10.713 5.326   1.00 0.00 ? 44  GLN A HB2  5  
ATOM 6368  H HB3  . GLN A 1 44  ? 8.799   -12.075 6.365   1.00 0.00 ? 44  GLN A HB3  5  
ATOM 6369  H HG2  . GLN A 1 44  ? 9.260   -13.503 4.401   1.00 0.00 ? 44  GLN A HG2  5  
ATOM 6370  H HG3  . GLN A 1 44  ? 8.767   -12.220 3.313   1.00 0.00 ? 44  GLN A HG3  5  
ATOM 6371  H HE21 . GLN A 1 44  ? 11.322  -13.672 3.684   1.00 0.00 ? 44  GLN A HE21 5  
ATOM 6372  H HE22 . GLN A 1 44  ? 12.547  -12.468 3.911   1.00 0.00 ? 44  GLN A HE22 5  
ATOM 6373  N N    . ALA A 1 45  ? 5.402   -10.888 6.560   1.00 0.00 ? 45  ALA A N    5  
ATOM 6374  C CA   . ALA A 1 45  ? 4.627   -10.482 7.720   1.00 0.00 ? 45  ALA A CA   5  
ATOM 6375  C C    . ALA A 1 45  ? 3.226   -11.090 7.630   1.00 0.00 ? 45  ALA A C    5  
ATOM 6376  O O    . ALA A 1 45  ? 2.323   -10.689 8.363   1.00 0.00 ? 45  ALA A O    5  
ATOM 6377  C CB   . ALA A 1 45  ? 4.595   -8.954  7.803   1.00 0.00 ? 45  ALA A CB   5  
ATOM 6378  H H    . ALA A 1 45  ? 5.300   -10.302 5.757   1.00 0.00 ? 45  ALA A H    5  
ATOM 6379  H HA   . ALA A 1 45  ? 5.127   -10.871 8.607   1.00 0.00 ? 45  ALA A HA   5  
ATOM 6380  H HB1  . ALA A 1 45  ? 5.480   -8.545  7.316   1.00 0.00 ? 45  ALA A HB1  5  
ATOM 6381  H HB2  . ALA A 1 45  ? 3.701   -8.582  7.302   1.00 0.00 ? 45  ALA A HB2  5  
ATOM 6382  H HB3  . ALA A 1 45  ? 4.580   -8.647  8.848   1.00 0.00 ? 45  ALA A HB3  5  
ATOM 6383  N N    . HIS A 1 46  ? 3.089   -12.049 6.726   1.00 0.00 ? 46  HIS A N    5  
ATOM 6384  C CA   . HIS A 1 46  ? 1.813   -12.717 6.532   1.00 0.00 ? 46  HIS A CA   5  
ATOM 6385  C C    . HIS A 1 46  ? 0.788   -11.719 5.991   1.00 0.00 ? 46  HIS A C    5  
ATOM 6386  O O    . HIS A 1 46  ? -0.352  -11.683 6.451   1.00 0.00 ? 46  HIS A O    5  
ATOM 6387  C CB   . HIS A 1 46  ? 1.354   -13.398 7.823   1.00 0.00 ? 46  HIS A CB   5  
ATOM 6388  C CG   . HIS A 1 46  ? 2.374   -14.339 8.417   1.00 0.00 ? 46  HIS A CG   5  
ATOM 6389  N ND1  . HIS A 1 46  ? 2.105   -15.673 8.670   1.00 0.00 ? 46  HIS A ND1  5  
ATOM 6390  C CD2  . HIS A 1 46  ? 3.664   -14.126 8.805   1.00 0.00 ? 46  HIS A CD2  5  
ATOM 6391  C CE1  . HIS A 1 46  ? 3.192   -16.228 9.187   1.00 0.00 ? 46  HIS A CE1  5  
ATOM 6392  N NE2  . HIS A 1 46  ? 4.157   -15.267 9.271   1.00 0.00 ? 46  HIS A NE2  5  
ATOM 6393  H H    . HIS A 1 46  ? 3.828   -12.370 6.135   1.00 0.00 ? 46  HIS A H    5  
ATOM 6394  H HA   . HIS A 1 46  ? 1.978   -13.495 5.786   1.00 0.00 ? 46  HIS A HA   5  
ATOM 6395  H HB2  . HIS A 1 46  ? 1.110   -12.632 8.558   1.00 0.00 ? 46  HIS A HB2  5  
ATOM 6396  H HB3  . HIS A 1 46  ? 0.437   -13.952 7.623   1.00 0.00 ? 46  HIS A HB3  5  
ATOM 6397  H HD1  . HIS A 1 46  ? 1.239   -16.139 8.493   1.00 0.00 ? 46  HIS A HD1  5  
ATOM 6398  H HD2  . HIS A 1 46  ? 4.200   -13.179 8.743   1.00 0.00 ? 46  HIS A HD2  5  
ATOM 6399  H HE1  . HIS A 1 46  ? 3.296   -17.269 9.493   1.00 0.00 ? 46  HIS A HE1  5  
ATOM 6400  N N    . VAL A 1 47  ? 1.231   -10.932 5.021   1.00 0.00 ? 47  VAL A N    5  
ATOM 6401  C CA   . VAL A 1 47  ? 0.366   -9.935  4.412   1.00 0.00 ? 47  VAL A CA   5  
ATOM 6402  C C    . VAL A 1 47  ? -0.157  -10.468 3.077   1.00 0.00 ? 47  VAL A C    5  
ATOM 6403  O O    . VAL A 1 47  ? 0.611   -10.648 2.133   1.00 0.00 ? 47  VAL A O    5  
ATOM 6404  C CB   . VAL A 1 47  ? 1.114   -8.608  4.275   1.00 0.00 ? 47  VAL A CB   5  
ATOM 6405  C CG1  . VAL A 1 47  ? 0.250   -7.563  3.566   1.00 0.00 ? 47  VAL A CG1  5  
ATOM 6406  C CG2  . VAL A 1 47  ? 1.581   -8.098  5.640   1.00 0.00 ? 47  VAL A CG2  5  
ATOM 6407  H H    . VAL A 1 47  ? 2.160   -10.968 4.652   1.00 0.00 ? 47  VAL A H    5  
ATOM 6408  H HA   . VAL A 1 47  ? -0.479  -9.779  5.083   1.00 0.00 ? 47  VAL A HA   5  
ATOM 6409  H HB   . VAL A 1 47  ? 1.998   -8.783  3.663   1.00 0.00 ? 47  VAL A HB   5  
ATOM 6410  H HG11 . VAL A 1 47  ? 0.125   -6.695  4.213   1.00 0.00 ? 47  VAL A HG11 5  
ATOM 6411  H HG12 . VAL A 1 47  ? 0.736   -7.258  2.639   1.00 0.00 ? 47  VAL A HG12 5  
ATOM 6412  H HG13 . VAL A 1 47  ? -0.726  -7.991  3.340   1.00 0.00 ? 47  VAL A HG13 5  
ATOM 6413  H HG21 . VAL A 1 47  ? 2.274   -7.268  5.500   1.00 0.00 ? 47  VAL A HG21 5  
ATOM 6414  H HG22 . VAL A 1 47  ? 0.719   -7.759  6.215   1.00 0.00 ? 47  VAL A HG22 5  
ATOM 6415  H HG23 . VAL A 1 47  ? 2.082   -8.903  6.177   1.00 0.00 ? 47  VAL A HG23 5  
ATOM 6416  N N    . ARG A 1 48  ? -1.460  -10.705 3.040   1.00 0.00 ? 48  ARG A N    5  
ATOM 6417  C CA   . ARG A 1 48  ? -2.095  -11.213 1.836   1.00 0.00 ? 48  ARG A CA   5  
ATOM 6418  C C    . ARG A 1 48  ? -2.802  -10.079 1.090   1.00 0.00 ? 48  ARG A C    5  
ATOM 6419  O O    . ARG A 1 48  ? -3.088  -9.033  1.670   1.00 0.00 ? 48  ARG A O    5  
ATOM 6420  C CB   . ARG A 1 48  ? -3.111  -12.307 2.168   1.00 0.00 ? 48  ARG A CB   5  
ATOM 6421  C CG   . ARG A 1 48  ? -2.453  -13.688 2.159   1.00 0.00 ? 48  ARG A CG   5  
ATOM 6422  C CD   . ARG A 1 48  ? -2.827  -14.482 3.412   1.00 0.00 ? 48  ARG A CD   5  
ATOM 6423  N NE   . ARG A 1 48  ? -2.271  -13.822 4.615   1.00 0.00 ? 48  ARG A NE   5  
ATOM 6424  C CZ   . ARG A 1 48  ? -2.648  -14.105 5.869   1.00 0.00 ? 48  ARG A CZ   5  
ATOM 6425  N NH1  . ARG A 1 48  ? -3.583  -15.039 6.093   1.00 0.00 ? 48  ARG A NH1  5  
ATOM 6426  N NH2  . ARG A 1 48  ? -2.089  -13.456 6.899   1.00 0.00 ? 48  ARG A NH2  5  
ATOM 6427  H H    . ARG A 1 48  ? -2.077  -10.555 3.812   1.00 0.00 ? 48  ARG A H    5  
ATOM 6428  H HA   . ARG A 1 48  ? -1.278  -11.623 1.242   1.00 0.00 ? 48  ARG A HA   5  
ATOM 6429  H HB2  . ARG A 1 48  ? -3.549  -12.115 3.148   1.00 0.00 ? 48  ARG A HB2  5  
ATOM 6430  H HB3  . ARG A 1 48  ? -3.926  -12.284 1.445   1.00 0.00 ? 48  ARG A HB3  5  
ATOM 6431  H HG2  . ARG A 1 48  ? -2.763  -14.237 1.270   1.00 0.00 ? 48  ARG A HG2  5  
ATOM 6432  H HG3  . ARG A 1 48  ? -1.369  -13.578 2.104   1.00 0.00 ? 48  ARG A HG3  5  
ATOM 6433  H HD2  . ARG A 1 48  ? -3.911  -14.556 3.496   1.00 0.00 ? 48  ARG A HD2  5  
ATOM 6434  H HD3  . ARG A 1 48  ? -2.443  -15.500 3.336   1.00 0.00 ? 48  ARG A HD3  5  
ATOM 6435  H HE   . ARG A 1 48  ? -1.571  -13.120 4.483   1.00 0.00 ? 48  ARG A HE   5  
ATOM 6436  H HH11 . ARG A 1 48  ? -4.000  -15.523 5.324   1.00 0.00 ? 48  ARG A HH11 5  
ATOM 6437  H HH12 . ARG A 1 48  ? -3.864  -15.250 7.029   1.00 0.00 ? 48  ARG A HH12 5  
ATOM 6438  H HH21 . ARG A 1 48  ? -1.391  -12.759 6.732   1.00 0.00 ? 48  ARG A HH21 5  
ATOM 6439  H HH22 . ARG A 1 48  ? -2.370  -13.667 7.835   1.00 0.00 ? 48  ARG A HH22 5  
ATOM 6440  N N    . ILE A 1 49  ? -3.063  -10.326 -0.185  1.00 0.00 ? 49  ILE A N    5  
ATOM 6441  C CA   . ILE A 1 49  ? -3.731  -9.339  -1.017  1.00 0.00 ? 49  ILE A CA   5  
ATOM 6442  C C    . ILE A 1 49  ? -5.152  -9.117  -0.495  1.00 0.00 ? 49  ILE A C    5  
ATOM 6443  O O    . ILE A 1 49  ? -5.816  -10.062 -0.071  1.00 0.00 ? 49  ILE A O    5  
ATOM 6444  C CB   . ILE A 1 49  ? -3.673  -9.751  -2.489  1.00 0.00 ? 49  ILE A CB   5  
ATOM 6445  C CG1  . ILE A 1 49  ? -2.335  -9.356  -3.117  1.00 0.00 ? 49  ILE A CG1  5  
ATOM 6446  C CG2  . ILE A 1 49  ? -4.862  -9.179  -3.265  1.00 0.00 ? 49  ILE A CG2  5  
ATOM 6447  C CD1  . ILE A 1 49  ? -2.337  -9.622  -4.624  1.00 0.00 ? 49  ILE A CD1  5  
ATOM 6448  H H    . ILE A 1 49  ? -2.827  -11.179 -0.650  1.00 0.00 ? 49  ILE A H    5  
ATOM 6449  H HA   . ILE A 1 49  ? -3.179  -8.404  -0.922  1.00 0.00 ? 49  ILE A HA   5  
ATOM 6450  H HB   . ILE A 1 49  ? -3.747  -10.837 -2.543  1.00 0.00 ? 49  ILE A HB   5  
ATOM 6451  H HG12 . ILE A 1 49  ? -2.140  -8.300  -2.931  1.00 0.00 ? 49  ILE A HG12 5  
ATOM 6452  H HG13 . ILE A 1 49  ? -1.529  -9.918  -2.646  1.00 0.00 ? 49  ILE A HG13 5  
ATOM 6453  H HG21 . ILE A 1 49  ? -5.227  -8.284  -2.763  1.00 0.00 ? 49  ILE A HG21 5  
ATOM 6454  H HG22 . ILE A 1 49  ? -4.546  -8.926  -4.277  1.00 0.00 ? 49  ILE A HG22 5  
ATOM 6455  H HG23 . ILE A 1 49  ? -5.658  -9.922  -3.309  1.00 0.00 ? 49  ILE A HG23 5  
ATOM 6456  H HD11 . ILE A 1 49  ? -1.340  -9.931  -4.939  1.00 0.00 ? 49  ILE A HD11 5  
ATOM 6457  H HD12 . ILE A 1 49  ? -3.051  -10.413 -4.852  1.00 0.00 ? 49  ILE A HD12 5  
ATOM 6458  H HD13 . ILE A 1 49  ? -2.620  -8.713  -5.153  1.00 0.00 ? 49  ILE A HD13 5  
ATOM 6459  N N    . GLY A 1 50  ? -5.578  -7.863  -0.544  1.00 0.00 ? 50  GLY A N    5  
ATOM 6460  C CA   . GLY A 1 50  ? -6.908  -7.506  -0.082  1.00 0.00 ? 50  GLY A CA   5  
ATOM 6461  C C    . GLY A 1 50  ? -6.849  -6.833  1.291   1.00 0.00 ? 50  GLY A C    5  
ATOM 6462  O O    . GLY A 1 50  ? -7.804  -6.179  1.707   1.00 0.00 ? 50  GLY A O    5  
ATOM 6463  H H    . GLY A 1 50  ? -5.032  -7.101  -0.891  1.00 0.00 ? 50  GLY A H    5  
ATOM 6464  H HA2  . GLY A 1 50  ? -7.378  -6.834  -0.800  1.00 0.00 ? 50  GLY A HA2  5  
ATOM 6465  H HA3  . GLY A 1 50  ? -7.530  -8.399  -0.027  1.00 0.00 ? 50  GLY A HA3  5  
ATOM 6466  N N    . ASP A 1 51  ? -5.718  -7.017  1.956   1.00 0.00 ? 51  ASP A N    5  
ATOM 6467  C CA   . ASP A 1 51  ? -5.522  -6.436  3.274   1.00 0.00 ? 51  ASP A CA   5  
ATOM 6468  C C    . ASP A 1 51  ? -5.789  -4.931  3.208   1.00 0.00 ? 51  ASP A C    5  
ATOM 6469  O O    . ASP A 1 51  ? -5.219  -4.232  2.372   1.00 0.00 ? 51  ASP A O    5  
ATOM 6470  C CB   . ASP A 1 51  ? -4.086  -6.641  3.758   1.00 0.00 ? 51  ASP A CB   5  
ATOM 6471  C CG   . ASP A 1 51  ? -3.721  -8.084  4.111   1.00 0.00 ? 51  ASP A CG   5  
ATOM 6472  O OD1  . ASP A 1 51  ? -4.563  -8.966  3.834   1.00 0.00 ? 51  ASP A OD1  5  
ATOM 6473  O OD2  . ASP A 1 51  ? -2.610  -8.273  4.651   1.00 0.00 ? 51  ASP A OD2  5  
ATOM 6474  H H    . ASP A 1 51  ? -4.946  -7.550  1.611   1.00 0.00 ? 51  ASP A H    5  
ATOM 6475  H HA   . ASP A 1 51  ? -6.226  -6.956  3.924   1.00 0.00 ? 51  ASP A HA   5  
ATOM 6476  H HB2  . ASP A 1 51  ? -3.404  -6.289  2.983   1.00 0.00 ? 51  ASP A HB2  5  
ATOM 6477  H HB3  . ASP A 1 51  ? -3.921  -6.015  4.635   1.00 0.00 ? 51  ASP A HB3  5  
ATOM 6478  N N    . VAL A 1 52  ? -6.657  -4.477  4.100   1.00 0.00 ? 52  VAL A N    5  
ATOM 6479  C CA   . VAL A 1 52  ? -7.006  -3.067  4.154   1.00 0.00 ? 52  VAL A CA   5  
ATOM 6480  C C    . VAL A 1 52  ? -6.066  -2.349  5.124   1.00 0.00 ? 52  VAL A C    5  
ATOM 6481  O O    . VAL A 1 52  ? -5.875  -2.796  6.254   1.00 0.00 ? 52  VAL A O    5  
ATOM 6482  C CB   . VAL A 1 52  ? -8.482  -2.908  4.524   1.00 0.00 ? 52  VAL A CB   5  
ATOM 6483  C CG1  . VAL A 1 52  ? -8.840  -1.434  4.727   1.00 0.00 ? 52  VAL A CG1  5  
ATOM 6484  C CG2  . VAL A 1 52  ? -9.384  -3.551  3.469   1.00 0.00 ? 52  VAL A CG2  5  
ATOM 6485  H H    . VAL A 1 52  ? -7.116  -5.052  4.777   1.00 0.00 ? 52  VAL A H    5  
ATOM 6486  H HA   . VAL A 1 52  ? -6.862  -2.654  3.156   1.00 0.00 ? 52  VAL A HA   5  
ATOM 6487  H HB   . VAL A 1 52  ? -8.649  -3.426  5.468   1.00 0.00 ? 52  VAL A HB   5  
ATOM 6488  H HG11 . VAL A 1 52  ? -8.703  -0.894  3.790   1.00 0.00 ? 52  VAL A HG11 5  
ATOM 6489  H HG12 . VAL A 1 52  ? -9.880  -1.353  5.044   1.00 0.00 ? 52  VAL A HG12 5  
ATOM 6490  H HG13 . VAL A 1 52  ? -8.193  -1.005  5.492   1.00 0.00 ? 52  VAL A HG13 5  
ATOM 6491  H HG21 . VAL A 1 52  ? -8.781  -4.165  2.801   1.00 0.00 ? 52  VAL A HG21 5  
ATOM 6492  H HG22 . VAL A 1 52  ? -10.130 -4.176  3.961   1.00 0.00 ? 52  VAL A HG22 5  
ATOM 6493  H HG23 . VAL A 1 52  ? -9.885  -2.772  2.895   1.00 0.00 ? 52  VAL A HG23 5  
ATOM 6494  N N    . VAL A 1 53  ? -5.502  -1.249  4.647   1.00 0.00 ? 53  VAL A N    5  
ATOM 6495  C CA   . VAL A 1 53  ? -4.586  -0.465  5.458   1.00 0.00 ? 53  VAL A CA   5  
ATOM 6496  C C    . VAL A 1 53  ? -5.386  0.511   6.324   1.00 0.00 ? 53  VAL A C    5  
ATOM 6497  O O    . VAL A 1 53  ? -5.835  1.549   5.842   1.00 0.00 ? 53  VAL A O    5  
ATOM 6498  C CB   . VAL A 1 53  ? -3.560  0.232   4.563   1.00 0.00 ? 53  VAL A CB   5  
ATOM 6499  C CG1  . VAL A 1 53  ? -2.542  1.009   5.399   1.00 0.00 ? 53  VAL A CG1  5  
ATOM 6500  C CG2  . VAL A 1 53  ? -2.863  -0.772  3.643   1.00 0.00 ? 53  VAL A CG2  5  
ATOM 6501  H H    . VAL A 1 53  ? -5.663  -0.893  3.727   1.00 0.00 ? 53  VAL A H    5  
ATOM 6502  H HA   . VAL A 1 53  ? -4.051  -1.156  6.110   1.00 0.00 ? 53  VAL A HA   5  
ATOM 6503  H HB   . VAL A 1 53  ? -4.094  0.946   3.936   1.00 0.00 ? 53  VAL A HB   5  
ATOM 6504  H HG11 . VAL A 1 53  ? -3.060  1.757   6.000   1.00 0.00 ? 53  VAL A HG11 5  
ATOM 6505  H HG12 . VAL A 1 53  ? -2.009  0.321   6.055   1.00 0.00 ? 53  VAL A HG12 5  
ATOM 6506  H HG13 . VAL A 1 53  ? -1.831  1.504   4.737   1.00 0.00 ? 53  VAL A HG13 5  
ATOM 6507  H HG21 . VAL A 1 53  ? -2.172  -0.244  2.986   1.00 0.00 ? 53  VAL A HG21 5  
ATOM 6508  H HG22 . VAL A 1 53  ? -2.312  -1.494  4.245   1.00 0.00 ? 53  VAL A HG22 5  
ATOM 6509  H HG23 . VAL A 1 53  ? -3.608  -1.293  3.042   1.00 0.00 ? 53  VAL A HG23 5  
ATOM 6510  N N    . LEU A 1 54  ? -5.539  0.142   7.588   1.00 0.00 ? 54  LEU A N    5  
ATOM 6511  C CA   . LEU A 1 54  ? -6.276  0.972   8.525   1.00 0.00 ? 54  LEU A CA   5  
ATOM 6512  C C    . LEU A 1 54  ? -5.506  2.273   8.763   1.00 0.00 ? 54  LEU A C    5  
ATOM 6513  O O    . LEU A 1 54  ? -6.101  3.346   8.838   1.00 0.00 ? 54  LEU A O    5  
ATOM 6514  C CB   . LEU A 1 54  ? -6.579  0.193   9.806   1.00 0.00 ? 54  LEU A CB   5  
ATOM 6515  C CG   . LEU A 1 54  ? -7.444  -1.058  9.642   1.00 0.00 ? 54  LEU A CG   5  
ATOM 6516  C CD1  . LEU A 1 54  ? -7.334  -1.966  10.868  1.00 0.00 ? 54  LEU A CD1  5  
ATOM 6517  C CD2  . LEU A 1 54  ? -8.896  -0.685  9.334   1.00 0.00 ? 54  LEU A CD2  5  
ATOM 6518  H H    . LEU A 1 54  ? -5.170  -0.704  7.972   1.00 0.00 ? 54  LEU A H    5  
ATOM 6519  H HA   . LEU A 1 54  ? -7.232  1.217   8.062   1.00 0.00 ? 54  LEU A HA   5  
ATOM 6520  H HB2  . LEU A 1 54  ? -5.634  -0.100  10.262  1.00 0.00 ? 54  LEU A HB2  5  
ATOM 6521  H HB3  . LEU A 1 54  ? -7.076  0.865   10.507  1.00 0.00 ? 54  LEU A HB3  5  
ATOM 6522  H HG   . LEU A 1 54  ? -7.069  -1.623  8.789   1.00 0.00 ? 54  LEU A HG   5  
ATOM 6523  H HD11 . LEU A 1 54  ? -6.394  -1.768  11.384  1.00 0.00 ? 54  LEU A HD11 5  
ATOM 6524  H HD12 . LEU A 1 54  ? -8.167  -1.768  11.543  1.00 0.00 ? 54  LEU A HD12 5  
ATOM 6525  H HD13 . LEU A 1 54  ? -7.362  -3.009  10.552  1.00 0.00 ? 54  LEU A HD13 5  
ATOM 6526  H HD21 . LEU A 1 54  ? -9.472  -0.671  10.259  1.00 0.00 ? 54  LEU A HD21 5  
ATOM 6527  H HD22 . LEU A 1 54  ? -8.927  0.302   8.872   1.00 0.00 ? 54  LEU A HD22 5  
ATOM 6528  H HD23 . LEU A 1 54  ? -9.322  -1.419  8.651   1.00 0.00 ? 54  LEU A HD23 5  
ATOM 6529  N N    . SER A 1 55  ? -4.193  2.133   8.876   1.00 0.00 ? 55  SER A N    5  
ATOM 6530  C CA   . SER A 1 55  ? -3.335  3.283   9.105   1.00 0.00 ? 55  SER A CA   5  
ATOM 6531  C C    . SER A 1 55  ? -2.060  3.159   8.269   1.00 0.00 ? 55  SER A C    5  
ATOM 6532  O O    . SER A 1 55  ? -1.758  2.088   7.745   1.00 0.00 ? 55  SER A O    5  
ATOM 6533  C CB   . SER A 1 55  ? -2.986  3.425   10.588  1.00 0.00 ? 55  SER A CB   5  
ATOM 6534  O OG   . SER A 1 55  ? -2.725  2.163   11.197  1.00 0.00 ? 55  SER A OG   5  
ATOM 6535  H H    . SER A 1 55  ? -3.716  1.256   8.814   1.00 0.00 ? 55  SER A H    5  
ATOM 6536  H HA   . SER A 1 55  ? -3.919  4.147   8.786   1.00 0.00 ? 55  SER A HA   5  
ATOM 6537  H HB2  . SER A 1 55  ? -2.112  4.067   10.695  1.00 0.00 ? 55  SER A HB2  5  
ATOM 6538  H HB3  . SER A 1 55  ? -3.809  3.915   11.108  1.00 0.00 ? 55  SER A HB3  5  
ATOM 6539  H HG   . SER A 1 55  ? -3.562  1.801   11.607  1.00 0.00 ? 55  SER A HG   5  
ATOM 6540  N N    . ILE A 1 56  ? -1.344  4.270   8.171   1.00 0.00 ? 56  ILE A N    5  
ATOM 6541  C CA   . ILE A 1 56  ? -0.108  4.299   7.407   1.00 0.00 ? 56  ILE A CA   5  
ATOM 6542  C C    . ILE A 1 56  ? 0.939   5.113   8.171   1.00 0.00 ? 56  ILE A C    5  
ATOM 6543  O O    . ILE A 1 56  ? 0.998   6.334   8.039   1.00 0.00 ? 56  ILE A O    5  
ATOM 6544  C CB   . ILE A 1 56  ? -0.367  4.807   5.988   1.00 0.00 ? 56  ILE A CB   5  
ATOM 6545  C CG1  . ILE A 1 56  ? -0.996  3.715   5.120   1.00 0.00 ? 56  ILE A CG1  5  
ATOM 6546  C CG2  . ILE A 1 56  ? 0.913   5.368   5.365   1.00 0.00 ? 56  ILE A CG2  5  
ATOM 6547  C CD1  . ILE A 1 56  ? -1.370  4.259   3.740   1.00 0.00 ? 56  ILE A CD1  5  
ATOM 6548  H H    . ILE A 1 56  ? -1.596  5.137   8.600   1.00 0.00 ? 56  ILE A H    5  
ATOM 6549  H HA   . ILE A 1 56  ? 0.247   3.272   7.322   1.00 0.00 ? 56  ILE A HA   5  
ATOM 6550  H HB   . ILE A 1 56  ? -1.083  5.627   6.044   1.00 0.00 ? 56  ILE A HB   5  
ATOM 6551  H HG12 . ILE A 1 56  ? -0.297  2.885   5.011   1.00 0.00 ? 56  ILE A HG12 5  
ATOM 6552  H HG13 . ILE A 1 56  ? -1.884  3.321   5.613   1.00 0.00 ? 56  ILE A HG13 5  
ATOM 6553  H HG21 . ILE A 1 56  ? 0.999   5.020   4.335   1.00 0.00 ? 56  ILE A HG21 5  
ATOM 6554  H HG22 . ILE A 1 56  ? 0.877   6.458   5.378   1.00 0.00 ? 56  ILE A HG22 5  
ATOM 6555  H HG23 . ILE A 1 56  ? 1.776   5.026   5.936   1.00 0.00 ? 56  ILE A HG23 5  
ATOM 6556  H HD11 . ILE A 1 56  ? -0.506  4.198   3.079   1.00 0.00 ? 56  ILE A HD11 5  
ATOM 6557  H HD12 . ILE A 1 56  ? -2.187  3.667   3.326   1.00 0.00 ? 56  ILE A HD12 5  
ATOM 6558  H HD13 . ILE A 1 56  ? -1.685  5.298   3.832   1.00 0.00 ? 56  ILE A HD13 5  
ATOM 6559  N N    . ASP A 1 57  ? 1.738   4.403   8.953   1.00 0.00 ? 57  ASP A N    5  
ATOM 6560  C CA   . ASP A 1 57  ? 2.780   5.044   9.738   1.00 0.00 ? 57  ASP A CA   5  
ATOM 6561  C C    . ASP A 1 57  ? 2.144   5.765   10.928  1.00 0.00 ? 57  ASP A C    5  
ATOM 6562  O O    . ASP A 1 57  ? 2.473   6.917   11.209  1.00 0.00 ? 57  ASP A O    5  
ATOM 6563  C CB   . ASP A 1 57  ? 3.536   6.082   8.906   1.00 0.00 ? 57  ASP A CB   5  
ATOM 6564  C CG   . ASP A 1 57  ? 4.995   6.297   9.312   1.00 0.00 ? 57  ASP A CG   5  
ATOM 6565  O OD1  . ASP A 1 57  ? 5.668   5.277   9.576   1.00 0.00 ? 57  ASP A OD1  5  
ATOM 6566  O OD2  . ASP A 1 57  ? 5.406   7.477   9.350   1.00 0.00 ? 57  ASP A OD2  5  
ATOM 6567  H H    . ASP A 1 57  ? 1.683   3.410   9.055   1.00 0.00 ? 57  ASP A H    5  
ATOM 6568  H HA   . ASP A 1 57  ? 3.444   4.237   10.046  1.00 0.00 ? 57  ASP A HA   5  
ATOM 6569  H HB2  . ASP A 1 57  ? 3.507   5.778   7.860   1.00 0.00 ? 57  ASP A HB2  5  
ATOM 6570  H HB3  . ASP A 1 57  ? 3.011   7.034   8.976   1.00 0.00 ? 57  ASP A HB3  5  
ATOM 6571  N N    . GLY A 1 58  ? 1.245   5.058   11.597  1.00 0.00 ? 58  GLY A N    5  
ATOM 6572  C CA   . GLY A 1 58  ? 0.561   5.616   12.751  1.00 0.00 ? 58  GLY A CA   5  
ATOM 6573  C C    . GLY A 1 58  ? -0.411  6.721   12.330  1.00 0.00 ? 58  GLY A C    5  
ATOM 6574  O O    . GLY A 1 58  ? -0.955  7.428   13.177  1.00 0.00 ? 58  GLY A O    5  
ATOM 6575  H H    . GLY A 1 58  ? 0.984   4.121   11.362  1.00 0.00 ? 58  GLY A H    5  
ATOM 6576  H HA2  . GLY A 1 58  ? 0.017   4.828   13.272  1.00 0.00 ? 58  GLY A HA2  5  
ATOM 6577  H HA3  . GLY A 1 58  ? 1.292   6.017   13.453  1.00 0.00 ? 58  GLY A HA3  5  
ATOM 6578  N N    . ILE A 1 59  ? -0.599  6.834   11.024  1.00 0.00 ? 59  ILE A N    5  
ATOM 6579  C CA   . ILE A 1 59  ? -1.495  7.840   10.481  1.00 0.00 ? 59  ILE A CA   5  
ATOM 6580  C C    . ILE A 1 59  ? -2.764  7.161   9.964   1.00 0.00 ? 59  ILE A C    5  
ATOM 6581  O O    . ILE A 1 59  ? -2.704  6.064   9.410   1.00 0.00 ? 59  ILE A O    5  
ATOM 6582  C CB   . ILE A 1 59  ? -0.777  8.685   9.427   1.00 0.00 ? 59  ILE A CB   5  
ATOM 6583  C CG1  . ILE A 1 59  ? 0.360   9.495   10.055  1.00 0.00 ? 59  ILE A CG1  5  
ATOM 6584  C CG2  . ILE A 1 59  ? -1.765  9.576   8.671   1.00 0.00 ? 59  ILE A CG2  5  
ATOM 6585  C CD1  . ILE A 1 59  ? -0.127  10.879  10.488  1.00 0.00 ? 59  ILE A CD1  5  
ATOM 6586  H H    . ILE A 1 59  ? -0.152  6.254   10.342  1.00 0.00 ? 59  ILE A H    5  
ATOM 6587  H HA   . ILE A 1 59  ? -1.769  8.508   11.298  1.00 0.00 ? 59  ILE A HA   5  
ATOM 6588  H HB   . ILE A 1 59  ? -0.327  8.012   8.698   1.00 0.00 ? 59  ILE A HB   5  
ATOM 6589  H HG12 . ILE A 1 59  ? 0.759   8.960   10.917  1.00 0.00 ? 59  ILE A HG12 5  
ATOM 6590  H HG13 . ILE A 1 59  ? 1.175   9.599   9.340   1.00 0.00 ? 59  ILE A HG13 5  
ATOM 6591  H HG21 . ILE A 1 59  ? -2.363  10.143  9.385   1.00 0.00 ? 59  ILE A HG21 5  
ATOM 6592  H HG22 . ILE A 1 59  ? -1.216  10.264  8.029   1.00 0.00 ? 59  ILE A HG22 5  
ATOM 6593  H HG23 . ILE A 1 59  ? -2.420  8.954   8.061   1.00 0.00 ? 59  ILE A HG23 5  
ATOM 6594  H HD11 . ILE A 1 59  ? 0.628   11.350  11.117  1.00 0.00 ? 59  ILE A HD11 5  
ATOM 6595  H HD12 . ILE A 1 59  ? -0.300  11.496  9.606   1.00 0.00 ? 59  ILE A HD12 5  
ATOM 6596  H HD13 . ILE A 1 59  ? -1.057  10.779  11.048  1.00 0.00 ? 59  ILE A HD13 5  
ATOM 6597  N N    . SER A 1 60  ? -3.884  7.840   10.162  1.00 0.00 ? 60  SER A N    5  
ATOM 6598  C CA   . SER A 1 60  ? -5.166  7.316   9.723   1.00 0.00 ? 60  SER A CA   5  
ATOM 6599  C C    . SER A 1 60  ? -5.253  7.360   8.196   1.00 0.00 ? 60  SER A C    5  
ATOM 6600  O O    . SER A 1 60  ? -5.100  8.421   7.592   1.00 0.00 ? 60  SER A O    5  
ATOM 6601  C CB   . SER A 1 60  ? -6.324  8.100   10.343  1.00 0.00 ? 60  SER A CB   5  
ATOM 6602  O OG   . SER A 1 60  ? -7.100  7.296   11.227  1.00 0.00 ? 60  SER A OG   5  
ATOM 6603  H H    . SER A 1 60  ? -3.925  8.732   10.614  1.00 0.00 ? 60  SER A H    5  
ATOM 6604  H HA   . SER A 1 60  ? -5.194  6.286   10.078  1.00 0.00 ? 60  SER A HA   5  
ATOM 6605  H HB2  . SER A 1 60  ? -5.930  8.959   10.887  1.00 0.00 ? 60  SER A HB2  5  
ATOM 6606  H HB3  . SER A 1 60  ? -6.964  8.490   9.551   1.00 0.00 ? 60  SER A HB3  5  
ATOM 6607  H HG   . SER A 1 60  ? -6.517  6.917   11.946  1.00 0.00 ? 60  SER A HG   5  
ATOM 6608  N N    . ALA A 1 61  ? -5.500  6.195   7.615   1.00 0.00 ? 61  ALA A N    5  
ATOM 6609  C CA   . ALA A 1 61  ? -5.609  6.087   6.171   1.00 0.00 ? 61  ALA A CA   5  
ATOM 6610  C C    . ALA A 1 61  ? -7.083  6.163   5.768   1.00 0.00 ? 61  ALA A C    5  
ATOM 6611  O O    . ALA A 1 61  ? -7.476  5.630   4.731   1.00 0.00 ? 61  ALA A O    5  
ATOM 6612  C CB   . ALA A 1 61  ? -4.943  4.791   5.703   1.00 0.00 ? 61  ALA A CB   5  
ATOM 6613  H H    . ALA A 1 61  ? -5.623  5.337   8.114   1.00 0.00 ? 61  ALA A H    5  
ATOM 6614  H HA   . ALA A 1 61  ? -5.078  6.932   5.733   1.00 0.00 ? 61  ALA A HA   5  
ATOM 6615  H HB1  . ALA A 1 61  ? -4.161  4.510   6.408   1.00 0.00 ? 61  ALA A HB1  5  
ATOM 6616  H HB2  . ALA A 1 61  ? -5.689  3.997   5.652   1.00 0.00 ? 61  ALA A HB2  5  
ATOM 6617  H HB3  . ALA A 1 61  ? -4.505  4.943   4.717   1.00 0.00 ? 61  ALA A HB3  5  
ATOM 6618  N N    . GLN A 1 62  ? -7.860  6.828   6.610   1.00 0.00 ? 62  GLN A N    5  
ATOM 6619  C CA   . GLN A 1 62  ? -9.283  6.980   6.355   1.00 0.00 ? 62  GLN A CA   5  
ATOM 6620  C C    . GLN A 1 62  ? -9.546  8.265   5.567   1.00 0.00 ? 62  GLN A C    5  
ATOM 6621  O O    . GLN A 1 62  ? -9.886  9.295   6.148   1.00 0.00 ? 62  GLN A O    5  
ATOM 6622  C CB   . GLN A 1 62  ? -10.078 6.966   7.662   1.00 0.00 ? 62  GLN A CB   5  
ATOM 6623  C CG   . GLN A 1 62  ? -10.682 5.584   7.921   1.00 0.00 ? 62  GLN A CG   5  
ATOM 6624  C CD   . GLN A 1 62  ? -11.834 5.299   6.954   1.00 0.00 ? 62  GLN A CD   5  
ATOM 6625  O OE1  . GLN A 1 62  ? -12.767 6.072   6.815   1.00 0.00 ? 62  GLN A OE1  5  
ATOM 6626  N NE2  . GLN A 1 62  ? -11.716 4.149   6.297   1.00 0.00 ? 62  GLN A NE2  5  
ATOM 6627  H H    . GLN A 1 62  ? -7.533  7.258   7.452   1.00 0.00 ? 62  GLN A H    5  
ATOM 6628  H HA   . GLN A 1 62  ? -9.564  6.114   5.756   1.00 0.00 ? 62  GLN A HA   5  
ATOM 6629  H HB2  . GLN A 1 62  ? -9.428  7.243   8.491   1.00 0.00 ? 62  GLN A HB2  5  
ATOM 6630  H HB3  . GLN A 1 62  ? -10.873 7.711   7.617   1.00 0.00 ? 62  GLN A HB3  5  
ATOM 6631  H HG2  . GLN A 1 62  ? -9.912  4.820   7.810   1.00 0.00 ? 62  GLN A HG2  5  
ATOM 6632  H HG3  . GLN A 1 62  ? -11.042 5.527   8.948   1.00 0.00 ? 62  GLN A HG3  5  
ATOM 6633  H HE21 . GLN A 1 62  ? -10.924 3.559   6.458   1.00 0.00 ? 62  GLN A HE21 5  
ATOM 6634  H HE22 . GLN A 1 62  ? -12.420 3.873   5.642   1.00 0.00 ? 62  GLN A HE22 5  
ATOM 6635  N N    . GLY A 1 63  ? -9.379  8.162   4.257   1.00 0.00 ? 63  GLY A N    5  
ATOM 6636  C CA   . GLY A 1 63  ? -9.594  9.303   3.383   1.00 0.00 ? 63  GLY A CA   5  
ATOM 6637  C C    . GLY A 1 63  ? -8.382  9.539   2.480   1.00 0.00 ? 63  GLY A C    5  
ATOM 6638  O O    . GLY A 1 63  ? -8.529  9.718   1.272   1.00 0.00 ? 63  GLY A O    5  
ATOM 6639  H H    . GLY A 1 63  ? -9.102  7.321   3.793   1.00 0.00 ? 63  GLY A H    5  
ATOM 6640  H HA2  . GLY A 1 63  ? -10.481 9.135   2.772   1.00 0.00 ? 63  GLY A HA2  5  
ATOM 6641  H HA3  . GLY A 1 63  ? -9.785  10.194  3.982   1.00 0.00 ? 63  GLY A HA3  5  
ATOM 6642  N N    . MET A 1 64  ? -7.212  9.532   3.101   1.00 0.00 ? 64  MET A N    5  
ATOM 6643  C CA   . MET A 1 64  ? -5.975  9.743   2.369   1.00 0.00 ? 64  MET A CA   5  
ATOM 6644  C C    . MET A 1 64  ? -6.015  9.041   1.010   1.00 0.00 ? 64  MET A C    5  
ATOM 6645  O O    . MET A 1 64  ? -6.248  7.836   0.937   1.00 0.00 ? 64  MET A O    5  
ATOM 6646  C CB   . MET A 1 64  ? -4.799  9.205   3.186   1.00 0.00 ? 64  MET A CB   5  
ATOM 6647  C CG   . MET A 1 64  ? -4.396  10.193  4.283   1.00 0.00 ? 64  MET A CG   5  
ATOM 6648  S SD   . MET A 1 64  ? -2.636  10.106  4.568   1.00 0.00 ? 64  MET A SD   5  
ATOM 6649  C CE   . MET A 1 64  ? -2.503  8.432   5.175   1.00 0.00 ? 64  MET A CE   5  
ATOM 6650  H H    . MET A 1 64  ? -7.101  9.386   4.084   1.00 0.00 ? 64  MET A H    5  
ATOM 6651  H HA   . MET A 1 64  ? -5.899  10.821  2.226   1.00 0.00 ? 64  MET A HA   5  
ATOM 6652  H HB2  . MET A 1 64  ? -5.070  8.249   3.635   1.00 0.00 ? 64  MET A HB2  5  
ATOM 6653  H HB3  . MET A 1 64  ? -3.949  9.020   2.530   1.00 0.00 ? 64  MET A HB3  5  
ATOM 6654  H HG2  . MET A 1 64  ? -4.676  11.206  3.993   1.00 0.00 ? 64  MET A HG2  5  
ATOM 6655  H HG3  . MET A 1 64  ? -4.933  9.966   5.204   1.00 0.00 ? 64  MET A HG3  5  
ATOM 6656  H HE1  . MET A 1 64  ? -3.440  8.143   5.651   1.00 0.00 ? 64  MET A HE1  5  
ATOM 6657  H HE2  . MET A 1 64  ? -2.296  7.759   4.343   1.00 0.00 ? 64  MET A HE2  5  
ATOM 6658  H HE3  . MET A 1 64  ? -1.692  8.372   5.901   1.00 0.00 ? 64  MET A HE3  5  
ATOM 6659  N N    . THR A 1 65  ? -5.785  9.826   -0.033  1.00 0.00 ? 65  THR A N    5  
ATOM 6660  C CA   . THR A 1 65  ? -5.793  9.294   -1.385  1.00 0.00 ? 65  THR A CA   5  
ATOM 6661  C C    . THR A 1 65  ? -4.570  8.405   -1.615  1.00 0.00 ? 65  THR A C    5  
ATOM 6662  O O    . THR A 1 65  ? -3.617  8.440   -0.838  1.00 0.00 ? 65  THR A O    5  
ATOM 6663  C CB   . THR A 1 65  ? -5.878  10.474  -2.356  1.00 0.00 ? 65  THR A CB   5  
ATOM 6664  O OG1  . THR A 1 65  ? -5.045  11.469  -1.768  1.00 0.00 ? 65  THR A OG1  5  
ATOM 6665  C CG2  . THR A 1 65  ? -7.267  11.116  -2.377  1.00 0.00 ? 65  THR A CG2  5  
ATOM 6666  H H    . THR A 1 65  ? -5.597  10.805  0.035   1.00 0.00 ? 65  THR A H    5  
ATOM 6667  H HA   . THR A 1 65  ? -6.674  8.663   -1.501  1.00 0.00 ? 65  THR A HA   5  
ATOM 6668  H HB   . THR A 1 65  ? -5.572  10.175  -3.359  1.00 0.00 ? 65  THR A HB   5  
ATOM 6669  H HG1  . THR A 1 65  ? -4.165  11.069  -1.510  1.00 0.00 ? 65  THR A HG1  5  
ATOM 6670  H HG21 . THR A 1 65  ? -7.181  12.174  -2.132  1.00 0.00 ? 65  THR A HG21 5  
ATOM 6671  H HG22 . THR A 1 65  ? -7.703  11.006  -3.370  1.00 0.00 ? 65  THR A HG22 5  
ATOM 6672  H HG23 . THR A 1 65  ? -7.906  10.624  -1.643  1.00 0.00 ? 65  THR A HG23 5  
ATOM 6673  N N    . HIS A 1 66  ? -4.635  7.629   -2.688  1.00 0.00 ? 66  HIS A N    5  
ATOM 6674  C CA   . HIS A 1 66  ? -3.545  6.732   -3.030  1.00 0.00 ? 66  HIS A CA   5  
ATOM 6675  C C    . HIS A 1 66  ? -2.218  7.491   -2.971  1.00 0.00 ? 66  HIS A C    5  
ATOM 6676  O O    . HIS A 1 66  ? -1.310  7.107   -2.236  1.00 0.00 ? 66  HIS A O    5  
ATOM 6677  C CB   . HIS A 1 66  ? -3.791  6.072   -4.388  1.00 0.00 ? 66  HIS A CB   5  
ATOM 6678  C CG   . HIS A 1 66  ? -3.084  4.749   -4.565  1.00 0.00 ? 66  HIS A CG   5  
ATOM 6679  N ND1  . HIS A 1 66  ? -2.567  4.331   -5.779  1.00 0.00 ? 66  HIS A ND1  5  
ATOM 6680  C CD2  . HIS A 1 66  ? -2.813  3.756   -3.669  1.00 0.00 ? 66  HIS A CD2  5  
ATOM 6681  C CE1  . HIS A 1 66  ? -2.014  3.139   -5.610  1.00 0.00 ? 66  HIS A CE1  5  
ATOM 6682  N NE2  . HIS A 1 66  ? -2.168  2.785   -4.302  1.00 0.00 ? 66  HIS A NE2  5  
ATOM 6683  H H    . HIS A 1 66  ? -5.414  7.607   -3.315  1.00 0.00 ? 66  HIS A H    5  
ATOM 6684  H HA   . HIS A 1 66  ? -3.537  5.946   -2.275  1.00 0.00 ? 66  HIS A HA   5  
ATOM 6685  H HB2  . HIS A 1 66  ? -4.862  5.920   -4.518  1.00 0.00 ? 66  HIS A HB2  5  
ATOM 6686  H HB3  . HIS A 1 66  ? -3.467  6.753   -5.176  1.00 0.00 ? 66  HIS A HB3  5  
ATOM 6687  H HD1  . HIS A 1 66  ? -2.606  4.842   -6.638  1.00 0.00 ? 66  HIS A HD1  5  
ATOM 6688  H HD2  . HIS A 1 66  ? -3.082  3.761   -2.613  1.00 0.00 ? 66  HIS A HD2  5  
ATOM 6689  H HE1  . HIS A 1 66  ? -1.522  2.547   -6.381  1.00 0.00 ? 66  HIS A HE1  5  
ATOM 6690  N N    . LEU A 1 67  ? -2.147  8.556   -3.757  1.00 0.00 ? 67  LEU A N    5  
ATOM 6691  C CA   . LEU A 1 67  ? -0.946  9.373   -3.804  1.00 0.00 ? 67  LEU A CA   5  
ATOM 6692  C C    . LEU A 1 67  ? -0.506  9.707   -2.377  1.00 0.00 ? 67  LEU A C    5  
ATOM 6693  O O    . LEU A 1 67  ? 0.620   9.408   -1.985  1.00 0.00 ? 67  LEU A O    5  
ATOM 6694  C CB   . LEU A 1 67  ? -1.171  10.605  -4.683  1.00 0.00 ? 67  LEU A CB   5  
ATOM 6695  C CG   . LEU A 1 67  ? -0.177  11.753  -4.494  1.00 0.00 ? 67  LEU A CG   5  
ATOM 6696  C CD1  . LEU A 1 67  ? 1.260   11.277  -4.715  1.00 0.00 ? 67  LEU A CD1  5  
ATOM 6697  C CD2  . LEU A 1 67  ? -0.533  12.939  -5.393  1.00 0.00 ? 67  LEU A CD2  5  
ATOM 6698  H H    . LEU A 1 67  ? -2.890  8.862   -4.352  1.00 0.00 ? 67  LEU A H    5  
ATOM 6699  H HA   . LEU A 1 67  ? -0.165  8.778   -4.276  1.00 0.00 ? 67  LEU A HA   5  
ATOM 6700  H HB2  . LEU A 1 67  ? -1.140  10.293  -5.727  1.00 0.00 ? 67  LEU A HB2  5  
ATOM 6701  H HB3  . LEU A 1 67  ? -2.175  10.984  -4.493  1.00 0.00 ? 67  LEU A HB3  5  
ATOM 6702  H HG   . LEU A 1 67  ? -0.247  12.099  -3.462  1.00 0.00 ? 67  LEU A HG   5  
ATOM 6703  H HD11 . LEU A 1 67  ? 1.312   10.199  -4.565  1.00 0.00 ? 67  LEU A HD11 5  
ATOM 6704  H HD12 . LEU A 1 67  ? 1.570   11.519  -5.731  1.00 0.00 ? 67  LEU A HD12 5  
ATOM 6705  H HD13 . LEU A 1 67  ? 1.921   11.775  -4.005  1.00 0.00 ? 67  LEU A HD13 5  
ATOM 6706  H HD21 . LEU A 1 67  ? -0.733  12.582  -6.403  1.00 0.00 ? 67  LEU A HD21 5  
ATOM 6707  H HD22 . LEU A 1 67  ? -1.420  13.439  -5.002  1.00 0.00 ? 67  LEU A HD22 5  
ATOM 6708  H HD23 . LEU A 1 67  ? 0.300   13.642  -5.414  1.00 0.00 ? 67  LEU A HD23 5  
ATOM 6709  N N    . GLU A 1 68  ? -1.418  10.324  -1.640  1.00 0.00 ? 68  GLU A N    5  
ATOM 6710  C CA   . GLU A 1 68  ? -1.138  10.702  -0.265  1.00 0.00 ? 68  GLU A CA   5  
ATOM 6711  C C    . GLU A 1 68  ? -0.606  9.500   0.518   1.00 0.00 ? 68  GLU A C    5  
ATOM 6712  O O    . GLU A 1 68  ? 0.507   9.538   1.039   1.00 0.00 ? 68  GLU A O    5  
ATOM 6713  C CB   . GLU A 1 68  ? -2.382  11.287  0.407   1.00 0.00 ? 68  GLU A CB   5  
ATOM 6714  C CG   . GLU A 1 68  ? -2.714  12.669  -0.161  1.00 0.00 ? 68  GLU A CG   5  
ATOM 6715  C CD   . GLU A 1 68  ? -2.380  13.771  0.846   1.00 0.00 ? 68  GLU A CD   5  
ATOM 6716  O OE1  . GLU A 1 68  ? -3.046  13.794  1.903   1.00 0.00 ? 68  GLU A OE1  5  
ATOM 6717  O OE2  . GLU A 1 68  ? -1.466  14.565  0.536   1.00 0.00 ? 68  GLU A OE2  5  
ATOM 6718  H H    . GLU A 1 68  ? -2.332  10.564  -1.966  1.00 0.00 ? 68  GLU A H    5  
ATOM 6719  H HA   . GLU A 1 68  ? -0.370  11.473  -0.327  1.00 0.00 ? 68  GLU A HA   5  
ATOM 6720  H HB2  . GLU A 1 68  ? -3.229  10.617  0.260   1.00 0.00 ? 68  GLU A HB2  5  
ATOM 6721  H HB3  . GLU A 1 68  ? -2.218  11.362  1.482   1.00 0.00 ? 68  GLU A HB3  5  
ATOM 6722  H HG2  . GLU A 1 68  ? -2.153  12.831  -1.082  1.00 0.00 ? 68  GLU A HG2  5  
ATOM 6723  H HG3  . GLU A 1 68  ? -3.772  12.715  -0.420  1.00 0.00 ? 68  GLU A HG3  5  
ATOM 6724  N N    . ALA A 1 69  ? -1.427  8.462   0.577   1.00 0.00 ? 69  ALA A N    5  
ATOM 6725  C CA   . ALA A 1 69  ? -1.053  7.251   1.288   1.00 0.00 ? 69  ALA A CA   5  
ATOM 6726  C C    . ALA A 1 69  ? 0.351   6.825   0.856   1.00 0.00 ? 69  ALA A C    5  
ATOM 6727  O O    . ALA A 1 69  ? 1.190   6.498   1.695   1.00 0.00 ? 69  ALA A O    5  
ATOM 6728  C CB   . ALA A 1 69  ? -2.098  6.164   1.030   1.00 0.00 ? 69  ALA A CB   5  
ATOM 6729  H H    . ALA A 1 69  ? -2.331  8.439   0.151   1.00 0.00 ? 69  ALA A H    5  
ATOM 6730  H HA   . ALA A 1 69  ? -1.043  7.482   2.353   1.00 0.00 ? 69  ALA A HA   5  
ATOM 6731  H HB1  . ALA A 1 69  ? -2.500  5.813   1.980   1.00 0.00 ? 69  ALA A HB1  5  
ATOM 6732  H HB2  . ALA A 1 69  ? -2.906  6.573   0.423   1.00 0.00 ? 69  ALA A HB2  5  
ATOM 6733  H HB3  . ALA A 1 69  ? -1.633  5.331   0.502   1.00 0.00 ? 69  ALA A HB3  5  
ATOM 6734  N N    . GLN A 1 70  ? 0.565   6.842   -0.451  1.00 0.00 ? 70  GLN A N    5  
ATOM 6735  C CA   . GLN A 1 70  ? 1.853   6.461   -1.004  1.00 0.00 ? 70  GLN A CA   5  
ATOM 6736  C C    . GLN A 1 70  ? 2.943   7.421   -0.521  1.00 0.00 ? 70  GLN A C    5  
ATOM 6737  O O    . GLN A 1 70  ? 4.083   7.013   -0.305  1.00 0.00 ? 70  GLN A O    5  
ATOM 6738  C CB   . GLN A 1 70  ? 1.802   6.415   -2.533  1.00 0.00 ? 70  GLN A CB   5  
ATOM 6739  C CG   . GLN A 1 70  ? 0.884   5.290   -3.016  1.00 0.00 ? 70  GLN A CG   5  
ATOM 6740  C CD   . GLN A 1 70  ? 1.685   4.023   -3.323  1.00 0.00 ? 70  GLN A CD   5  
ATOM 6741  O OE1  . GLN A 1 70  ? 2.431   3.516   -2.501  1.00 0.00 ? 70  GLN A OE1  5  
ATOM 6742  N NE2  . GLN A 1 70  ? 1.489   3.542   -4.547  1.00 0.00 ? 70  GLN A NE2  5  
ATOM 6743  H H    . GLN A 1 70  ? -0.123  7.110   -1.127  1.00 0.00 ? 70  GLN A H    5  
ATOM 6744  H HA   . GLN A 1 70  ? 2.047   5.459   -0.623  1.00 0.00 ? 70  GLN A HA   5  
ATOM 6745  H HB2  . GLN A 1 70  ? 1.445   7.371   -2.917  1.00 0.00 ? 70  GLN A HB2  5  
ATOM 6746  H HB3  . GLN A 1 70  ? 2.806   6.266   -2.930  1.00 0.00 ? 70  GLN A HB3  5  
ATOM 6747  H HG2  . GLN A 1 70  ? 0.134   5.076   -2.256  1.00 0.00 ? 70  GLN A HG2  5  
ATOM 6748  H HG3  . GLN A 1 70  ? 0.349   5.612   -3.910  1.00 0.00 ? 70  GLN A HG3  5  
ATOM 6749  H HE21 . GLN A 1 70  ? 0.862   4.007   -5.172  1.00 0.00 ? 70  GLN A HE21 5  
ATOM 6750  H HE22 . GLN A 1 70  ? 1.968   2.715   -4.842  1.00 0.00 ? 70  GLN A HE22 5  
ATOM 6751  N N    . ASN A 1 71  ? 2.553   8.678   -0.367  1.00 0.00 ? 71  ASN A N    5  
ATOM 6752  C CA   . ASN A 1 71  ? 3.483   9.699   0.087   1.00 0.00 ? 71  ASN A CA   5  
ATOM 6753  C C    . ASN A 1 71  ? 4.007   9.325   1.475   1.00 0.00 ? 71  ASN A C    5  
ATOM 6754  O O    . ASN A 1 71  ? 5.215   9.314   1.703   1.00 0.00 ? 71  ASN A O    5  
ATOM 6755  C CB   . ASN A 1 71  ? 2.796   11.062  0.192   1.00 0.00 ? 71  ASN A CB   5  
ATOM 6756  C CG   . ASN A 1 71  ? 3.478   12.091  -0.711  1.00 0.00 ? 71  ASN A CG   5  
ATOM 6757  O OD1  . ASN A 1 71  ? 4.645   12.412  -0.558  1.00 0.00 ? 71  ASN A OD1  5  
ATOM 6758  N ND2  . ASN A 1 71  ? 2.688   12.589  -1.657  1.00 0.00 ? 71  ASN A ND2  5  
ATOM 6759  H H    . ASN A 1 71  ? 1.624   9.002   -0.545  1.00 0.00 ? 71  ASN A H    5  
ATOM 6760  H HA   . ASN A 1 71  ? 4.272   9.722   -0.665  1.00 0.00 ? 71  ASN A HA   5  
ATOM 6761  H HB2  . ASN A 1 71  ? 1.746   10.966  -0.087  1.00 0.00 ? 71  ASN A HB2  5  
ATOM 6762  H HB3  . ASN A 1 71  ? 2.820   11.406  1.226   1.00 0.00 ? 71  ASN A HB3  5  
ATOM 6763  H HD21 . ASN A 1 71  ? 1.739   12.282  -1.729  1.00 0.00 ? 71  ASN A HD21 5  
ATOM 6764  H HD22 . ASN A 1 71  ? 3.043   13.269  -2.298  1.00 0.00 ? 71  ASN A HD22 5  
ATOM 6765  N N    . LYS A 1 72  ? 3.072   9.028   2.365   1.00 0.00 ? 72  LYS A N    5  
ATOM 6766  C CA   . LYS A 1 72  ? 3.424   8.655   3.724   1.00 0.00 ? 72  LYS A CA   5  
ATOM 6767  C C    . LYS A 1 72  ? 4.476   7.544   3.687   1.00 0.00 ? 72  LYS A C    5  
ATOM 6768  O O    . LYS A 1 72  ? 5.493   7.624   4.374   1.00 0.00 ? 72  LYS A O    5  
ATOM 6769  C CB   . LYS A 1 72  ? 2.171   8.289   4.522   1.00 0.00 ? 72  LYS A CB   5  
ATOM 6770  C CG   . LYS A 1 72  ? 1.432   9.545   4.989   1.00 0.00 ? 72  LYS A CG   5  
ATOM 6771  C CD   . LYS A 1 72  ? 2.066   10.112  6.261   1.00 0.00 ? 72  LYS A CD   5  
ATOM 6772  C CE   . LYS A 1 72  ? 1.186   11.205  6.871   1.00 0.00 ? 72  LYS A CE   5  
ATOM 6773  N NZ   . LYS A 1 72  ? 1.942   12.472  6.990   1.00 0.00 ? 72  LYS A NZ   5  
ATOM 6774  H H    . LYS A 1 72  ? 2.091   9.040   2.171   1.00 0.00 ? 72  LYS A H    5  
ATOM 6775  H HA   . LYS A 1 72  ? 3.864   9.531   4.200   1.00 0.00 ? 72  LYS A HA   5  
ATOM 6776  H HB2  . LYS A 1 72  ? 1.508   7.681   3.906   1.00 0.00 ? 72  LYS A HB2  5  
ATOM 6777  H HB3  . LYS A 1 72  ? 2.448   7.683   5.385   1.00 0.00 ? 72  LYS A HB3  5  
ATOM 6778  H HG2  . LYS A 1 72  ? 1.453   10.298  4.201   1.00 0.00 ? 72  LYS A HG2  5  
ATOM 6779  H HG3  . LYS A 1 72  ? 0.385   9.307   5.175   1.00 0.00 ? 72  LYS A HG3  5  
ATOM 6780  H HD2  . LYS A 1 72  ? 2.214   9.312   6.986   1.00 0.00 ? 72  LYS A HD2  5  
ATOM 6781  H HD3  . LYS A 1 72  ? 3.051   10.519  6.031   1.00 0.00 ? 72  LYS A HD3  5  
ATOM 6782  H HE2  . LYS A 1 72  ? 0.303   11.358  6.251   1.00 0.00 ? 72  LYS A HE2  5  
ATOM 6783  H HE3  . LYS A 1 72  ? 0.835   10.891  7.854   1.00 0.00 ? 72  LYS A HE3  5  
ATOM 6784  H HZ1  . LYS A 1 72  ? 1.467   13.085  7.622   1.00 0.00 ? 72  LYS A HZ1  5  
ATOM 6785  H HZ2  . LYS A 1 72  ? 2.860   12.282  7.337   1.00 0.00 ? 72  LYS A HZ2  5  
ATOM 6786  H HZ3  . LYS A 1 72  ? 2.008   12.906  6.091   1.00 0.00 ? 72  LYS A HZ3  5  
ATOM 6787  N N    . ILE A 1 73  ? 4.194   6.533   2.878   1.00 0.00 ? 73  ILE A N    5  
ATOM 6788  C CA   . ILE A 1 73  ? 5.102   5.407   2.743   1.00 0.00 ? 73  ILE A CA   5  
ATOM 6789  C C    . ILE A 1 73  ? 6.526   5.928   2.539   1.00 0.00 ? 73  ILE A C    5  
ATOM 6790  O O    . ILE A 1 73  ? 7.473   5.402   3.122   1.00 0.00 ? 73  ILE A O    5  
ATOM 6791  C CB   . ILE A 1 73  ? 4.627   4.466   1.634   1.00 0.00 ? 73  ILE A CB   5  
ATOM 6792  C CG1  . ILE A 1 73  ? 3.469   3.591   2.116   1.00 0.00 ? 73  ILE A CG1  5  
ATOM 6793  C CG2  . ILE A 1 73  ? 5.788   3.632   1.089   1.00 0.00 ? 73  ILE A CG2  5  
ATOM 6794  C CD1  . ILE A 1 73  ? 2.427   3.402   1.012   1.00 0.00 ? 73  ILE A CD1  5  
ATOM 6795  H H    . ILE A 1 73  ? 3.364   6.476   2.323   1.00 0.00 ? 73  ILE A H    5  
ATOM 6796  H HA   . ILE A 1 73  ? 5.070   4.847   3.677   1.00 0.00 ? 73  ILE A HA   5  
ATOM 6797  H HB   . ILE A 1 73  ? 4.251   5.072   0.809   1.00 0.00 ? 73  ILE A HB   5  
ATOM 6798  H HG12 . ILE A 1 73  ? 3.850   2.619   2.432   1.00 0.00 ? 73  ILE A HG12 5  
ATOM 6799  H HG13 . ILE A 1 73  ? 3.001   4.048   2.988   1.00 0.00 ? 73  ILE A HG13 5  
ATOM 6800  H HG21 . ILE A 1 73  ? 6.592   3.602   1.825   1.00 0.00 ? 73  ILE A HG21 5  
ATOM 6801  H HG22 . ILE A 1 73  ? 5.443   2.618   0.887   1.00 0.00 ? 73  ILE A HG22 5  
ATOM 6802  H HG23 . ILE A 1 73  ? 6.156   4.081   0.166   1.00 0.00 ? 73  ILE A HG23 5  
ATOM 6803  H HD11 . ILE A 1 73  ? 2.856   3.698   0.054   1.00 0.00 ? 73  ILE A HD11 5  
ATOM 6804  H HD12 . ILE A 1 73  ? 2.129   2.355   0.969   1.00 0.00 ? 73  ILE A HD12 5  
ATOM 6805  H HD13 . ILE A 1 73  ? 1.555   4.020   1.226   1.00 0.00 ? 73  ILE A HD13 5  
ATOM 6806  N N    . LYS A 1 74  ? 6.633   6.957   1.710   1.00 0.00 ? 74  LYS A N    5  
ATOM 6807  C CA   . LYS A 1 74  ? 7.926   7.555   1.422   1.00 0.00 ? 74  LYS A CA   5  
ATOM 6808  C C    . LYS A 1 74  ? 8.484   8.190   2.697   1.00 0.00 ? 74  LYS A C    5  
ATOM 6809  O O    . LYS A 1 74  ? 9.695   8.201   2.911   1.00 0.00 ? 74  LYS A O    5  
ATOM 6810  C CB   . LYS A 1 74  ? 7.816   8.528   0.247   1.00 0.00 ? 74  LYS A CB   5  
ATOM 6811  C CG   . LYS A 1 74  ? 8.591   8.012   -0.967  1.00 0.00 ? 74  LYS A CG   5  
ATOM 6812  C CD   . LYS A 1 74  ? 8.753   9.109   -2.021  1.00 0.00 ? 74  LYS A CD   5  
ATOM 6813  C CE   . LYS A 1 74  ? 10.005  9.946   -1.754  1.00 0.00 ? 74  LYS A CE   5  
ATOM 6814  N NZ   . LYS A 1 74  ? 10.655  10.327  -3.027  1.00 0.00 ? 74  LYS A NZ   5  
ATOM 6815  H H    . LYS A 1 74  ? 5.858   7.379   1.240   1.00 0.00 ? 74  LYS A H    5  
ATOM 6816  H HA   . LYS A 1 74  ? 8.596   6.752   1.115   1.00 0.00 ? 74  LYS A HA   5  
ATOM 6817  H HB2  . LYS A 1 74  ? 6.768   8.668   -0.018  1.00 0.00 ? 74  LYS A HB2  5  
ATOM 6818  H HB3  . LYS A 1 74  ? 8.202   9.504   0.542   1.00 0.00 ? 74  LYS A HB3  5  
ATOM 6819  H HG2  . LYS A 1 74  ? 9.572   7.658   -0.652  1.00 0.00 ? 74  LYS A HG2  5  
ATOM 6820  H HG3  . LYS A 1 74  ? 8.068   7.160   -1.401  1.00 0.00 ? 74  LYS A HG3  5  
ATOM 6821  H HD2  . LYS A 1 74  ? 8.816   8.660   -3.012  1.00 0.00 ? 74  LYS A HD2  5  
ATOM 6822  H HD3  . LYS A 1 74  ? 7.873   9.753   -2.019  1.00 0.00 ? 74  LYS A HD3  5  
ATOM 6823  H HE2  . LYS A 1 74  ? 9.738   10.842  -1.192  1.00 0.00 ? 74  LYS A HE2  5  
ATOM 6824  H HE3  . LYS A 1 74  ? 10.703  9.380   -1.137  1.00 0.00 ? 74  LYS A HE3  5  
ATOM 6825  H HZ1  . LYS A 1 74  ? 10.092  11.005  -3.499  1.00 0.00 ? 74  LYS A HZ1  5  
ATOM 6826  H HZ2  . LYS A 1 74  ? 11.557  10.717  -2.838  1.00 0.00 ? 74  LYS A HZ2  5  
ATOM 6827  H HZ3  . LYS A 1 74  ? 10.757  9.517   -3.605  1.00 0.00 ? 74  LYS A HZ3  5  
ATOM 6828  N N    . ALA A 1 75  ? 7.574   8.704   3.512   1.00 0.00 ? 75  ALA A N    5  
ATOM 6829  C CA   . ALA A 1 75  ? 7.960   9.340   4.760   1.00 0.00 ? 75  ALA A CA   5  
ATOM 6830  C C    . ALA A 1 75  ? 8.757   8.347   5.608   1.00 0.00 ? 75  ALA A C    5  
ATOM 6831  O O    . ALA A 1 75  ? 9.536   8.747   6.472   1.00 0.00 ? 75  ALA A O    5  
ATOM 6832  C CB   . ALA A 1 75  ? 6.711   9.851   5.480   1.00 0.00 ? 75  ALA A CB   5  
ATOM 6833  H H    . ALA A 1 75  ? 6.590   8.691   3.331   1.00 0.00 ? 75  ALA A H    5  
ATOM 6834  H HA   . ALA A 1 75  ? 8.597   10.190  4.516   1.00 0.00 ? 75  ALA A HA   5  
ATOM 6835  H HB1  . ALA A 1 75  ? 5.977   10.181  4.745   1.00 0.00 ? 75  ALA A HB1  5  
ATOM 6836  H HB2  . ALA A 1 75  ? 6.286   9.050   6.084   1.00 0.00 ? 75  ALA A HB2  5  
ATOM 6837  H HB3  . ALA A 1 75  ? 6.980   10.688  6.125   1.00 0.00 ? 75  ALA A HB3  5  
ATOM 6838  N N    . CYS A 1 76  ? 8.535   7.070   5.331   1.00 0.00 ? 76  CYS A N    5  
ATOM 6839  C CA   . CYS A 1 76  ? 9.222   6.016   6.058   1.00 0.00 ? 76  CYS A CA   5  
ATOM 6840  C C    . CYS A 1 76  ? 10.685  6.430   6.235   1.00 0.00 ? 76  CYS A C    5  
ATOM 6841  O O    . CYS A 1 76  ? 11.261  7.076   5.361   1.00 0.00 ? 76  CYS A O    5  
ATOM 6842  C CB   . CYS A 1 76  ? 9.093   4.665   5.353   1.00 0.00 ? 76  CYS A CB   5  
ATOM 6843  S SG   . CYS A 1 76  ? 10.207  4.607   3.902   1.00 0.00 ? 76  CYS A SG   5  
ATOM 6844  H H    . CYS A 1 76  ? 7.900   6.753   4.627   1.00 0.00 ? 76  CYS A H    5  
ATOM 6845  H HA   . CYS A 1 76  ? 8.726   5.927   7.025   1.00 0.00 ? 76  CYS A HA   5  
ATOM 6846  H HB2  . CYS A 1 76  ? 9.340   3.859   6.044   1.00 0.00 ? 76  CYS A HB2  5  
ATOM 6847  H HB3  . CYS A 1 76  ? 8.061   4.508   5.036   1.00 0.00 ? 76  CYS A HB3  5  
ATOM 6848  H HG   . CYS A 1 76  ? 11.178  3.924   4.500   1.00 0.00 ? 76  CYS A HG   5  
ATOM 6849  N N    . THR A 1 77  ? 11.243  6.041   7.371   1.00 0.00 ? 77  THR A N    5  
ATOM 6850  C CA   . THR A 1 77  ? 12.628  6.363   7.674   1.00 0.00 ? 77  THR A CA   5  
ATOM 6851  C C    . THR A 1 77  ? 13.372  5.117   8.159   1.00 0.00 ? 77  THR A C    5  
ATOM 6852  O O    . THR A 1 77  ? 14.028  5.147   9.198   1.00 0.00 ? 77  THR A O    5  
ATOM 6853  C CB   . THR A 1 77  ? 12.636  7.509   8.688   1.00 0.00 ? 77  THR A CB   5  
ATOM 6854  O OG1  . THR A 1 77  ? 14.000  7.919   8.737   1.00 0.00 ? 77  THR A OG1  5  
ATOM 6855  C CG2  . THR A 1 77  ? 12.339  7.033   10.111  1.00 0.00 ? 77  THR A CG2  5  
ATOM 6856  H H    . THR A 1 77  ? 10.768  5.516   8.077   1.00 0.00 ? 77  THR A H    5  
ATOM 6857  H HA   . THR A 1 77  ? 13.114  6.688   6.754   1.00 0.00 ? 77  THR A HA   5  
ATOM 6858  H HB   . THR A 1 77  ? 11.946  8.298   8.389   1.00 0.00 ? 77  THR A HB   5  
ATOM 6859  H HG1  . THR A 1 77  ? 14.094  8.721   9.327   1.00 0.00 ? 77  THR A HG1  5  
ATOM 6860  H HG21 . THR A 1 77  ? 12.194  5.953   10.111  1.00 0.00 ? 77  THR A HG21 5  
ATOM 6861  H HG22 . THR A 1 77  ? 13.175  7.288   10.761  1.00 0.00 ? 77  THR A HG22 5  
ATOM 6862  H HG23 . THR A 1 77  ? 11.434  7.520   10.476  1.00 0.00 ? 77  THR A HG23 5  
ATOM 6863  N N    . GLY A 1 78  ? 13.244  4.051   7.382   1.00 0.00 ? 78  GLY A N    5  
ATOM 6864  C CA   . GLY A 1 78  ? 13.896  2.797   7.720   1.00 0.00 ? 78  GLY A CA   5  
ATOM 6865  C C    . GLY A 1 78  ? 12.917  1.626   7.619   1.00 0.00 ? 78  GLY A C    5  
ATOM 6866  O O    . GLY A 1 78  ? 13.160  0.670   6.885   1.00 0.00 ? 78  GLY A O    5  
ATOM 6867  H H    . GLY A 1 78  ? 12.708  4.035   6.538   1.00 0.00 ? 78  GLY A H    5  
ATOM 6868  H HA2  . GLY A 1 78  ? 14.739  2.630   7.049   1.00 0.00 ? 78  GLY A HA2  5  
ATOM 6869  H HA3  . GLY A 1 78  ? 14.299  2.853   8.731   1.00 0.00 ? 78  GLY A HA3  5  
ATOM 6870  N N    . SER A 1 79  ? 11.830  1.739   8.368   1.00 0.00 ? 79  SER A N    5  
ATOM 6871  C CA   . SER A 1 79  ? 10.813  0.701   8.373   1.00 0.00 ? 79  SER A CA   5  
ATOM 6872  C C    . SER A 1 79  ? 9.425   1.327   8.219   1.00 0.00 ? 79  SER A C    5  
ATOM 6873  O O    . SER A 1 79  ? 9.256   2.528   8.424   1.00 0.00 ? 79  SER A O    5  
ATOM 6874  C CB   . SER A 1 79  ? 10.880  -0.130  9.656   1.00 0.00 ? 79  SER A CB   5  
ATOM 6875  O OG   . SER A 1 79  ? 11.172  0.672   10.797  1.00 0.00 ? 79  SER A OG   5  
ATOM 6876  H H    . SER A 1 79  ? 11.639  2.520   8.963   1.00 0.00 ? 79  SER A H    5  
ATOM 6877  H HA   . SER A 1 79  ? 11.044  0.067   7.518   1.00 0.00 ? 79  SER A HA   5  
ATOM 6878  H HB2  . SER A 1 79  ? 9.930   -0.642  9.806   1.00 0.00 ? 79  SER A HB2  5  
ATOM 6879  H HB3  . SER A 1 79  ? 11.644  -0.900  9.549   1.00 0.00 ? 79  SER A HB3  5  
ATOM 6880  H HG   . SER A 1 79  ? 11.170  0.107   11.622  1.00 0.00 ? 79  SER A HG   5  
ATOM 6881  N N    . LEU A 1 80  ? 8.468   0.485   7.858   1.00 0.00 ? 80  LEU A N    5  
ATOM 6882  C CA   . LEU A 1 80  ? 7.101   0.941   7.673   1.00 0.00 ? 80  LEU A CA   5  
ATOM 6883  C C    . LEU A 1 80  ? 6.220   0.358   8.780   1.00 0.00 ? 80  LEU A C    5  
ATOM 6884  O O    . LEU A 1 80  ? 6.401   -0.790  9.183   1.00 0.00 ? 80  LEU A O    5  
ATOM 6885  C CB   . LEU A 1 80  ? 6.612   0.612   6.261   1.00 0.00 ? 80  LEU A CB   5  
ATOM 6886  C CG   . LEU A 1 80  ? 5.540   1.541   5.689   1.00 0.00 ? 80  LEU A CG   5  
ATOM 6887  C CD1  . LEU A 1 80  ? 6.071   2.969   5.544   1.00 0.00 ? 80  LEU A CD1  5  
ATOM 6888  C CD2  . LEU A 1 80  ? 4.991   0.997   4.369   1.00 0.00 ? 80  LEU A CD2  5  
ATOM 6889  H H    . LEU A 1 80  ? 8.614   -0.490  7.693   1.00 0.00 ? 80  LEU A H    5  
ATOM 6890  H HA   . LEU A 1 80  ? 7.103   2.027   7.769   1.00 0.00 ? 80  LEU A HA   5  
ATOM 6891  H HB2  . LEU A 1 80  ? 7.471   0.624   5.589   1.00 0.00 ? 80  LEU A HB2  5  
ATOM 6892  H HB3  . LEU A 1 80  ? 6.221   -0.405  6.261   1.00 0.00 ? 80  LEU A HB3  5  
ATOM 6893  H HG   . LEU A 1 80  ? 4.708   1.578   6.393   1.00 0.00 ? 80  LEU A HG   5  
ATOM 6894  H HD11 . LEU A 1 80  ? 6.082   3.247   4.490   1.00 0.00 ? 80  LEU A HD11 5  
ATOM 6895  H HD12 . LEU A 1 80  ? 5.427   3.654   6.094   1.00 0.00 ? 80  LEU A HD12 5  
ATOM 6896  H HD13 . LEU A 1 80  ? 7.084   3.022   5.944   1.00 0.00 ? 80  LEU A HD13 5  
ATOM 6897  H HD21 . LEU A 1 80  ? 4.090   1.548   4.095   1.00 0.00 ? 80  LEU A HD21 5  
ATOM 6898  H HD22 . LEU A 1 80  ? 5.741   1.116   3.587   1.00 0.00 ? 80  LEU A HD22 5  
ATOM 6899  H HD23 . LEU A 1 80  ? 4.749   -0.059  4.484   1.00 0.00 ? 80  LEU A HD23 5  
ATOM 6900  N N    . ASN A 1 81  ? 5.284   1.176   9.240   1.00 0.00 ? 81  ASN A N    5  
ATOM 6901  C CA   . ASN A 1 81  ? 4.375   0.756   10.292  1.00 0.00 ? 81  ASN A CA   5  
ATOM 6902  C C    . ASN A 1 81  ? 2.938   1.083   9.879   1.00 0.00 ? 81  ASN A C    5  
ATOM 6903  O O    . ASN A 1 81  ? 2.525   2.240   9.919   1.00 0.00 ? 81  ASN A O    5  
ATOM 6904  C CB   . ASN A 1 81  ? 4.669   1.491   11.601  1.00 0.00 ? 81  ASN A CB   5  
ATOM 6905  C CG   . ASN A 1 81  ? 5.251   0.538   12.647  1.00 0.00 ? 81  ASN A CG   5  
ATOM 6906  O OD1  . ASN A 1 81  ? 4.626   0.209   13.641  1.00 0.00 ? 81  ASN A OD1  5  
ATOM 6907  N ND2  . ASN A 1 81  ? 6.480   0.114   12.367  1.00 0.00 ? 81  ASN A ND2  5  
ATOM 6908  H H    . ASN A 1 81  ? 5.143   2.108   8.907   1.00 0.00 ? 81  ASN A H    5  
ATOM 6909  H HA   . ASN A 1 81  ? 4.543   -0.315  10.405  1.00 0.00 ? 81  ASN A HA   5  
ATOM 6910  H HB2  . ASN A 1 81  ? 5.370   2.305   11.415  1.00 0.00 ? 81  ASN A HB2  5  
ATOM 6911  H HB3  . ASN A 1 81  ? 3.753   1.941   11.984  1.00 0.00 ? 81  ASN A HB3  5  
ATOM 6912  H HD21 . ASN A 1 81  ? 6.938   0.422   11.534  1.00 0.00 ? 81  ASN A HD21 5  
ATOM 6913  H HD22 . ASN A 1 81  ? 6.947   -0.513  12.991  1.00 0.00 ? 81  ASN A HD22 5  
ATOM 6914  N N    . MET A 1 82  ? 2.216   0.041   9.491   1.00 0.00 ? 82  MET A N    5  
ATOM 6915  C CA   . MET A 1 82  ? 0.835   0.203   9.071   1.00 0.00 ? 82  MET A CA   5  
ATOM 6916  C C    . MET A 1 82  ? -0.037  -0.936  9.604   1.00 0.00 ? 82  MET A C    5  
ATOM 6917  O O    . MET A 1 82  ? 0.364   -2.098  9.570   1.00 0.00 ? 82  MET A O    5  
ATOM 6918  C CB   . MET A 1 82  ? 0.765   0.228   7.543   1.00 0.00 ? 82  MET A CB   5  
ATOM 6919  C CG   . MET A 1 82  ? 1.897   1.074   6.956   1.00 0.00 ? 82  MET A CG   5  
ATOM 6920  S SD   . MET A 1 82  ? 1.768   1.117   5.177   1.00 0.00 ? 82  MET A SD   5  
ATOM 6921  C CE   . MET A 1 82  ? 2.005   -0.614  4.808   1.00 0.00 ? 82  MET A CE   5  
ATOM 6922  H H    . MET A 1 82  ? 2.560   -0.897  9.462   1.00 0.00 ? 82  MET A H    5  
ATOM 6923  H HA   . MET A 1 82  ? 0.508   1.151   9.499   1.00 0.00 ? 82  MET A HA   5  
ATOM 6924  H HB2  . MET A 1 82  ? 0.829   -0.789  7.156   1.00 0.00 ? 82  MET A HB2  5  
ATOM 6925  H HB3  . MET A 1 82  ? -0.197  0.630   7.226   1.00 0.00 ? 82  MET A HB3  5  
ATOM 6926  H HG2  . MET A 1 82  ? 1.849   2.087   7.357   1.00 0.00 ? 82  MET A HG2  5  
ATOM 6927  H HG3  . MET A 1 82  ? 2.861   0.661   7.250   1.00 0.00 ? 82  MET A HG3  5  
ATOM 6928  H HE1  . MET A 1 82  ? 1.058   -1.052  4.493   1.00 0.00 ? 82  MET A HE1  5  
ATOM 6929  H HE2  . MET A 1 82  ? 2.737   -0.717  4.006   1.00 0.00 ? 82  MET A HE2  5  
ATOM 6930  H HE3  . MET A 1 82  ? 2.366   -1.129  5.698   1.00 0.00 ? 82  MET A HE3  5  
ATOM 6931  N N    . THR A 1 83  ? -1.215  -0.562  10.083  1.00 0.00 ? 83  THR A N    5  
ATOM 6932  C CA   . THR A 1 83  ? -2.147  -1.538  10.622  1.00 0.00 ? 83  THR A CA   5  
ATOM 6933  C C    . THR A 1 83  ? -2.957  -2.180  9.495   1.00 0.00 ? 83  THR A C    5  
ATOM 6934  O O    . THR A 1 83  ? -3.241  -1.538  8.485   1.00 0.00 ? 83  THR A O    5  
ATOM 6935  C CB   . THR A 1 83  ? -3.013  -0.835  11.669  1.00 0.00 ? 83  THR A CB   5  
ATOM 6936  O OG1  . THR A 1 83  ? -2.091  -0.036  12.404  1.00 0.00 ? 83  THR A OG1  5  
ATOM 6937  C CG2  . THR A 1 83  ? -3.577  -1.806  12.710  1.00 0.00 ? 83  THR A CG2  5  
ATOM 6938  H H    . THR A 1 83  ? -1.534  0.385   10.107  1.00 0.00 ? 83  THR A H    5  
ATOM 6939  H HA   . THR A 1 83  ? -1.574  -2.334  11.098  1.00 0.00 ? 83  THR A HA   5  
ATOM 6940  H HB   . THR A 1 83  ? -3.813  -0.266  11.195  1.00 0.00 ? 83  THR A HB   5  
ATOM 6941  H HG1  . THR A 1 83  ? -2.585  0.622   12.972  1.00 0.00 ? 83  THR A HG1  5  
ATOM 6942  H HG21 . THR A 1 83  ? -4.080  -1.243  13.496  1.00 0.00 ? 83  THR A HG21 5  
ATOM 6943  H HG22 . THR A 1 83  ? -4.288  -2.478  12.231  1.00 0.00 ? 83  THR A HG22 5  
ATOM 6944  H HG23 . THR A 1 83  ? -2.763  -2.386  13.143  1.00 0.00 ? 83  THR A HG23 5  
ATOM 6945  N N    . LEU A 1 84  ? -3.307  -3.441  9.705   1.00 0.00 ? 84  LEU A N    5  
ATOM 6946  C CA   . LEU A 1 84  ? -4.079  -4.178  8.719   1.00 0.00 ? 84  LEU A CA   5  
ATOM 6947  C C    . LEU A 1 84  ? -5.420  -4.589  9.331   1.00 0.00 ? 84  LEU A C    5  
ATOM 6948  O O    . LEU A 1 84  ? -5.577  -4.585  10.551  1.00 0.00 ? 84  LEU A O    5  
ATOM 6949  C CB   . LEU A 1 84  ? -3.267  -5.353  8.172   1.00 0.00 ? 84  LEU A CB   5  
ATOM 6950  C CG   . LEU A 1 84  ? -1.931  -4.998  7.517   1.00 0.00 ? 84  LEU A CG   5  
ATOM 6951  C CD1  . LEU A 1 84  ? -1.289  -6.230  6.876   1.00 0.00 ? 84  LEU A CD1  5  
ATOM 6952  C CD2  . LEU A 1 84  ? -2.098  -3.853  6.516   1.00 0.00 ? 84  LEU A CD2  5  
ATOM 6953  H H    . LEU A 1 84  ? -3.073  -3.956  10.529  1.00 0.00 ? 84  LEU A H    5  
ATOM 6954  H HA   . LEU A 1 84  ? -4.273  -3.503  7.885   1.00 0.00 ? 84  LEU A HA   5  
ATOM 6955  H HB2  . LEU A 1 84  ? -3.075  -6.048  8.989   1.00 0.00 ? 84  LEU A HB2  5  
ATOM 6956  H HB3  . LEU A 1 84  ? -3.878  -5.882  7.441   1.00 0.00 ? 84  LEU A HB3  5  
ATOM 6957  H HG   . LEU A 1 84  ? -1.252  -4.649  8.294   1.00 0.00 ? 84  LEU A HG   5  
ATOM 6958  H HD11 . LEU A 1 84  ? -0.880  -6.873  7.655   1.00 0.00 ? 84  LEU A HD11 5  
ATOM 6959  H HD12 . LEU A 1 84  ? -2.042  -6.779  6.311   1.00 0.00 ? 84  LEU A HD12 5  
ATOM 6960  H HD13 . LEU A 1 84  ? -0.489  -5.916  6.206   1.00 0.00 ? 84  LEU A HD13 5  
ATOM 6961  H HD21 . LEU A 1 84  ? -1.179  -3.735  5.942   1.00 0.00 ? 84  LEU A HD21 5  
ATOM 6962  H HD22 . LEU A 1 84  ? -2.923  -4.080  5.839   1.00 0.00 ? 84  LEU A HD22 5  
ATOM 6963  H HD23 . LEU A 1 84  ? -2.313  -2.929  7.053   1.00 0.00 ? 84  LEU A HD23 5  
ATOM 6964  N N    . GLN A 1 85  ? -6.353  -4.933  8.456   1.00 0.00 ? 85  GLN A N    5  
ATOM 6965  C CA   . GLN A 1 85  ? -7.675  -5.346  8.895   1.00 0.00 ? 85  GLN A CA   5  
ATOM 6966  C C    . GLN A 1 85  ? -7.944  -6.794  8.480   1.00 0.00 ? 85  GLN A C    5  
ATOM 6967  O O    . GLN A 1 85  ? -7.520  -7.226  7.410   1.00 0.00 ? 85  GLN A O    5  
ATOM 6968  C CB   . GLN A 1 85  ? -8.753  -4.409  8.345   1.00 0.00 ? 85  GLN A CB   5  
ATOM 6969  C CG   . GLN A 1 85  ? -10.148 -5.008  8.533   1.00 0.00 ? 85  GLN A CG   5  
ATOM 6970  C CD   . GLN A 1 85  ? -10.644 -5.661  7.241   1.00 0.00 ? 85  GLN A CD   5  
ATOM 6971  O OE1  . GLN A 1 85  ? -10.231 -6.746  6.866   1.00 0.00 ? 85  GLN A OE1  5  
ATOM 6972  N NE2  . GLN A 1 85  ? -11.549 -4.942  6.584   1.00 0.00 ? 85  GLN A NE2  5  
ATOM 6973  H H    . GLN A 1 85  ? -6.218  -4.933  7.465   1.00 0.00 ? 85  GLN A H    5  
ATOM 6974  H HA   . GLN A 1 85  ? -7.657  -5.269  9.982   1.00 0.00 ? 85  GLN A HA   5  
ATOM 6975  H HB2  . GLN A 1 85  ? -8.695  -3.446  8.851   1.00 0.00 ? 85  GLN A HB2  5  
ATOM 6976  H HB3  . GLN A 1 85  ? -8.573  -4.224  7.286   1.00 0.00 ? 85  GLN A HB3  5  
ATOM 6977  H HG2  . GLN A 1 85  ? -10.125 -5.748  9.333   1.00 0.00 ? 85  GLN A HG2  5  
ATOM 6978  H HG3  . GLN A 1 85  ? -10.844 -4.228  8.841   1.00 0.00 ? 85  GLN A HG3  5  
ATOM 6979  H HE21 . GLN A 1 85  ? -11.845 -4.059  6.948   1.00 0.00 ? 85  GLN A HE21 5  
ATOM 6980  H HE22 . GLN A 1 85  ? -11.934 -5.285  5.728   1.00 0.00 ? 85  GLN A HE22 5  
ATOM 6981  N N    . ARG A 1 86  ? -8.647  -7.504  9.351   1.00 0.00 ? 86  ARG A N    5  
ATOM 6982  C CA   . ARG A 1 86  ? -8.978  -8.895  9.089   1.00 0.00 ? 86  ARG A CA   5  
ATOM 6983  C C    . ARG A 1 86  ? -10.236 -8.987  8.224   1.00 0.00 ? 86  ARG A C    5  
ATOM 6984  O O    . ARG A 1 86  ? -11.308 -8.544  8.633   1.00 0.00 ? 86  ARG A O    5  
ATOM 6985  C CB   . ARG A 1 86  ? -9.205  -9.662  10.393  1.00 0.00 ? 86  ARG A CB   5  
ATOM 6986  C CG   . ARG A 1 86  ? -7.875  -10.076 11.025  1.00 0.00 ? 86  ARG A CG   5  
ATOM 6987  C CD   . ARG A 1 86  ? -6.981  -8.858  11.268  1.00 0.00 ? 86  ARG A CD   5  
ATOM 6988  N NE   . ARG A 1 86  ? -5.808  -9.246  12.082  1.00 0.00 ? 86  ARG A NE   5  
ATOM 6989  C CZ   . ARG A 1 86  ? -4.694  -9.797  11.580  1.00 0.00 ? 86  ARG A CZ   5  
ATOM 6990  N NH1  . ARG A 1 86  ? -4.596  -10.029 10.264  1.00 0.00 ? 86  ARG A NH1  5  
ATOM 6991  N NH2  . ARG A 1 86  ? -3.679  -10.117 12.395  1.00 0.00 ? 86  ARG A NH2  5  
ATOM 6992  H H    . ARG A 1 86  ? -8.988  -7.145  10.219  1.00 0.00 ? 86  ARG A H    5  
ATOM 6993  H HA   . ARG A 1 86  ? -8.110  -9.293  8.562   1.00 0.00 ? 86  ARG A HA   5  
ATOM 6994  H HB2  . ARG A 1 86  ? -9.766  -9.041  11.091  1.00 0.00 ? 86  ARG A HB2  5  
ATOM 6995  H HB3  . ARG A 1 86  ? -9.810  -10.547 10.197  1.00 0.00 ? 86  ARG A HB3  5  
ATOM 6996  H HG2  . ARG A 1 86  ? -8.060  -10.590 11.968  1.00 0.00 ? 86  ARG A HG2  5  
ATOM 6997  H HG3  . ARG A 1 86  ? -7.362  -10.783 10.372  1.00 0.00 ? 86  ARG A HG3  5  
ATOM 6998  H HD2  . ARG A 1 86  ? -6.652  -8.442  10.316  1.00 0.00 ? 86  ARG A HD2  5  
ATOM 6999  H HD3  . ARG A 1 86  ? -7.546  -8.078  11.779  1.00 0.00 ? 86  ARG A HD3  5  
ATOM 7000  H HE   . ARG A 1 86  ? -5.848  -9.087  13.069  1.00 0.00 ? 86  ARG A HE   5  
ATOM 7001  H HH11 . ARG A 1 86  ? -5.353  -9.790  9.657   1.00 0.00 ? 86  ARG A HH11 5  
ATOM 7002  H HH12 . ARG A 1 86  ? -3.765  -10.440 9.890   1.00 0.00 ? 86  ARG A HH12 5  
ATOM 7003  H HH21 . ARG A 1 86  ? -3.753  -9.945  13.377  1.00 0.00 ? 86  ARG A HH21 5  
ATOM 7004  H HH22 . ARG A 1 86  ? -2.848  -10.529 12.020  1.00 0.00 ? 86  ARG A HH22 5  
ATOM 7005  N N    . ALA A 1 87  ? -10.064 -9.566  7.045   1.00 0.00 ? 87  ALA A N    5  
ATOM 7006  C CA   . ALA A 1 87  ? -11.173 -9.723  6.119   1.00 0.00 ? 87  ALA A CA   5  
ATOM 7007  C C    . ALA A 1 87  ? -11.662 -11.172 6.156   1.00 0.00 ? 87  ALA A C    5  
ATOM 7008  O O    . ALA A 1 87  ? -11.391 -11.946 5.238   1.00 0.00 ? 87  ALA A O    5  
ATOM 7009  C CB   . ALA A 1 87  ? -10.734 -9.291  4.718   1.00 0.00 ? 87  ALA A CB   5  
ATOM 7010  H H    . ALA A 1 87  ? -9.189  -9.924  6.720   1.00 0.00 ? 87  ALA A H    5  
ATOM 7011  H HA   . ALA A 1 87  ? -11.978 -9.068  6.452   1.00 0.00 ? 87  ALA A HA   5  
ATOM 7012  H HB1  . ALA A 1 87  ? -11.146 -8.307  4.496   1.00 0.00 ? 87  ALA A HB1  5  
ATOM 7013  H HB2  . ALA A 1 87  ? -9.646  -9.248  4.676   1.00 0.00 ? 87  ALA A HB2  5  
ATOM 7014  H HB3  . ALA A 1 87  ? -11.098 -10.011 3.985   1.00 0.00 ? 87  ALA A HB3  5  
ATOM 7015  N N    . SER A 1 88  ? -12.374 -11.496 7.225   1.00 0.00 ? 88  SER A N    5  
ATOM 7016  C CA   . SER A 1 88  ? -12.903 -12.839 7.393   1.00 0.00 ? 88  SER A CA   5  
ATOM 7017  C C    . SER A 1 88  ? -14.190 -12.999 6.583   1.00 0.00 ? 88  SER A C    5  
ATOM 7018  O O    . SER A 1 88  ? -14.795 -12.011 6.169   1.00 0.00 ? 88  SER A O    5  
ATOM 7019  C CB   . SER A 1 88  ? -13.162 -13.148 8.869   1.00 0.00 ? 88  SER A CB   5  
ATOM 7020  O OG   . SER A 1 88  ? -14.161 -12.297 9.425   1.00 0.00 ? 88  SER A OG   5  
ATOM 7021  H H    . SER A 1 88  ? -12.589 -10.861 7.967   1.00 0.00 ? 88  SER A H    5  
ATOM 7022  H HA   . SER A 1 88  ? -12.127 -13.504 7.015   1.00 0.00 ? 88  SER A HA   5  
ATOM 7023  H HB2  . SER A 1 88  ? -13.473 -14.188 8.973   1.00 0.00 ? 88  SER A HB2  5  
ATOM 7024  H HB3  . SER A 1 88  ? -12.236 -13.035 9.432   1.00 0.00 ? 88  SER A HB3  5  
ATOM 7025  H HG   . SER A 1 88  ? -14.430 -12.630 10.329  1.00 0.00 ? 88  SER A HG   5  
ATOM 7026  N N    . ALA A 1 89  ? -14.572 -14.252 6.381   1.00 0.00 ? 89  ALA A N    5  
ATOM 7027  C CA   . ALA A 1 89  ? -15.777 -14.554 5.627   1.00 0.00 ? 89  ALA A CA   5  
ATOM 7028  C C    . ALA A 1 89  ? -16.893 -14.951 6.596   1.00 0.00 ? 89  ALA A C    5  
ATOM 7029  O O    . ALA A 1 89  ? -16.624 -15.395 7.711   1.00 0.00 ? 89  ALA A O    5  
ATOM 7030  C CB   . ALA A 1 89  ? -15.478 -15.651 4.603   1.00 0.00 ? 89  ALA A CB   5  
ATOM 7031  H H    . ALA A 1 89  ? -14.075 -15.050 6.721   1.00 0.00 ? 89  ALA A H    5  
ATOM 7032  H HA   . ALA A 1 89  ? -16.073 -13.650 5.097   1.00 0.00 ? 89  ALA A HA   5  
ATOM 7033  H HB1  . ALA A 1 89  ? -14.952 -16.471 5.092   1.00 0.00 ? 89  ALA A HB1  5  
ATOM 7034  H HB2  . ALA A 1 89  ? -16.413 -16.019 4.181   1.00 0.00 ? 89  ALA A HB2  5  
ATOM 7035  H HB3  . ALA A 1 89  ? -14.855 -15.244 3.807   1.00 0.00 ? 89  ALA A HB3  5  
ATOM 7036  N N    . ALA A 1 90  ? -18.123 -14.776 6.135   1.00 0.00 ? 90  ALA A N    5  
ATOM 7037  C CA   . ALA A 1 90  ? -19.281 -15.110 6.947   1.00 0.00 ? 90  ALA A CA   5  
ATOM 7038  C C    . ALA A 1 90  ? -19.661 -16.572 6.709   1.00 0.00 ? 90  ALA A C    5  
ATOM 7039  O O    . ALA A 1 90  ? -19.628 -17.049 5.575   1.00 0.00 ? 90  ALA A O    5  
ATOM 7040  C CB   . ALA A 1 90  ? -20.427 -14.149 6.622   1.00 0.00 ? 90  ALA A CB   5  
ATOM 7041  H H    . ALA A 1 90  ? -18.334 -14.414 5.227   1.00 0.00 ? 90  ALA A H    5  
ATOM 7042  H HA   . ALA A 1 90  ? -19.001 -14.982 7.993   1.00 0.00 ? 90  ALA A HA   5  
ATOM 7043  H HB1  . ALA A 1 90  ? -20.142 -13.515 5.783   1.00 0.00 ? 90  ALA A HB1  5  
ATOM 7044  H HB2  . ALA A 1 90  ? -21.317 -14.721 6.361   1.00 0.00 ? 90  ALA A HB2  5  
ATOM 7045  H HB3  . ALA A 1 90  ? -20.637 -13.527 7.492   1.00 0.00 ? 90  ALA A HB3  5  
ATOM 7046  N N    . ALA A 1 91  ? -20.013 -17.244 7.795   1.00 0.00 ? 91  ALA A N    5  
ATOM 7047  C CA   . ALA A 1 91  ? -20.399 -18.643 7.718   1.00 0.00 ? 91  ALA A CA   5  
ATOM 7048  C C    . ALA A 1 91  ? -19.216 -19.467 7.208   1.00 0.00 ? 91  ALA A C    5  
ATOM 7049  O O    . ALA A 1 91  ? -18.742 -19.254 6.092   1.00 0.00 ? 91  ALA A O    5  
ATOM 7050  C CB   . ALA A 1 91  ? -21.635 -18.783 6.827   1.00 0.00 ? 91  ALA A CB   5  
ATOM 7051  H H    . ALA A 1 91  ? -20.037 -16.849 8.713   1.00 0.00 ? 91  ALA A H    5  
ATOM 7052  H HA   . ALA A 1 91  ? -20.654 -18.973 8.725   1.00 0.00 ? 91  ALA A HA   5  
ATOM 7053  H HB1  . ALA A 1 91  ? -22.470 -18.245 7.276   1.00 0.00 ? 91  ALA A HB1  5  
ATOM 7054  H HB2  . ALA A 1 91  ? -21.422 -18.367 5.842   1.00 0.00 ? 91  ALA A HB2  5  
ATOM 7055  H HB3  . ALA A 1 91  ? -21.893 -19.837 6.727   1.00 0.00 ? 91  ALA A HB3  5  
ATOM 7056  N N    . LYS A 1 92  ? -18.772 -20.390 8.048   1.00 0.00 ? 92  LYS A N    5  
ATOM 7057  C CA   . LYS A 1 92  ? -17.653 -21.247 7.696   1.00 0.00 ? 92  LYS A CA   5  
ATOM 7058  C C    . LYS A 1 92  ? -18.042 -22.123 6.504   1.00 0.00 ? 92  LYS A C    5  
ATOM 7059  O O    . LYS A 1 92  ? -19.195 -22.533 6.381   1.00 0.00 ? 92  LYS A O    5  
ATOM 7060  C CB   . LYS A 1 92  ? -17.181 -22.041 8.915   1.00 0.00 ? 92  LYS A CB   5  
ATOM 7061  C CG   . LYS A 1 92  ? -18.217 -23.093 9.318   1.00 0.00 ? 92  LYS A CG   5  
ATOM 7062  C CD   . LYS A 1 92  ? -19.154 -22.553 10.400  1.00 0.00 ? 92  LYS A CD   5  
ATOM 7063  C CE   . LYS A 1 92  ? -19.573 -23.664 11.366  1.00 0.00 ? 92  LYS A CE   5  
ATOM 7064  N NZ   . LYS A 1 92  ? -21.036 -23.633 11.588  1.00 0.00 ? 92  LYS A NZ   5  
ATOM 7065  H H    . LYS A 1 92  ? -19.163 -20.556 8.953   1.00 0.00 ? 92  LYS A H    5  
ATOM 7066  H HA   . LYS A 1 92  ? -16.828 -20.600 7.394   1.00 0.00 ? 92  LYS A HA   5  
ATOM 7067  H HB2  . LYS A 1 92  ? -16.232 -22.528 8.693   1.00 0.00 ? 92  LYS A HB2  5  
ATOM 7068  H HB3  . LYS A 1 92  ? -17.004 -21.363 9.749   1.00 0.00 ? 92  LYS A HB3  5  
ATOM 7069  H HG2  . LYS A 1 92  ? -18.798 -23.390 8.444   1.00 0.00 ? 92  LYS A HG2  5  
ATOM 7070  H HG3  . LYS A 1 92  ? -17.711 -23.986 9.683   1.00 0.00 ? 92  LYS A HG3  5  
ATOM 7071  H HD2  . LYS A 1 92  ? -18.657 -21.755 10.951  1.00 0.00 ? 92  LYS A HD2  5  
ATOM 7072  H HD3  . LYS A 1 92  ? -20.039 -22.118 9.936   1.00 0.00 ? 92  LYS A HD3  5  
ATOM 7073  H HE2  . LYS A 1 92  ? -19.280 -24.633 10.964  1.00 0.00 ? 92  LYS A HE2  5  
ATOM 7074  H HE3  . LYS A 1 92  ? -19.052 -23.542 12.316  1.00 0.00 ? 92  LYS A HE3  5  
ATOM 7075  H HZ1  . LYS A 1 92  ? -21.227 -23.279 12.504  1.00 0.00 ? 92  LYS A HZ1  5  
ATOM 7076  H HZ2  . LYS A 1 92  ? -21.464 -23.041 10.906  1.00 0.00 ? 92  LYS A HZ2  5  
ATOM 7077  H HZ3  . LYS A 1 92  ? -21.405 -24.559 11.505  1.00 0.00 ? 92  LYS A HZ3  5  
ATOM 7078  N N    . SER A 1 93  ? -17.059 -22.384 5.655   1.00 0.00 ? 93  SER A N    5  
ATOM 7079  C CA   . SER A 1 93  ? -17.284 -23.205 4.478   1.00 0.00 ? 93  SER A CA   5  
ATOM 7080  C C    . SER A 1 93  ? -17.008 -24.674 4.802   1.00 0.00 ? 93  SER A C    5  
ATOM 7081  O O    . SER A 1 93  ? -15.904 -25.025 5.216   1.00 0.00 ? 93  SER A O    5  
ATOM 7082  C CB   . SER A 1 93  ? -16.408 -22.745 3.310   1.00 0.00 ? 93  SER A CB   5  
ATOM 7083  O OG   . SER A 1 93  ? -15.019 -22.848 3.613   1.00 0.00 ? 93  SER A OG   5  
ATOM 7084  H H    . SER A 1 93  ? -16.123 -22.047 5.763   1.00 0.00 ? 93  SER A H    5  
ATOM 7085  H HA   . SER A 1 93  ? -18.334 -23.060 4.222   1.00 0.00 ? 93  SER A HA   5  
ATOM 7086  H HB2  . SER A 1 93  ? -16.633 -23.347 2.430   1.00 0.00 ? 93  SER A HB2  5  
ATOM 7087  H HB3  . SER A 1 93  ? -16.649 -21.712 3.061   1.00 0.00 ? 93  SER A HB3  5  
ATOM 7088  H HG   . SER A 1 93  ? -14.651 -21.947 3.841   1.00 0.00 ? 93  SER A HG   5  
ATOM 7089  N N    . GLU A 1 94  ? -18.030 -25.493 4.603   1.00 0.00 ? 94  GLU A N    5  
ATOM 7090  C CA   . GLU A 1 94  ? -17.911 -26.917 4.869   1.00 0.00 ? 94  GLU A CA   5  
ATOM 7091  C C    . GLU A 1 94  ? -17.617 -27.677 3.574   1.00 0.00 ? 94  GLU A C    5  
ATOM 7092  O O    . GLU A 1 94  ? -18.025 -27.251 2.494   1.00 0.00 ? 94  GLU A O    5  
ATOM 7093  C CB   . GLU A 1 94  ? -19.172 -27.455 5.547   1.00 0.00 ? 94  GLU A CB   5  
ATOM 7094  C CG   . GLU A 1 94  ? -20.352 -27.475 4.572   1.00 0.00 ? 94  GLU A CG   5  
ATOM 7095  C CD   . GLU A 1 94  ? -21.483 -28.360 5.100   1.00 0.00 ? 94  GLU A CD   5  
ATOM 7096  O OE1  . GLU A 1 94  ? -21.856 -28.164 6.276   1.00 0.00 ? 94  GLU A OE1  5  
ATOM 7097  O OE2  . GLU A 1 94  ? -21.950 -29.213 4.314   1.00 0.00 ? 94  GLU A OE2  5  
ATOM 7098  H H    . GLU A 1 94  ? -18.924 -25.200 4.266   1.00 0.00 ? 94  GLU A H    5  
ATOM 7099  H HA   . GLU A 1 94  ? -17.068 -27.014 5.554   1.00 0.00 ? 94  GLU A HA   5  
ATOM 7100  H HB2  . GLU A 1 94  ? -18.987 -28.462 5.921   1.00 0.00 ? 94  GLU A HB2  5  
ATOM 7101  H HB3  . GLU A 1 94  ? -19.419 -26.836 6.409   1.00 0.00 ? 94  GLU A HB3  5  
ATOM 7102  H HG2  . GLU A 1 94  ? -20.720 -26.461 4.420   1.00 0.00 ? 94  GLU A HG2  5  
ATOM 7103  H HG3  . GLU A 1 94  ? -20.020 -27.843 3.602   1.00 0.00 ? 94  GLU A HG3  5  
ATOM 7104  N N    . PRO A 1 95  ? -16.894 -28.818 3.728   1.00 0.00 ? 95  PRO A N    5  
ATOM 7105  C CA   . PRO A 1 95  ? -16.541 -29.641 2.584   1.00 0.00 ? 95  PRO A CA   5  
ATOM 7106  C C    . PRO A 1 95  ? -17.751 -30.434 2.086   1.00 0.00 ? 95  PRO A C    5  
ATOM 7107  O O    . PRO A 1 95  ? -18.392 -31.147 2.857   1.00 0.00 ? 95  PRO A O    5  
ATOM 7108  C CB   . PRO A 1 95  ? -15.409 -30.530 3.073   1.00 0.00 ? 95  PRO A CB   5  
ATOM 7109  C CG   . PRO A 1 95  ? -15.481 -30.500 4.591   1.00 0.00 ? 95  PRO A CG   5  
ATOM 7110  C CD   . PRO A 1 95  ? -16.395 -29.353 4.992   1.00 0.00 ? 95  PRO A CD   5  
ATOM 7111  H HA   . PRO A 1 95  ? -16.257 -29.066 1.817   1.00 0.00 ? 95  PRO A HA   5  
ATOM 7112  H HB2  . PRO A 1 95  ? -15.520 -31.546 2.696   1.00 0.00 ? 95  PRO A HB2  5  
ATOM 7113  H HB3  . PRO A 1 95  ? -14.445 -30.163 2.720   1.00 0.00 ? 95  PRO A HB3  5  
ATOM 7114  H HG2  . PRO A 1 95  ? -15.866 -31.446 4.973   1.00 0.00 ? 95  PRO A HG2  5  
ATOM 7115  H HG3  . PRO A 1 95  ? -14.488 -30.364 5.018   1.00 0.00 ? 95  PRO A HG3  5  
ATOM 7116  H HD2  . PRO A 1 95  ? -17.211 -29.700 5.625   1.00 0.00 ? 95  PRO A HD2  5  
ATOM 7117  H HD3  . PRO A 1 95  ? -15.853 -28.594 5.557   1.00 0.00 ? 95  PRO A HD3  5  
ATOM 7118  N N    . VAL A 1 96  ? -18.027 -30.284 0.798   1.00 0.00 ? 96  VAL A N    5  
ATOM 7119  C CA   . VAL A 1 96  ? -19.149 -30.977 0.188   1.00 0.00 ? 96  VAL A CA   5  
ATOM 7120  C C    . VAL A 1 96  ? -18.628 -31.925 -0.895  1.00 0.00 ? 96  VAL A C    5  
ATOM 7121  O O    . VAL A 1 96  ? -17.569 -31.689 -1.474  1.00 0.00 ? 96  VAL A O    5  
ATOM 7122  C CB   . VAL A 1 96  ? -20.165 -29.963 -0.343  1.00 0.00 ? 96  VAL A CB   5  
ATOM 7123  C CG1  . VAL A 1 96  ? -19.575 -29.148 -1.495  1.00 0.00 ? 96  VAL A CG1  5  
ATOM 7124  C CG2  . VAL A 1 96  ? -21.460 -30.657 -0.768  1.00 0.00 ? 96  VAL A CG2  5  
ATOM 7125  H H    . VAL A 1 96  ? -17.501 -29.703 0.178   1.00 0.00 ? 96  VAL A H    5  
ATOM 7126  H HA   . VAL A 1 96  ? -19.634 -31.566 0.966   1.00 0.00 ? 96  VAL A HA   5  
ATOM 7127  H HB   . VAL A 1 96  ? -20.404 -29.274 0.467   1.00 0.00 ? 96  VAL A HB   5  
ATOM 7128  H HG11 . VAL A 1 96  ? -18.853 -28.433 -1.102  1.00 0.00 ? 96  VAL A HG11 5  
ATOM 7129  H HG12 . VAL A 1 96  ? -19.078 -29.818 -2.197  1.00 0.00 ? 96  VAL A HG12 5  
ATOM 7130  H HG13 . VAL A 1 96  ? -20.374 -28.613 -2.008  1.00 0.00 ? 96  VAL A HG13 5  
ATOM 7131  H HG21 . VAL A 1 96  ? -21.222 -31.571 -1.312  1.00 0.00 ? 96  VAL A HG21 5  
ATOM 7132  H HG22 . VAL A 1 96  ? -22.047 -30.904 0.117   1.00 0.00 ? 96  VAL A HG22 5  
ATOM 7133  H HG23 . VAL A 1 96  ? -22.035 -29.991 -1.411  1.00 0.00 ? 96  VAL A HG23 5  
ATOM 7134  N N    . SER A 1 97  ? -19.398 -32.976 -1.136  1.00 0.00 ? 97  SER A N    5  
ATOM 7135  C CA   . SER A 1 97  ? -19.028 -33.960 -2.139  1.00 0.00 ? 97  SER A CA   5  
ATOM 7136  C C    . SER A 1 97  ? -19.624 -33.575 -3.495  1.00 0.00 ? 97  SER A C    5  
ATOM 7137  O O    . SER A 1 97  ? -20.843 -33.527 -3.649  1.00 0.00 ? 97  SER A O    5  
ATOM 7138  C CB   . SER A 1 97  ? -19.491 -35.361 -1.734  1.00 0.00 ? 97  SER A CB   5  
ATOM 7139  O OG   . SER A 1 97  ? -20.898 -35.414 -1.512  1.00 0.00 ? 97  SER A OG   5  
ATOM 7140  H H    . SER A 1 97  ? -20.258 -33.160 -0.660  1.00 0.00 ? 97  SER A H    5  
ATOM 7141  H HA   . SER A 1 97  ? -17.939 -33.936 -2.179  1.00 0.00 ? 97  SER A HA   5  
ATOM 7142  H HB2  . SER A 1 97  ? -19.220 -36.072 -2.514  1.00 0.00 ? 97  SER A HB2  5  
ATOM 7143  H HB3  . SER A 1 97  ? -18.970 -35.667 -0.827  1.00 0.00 ? 97  SER A HB3  5  
ATOM 7144  H HG   . SER A 1 97  ? -21.305 -36.138 -2.070  1.00 0.00 ? 97  SER A HG   5  
ATOM 7145  N N    . SER A 1 98  ? -18.736 -33.310 -4.442  1.00 0.00 ? 98  SER A N    5  
ATOM 7146  C CA   . SER A 1 98  ? -19.159 -32.931 -5.779  1.00 0.00 ? 98  SER A CA   5  
ATOM 7147  C C    . SER A 1 98  ? -18.063 -33.270 -6.791  1.00 0.00 ? 98  SER A C    5  
ATOM 7148  O O    . SER A 1 98  ? -16.884 -33.318 -6.442  1.00 0.00 ? 98  SER A O    5  
ATOM 7149  C CB   . SER A 1 98  ? -19.501 -31.441 -5.847  1.00 0.00 ? 98  SER A CB   5  
ATOM 7150  O OG   . SER A 1 98  ? -20.905 -31.220 -5.948  1.00 0.00 ? 98  SER A OG   5  
ATOM 7151  H H    . SER A 1 98  ? -17.746 -33.352 -4.307  1.00 0.00 ? 98  SER A H    5  
ATOM 7152  H HA   . SER A 1 98  ? -20.056 -33.518 -5.975  1.00 0.00 ? 98  SER A HA   5  
ATOM 7153  H HB2  . SER A 1 98  ? -19.118 -30.941 -4.957  1.00 0.00 ? 98  SER A HB2  5  
ATOM 7154  H HB3  . SER A 1 98  ? -19.000 -30.993 -6.705  1.00 0.00 ? 98  SER A HB3  5  
ATOM 7155  H HG   . SER A 1 98  ? -21.402 -31.994 -5.556  1.00 0.00 ? 98  SER A HG   5  
ATOM 7156  N N    . GLY A 1 99  ? -18.490 -33.497 -8.024  1.00 0.00 ? 99  GLY A N    5  
ATOM 7157  C CA   . GLY A 1 99  ? -17.559 -33.831 -9.089  1.00 0.00 ? 99  GLY A CA   5  
ATOM 7158  C C    . GLY A 1 99  ? -18.139 -34.910 -10.006 1.00 0.00 ? 99  GLY A C    5  
ATOM 7159  O O    . GLY A 1 99  ? -19.356 -35.053 -10.110 1.00 0.00 ? 99  GLY A O    5  
ATOM 7160  H H    . GLY A 1 99  ? -19.450 -33.456 -8.300  1.00 0.00 ? 99  GLY A H    5  
ATOM 7161  H HA2  . GLY A 1 99  ? -17.332 -32.938 -9.671  1.00 0.00 ? 99  GLY A HA2  5  
ATOM 7162  H HA3  . GLY A 1 99  ? -16.620 -34.179 -8.660  1.00 0.00 ? 99  GLY A HA3  5  
ATOM 7163  N N    . PRO A 1 100 ? -17.216 -35.661 -10.664 1.00 0.00 ? 100 PRO A N    5  
ATOM 7164  C CA   . PRO A 1 100 ? -17.623 -36.723 -11.569 1.00 0.00 ? 100 PRO A CA   5  
ATOM 7165  C C    . PRO A 1 100 ? -18.115 -37.946 -10.793 1.00 0.00 ? 100 PRO A C    5  
ATOM 7166  O O    . PRO A 1 100 ? -17.329 -38.832 -10.460 1.00 0.00 ? 100 PRO A O    5  
ATOM 7167  C CB   . PRO A 1 100 ? -16.393 -37.012 -12.415 1.00 0.00 ? 100 PRO A CB   5  
ATOM 7168  C CG   . PRO A 1 100 ? -15.215 -36.433 -11.649 1.00 0.00 ? 100 PRO A CG   5  
ATOM 7169  C CD   . PRO A 1 100 ? -15.766 -35.520 -10.566 1.00 0.00 ? 100 PRO A CD   5  
ATOM 7170  H HA   . PRO A 1 100 ? -18.396 -36.425 -12.128 1.00 0.00 ? 100 PRO A HA   5  
ATOM 7171  H HB2  . PRO A 1 100 ? -16.269 -38.083 -12.571 1.00 0.00 ? 100 PRO A HB2  5  
ATOM 7172  H HB3  . PRO A 1 100 ? -16.481 -36.554 -13.400 1.00 0.00 ? 100 PRO A HB3  5  
ATOM 7173  H HG2  . PRO A 1 100 ? -14.617 -37.231 -11.208 1.00 0.00 ? 100 PRO A HG2  5  
ATOM 7174  H HG3  . PRO A 1 100 ? -14.559 -35.877 -12.319 1.00 0.00 ? 100 PRO A HG3  5  
ATOM 7175  H HD2  . PRO A 1 100 ? -15.406 -35.813 -9.580  1.00 0.00 ? 100 PRO A HD2  5  
ATOM 7176  H HD3  . PRO A 1 100 ? -15.457 -34.487 -10.724 1.00 0.00 ? 100 PRO A HD3  5  
ATOM 7177  N N    . SER A 1 101 ? -19.413 -37.955 -10.527 1.00 0.00 ? 101 SER A N    5  
ATOM 7178  C CA   . SER A 1 101 ? -20.019 -39.055 -9.796  1.00 0.00 ? 101 SER A CA   5  
ATOM 7179  C C    . SER A 1 101 ? -20.265 -40.237 -10.737 1.00 0.00 ? 101 SER A C    5  
ATOM 7180  O O    . SER A 1 101 ? -21.215 -40.226 -11.518 1.00 0.00 ? 101 SER A O    5  
ATOM 7181  C CB   . SER A 1 101 ? -21.329 -38.622 -9.135  1.00 0.00 ? 101 SER A CB   5  
ATOM 7182  O OG   . SER A 1 101 ? -21.104 -37.811 -7.985  1.00 0.00 ? 101 SER A OG   5  
ATOM 7183  H H    . SER A 1 101 ? -20.045 -37.231 -10.801 1.00 0.00 ? 101 SER A H    5  
ATOM 7184  H HA   . SER A 1 101 ? -19.296 -39.323 -9.026  1.00 0.00 ? 101 SER A HA   5  
ATOM 7185  H HB2  . SER A 1 101 ? -21.933 -38.070 -9.856  1.00 0.00 ? 101 SER A HB2  5  
ATOM 7186  H HB3  . SER A 1 101 ? -21.901 -39.505 -8.851  1.00 0.00 ? 101 SER A HB3  5  
ATOM 7187  H HG   . SER A 1 101 ? -21.903 -37.235 -7.811  1.00 0.00 ? 101 SER A HG   5  
ATOM 7188  N N    . SER A 1 102 ? -19.391 -41.227 -10.631 1.00 0.00 ? 102 SER A N    5  
ATOM 7189  C CA   . SER A 1 102 ? -19.501 -42.414 -11.463 1.00 0.00 ? 102 SER A CA   5  
ATOM 7190  C C    . SER A 1 102 ? -20.327 -43.482 -10.744 1.00 0.00 ? 102 SER A C    5  
ATOM 7191  O O    . SER A 1 102 ? -19.930 -43.972 -9.688  1.00 0.00 ? 102 SER A O    5  
ATOM 7192  C CB   . SER A 1 102 ? -18.120 -42.964 -11.823 1.00 0.00 ? 102 SER A CB   5  
ATOM 7193  O OG   . SER A 1 102 ? -18.205 -44.109 -12.667 1.00 0.00 ? 102 SER A OG   5  
ATOM 7194  H H    . SER A 1 102 ? -18.621 -41.228 -9.994  1.00 0.00 ? 102 SER A H    5  
ATOM 7195  H HA   . SER A 1 102 ? -20.008 -42.084 -12.370 1.00 0.00 ? 102 SER A HA   5  
ATOM 7196  H HB2  . SER A 1 102 ? -17.540 -42.188 -12.323 1.00 0.00 ? 102 SER A HB2  5  
ATOM 7197  H HB3  . SER A 1 102 ? -17.584 -43.224 -10.911 1.00 0.00 ? 102 SER A HB3  5  
ATOM 7198  H HG   . SER A 1 102 ? -19.074 -44.107 -13.161 1.00 0.00 ? 102 SER A HG   5  
ATOM 7199  N N    . GLY A 1 103 ? -21.461 -43.812 -11.345 1.00 0.00 ? 103 GLY A N    5  
ATOM 7200  C CA   . GLY A 1 103 ? -22.346 -44.813 -10.775 1.00 0.00 ? 103 GLY A CA   5  
ATOM 7201  C C    . GLY A 1 103 ? -22.299 -46.111 -11.584 1.00 0.00 ? 103 GLY A C    5  
ATOM 7202  O O    . GLY A 1 103 ? -22.857 -46.186 -12.677 1.00 0.00 ? 103 GLY A O    5  
ATOM 7203  H H    . GLY A 1 103 ? -21.777 -43.409 -12.204 1.00 0.00 ? 103 GLY A H    5  
ATOM 7204  H HA2  . GLY A 1 103 ? -22.058 -45.013 -9.743  1.00 0.00 ? 103 GLY A HA2  5  
ATOM 7205  H HA3  . GLY A 1 103 ? -23.367 -44.431 -10.753 1.00 0.00 ? 103 GLY A HA3  5  
ATOM 7206  N N    . GLY A 1 1   ? -17.343 -13.975 16.563  1.00 0.00 ? 1   GLY A N    6  
ATOM 7207  C CA   . GLY A 1 1   ? -16.169 -13.754 15.735  1.00 0.00 ? 1   GLY A CA   6  
ATOM 7208  C C    . GLY A 1 1   ? -15.131 -14.857 15.951  1.00 0.00 ? 1   GLY A C    6  
ATOM 7209  O O    . GLY A 1 1   ? -14.809 -15.601 15.026  1.00 0.00 ? 1   GLY A O    6  
ATOM 7210  H H1   . GLY A 1 1   ? -17.168 -13.994 17.547  1.00 0.00 ? 1   GLY A H1   6  
ATOM 7211  H HA2  . GLY A 1 1   ? -16.461 -13.725 14.685  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 7212  H HA3  . GLY A 1 1   ? -15.730 -12.785 15.971  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 7213  N N    . SER A 1 2   ? -14.637 -14.928 17.178  1.00 0.00 ? 2   SER A N    6  
ATOM 7214  C CA   . SER A 1 2   ? -13.642 -15.928 17.527  1.00 0.00 ? 2   SER A CA   6  
ATOM 7215  C C    . SER A 1 2   ? -12.316 -15.611 16.833  1.00 0.00 ? 2   SER A C    6  
ATOM 7216  O O    . SER A 1 2   ? -11.346 -15.226 17.485  1.00 0.00 ? 2   SER A O    6  
ATOM 7217  C CB   . SER A 1 2   ? -14.116 -17.333 17.150  1.00 0.00 ? 2   SER A CB   6  
ATOM 7218  O OG   . SER A 1 2   ? -15.417 -17.612 17.660  1.00 0.00 ? 2   SER A OG   6  
ATOM 7219  H H    . SER A 1 2   ? -14.905 -14.320 17.925  1.00 0.00 ? 2   SER A H    6  
ATOM 7220  H HA   . SER A 1 2   ? -13.533 -15.861 18.610  1.00 0.00 ? 2   SER A HA   6  
ATOM 7221  H HB2  . SER A 1 2   ? -14.124 -17.434 16.064  1.00 0.00 ? 2   SER A HB2  6  
ATOM 7222  H HB3  . SER A 1 2   ? -13.410 -18.069 17.533  1.00 0.00 ? 2   SER A HB3  6  
ATOM 7223  H HG   . SER A 1 2   ? -15.914 -16.759 17.816  1.00 0.00 ? 2   SER A HG   6  
ATOM 7224  N N    . SER A 1 3   ? -12.316 -15.785 15.520  1.00 0.00 ? 3   SER A N    6  
ATOM 7225  C CA   . SER A 1 3   ? -11.125 -15.523 14.730  1.00 0.00 ? 3   SER A CA   6  
ATOM 7226  C C    . SER A 1 3   ? -11.265 -14.186 14.000  1.00 0.00 ? 3   SER A C    6  
ATOM 7227  O O    . SER A 1 3   ? -12.176 -14.008 13.192  1.00 0.00 ? 3   SER A O    6  
ATOM 7228  C CB   . SER A 1 3   ? -10.868 -16.650 13.728  1.00 0.00 ? 3   SER A CB   6  
ATOM 7229  O OG   . SER A 1 3   ? -11.615 -16.477 12.527  1.00 0.00 ? 3   SER A OG   6  
ATOM 7230  H H    . SER A 1 3   ? -13.109 -16.099 14.997  1.00 0.00 ? 3   SER A H    6  
ATOM 7231  H HA   . SER A 1 3   ? -10.306 -15.482 15.448  1.00 0.00 ? 3   SER A HA   6  
ATOM 7232  H HB2  . SER A 1 3   ? -9.805  -16.691 13.492  1.00 0.00 ? 3   SER A HB2  6  
ATOM 7233  H HB3  . SER A 1 3   ? -11.130 -17.606 14.183  1.00 0.00 ? 3   SER A HB3  6  
ATOM 7234  H HG   . SER A 1 3   ? -11.727 -17.356 12.063  1.00 0.00 ? 3   SER A HG   6  
ATOM 7235  N N    . GLY A 1 4   ? -10.349 -13.280 14.309  1.00 0.00 ? 4   GLY A N    6  
ATOM 7236  C CA   . GLY A 1 4   ? -10.360 -11.964 13.693  1.00 0.00 ? 4   GLY A CA   6  
ATOM 7237  C C    . GLY A 1 4   ? -9.966  -10.883 14.701  1.00 0.00 ? 4   GLY A C    6  
ATOM 7238  O O    . GLY A 1 4   ? -10.782 -10.466 15.521  1.00 0.00 ? 4   GLY A O    6  
ATOM 7239  H H    . GLY A 1 4   ? -9.612  -13.432 14.967  1.00 0.00 ? 4   GLY A H    6  
ATOM 7240  H HA2  . GLY A 1 4   ? -9.670  -11.949 12.849  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 7241  H HA3  . GLY A 1 4   ? -11.353 -11.752 13.296  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 7242  N N    . SER A 1 5   ? -8.714  -10.459 14.607  1.00 0.00 ? 5   SER A N    6  
ATOM 7243  C CA   . SER A 1 5   ? -8.201  -9.434  15.500  1.00 0.00 ? 5   SER A CA   6  
ATOM 7244  C C    . SER A 1 5   ? -7.182  -8.561  14.766  1.00 0.00 ? 5   SER A C    6  
ATOM 7245  O O    . SER A 1 5   ? -6.262  -9.075  14.132  1.00 0.00 ? 5   SER A O    6  
ATOM 7246  C CB   . SER A 1 5   ? -7.567  -10.057 16.746  1.00 0.00 ? 5   SER A CB   6  
ATOM 7247  O OG   . SER A 1 5   ? -6.899  -9.085  17.547  1.00 0.00 ? 5   SER A OG   6  
ATOM 7248  H H    . SER A 1 5   ? -8.056  -10.803 13.937  1.00 0.00 ? 5   SER A H    6  
ATOM 7249  H HA   . SER A 1 5   ? -9.071  -8.845  15.792  1.00 0.00 ? 5   SER A HA   6  
ATOM 7250  H HB2  . SER A 1 5   ? -8.339  -10.547 17.339  1.00 0.00 ? 5   SER A HB2  6  
ATOM 7251  H HB3  . SER A 1 5   ? -6.858  -10.828 16.445  1.00 0.00 ? 5   SER A HB3  6  
ATOM 7252  H HG   . SER A 1 5   ? -7.281  -8.178  17.374  1.00 0.00 ? 5   SER A HG   6  
ATOM 7253  N N    . SER A 1 6   ? -7.381  -7.256  14.875  1.00 0.00 ? 6   SER A N    6  
ATOM 7254  C CA   . SER A 1 6   ? -6.491  -6.306  14.229  1.00 0.00 ? 6   SER A CA   6  
ATOM 7255  C C    . SER A 1 6   ? -5.037  -6.632  14.577  1.00 0.00 ? 6   SER A C    6  
ATOM 7256  O O    . SER A 1 6   ? -4.773  -7.509  15.398  1.00 0.00 ? 6   SER A O    6  
ATOM 7257  C CB   . SER A 1 6   ? -6.825  -4.871  14.639  1.00 0.00 ? 6   SER A CB   6  
ATOM 7258  O OG   . SER A 1 6   ? -6.398  -4.581  15.967  1.00 0.00 ? 6   SER A OG   6  
ATOM 7259  H H    . SER A 1 6   ? -8.132  -6.846  15.393  1.00 0.00 ? 6   SER A H    6  
ATOM 7260  H HA   . SER A 1 6   ? -6.665  -6.429  13.160  1.00 0.00 ? 6   SER A HA   6  
ATOM 7261  H HB2  . SER A 1 6   ? -6.350  -4.176  13.946  1.00 0.00 ? 6   SER A HB2  6  
ATOM 7262  H HB3  . SER A 1 6   ? -7.901  -4.713  14.561  1.00 0.00 ? 6   SER A HB3  6  
ATOM 7263  H HG   . SER A 1 6   ? -6.417  -3.594  16.125  1.00 0.00 ? 6   SER A HG   6  
ATOM 7264  N N    . GLY A 1 7   ? -4.132  -5.909  13.934  1.00 0.00 ? 7   GLY A N    6  
ATOM 7265  C CA   . GLY A 1 7   ? -2.711  -6.110  14.165  1.00 0.00 ? 7   GLY A CA   6  
ATOM 7266  C C    . GLY A 1 7   ? -1.874  -5.271  13.197  1.00 0.00 ? 7   GLY A C    6  
ATOM 7267  O O    . GLY A 1 7   ? -2.204  -5.165  12.017  1.00 0.00 ? 7   GLY A O    6  
ATOM 7268  H H    . GLY A 1 7   ? -4.355  -5.198  13.267  1.00 0.00 ? 7   GLY A H    6  
ATOM 7269  H HA2  . GLY A 1 7   ? -2.464  -5.842  15.192  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 7270  H HA3  . GLY A 1 7   ? -2.465  -7.165  14.043  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 7271  N N    . SER A 1 8   ? -0.807  -4.697  13.733  1.00 0.00 ? 8   SER A N    6  
ATOM 7272  C CA   . SER A 1 8   ? 0.079   -3.870  12.932  1.00 0.00 ? 8   SER A CA   6  
ATOM 7273  C C    . SER A 1 8   ? 1.318   -4.672  12.527  1.00 0.00 ? 8   SER A C    6  
ATOM 7274  O O    . SER A 1 8   ? 1.763   -5.549  13.265  1.00 0.00 ? 8   SER A O    6  
ATOM 7275  C CB   . SER A 1 8   ? 0.490   -2.607  13.691  1.00 0.00 ? 8   SER A CB   6  
ATOM 7276  O OG   . SER A 1 8   ? 0.833   -2.886  15.046  1.00 0.00 ? 8   SER A OG   6  
ATOM 7277  H H    . SER A 1 8   ? -0.547  -4.788  14.694  1.00 0.00 ? 8   SER A H    6  
ATOM 7278  H HA   . SER A 1 8   ? -0.501  -3.592  12.052  1.00 0.00 ? 8   SER A HA   6  
ATOM 7279  H HB2  . SER A 1 8   ? 1.340   -2.143  13.190  1.00 0.00 ? 8   SER A HB2  6  
ATOM 7280  H HB3  . SER A 1 8   ? -0.327  -1.886  13.664  1.00 0.00 ? 8   SER A HB3  6  
ATOM 7281  H HG   . SER A 1 8   ? 1.156   -3.828  15.130  1.00 0.00 ? 8   SER A HG   6  
ATOM 7282  N N    . VAL A 1 9   ? 1.839   -4.343  11.354  1.00 0.00 ? 9   VAL A N    6  
ATOM 7283  C CA   . VAL A 1 9   ? 3.017   -5.021  10.841  1.00 0.00 ? 9   VAL A CA   6  
ATOM 7284  C C    . VAL A 1 9   ? 4.158   -4.012  10.695  1.00 0.00 ? 9   VAL A C    6  
ATOM 7285  O O    . VAL A 1 9   ? 3.930   -2.804  10.719  1.00 0.00 ? 9   VAL A O    6  
ATOM 7286  C CB   . VAL A 1 9   ? 2.681   -5.737  9.532   1.00 0.00 ? 9   VAL A CB   6  
ATOM 7287  C CG1  . VAL A 1 9   ? 1.820   -4.851  8.629   1.00 0.00 ? 9   VAL A CG1  6  
ATOM 7288  C CG2  . VAL A 1 9   ? 3.953   -6.185  8.809   1.00 0.00 ? 9   VAL A CG2  6  
ATOM 7289  H H    . VAL A 1 9   ? 1.471   -3.628  10.759  1.00 0.00 ? 9   VAL A H    6  
ATOM 7290  H HA   . VAL A 1 9   ? 3.307   -5.775  11.573  1.00 0.00 ? 9   VAL A HA   6  
ATOM 7291  H HB   . VAL A 1 9   ? 2.103   -6.628  9.776   1.00 0.00 ? 9   VAL A HB   6  
ATOM 7292  H HG11 . VAL A 1 9   ? 2.073   -3.805  8.798   1.00 0.00 ? 9   VAL A HG11 6  
ATOM 7293  H HG12 . VAL A 1 9   ? 2.006   -5.106  7.585   1.00 0.00 ? 9   VAL A HG12 6  
ATOM 7294  H HG13 . VAL A 1 9   ? 0.767   -5.012  8.860   1.00 0.00 ? 9   VAL A HG13 6  
ATOM 7295  H HG21 . VAL A 1 9   ? 4.539   -6.825  9.469   1.00 0.00 ? 9   VAL A HG21 6  
ATOM 7296  H HG22 . VAL A 1 9   ? 3.684   -6.739  7.910   1.00 0.00 ? 9   VAL A HG22 6  
ATOM 7297  H HG23 . VAL A 1 9   ? 4.542   -5.310  8.534   1.00 0.00 ? 9   VAL A HG23 6  
ATOM 7298  N N    . SER A 1 10  ? 5.362   -4.546  10.547  1.00 0.00 ? 10  SER A N    6  
ATOM 7299  C CA   . SER A 1 10  ? 6.539   -3.708  10.397  1.00 0.00 ? 10  SER A CA   6  
ATOM 7300  C C    . SER A 1 10  ? 7.428   -4.250  9.276   1.00 0.00 ? 10  SER A C    6  
ATOM 7301  O O    . SER A 1 10  ? 7.800   -5.422  9.285   1.00 0.00 ? 10  SER A O    6  
ATOM 7302  C CB   . SER A 1 10  ? 7.327   -3.625  11.706  1.00 0.00 ? 10  SER A CB   6  
ATOM 7303  O OG   . SER A 1 10  ? 8.589   -2.987  11.530  1.00 0.00 ? 10  SER A OG   6  
ATOM 7304  H H    . SER A 1 10  ? 5.539   -5.530  10.528  1.00 0.00 ? 10  SER A H    6  
ATOM 7305  H HA   . SER A 1 10  ? 6.158   -2.719  10.140  1.00 0.00 ? 10  SER A HA   6  
ATOM 7306  H HB2  . SER A 1 10  ? 6.744   -3.076  12.446  1.00 0.00 ? 10  SER A HB2  6  
ATOM 7307  H HB3  . SER A 1 10  ? 7.480   -4.629  12.101  1.00 0.00 ? 10  SER A HB3  6  
ATOM 7308  H HG   . SER A 1 10  ? 8.578   -2.431  10.700  1.00 0.00 ? 10  SER A HG   6  
ATOM 7309  N N    . LEU A 1 11  ? 7.743   -3.370  8.336   1.00 0.00 ? 11  LEU A N    6  
ATOM 7310  C CA   . LEU A 1 11  ? 8.582   -3.746  7.211   1.00 0.00 ? 11  LEU A CA   6  
ATOM 7311  C C    . LEU A 1 11  ? 9.923   -3.017  7.314   1.00 0.00 ? 11  LEU A C    6  
ATOM 7312  O O    . LEU A 1 11  ? 9.998   -1.923  7.872   1.00 0.00 ? 11  LEU A O    6  
ATOM 7313  C CB   . LEU A 1 11  ? 7.848   -3.499  5.891   1.00 0.00 ? 11  LEU A CB   6  
ATOM 7314  C CG   . LEU A 1 11  ? 6.574   -4.316  5.668   1.00 0.00 ? 11  LEU A CG   6  
ATOM 7315  C CD1  . LEU A 1 11  ? 6.137   -4.262  4.203   1.00 0.00 ? 11  LEU A CD1  6  
ATOM 7316  C CD2  . LEU A 1 11  ? 6.752   -5.754  6.161   1.00 0.00 ? 11  LEU A CD2  6  
ATOM 7317  H H    . LEU A 1 11  ? 7.437   -2.418  8.336   1.00 0.00 ? 11  LEU A H    6  
ATOM 7318  H HA   . LEU A 1 11  ? 8.764   -4.818  7.283   1.00 0.00 ? 11  LEU A HA   6  
ATOM 7319  H HB2  . LEU A 1 11  ? 7.592   -2.441  5.832   1.00 0.00 ? 11  LEU A HB2  6  
ATOM 7320  H HB3  . LEU A 1 11  ? 8.537   -3.706  5.071   1.00 0.00 ? 11  LEU A HB3  6  
ATOM 7321  H HG   . LEU A 1 11  ? 5.775   -3.870  6.260   1.00 0.00 ? 11  LEU A HG   6  
ATOM 7322  H HD11 . LEU A 1 11  ? 6.613   -5.073  3.652   1.00 0.00 ? 11  LEU A HD11 6  
ATOM 7323  H HD12 . LEU A 1 11  ? 5.054   -4.369  4.143   1.00 0.00 ? 11  LEU A HD12 6  
ATOM 7324  H HD13 . LEU A 1 11  ? 6.432   -3.306  3.771   1.00 0.00 ? 11  LEU A HD13 6  
ATOM 7325  H HD21 . LEU A 1 11  ? 6.864   -5.756  7.245   1.00 0.00 ? 11  LEU A HD21 6  
ATOM 7326  H HD22 . LEU A 1 11  ? 5.878   -6.344  5.884   1.00 0.00 ? 11  LEU A HD22 6  
ATOM 7327  H HD23 . LEU A 1 11  ? 7.642   -6.187  5.703   1.00 0.00 ? 11  LEU A HD23 6  
ATOM 7328  N N    . VAL A 1 12  ? 10.949  -3.654  6.768   1.00 0.00 ? 12  VAL A N    6  
ATOM 7329  C CA   . VAL A 1 12  ? 12.284  -3.080  6.792   1.00 0.00 ? 12  VAL A CA   6  
ATOM 7330  C C    . VAL A 1 12  ? 12.747  -2.817  5.358   1.00 0.00 ? 12  VAL A C    6  
ATOM 7331  O O    . VAL A 1 12  ? 13.078  -3.750  4.628   1.00 0.00 ? 12  VAL A O    6  
ATOM 7332  C CB   . VAL A 1 12  ? 13.233  -3.995  7.569   1.00 0.00 ? 12  VAL A CB   6  
ATOM 7333  C CG1  . VAL A 1 12  ? 13.242  -5.406  6.976   1.00 0.00 ? 12  VAL A CG1  6  
ATOM 7334  C CG2  . VAL A 1 12  ? 14.646  -3.410  7.612   1.00 0.00 ? 12  VAL A CG2  6  
ATOM 7335  H H    . VAL A 1 12  ? 10.880  -4.543  6.317   1.00 0.00 ? 12  VAL A H    6  
ATOM 7336  H HA   . VAL A 1 12  ? 12.224  -2.129  7.322   1.00 0.00 ? 12  VAL A HA   6  
ATOM 7337  H HB   . VAL A 1 12  ? 12.868  -4.065  8.593   1.00 0.00 ? 12  VAL A HB   6  
ATOM 7338  H HG11 . VAL A 1 12  ? 12.735  -5.397  6.011   1.00 0.00 ? 12  VAL A HG11 6  
ATOM 7339  H HG12 . VAL A 1 12  ? 14.271  -5.737  6.842   1.00 0.00 ? 12  VAL A HG12 6  
ATOM 7340  H HG13 . VAL A 1 12  ? 12.725  -6.087  7.652   1.00 0.00 ? 12  VAL A HG13 6  
ATOM 7341  H HG21 . VAL A 1 12  ? 15.323  -4.053  7.049   1.00 0.00 ? 12  VAL A HG21 6  
ATOM 7342  H HG22 . VAL A 1 12  ? 14.640  -2.413  7.170   1.00 0.00 ? 12  VAL A HG22 6  
ATOM 7343  H HG23 . VAL A 1 12  ? 14.982  -3.346  8.647   1.00 0.00 ? 12  VAL A HG23 6  
ATOM 7344  N N    . GLY A 1 13  ? 12.756  -1.542  4.997   1.00 0.00 ? 13  GLY A N    6  
ATOM 7345  C CA   . GLY A 1 13  ? 13.173  -1.144  3.664   1.00 0.00 ? 13  GLY A CA   6  
ATOM 7346  C C    . GLY A 1 13  ? 13.165  0.379   3.518   1.00 0.00 ? 13  GLY A C    6  
ATOM 7347  O O    . GLY A 1 13  ? 12.460  1.072   4.250   1.00 0.00 ? 13  GLY A O    6  
ATOM 7348  H H    . GLY A 1 13  ? 12.485  -0.789  5.598   1.00 0.00 ? 13  GLY A H    6  
ATOM 7349  H HA2  . GLY A 1 13  ? 14.173  -1.527  3.462   1.00 0.00 ? 13  GLY A HA2  6  
ATOM 7350  H HA3  . GLY A 1 13  ? 12.507  -1.588  2.923   1.00 0.00 ? 13  GLY A HA3  6  
ATOM 7351  N N    . PRO A 1 14  ? 13.978  0.867   2.543   1.00 0.00 ? 14  PRO A N    6  
ATOM 7352  C CA   . PRO A 1 14  ? 14.071  2.295   2.292   1.00 0.00 ? 14  PRO A CA   6  
ATOM 7353  C C    . PRO A 1 14  ? 12.828  2.805   1.559   1.00 0.00 ? 14  PRO A C    6  
ATOM 7354  O O    . PRO A 1 14  ? 12.672  4.008   1.357   1.00 0.00 ? 14  PRO A O    6  
ATOM 7355  C CB   . PRO A 1 14  ? 15.348  2.471   1.487   1.00 0.00 ? 14  PRO A CB   6  
ATOM 7356  C CG   . PRO A 1 14  ? 15.676  1.098   0.921   1.00 0.00 ? 14  PRO A CG   6  
ATOM 7357  C CD   . PRO A 1 14  ? 14.826  0.075   1.657   1.00 0.00 ? 14  PRO A CD   6  
ATOM 7358  H HA   . PRO A 1 14  ? 14.105  2.798   3.155   1.00 0.00 ? 14  PRO A HA   6  
ATOM 7359  H HB2  . PRO A 1 14  ? 15.210  3.199   0.688   1.00 0.00 ? 14  PRO A HB2  6  
ATOM 7360  H HB3  . PRO A 1 14  ? 16.159  2.838   2.116   1.00 0.00 ? 14  PRO A HB3  6  
ATOM 7361  H HG2  . PRO A 1 14  ? 15.470  1.067   -0.149  1.00 0.00 ? 14  PRO A HG2  6  
ATOM 7362  H HG3  . PRO A 1 14  ? 16.736  0.877   1.048   1.00 0.00 ? 14  PRO A HG3  6  
ATOM 7363  H HD2  . PRO A 1 14  ? 14.230  -0.517  0.963   1.00 0.00 ? 14  PRO A HD2  6  
ATOM 7364  H HD3  . PRO A 1 14  ? 15.446  -0.622  2.221   1.00 0.00 ? 14  PRO A HD3  6  
ATOM 7365  N N    . ALA A 1 15  ? 11.975  1.864   1.182   1.00 0.00 ? 15  ALA A N    6  
ATOM 7366  C CA   . ALA A 1 15  ? 10.750  2.203   0.477   1.00 0.00 ? 15  ALA A CA   6  
ATOM 7367  C C    . ALA A 1 15  ? 10.203  0.954   -0.216  1.00 0.00 ? 15  ALA A C    6  
ATOM 7368  O O    . ALA A 1 15  ? 9.027   0.625   -0.073  1.00 0.00 ? 15  ALA A O    6  
ATOM 7369  C CB   . ALA A 1 15  ? 11.027  3.342   -0.508  1.00 0.00 ? 15  ALA A CB   6  
ATOM 7370  H H    . ALA A 1 15  ? 12.109  0.888   1.351   1.00 0.00 ? 15  ALA A H    6  
ATOM 7371  H HA   . ALA A 1 15  ? 10.026  2.546   1.215   1.00 0.00 ? 15  ALA A HA   6  
ATOM 7372  H HB1  . ALA A 1 15  ? 10.647  4.277   -0.097  1.00 0.00 ? 15  ALA A HB1  6  
ATOM 7373  H HB2  . ALA A 1 15  ? 12.101  3.427   -0.672  1.00 0.00 ? 15  ALA A HB2  6  
ATOM 7374  H HB3  . ALA A 1 15  ? 10.529  3.132   -1.454  1.00 0.00 ? 15  ALA A HB3  6  
ATOM 7375  N N    . PRO A 1 16  ? 11.107  0.273   -0.971  1.00 0.00 ? 16  PRO A N    6  
ATOM 7376  C CA   . PRO A 1 16  ? 10.727  -0.933  -1.686  1.00 0.00 ? 16  PRO A CA   6  
ATOM 7377  C C    . PRO A 1 16  ? 10.584  -2.117  -0.728  1.00 0.00 ? 16  PRO A C    6  
ATOM 7378  O O    . PRO A 1 16  ? 11.473  -2.963  -0.643  1.00 0.00 ? 16  PRO A O    6  
ATOM 7379  C CB   . PRO A 1 16  ? 11.819  -1.137  -2.723  1.00 0.00 ? 16  PRO A CB   6  
ATOM 7380  C CG   . PRO A 1 16  ? 13.003  -0.310  -2.249  1.00 0.00 ? 16  PRO A CG   6  
ATOM 7381  C CD   . PRO A 1 16  ? 12.509  0.632   -1.163  1.00 0.00 ? 16  PRO A CD   6  
ATOM 7382  H HA   . PRO A 1 16  ? 9.829   -0.816  -2.112  1.00 0.00 ? 16  PRO A HA   6  
ATOM 7383  H HB2  . PRO A 1 16  ? 12.087  -2.190  -2.807  1.00 0.00 ? 16  PRO A HB2  6  
ATOM 7384  H HB3  . PRO A 1 16  ? 11.487  -0.813  -3.709  1.00 0.00 ? 16  PRO A HB3  6  
ATOM 7385  H HG2  . PRO A 1 16  ? 13.791  -0.957  -1.862  1.00 0.00 ? 16  PRO A HG2  6  
ATOM 7386  H HG3  . PRO A 1 16  ? 13.432  0.254   -3.077  1.00 0.00 ? 16  PRO A HG3  6  
ATOM 7387  H HD2  . PRO A 1 16  ? 13.079  0.510   -0.242  1.00 0.00 ? 16  PRO A HD2  6  
ATOM 7388  H HD3  . PRO A 1 16  ? 12.612  1.674   -1.466  1.00 0.00 ? 16  PRO A HD3  6  
ATOM 7389  N N    . TRP A 1 17  ? 9.458   -2.140  -0.030  1.00 0.00 ? 17  TRP A N    6  
ATOM 7390  C CA   . TRP A 1 17  ? 9.188   -3.206  0.920   1.00 0.00 ? 17  TRP A CA   6  
ATOM 7391  C C    . TRP A 1 17  ? 8.886   -4.480  0.127   1.00 0.00 ? 17  TRP A C    6  
ATOM 7392  O O    . TRP A 1 17  ? 9.045   -5.586  0.640   1.00 0.00 ? 17  TRP A O    6  
ATOM 7393  C CB   . TRP A 1 17  ? 8.059   -2.815  1.876   1.00 0.00 ? 17  TRP A CB   6  
ATOM 7394  C CG   . TRP A 1 17  ? 7.996   -1.319  2.186   1.00 0.00 ? 17  TRP A CG   6  
ATOM 7395  C CD1  . TRP A 1 17  ? 7.334   -0.364  1.518   1.00 0.00 ? 17  TRP A CD1  6  
ATOM 7396  C CD2  . TRP A 1 17  ? 8.650   -0.639  3.279   1.00 0.00 ? 17  TRP A CD2  6  
ATOM 7397  N NE1  . TRP A 1 17  ? 7.513   0.876   2.096   1.00 0.00 ? 17  TRP A NE1  6  
ATOM 7398  C CE2  . TRP A 1 17  ? 8.339   0.703   3.201   1.00 0.00 ? 17  TRP A CE2  6  
ATOM 7399  C CE3  . TRP A 1 17  ? 9.477   -1.141  4.298   1.00 0.00 ? 17  TRP A CE3  6  
ATOM 7400  C CZ2  . TRP A 1 17  ? 8.812   1.654   4.114   1.00 0.00 ? 17  TRP A CZ2  6  
ATOM 7401  C CZ3  . TRP A 1 17  ? 9.942   -0.178  5.202   1.00 0.00 ? 17  TRP A CZ3  6  
ATOM 7402  C CH2  . TRP A 1 17  ? 9.638   1.176   5.138   1.00 0.00 ? 17  TRP A CH2  6  
ATOM 7403  H H    . TRP A 1 17  ? 8.740   -1.448  -0.104  1.00 0.00 ? 17  TRP A H    6  
ATOM 7404  H HA   . TRP A 1 17  ? 10.082  -3.348  1.526   1.00 0.00 ? 17  TRP A HA   6  
ATOM 7405  H HB2  . TRP A 1 17  ? 7.107   -3.127  1.445   1.00 0.00 ? 17  TRP A HB2  6  
ATOM 7406  H HB3  . TRP A 1 17  ? 8.181   -3.365  2.810   1.00 0.00 ? 17  TRP A HB3  6  
ATOM 7407  H HD1  . TRP A 1 17  ? 6.731   -0.545  0.628   1.00 0.00 ? 17  TRP A HD1  6  
ATOM 7408  H HE1  . TRP A 1 17  ? 7.086   1.817   1.751   1.00 0.00 ? 17  TRP A HE1  6  
ATOM 7409  H HE3  . TRP A 1 17  ? 9.738   -2.196  4.381   1.00 0.00 ? 17  TRP A HE3  6  
ATOM 7410  H HZ2  . TRP A 1 17  ? 8.551   2.709   4.031   1.00 0.00 ? 17  TRP A HZ2  6  
ATOM 7411  H HZ3  . TRP A 1 17  ? 10.588  -0.515  6.013   1.00 0.00 ? 17  TRP A HZ3  6  
ATOM 7412  H HH2  . TRP A 1 17  ? 10.041  1.864   5.882   1.00 0.00 ? 17  TRP A HH2  6  
ATOM 7413  N N    . GLY A 1 18  ? 8.455   -4.280  -1.110  1.00 0.00 ? 18  GLY A N    6  
ATOM 7414  C CA   . GLY A 1 18  ? 8.130   -5.399  -1.978  1.00 0.00 ? 18  GLY A CA   6  
ATOM 7415  C C    . GLY A 1 18  ? 6.632   -5.434  -2.290  1.00 0.00 ? 18  GLY A C    6  
ATOM 7416  O O    . GLY A 1 18  ? 6.209   -6.076  -3.249  1.00 0.00 ? 18  GLY A O    6  
ATOM 7417  H H    . GLY A 1 18  ? 8.329   -3.377  -1.519  1.00 0.00 ? 18  GLY A H    6  
ATOM 7418  H HA2  . GLY A 1 18  ? 8.696   -5.321  -2.906  1.00 0.00 ? 18  GLY A HA2  6  
ATOM 7419  H HA3  . GLY A 1 18  ? 8.427   -6.333  -1.501  1.00 0.00 ? 18  GLY A HA3  6  
ATOM 7420  N N    . PHE A 1 19  ? 5.872   -4.735  -1.460  1.00 0.00 ? 19  PHE A N    6  
ATOM 7421  C CA   . PHE A 1 19  ? 4.430   -4.677  -1.635  1.00 0.00 ? 19  PHE A CA   6  
ATOM 7422  C C    . PHE A 1 19  ? 4.001   -3.324  -2.206  1.00 0.00 ? 19  PHE A C    6  
ATOM 7423  O O    . PHE A 1 19  ? 4.730   -2.340  -2.095  1.00 0.00 ? 19  PHE A O    6  
ATOM 7424  C CB   . PHE A 1 19  ? 3.804   -4.855  -0.250  1.00 0.00 ? 19  PHE A CB   6  
ATOM 7425  C CG   . PHE A 1 19  ? 3.679   -3.555  0.548   1.00 0.00 ? 19  PHE A CG   6  
ATOM 7426  C CD1  . PHE A 1 19  ? 2.736   -2.637  0.207   1.00 0.00 ? 19  PHE A CD1  6  
ATOM 7427  C CD2  . PHE A 1 19  ? 4.511   -3.319  1.597   1.00 0.00 ? 19  PHE A CD2  6  
ATOM 7428  C CE1  . PHE A 1 19  ? 2.619   -1.431  0.948   1.00 0.00 ? 19  PHE A CE1  6  
ATOM 7429  C CE2  . PHE A 1 19  ? 4.394   -2.113  2.338   1.00 0.00 ? 19  PHE A CE2  6  
ATOM 7430  C CZ   . PHE A 1 19  ? 3.451   -1.194  1.997   1.00 0.00 ? 19  PHE A CZ   6  
ATOM 7431  H H    . PHE A 1 19  ? 6.224   -4.215  -0.682  1.00 0.00 ? 19  PHE A H    6  
ATOM 7432  H HA   . PHE A 1 19  ? 4.157   -5.468  -2.334  1.00 0.00 ? 19  PHE A HA   6  
ATOM 7433  H HB2  . PHE A 1 19  ? 2.814   -5.296  -0.364  1.00 0.00 ? 19  PHE A HB2  6  
ATOM 7434  H HB3  . PHE A 1 19  ? 4.405   -5.563  0.321   1.00 0.00 ? 19  PHE A HB3  6  
ATOM 7435  H HD1  . PHE A 1 19  ? 2.069   -2.826  -0.634  1.00 0.00 ? 19  PHE A HD1  6  
ATOM 7436  H HD2  . PHE A 1 19  ? 5.267   -4.055  1.870   1.00 0.00 ? 19  PHE A HD2  6  
ATOM 7437  H HE1  . PHE A 1 19  ? 1.863   -0.695  0.675   1.00 0.00 ? 19  PHE A HE1  6  
ATOM 7438  H HE2  . PHE A 1 19  ? 5.061   -1.923  3.179   1.00 0.00 ? 19  PHE A HE2  6  
ATOM 7439  H HZ   . PHE A 1 19  ? 3.362   -0.269  2.566   1.00 0.00 ? 19  PHE A HZ   6  
ATOM 7440  N N    . ARG A 1 20  ? 2.819   -3.319  -2.805  1.00 0.00 ? 20  ARG A N    6  
ATOM 7441  C CA   . ARG A 1 20  ? 2.283   -2.103  -3.393  1.00 0.00 ? 20  ARG A CA   6  
ATOM 7442  C C    . ARG A 1 20  ? 0.882   -1.822  -2.847  1.00 0.00 ? 20  ARG A C    6  
ATOM 7443  O O    . ARG A 1 20  ? 0.301   -2.658  -2.156  1.00 0.00 ? 20  ARG A O    6  
ATOM 7444  C CB   . ARG A 1 20  ? 2.217   -2.212  -4.918  1.00 0.00 ? 20  ARG A CB   6  
ATOM 7445  C CG   . ARG A 1 20  ? 3.567   -1.871  -5.551  1.00 0.00 ? 20  ARG A CG   6  
ATOM 7446  C CD   . ARG A 1 20  ? 3.432   -0.711  -6.540  1.00 0.00 ? 20  ARG A CD   6  
ATOM 7447  N NE   . ARG A 1 20  ? 4.139   0.481   -6.021  1.00 0.00 ? 20  ARG A NE   6  
ATOM 7448  C CZ   . ARG A 1 20  ? 4.330   1.606   -6.724  1.00 0.00 ? 20  ARG A CZ   6  
ATOM 7449  N NH1  . ARG A 1 20  ? 3.868   1.698   -7.979  1.00 0.00 ? 20  ARG A NH1  6  
ATOM 7450  N NH2  . ARG A 1 20  ? 4.983   2.637   -6.173  1.00 0.00 ? 20  ARG A NH2  6  
ATOM 7451  H H    . ARG A 1 20  ? 2.232   -4.124  -2.891  1.00 0.00 ? 20  ARG A H    6  
ATOM 7452  H HA   . ARG A 1 20  ? 2.983   -1.320  -3.100  1.00 0.00 ? 20  ARG A HA   6  
ATOM 7453  H HB2  . ARG A 1 20  ? 1.923   -3.223  -5.201  1.00 0.00 ? 20  ARG A HB2  6  
ATOM 7454  H HB3  . ARG A 1 20  ? 1.451   -1.539  -5.301  1.00 0.00 ? 20  ARG A HB3  6  
ATOM 7455  H HG2  . ARG A 1 20  ? 4.282   -1.608  -4.772  1.00 0.00 ? 20  ARG A HG2  6  
ATOM 7456  H HG3  . ARG A 1 20  ? 3.964   -2.747  -6.065  1.00 0.00 ? 20  ARG A HG3  6  
ATOM 7457  H HD2  . ARG A 1 20  ? 3.845   -0.997  -7.507  1.00 0.00 ? 20  ARG A HD2  6  
ATOM 7458  H HD3  . ARG A 1 20  ? 2.379   -0.479  -6.699  1.00 0.00 ? 20  ARG A HD3  6  
ATOM 7459  H HE   . ARG A 1 20  ? 4.497   0.445   -5.088  1.00 0.00 ? 20  ARG A HE   6  
ATOM 7460  H HH11 . ARG A 1 20  ? 3.381   0.928   -8.390  1.00 0.00 ? 20  ARG A HH11 6  
ATOM 7461  H HH12 . ARG A 1 20  ? 4.011   2.538   -8.503  1.00 0.00 ? 20  ARG A HH12 6  
ATOM 7462  H HH21 . ARG A 1 20  ? 5.328   2.568   -5.236  1.00 0.00 ? 20  ARG A HH21 6  
ATOM 7463  H HH22 . ARG A 1 20  ? 5.126   3.477   -6.697  1.00 0.00 ? 20  ARG A HH22 6  
ATOM 7464  N N    . LEU A 1 21  ? 0.379   -0.642  -3.178  1.00 0.00 ? 21  LEU A N    6  
ATOM 7465  C CA   . LEU A 1 21  ? -0.944  -0.240  -2.730  1.00 0.00 ? 21  LEU A CA   6  
ATOM 7466  C C    . LEU A 1 21  ? -1.852  -0.043  -3.946  1.00 0.00 ? 21  LEU A C    6  
ATOM 7467  O O    . LEU A 1 21  ? -1.369  0.119   -5.065  1.00 0.00 ? 21  LEU A O    6  
ATOM 7468  C CB   . LEU A 1 21  ? -0.852  0.991   -1.826  1.00 0.00 ? 21  LEU A CB   6  
ATOM 7469  C CG   . LEU A 1 21  ? -0.191  0.774   -0.463  1.00 0.00 ? 21  LEU A CG   6  
ATOM 7470  C CD1  . LEU A 1 21  ? -0.222  2.056   0.372   1.00 0.00 ? 21  LEU A CD1  6  
ATOM 7471  C CD2  . LEU A 1 21  ? -0.829  -0.405  0.274   1.00 0.00 ? 21  LEU A CD2  6  
ATOM 7472  H H    . LEU A 1 21  ? 0.857   0.032   -3.741  1.00 0.00 ? 21  LEU A H    6  
ATOM 7473  H HA   . LEU A 1 21  ? -1.346  -1.054  -2.127  1.00 0.00 ? 21  LEU A HA   6  
ATOM 7474  H HB2  . LEU A 1 21  ? -0.299  1.766   -2.356  1.00 0.00 ? 21  LEU A HB2  6  
ATOM 7475  H HB3  . LEU A 1 21  ? -1.860  1.373   -1.662  1.00 0.00 ? 21  LEU A HB3  6  
ATOM 7476  H HG   . LEU A 1 21  ? 0.857   0.522   -0.627  1.00 0.00 ? 21  LEU A HG   6  
ATOM 7477  H HD11 . LEU A 1 21  ? -1.240  2.442   0.407   1.00 0.00 ? 21  LEU A HD11 6  
ATOM 7478  H HD12 . LEU A 1 21  ? 0.121   1.839   1.384   1.00 0.00 ? 21  LEU A HD12 6  
ATOM 7479  H HD13 . LEU A 1 21  ? 0.433   2.800   -0.082  1.00 0.00 ? 21  LEU A HD13 6  
ATOM 7480  H HD21 . LEU A 1 21  ? -1.915  -0.313  0.236   1.00 0.00 ? 21  LEU A HD21 6  
ATOM 7481  H HD22 . LEU A 1 21  ? -0.526  -1.338  -0.201  1.00 0.00 ? 21  LEU A HD22 6  
ATOM 7482  H HD23 . LEU A 1 21  ? -0.501  -0.404  1.314   1.00 0.00 ? 21  LEU A HD23 6  
ATOM 7483  N N    . GLN A 1 22  ? -3.151  -0.065  -3.684  1.00 0.00 ? 22  GLN A N    6  
ATOM 7484  C CA   . GLN A 1 22  ? -4.130  0.109   -4.743  1.00 0.00 ? 22  GLN A CA   6  
ATOM 7485  C C    . GLN A 1 22  ? -5.432  0.677   -4.173  1.00 0.00 ? 22  GLN A C    6  
ATOM 7486  O O    . GLN A 1 22  ? -5.801  0.376   -3.039  1.00 0.00 ? 22  GLN A O    6  
ATOM 7487  C CB   . GLN A 1 22  ? -4.382  -1.208  -5.478  1.00 0.00 ? 22  GLN A CB   6  
ATOM 7488  C CG   . GLN A 1 22  ? -4.769  -2.318  -4.499  1.00 0.00 ? 22  GLN A CG   6  
ATOM 7489  C CD   . GLN A 1 22  ? -5.639  -3.375  -5.182  1.00 0.00 ? 22  GLN A CD   6  
ATOM 7490  O OE1  . GLN A 1 22  ? -6.670  -3.084  -5.766  1.00 0.00 ? 22  GLN A OE1  6  
ATOM 7491  N NE2  . GLN A 1 22  ? -5.168  -4.614  -5.078  1.00 0.00 ? 22  GLN A NE2  6  
ATOM 7492  H H    . GLN A 1 22  ? -3.535  -0.198  -2.770  1.00 0.00 ? 22  GLN A H    6  
ATOM 7493  H HA   . GLN A 1 22  ? -3.686  0.825   -5.434  1.00 0.00 ? 22  GLN A HA   6  
ATOM 7494  H HB2  . GLN A 1 22  ? -5.177  -1.073  -6.212  1.00 0.00 ? 22  GLN A HB2  6  
ATOM 7495  H HB3  . GLN A 1 22  ? -3.487  -1.499  -6.028  1.00 0.00 ? 22  GLN A HB3  6  
ATOM 7496  H HG2  . GLN A 1 22  ? -3.868  -2.786  -4.100  1.00 0.00 ? 22  GLN A HG2  6  
ATOM 7497  H HG3  . GLN A 1 22  ? -5.307  -1.891  -3.653  1.00 0.00 ? 22  GLN A HG3  6  
ATOM 7498  H HE21 . GLN A 1 22  ? -4.314  -4.785  -4.585  1.00 0.00 ? 22  GLN A HE21 6  
ATOM 7499  H HE22 . GLN A 1 22  ? -5.666  -5.375  -5.493  1.00 0.00 ? 22  GLN A HE22 6  
ATOM 7500  N N    . GLY A 1 23  ? -6.093  1.487   -4.987  1.00 0.00 ? 23  GLY A N    6  
ATOM 7501  C CA   . GLY A 1 23  ? -7.345  2.100   -4.578  1.00 0.00 ? 23  GLY A CA   6  
ATOM 7502  C C    . GLY A 1 23  ? -7.118  3.522   -4.063  1.00 0.00 ? 23  GLY A C    6  
ATOM 7503  O O    . GLY A 1 23  ? -6.095  4.137   -4.359  1.00 0.00 ? 23  GLY A O    6  
ATOM 7504  H H    . GLY A 1 23  ? -5.786  1.727   -5.908  1.00 0.00 ? 23  GLY A H    6  
ATOM 7505  H HA2  . GLY A 1 23  ? -8.036  2.121   -5.421  1.00 0.00 ? 23  GLY A HA2  6  
ATOM 7506  H HA3  . GLY A 1 23  ? -7.812  1.497   -3.799  1.00 0.00 ? 23  GLY A HA3  6  
ATOM 7507  N N    . GLY A 1 24  ? -8.089  4.003   -3.300  1.00 0.00 ? 24  GLY A N    6  
ATOM 7508  C CA   . GLY A 1 24  ? -8.007  5.342   -2.741  1.00 0.00 ? 24  GLY A CA   6  
ATOM 7509  C C    . GLY A 1 24  ? -9.293  6.127   -3.008  1.00 0.00 ? 24  GLY A C    6  
ATOM 7510  O O    . GLY A 1 24  ? -10.169 5.662   -3.736  1.00 0.00 ? 24  GLY A O    6  
ATOM 7511  H H    . GLY A 1 24  ? -8.917  3.496   -3.064  1.00 0.00 ? 24  GLY A H    6  
ATOM 7512  H HA2  . GLY A 1 24  ? -7.830  5.281   -1.667  1.00 0.00 ? 24  GLY A HA2  6  
ATOM 7513  H HA3  . GLY A 1 24  ? -7.158  5.870   -3.174  1.00 0.00 ? 24  GLY A HA3  6  
ATOM 7514  N N    . LYS A 1 25  ? -9.366  7.304   -2.403  1.00 0.00 ? 25  LYS A N    6  
ATOM 7515  C CA   . LYS A 1 25  ? -10.530 8.158   -2.566  1.00 0.00 ? 25  LYS A CA   6  
ATOM 7516  C C    . LYS A 1 25  ? -10.670 8.546   -4.040  1.00 0.00 ? 25  LYS A C    6  
ATOM 7517  O O    . LYS A 1 25  ? -11.758 8.465   -4.606  1.00 0.00 ? 25  LYS A O    6  
ATOM 7518  C CB   . LYS A 1 25  ? -10.452 9.356   -1.619  1.00 0.00 ? 25  LYS A CB   6  
ATOM 7519  C CG   . LYS A 1 25  ? -11.850 9.882   -1.283  1.00 0.00 ? 25  LYS A CG   6  
ATOM 7520  C CD   . LYS A 1 25  ? -11.857 10.594  0.071   1.00 0.00 ? 25  LYS A CD   6  
ATOM 7521  C CE   . LYS A 1 25  ? -11.215 11.978  -0.034  1.00 0.00 ? 25  LYS A CE   6  
ATOM 7522  N NZ   . LYS A 1 25  ? -11.707 12.861  1.047   1.00 0.00 ? 25  LYS A NZ   6  
ATOM 7523  H H    . LYS A 1 25  ? -8.649  7.675   -1.813  1.00 0.00 ? 25  LYS A H    6  
ATOM 7524  H HA   . LYS A 1 25  ? -11.405 7.575   -2.278  1.00 0.00 ? 25  LYS A HA   6  
ATOM 7525  H HB2  . LYS A 1 25  ? -9.939  9.068   -0.702  1.00 0.00 ? 25  LYS A HB2  6  
ATOM 7526  H HB3  . LYS A 1 25  ? -9.862  10.150  -2.078  1.00 0.00 ? 25  LYS A HB3  6  
ATOM 7527  H HG2  . LYS A 1 25  ? -12.180 10.570  -2.062  1.00 0.00 ? 25  LYS A HG2  6  
ATOM 7528  H HG3  . LYS A 1 25  ? -12.559 9.054   -1.267  1.00 0.00 ? 25  LYS A HG3  6  
ATOM 7529  H HD2  . LYS A 1 25  ? -12.882 10.690  0.429   1.00 0.00 ? 25  LYS A HD2  6  
ATOM 7530  H HD3  . LYS A 1 25  ? -11.319 9.993   0.804   1.00 0.00 ? 25  LYS A HD3  6  
ATOM 7531  H HE2  . LYS A 1 25  ? -10.130 11.888  0.027   1.00 0.00 ? 25  LYS A HE2  6  
ATOM 7532  H HE3  . LYS A 1 25  ? -11.444 12.419  -1.004  1.00 0.00 ? 25  LYS A HE3  6  
ATOM 7533  H HZ1  . LYS A 1 25  ? -11.828 13.788  0.692   1.00 0.00 ? 25  LYS A HZ1  6  
ATOM 7534  H HZ2  . LYS A 1 25  ? -12.582 12.517  1.387   1.00 0.00 ? 25  LYS A HZ2  6  
ATOM 7535  H HZ3  . LYS A 1 25  ? -11.042 12.875  1.794   1.00 0.00 ? 25  LYS A HZ3  6  
ATOM 7536  N N    . ASP A 1 26  ? -9.552  8.961   -4.618  1.00 0.00 ? 26  ASP A N    6  
ATOM 7537  C CA   . ASP A 1 26  ? -9.536  9.363   -6.014  1.00 0.00 ? 26  ASP A CA   6  
ATOM 7538  C C    . ASP A 1 26  ? -9.864  8.153   -6.892  1.00 0.00 ? 26  ASP A C    6  
ATOM 7539  O O    . ASP A 1 26  ? -10.260 8.308   -8.046  1.00 0.00 ? 26  ASP A O    6  
ATOM 7540  C CB   . ASP A 1 26  ? -8.156  9.883   -6.422  1.00 0.00 ? 26  ASP A CB   6  
ATOM 7541  C CG   . ASP A 1 26  ? -7.914  9.959   -7.931  1.00 0.00 ? 26  ASP A CG   6  
ATOM 7542  O OD1  . ASP A 1 26  ? -8.741  10.608  -8.606  1.00 0.00 ? 26  ASP A OD1  6  
ATOM 7543  O OD2  . ASP A 1 26  ? -6.907  9.365   -8.374  1.00 0.00 ? 26  ASP A OD2  6  
ATOM 7544  H H    . ASP A 1 26  ? -8.671  9.025   -4.150  1.00 0.00 ? 26  ASP A H    6  
ATOM 7545  H HA   . ASP A 1 26  ? -10.285 10.151  -6.094  1.00 0.00 ? 26  ASP A HA   6  
ATOM 7546  H HB2  . ASP A 1 26  ? -8.019  10.877  -5.997  1.00 0.00 ? 26  ASP A HB2  6  
ATOM 7547  H HB3  . ASP A 1 26  ? -7.396  9.240   -5.979  1.00 0.00 ? 26  ASP A HB3  6  
ATOM 7548  N N    . PHE A 1 27  ? -9.686  6.975   -6.312  1.00 0.00 ? 27  PHE A N    6  
ATOM 7549  C CA   . PHE A 1 27  ? -9.957  5.740   -7.027  1.00 0.00 ? 27  PHE A CA   6  
ATOM 7550  C C    . PHE A 1 27  ? -11.379 5.248   -6.751  1.00 0.00 ? 27  PHE A C    6  
ATOM 7551  O O    . PHE A 1 27  ? -11.984 4.583   -7.590  1.00 0.00 ? 27  PHE A O    6  
ATOM 7552  C CB   . PHE A 1 27  ? -8.961  4.698   -6.514  1.00 0.00 ? 27  PHE A CB   6  
ATOM 7553  C CG   . PHE A 1 27  ? -7.548  4.857   -7.078  1.00 0.00 ? 27  PHE A CG   6  
ATOM 7554  C CD1  . PHE A 1 27  ? -6.893  6.042   -6.946  1.00 0.00 ? 27  PHE A CD1  6  
ATOM 7555  C CD2  . PHE A 1 27  ? -6.947  3.814   -7.711  1.00 0.00 ? 27  PHE A CD2  6  
ATOM 7556  C CE1  . PHE A 1 27  ? -5.581  6.189   -7.469  1.00 0.00 ? 27  PHE A CE1  6  
ATOM 7557  C CE2  . PHE A 1 27  ? -5.635  3.962   -8.235  1.00 0.00 ? 27  PHE A CE2  6  
ATOM 7558  C CZ   . PHE A 1 27  ? -4.980  5.146   -8.103  1.00 0.00 ? 27  PHE A CZ   6  
ATOM 7559  H H    . PHE A 1 27  ? -9.363  6.858   -5.372  1.00 0.00 ? 27  PHE A H    6  
ATOM 7560  H HA   . PHE A 1 27  ? -9.848  5.951   -8.090  1.00 0.00 ? 27  PHE A HA   6  
ATOM 7561  H HB2  . PHE A 1 27  ? -8.916  4.758   -5.426  1.00 0.00 ? 27  PHE A HB2  6  
ATOM 7562  H HB3  . PHE A 1 27  ? -9.331  3.703   -6.763  1.00 0.00 ? 27  PHE A HB3  6  
ATOM 7563  H HD1  . PHE A 1 27  ? -7.374  6.877   -6.438  1.00 0.00 ? 27  PHE A HD1  6  
ATOM 7564  H HD2  . PHE A 1 27  ? -7.472  2.865   -7.817  1.00 0.00 ? 27  PHE A HD2  6  
ATOM 7565  H HE1  . PHE A 1 27  ? -5.056  7.139   -7.364  1.00 0.00 ? 27  PHE A HE1  6  
ATOM 7566  H HE2  . PHE A 1 27  ? -5.154  3.126   -8.742  1.00 0.00 ? 27  PHE A HE2  6  
ATOM 7567  H HZ   . PHE A 1 27  ? -3.973  5.260   -8.505  1.00 0.00 ? 27  PHE A HZ   6  
ATOM 7568  N N    . ASN A 1 28  ? -11.872 5.594   -5.571  1.00 0.00 ? 28  ASN A N    6  
ATOM 7569  C CA   . ASN A 1 28  ? -13.212 5.196   -5.173  1.00 0.00 ? 28  ASN A CA   6  
ATOM 7570  C C    . ASN A 1 28  ? -13.181 3.755   -4.661  1.00 0.00 ? 28  ASN A C    6  
ATOM 7571  O O    . ASN A 1 28  ? -13.903 2.897   -5.166  1.00 0.00 ? 28  ASN A O    6  
ATOM 7572  C CB   . ASN A 1 28  ? -14.179 5.256   -6.358  1.00 0.00 ? 28  ASN A CB   6  
ATOM 7573  C CG   . ASN A 1 28  ? -15.588 5.633   -5.898  1.00 0.00 ? 28  ASN A CG   6  
ATOM 7574  O OD1  . ASN A 1 28  ? -16.386 4.797   -5.506  1.00 0.00 ? 28  ASN A OD1  6  
ATOM 7575  N ND2  . ASN A 1 28  ? -15.849 6.935   -5.966  1.00 0.00 ? 28  ASN A ND2  6  
ATOM 7576  H H    . ASN A 1 28  ? -11.374 6.135   -4.893  1.00 0.00 ? 28  ASN A H    6  
ATOM 7577  H HA   . ASN A 1 28  ? -13.505 5.907   -4.401  1.00 0.00 ? 28  ASN A HA   6  
ATOM 7578  H HB2  . ASN A 1 28  ? -13.823 5.985   -7.086  1.00 0.00 ? 28  ASN A HB2  6  
ATOM 7579  H HB3  . ASN A 1 28  ? -14.203 4.289   -6.861  1.00 0.00 ? 28  ASN A HB3  6  
ATOM 7580  H HD21 . ASN A 1 28  ? -15.149 7.569   -6.297  1.00 0.00 ? 28  ASN A HD21 6  
ATOM 7581  H HD22 . ASN A 1 28  ? -16.745 7.281   -5.687  1.00 0.00 ? 28  ASN A HD22 6  
ATOM 7582  N N    . MET A 1 29  ? -12.336 3.533   -3.665  1.00 0.00 ? 29  MET A N    6  
ATOM 7583  C CA   . MET A 1 29  ? -12.200 2.210   -3.079  1.00 0.00 ? 29  MET A CA   6  
ATOM 7584  C C    . MET A 1 29  ? -11.238 2.233   -1.890  1.00 0.00 ? 29  MET A C    6  
ATOM 7585  O O    . MET A 1 29  ? -10.511 3.206   -1.694  1.00 0.00 ? 29  MET A O    6  
ATOM 7586  C CB   . MET A 1 29  ? -11.682 1.234   -4.137  1.00 0.00 ? 29  MET A CB   6  
ATOM 7587  C CG   . MET A 1 29  ? -10.153 1.174   -4.125  1.00 0.00 ? 29  MET A CG   6  
ATOM 7588  S SD   . MET A 1 29  ? -9.577  0.047   -5.384  1.00 0.00 ? 29  MET A SD   6  
ATOM 7589  C CE   . MET A 1 29  ? -9.019  -1.304  -4.360  1.00 0.00 ? 29  MET A CE   6  
ATOM 7590  H H    . MET A 1 29  ? -11.751 4.236   -3.260  1.00 0.00 ? 29  MET A H    6  
ATOM 7591  H HA   . MET A 1 29  ? -13.200 1.936   -2.741  1.00 0.00 ? 29  MET A HA   6  
ATOM 7592  H HB2  . MET A 1 29  ? -12.090 0.240   -3.950  1.00 0.00 ? 29  MET A HB2  6  
ATOM 7593  H HB3  . MET A 1 29  ? -12.030 1.541   -5.123  1.00 0.00 ? 29  MET A HB3  6  
ATOM 7594  H HG2  . MET A 1 29  ? -9.741  2.168   -4.299  1.00 0.00 ? 29  MET A HG2  6  
ATOM 7595  H HG3  . MET A 1 29  ? -9.801  0.849   -3.146  1.00 0.00 ? 29  MET A HG3  6  
ATOM 7596  H HE1  . MET A 1 29  ? -9.540  -1.273  -3.403  1.00 0.00 ? 29  MET A HE1  6  
ATOM 7597  H HE2  . MET A 1 29  ? -9.230  -2.250  -4.859  1.00 0.00 ? 29  MET A HE2  6  
ATOM 7598  H HE3  . MET A 1 29  ? -7.946  -1.213  -4.192  1.00 0.00 ? 29  MET A HE3  6  
ATOM 7599  N N    . PRO A 1 30  ? -11.265 1.122   -1.107  1.00 0.00 ? 30  PRO A N    6  
ATOM 7600  C CA   . PRO A 1 30  ? -10.404 1.005   0.058   1.00 0.00 ? 30  PRO A CA   6  
ATOM 7601  C C    . PRO A 1 30  ? -8.959  0.721   -0.355  1.00 0.00 ? 30  PRO A C    6  
ATOM 7602  O O    . PRO A 1 30  ? -8.714  0.146   -1.415  1.00 0.00 ? 30  PRO A O    6  
ATOM 7603  C CB   . PRO A 1 30  ? -11.015 -0.111  0.889   1.00 0.00 ? 30  PRO A CB   6  
ATOM 7604  C CG   . PRO A 1 30  ? -11.918 -0.888  -0.056  1.00 0.00 ? 30  PRO A CG   6  
ATOM 7605  C CD   . PRO A 1 30  ? -12.114 -0.049  -1.308  1.00 0.00 ? 30  PRO A CD   6  
ATOM 7606  H HA   . PRO A 1 30  ? -10.380 1.870   0.559   1.00 0.00 ? 30  PRO A HA   6  
ATOM 7607  H HB2  . PRO A 1 30  ? -10.242 -0.755  1.308   1.00 0.00 ? 30  PRO A HB2  6  
ATOM 7608  H HB3  . PRO A 1 30  ? -11.583 0.292   1.728   1.00 0.00 ? 30  PRO A HB3  6  
ATOM 7609  H HG2  . PRO A 1 30  ? -11.470 -1.850  -0.307  1.00 0.00 ? 30  PRO A HG2  6  
ATOM 7610  H HG3  . PRO A 1 30  ? -12.877 -1.097  0.418   1.00 0.00 ? 30  PRO A HG3  6  
ATOM 7611  H HD2  . PRO A 1 30  ? -11.823 -0.600  -2.203  1.00 0.00 ? 30  PRO A HD2  6  
ATOM 7612  H HD3  . PRO A 1 30  ? -13.158 0.235   -1.435  1.00 0.00 ? 30  PRO A HD3  6  
ATOM 7613  N N    . LEU A 1 31  ? -8.039  1.137   0.503   1.00 0.00 ? 31  LEU A N    6  
ATOM 7614  C CA   . LEU A 1 31  ? -6.624  0.934   0.241   1.00 0.00 ? 31  LEU A CA   6  
ATOM 7615  C C    . LEU A 1 31  ? -6.273  -0.537  0.474   1.00 0.00 ? 31  LEU A C    6  
ATOM 7616  O O    . LEU A 1 31  ? -6.364  -1.030  1.597   1.00 0.00 ? 31  LEU A O    6  
ATOM 7617  C CB   . LEU A 1 31  ? -5.781  1.906   1.068   1.00 0.00 ? 31  LEU A CB   6  
ATOM 7618  C CG   . LEU A 1 31  ? -5.759  3.356   0.581   1.00 0.00 ? 31  LEU A CG   6  
ATOM 7619  C CD1  . LEU A 1 31  ? -5.745  4.331   1.760   1.00 0.00 ? 31  LEU A CD1  6  
ATOM 7620  C CD2  . LEU A 1 31  ? -4.589  3.596   -0.375  1.00 0.00 ? 31  LEU A CD2  6  
ATOM 7621  H H    . LEU A 1 31  ? -8.247  1.603   1.363   1.00 0.00 ? 31  LEU A H    6  
ATOM 7622  H HA   . LEU A 1 31  ? -6.450  1.168   -0.809  1.00 0.00 ? 31  LEU A HA   6  
ATOM 7623  H HB2  . LEU A 1 31  ? -6.150  1.894   2.094   1.00 0.00 ? 31  LEU A HB2  6  
ATOM 7624  H HB3  . LEU A 1 31  ? -4.756  1.536   1.093   1.00 0.00 ? 31  LEU A HB3  6  
ATOM 7625  H HG   . LEU A 1 31  ? -6.676  3.542   0.020   1.00 0.00 ? 31  LEU A HG   6  
ATOM 7626  H HD11 . LEU A 1 31  ? -5.692  3.770   2.693   1.00 0.00 ? 31  LEU A HD11 6  
ATOM 7627  H HD12 . LEU A 1 31  ? -4.878  4.986   1.679   1.00 0.00 ? 31  LEU A HD12 6  
ATOM 7628  H HD13 . LEU A 1 31  ? -6.656  4.930   1.747   1.00 0.00 ? 31  LEU A HD13 6  
ATOM 7629  H HD21 . LEU A 1 31  ? -4.716  2.983   -1.267  1.00 0.00 ? 31  LEU A HD21 6  
ATOM 7630  H HD22 . LEU A 1 31  ? -4.561  4.648   -0.659  1.00 0.00 ? 31  LEU A HD22 6  
ATOM 7631  H HD23 . LEU A 1 31  ? -3.655  3.328   0.120   1.00 0.00 ? 31  LEU A HD23 6  
ATOM 7632  N N    . THR A 1 32  ? -5.878  -1.196  -0.605  1.00 0.00 ? 32  THR A N    6  
ATOM 7633  C CA   . THR A 1 32  ? -5.512  -2.601  -0.532  1.00 0.00 ? 32  THR A CA   6  
ATOM 7634  C C    . THR A 1 32  ? -4.098  -2.812  -1.076  1.00 0.00 ? 32  THR A C    6  
ATOM 7635  O O    . THR A 1 32  ? -3.489  -1.886  -1.609  1.00 0.00 ? 32  THR A O    6  
ATOM 7636  C CB   . THR A 1 32  ? -6.577  -3.406  -1.279  1.00 0.00 ? 32  THR A CB   6  
ATOM 7637  O OG1  . THR A 1 32  ? -7.091  -2.492  -2.244  1.00 0.00 ? 32  THR A OG1  6  
ATOM 7638  C CG2  . THR A 1 32  ? -7.785  -3.737  -0.399  1.00 0.00 ? 32  THR A CG2  6  
ATOM 7639  H H    . THR A 1 32  ? -5.806  -0.788  -1.515  1.00 0.00 ? 32  THR A H    6  
ATOM 7640  H HA   . THR A 1 32  ? -5.499  -2.898  0.516   1.00 0.00 ? 32  THR A HA   6  
ATOM 7641  H HB   . THR A 1 32  ? -6.150  -4.312  -1.710  1.00 0.00 ? 32  THR A HB   6  
ATOM 7642  H HG1  . THR A 1 32  ? -7.277  -2.970  -3.102  1.00 0.00 ? 32  THR A HG1  6  
ATOM 7643  H HG21 . THR A 1 32  ? -7.661  -4.732  0.029   1.00 0.00 ? 32  THR A HG21 6  
ATOM 7644  H HG22 . THR A 1 32  ? -7.862  -3.003  0.403   1.00 0.00 ? 32  THR A HG22 6  
ATOM 7645  H HG23 . THR A 1 32  ? -8.692  -3.712  -1.003  1.00 0.00 ? 32  THR A HG23 6  
ATOM 7646  N N    . ILE A 1 33  ? -3.617  -4.037  -0.923  1.00 0.00 ? 33  ILE A N    6  
ATOM 7647  C CA   . ILE A 1 33  ? -2.285  -4.382  -1.392  1.00 0.00 ? 33  ILE A CA   6  
ATOM 7648  C C    . ILE A 1 33  ? -2.324  -4.604  -2.906  1.00 0.00 ? 33  ILE A C    6  
ATOM 7649  O O    . ILE A 1 33  ? -2.916  -5.572  -3.380  1.00 0.00 ? 33  ILE A O    6  
ATOM 7650  C CB   . ILE A 1 33  ? -1.734  -5.576  -0.610  1.00 0.00 ? 33  ILE A CB   6  
ATOM 7651  C CG1  . ILE A 1 33  ? -1.615  -5.248  0.880   1.00 0.00 ? 33  ILE A CG1  6  
ATOM 7652  C CG2  . ILE A 1 33  ? -0.406  -6.052  -1.200  1.00 0.00 ? 33  ILE A CG2  6  
ATOM 7653  C CD1  . ILE A 1 33  ? -0.482  -4.253  1.133   1.00 0.00 ? 33  ILE A CD1  6  
ATOM 7654  H H    . ILE A 1 33  ? -4.118  -4.785  -0.488  1.00 0.00 ? 33  ILE A H    6  
ATOM 7655  H HA   . ILE A 1 33  ? -1.635  -3.533  -1.184  1.00 0.00 ? 33  ILE A HA   6  
ATOM 7656  H HB   . ILE A 1 33  ? -2.441  -6.401  -0.703  1.00 0.00 ? 33  ILE A HB   6  
ATOM 7657  H HG12 . ILE A 1 33  ? -2.556  -4.833  1.240   1.00 0.00 ? 33  ILE A HG12 6  
ATOM 7658  H HG13 . ILE A 1 33  ? -1.433  -6.163  1.444   1.00 0.00 ? 33  ILE A HG13 6  
ATOM 7659  H HG21 . ILE A 1 33  ? 0.413   -5.742  -0.551  1.00 0.00 ? 33  ILE A HG21 6  
ATOM 7660  H HG22 . ILE A 1 33  ? -0.412  -7.139  -1.281  1.00 0.00 ? 33  ILE A HG22 6  
ATOM 7661  H HG23 . ILE A 1 33  ? -0.270  -5.615  -2.190  1.00 0.00 ? 33  ILE A HG23 6  
ATOM 7662  H HD11 . ILE A 1 33  ? -0.170  -3.809  0.187   1.00 0.00 ? 33  ILE A HD11 6  
ATOM 7663  H HD12 . ILE A 1 33  ? -0.830  -3.468  1.805   1.00 0.00 ? 33  ILE A HD12 6  
ATOM 7664  H HD13 . ILE A 1 33  ? 0.363   -4.771  1.587   1.00 0.00 ? 33  ILE A HD13 6  
ATOM 7665  N N    . SER A 1 34  ? -1.686  -3.690  -3.622  1.00 0.00 ? 34  SER A N    6  
ATOM 7666  C CA   . SER A 1 34  ? -1.640  -3.773  -5.072  1.00 0.00 ? 34  SER A CA   6  
ATOM 7667  C C    . SER A 1 34  ? -0.997  -5.093  -5.500  1.00 0.00 ? 34  SER A C    6  
ATOM 7668  O O    . SER A 1 34  ? -1.622  -5.898  -6.189  1.00 0.00 ? 34  SER A O    6  
ATOM 7669  C CB   . SER A 1 34  ? -0.873  -2.591  -5.667  1.00 0.00 ? 34  SER A CB   6  
ATOM 7670  O OG   . SER A 1 34  ? 0.185   -3.017  -6.521  1.00 0.00 ? 34  SER A OG   6  
ATOM 7671  H H    . SER A 1 34  ? -1.207  -2.905  -3.228  1.00 0.00 ? 34  SER A H    6  
ATOM 7672  H HA   . SER A 1 34  ? -2.680  -3.731  -5.396  1.00 0.00 ? 34  SER A HA   6  
ATOM 7673  H HB2  . SER A 1 34  ? -1.560  -1.958  -6.229  1.00 0.00 ? 34  SER A HB2  6  
ATOM 7674  H HB3  . SER A 1 34  ? -0.465  -1.980  -4.861  1.00 0.00 ? 34  SER A HB3  6  
ATOM 7675  H HG   . SER A 1 34  ? -0.162  -3.169  -7.446  1.00 0.00 ? 34  SER A HG   6  
ATOM 7676  N N    . SER A 1 35  ? 0.245   -5.275  -5.075  1.00 0.00 ? 35  SER A N    6  
ATOM 7677  C CA   . SER A 1 35  ? 0.979   -6.484  -5.406  1.00 0.00 ? 35  SER A CA   6  
ATOM 7678  C C    . SER A 1 35  ? 2.071   -6.735  -4.363  1.00 0.00 ? 35  SER A C    6  
ATOM 7679  O O    . SER A 1 35  ? 2.185   -5.994  -3.388  1.00 0.00 ? 35  SER A O    6  
ATOM 7680  C CB   . SER A 1 35  ? 1.593   -6.390  -6.804  1.00 0.00 ? 35  SER A CB   6  
ATOM 7681  O OG   . SER A 1 35  ? 1.000   -7.316  -7.711  1.00 0.00 ? 35  SER A OG   6  
ATOM 7682  H H    . SER A 1 35  ? 0.746   -4.615  -4.515  1.00 0.00 ? 35  SER A H    6  
ATOM 7683  H HA   . SER A 1 35  ? 0.241   -7.285  -5.387  1.00 0.00 ? 35  SER A HA   6  
ATOM 7684  H HB2  . SER A 1 35  ? 1.469   -5.377  -7.187  1.00 0.00 ? 35  SER A HB2  6  
ATOM 7685  H HB3  . SER A 1 35  ? 2.665   -6.579  -6.743  1.00 0.00 ? 35  SER A HB3  6  
ATOM 7686  H HG   . SER A 1 35  ? 0.148   -6.940  -8.075  1.00 0.00 ? 35  SER A HG   6  
ATOM 7687  N N    . LEU A 1 36  ? 2.845   -7.783  -4.604  1.00 0.00 ? 36  LEU A N    6  
ATOM 7688  C CA   . LEU A 1 36  ? 3.923   -8.141  -3.698  1.00 0.00 ? 36  LEU A CA   6  
ATOM 7689  C C    . LEU A 1 36  ? 5.041   -8.825  -4.488  1.00 0.00 ? 36  LEU A C    6  
ATOM 7690  O O    . LEU A 1 36  ? 4.812   -9.328  -5.586  1.00 0.00 ? 36  LEU A O    6  
ATOM 7691  C CB   . LEU A 1 36  ? 3.389   -8.981  -2.536  1.00 0.00 ? 36  LEU A CB   6  
ATOM 7692  C CG   . LEU A 1 36  ? 3.581   -8.389  -1.138  1.00 0.00 ? 36  LEU A CG   6  
ATOM 7693  C CD1  . LEU A 1 36  ? 2.642   -9.053  -0.128  1.00 0.00 ? 36  LEU A CD1  6  
ATOM 7694  C CD2  . LEU A 1 36  ? 5.045   -8.475  -0.702  1.00 0.00 ? 36  LEU A CD2  6  
ATOM 7695  H H    . LEU A 1 36  ? 2.745   -8.381  -5.399  1.00 0.00 ? 36  LEU A H    6  
ATOM 7696  H HA   . LEU A 1 36  ? 4.314   -7.216  -3.274  1.00 0.00 ? 36  LEU A HA   6  
ATOM 7697  H HB2  . LEU A 1 36  ? 2.324   -9.150  -2.694  1.00 0.00 ? 36  LEU A HB2  6  
ATOM 7698  H HB3  . LEU A 1 36  ? 3.875   -9.956  -2.565  1.00 0.00 ? 36  LEU A HB3  6  
ATOM 7699  H HG   . LEU A 1 36  ? 3.317   -7.332  -1.175  1.00 0.00 ? 36  LEU A HG   6  
ATOM 7700  H HD11 . LEU A 1 36  ? 3.200   -9.777  0.465   1.00 0.00 ? 36  LEU A HD11 6  
ATOM 7701  H HD12 . LEU A 1 36  ? 2.219   -8.293  0.529   1.00 0.00 ? 36  LEU A HD12 6  
ATOM 7702  H HD13 . LEU A 1 36  ? 1.838   -9.562  -0.660  1.00 0.00 ? 36  LEU A HD13 6  
ATOM 7703  H HD21 . LEU A 1 36  ? 5.490   -7.480  -0.727  1.00 0.00 ? 36  LEU A HD21 6  
ATOM 7704  H HD22 . LEU A 1 36  ? 5.099   -8.871  0.312   1.00 0.00 ? 36  LEU A HD22 6  
ATOM 7705  H HD23 . LEU A 1 36  ? 5.588   -9.134  -1.379  1.00 0.00 ? 36  LEU A HD23 6  
ATOM 7706  N N    . LYS A 1 37  ? 6.227   -8.820  -3.897  1.00 0.00 ? 37  LYS A N    6  
ATOM 7707  C CA   . LYS A 1 37  ? 7.381   -9.433  -4.532  1.00 0.00 ? 37  LYS A CA   6  
ATOM 7708  C C    . LYS A 1 37  ? 7.549   -10.860 -4.006  1.00 0.00 ? 37  LYS A C    6  
ATOM 7709  O O    . LYS A 1 37  ? 7.268   -11.133 -2.840  1.00 0.00 ? 37  LYS A O    6  
ATOM 7710  C CB   . LYS A 1 37  ? 8.623   -8.559  -4.344  1.00 0.00 ? 37  LYS A CB   6  
ATOM 7711  C CG   . LYS A 1 37  ? 9.835   -9.170  -5.050  1.00 0.00 ? 37  LYS A CG   6  
ATOM 7712  C CD   . LYS A 1 37  ? 10.531  -8.137  -5.939  1.00 0.00 ? 37  LYS A CD   6  
ATOM 7713  C CE   . LYS A 1 37  ? 10.984  -8.765  -7.258  1.00 0.00 ? 37  LYS A CE   6  
ATOM 7714  N NZ   . LYS A 1 37  ? 12.212  -8.103  -7.752  1.00 0.00 ? 37  LYS A NZ   6  
ATOM 7715  H H    . LYS A 1 37  ? 6.405   -8.408  -3.003  1.00 0.00 ? 37  LYS A H    6  
ATOM 7716  H HA   . LYS A 1 37  ? 7.179   -9.481  -5.602  1.00 0.00 ? 37  LYS A HA   6  
ATOM 7717  H HB2  . LYS A 1 37  ? 8.433   -7.561  -4.739  1.00 0.00 ? 37  LYS A HB2  6  
ATOM 7718  H HB3  . LYS A 1 37  ? 8.836   -8.446  -3.281  1.00 0.00 ? 37  LYS A HB3  6  
ATOM 7719  H HG2  . LYS A 1 37  ? 10.539  -9.550  -4.309  1.00 0.00 ? 37  LYS A HG2  6  
ATOM 7720  H HG3  . LYS A 1 37  ? 9.519   -10.020 -5.654  1.00 0.00 ? 37  LYS A HG3  6  
ATOM 7721  H HD2  . LYS A 1 37  ? 9.851   -7.309  -6.141  1.00 0.00 ? 37  LYS A HD2  6  
ATOM 7722  H HD3  . LYS A 1 37  ? 11.392  -7.722  -5.415  1.00 0.00 ? 37  LYS A HD3  6  
ATOM 7723  H HE2  . LYS A 1 37  ? 11.170  -9.830  -7.116  1.00 0.00 ? 37  LYS A HE2  6  
ATOM 7724  H HE3  . LYS A 1 37  ? 10.192  -8.676  -8.002  1.00 0.00 ? 37  LYS A HE3  6  
ATOM 7725  H HZ1  . LYS A 1 37  ? 12.038  -7.126  -7.875  1.00 0.00 ? 37  LYS A HZ1  6  
ATOM 7726  H HZ2  . LYS A 1 37  ? 12.949  -8.230  -7.088  1.00 0.00 ? 37  LYS A HZ2  6  
ATOM 7727  H HZ3  . LYS A 1 37  ? 12.479  -8.506  -8.628  1.00 0.00 ? 37  LYS A HZ3  6  
ATOM 7728  N N    . ASP A 1 38  ? 8.006   -11.733 -4.891  1.00 0.00 ? 38  ASP A N    6  
ATOM 7729  C CA   . ASP A 1 38  ? 8.215   -13.125 -4.531  1.00 0.00 ? 38  ASP A CA   6  
ATOM 7730  C C    . ASP A 1 38  ? 8.978   -13.196 -3.207  1.00 0.00 ? 38  ASP A C    6  
ATOM 7731  O O    . ASP A 1 38  ? 10.148  -12.825 -3.140  1.00 0.00 ? 38  ASP A O    6  
ATOM 7732  C CB   . ASP A 1 38  ? 9.043   -13.851 -5.593  1.00 0.00 ? 38  ASP A CB   6  
ATOM 7733  C CG   . ASP A 1 38  ? 8.676   -15.321 -5.806  1.00 0.00 ? 38  ASP A CG   6  
ATOM 7734  O OD1  . ASP A 1 38  ? 8.889   -16.103 -4.855  1.00 0.00 ? 38  ASP A OD1  6  
ATOM 7735  O OD2  . ASP A 1 38  ? 8.191   -15.630 -6.916  1.00 0.00 ? 38  ASP A OD2  6  
ATOM 7736  H H    . ASP A 1 38  ? 8.233   -11.503 -5.838  1.00 0.00 ? 38  ASP A H    6  
ATOM 7737  H HA   . ASP A 1 38  ? 7.216   -13.556 -4.461  1.00 0.00 ? 38  ASP A HA   6  
ATOM 7738  H HB2  . ASP A 1 38  ? 8.933   -13.324 -6.541  1.00 0.00 ? 38  ASP A HB2  6  
ATOM 7739  H HB3  . ASP A 1 38  ? 10.095  -13.792 -5.315  1.00 0.00 ? 38  ASP A HB3  6  
ATOM 7740  N N    . GLY A 1 39  ? 8.283   -13.676 -2.186  1.00 0.00 ? 39  GLY A N    6  
ATOM 7741  C CA   . GLY A 1 39  ? 8.880   -13.801 -0.867  1.00 0.00 ? 39  GLY A CA   6  
ATOM 7742  C C    . GLY A 1 39  ? 9.545   -12.490 -0.440  1.00 0.00 ? 39  GLY A C    6  
ATOM 7743  O O    . GLY A 1 39  ? 10.661  -12.496 0.077   1.00 0.00 ? 39  GLY A O    6  
ATOM 7744  H H    . GLY A 1 39  ? 7.331   -13.976 -2.248  1.00 0.00 ? 39  GLY A H    6  
ATOM 7745  H HA2  . GLY A 1 39  ? 8.115   -14.077 -0.142  1.00 0.00 ? 39  GLY A HA2  6  
ATOM 7746  H HA3  . GLY A 1 39  ? 9.619   -14.602 -0.872  1.00 0.00 ? 39  GLY A HA3  6  
ATOM 7747  N N    . GLY A 1 40  ? 8.832   -11.399 -0.673  1.00 0.00 ? 40  GLY A N    6  
ATOM 7748  C CA   . GLY A 1 40  ? 9.339   -10.084 -0.319  1.00 0.00 ? 40  GLY A CA   6  
ATOM 7749  C C    . GLY A 1 40  ? 9.357   -9.893  1.199   1.00 0.00 ? 40  GLY A C    6  
ATOM 7750  O O    . GLY A 1 40  ? 9.524   -10.856 1.947   1.00 0.00 ? 40  GLY A O    6  
ATOM 7751  H H    . GLY A 1 40  ? 7.925   -11.403 -1.094  1.00 0.00 ? 40  GLY A H    6  
ATOM 7752  H HA2  . GLY A 1 40  ? 10.345  -9.959  -0.718  1.00 0.00 ? 40  GLY A HA2  6  
ATOM 7753  H HA3  . GLY A 1 40  ? 8.717   -9.315  -0.778  1.00 0.00 ? 40  GLY A HA3  6  
ATOM 7754  N N    . LYS A 1 41  ? 9.184   -8.645  1.609   1.00 0.00 ? 41  LYS A N    6  
ATOM 7755  C CA   . LYS A 1 41  ? 9.179   -8.317  3.024   1.00 0.00 ? 41  LYS A CA   6  
ATOM 7756  C C    . LYS A 1 41  ? 7.764   -8.488  3.578   1.00 0.00 ? 41  LYS A C    6  
ATOM 7757  O O    . LYS A 1 41  ? 7.582   -9.019  4.673   1.00 0.00 ? 41  LYS A O    6  
ATOM 7758  C CB   . LYS A 1 41  ? 9.764   -6.921  3.252   1.00 0.00 ? 41  LYS A CB   6  
ATOM 7759  C CG   . LYS A 1 41  ? 11.137  -6.787  2.591   1.00 0.00 ? 41  LYS A CG   6  
ATOM 7760  C CD   . LYS A 1 41  ? 12.051  -5.870  3.406   1.00 0.00 ? 41  LYS A CD   6  
ATOM 7761  C CE   . LYS A 1 41  ? 13.438  -6.493  3.580   1.00 0.00 ? 41  LYS A CE   6  
ATOM 7762  N NZ   . LYS A 1 41  ? 14.434  -5.782  2.747   1.00 0.00 ? 41  LYS A NZ   6  
ATOM 7763  H H    . LYS A 1 41  ? 9.050   -7.868  0.994   1.00 0.00 ? 41  LYS A H    6  
ATOM 7764  H HA   . LYS A 1 41  ? 9.836   -9.027  3.527   1.00 0.00 ? 41  LYS A HA   6  
ATOM 7765  H HB2  . LYS A 1 41  ? 9.087   -6.168  2.848   1.00 0.00 ? 41  LYS A HB2  6  
ATOM 7766  H HB3  . LYS A 1 41  ? 9.851   -6.730  4.321   1.00 0.00 ? 41  LYS A HB3  6  
ATOM 7767  H HG2  . LYS A 1 41  ? 11.596  -7.771  2.494   1.00 0.00 ? 41  LYS A HG2  6  
ATOM 7768  H HG3  . LYS A 1 41  ? 11.022  -6.389  1.583   1.00 0.00 ? 41  LYS A HG3  6  
ATOM 7769  H HD2  . LYS A 1 41  ? 12.142  -4.905  2.908   1.00 0.00 ? 41  LYS A HD2  6  
ATOM 7770  H HD3  . LYS A 1 41  ? 11.607  -5.684  4.383   1.00 0.00 ? 41  LYS A HD3  6  
ATOM 7771  H HE2  . LYS A 1 41  ? 13.734  -6.448  4.628   1.00 0.00 ? 41  LYS A HE2  6  
ATOM 7772  H HE3  . LYS A 1 41  ? 13.408  -7.546  3.302   1.00 0.00 ? 41  LYS A HE3  6  
ATOM 7773  H HZ1  . LYS A 1 41  ? 15.257  -6.343  2.660   1.00 0.00 ? 41  LYS A HZ1  6  
ATOM 7774  H HZ2  . LYS A 1 41  ? 14.049  -5.612  1.840   1.00 0.00 ? 41  LYS A HZ2  6  
ATOM 7775  H HZ3  . LYS A 1 41  ? 14.668  -4.910  3.178   1.00 0.00 ? 41  LYS A HZ3  6  
ATOM 7776  N N    . ALA A 1 42  ? 6.797   -8.029  2.797   1.00 0.00 ? 42  ALA A N    6  
ATOM 7777  C CA   . ALA A 1 42  ? 5.403   -8.125  3.196   1.00 0.00 ? 42  ALA A CA   6  
ATOM 7778  C C    . ALA A 1 42  ? 5.018   -9.599  3.336   1.00 0.00 ? 42  ALA A C    6  
ATOM 7779  O O    . ALA A 1 42  ? 4.316   -9.974  4.274   1.00 0.00 ? 42  ALA A O    6  
ATOM 7780  C CB   . ALA A 1 42  ? 4.529   -7.388  2.179   1.00 0.00 ? 42  ALA A CB   6  
ATOM 7781  H H    . ALA A 1 42  ? 6.954   -7.598  1.908   1.00 0.00 ? 42  ALA A H    6  
ATOM 7782  H HA   . ALA A 1 42  ? 5.301   -7.637  4.165   1.00 0.00 ? 42  ALA A HA   6  
ATOM 7783  H HB1  . ALA A 1 42  ? 4.144   -6.472  2.627   1.00 0.00 ? 42  ALA A HB1  6  
ATOM 7784  H HB2  . ALA A 1 42  ? 5.124   -7.140  1.300   1.00 0.00 ? 42  ALA A HB2  6  
ATOM 7785  H HB3  . ALA A 1 42  ? 3.696   -8.027  1.885   1.00 0.00 ? 42  ALA A HB3  6  
ATOM 7786  N N    . SER A 1 43  ? 5.493   -10.395 2.389   1.00 0.00 ? 43  SER A N    6  
ATOM 7787  C CA   . SER A 1 43  ? 5.207   -11.819 2.396   1.00 0.00 ? 43  SER A CA   6  
ATOM 7788  C C    . SER A 1 43  ? 5.695   -12.445 3.704   1.00 0.00 ? 43  SER A C    6  
ATOM 7789  O O    . SER A 1 43  ? 4.998   -13.261 4.304   1.00 0.00 ? 43  SER A O    6  
ATOM 7790  C CB   . SER A 1 43  ? 5.857   -12.517 1.199   1.00 0.00 ? 43  SER A CB   6  
ATOM 7791  O OG   . SER A 1 43  ? 5.505   -13.896 1.129   1.00 0.00 ? 43  SER A OG   6  
ATOM 7792  H H    . SER A 1 43  ? 6.063   -10.081 1.630   1.00 0.00 ? 43  SER A H    6  
ATOM 7793  H HA   . SER A 1 43  ? 4.123   -11.896 2.316   1.00 0.00 ? 43  SER A HA   6  
ATOM 7794  H HB2  . SER A 1 43  ? 5.551   -12.018 0.279   1.00 0.00 ? 43  SER A HB2  6  
ATOM 7795  H HB3  . SER A 1 43  ? 6.940   -12.422 1.268   1.00 0.00 ? 43  SER A HB3  6  
ATOM 7796  H HG   . SER A 1 43  ? 6.016   -14.343 0.395   1.00 0.00 ? 43  SER A HG   6  
ATOM 7797  N N    . GLN A 1 44  ? 6.890   -12.039 4.108   1.00 0.00 ? 44  GLN A N    6  
ATOM 7798  C CA   . GLN A 1 44  ? 7.480   -12.549 5.333   1.00 0.00 ? 44  GLN A CA   6  
ATOM 7799  C C    . GLN A 1 44  ? 6.688   -12.060 6.547   1.00 0.00 ? 44  GLN A C    6  
ATOM 7800  O O    . GLN A 1 44  ? 6.726   -12.680 7.609   1.00 0.00 ? 44  GLN A O    6  
ATOM 7801  C CB   . GLN A 1 44  ? 8.952   -12.149 5.442   1.00 0.00 ? 44  GLN A CB   6  
ATOM 7802  C CG   . GLN A 1 44  ? 9.853   -13.184 4.764   1.00 0.00 ? 44  GLN A CG   6  
ATOM 7803  C CD   . GLN A 1 44  ? 11.317  -12.978 5.157   1.00 0.00 ? 44  GLN A CD   6  
ATOM 7804  O OE1  . GLN A 1 44  ? 11.826  -13.576 6.091   1.00 0.00 ? 44  GLN A OE1  6  
ATOM 7805  N NE2  . GLN A 1 44  ? 11.964  -12.101 4.395   1.00 0.00 ? 44  GLN A NE2  6  
ATOM 7806  H H    . GLN A 1 44  ? 7.451   -11.374 3.614   1.00 0.00 ? 44  GLN A H    6  
ATOM 7807  H HA   . GLN A 1 44  ? 7.409   -13.635 5.259   1.00 0.00 ? 44  GLN A HA   6  
ATOM 7808  H HB2  . GLN A 1 44  ? 9.103   -11.173 4.981   1.00 0.00 ? 44  GLN A HB2  6  
ATOM 7809  H HB3  . GLN A 1 44  ? 9.230   -12.052 6.491   1.00 0.00 ? 44  GLN A HB3  6  
ATOM 7810  H HG2  . GLN A 1 44  ? 9.535   -14.188 5.044   1.00 0.00 ? 44  GLN A HG2  6  
ATOM 7811  H HG3  . GLN A 1 44  ? 9.749   -13.107 3.681   1.00 0.00 ? 44  GLN A HG3  6  
ATOM 7812  H HE21 . GLN A 1 44  ? 11.488  -11.644 3.644   1.00 0.00 ? 44  GLN A HE21 6  
ATOM 7813  H HE22 . GLN A 1 44  ? 12.927  -11.898 4.573   1.00 0.00 ? 44  GLN A HE22 6  
ATOM 7814  N N    . ALA A 1 45  ? 5.988   -10.952 6.350   1.00 0.00 ? 45  ALA A N    6  
ATOM 7815  C CA   . ALA A 1 45  ? 5.188   -10.372 7.415   1.00 0.00 ? 45  ALA A CA   6  
ATOM 7816  C C    . ALA A 1 45  ? 3.782   -10.974 7.377   1.00 0.00 ? 45  ALA A C    6  
ATOM 7817  O O    . ALA A 1 45  ? 2.865   -10.459 8.015   1.00 0.00 ? 45  ALA A O    6  
ATOM 7818  C CB   . ALA A 1 45  ? 5.175   -8.849  7.272   1.00 0.00 ? 45  ALA A CB   6  
ATOM 7819  H H    . ALA A 1 45  ? 5.962   -10.454 5.483   1.00 0.00 ? 45  ALA A H    6  
ATOM 7820  H HA   . ALA A 1 45  ? 5.660   -10.632 8.363   1.00 0.00 ? 45  ALA A HA   6  
ATOM 7821  H HB1  . ALA A 1 45  ? 5.262   -8.391  8.258   1.00 0.00 ? 45  ALA A HB1  6  
ATOM 7822  H HB2  . ALA A 1 45  ? 6.013   -8.535  6.650   1.00 0.00 ? 45  ALA A HB2  6  
ATOM 7823  H HB3  . ALA A 1 45  ? 4.240   -8.536  6.808   1.00 0.00 ? 45  ALA A HB3  6  
ATOM 7824  N N    . HIS A 1 46  ? 3.656   -12.056 6.623   1.00 0.00 ? 46  HIS A N    6  
ATOM 7825  C CA   . HIS A 1 46  ? 2.378   -12.733 6.493   1.00 0.00 ? 46  HIS A CA   6  
ATOM 7826  C C    . HIS A 1 46  ? 1.339   -11.765 5.923   1.00 0.00 ? 46  HIS A C    6  
ATOM 7827  O O    . HIS A 1 46  ? 0.219   -11.685 6.423   1.00 0.00 ? 46  HIS A O    6  
ATOM 7828  C CB   . HIS A 1 46  ? 1.948   -13.344 7.828   1.00 0.00 ? 46  HIS A CB   6  
ATOM 7829  C CG   . HIS A 1 46  ? 3.006   -14.203 8.479   1.00 0.00 ? 46  HIS A CG   6  
ATOM 7830  N ND1  . HIS A 1 46  ? 2.821   -15.549 8.743   1.00 0.00 ? 46  HIS A ND1  6  
ATOM 7831  C CD2  . HIS A 1 46  ? 4.261   -13.894 8.915   1.00 0.00 ? 46  HIS A CD2  6  
ATOM 7832  C CE1  . HIS A 1 46  ? 3.921   -16.019 9.313   1.00 0.00 ? 46  HIS A CE1  6  
ATOM 7833  N NE2  . HIS A 1 46  ? 4.812   -14.991 9.419   1.00 0.00 ? 46  HIS A NE2  6  
ATOM 7834  H H    . HIS A 1 46  ? 4.407   -12.469 6.107   1.00 0.00 ? 46  HIS A H    6  
ATOM 7835  H HA   . HIS A 1 46  ? 2.526   -13.550 5.786   1.00 0.00 ? 46  HIS A HA   6  
ATOM 7836  H HB2  . HIS A 1 46  ? 1.675   -12.541 8.513   1.00 0.00 ? 46  HIS A HB2  6  
ATOM 7837  H HB3  . HIS A 1 46  ? 1.053   -13.946 7.670   1.00 0.00 ? 46  HIS A HB3  6  
ATOM 7838  H HD1  . HIS A 1 46  ? 1.997   -16.077 8.538   1.00 0.00 ? 46  HIS A HD1  6  
ATOM 7839  H HD2  . HIS A 1 46  ? 4.731   -12.912 8.859   1.00 0.00 ? 46  HIS A HD2  6  
ATOM 7840  H HE1  . HIS A 1 46  ? 4.086   -17.045 9.639   1.00 0.00 ? 46  HIS A HE1  6  
ATOM 7841  N N    . VAL A 1 47  ? 1.749   -11.053 4.883   1.00 0.00 ? 47  VAL A N    6  
ATOM 7842  C CA   . VAL A 1 47  ? 0.869   -10.093 4.240   1.00 0.00 ? 47  VAL A CA   6  
ATOM 7843  C C    . VAL A 1 47  ? 0.419   -10.647 2.886   1.00 0.00 ? 47  VAL A C    6  
ATOM 7844  O O    . VAL A 1 47  ? 1.249   -10.960 2.033   1.00 0.00 ? 47  VAL A O    6  
ATOM 7845  C CB   . VAL A 1 47  ? 1.566   -8.736  4.128   1.00 0.00 ? 47  VAL A CB   6  
ATOM 7846  C CG1  . VAL A 1 47  ? 0.690   -7.728  3.381   1.00 0.00 ? 47  VAL A CG1  6  
ATOM 7847  C CG2  . VAL A 1 47  ? 1.957   -8.205  5.509   1.00 0.00 ? 47  VAL A CG2  6  
ATOM 7848  H H    . VAL A 1 47  ? 2.663   -11.124 4.482   1.00 0.00 ? 47  VAL A H    6  
ATOM 7849  H HA   . VAL A 1 47  ? -0.007  -9.971  4.877   1.00 0.00 ? 47  VAL A HA   6  
ATOM 7850  H HB   . VAL A 1 47  ? 2.481   -8.875  3.553   1.00 0.00 ? 47  VAL A HB   6  
ATOM 7851  H HG11 . VAL A 1 47  ? 1.000   -7.681  2.337   1.00 0.00 ? 47  VAL A HG11 6  
ATOM 7852  H HG12 . VAL A 1 47  ? -0.352  -8.042  3.436   1.00 0.00 ? 47  VAL A HG12 6  
ATOM 7853  H HG13 . VAL A 1 47  ? 0.798   -6.744  3.837   1.00 0.00 ? 47  VAL A HG13 6  
ATOM 7854  H HG21 . VAL A 1 47  ? 1.973   -9.028  6.224   1.00 0.00 ? 47  VAL A HG21 6  
ATOM 7855  H HG22 . VAL A 1 47  ? 2.946   -7.749  5.457   1.00 0.00 ? 47  VAL A HG22 6  
ATOM 7856  H HG23 . VAL A 1 47  ? 1.230   -7.459  5.831   1.00 0.00 ? 47  VAL A HG23 6  
ATOM 7857  N N    . ARG A 1 48  ? -0.892  -10.751 2.732   1.00 0.00 ? 48  ARG A N    6  
ATOM 7858  C CA   . ARG A 1 48  ? -1.462  -11.262 1.496   1.00 0.00 ? 48  ARG A CA   6  
ATOM 7859  C C    . ARG A 1 48  ? -2.154  -10.137 0.726   1.00 0.00 ? 48  ARG A C    6  
ATOM 7860  O O    . ARG A 1 48  ? -2.454  -9.086  1.290   1.00 0.00 ? 48  ARG A O    6  
ATOM 7861  C CB   . ARG A 1 48  ? -2.472  -12.377 1.775   1.00 0.00 ? 48  ARG A CB   6  
ATOM 7862  C CG   . ARG A 1 48  ? -3.220  -12.123 3.086   1.00 0.00 ? 48  ARG A CG   6  
ATOM 7863  C CD   . ARG A 1 48  ? -2.417  -12.637 4.283   1.00 0.00 ? 48  ARG A CD   6  
ATOM 7864  N NE   . ARG A 1 48  ? -2.762  -11.861 5.495   1.00 0.00 ? 48  ARG A NE   6  
ATOM 7865  C CZ   . ARG A 1 48  ? -2.381  -12.195 6.735   1.00 0.00 ? 48  ARG A CZ   6  
ATOM 7866  N NH1  . ARG A 1 48  ? -1.640  -13.293 6.935   1.00 0.00 ? 48  ARG A NH1  6  
ATOM 7867  N NH2  . ARG A 1 48  ? -2.741  -11.431 7.775   1.00 0.00 ? 48  ARG A NH2  6  
ATOM 7868  H H    . ARG A 1 48  ? -1.560  -10.495 3.430   1.00 0.00 ? 48  ARG A H    6  
ATOM 7869  H HA   . ARG A 1 48  ? -0.611  -11.654 0.939   1.00 0.00 ? 48  ARG A HA   6  
ATOM 7870  H HB2  . ARG A 1 48  ? -3.185  -12.441 0.953   1.00 0.00 ? 48  ARG A HB2  6  
ATOM 7871  H HB3  . ARG A 1 48  ? -1.957  -13.336 1.826   1.00 0.00 ? 48  ARG A HB3  6  
ATOM 7872  H HG2  . ARG A 1 48  ? -3.408  -11.056 3.201   1.00 0.00 ? 48  ARG A HG2  6  
ATOM 7873  H HG3  . ARG A 1 48  ? -4.191  -12.617 3.056   1.00 0.00 ? 48  ARG A HG3  6  
ATOM 7874  H HD2  . ARG A 1 48  ? -2.628  -13.694 4.446   1.00 0.00 ? 48  ARG A HD2  6  
ATOM 7875  H HD3  . ARG A 1 48  ? -1.350  -12.553 4.079   1.00 0.00 ? 48  ARG A HD3  6  
ATOM 7876  H HE   . ARG A 1 48  ? -3.314  -11.035 5.381   1.00 0.00 ? 48  ARG A HE   6  
ATOM 7877  H HH11 . ARG A 1 48  ? -1.372  -13.864 6.159   1.00 0.00 ? 48  ARG A HH11 6  
ATOM 7878  H HH12 . ARG A 1 48  ? -1.356  -13.543 7.861   1.00 0.00 ? 48  ARG A HH12 6  
ATOM 7879  H HH21 . ARG A 1 48  ? -3.293  -10.611 7.626   1.00 0.00 ? 48  ARG A HH21 6  
ATOM 7880  H HH22 . ARG A 1 48  ? -2.456  -11.680 8.701   1.00 0.00 ? 48  ARG A HH22 6  
ATOM 7881  N N    . ILE A 1 49  ? -2.388  -10.395 -0.553  1.00 0.00 ? 49  ILE A N    6  
ATOM 7882  C CA   . ILE A 1 49  ? -3.040  -9.416  -1.407  1.00 0.00 ? 49  ILE A CA   6  
ATOM 7883  C C    . ILE A 1 49  ? -4.511  -9.293  -1.004  1.00 0.00 ? 49  ILE A C    6  
ATOM 7884  O O    . ILE A 1 49  ? -5.189  -10.299 -0.803  1.00 0.00 ? 49  ILE A O    6  
ATOM 7885  C CB   . ILE A 1 49  ? -2.833  -9.770  -2.881  1.00 0.00 ? 49  ILE A CB   6  
ATOM 7886  C CG1  . ILE A 1 49  ? -1.382  -9.532  -3.304  1.00 0.00 ? 49  ILE A CG1  6  
ATOM 7887  C CG2  . ILE A 1 49  ? -3.821  -9.012  -3.770  1.00 0.00 ? 49  ILE A CG2  6  
ATOM 7888  C CD1  . ILE A 1 49  ? -1.279  -9.323  -4.816  1.00 0.00 ? 49  ILE A CD1  6  
ATOM 7889  H H    . ILE A 1 49  ? -2.141  -11.252 -1.004  1.00 0.00 ? 49  ILE A H    6  
ATOM 7890  H HA   . ILE A 1 49  ? -2.553  -8.456  -1.234  1.00 0.00 ? 49  ILE A HA   6  
ATOM 7891  H HB   . ILE A 1 49  ? -3.036  -10.833 -3.009  1.00 0.00 ? 49  ILE A HB   6  
ATOM 7892  H HG12 . ILE A 1 49  ? -0.987  -8.658  -2.785  1.00 0.00 ? 49  ILE A HG12 6  
ATOM 7893  H HG13 . ILE A 1 49  ? -0.769  -10.383 -3.008  1.00 0.00 ? 49  ILE A HG13 6  
ATOM 7894  H HG21 . ILE A 1 49  ? -3.644  -7.940  -3.679  1.00 0.00 ? 49  ILE A HG21 6  
ATOM 7895  H HG22 . ILE A 1 49  ? -3.684  -9.316  -4.808  1.00 0.00 ? 49  ILE A HG22 6  
ATOM 7896  H HG23 . ILE A 1 49  ? -4.840  -9.239  -3.457  1.00 0.00 ? 49  ILE A HG23 6  
ATOM 7897  H HD11 . ILE A 1 49  ? -1.666  -8.337  -5.074  1.00 0.00 ? 49  ILE A HD11 6  
ATOM 7898  H HD12 . ILE A 1 49  ? -0.235  -9.395  -5.122  1.00 0.00 ? 49  ILE A HD12 6  
ATOM 7899  H HD13 . ILE A 1 49  ? -1.862  -10.088 -5.329  1.00 0.00 ? 49  ILE A HD13 6  
ATOM 7900  N N    . GLY A 1 50  ? -4.960  -8.051  -0.898  1.00 0.00 ? 50  GLY A N    6  
ATOM 7901  C CA   . GLY A 1 50  ? -6.338  -7.784  -0.522  1.00 0.00 ? 50  GLY A CA   6  
ATOM 7902  C C    . GLY A 1 50  ? -6.414  -7.144  0.865   1.00 0.00 ? 50  GLY A C    6  
ATOM 7903  O O    . GLY A 1 50  ? -7.454  -6.612  1.251   1.00 0.00 ? 50  GLY A O    6  
ATOM 7904  H H    . GLY A 1 50  ? -4.402  -7.238  -1.062  1.00 0.00 ? 50  GLY A H    6  
ATOM 7905  H HA2  . GLY A 1 50  ? -6.797  -7.122  -1.257  1.00 0.00 ? 50  GLY A HA2  6  
ATOM 7906  H HA3  . GLY A 1 50  ? -6.908  -8.713  -0.530  1.00 0.00 ? 50  GLY A HA3  6  
ATOM 7907  N N    . ASP A 1 51  ? -5.299  -7.216  1.577   1.00 0.00 ? 51  ASP A N    6  
ATOM 7908  C CA   . ASP A 1 51  ? -5.226  -6.651  2.914   1.00 0.00 ? 51  ASP A CA   6  
ATOM 7909  C C    . ASP A 1 51  ? -5.508  -5.149  2.843   1.00 0.00 ? 51  ASP A C    6  
ATOM 7910  O O    . ASP A 1 51  ? -4.904  -4.437  2.043   1.00 0.00 ? 51  ASP A O    6  
ATOM 7911  C CB   . ASP A 1 51  ? -3.834  -6.843  3.518   1.00 0.00 ? 51  ASP A CB   6  
ATOM 7912  C CG   . ASP A 1 51  ? -3.516  -8.269  3.970   1.00 0.00 ? 51  ASP A CG   6  
ATOM 7913  O OD1  . ASP A 1 51  ? -4.466  -9.080  3.999   1.00 0.00 ? 51  ASP A OD1  6  
ATOM 7914  O OD2  . ASP A 1 51  ? -2.329  -8.516  4.276   1.00 0.00 ? 51  ASP A OD2  6  
ATOM 7915  H H    . ASP A 1 51  ? -4.458  -7.651  1.256   1.00 0.00 ? 51  ASP A H    6  
ATOM 7916  H HA   . ASP A 1 51  ? -5.976  -7.189  3.494   1.00 0.00 ? 51  ASP A HA   6  
ATOM 7917  H HB2  . ASP A 1 51  ? -3.090  -6.536  2.783   1.00 0.00 ? 51  ASP A HB2  6  
ATOM 7918  H HB3  . ASP A 1 51  ? -3.730  -6.175  4.373   1.00 0.00 ? 51  ASP A HB3  6  
ATOM 7919  N N    . VAL A 1 52  ? -6.427  -4.711  3.692   1.00 0.00 ? 52  VAL A N    6  
ATOM 7920  C CA   . VAL A 1 52  ? -6.797  -3.307  3.736   1.00 0.00 ? 52  VAL A CA   6  
ATOM 7921  C C    . VAL A 1 52  ? -5.968  -2.599  4.810   1.00 0.00 ? 52  VAL A C    6  
ATOM 7922  O O    . VAL A 1 52  ? -5.913  -3.050  5.953   1.00 0.00 ? 52  VAL A O    6  
ATOM 7923  C CB   . VAL A 1 52  ? -8.305  -3.169  3.956   1.00 0.00 ? 52  VAL A CB   6  
ATOM 7924  C CG1  . VAL A 1 52  ? -8.700  -1.702  4.142   1.00 0.00 ? 52  VAL A CG1  6  
ATOM 7925  C CG2  . VAL A 1 52  ? -9.087  -3.807  2.807   1.00 0.00 ? 52  VAL A CG2  6  
ATOM 7926  H H    . VAL A 1 52  ? -6.915  -5.297  4.339   1.00 0.00 ? 52  VAL A H    6  
ATOM 7927  H HA   . VAL A 1 52  ? -6.557  -2.873  2.765   1.00 0.00 ? 52  VAL A HA   6  
ATOM 7928  H HB   . VAL A 1 52  ? -8.559  -3.703  4.872   1.00 0.00 ? 52  VAL A HB   6  
ATOM 7929  H HG11 . VAL A 1 52  ? -9.497  -1.450  3.442   1.00 0.00 ? 52  VAL A HG11 6  
ATOM 7930  H HG12 . VAL A 1 52  ? -9.050  -1.546  5.162   1.00 0.00 ? 52  VAL A HG12 6  
ATOM 7931  H HG13 . VAL A 1 52  ? -7.835  -1.066  3.953   1.00 0.00 ? 52  VAL A HG13 6  
ATOM 7932  H HG21 . VAL A 1 52  ? -9.874  -4.444  3.212   1.00 0.00 ? 52  VAL A HG21 6  
ATOM 7933  H HG22 . VAL A 1 52  ? -9.534  -3.024  2.193   1.00 0.00 ? 52  VAL A HG22 6  
ATOM 7934  H HG23 . VAL A 1 52  ? -8.413  -4.406  2.196   1.00 0.00 ? 52  VAL A HG23 6  
ATOM 7935  N N    . VAL A 1 53  ? -5.345  -1.502  4.404   1.00 0.00 ? 53  VAL A N    6  
ATOM 7936  C CA   . VAL A 1 53  ? -4.522  -0.728  5.318   1.00 0.00 ? 53  VAL A CA   6  
ATOM 7937  C C    . VAL A 1 53  ? -5.416  0.206   6.135   1.00 0.00 ? 53  VAL A C    6  
ATOM 7938  O O    . VAL A 1 53  ? -5.883  1.225   5.629   1.00 0.00 ? 53  VAL A O    6  
ATOM 7939  C CB   . VAL A 1 53  ? -3.434  0.015   4.540   1.00 0.00 ? 53  VAL A CB   6  
ATOM 7940  C CG1  . VAL A 1 53  ? -2.483  0.745   5.490   1.00 0.00 ? 53  VAL A CG1  6  
ATOM 7941  C CG2  . VAL A 1 53  ? -2.666  -0.940  3.623   1.00 0.00 ? 53  VAL A CG2  6  
ATOM 7942  H H    . VAL A 1 53  ? -5.395  -1.143  3.472   1.00 0.00 ? 53  VAL A H    6  
ATOM 7943  H HA   . VAL A 1 53  ? -4.034  -1.429  5.995   1.00 0.00 ? 53  VAL A HA   6  
ATOM 7944  H HB   . VAL A 1 53  ? -3.920  0.762   3.913   1.00 0.00 ? 53  VAL A HB   6  
ATOM 7945  H HG11 . VAL A 1 53  ? -3.045  1.464   6.085   1.00 0.00 ? 53  VAL A HG11 6  
ATOM 7946  H HG12 . VAL A 1 53  ? -2.003  0.023   6.151   1.00 0.00 ? 53  VAL A HG12 6  
ATOM 7947  H HG13 . VAL A 1 53  ? -1.722  1.269   4.911   1.00 0.00 ? 53  VAL A HG13 6  
ATOM 7948  H HG21 . VAL A 1 53  ? -1.989  -0.368  2.988   1.00 0.00 ? 53  VAL A HG21 6  
ATOM 7949  H HG22 . VAL A 1 53  ? -2.091  -1.641  4.228   1.00 0.00 ? 53  VAL A HG22 6  
ATOM 7950  H HG23 . VAL A 1 53  ? -3.371  -1.491  3.000   1.00 0.00 ? 53  VAL A HG23 6  
ATOM 7951  N N    . LEU A 1 54  ? -5.627  -0.174  7.387   1.00 0.00 ? 54  LEU A N    6  
ATOM 7952  C CA   . LEU A 1 54  ? -6.456  0.617   8.280   1.00 0.00 ? 54  LEU A CA   6  
ATOM 7953  C C    . LEU A 1 54  ? -5.721  1.909   8.640   1.00 0.00 ? 54  LEU A C    6  
ATOM 7954  O O    . LEU A 1 54  ? -6.342  2.962   8.780   1.00 0.00 ? 54  LEU A O    6  
ATOM 7955  C CB   . LEU A 1 54  ? -6.876  -0.212  9.496   1.00 0.00 ? 54  LEU A CB   6  
ATOM 7956  C CG   . LEU A 1 54  ? -7.774  -1.416  9.209   1.00 0.00 ? 54  LEU A CG   6  
ATOM 7957  C CD1  . LEU A 1 54  ? -7.829  -2.359  10.413  1.00 0.00 ? 54  LEU A CD1  6  
ATOM 7958  C CD2  . LEU A 1 54  ? -9.169  -0.967  8.769   1.00 0.00 ? 54  LEU A CD2  6  
ATOM 7959  H H    . LEU A 1 54  ? -5.243  -1.004  7.791   1.00 0.00 ? 54  LEU A H    6  
ATOM 7960  H HA   . LEU A 1 54  ? -7.365  0.876   7.737   1.00 0.00 ? 54  LEU A HA   6  
ATOM 7961  H HB2  . LEU A 1 54  ? -5.975  -0.566  9.997   1.00 0.00 ? 54  LEU A HB2  6  
ATOM 7962  H HB3  . LEU A 1 54  ? -7.393  0.444   10.196  1.00 0.00 ? 54  LEU A HB3  6  
ATOM 7963  H HG   . LEU A 1 54  ? -7.340  -1.977  8.381   1.00 0.00 ? 54  LEU A HG   6  
ATOM 7964  H HD11 . LEU A 1 54  ? -6.821  -2.697  10.656  1.00 0.00 ? 54  LEU A HD11 6  
ATOM 7965  H HD12 . LEU A 1 54  ? -8.251  -1.831  11.269  1.00 0.00 ? 54  LEU A HD12 6  
ATOM 7966  H HD13 . LEU A 1 54  ? -8.453  -3.219  10.173  1.00 0.00 ? 54  LEU A HD13 6  
ATOM 7967  H HD21 . LEU A 1 54  ? -9.803  -1.842  8.621   1.00 0.00 ? 54  LEU A HD21 6  
ATOM 7968  H HD22 . LEU A 1 54  ? -9.605  -0.329  9.537   1.00 0.00 ? 54  LEU A HD22 6  
ATOM 7969  H HD23 . LEU A 1 54  ? -9.094  -0.412  7.834   1.00 0.00 ? 54  LEU A HD23 6  
ATOM 7970  N N    . SER A 1 55  ? -4.409  1.787   8.780   1.00 0.00 ? 55  SER A N    6  
ATOM 7971  C CA   . SER A 1 55  ? -3.583  2.933   9.121   1.00 0.00 ? 55  SER A CA   6  
ATOM 7972  C C    . SER A 1 55  ? -2.235  2.839   8.403   1.00 0.00 ? 55  SER A C    6  
ATOM 7973  O O    . SER A 1 55  ? -1.860  1.773   7.918   1.00 0.00 ? 55  SER A O    6  
ATOM 7974  C CB   . SER A 1 55  ? -3.373  3.030   10.634  1.00 0.00 ? 55  SER A CB   6  
ATOM 7975  O OG   . SER A 1 55  ? -3.011  1.775   11.204  1.00 0.00 ? 55  SER A OG   6  
ATOM 7976  H H    . SER A 1 55  ? -3.912  0.928   8.664   1.00 0.00 ? 55  SER A H    6  
ATOM 7977  H HA   . SER A 1 55  ? -4.141  3.804   8.776   1.00 0.00 ? 55  SER A HA   6  
ATOM 7978  H HB2  . SER A 1 55  ? -2.594  3.762   10.845  1.00 0.00 ? 55  SER A HB2  6  
ATOM 7979  H HB3  . SER A 1 55  ? -4.287  3.391   11.104  1.00 0.00 ? 55  SER A HB3  6  
ATOM 7980  H HG   . SER A 1 55  ? -3.780  1.401   11.723  1.00 0.00 ? 55  SER A HG   6  
ATOM 7981  N N    . ILE A 1 56  ? -1.545  3.969   8.359   1.00 0.00 ? 56  ILE A N    6  
ATOM 7982  C CA   . ILE A 1 56  ? -0.247  4.027   7.708   1.00 0.00 ? 56  ILE A CA   6  
ATOM 7983  C C    . ILE A 1 56  ? 0.721   4.830   8.581   1.00 0.00 ? 56  ILE A C    6  
ATOM 7984  O O    . ILE A 1 56  ? 0.820   6.048   8.445   1.00 0.00 ? 56  ILE A O    6  
ATOM 7985  C CB   . ILE A 1 56  ? -0.385  4.569   6.284   1.00 0.00 ? 56  ILE A CB   6  
ATOM 7986  C CG1  . ILE A 1 56  ? -0.968  3.509   5.348   1.00 0.00 ? 56  ILE A CG1  6  
ATOM 7987  C CG2  . ILE A 1 56  ? 0.950   5.113   5.773   1.00 0.00 ? 56  ILE A CG2  6  
ATOM 7988  C CD1  . ILE A 1 56  ? -1.305  4.109   3.982   1.00 0.00 ? 56  ILE A CD1  6  
ATOM 7989  H H    . ILE A 1 56  ? -1.857  4.831   8.756   1.00 0.00 ? 56  ILE A H    6  
ATOM 7990  H HA   . ILE A 1 56  ? 0.125   3.005   7.629   1.00 0.00 ? 56  ILE A HA   6  
ATOM 7991  H HB   . ILE A 1 56  ? -1.086  5.403   6.303   1.00 0.00 ? 56  ILE A HB   6  
ATOM 7992  H HG12 . ILE A 1 56  ? -0.254  2.694   5.225   1.00 0.00 ? 56  ILE A HG12 6  
ATOM 7993  H HG13 . ILE A 1 56  ? -1.866  3.080   5.792   1.00 0.00 ? 56  ILE A HG13 6  
ATOM 7994  H HG21 . ILE A 1 56  ? 1.071   4.851   4.722   1.00 0.00 ? 56  ILE A HG21 6  
ATOM 7995  H HG22 . ILE A 1 56  ? 0.966   6.198   5.881   1.00 0.00 ? 56  ILE A HG22 6  
ATOM 7996  H HG23 . ILE A 1 56  ? 1.766   4.679   6.351   1.00 0.00 ? 56  ILE A HG23 6  
ATOM 7997  H HD11 . ILE A 1 56  ? -1.742  5.098   4.117   1.00 0.00 ? 56  ILE A HD11 6  
ATOM 7998  H HD12 . ILE A 1 56  ? -0.395  4.192   3.387   1.00 0.00 ? 56  ILE A HD12 6  
ATOM 7999  H HD13 . ILE A 1 56  ? -2.017  3.464   3.467   1.00 0.00 ? 56  ILE A HD13 6  
ATOM 8000  N N    . ASP A 1 57  ? 1.410   4.114   9.457   1.00 0.00 ? 57  ASP A N    6  
ATOM 8001  C CA   . ASP A 1 57  ? 2.366   4.744   10.352  1.00 0.00 ? 57  ASP A CA   6  
ATOM 8002  C C    . ASP A 1 57  ? 1.611   5.552   11.410  1.00 0.00 ? 57  ASP A C    6  
ATOM 8003  O O    . ASP A 1 57  ? 1.922   6.719   11.642  1.00 0.00 ? 57  ASP A O    6  
ATOM 8004  C CB   . ASP A 1 57  ? 3.283   5.703   9.590   1.00 0.00 ? 57  ASP A CB   6  
ATOM 8005  C CG   . ASP A 1 57  ? 4.658   5.922   10.224  1.00 0.00 ? 57  ASP A CG   6  
ATOM 8006  O OD1  . ASP A 1 57  ? 4.917   5.269   11.258  1.00 0.00 ? 57  ASP A OD1  6  
ATOM 8007  O OD2  . ASP A 1 57  ? 5.420   6.737   9.660   1.00 0.00 ? 57  ASP A OD2  6  
ATOM 8008  H H    . ASP A 1 57  ? 1.323   3.123   9.561   1.00 0.00 ? 57  ASP A H    6  
ATOM 8009  H HA   . ASP A 1 57  ? 2.938   3.923   10.783  1.00 0.00 ? 57  ASP A HA   6  
ATOM 8010  H HB2  . ASP A 1 57  ? 3.422   5.322   8.578   1.00 0.00 ? 57  ASP A HB2  6  
ATOM 8011  H HB3  . ASP A 1 57  ? 2.783   6.667   9.501   1.00 0.00 ? 57  ASP A HB3  6  
ATOM 8012  N N    . GLY A 1 58  ? 0.636   4.898   12.023  1.00 0.00 ? 58  GLY A N    6  
ATOM 8013  C CA   . GLY A 1 58  ? -0.165  5.541   13.051  1.00 0.00 ? 58  GLY A CA   6  
ATOM 8014  C C    . GLY A 1 58  ? -1.064  6.623   12.449  1.00 0.00 ? 58  GLY A C    6  
ATOM 8015  O O    . GLY A 1 58  ? -1.675  7.404   13.178  1.00 0.00 ? 58  GLY A O    6  
ATOM 8016  H H    . GLY A 1 58  ? 0.390   3.949   11.828  1.00 0.00 ? 58  GLY A H    6  
ATOM 8017  H HA2  . GLY A 1 58  ? -0.778  4.796   13.559  1.00 0.00 ? 58  GLY A HA2  6  
ATOM 8018  H HA3  . GLY A 1 58  ? 0.489   5.983   13.803  1.00 0.00 ? 58  GLY A HA3  6  
ATOM 8019  N N    . ILE A 1 59  ? -1.115  6.636   11.125  1.00 0.00 ? 59  ILE A N    6  
ATOM 8020  C CA   . ILE A 1 59  ? -1.929  7.610   10.417  1.00 0.00 ? 59  ILE A CA   6  
ATOM 8021  C C    . ILE A 1 59  ? -3.178  6.920   9.866   1.00 0.00 ? 59  ILE A C    6  
ATOM 8022  O O    . ILE A 1 59  ? -3.087  5.845   9.275   1.00 0.00 ? 59  ILE A O    6  
ATOM 8023  C CB   . ILE A 1 59  ? -1.099  8.326   9.350   1.00 0.00 ? 59  ILE A CB   6  
ATOM 8024  C CG1  . ILE A 1 59  ? 0.137   8.985   9.966   1.00 0.00 ? 59  ILE A CG1  6  
ATOM 8025  C CG2  . ILE A 1 59  ? -1.954  9.327   8.571   1.00 0.00 ? 59  ILE A CG2  6  
ATOM 8026  C CD1  . ILE A 1 59  ? -0.229  10.302  10.654  1.00 0.00 ? 59  ILE A CD1  6  
ATOM 8027  H H    . ILE A 1 59  ? -0.615  5.998   10.540  1.00 0.00 ? 59  ILE A H    6  
ATOM 8028  H HA   . ILE A 1 59  ? -2.241  8.363   11.141  1.00 0.00 ? 59  ILE A HA   6  
ATOM 8029  H HB   . ILE A 1 59  ? -0.745  7.582   8.636   1.00 0.00 ? 59  ILE A HB   6  
ATOM 8030  H HG12 . ILE A 1 59  ? 0.592   8.308   10.688  1.00 0.00 ? 59  ILE A HG12 6  
ATOM 8031  H HG13 . ILE A 1 59  ? 0.880   9.170   9.190   1.00 0.00 ? 59  ILE A HG13 6  
ATOM 8032  H HG21 . ILE A 1 59  ? -1.489  10.312  8.612   1.00 0.00 ? 59  ILE A HG21 6  
ATOM 8033  H HG22 . ILE A 1 59  ? -2.034  9.007   7.532   1.00 0.00 ? 59  ILE A HG22 6  
ATOM 8034  H HG23 . ILE A 1 59  ? -2.949  9.377   9.013   1.00 0.00 ? 59  ILE A HG23 6  
ATOM 8035  H HD11 . ILE A 1 59  ? -0.095  11.127  9.954   1.00 0.00 ? 59  ILE A HD11 6  
ATOM 8036  H HD12 . ILE A 1 59  ? -1.270  10.265  10.977  1.00 0.00 ? 59  ILE A HD12 6  
ATOM 8037  H HD13 . ILE A 1 59  ? 0.416   10.451  11.520  1.00 0.00 ? 59  ILE A HD13 6  
ATOM 8038  N N    . SER A 1 60  ? -4.314  7.567   10.077  1.00 0.00 ? 60  SER A N    6  
ATOM 8039  C CA   . SER A 1 60  ? -5.580  7.029   9.608   1.00 0.00 ? 60  SER A CA   6  
ATOM 8040  C C    . SER A 1 60  ? -5.629  7.064   8.079   1.00 0.00 ? 60  SER A C    6  
ATOM 8041  O O    . SER A 1 60  ? -5.505  8.128   7.475   1.00 0.00 ? 60  SER A O    6  
ATOM 8042  C CB   . SER A 1 60  ? -6.760  7.806   10.195  1.00 0.00 ? 60  SER A CB   6  
ATOM 8043  O OG   . SER A 1 60  ? -7.568  6.992   11.040  1.00 0.00 ? 60  SER A OG   6  
ATOM 8044  H H    . SER A 1 60  ? -4.379  8.441   10.558  1.00 0.00 ? 60  SER A H    6  
ATOM 8045  H HA   . SER A 1 60  ? -5.608  6.001   9.969   1.00 0.00 ? 60  SER A HA   6  
ATOM 8046  H HB2  . SER A 1 60  ? -6.386  8.658   10.763  1.00 0.00 ? 60  SER A HB2  6  
ATOM 8047  H HB3  . SER A 1 60  ? -7.370  8.205   9.385   1.00 0.00 ? 60  SER A HB3  6  
ATOM 8048  H HG   . SER A 1 60  ? -7.103  6.835   11.911  1.00 0.00 ? 60  SER A HG   6  
ATOM 8049  N N    . ALA A 1 61  ? -5.810  5.887   7.498   1.00 0.00 ? 61  ALA A N    6  
ATOM 8050  C CA   . ALA A 1 61  ? -5.878  5.770   6.051   1.00 0.00 ? 61  ALA A CA   6  
ATOM 8051  C C    . ALA A 1 61  ? -7.336  5.880   5.602   1.00 0.00 ? 61  ALA A C    6  
ATOM 8052  O O    . ALA A 1 61  ? -7.691  5.424   4.516   1.00 0.00 ? 61  ALA A O    6  
ATOM 8053  C CB   . ALA A 1 61  ? -5.231  4.454   5.615   1.00 0.00 ? 61  ALA A CB   6  
ATOM 8054  H H    . ALA A 1 61  ? -5.911  5.026   7.997   1.00 0.00 ? 61  ALA A H    6  
ATOM 8055  H HA   . ALA A 1 61  ? -5.311  6.598   5.624   1.00 0.00 ? 61  ALA A HA   6  
ATOM 8056  H HB1  . ALA A 1 61  ? -4.772  4.582   4.635   1.00 0.00 ? 61  ALA A HB1  6  
ATOM 8057  H HB2  . ALA A 1 61  ? -4.468  4.166   6.339   1.00 0.00 ? 61  ALA A HB2  6  
ATOM 8058  H HB3  . ALA A 1 61  ? -5.992  3.675   5.561   1.00 0.00 ? 61  ALA A HB3  6  
ATOM 8059  N N    . GLN A 1 62  ? -8.142  6.487   6.460   1.00 0.00 ? 62  GLN A N    6  
ATOM 8060  C CA   . GLN A 1 62  ? -9.554  6.663   6.166   1.00 0.00 ? 62  GLN A CA   6  
ATOM 8061  C C    . GLN A 1 62  ? -9.781  7.980   5.422   1.00 0.00 ? 62  GLN A C    6  
ATOM 8062  O O    . GLN A 1 62  ? -9.799  9.047   6.034   1.00 0.00 ? 62  GLN A O    6  
ATOM 8063  C CB   . GLN A 1 62  ? -10.393 6.602   7.444   1.00 0.00 ? 62  GLN A CB   6  
ATOM 8064  C CG   . GLN A 1 62  ? -10.231 5.251   8.143   1.00 0.00 ? 62  GLN A CG   6  
ATOM 8065  C CD   . GLN A 1 62  ? -11.335 5.034   9.180   1.00 0.00 ? 62  GLN A CD   6  
ATOM 8066  O OE1  . GLN A 1 62  ? -12.514 5.205   8.914   1.00 0.00 ? 62  GLN A OE1  6  
ATOM 8067  N NE2  . GLN A 1 62  ? -10.889 4.650   10.372  1.00 0.00 ? 62  GLN A NE2  6  
ATOM 8068  H H    . GLN A 1 62  ? -7.846  6.855   7.342   1.00 0.00 ? 62  GLN A H    6  
ATOM 8069  H HA   . GLN A 1 62  ? -9.822  5.824   5.523   1.00 0.00 ? 62  GLN A HA   6  
ATOM 8070  H HB2  . GLN A 1 62  ? -10.091 7.403   8.119   1.00 0.00 ? 62  GLN A HB2  6  
ATOM 8071  H HB3  . GLN A 1 62  ? -11.443 6.768   7.202   1.00 0.00 ? 62  GLN A HB3  6  
ATOM 8072  H HG2  . GLN A 1 62  ? -10.259 4.450   7.404   1.00 0.00 ? 62  GLN A HG2  6  
ATOM 8073  H HG3  . GLN A 1 62  ? -9.257  5.203   8.628   1.00 0.00 ? 62  GLN A HG3  6  
ATOM 8074  H HE21 . GLN A 1 62  ? -9.908  4.528   10.524  1.00 0.00 ? 62  GLN A HE21 6  
ATOM 8075  H HE22 . GLN A 1 62  ? -11.535 4.483   11.117  1.00 0.00 ? 62  GLN A HE22 6  
ATOM 8076  N N    . GLY A 1 63  ? -9.949  7.863   4.113   1.00 0.00 ? 63  GLY A N    6  
ATOM 8077  C CA   . GLY A 1 63  ? -10.174 9.032   3.280   1.00 0.00 ? 63  GLY A CA   6  
ATOM 8078  C C    . GLY A 1 63  ? -8.934  9.358   2.446   1.00 0.00 ? 63  GLY A C    6  
ATOM 8079  O O    . GLY A 1 63  ? -9.044  9.696   1.269   1.00 0.00 ? 63  GLY A O    6  
ATOM 8080  H H    . GLY A 1 63  ? -9.933  6.992   3.623   1.00 0.00 ? 63  GLY A H    6  
ATOM 8081  H HA2  . GLY A 1 63  ? -11.024 8.855   2.620   1.00 0.00 ? 63  GLY A HA2  6  
ATOM 8082  H HA3  . GLY A 1 63  ? -10.430 9.886   3.907   1.00 0.00 ? 63  GLY A HA3  6  
ATOM 8083  N N    . MET A 1 64  ? -7.781  9.245   3.089   1.00 0.00 ? 64  MET A N    6  
ATOM 8084  C CA   . MET A 1 64  ? -6.521  9.524   2.422   1.00 0.00 ? 64  MET A CA   6  
ATOM 8085  C C    . MET A 1 64  ? -6.473  8.863   1.043   1.00 0.00 ? 64  MET A C    6  
ATOM 8086  O O    . MET A 1 64  ? -6.796  7.684   0.904   1.00 0.00 ? 64  MET A O    6  
ATOM 8087  C CB   . MET A 1 64  ? -5.364  9.005   3.278   1.00 0.00 ? 64  MET A CB   6  
ATOM 8088  C CG   . MET A 1 64  ? -5.132  9.907   4.492   1.00 0.00 ? 64  MET A CG   6  
ATOM 8089  S SD   . MET A 1 64  ? -3.389  9.989   4.868   1.00 0.00 ? 64  MET A SD   6  
ATOM 8090  C CE   . MET A 1 64  ? -3.096  8.294   5.347   1.00 0.00 ? 64  MET A CE   6  
ATOM 8091  H H    . MET A 1 64  ? -7.700  8.970   4.047   1.00 0.00 ? 64  MET A H    6  
ATOM 8092  H HA   . MET A 1 64  ? -6.480  10.608  2.315   1.00 0.00 ? 64  MET A HA   6  
ATOM 8093  H HB2  . MET A 1 64  ? -5.580  7.990   3.611   1.00 0.00 ? 64  MET A HB2  6  
ATOM 8094  H HB3  . MET A 1 64  ? -4.455  8.957   2.677   1.00 0.00 ? 64  MET A HB3  6  
ATOM 8095  H HG2  . MET A 1 64  ? -5.516  10.907  4.290   1.00 0.00 ? 64  MET A HG2  6  
ATOM 8096  H HG3  . MET A 1 64  ? -5.680  9.522   5.351   1.00 0.00 ? 64  MET A HG3  6  
ATOM 8097  H HE1  . MET A 1 64  ? -3.673  8.065   6.242   1.00 0.00 ? 64  MET A HE1  6  
ATOM 8098  H HE2  . MET A 1 64  ? -3.400  7.630   4.538   1.00 0.00 ? 64  MET A HE2  6  
ATOM 8099  H HE3  . MET A 1 64  ? -2.035  8.153   5.553   1.00 0.00 ? 64  MET A HE3  6  
ATOM 8100  N N    . THR A 1 65  ? -6.066  9.651   0.058   1.00 0.00 ? 65  THR A N    6  
ATOM 8101  C CA   . THR A 1 65  ? -5.972  9.156   -1.305  1.00 0.00 ? 65  THR A CA   6  
ATOM 8102  C C    . THR A 1 65  ? -4.750  8.248   -1.460  1.00 0.00 ? 65  THR A C    6  
ATOM 8103  O O    . THR A 1 65  ? -3.925  8.153   -0.553  1.00 0.00 ? 65  THR A O    6  
ATOM 8104  C CB   . THR A 1 65  ? -5.955  10.363  -2.245  1.00 0.00 ? 65  THR A CB   6  
ATOM 8105  O OG1  . THR A 1 65  ? -5.139  11.317  -1.572  1.00 0.00 ? 65  THR A OG1  6  
ATOM 8106  C CG2  . THR A 1 65  ? -7.321  11.046  -2.346  1.00 0.00 ? 65  THR A CG2  6  
ATOM 8107  H H    . THR A 1 65  ? -5.805  10.608  0.180   1.00 0.00 ? 65  THR A H    6  
ATOM 8108  H HA   . THR A 1 65  ? -6.852  8.546   -1.511  1.00 0.00 ? 65  THR A HA   6  
ATOM 8109  H HB   . THR A 1 65  ? -5.586  10.082  -3.232  1.00 0.00 ? 65  THR A HB   6  
ATOM 8110  H HG1  . THR A 1 65  ? -4.287  10.887  -1.272  1.00 0.00 ? 65  THR A HG1  6  
ATOM 8111  H HG21 . THR A 1 65  ? -7.777  10.806  -3.306  1.00 0.00 ? 65  THR A HG21 6  
ATOM 8112  H HG22 . THR A 1 65  ? -7.964  10.693  -1.540  1.00 0.00 ? 65  THR A HG22 6  
ATOM 8113  H HG23 . THR A 1 65  ? -7.194  12.125  -2.264  1.00 0.00 ? 65  THR A HG23 6  
ATOM 8114  N N    . HIS A 1 66  ? -4.673  7.605   -2.615  1.00 0.00 ? 66  HIS A N    6  
ATOM 8115  C CA   . HIS A 1 66  ? -3.566  6.708   -2.900  1.00 0.00 ? 66  HIS A CA   6  
ATOM 8116  C C    . HIS A 1 66  ? -2.242  7.450   -2.707  1.00 0.00 ? 66  HIS A C    6  
ATOM 8117  O O    . HIS A 1 66  ? -1.396  7.023   -1.923  1.00 0.00 ? 66  HIS A O    6  
ATOM 8118  C CB   . HIS A 1 66  ? -3.706  6.099   -4.297  1.00 0.00 ? 66  HIS A CB   6  
ATOM 8119  C CG   . HIS A 1 66  ? -3.018  4.764   -4.456  1.00 0.00 ? 66  HIS A CG   6  
ATOM 8120  N ND1  . HIS A 1 66  ? -2.300  4.421   -5.589  1.00 0.00 ? 66  HIS A ND1  6  
ATOM 8121  C CD2  . HIS A 1 66  ? -2.946  3.693   -3.615  1.00 0.00 ? 66  HIS A CD2  6  
ATOM 8122  C CE1  . HIS A 1 66  ? -1.822  3.197   -5.426  1.00 0.00 ? 66  HIS A CE1  6  
ATOM 8123  N NE2  . HIS A 1 66  ? -2.224  2.746   -4.203  1.00 0.00 ? 66  HIS A NE2  6  
ATOM 8124  H H    . HIS A 1 66  ? -5.349  7.689   -3.348  1.00 0.00 ? 66  HIS A H    6  
ATOM 8125  H HA   . HIS A 1 66  ? -3.627  5.896   -2.176  1.00 0.00 ? 66  HIS A HA   6  
ATOM 8126  H HB2  . HIS A 1 66  ? -4.765  5.980   -4.526  1.00 0.00 ? 66  HIS A HB2  6  
ATOM 8127  H HB3  . HIS A 1 66  ? -3.298  6.796   -5.029  1.00 0.00 ? 66  HIS A HB3  6  
ATOM 8128  H HD1  . HIS A 1 66  ? -2.165  5.000   -6.393  1.00 0.00 ? 66  HIS A HD1  6  
ATOM 8129  H HD2  . HIS A 1 66  ? -3.403  3.626   -2.628  1.00 0.00 ? 66  HIS A HD2  6  
ATOM 8130  H HE1  . HIS A 1 66  ? -1.215  2.645   -6.144  1.00 0.00 ? 66  HIS A HE1  6  
ATOM 8131  N N    . LEU A 1 67  ? -2.104  8.548   -3.436  1.00 0.00 ? 67  LEU A N    6  
ATOM 8132  C CA   . LEU A 1 67  ? -0.897  9.353   -3.354  1.00 0.00 ? 67  LEU A CA   6  
ATOM 8133  C C    . LEU A 1 67  ? -0.558  9.609   -1.884  1.00 0.00 ? 67  LEU A C    6  
ATOM 8134  O O    . LEU A 1 67  ? 0.573   9.385   -1.456  1.00 0.00 ? 67  LEU A O    6  
ATOM 8135  C CB   . LEU A 1 67  ? -1.049  10.631  -4.182  1.00 0.00 ? 67  LEU A CB   6  
ATOM 8136  C CG   . LEU A 1 67  ? -0.525  11.915  -3.536  1.00 0.00 ? 67  LEU A CG   6  
ATOM 8137  C CD1  . LEU A 1 67  ? -1.493  12.425  -2.467  1.00 0.00 ? 67  LEU A CD1  6  
ATOM 8138  C CD2  . LEU A 1 67  ? 0.887   11.713  -2.982  1.00 0.00 ? 67  LEU A CD2  6  
ATOM 8139  H H    . LEU A 1 67  ? -2.797  8.888   -4.071  1.00 0.00 ? 67  LEU A H    6  
ATOM 8140  H HA   . LEU A 1 67  ? -0.088  8.775   -3.800  1.00 0.00 ? 67  LEU A HA   6  
ATOM 8141  H HB2  . LEU A 1 67  ? -0.532  10.489  -5.131  1.00 0.00 ? 67  LEU A HB2  6  
ATOM 8142  H HB3  . LEU A 1 67  ? -2.105  10.768  -4.412  1.00 0.00 ? 67  LEU A HB3  6  
ATOM 8143  H HG   . LEU A 1 67  ? -0.462  12.684  -4.306  1.00 0.00 ? 67  LEU A HG   6  
ATOM 8144  H HD11 . LEU A 1 67  ? -1.057  12.272  -1.479  1.00 0.00 ? 67  LEU A HD11 6  
ATOM 8145  H HD12 . LEU A 1 67  ? -1.678  13.488  -2.621  1.00 0.00 ? 67  LEU A HD12 6  
ATOM 8146  H HD13 . LEU A 1 67  ? -2.433  11.878  -2.537  1.00 0.00 ? 67  LEU A HD13 6  
ATOM 8147  H HD21 . LEU A 1 67  ? 1.487   12.601  -3.184  1.00 0.00 ? 67  LEU A HD21 6  
ATOM 8148  H HD22 . LEU A 1 67  ? 0.835   11.547  -1.906  1.00 0.00 ? 67  LEU A HD22 6  
ATOM 8149  H HD23 . LEU A 1 67  ? 1.345   10.848  -3.461  1.00 0.00 ? 67  LEU A HD23 6  
ATOM 8150  N N    . GLU A 1 68  ? -1.559  10.076  -1.152  1.00 0.00 ? 68  GLU A N    6  
ATOM 8151  C CA   . GLU A 1 68  ? -1.381  10.365  0.261   1.00 0.00 ? 68  GLU A CA   6  
ATOM 8152  C C    . GLU A 1 68  ? -0.724  9.178   0.967   1.00 0.00 ? 68  GLU A C    6  
ATOM 8153  O O    . GLU A 1 68  ? 0.399   9.286   1.456   1.00 0.00 ? 68  GLU A O    6  
ATOM 8154  C CB   . GLU A 1 68  ? -2.715  10.725  0.919   1.00 0.00 ? 68  GLU A CB   6  
ATOM 8155  C CG   . GLU A 1 68  ? -3.048  12.203  0.710   1.00 0.00 ? 68  GLU A CG   6  
ATOM 8156  C CD   . GLU A 1 68  ? -3.291  12.905  2.047   1.00 0.00 ? 68  GLU A CD   6  
ATOM 8157  O OE1  . GLU A 1 68  ? -2.288  13.356  2.642   1.00 0.00 ? 68  GLU A OE1  6  
ATOM 8158  O OE2  . GLU A 1 68  ? -4.474  12.975  2.445   1.00 0.00 ? 68  GLU A OE2  6  
ATOM 8159  H H    . GLU A 1 68  ? -2.476  10.256  -1.508  1.00 0.00 ? 68  GLU A H    6  
ATOM 8160  H HA   . GLU A 1 68  ? -0.720  11.230  0.298   1.00 0.00 ? 68  GLU A HA   6  
ATOM 8161  H HB2  . GLU A 1 68  ? -3.509  10.107  0.501   1.00 0.00 ? 68  GLU A HB2  6  
ATOM 8162  H HB3  . GLU A 1 68  ? -2.669  10.506  1.986   1.00 0.00 ? 68  GLU A HB3  6  
ATOM 8163  H HG2  . GLU A 1 68  ? -2.230  12.693  0.181   1.00 0.00 ? 68  GLU A HG2  6  
ATOM 8164  H HG3  . GLU A 1 68  ? -3.934  12.295  0.081   1.00 0.00 ? 68  GLU A HG3  6  
ATOM 8165  N N    . ALA A 1 69  ? -1.452  8.071   0.998   1.00 0.00 ? 69  ALA A N    6  
ATOM 8166  C CA   . ALA A 1 69  ? -0.954  6.865   1.636   1.00 0.00 ? 69  ALA A CA   6  
ATOM 8167  C C    . ALA A 1 69  ? 0.472   6.591   1.155   1.00 0.00 ? 69  ALA A C    6  
ATOM 8168  O O    . ALA A 1 69  ? 1.321   6.159   1.934   1.00 0.00 ? 69  ALA A O    6  
ATOM 8169  C CB   . ALA A 1 69  ? -1.903  5.701   1.340   1.00 0.00 ? 69  ALA A CB   6  
ATOM 8170  H H    . ALA A 1 69  ? -2.365  7.991   0.597   1.00 0.00 ? 69  ALA A H    6  
ATOM 8171  H HA   . ALA A 1 69  ? -0.939  7.040   2.712   1.00 0.00 ? 69  ALA A HA   6  
ATOM 8172  H HB1  . ALA A 1 69  ? -1.331  4.776   1.268   1.00 0.00 ? 69  ALA A HB1  6  
ATOM 8173  H HB2  . ALA A 1 69  ? -2.635  5.616   2.143   1.00 0.00 ? 69  ALA A HB2  6  
ATOM 8174  H HB3  . ALA A 1 69  ? -2.418  5.884   0.397   1.00 0.00 ? 69  ALA A HB3  6  
ATOM 8175  N N    . GLN A 1 70  ? 0.692   6.853   -0.125  1.00 0.00 ? 70  GLN A N    6  
ATOM 8176  C CA   . GLN A 1 70  ? 2.001   6.640   -0.718  1.00 0.00 ? 70  GLN A CA   6  
ATOM 8177  C C    . GLN A 1 70  ? 3.006   7.651   -0.164  1.00 0.00 ? 70  GLN A C    6  
ATOM 8178  O O    . GLN A 1 70  ? 4.171   7.320   0.051   1.00 0.00 ? 70  GLN A O    6  
ATOM 8179  C CB   . GLN A 1 70  ? 1.930   6.717   -2.244  1.00 0.00 ? 70  GLN A CB   6  
ATOM 8180  C CG   . GLN A 1 70  ? 0.987   5.650   -2.804  1.00 0.00 ? 70  GLN A CG   6  
ATOM 8181  C CD   . GLN A 1 70  ? 1.700   4.777   -3.839  1.00 0.00 ? 70  GLN A CD   6  
ATOM 8182  O OE1  . GLN A 1 70  ? 2.744   4.199   -3.588  1.00 0.00 ? 70  GLN A OE1  6  
ATOM 8183  N NE2  . GLN A 1 70  ? 1.079   4.715   -5.014  1.00 0.00 ? 70  GLN A NE2  6  
ATOM 8184  H H    . GLN A 1 70  ? -0.004  7.204   -0.751  1.00 0.00 ? 70  GLN A H    6  
ATOM 8185  H HA   . GLN A 1 70  ? 2.291   5.631   -0.425  1.00 0.00 ? 70  GLN A HA   6  
ATOM 8186  H HB2  . GLN A 1 70  ? 1.586   7.706   -2.547  1.00 0.00 ? 70  GLN A HB2  6  
ATOM 8187  H HB3  . GLN A 1 70  ? 2.927   6.584   -2.666  1.00 0.00 ? 70  GLN A HB3  6  
ATOM 8188  H HG2  . GLN A 1 70  ? 0.614   5.027   -1.992  1.00 0.00 ? 70  GLN A HG2  6  
ATOM 8189  H HG3  . GLN A 1 70  ? 0.121   6.129   -3.262  1.00 0.00 ? 70  GLN A HG3  6  
ATOM 8190  H HE21 . GLN A 1 70  ? 0.224   5.214   -5.154  1.00 0.00 ? 70  GLN A HE21 6  
ATOM 8191  H HE22 . GLN A 1 70  ? 1.467   4.168   -5.756  1.00 0.00 ? 70  GLN A HE22 6  
ATOM 8192  N N    . ASN A 1 71  ? 2.519   8.865   0.051   1.00 0.00 ? 71  ASN A N    6  
ATOM 8193  C CA   . ASN A 1 71  ? 3.360   9.927   0.576   1.00 0.00 ? 71  ASN A CA   6  
ATOM 8194  C C    . ASN A 1 71  ? 3.929   9.498   1.930   1.00 0.00 ? 71  ASN A C    6  
ATOM 8195  O O    . ASN A 1 71  ? 5.129   9.623   2.170   1.00 0.00 ? 71  ASN A O    6  
ATOM 8196  C CB   . ASN A 1 71  ? 2.557   11.212  0.787   1.00 0.00 ? 71  ASN A CB   6  
ATOM 8197  C CG   . ASN A 1 71  ? 3.015   12.308  -0.178  1.00 0.00 ? 71  ASN A CG   6  
ATOM 8198  O OD1  . ASN A 1 71  ? 4.191   12.471  -0.460  1.00 0.00 ? 71  ASN A OD1  6  
ATOM 8199  N ND2  . ASN A 1 71  ? 2.024   13.049  -0.665  1.00 0.00 ? 71  ASN A ND2  6  
ATOM 8200  H H    . ASN A 1 71  ? 1.570   9.126   -0.127  1.00 0.00 ? 71  ASN A H    6  
ATOM 8201  H HA   . ASN A 1 71  ? 4.136   10.075  -0.174  1.00 0.00 ? 71  ASN A HA   6  
ATOM 8202  H HB2  . ASN A 1 71  ? 1.496   11.011  0.637   1.00 0.00 ? 71  ASN A HB2  6  
ATOM 8203  H HB3  . ASN A 1 71  ? 2.675   11.555  1.815   1.00 0.00 ? 71  ASN A HB3  6  
ATOM 8204  H HD21 . ASN A 1 71  ? 1.080   12.863  -0.392  1.00 0.00 ? 71  ASN A HD21 6  
ATOM 8205  H HD22 . ASN A 1 71  ? 2.222   13.792  -1.304  1.00 0.00 ? 71  ASN A HD22 6  
ATOM 8206  N N    . LYS A 1 72  ? 3.042   9.002   2.779   1.00 0.00 ? 72  LYS A N    6  
ATOM 8207  C CA   . LYS A 1 72  ? 3.441   8.555   4.103   1.00 0.00 ? 72  LYS A CA   6  
ATOM 8208  C C    . LYS A 1 72  ? 4.509   7.467   3.968   1.00 0.00 ? 72  LYS A C    6  
ATOM 8209  O O    . LYS A 1 72  ? 5.554   7.535   4.614   1.00 0.00 ? 72  LYS A O    6  
ATOM 8210  C CB   . LYS A 1 72  ? 2.218   8.119   4.913   1.00 0.00 ? 72  LYS A CB   6  
ATOM 8211  C CG   . LYS A 1 72  ? 1.426   9.332   5.405   1.00 0.00 ? 72  LYS A CG   6  
ATOM 8212  C CD   . LYS A 1 72  ? 2.163   10.043  6.541   1.00 0.00 ? 72  LYS A CD   6  
ATOM 8213  C CE   . LYS A 1 72  ? 1.196   10.873  7.388   1.00 0.00 ? 72  LYS A CE   6  
ATOM 8214  N NZ   . LYS A 1 72  ? 0.798   12.102  6.665   1.00 0.00 ? 72  LYS A NZ   6  
ATOM 8215  H H    . LYS A 1 72  ? 2.067   8.904   2.576   1.00 0.00 ? 72  LYS A H    6  
ATOM 8216  H HA   . LYS A 1 72  ? 3.881   9.409   4.618   1.00 0.00 ? 72  LYS A HA   6  
ATOM 8217  H HB2  . LYS A 1 72  ? 1.577   7.486   4.299   1.00 0.00 ? 72  LYS A HB2  6  
ATOM 8218  H HB3  . LYS A 1 72  ? 2.537   7.518   5.764   1.00 0.00 ? 72  LYS A HB3  6  
ATOM 8219  H HG2  . LYS A 1 72  ? 1.266   10.025  4.580   1.00 0.00 ? 72  LYS A HG2  6  
ATOM 8220  H HG3  . LYS A 1 72  ? 0.442   9.012   5.749   1.00 0.00 ? 72  LYS A HG3  6  
ATOM 8221  H HD2  . LYS A 1 72  ? 2.665   9.309   7.171   1.00 0.00 ? 72  LYS A HD2  6  
ATOM 8222  H HD3  . LYS A 1 72  ? 2.937   10.690  6.128   1.00 0.00 ? 72  LYS A HD3  6  
ATOM 8223  H HE2  . LYS A 1 72  ? 0.312   10.281  7.625   1.00 0.00 ? 72  LYS A HE2  6  
ATOM 8224  H HE3  . LYS A 1 72  ? 1.666   11.137  8.335   1.00 0.00 ? 72  LYS A HE3  6  
ATOM 8225  H HZ1  . LYS A 1 72  ? 1.606   12.668  6.499   1.00 0.00 ? 72  LYS A HZ1  6  
ATOM 8226  H HZ2  . LYS A 1 72  ? 0.379   11.855  5.792   1.00 0.00 ? 72  LYS A HZ2  6  
ATOM 8227  H HZ3  . LYS A 1 72  ? 0.140   12.615  7.217   1.00 0.00 ? 72  LYS A HZ3  6  
ATOM 8228  N N    . ILE A 1 73  ? 4.210   6.490   3.126   1.00 0.00 ? 73  ILE A N    6  
ATOM 8229  C CA   . ILE A 1 73  ? 5.131   5.390   2.898   1.00 0.00 ? 73  ILE A CA   6  
ATOM 8230  C C    . ILE A 1 73  ? 6.523   5.949   2.599   1.00 0.00 ? 73  ILE A C    6  
ATOM 8231  O O    . ILE A 1 73  ? 7.523   5.436   3.098   1.00 0.00 ? 73  ILE A O    6  
ATOM 8232  C CB   . ILE A 1 73  ? 4.595   4.459   1.808   1.00 0.00 ? 73  ILE A CB   6  
ATOM 8233  C CG1  . ILE A 1 73  ? 3.477   3.566   2.351   1.00 0.00 ? 73  ILE A CG1  6  
ATOM 8234  C CG2  . ILE A 1 73  ? 5.726   3.642   1.180   1.00 0.00 ? 73  ILE A CG2  6  
ATOM 8235  C CD1  . ILE A 1 73  ? 2.378   3.366   1.305   1.00 0.00 ? 73  ILE A CD1  6  
ATOM 8236  H H    . ILE A 1 73  ? 3.357   6.442   2.605   1.00 0.00 ? 73  ILE A H    6  
ATOM 8237  H HA   . ILE A 1 73  ? 5.182   4.811   3.820   1.00 0.00 ? 73  ILE A HA   6  
ATOM 8238  H HB   . ILE A 1 73  ? 4.162   5.072   1.018   1.00 0.00 ? 73  ILE A HB   6  
ATOM 8239  H HG12 . ILE A 1 73  ? 3.888   2.599   2.641   1.00 0.00 ? 73  ILE A HG12 6  
ATOM 8240  H HG13 . ILE A 1 73  ? 3.052   4.014   3.249   1.00 0.00 ? 73  ILE A HG13 6  
ATOM 8241  H HG21 . ILE A 1 73  ? 6.608   3.691   1.818   1.00 0.00 ? 73  ILE A HG21 6  
ATOM 8242  H HG22 . ILE A 1 73  ? 5.410   2.604   1.075   1.00 0.00 ? 73  ILE A HG22 6  
ATOM 8243  H HG23 . ILE A 1 73  ? 5.966   4.050   0.198   1.00 0.00 ? 73  ILE A HG23 6  
ATOM 8244  H HD11 . ILE A 1 73  ? 2.059   2.324   1.308   1.00 0.00 ? 73  ILE A HD11 6  
ATOM 8245  H HD12 . ILE A 1 73  ? 1.529   4.007   1.544   1.00 0.00 ? 73  ILE A HD12 6  
ATOM 8246  H HD13 . ILE A 1 73  ? 2.764   3.626   0.319   1.00 0.00 ? 73  ILE A HD13 6  
ATOM 8247  N N    . LYS A 1 74  ? 6.543   6.995   1.785   1.00 0.00 ? 74  LYS A N    6  
ATOM 8248  C CA   . LYS A 1 74  ? 7.796   7.629   1.413   1.00 0.00 ? 74  LYS A CA   6  
ATOM 8249  C C    . LYS A 1 74  ? 8.449   8.228   2.660   1.00 0.00 ? 74  LYS A C    6  
ATOM 8250  O O    . LYS A 1 74  ? 9.671   8.196   2.801   1.00 0.00 ? 74  LYS A O    6  
ATOM 8251  C CB   . LYS A 1 74  ? 7.570   8.644   0.290   1.00 0.00 ? 74  LYS A CB   6  
ATOM 8252  C CG   . LYS A 1 74  ? 7.426   7.943   -1.062  1.00 0.00 ? 74  LYS A CG   6  
ATOM 8253  C CD   . LYS A 1 74  ? 6.905   8.909   -2.128  1.00 0.00 ? 74  LYS A CD   6  
ATOM 8254  C CE   . LYS A 1 74  ? 7.962   9.955   -2.485  1.00 0.00 ? 74  LYS A CE   6  
ATOM 8255  N NZ   . LYS A 1 74  ? 9.067   9.334   -3.250  1.00 0.00 ? 74  LYS A NZ   6  
ATOM 8256  H H    . LYS A 1 74  ? 5.725   7.406   1.382   1.00 0.00 ? 74  LYS A H    6  
ATOM 8257  H HA   . LYS A 1 74  ? 8.451   6.853   1.018   1.00 0.00 ? 74  LYS A HA   6  
ATOM 8258  H HB2  . LYS A 1 74  ? 6.673   9.229   0.498   1.00 0.00 ? 74  LYS A HB2  6  
ATOM 8259  H HB3  . LYS A 1 74  ? 8.405   9.344   0.255   1.00 0.00 ? 74  LYS A HB3  6  
ATOM 8260  H HG2  . LYS A 1 74  ? 8.391   7.542   -1.371  1.00 0.00 ? 74  LYS A HG2  6  
ATOM 8261  H HG3  . LYS A 1 74  ? 6.745   7.098   -0.967  1.00 0.00 ? 74  LYS A HG3  6  
ATOM 8262  H HD2  . LYS A 1 74  ? 6.622   8.352   -3.021  1.00 0.00 ? 74  LYS A HD2  6  
ATOM 8263  H HD3  . LYS A 1 74  ? 6.005   9.406   -1.764  1.00 0.00 ? 74  LYS A HD3  6  
ATOM 8264  H HE2  . LYS A 1 74  ? 7.509   10.753  -3.073  1.00 0.00 ? 74  LYS A HE2  6  
ATOM 8265  H HE3  . LYS A 1 74  ? 8.353   10.411  -1.576  1.00 0.00 ? 74  LYS A HE3  6  
ATOM 8266  H HZ1  . LYS A 1 74  ? 9.741   10.034  -3.489  1.00 0.00 ? 74  LYS A HZ1  6  
ATOM 8267  H HZ2  . LYS A 1 74  ? 9.503   8.628   -2.692  1.00 0.00 ? 74  LYS A HZ2  6  
ATOM 8268  H HZ3  . LYS A 1 74  ? 8.704   8.922   -4.085  1.00 0.00 ? 74  LYS A HZ3  6  
ATOM 8269  N N    . ALA A 1 75  ? 7.607   8.759   3.534   1.00 0.00 ? 75  ALA A N    6  
ATOM 8270  C CA   . ALA A 1 75  ? 8.087   9.363   4.765   1.00 0.00 ? 75  ALA A CA   6  
ATOM 8271  C C    . ALA A 1 75  ? 8.909   8.336   5.545   1.00 0.00 ? 75  ALA A C    6  
ATOM 8272  O O    . ALA A 1 75  ? 10.007  8.637   6.010   1.00 0.00 ? 75  ALA A O    6  
ATOM 8273  C CB   . ALA A 1 75  ? 6.900   9.894   5.570   1.00 0.00 ? 75  ALA A CB   6  
ATOM 8274  H H    . ALA A 1 75  ? 6.614   8.780   3.412   1.00 0.00 ? 75  ALA A H    6  
ATOM 8275  H HA   . ALA A 1 75  ? 8.730   10.201  4.494   1.00 0.00 ? 75  ALA A HA   6  
ATOM 8276  H HB1  . ALA A 1 75  ? 6.053   10.059  4.904   1.00 0.00 ? 75  ALA A HB1  6  
ATOM 8277  H HB2  . ALA A 1 75  ? 6.625   9.166   6.334   1.00 0.00 ? 75  ALA A HB2  6  
ATOM 8278  H HB3  . ALA A 1 75  ? 7.175   10.834  6.047   1.00 0.00 ? 75  ALA A HB3  6  
ATOM 8279  N N    . CYS A 1 76  ? 8.345   7.143   5.666   1.00 0.00 ? 76  CYS A N    6  
ATOM 8280  C CA   . CYS A 1 76  ? 9.012   6.069   6.383   1.00 0.00 ? 76  CYS A CA   6  
ATOM 8281  C C    . CYS A 1 76  ? 10.360  5.805   5.708   1.00 0.00 ? 76  CYS A C    6  
ATOM 8282  O O    . CYS A 1 76  ? 10.408  5.339   4.570   1.00 0.00 ? 76  CYS A O    6  
ATOM 8283  C CB   . CYS A 1 76  ? 8.148   4.808   6.444   1.00 0.00 ? 76  CYS A CB   6  
ATOM 8284  S SG   . CYS A 1 76  ? 6.546   5.185   7.243   1.00 0.00 ? 76  CYS A SG   6  
ATOM 8285  H H    . CYS A 1 76  ? 7.452   6.905   5.285   1.00 0.00 ? 76  CYS A H    6  
ATOM 8286  H HA   . CYS A 1 76  ? 9.154   6.416   7.406   1.00 0.00 ? 76  CYS A HA   6  
ATOM 8287  H HB2  . CYS A 1 76  ? 7.981   4.423   5.438   1.00 0.00 ? 76  CYS A HB2  6  
ATOM 8288  H HB3  . CYS A 1 76  ? 8.668   4.028   7.001   1.00 0.00 ? 76  CYS A HB3  6  
ATOM 8289  H HG   . CYS A 1 76  ? 6.837   6.446   7.549   1.00 0.00 ? 76  CYS A HG   6  
ATOM 8290  N N    . THR A 1 77  ? 11.422  6.115   6.437   1.00 0.00 ? 77  THR A N    6  
ATOM 8291  C CA   . THR A 1 77  ? 12.766  5.917   5.923   1.00 0.00 ? 77  THR A CA   6  
ATOM 8292  C C    . THR A 1 77  ? 13.434  4.730   6.619   1.00 0.00 ? 77  THR A C    6  
ATOM 8293  O O    . THR A 1 77  ? 14.455  4.226   6.153   1.00 0.00 ? 77  THR A O    6  
ATOM 8294  C CB   . THR A 1 77  ? 13.534  7.230   6.090   1.00 0.00 ? 77  THR A CB   6  
ATOM 8295  O OG1  . THR A 1 77  ? 14.802  6.969   5.495   1.00 0.00 ? 77  THR A OG1  6  
ATOM 8296  C CG2  . THR A 1 77  ? 13.864  7.533   7.553   1.00 0.00 ? 77  THR A CG2  6  
ATOM 8297  H H    . THR A 1 77  ? 11.374  6.493   7.361   1.00 0.00 ? 77  THR A H    6  
ATOM 8298  H HA   . THR A 1 77  ? 12.696  5.669   4.864   1.00 0.00 ? 77  THR A HA   6  
ATOM 8299  H HB   . THR A 1 77  ? 12.993  8.059   5.633   1.00 0.00 ? 77  THR A HB   6  
ATOM 8300  H HG1  . THR A 1 77  ? 14.906  7.508   4.660   1.00 0.00 ? 77  THR A HG1  6  
ATOM 8301  H HG21 . THR A 1 77  ? 14.946  7.573   7.681   1.00 0.00 ? 77  THR A HG21 6  
ATOM 8302  H HG22 . THR A 1 77  ? 13.429  8.493   7.833   1.00 0.00 ? 77  THR A HG22 6  
ATOM 8303  H HG23 . THR A 1 77  ? 13.452  6.749   8.189   1.00 0.00 ? 77  THR A HG23 6  
ATOM 8304  N N    . GLY A 1 78  ? 12.830  4.316   7.724   1.00 0.00 ? 78  GLY A N    6  
ATOM 8305  C CA   . GLY A 1 78  ? 13.354  3.197   8.488   1.00 0.00 ? 78  GLY A CA   6  
ATOM 8306  C C    . GLY A 1 78  ? 12.494  1.947   8.290   1.00 0.00 ? 78  GLY A C    6  
ATOM 8307  O O    . GLY A 1 78  ? 12.920  0.993   7.642   1.00 0.00 ? 78  GLY A O    6  
ATOM 8308  H H    . GLY A 1 78  ? 12.000  4.731   8.096   1.00 0.00 ? 78  GLY A H    6  
ATOM 8309  H HA2  . GLY A 1 78  ? 14.379  2.990   8.182   1.00 0.00 ? 78  GLY A HA2  6  
ATOM 8310  H HA3  . GLY A 1 78  ? 13.384  3.458   9.546   1.00 0.00 ? 78  GLY A HA3  6  
ATOM 8311  N N    . SER A 1 79  ? 11.299  1.994   8.860   1.00 0.00 ? 79  SER A N    6  
ATOM 8312  C CA   . SER A 1 79  ? 10.376  0.877   8.754   1.00 0.00 ? 79  SER A CA   6  
ATOM 8313  C C    . SER A 1 79  ? 8.960   1.392   8.486   1.00 0.00 ? 79  SER A C    6  
ATOM 8314  O O    . SER A 1 79  ? 8.671   2.567   8.707   1.00 0.00 ? 79  SER A O    6  
ATOM 8315  C CB   . SER A 1 79  ? 10.398  0.021   10.022  1.00 0.00 ? 79  SER A CB   6  
ATOM 8316  O OG   . SER A 1 79  ? 10.679  0.796   11.184  1.00 0.00 ? 79  SER A OG   6  
ATOM 8317  H H    . SER A 1 79  ? 10.960  2.774   9.385   1.00 0.00 ? 79  SER A H    6  
ATOM 8318  H HA   . SER A 1 79  ? 10.733  0.286   7.911   1.00 0.00 ? 79  SER A HA   6  
ATOM 8319  H HB2  . SER A 1 79  ? 9.435   -0.475  10.141  1.00 0.00 ? 79  SER A HB2  6  
ATOM 8320  H HB3  . SER A 1 79  ? 11.149  -0.762  9.917   1.00 0.00 ? 79  SER A HB3  6  
ATOM 8321  H HG   . SER A 1 79  ? 9.892   1.369   11.412  1.00 0.00 ? 79  SER A HG   6  
ATOM 8322  N N    . LEU A 1 80  ? 8.115   0.487   8.015   1.00 0.00 ? 80  LEU A N    6  
ATOM 8323  C CA   . LEU A 1 80  ? 6.736   0.836   7.715   1.00 0.00 ? 80  LEU A CA   6  
ATOM 8324  C C    . LEU A 1 80  ? 5.809   0.131   8.707   1.00 0.00 ? 80  LEU A C    6  
ATOM 8325  O O    . LEU A 1 80  ? 5.727   -1.096  8.721   1.00 0.00 ? 80  LEU A O    6  
ATOM 8326  C CB   . LEU A 1 80  ? 6.414   0.533   6.250   1.00 0.00 ? 80  LEU A CB   6  
ATOM 8327  C CG   . LEU A 1 80  ? 5.222   1.287   5.656   1.00 0.00 ? 80  LEU A CG   6  
ATOM 8328  C CD1  . LEU A 1 80  ? 5.371   2.796   5.861   1.00 0.00 ? 80  LEU A CD1  6  
ATOM 8329  C CD2  . LEU A 1 80  ? 5.024   0.926   4.183   1.00 0.00 ? 80  LEU A CD2  6  
ATOM 8330  H H    . LEU A 1 80  ? 8.358   -0.466  7.838   1.00 0.00 ? 80  LEU A H    6  
ATOM 8331  H HA   . LEU A 1 80  ? 6.634   1.912   7.851   1.00 0.00 ? 80  LEU A HA   6  
ATOM 8332  H HB2  . LEU A 1 80  ? 7.296   0.757   5.651   1.00 0.00 ? 80  LEU A HB2  6  
ATOM 8333  H HB3  . LEU A 1 80  ? 6.226   -0.536  6.154   1.00 0.00 ? 80  LEU A HB3  6  
ATOM 8334  H HG   . LEU A 1 80  ? 4.322   0.977   6.187   1.00 0.00 ? 80  LEU A HG   6  
ATOM 8335  H HD11 . LEU A 1 80  ? 4.707   3.323   5.176   1.00 0.00 ? 80  LEU A HD11 6  
ATOM 8336  H HD12 . LEU A 1 80  ? 5.110   3.051   6.888   1.00 0.00 ? 80  LEU A HD12 6  
ATOM 8337  H HD13 . LEU A 1 80  ? 6.403   3.089   5.666   1.00 0.00 ? 80  LEU A HD13 6  
ATOM 8338  H HD21 . LEU A 1 80  ? 5.307   -0.115  4.022   1.00 0.00 ? 80  LEU A HD21 6  
ATOM 8339  H HD22 . LEU A 1 80  ? 3.977   1.064   3.912   1.00 0.00 ? 80  LEU A HD22 6  
ATOM 8340  H HD23 . LEU A 1 80  ? 5.648   1.571   3.563   1.00 0.00 ? 80  LEU A HD23 6  
ATOM 8341  N N    . ASN A 1 81  ? 5.135   0.937   9.513   1.00 0.00 ? 81  ASN A N    6  
ATOM 8342  C CA   . ASN A 1 81  ? 4.217   0.406   10.506  1.00 0.00 ? 81  ASN A CA   6  
ATOM 8343  C C    . ASN A 1 81  ? 2.781   0.741   10.098  1.00 0.00 ? 81  ASN A C    6  
ATOM 8344  O O    . ASN A 1 81  ? 2.344   1.883   10.229  1.00 0.00 ? 81  ASN A O    6  
ATOM 8345  C CB   . ASN A 1 81  ? 4.473   1.026   11.881  1.00 0.00 ? 81  ASN A CB   6  
ATOM 8346  C CG   . ASN A 1 81  ? 5.288   0.081   12.766  1.00 0.00 ? 81  ASN A CG   6  
ATOM 8347  O OD1  . ASN A 1 81  ? 4.783   -0.537  13.689  1.00 0.00 ? 81  ASN A OD1  6  
ATOM 8348  N ND2  . ASN A 1 81  ? 6.573   0.002   12.434  1.00 0.00 ? 81  ASN A ND2  6  
ATOM 8349  H H    . ASN A 1 81  ? 5.207   1.935   9.495   1.00 0.00 ? 81  ASN A H    6  
ATOM 8350  H HA   . ASN A 1 81  ? 4.405   -0.667  10.526  1.00 0.00 ? 81  ASN A HA   6  
ATOM 8351  H HB2  . ASN A 1 81  ? 5.006   1.970   11.765  1.00 0.00 ? 81  ASN A HB2  6  
ATOM 8352  H HB3  . ASN A 1 81  ? 3.523   1.254   12.365  1.00 0.00 ? 81  ASN A HB3  6  
ATOM 8353  H HD21 . ASN A 1 81  ? 6.925   0.536   11.664  1.00 0.00 ? 81  ASN A HD21 6  
ATOM 8354  H HD22 . ASN A 1 81  ? 7.189   -0.591  12.953  1.00 0.00 ? 81  ASN A HD22 6  
ATOM 8355  N N    . MET A 1 82  ? 2.086   -0.277  9.610   1.00 0.00 ? 82  MET A N    6  
ATOM 8356  C CA   . MET A 1 82  ? 0.708   -0.105  9.182   1.00 0.00 ? 82  MET A CA   6  
ATOM 8357  C C    . MET A 1 82  ? -0.177  -1.234  9.713   1.00 0.00 ? 82  MET A C    6  
ATOM 8358  O O    . MET A 1 82  ? 0.297   -2.349  9.929   1.00 0.00 ? 82  MET A O    6  
ATOM 8359  C CB   . MET A 1 82  ? 0.647   -0.085  7.653   1.00 0.00 ? 82  MET A CB   6  
ATOM 8360  C CG   . MET A 1 82  ? 1.795   0.742   7.069   1.00 0.00 ? 82  MET A CG   6  
ATOM 8361  S SD   . MET A 1 82  ? 1.801   0.606   5.290   1.00 0.00 ? 82  MET A SD   6  
ATOM 8362  C CE   . MET A 1 82  ? 2.450   -1.047  5.107   1.00 0.00 ? 82  MET A CE   6  
ATOM 8363  H H    . MET A 1 82  ? 2.448   -1.203  9.507   1.00 0.00 ? 82  MET A H    6  
ATOM 8364  H HA   . MET A 1 82  ? 0.387   0.847   9.604   1.00 0.00 ? 82  MET A HA   6  
ATOM 8365  H HB2  . MET A 1 82  ? 0.698   -1.105  7.270   1.00 0.00 ? 82  MET A HB2  6  
ATOM 8366  H HB3  . MET A 1 82  ? -0.307  0.330   7.329   1.00 0.00 ? 82  MET A HB3  6  
ATOM 8367  H HG2  . MET A 1 82  ? 1.687   1.786   7.362   1.00 0.00 ? 82  MET A HG2  6  
ATOM 8368  H HG3  . MET A 1 82  ? 2.746   0.395   7.472   1.00 0.00 ? 82  MET A HG3  6  
ATOM 8369  H HE1  . MET A 1 82  ? 3.517   -1.045  5.330   1.00 0.00 ? 82  MET A HE1  6  
ATOM 8370  H HE2  . MET A 1 82  ? 1.936   -1.717  5.796   1.00 0.00 ? 82  MET A HE2  6  
ATOM 8371  H HE3  . MET A 1 82  ? 2.294   -1.388  4.084   1.00 0.00 ? 82  MET A HE3  6  
ATOM 8372  N N    . THR A 1 83  ? -1.445  -0.907  9.910   1.00 0.00 ? 83  THR A N    6  
ATOM 8373  C CA   . THR A 1 83  ? -2.400  -1.880  10.412  1.00 0.00 ? 83  THR A CA   6  
ATOM 8374  C C    . THR A 1 83  ? -3.197  -2.491  9.258   1.00 0.00 ? 83  THR A C    6  
ATOM 8375  O O    . THR A 1 83  ? -3.490  -1.813  8.274   1.00 0.00 ? 83  THR A O    6  
ATOM 8376  C CB   . THR A 1 83  ? -3.278  -1.186  11.456  1.00 0.00 ? 83  THR A CB   6  
ATOM 8377  O OG1  . THR A 1 83  ? -2.376  -0.333  12.156  1.00 0.00 ? 83  THR A OG1  6  
ATOM 8378  C CG2  . THR A 1 83  ? -3.787  -2.151  12.528  1.00 0.00 ? 83  THR A CG2  6  
ATOM 8379  H H    . THR A 1 83  ? -1.822  0.002   9.732   1.00 0.00 ? 83  THR A H    6  
ATOM 8380  H HA   . THR A 1 83  ? -1.847  -2.692  10.884  1.00 0.00 ? 83  THR A HA   6  
ATOM 8381  H HB   . THR A 1 83  ? -4.106  -0.660  10.980  1.00 0.00 ? 83  THR A HB   6  
ATOM 8382  H HG1  . THR A 1 83  ? -1.615  -0.867  12.523  1.00 0.00 ? 83  THR A HG1  6  
ATOM 8383  H HG21 . THR A 1 83  ? -4.676  -2.665  12.163  1.00 0.00 ? 83  THR A HG21 6  
ATOM 8384  H HG22 . THR A 1 83  ? -3.012  -2.883  12.756  1.00 0.00 ? 83  THR A HG22 6  
ATOM 8385  H HG23 . THR A 1 83  ? -4.035  -1.593  13.431  1.00 0.00 ? 83  THR A HG23 6  
ATOM 8386  N N    . LEU A 1 84  ? -3.524  -3.765  9.416   1.00 0.00 ? 84  LEU A N    6  
ATOM 8387  C CA   . LEU A 1 84  ? -4.281  -4.475  8.399   1.00 0.00 ? 84  LEU A CA   6  
ATOM 8388  C C    . LEU A 1 84  ? -5.657  -4.844  8.958   1.00 0.00 ? 84  LEU A C    6  
ATOM 8389  O O    . LEU A 1 84  ? -5.863  -4.829  10.170  1.00 0.00 ? 84  LEU A O    6  
ATOM 8390  C CB   . LEU A 1 84  ? -3.487  -5.674  7.879   1.00 0.00 ? 84  LEU A CB   6  
ATOM 8391  C CG   . LEU A 1 84  ? -2.104  -5.364  7.303   1.00 0.00 ? 84  LEU A CG   6  
ATOM 8392  C CD1  . LEU A 1 84  ? -1.515  -6.589  6.600   1.00 0.00 ? 84  LEU A CD1  6  
ATOM 8393  C CD2  . LEU A 1 84  ? -2.155  -4.144  6.381   1.00 0.00 ? 84  LEU A CD2  6  
ATOM 8394  H H    . LEU A 1 84  ? -3.282  -4.309  10.219  1.00 0.00 ? 84  LEU A H    6  
ATOM 8395  H HA   . LEU A 1 84  ? -4.421  -3.793  7.560   1.00 0.00 ? 84  LEU A HA   6  
ATOM 8396  H HB2  . LEU A 1 84  ? -3.367  -6.387  8.695   1.00 0.00 ? 84  LEU A HB2  6  
ATOM 8397  H HB3  . LEU A 1 84  ? -4.077  -6.170  7.108   1.00 0.00 ? 84  LEU A HB3  6  
ATOM 8398  H HG   . LEU A 1 84  ? -1.437  -5.116  8.129   1.00 0.00 ? 84  LEU A HG   6  
ATOM 8399  H HD11 . LEU A 1 84  ? -1.191  -7.315  7.345   1.00 0.00 ? 84  LEU A HD11 6  
ATOM 8400  H HD12 . LEU A 1 84  ? -2.274  -7.039  5.959   1.00 0.00 ? 84  LEU A HD12 6  
ATOM 8401  H HD13 . LEU A 1 84  ? -0.662  -6.285  5.993   1.00 0.00 ? 84  LEU A HD13 6  
ATOM 8402  H HD21 . LEU A 1 84  ? -2.940  -4.283  5.638   1.00 0.00 ? 84  LEU A HD21 6  
ATOM 8403  H HD22 . LEU A 1 84  ? -2.367  -3.252  6.971   1.00 0.00 ? 84  LEU A HD22 6  
ATOM 8404  H HD23 . LEU A 1 84  ? -1.195  -4.027  5.879   1.00 0.00 ? 84  LEU A HD23 6  
ATOM 8405  N N    . GLN A 1 85  ? -6.563  -5.166  8.047   1.00 0.00 ? 85  GLN A N    6  
ATOM 8406  C CA   . GLN A 1 85  ? -7.914  -5.538  8.433   1.00 0.00 ? 85  GLN A CA   6  
ATOM 8407  C C    . GLN A 1 85  ? -8.165  -7.016  8.129   1.00 0.00 ? 85  GLN A C    6  
ATOM 8408  O O    . GLN A 1 85  ? -7.914  -7.475  7.015   1.00 0.00 ? 85  GLN A O    6  
ATOM 8409  C CB   . GLN A 1 85  ? -8.948  -4.651  7.737   1.00 0.00 ? 85  GLN A CB   6  
ATOM 8410  C CG   . GLN A 1 85  ? -10.345 -5.269  7.820   1.00 0.00 ? 85  GLN A CG   6  
ATOM 8411  C CD   . GLN A 1 85  ? -11.367 -4.420  7.062   1.00 0.00 ? 85  GLN A CD   6  
ATOM 8412  O OE1  . GLN A 1 85  ? -11.123 -3.276  6.711   1.00 0.00 ? 85  GLN A OE1  6  
ATOM 8413  N NE2  . GLN A 1 85  ? -12.520 -5.040  6.829   1.00 0.00 ? 85  GLN A NE2  6  
ATOM 8414  H H    . GLN A 1 85  ? -6.388  -5.175  7.062   1.00 0.00 ? 85  GLN A H    6  
ATOM 8415  H HA   . GLN A 1 85  ? -7.964  -5.368  9.509   1.00 0.00 ? 85  GLN A HA   6  
ATOM 8416  H HB2  . GLN A 1 85  ? -8.955  -3.664  8.198   1.00 0.00 ? 85  GLN A HB2  6  
ATOM 8417  H HB3  . GLN A 1 85  ? -8.669  -4.513  6.692   1.00 0.00 ? 85  GLN A HB3  6  
ATOM 8418  H HG2  . GLN A 1 85  ? -10.326 -6.277  7.406   1.00 0.00 ? 85  GLN A HG2  6  
ATOM 8419  H HG3  . GLN A 1 85  ? -10.645 -5.360  8.864   1.00 0.00 ? 85  GLN A HG3  6  
ATOM 8420  H HE21 . GLN A 1 85  ? -12.655 -5.979  7.144   1.00 0.00 ? 85  GLN A HE21 6  
ATOM 8421  H HE22 . GLN A 1 85  ? -13.252 -4.566  6.339   1.00 0.00 ? 85  GLN A HE22 6  
ATOM 8422  N N    . ARG A 1 86  ? -8.656  -7.721  9.138   1.00 0.00 ? 86  ARG A N    6  
ATOM 8423  C CA   . ARG A 1 86  ? -8.943  -9.137  8.991   1.00 0.00 ? 86  ARG A CA   6  
ATOM 8424  C C    . ARG A 1 86  ? -10.300 -9.336  8.312   1.00 0.00 ? 86  ARG A C    6  
ATOM 8425  O O    . ARG A 1 86  ? -11.180 -8.484  8.414   1.00 0.00 ? 86  ARG A O    6  
ATOM 8426  C CB   . ARG A 1 86  ? -8.954  -9.840  10.350  1.00 0.00 ? 86  ARG A CB   6  
ATOM 8427  C CG   . ARG A 1 86  ? -10.305 -9.667  11.047  1.00 0.00 ? 86  ARG A CG   6  
ATOM 8428  C CD   . ARG A 1 86  ? -10.584 -8.193  11.343  1.00 0.00 ? 86  ARG A CD   6  
ATOM 8429  N NE   . ARG A 1 86  ? -11.709 -8.072  12.298  1.00 0.00 ? 86  ARG A NE   6  
ATOM 8430  C CZ   . ARG A 1 86  ? -13.001 -8.118  11.946  1.00 0.00 ? 86  ARG A CZ   6  
ATOM 8431  N NH1  . ARG A 1 86  ? -13.340 -8.281  10.660  1.00 0.00 ? 86  ARG A NH1  6  
ATOM 8432  N NH2  . ARG A 1 86  ? -13.954 -8.000  12.880  1.00 0.00 ? 86  ARG A NH2  6  
ATOM 8433  H H    . ARG A 1 86  ? -8.857  -7.340  10.040  1.00 0.00 ? 86  ARG A H    6  
ATOM 8434  H HA   . ARG A 1 86  ? -8.134  -9.524  8.372   1.00 0.00 ? 86  ARG A HA   6  
ATOM 8435  H HB2  . ARG A 1 86  ? -8.743  -10.901 10.217  1.00 0.00 ? 86  ARG A HB2  6  
ATOM 8436  H HB3  . ARG A 1 86  ? -8.162  -9.435  10.980  1.00 0.00 ? 86  ARG A HB3  6  
ATOM 8437  H HG2  . ARG A 1 86  ? -11.097 -10.072 10.417  1.00 0.00 ? 86  ARG A HG2  6  
ATOM 8438  H HG3  . ARG A 1 86  ? -10.315 -10.237 11.976  1.00 0.00 ? 86  ARG A HG3  6  
ATOM 8439  H HD2  . ARG A 1 86  ? -9.693  -7.721  11.757  1.00 0.00 ? 86  ARG A HD2  6  
ATOM 8440  H HD3  . ARG A 1 86  ? -10.823 -7.666  10.419  1.00 0.00 ? 86  ARG A HD3  6  
ATOM 8441  H HE   . ARG A 1 86  ? -11.491 -7.949  13.266  1.00 0.00 ? 86  ARG A HE   6  
ATOM 8442  H HH11 . ARG A 1 86  ? -12.628 -8.369  9.963   1.00 0.00 ? 86  ARG A HH11 6  
ATOM 8443  H HH12 . ARG A 1 86  ? -14.304 -8.315  10.398  1.00 0.00 ? 86  ARG A HH12 6  
ATOM 8444  H HH21 . ARG A 1 86  ? -13.701 -7.878  13.840  1.00 0.00 ? 86  ARG A HH21 6  
ATOM 8445  H HH22 . ARG A 1 86  ? -14.919 -8.034  12.618  1.00 0.00 ? 86  ARG A HH22 6  
ATOM 8446  N N    . ALA A 1 87  ? -10.425 -10.467 7.632   1.00 0.00 ? 87  ALA A N    6  
ATOM 8447  C CA   . ALA A 1 87  ? -11.659 -10.789 6.936   1.00 0.00 ? 87  ALA A CA   6  
ATOM 8448  C C    . ALA A 1 87  ? -12.520 -11.690 7.823   1.00 0.00 ? 87  ALA A C    6  
ATOM 8449  O O    . ALA A 1 87  ? -12.420 -12.914 7.753   1.00 0.00 ? 87  ALA A O    6  
ATOM 8450  C CB   . ALA A 1 87  ? -11.331 -11.437 5.589   1.00 0.00 ? 87  ALA A CB   6  
ATOM 8451  H H    . ALA A 1 87  ? -9.704  -11.155 7.554   1.00 0.00 ? 87  ALA A H    6  
ATOM 8452  H HA   . ALA A 1 87  ? -12.191 -9.855  6.756   1.00 0.00 ? 87  ALA A HA   6  
ATOM 8453  H HB1  . ALA A 1 87  ? -10.741 -12.339 5.754   1.00 0.00 ? 87  ALA A HB1  6  
ATOM 8454  H HB2  . ALA A 1 87  ? -12.257 -11.698 5.077   1.00 0.00 ? 87  ALA A HB2  6  
ATOM 8455  H HB3  . ALA A 1 87  ? -10.762 -10.737 4.978   1.00 0.00 ? 87  ALA A HB3  6  
ATOM 8456  N N    . SER A 1 88  ? -13.346 -11.050 8.637   1.00 0.00 ? 88  SER A N    6  
ATOM 8457  C CA   . SER A 1 88  ? -14.224 -11.779 9.537   1.00 0.00 ? 88  SER A CA   6  
ATOM 8458  C C    . SER A 1 88  ? -15.474 -10.949 9.834   1.00 0.00 ? 88  SER A C    6  
ATOM 8459  O O    . SER A 1 88  ? -15.534 -10.251 10.846  1.00 0.00 ? 88  SER A O    6  
ATOM 8460  C CB   . SER A 1 88  ? -13.504 -12.139 10.838  1.00 0.00 ? 88  SER A CB   6  
ATOM 8461  O OG   . SER A 1 88  ? -14.240 -13.082 11.612  1.00 0.00 ? 88  SER A OG   6  
ATOM 8462  H H    . SER A 1 88  ? -13.421 -10.054 8.688   1.00 0.00 ? 88  SER A H    6  
ATOM 8463  H HA   . SER A 1 88  ? -14.489 -12.692 9.004   1.00 0.00 ? 88  SER A HA   6  
ATOM 8464  H HB2  . SER A 1 88  ? -12.521 -12.549 10.606  1.00 0.00 ? 88  SER A HB2  6  
ATOM 8465  H HB3  . SER A 1 88  ? -13.343 -11.235 11.425  1.00 0.00 ? 88  SER A HB3  6  
ATOM 8466  H HG   . SER A 1 88  ? -15.114 -12.686 11.892  1.00 0.00 ? 88  SER A HG   6  
ATOM 8467  N N    . ALA A 1 89  ? -16.442 -11.051 8.935   1.00 0.00 ? 89  ALA A N    6  
ATOM 8468  C CA   . ALA A 1 89  ? -17.687 -10.318 9.089   1.00 0.00 ? 89  ALA A CA   6  
ATOM 8469  C C    . ALA A 1 89  ? -18.678 -10.774 8.016   1.00 0.00 ? 89  ALA A C    6  
ATOM 8470  O O    . ALA A 1 89  ? -18.548 -10.406 6.849   1.00 0.00 ? 89  ALA A O    6  
ATOM 8471  C CB   . ALA A 1 89  ? -17.407 -8.816  9.023   1.00 0.00 ? 89  ALA A CB   6  
ATOM 8472  H H    . ALA A 1 89  ? -16.385 -11.621 8.115   1.00 0.00 ? 89  ALA A H    6  
ATOM 8473  H HA   . ALA A 1 89  ? -18.093 -10.557 10.072  1.00 0.00 ? 89  ALA A HA   6  
ATOM 8474  H HB1  . ALA A 1 89  ? -17.371 -8.498  7.981   1.00 0.00 ? 89  ALA A HB1  6  
ATOM 8475  H HB2  . ALA A 1 89  ? -18.200 -8.275  9.540   1.00 0.00 ? 89  ALA A HB2  6  
ATOM 8476  H HB3  . ALA A 1 89  ? -16.451 -8.603  9.501   1.00 0.00 ? 89  ALA A HB3  6  
ATOM 8477  N N    . ALA A 1 90  ? -19.646 -11.569 8.449   1.00 0.00 ? 90  ALA A N    6  
ATOM 8478  C CA   . ALA A 1 90  ? -20.658 -12.079 7.540   1.00 0.00 ? 90  ALA A CA   6  
ATOM 8479  C C    . ALA A 1 90  ? -19.977 -12.833 6.396   1.00 0.00 ? 90  ALA A C    6  
ATOM 8480  O O    . ALA A 1 90  ? -18.752 -12.825 6.285   1.00 0.00 ? 90  ALA A O    6  
ATOM 8481  C CB   . ALA A 1 90  ? -21.526 -10.922 7.041   1.00 0.00 ? 90  ALA A CB   6  
ATOM 8482  H H    . ALA A 1 90  ? -19.744 -11.863 9.399   1.00 0.00 ? 90  ALA A H    6  
ATOM 8483  H HA   . ALA A 1 90  ? -21.286 -12.773 8.098   1.00 0.00 ? 90  ALA A HA   6  
ATOM 8484  H HB1  . ALA A 1 90  ? -21.983 -10.417 7.892   1.00 0.00 ? 90  ALA A HB1  6  
ATOM 8485  H HB2  . ALA A 1 90  ? -20.907 -10.215 6.489   1.00 0.00 ? 90  ALA A HB2  6  
ATOM 8486  H HB3  . ALA A 1 90  ? -22.306 -11.309 6.386   1.00 0.00 ? 90  ALA A HB3  6  
ATOM 8487  N N    . ALA A 1 91  ? -20.801 -13.466 5.574   1.00 0.00 ? 91  ALA A N    6  
ATOM 8488  C CA   . ALA A 1 91  ? -20.293 -14.223 4.442   1.00 0.00 ? 91  ALA A CA   6  
ATOM 8489  C C    . ALA A 1 91  ? -19.425 -15.374 4.953   1.00 0.00 ? 91  ALA A C    6  
ATOM 8490  O O    . ALA A 1 91  ? -18.395 -15.147 5.584   1.00 0.00 ? 91  ALA A O    6  
ATOM 8491  C CB   . ALA A 1 91  ? -19.528 -13.287 3.504   1.00 0.00 ? 91  ALA A CB   6  
ATOM 8492  H H    . ALA A 1 91  ? -21.796 -13.467 5.671   1.00 0.00 ? 91  ALA A H    6  
ATOM 8493  H HA   . ALA A 1 91  ? -21.149 -14.633 3.907   1.00 0.00 ? 91  ALA A HA   6  
ATOM 8494  H HB1  . ALA A 1 91  ? -18.961 -12.566 4.093   1.00 0.00 ? 91  ALA A HB1  6  
ATOM 8495  H HB2  . ALA A 1 91  ? -18.844 -13.871 2.888   1.00 0.00 ? 91  ALA A HB2  6  
ATOM 8496  H HB3  . ALA A 1 91  ? -20.233 -12.759 2.863   1.00 0.00 ? 91  ALA A HB3  6  
ATOM 8497  N N    . LYS A 1 92  ? -19.874 -16.586 4.660   1.00 0.00 ? 92  LYS A N    6  
ATOM 8498  C CA   . LYS A 1 92  ? -19.151 -17.774 5.081   1.00 0.00 ? 92  LYS A CA   6  
ATOM 8499  C C    . LYS A 1 92  ? -18.786 -18.607 3.851   1.00 0.00 ? 92  LYS A C    6  
ATOM 8500  O O    . LYS A 1 92  ? -19.359 -18.421 2.779   1.00 0.00 ? 92  LYS A O    6  
ATOM 8501  C CB   . LYS A 1 92  ? -19.954 -18.546 6.130   1.00 0.00 ? 92  LYS A CB   6  
ATOM 8502  C CG   . LYS A 1 92  ? -19.823 -17.896 7.509   1.00 0.00 ? 92  LYS A CG   6  
ATOM 8503  C CD   . LYS A 1 92  ? -20.839 -16.765 7.681   1.00 0.00 ? 92  LYS A CD   6  
ATOM 8504  C CE   . LYS A 1 92  ? -22.069 -17.247 8.453   1.00 0.00 ? 92  LYS A CE   6  
ATOM 8505  N NZ   . LYS A 1 92  ? -23.305 -16.694 7.855   1.00 0.00 ? 92  LYS A NZ   6  
ATOM 8506  H H    . LYS A 1 92  ? -20.713 -16.762 4.145   1.00 0.00 ? 92  LYS A H    6  
ATOM 8507  H HA   . LYS A 1 92  ? -18.230 -17.443 5.560   1.00 0.00 ? 92  LYS A HA   6  
ATOM 8508  H HB2  . LYS A 1 92  ? -21.004 -18.579 5.838   1.00 0.00 ? 92  LYS A HB2  6  
ATOM 8509  H HB3  . LYS A 1 92  ? -19.604 -19.577 6.175   1.00 0.00 ? 92  LYS A HB3  6  
ATOM 8510  H HG2  . LYS A 1 92  ? -19.974 -18.647 8.284   1.00 0.00 ? 92  LYS A HG2  6  
ATOM 8511  H HG3  . LYS A 1 92  ? -18.814 -17.505 7.636   1.00 0.00 ? 92  LYS A HG3  6  
ATOM 8512  H HD2  . LYS A 1 92  ? -20.376 -15.933 8.211   1.00 0.00 ? 92  LYS A HD2  6  
ATOM 8513  H HD3  . LYS A 1 92  ? -21.142 -16.392 6.703   1.00 0.00 ? 92  LYS A HD3  6  
ATOM 8514  H HE2  . LYS A 1 92  ? -22.109 -18.336 8.444   1.00 0.00 ? 92  LYS A HE2  6  
ATOM 8515  H HE3  . LYS A 1 92  ? -21.994 -16.939 9.496   1.00 0.00 ? 92  LYS A HE3  6  
ATOM 8516  H HZ1  . LYS A 1 92  ? -23.316 -15.701 7.969   1.00 0.00 ? 92  LYS A HZ1  6  
ATOM 8517  H HZ2  . LYS A 1 92  ? -23.333 -16.919 6.881   1.00 0.00 ? 92  LYS A HZ2  6  
ATOM 8518  H HZ3  . LYS A 1 92  ? -24.102 -17.091 8.311   1.00 0.00 ? 92  LYS A HZ3  6  
ATOM 8519  N N    . SER A 1 93  ? -17.834 -19.507 4.047   1.00 0.00 ? 93  SER A N    6  
ATOM 8520  C CA   . SER A 1 93  ? -17.385 -20.369 2.966   1.00 0.00 ? 93  SER A CA   6  
ATOM 8521  C C    . SER A 1 93  ? -17.962 -21.775 3.145   1.00 0.00 ? 93  SER A C    6  
ATOM 8522  O O    . SER A 1 93  ? -17.599 -22.484 4.082   1.00 0.00 ? 93  SER A O    6  
ATOM 8523  C CB   . SER A 1 93  ? -15.857 -20.426 2.905   1.00 0.00 ? 93  SER A CB   6  
ATOM 8524  O OG   . SER A 1 93  ? -15.388 -20.804 1.614   1.00 0.00 ? 93  SER A OG   6  
ATOM 8525  H H    . SER A 1 93  ? -17.373 -19.652 4.922   1.00 0.00 ? 93  SER A H    6  
ATOM 8526  H HA   . SER A 1 93  ? -17.768 -19.911 2.054   1.00 0.00 ? 93  SER A HA   6  
ATOM 8527  H HB2  . SER A 1 93  ? -15.448 -19.451 3.169   1.00 0.00 ? 93  SER A HB2  6  
ATOM 8528  H HB3  . SER A 1 93  ? -15.491 -21.136 3.646   1.00 0.00 ? 93  SER A HB3  6  
ATOM 8529  H HG   . SER A 1 93  ? -14.980 -20.015 1.154   1.00 0.00 ? 93  SER A HG   6  
ATOM 8530  N N    . GLU A 1 94  ? -18.850 -22.136 2.230   1.00 0.00 ? 94  GLU A N    6  
ATOM 8531  C CA   . GLU A 1 94  ? -19.481 -23.444 2.275   1.00 0.00 ? 94  GLU A CA   6  
ATOM 8532  C C    . GLU A 1 94  ? -18.484 -24.528 1.861   1.00 0.00 ? 94  GLU A C    6  
ATOM 8533  O O    . GLU A 1 94  ? -18.018 -24.546 0.722   1.00 0.00 ? 94  GLU A O    6  
ATOM 8534  C CB   . GLU A 1 94  ? -20.729 -23.481 1.392   1.00 0.00 ? 94  GLU A CB   6  
ATOM 8535  C CG   . GLU A 1 94  ? -20.354 -23.438 -0.091  1.00 0.00 ? 94  GLU A CG   6  
ATOM 8536  C CD   . GLU A 1 94  ? -21.561 -23.058 -0.951  1.00 0.00 ? 94  GLU A CD   6  
ATOM 8537  O OE1  . GLU A 1 94  ? -22.339 -23.981 -1.277  1.00 0.00 ? 94  GLU A OE1  6  
ATOM 8538  O OE2  . GLU A 1 94  ? -21.677 -21.854 -1.264  1.00 0.00 ? 94  GLU A OE2  6  
ATOM 8539  H H    . GLU A 1 94  ? -19.140 -21.553 1.471   1.00 0.00 ? 94  GLU A H    6  
ATOM 8540  H HA   . GLU A 1 94  ? -19.774 -23.589 3.315   1.00 0.00 ? 94  GLU A HA   6  
ATOM 8541  H HB2  . GLU A 1 94  ? -21.300 -24.387 1.600   1.00 0.00 ? 94  GLU A HB2  6  
ATOM 8542  H HB3  . GLU A 1 94  ? -21.375 -22.636 1.632   1.00 0.00 ? 94  GLU A HB3  6  
ATOM 8543  H HG2  . GLU A 1 94  ? -19.551 -22.717 -0.246  1.00 0.00 ? 94  GLU A HG2  6  
ATOM 8544  H HG3  . GLU A 1 94  ? -19.973 -24.411 -0.402  1.00 0.00 ? 94  GLU A HG3  6  
ATOM 8545  N N    . PRO A 1 95  ? -18.177 -25.429 2.833   1.00 0.00 ? 95  PRO A N    6  
ATOM 8546  C CA   . PRO A 1 95  ? -17.244 -26.513 2.580   1.00 0.00 ? 95  PRO A CA   6  
ATOM 8547  C C    . PRO A 1 95  ? -17.890 -27.605 1.725   1.00 0.00 ? 95  PRO A C    6  
ATOM 8548  O O    . PRO A 1 95  ? -19.047 -27.483 1.328   1.00 0.00 ? 95  PRO A O    6  
ATOM 8549  C CB   . PRO A 1 95  ? -16.831 -27.005 3.958   1.00 0.00 ? 95  PRO A CB   6  
ATOM 8550  C CG   . PRO A 1 95  ? -17.892 -26.495 4.918   1.00 0.00 ? 95  PRO A CG   6  
ATOM 8551  C CD   . PRO A 1 95  ? -18.709 -25.438 4.192   1.00 0.00 ? 95  PRO A CD   6  
ATOM 8552  H HA   . PRO A 1 95  ? -16.460 -26.182 2.055   1.00 0.00 ? 95  PRO A HA   6  
ATOM 8553  H HB2  . PRO A 1 95  ? -16.772 -28.093 3.983   1.00 0.00 ? 95  PRO A HB2  6  
ATOM 8554  H HB3  . PRO A 1 95  ? -15.845 -26.627 4.228   1.00 0.00 ? 95  PRO A HB3  6  
ATOM 8555  H HG2  . PRO A 1 95  ? -18.533 -27.312 5.248   1.00 0.00 ? 95  PRO A HG2  6  
ATOM 8556  H HG3  . PRO A 1 95  ? -17.429 -26.073 5.811   1.00 0.00 ? 95  PRO A HG3  6  
ATOM 8557  H HD2  . PRO A 1 95  ? -19.771 -25.683 4.200   1.00 0.00 ? 95  PRO A HD2  6  
ATOM 8558  H HD3  . PRO A 1 95  ? -18.603 -24.462 4.665   1.00 0.00 ? 95  PRO A HD3  6  
ATOM 8559  N N    . VAL A 1 96  ? -17.113 -28.646 1.466   1.00 0.00 ? 96  VAL A N    6  
ATOM 8560  C CA   . VAL A 1 96  ? -17.595 -29.758 0.664   1.00 0.00 ? 96  VAL A CA   6  
ATOM 8561  C C    . VAL A 1 96  ? -17.778 -30.985 1.560   1.00 0.00 ? 96  VAL A C    6  
ATOM 8562  O O    . VAL A 1 96  ? -16.896 -31.320 2.349   1.00 0.00 ? 96  VAL A O    6  
ATOM 8563  C CB   . VAL A 1 96  ? -16.643 -30.011 -0.507  1.00 0.00 ? 96  VAL A CB   6  
ATOM 8564  C CG1  . VAL A 1 96  ? -16.593 -28.801 -1.443  1.00 0.00 ? 96  VAL A CG1  6  
ATOM 8565  C CG2  . VAL A 1 96  ? -15.244 -30.375 -0.008  1.00 0.00 ? 96  VAL A CG2  6  
ATOM 8566  H H    . VAL A 1 96  ? -16.172 -28.737 1.792   1.00 0.00 ? 96  VAL A H    6  
ATOM 8567  H HA   . VAL A 1 96  ? -18.564 -29.474 0.256   1.00 0.00 ? 96  VAL A HA   6  
ATOM 8568  H HB   . VAL A 1 96  ? -17.027 -30.858 -1.075  1.00 0.00 ? 96  VAL A HB   6  
ATOM 8569  H HG11 . VAL A 1 96  ? -15.639 -28.788 -1.969  1.00 0.00 ? 96  VAL A HG11 6  
ATOM 8570  H HG12 . VAL A 1 96  ? -17.406 -28.868 -2.167  1.00 0.00 ? 96  VAL A HG12 6  
ATOM 8571  H HG13 . VAL A 1 96  ? -16.700 -27.886 -0.861  1.00 0.00 ? 96  VAL A HG13 6  
ATOM 8572  H HG21 . VAL A 1 96  ? -15.324 -31.103 0.800   1.00 0.00 ? 96  VAL A HG21 6  
ATOM 8573  H HG22 . VAL A 1 96  ? -14.666 -30.805 -0.826  1.00 0.00 ? 96  VAL A HG22 6  
ATOM 8574  H HG23 . VAL A 1 96  ? -14.743 -29.479 0.359   1.00 0.00 ? 96  VAL A HG23 6  
ATOM 8575  N N    . SER A 1 97  ? -18.930 -31.622 1.408   1.00 0.00 ? 97  SER A N    6  
ATOM 8576  C CA   . SER A 1 97  ? -19.241 -32.804 2.194   1.00 0.00 ? 97  SER A CA   6  
ATOM 8577  C C    . SER A 1 97  ? -19.515 -33.991 1.267   1.00 0.00 ? 97  SER A C    6  
ATOM 8578  O O    . SER A 1 97  ? -20.136 -33.833 0.217   1.00 0.00 ? 97  SER A O    6  
ATOM 8579  C CB   . SER A 1 97  ? -20.441 -32.557 3.109   1.00 0.00 ? 97  SER A CB   6  
ATOM 8580  O OG   . SER A 1 97  ? -20.046 -32.345 4.462   1.00 0.00 ? 97  SER A OG   6  
ATOM 8581  H H    . SER A 1 97  ? -19.643 -31.343 0.764   1.00 0.00 ? 97  SER A H    6  
ATOM 8582  H HA   . SER A 1 97  ? -18.354 -32.989 2.800   1.00 0.00 ? 97  SER A HA   6  
ATOM 8583  H HB2  . SER A 1 97  ? -20.997 -31.689 2.753   1.00 0.00 ? 97  SER A HB2  6  
ATOM 8584  H HB3  . SER A 1 97  ? -21.118 -33.411 3.059   1.00 0.00 ? 97  SER A HB3  6  
ATOM 8585  H HG   . SER A 1 97  ? -19.079 -32.093 4.500   1.00 0.00 ? 97  SER A HG   6  
ATOM 8586  N N    . SER A 1 98  ? -19.038 -35.153 1.690   1.00 0.00 ? 98  SER A N    6  
ATOM 8587  C CA   . SER A 1 98  ? -19.225 -36.365 0.911   1.00 0.00 ? 98  SER A CA   6  
ATOM 8588  C C    . SER A 1 98  ? -20.019 -37.391 1.722   1.00 0.00 ? 98  SER A C    6  
ATOM 8589  O O    . SER A 1 98  ? -20.069 -37.314 2.948   1.00 0.00 ? 98  SER A O    6  
ATOM 8590  C CB   . SER A 1 98  ? -17.880 -36.955 0.481   1.00 0.00 ? 98  SER A CB   6  
ATOM 8591  O OG   . SER A 1 98  ? -17.079 -37.328 1.598   1.00 0.00 ? 98  SER A OG   6  
ATOM 8592  H H    . SER A 1 98  ? -18.535 -35.273 2.545   1.00 0.00 ? 98  SER A H    6  
ATOM 8593  H HA   . SER A 1 98  ? -19.785 -36.058 0.028   1.00 0.00 ? 98  SER A HA   6  
ATOM 8594  H HB2  . SER A 1 98  ? -18.052 -37.828 -0.149  1.00 0.00 ? 98  SER A HB2  6  
ATOM 8595  H HB3  . SER A 1 98  ? -17.341 -36.226 -0.125  1.00 0.00 ? 98  SER A HB3  6  
ATOM 8596  H HG   . SER A 1 98  ? -17.067 -36.590 2.273   1.00 0.00 ? 98  SER A HG   6  
ATOM 8597  N N    . GLY A 1 99  ? -20.620 -38.328 1.004   1.00 0.00 ? 99  GLY A N    6  
ATOM 8598  C CA   . GLY A 1 99  ? -21.410 -39.368 1.641   1.00 0.00 ? 99  GLY A CA   6  
ATOM 8599  C C    . GLY A 1 99  ? -20.782 -40.746 1.421   1.00 0.00 ? 99  GLY A C    6  
ATOM 8600  O O    . GLY A 1 99  ? -20.591 -41.171 0.283   1.00 0.00 ? 99  GLY A O    6  
ATOM 8601  H H    . GLY A 1 99  ? -20.574 -38.384 0.006   1.00 0.00 ? 99  GLY A H    6  
ATOM 8602  H HA2  . GLY A 1 99  ? -21.488 -39.167 2.709   1.00 0.00 ? 99  GLY A HA2  6  
ATOM 8603  H HA3  . GLY A 1 99  ? -22.423 -39.358 1.239   1.00 0.00 ? 99  GLY A HA3  6  
ATOM 8604  N N    . PRO A 1 100 ? -20.469 -41.423 2.559   1.00 0.00 ? 100 PRO A N    6  
ATOM 8605  C CA   . PRO A 1 100 ? -19.866 -42.744 2.502   1.00 0.00 ? 100 PRO A CA   6  
ATOM 8606  C C    . PRO A 1 100 ? -20.901 -43.802 2.115   1.00 0.00 ? 100 PRO A C    6  
ATOM 8607  O O    . PRO A 1 100 ? -21.797 -44.115 2.898   1.00 0.00 ? 100 PRO A O    6  
ATOM 8608  C CB   . PRO A 1 100 ? -19.276 -42.967 3.885   1.00 0.00 ? 100 PRO A CB   6  
ATOM 8609  C CG   . PRO A 1 100 ? -19.968 -41.970 4.799   1.00 0.00 ? 100 PRO A CG   6  
ATOM 8610  C CD   . PRO A 1 100 ? -20.680 -40.951 3.924   1.00 0.00 ? 100 PRO A CD   6  
ATOM 8611  H HA   . PRO A 1 100 ? -19.164 -42.775 1.790   1.00 0.00 ? 100 PRO A HA   6  
ATOM 8612  H HB2  . PRO A 1 100 ? -19.447 -43.990 4.221   1.00 0.00 ? 100 PRO A HB2  6  
ATOM 8613  H HB3  . PRO A 1 100 ? -18.198 -42.809 3.879   1.00 0.00 ? 100 PRO A HB3  6  
ATOM 8614  H HG2  . PRO A 1 100 ? -20.681 -42.478 5.449   1.00 0.00 ? 100 PRO A HG2  6  
ATOM 8615  H HG3  . PRO A 1 100 ? -19.242 -41.477 5.446   1.00 0.00 ? 100 PRO A HG3  6  
ATOM 8616  H HD2  . PRO A 1 100 ? -21.741 -40.895 4.164   1.00 0.00 ? 100 PRO A HD2  6  
ATOM 8617  H HD3  . PRO A 1 100 ? -20.268 -39.951 4.065   1.00 0.00 ? 100 PRO A HD3  6  
ATOM 8618  N N    . SER A 1 101 ? -20.743 -44.325 0.908   1.00 0.00 ? 101 SER A N    6  
ATOM 8619  C CA   . SER A 1 101 ? -21.653 -45.342 0.408   1.00 0.00 ? 101 SER A CA   6  
ATOM 8620  C C    . SER A 1 101 ? -20.894 -46.648 0.163   1.00 0.00 ? 101 SER A C    6  
ATOM 8621  O O    . SER A 1 101 ? -19.805 -46.639 -0.408  1.00 0.00 ? 101 SER A O    6  
ATOM 8622  C CB   . SER A 1 101 ? -22.343 -44.880 -0.877  1.00 0.00 ? 101 SER A CB   6  
ATOM 8623  O OG   . SER A 1 101 ? -23.754 -45.069 -0.823  1.00 0.00 ? 101 SER A OG   6  
ATOM 8624  H H    . SER A 1 101 ? -20.012 -44.065 0.277   1.00 0.00 ? 101 SER A H    6  
ATOM 8625  H HA   . SER A 1 101 ? -22.398 -45.473 1.192   1.00 0.00 ? 101 SER A HA   6  
ATOM 8626  H HB2  . SER A 1 101 ? -22.124 -43.825 -1.047  1.00 0.00 ? 101 SER A HB2  6  
ATOM 8627  H HB3  . SER A 1 101 ? -21.935 -45.430 -1.725  1.00 0.00 ? 101 SER A HB3  6  
ATOM 8628  H HG   . SER A 1 101 ? -24.206 -44.458 -1.473  1.00 0.00 ? 101 SER A HG   6  
ATOM 8629  N N    . SER A 1 102 ? -21.500 -47.739 0.607   1.00 0.00 ? 102 SER A N    6  
ATOM 8630  C CA   . SER A 1 102 ? -20.895 -49.050 0.443   1.00 0.00 ? 102 SER A CA   6  
ATOM 8631  C C    . SER A 1 102 ? -21.647 -49.843 -0.627  1.00 0.00 ? 102 SER A C    6  
ATOM 8632  O O    . SER A 1 102 ? -22.869 -49.972 -0.565  1.00 0.00 ? 102 SER A O    6  
ATOM 8633  C CB   . SER A 1 102 ? -20.883 -49.820 1.765   1.00 0.00 ? 102 SER A CB   6  
ATOM 8634  O OG   . SER A 1 102 ? -22.182 -50.286 2.123   1.00 0.00 ? 102 SER A OG   6  
ATOM 8635  H H    . SER A 1 102 ? -22.386 -47.737 1.071   1.00 0.00 ? 102 SER A H    6  
ATOM 8636  H HA   . SER A 1 102 ? -19.870 -48.857 0.127   1.00 0.00 ? 102 SER A HA   6  
ATOM 8637  H HB2  . SER A 1 102 ? -20.203 -50.668 1.685   1.00 0.00 ? 102 SER A HB2  6  
ATOM 8638  H HB3  . SER A 1 102 ? -20.498 -49.177 2.556   1.00 0.00 ? 102 SER A HB3  6  
ATOM 8639  H HG   . SER A 1 102 ? -22.748 -49.520 2.428   1.00 0.00 ? 102 SER A HG   6  
ATOM 8640  N N    . GLY A 1 103 ? -20.886 -50.355 -1.583  1.00 0.00 ? 103 GLY A N    6  
ATOM 8641  C CA   . GLY A 1 103 ? -21.466 -51.132 -2.665  1.00 0.00 ? 103 GLY A CA   6  
ATOM 8642  C C    . GLY A 1 103 ? -21.125 -52.617 -2.518  1.00 0.00 ? 103 GLY A C    6  
ATOM 8643  O O    . GLY A 1 103 ? -19.963 -53.004 -2.629  1.00 0.00 ? 103 GLY A O    6  
ATOM 8644  H H    . GLY A 1 103 ? -19.893 -50.246 -1.626  1.00 0.00 ? 103 GLY A H    6  
ATOM 8645  H HA2  . GLY A 1 103 ? -22.548 -51.003 -2.671  1.00 0.00 ? 103 GLY A HA2  6  
ATOM 8646  H HA3  . GLY A 1 103 ? -21.095 -50.764 -3.622  1.00 0.00 ? 103 GLY A HA3  6  
ATOM 8647  N N    . GLY A 1 1   ? -17.497 -3.730  22.462  1.00 0.00 ? 1   GLY A N    7  
ATOM 8648  C CA   . GLY A 1 1   ? -16.316 -4.569  22.570  1.00 0.00 ? 1   GLY A CA   7  
ATOM 8649  C C    . GLY A 1 1   ? -15.433 -4.437  21.328  1.00 0.00 ? 1   GLY A C    7  
ATOM 8650  O O    . GLY A 1 1   ? -15.292 -3.347  20.776  1.00 0.00 ? 1   GLY A O    7  
ATOM 8651  H H1   . GLY A 1 1   ? -18.110 -3.958  21.705  1.00 0.00 ? 1   GLY A H1   7  
ATOM 8652  H HA2  . GLY A 1 1   ? -15.747 -4.290  23.457  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 8653  H HA3  . GLY A 1 1   ? -16.616 -5.609  22.699  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 8654  N N    . SER A 1 2   ? -14.861 -5.562  20.925  1.00 0.00 ? 2   SER A N    7  
ATOM 8655  C CA   . SER A 1 2   ? -13.996 -5.585  19.758  1.00 0.00 ? 2   SER A CA   7  
ATOM 8656  C C    . SER A 1 2   ? -14.809 -5.934  18.510  1.00 0.00 ? 2   SER A C    7  
ATOM 8657  O O    . SER A 1 2   ? -15.919 -6.455  18.613  1.00 0.00 ? 2   SER A O    7  
ATOM 8658  C CB   . SER A 1 2   ? -12.851 -6.584  19.942  1.00 0.00 ? 2   SER A CB   7  
ATOM 8659  O OG   . SER A 1 2   ? -12.058 -6.282  21.086  1.00 0.00 ? 2   SER A OG   7  
ATOM 8660  H H    . SER A 1 2   ? -14.981 -6.444  21.380  1.00 0.00 ? 2   SER A H    7  
ATOM 8661  H HA   . SER A 1 2   ? -13.589 -4.577  19.681  1.00 0.00 ? 2   SER A HA   7  
ATOM 8662  H HB2  . SER A 1 2   ? -13.260 -7.590  20.039  1.00 0.00 ? 2   SER A HB2  7  
ATOM 8663  H HB3  . SER A 1 2   ? -12.221 -6.580  19.052  1.00 0.00 ? 2   SER A HB3  7  
ATOM 8664  H HG   . SER A 1 2   ? -11.599 -5.403  20.962  1.00 0.00 ? 2   SER A HG   7  
ATOM 8665  N N    . SER A 1 3   ? -14.226 -5.632  17.359  1.00 0.00 ? 3   SER A N    7  
ATOM 8666  C CA   . SER A 1 3   ? -14.882 -5.907  16.093  1.00 0.00 ? 3   SER A CA   7  
ATOM 8667  C C    . SER A 1 3   ? -14.366 -7.225  15.511  1.00 0.00 ? 3   SER A C    7  
ATOM 8668  O O    . SER A 1 3   ? -15.131 -8.172  15.336  1.00 0.00 ? 3   SER A O    7  
ATOM 8669  C CB   . SER A 1 3   ? -14.662 -4.765  15.099  1.00 0.00 ? 3   SER A CB   7  
ATOM 8670  O OG   . SER A 1 3   ? -15.698 -3.790  15.168  1.00 0.00 ? 3   SER A OG   7  
ATOM 8671  H H    . SER A 1 3   ? -13.323 -5.209  17.284  1.00 0.00 ? 3   SER A H    7  
ATOM 8672  H HA   . SER A 1 3   ? -15.944 -5.983  16.329  1.00 0.00 ? 3   SER A HA   7  
ATOM 8673  H HB2  . SER A 1 3   ? -13.702 -4.289  15.300  1.00 0.00 ? 3   SER A HB2  7  
ATOM 8674  H HB3  . SER A 1 3   ? -14.611 -5.169  14.088  1.00 0.00 ? 3   SER A HB3  7  
ATOM 8675  H HG   . SER A 1 3   ? -15.373 -2.979  15.654  1.00 0.00 ? 3   SER A HG   7  
ATOM 8676  N N    . GLY A 1 4   ? -13.072 -7.242  15.227  1.00 0.00 ? 4   GLY A N    7  
ATOM 8677  C CA   . GLY A 1 4   ? -12.445 -8.428  14.668  1.00 0.00 ? 4   GLY A CA   7  
ATOM 8678  C C    . GLY A 1 4   ? -11.198 -8.816  15.465  1.00 0.00 ? 4   GLY A C    7  
ATOM 8679  O O    . GLY A 1 4   ? -11.299 -9.237  16.616  1.00 0.00 ? 4   GLY A O    7  
ATOM 8680  H H    . GLY A 1 4   ? -12.457 -6.467  15.372  1.00 0.00 ? 4   GLY A H    7  
ATOM 8681  H HA2  . GLY A 1 4   ? -13.155 -9.255  14.671  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 8682  H HA3  . GLY A 1 4   ? -12.174 -8.244  13.628  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 8683  N N    . SER A 1 5   ? -10.051 -8.660  14.821  1.00 0.00 ? 5   SER A N    7  
ATOM 8684  C CA   . SER A 1 5   ? -8.785  -8.988  15.455  1.00 0.00 ? 5   SER A CA   7  
ATOM 8685  C C    . SER A 1 5   ? -7.828  -7.799  15.359  1.00 0.00 ? 5   SER A C    7  
ATOM 8686  O O    . SER A 1 5   ? -7.267  -7.366  16.365  1.00 0.00 ? 5   SER A O    7  
ATOM 8687  C CB   . SER A 1 5   ? -8.156  -10.229 14.819  1.00 0.00 ? 5   SER A CB   7  
ATOM 8688  O OG   . SER A 1 5   ? -7.548  -11.076 15.789  1.00 0.00 ? 5   SER A OG   7  
ATOM 8689  H H    . SER A 1 5   ? -9.977  -8.316  13.884  1.00 0.00 ? 5   SER A H    7  
ATOM 8690  H HA   . SER A 1 5   ? -9.031  -9.199  16.496  1.00 0.00 ? 5   SER A HA   7  
ATOM 8691  H HB2  . SER A 1 5   ? -8.921  -10.787 14.279  1.00 0.00 ? 5   SER A HB2  7  
ATOM 8692  H HB3  . SER A 1 5   ? -7.410  -9.922  14.086  1.00 0.00 ? 5   SER A HB3  7  
ATOM 8693  H HG   . SER A 1 5   ? -7.194  -11.902 15.349  1.00 0.00 ? 5   SER A HG   7  
ATOM 8694  N N    . SER A 1 6   ? -7.669  -7.304  14.140  1.00 0.00 ? 6   SER A N    7  
ATOM 8695  C CA   . SER A 1 6   ? -6.789  -6.174  13.900  1.00 0.00 ? 6   SER A CA   7  
ATOM 8696  C C    . SER A 1 6   ? -5.357  -6.530  14.304  1.00 0.00 ? 6   SER A C    7  
ATOM 8697  O O    . SER A 1 6   ? -5.133  -7.518  15.002  1.00 0.00 ? 6   SER A O    7  
ATOM 8698  C CB   . SER A 1 6   ? -7.263  -4.935  14.663  1.00 0.00 ? 6   SER A CB   7  
ATOM 8699  O OG   . SER A 1 6   ? -8.664  -4.721  14.516  1.00 0.00 ? 6   SER A OG   7  
ATOM 8700  H H    . SER A 1 6   ? -8.129  -7.662  13.327  1.00 0.00 ? 6   SER A H    7  
ATOM 8701  H HA   . SER A 1 6   ? -6.848  -5.984  12.828  1.00 0.00 ? 6   SER A HA   7  
ATOM 8702  H HB2  . SER A 1 6   ? -7.022  -5.046  15.720  1.00 0.00 ? 6   SER A HB2  7  
ATOM 8703  H HB3  . SER A 1 6   ? -6.722  -4.059  14.303  1.00 0.00 ? 6   SER A HB3  7  
ATOM 8704  H HG   . SER A 1 6   ? -9.171  -5.419  15.021  1.00 0.00 ? 6   SER A HG   7  
ATOM 8705  N N    . GLY A 1 7   ? -4.425  -5.706  13.848  1.00 0.00 ? 7   GLY A N    7  
ATOM 8706  C CA   . GLY A 1 7   ? -3.021  -5.922  14.153  1.00 0.00 ? 7   GLY A CA   7  
ATOM 8707  C C    . GLY A 1 7   ? -2.125  -5.095  13.229  1.00 0.00 ? 7   GLY A C    7  
ATOM 8708  O O    . GLY A 1 7   ? -2.426  -4.934  12.047  1.00 0.00 ? 7   GLY A O    7  
ATOM 8709  H H    . GLY A 1 7   ? -4.616  -4.905  13.281  1.00 0.00 ? 7   GLY A H    7  
ATOM 8710  H HA2  . GLY A 1 7   ? -2.825  -5.654  15.191  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 8711  H HA3  . GLY A 1 7   ? -2.780  -6.980  14.046  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 8712  N N    . SER A 1 8   ? -1.042  -4.591  13.803  1.00 0.00 ? 8   SER A N    7  
ATOM 8713  C CA   . SER A 1 8   ? -0.101  -3.784  13.046  1.00 0.00 ? 8   SER A CA   7  
ATOM 8714  C C    . SER A 1 8   ? 1.059   -4.654  12.556  1.00 0.00 ? 8   SER A C    7  
ATOM 8715  O O    . SER A 1 8   ? 1.285   -5.744  13.078  1.00 0.00 ? 8   SER A O    7  
ATOM 8716  C CB   . SER A 1 8   ? 0.427   -2.620  13.887  1.00 0.00 ? 8   SER A CB   7  
ATOM 8717  O OG   . SER A 1 8   ? 1.403   -1.854  13.185  1.00 0.00 ? 8   SER A OG   7  
ATOM 8718  H H    . SER A 1 8   ? -0.805  -4.726  14.765  1.00 0.00 ? 8   SER A H    7  
ATOM 8719  H HA   . SER A 1 8   ? -0.669  -3.393  12.202  1.00 0.00 ? 8   SER A HA   7  
ATOM 8720  H HB2  . SER A 1 8   ? -0.403  -1.974  14.174  1.00 0.00 ? 8   SER A HB2  7  
ATOM 8721  H HB3  . SER A 1 8   ? 0.863   -3.006  14.808  1.00 0.00 ? 8   SER A HB3  7  
ATOM 8722  H HG   . SER A 1 8   ? 2.211   -2.414  13.003  1.00 0.00 ? 8   SER A HG   7  
ATOM 8723  N N    . VAL A 1 9   ? 1.763   -4.138  11.559  1.00 0.00 ? 9   VAL A N    7  
ATOM 8724  C CA   . VAL A 1 9   ? 2.894   -4.854  10.993  1.00 0.00 ? 9   VAL A CA   7  
ATOM 8725  C C    . VAL A 1 9   ? 4.096   -3.912  10.905  1.00 0.00 ? 9   VAL A C    7  
ATOM 8726  O O    . VAL A 1 9   ? 3.943   -2.695  10.996  1.00 0.00 ? 9   VAL A O    7  
ATOM 8727  C CB   . VAL A 1 9   ? 2.507   -5.459  9.642   1.00 0.00 ? 9   VAL A CB   7  
ATOM 8728  C CG1  . VAL A 1 9   ? 1.649   -4.485  8.831   1.00 0.00 ? 9   VAL A CG1  7  
ATOM 8729  C CG2  . VAL A 1 9   ? 3.749   -5.882  8.855   1.00 0.00 ? 9   VAL A CG2  7  
ATOM 8730  H H    . VAL A 1 9   ? 1.573   -3.250  11.141  1.00 0.00 ? 9   VAL A H    7  
ATOM 8731  H HA   . VAL A 1 9   ? 3.138   -5.672  11.672  1.00 0.00 ? 9   VAL A HA   7  
ATOM 8732  H HB   . VAL A 1 9   ? 1.911   -6.351  9.833   1.00 0.00 ? 9   VAL A HB   7  
ATOM 8733  H HG11 . VAL A 1 9   ? 0.598   -4.639  9.073   1.00 0.00 ? 9   VAL A HG11 7  
ATOM 8734  H HG12 . VAL A 1 9   ? 1.932   -3.461  9.076   1.00 0.00 ? 9   VAL A HG12 7  
ATOM 8735  H HG13 . VAL A 1 9   ? 1.807   -4.661  7.767   1.00 0.00 ? 9   VAL A HG13 7  
ATOM 8736  H HG21 . VAL A 1 9   ? 4.366   -5.007  8.653   1.00 0.00 ? 9   VAL A HG21 7  
ATOM 8737  H HG22 . VAL A 1 9   ? 4.321   -6.603  9.439   1.00 0.00 ? 9   VAL A HG22 7  
ATOM 8738  H HG23 . VAL A 1 9   ? 3.444   -6.337  7.913   1.00 0.00 ? 9   VAL A HG23 7  
ATOM 8739  N N    . SER A 1 10  ? 5.265   -4.510  10.728  1.00 0.00 ? 10  SER A N    7  
ATOM 8740  C CA   . SER A 1 10  ? 6.492   -3.740  10.626  1.00 0.00 ? 10  SER A CA   7  
ATOM 8741  C C    . SER A 1 10  ? 7.368   -4.297  9.502   1.00 0.00 ? 10  SER A C    7  
ATOM 8742  O O    . SER A 1 10  ? 7.706   -5.480  9.502   1.00 0.00 ? 10  SER A O    7  
ATOM 8743  C CB   . SER A 1 10  ? 7.259   -3.748  11.949  1.00 0.00 ? 10  SER A CB   7  
ATOM 8744  O OG   . SER A 1 10  ? 8.558   -3.177  11.817  1.00 0.00 ? 10  SER A OG   7  
ATOM 8745  H H    . SER A 1 10  ? 5.380   -5.501  10.654  1.00 0.00 ? 10  SER A H    7  
ATOM 8746  H HA   . SER A 1 10  ? 6.176   -2.723  10.395  1.00 0.00 ? 10  SER A HA   7  
ATOM 8747  H HB2  . SER A 1 10  ? 6.694   -3.193  12.699  1.00 0.00 ? 10  SER A HB2  7  
ATOM 8748  H HB3  . SER A 1 10  ? 7.348   -4.772  12.311  1.00 0.00 ? 10  SER A HB3  7  
ATOM 8749  H HG   . SER A 1 10  ? 8.512   -2.187  11.951  1.00 0.00 ? 10  SER A HG   7  
ATOM 8750  N N    . LEU A 1 11  ? 7.711   -3.419  8.571   1.00 0.00 ? 11  LEU A N    7  
ATOM 8751  C CA   . LEU A 1 11  ? 8.541   -3.809  7.443   1.00 0.00 ? 11  LEU A CA   7  
ATOM 8752  C C    . LEU A 1 11  ? 9.874   -3.062  7.516   1.00 0.00 ? 11  LEU A C    7  
ATOM 8753  O O    . LEU A 1 11  ? 9.944   -1.958  8.053   1.00 0.00 ? 11  LEU A O    7  
ATOM 8754  C CB   . LEU A 1 11  ? 7.789   -3.599  6.127   1.00 0.00 ? 11  LEU A CB   7  
ATOM 8755  C CG   . LEU A 1 11  ? 6.363   -4.151  6.074   1.00 0.00 ? 11  LEU A CG   7  
ATOM 8756  C CD1  . LEU A 1 11  ? 5.699   -3.825  4.735   1.00 0.00 ? 11  LEU A CD1  7  
ATOM 8757  C CD2  . LEU A 1 11  ? 6.344   -5.651  6.374   1.00 0.00 ? 11  LEU A CD2  7  
ATOM 8758  H H    . LEU A 1 11  ? 7.432   -2.459  8.578   1.00 0.00 ? 11  LEU A H    7  
ATOM 8759  H HA   . LEU A 1 11  ? 8.737   -4.877  7.536   1.00 0.00 ? 11  LEU A HA   7  
ATOM 8760  H HB2  . LEU A 1 11  ? 7.752   -2.530  5.919   1.00 0.00 ? 11  LEU A HB2  7  
ATOM 8761  H HB3  . LEU A 1 11  ? 8.366   -4.060  5.325   1.00 0.00 ? 11  LEU A HB3  7  
ATOM 8762  H HG   . LEU A 1 11  ? 5.778   -3.660  6.851   1.00 0.00 ? 11  LEU A HG   7  
ATOM 8763  H HD11 . LEU A 1 11  ? 5.126   -2.903  4.828   1.00 0.00 ? 11  LEU A HD11 7  
ATOM 8764  H HD12 . LEU A 1 11  ? 6.465   -3.701  3.970   1.00 0.00 ? 11  LEU A HD12 7  
ATOM 8765  H HD13 . LEU A 1 11  ? 5.032   -4.640  4.452   1.00 0.00 ? 11  LEU A HD13 7  
ATOM 8766  H HD21 . LEU A 1 11  ? 6.966   -6.175  5.648   1.00 0.00 ? 11  LEU A HD21 7  
ATOM 8767  H HD22 . LEU A 1 11  ? 6.731   -5.826  7.378   1.00 0.00 ? 11  LEU A HD22 7  
ATOM 8768  H HD23 . LEU A 1 11  ? 5.320   -6.021  6.310   1.00 0.00 ? 11  LEU A HD23 7  
ATOM 8769  N N    . VAL A 1 12  ? 10.900  -3.695  6.966   1.00 0.00 ? 12  VAL A N    7  
ATOM 8770  C CA   . VAL A 1 12  ? 12.228  -3.105  6.961   1.00 0.00 ? 12  VAL A CA   7  
ATOM 8771  C C    . VAL A 1 12  ? 12.675  -2.877  5.516   1.00 0.00 ? 12  VAL A C    7  
ATOM 8772  O O    . VAL A 1 12  ? 13.007  -3.826  4.808   1.00 0.00 ? 12  VAL A O    7  
ATOM 8773  C CB   . VAL A 1 12  ? 13.195  -3.986  7.754   1.00 0.00 ? 12  VAL A CB   7  
ATOM 8774  C CG1  . VAL A 1 12  ? 14.633  -3.481  7.620   1.00 0.00 ? 12  VAL A CG1  7  
ATOM 8775  C CG2  . VAL A 1 12  ? 12.780  -4.072  9.224   1.00 0.00 ? 12  VAL A CG2  7  
ATOM 8776  H H    . VAL A 1 12  ? 10.836  -4.593  6.531   1.00 0.00 ? 12  VAL A H    7  
ATOM 8777  H HA   . VAL A 1 12  ? 12.161  -2.140  7.464   1.00 0.00 ? 12  VAL A HA   7  
ATOM 8778  H HB   . VAL A 1 12  ? 13.153  -4.991  7.335   1.00 0.00 ? 12  VAL A HB   7  
ATOM 8779  H HG11 . VAL A 1 12  ? 15.322  -4.242  7.985   1.00 0.00 ? 12  VAL A HG11 7  
ATOM 8780  H HG12 . VAL A 1 12  ? 14.848  -3.269  6.572   1.00 0.00 ? 12  VAL A HG12 7  
ATOM 8781  H HG13 . VAL A 1 12  ? 14.755  -2.570  8.206   1.00 0.00 ? 12  VAL A HG13 7  
ATOM 8782  H HG21 . VAL A 1 12  ? 12.052  -4.873  9.349   1.00 0.00 ? 12  VAL A HG21 7  
ATOM 8783  H HG22 . VAL A 1 12  ? 13.656  -4.278  9.838   1.00 0.00 ? 12  VAL A HG22 7  
ATOM 8784  H HG23 . VAL A 1 12  ? 12.335  -3.126  9.532   1.00 0.00 ? 12  VAL A HG23 7  
ATOM 8785  N N    . GLY A 1 13  ? 12.670  -1.612  5.121   1.00 0.00 ? 13  GLY A N    7  
ATOM 8786  C CA   . GLY A 1 13  ? 13.070  -1.247  3.773   1.00 0.00 ? 13  GLY A CA   7  
ATOM 8787  C C    . GLY A 1 13  ? 13.061  0.272   3.590   1.00 0.00 ? 13  GLY A C    7  
ATOM 8788  O O    . GLY A 1 13  ? 12.344  0.981   4.295   1.00 0.00 ? 13  GLY A O    7  
ATOM 8789  H H    . GLY A 1 13  ? 12.399  -0.845  5.703   1.00 0.00 ? 13  GLY A H    7  
ATOM 8790  H HA2  . GLY A 1 13  ? 14.068  -1.636  3.569   1.00 0.00 ? 13  GLY A HA2  7  
ATOM 8791  H HA3  . GLY A 1 13  ? 12.395  -1.708  3.052   1.00 0.00 ? 13  GLY A HA3  7  
ATOM 8792  N N    . PRO A 1 14  ? 13.887  0.739   2.615   1.00 0.00 ? 14  PRO A N    7  
ATOM 8793  C CA   . PRO A 1 14  ? 13.980  2.160   2.331   1.00 0.00 ? 14  PRO A CA   7  
ATOM 8794  C C    . PRO A 1 14  ? 12.747  2.649   1.569   1.00 0.00 ? 14  PRO A C    7  
ATOM 8795  O O    . PRO A 1 14  ? 12.589  3.847   1.340   1.00 0.00 ? 14  PRO A O    7  
ATOM 8796  C CB   . PRO A 1 14  ? 15.269  2.320   1.541   1.00 0.00 ? 14  PRO A CB   7  
ATOM 8797  C CG   . PRO A 1 14  ? 15.608  0.935   1.013   1.00 0.00 ? 14  PRO A CG   7  
ATOM 8798  C CD   . PRO A 1 14  ? 14.750  -0.072  1.761   1.00 0.00 ? 14  PRO A CD   7  
ATOM 8799  H HA   . PRO A 1 14  ? 14.000  2.684   3.183   1.00 0.00 ? 14  PRO A HA   7  
ATOM 8800  H HB2  . PRO A 1 14  ? 15.140  3.029   0.723   1.00 0.00 ? 14  PRO A HB2  7  
ATOM 8801  H HB3  . PRO A 1 14  ? 16.069  2.704   2.173   1.00 0.00 ? 14  PRO A HB3  7  
ATOM 8802  H HG2  . PRO A 1 14  ? 15.417  0.878   -0.058  1.00 0.00 ? 14  PRO A HG2  7  
ATOM 8803  H HG3  . PRO A 1 14  ? 16.666  0.719   1.161   1.00 0.00 ? 14  PRO A HG3  7  
ATOM 8804  H HD2  . PRO A 1 14  ? 14.165  -0.683  1.073   1.00 0.00 ? 14  PRO A HD2  7  
ATOM 8805  H HD3  . PRO A 1 14  ? 15.363  -0.754  2.351   1.00 0.00 ? 14  PRO A HD3  7  
ATOM 8806  N N    . ALA A 1 15  ? 11.905  1.697   1.197   1.00 0.00 ? 15  ALA A N    7  
ATOM 8807  C CA   . ALA A 1 15  ? 10.690  2.015   0.465   1.00 0.00 ? 15  ALA A CA   7  
ATOM 8808  C C    . ALA A 1 15  ? 10.163  0.750   -0.215  1.00 0.00 ? 15  ALA A C    7  
ATOM 8809  O O    . ALA A 1 15  ? 8.985   0.418   -0.088  1.00 0.00 ? 15  ALA A O    7  
ATOM 8810  C CB   . ALA A 1 15  ? 10.976  3.138   -0.535  1.00 0.00 ? 15  ALA A CB   7  
ATOM 8811  H H    . ALA A 1 15  ? 12.041  0.724   1.387   1.00 0.00 ? 15  ALA A H    7  
ATOM 8812  H HA   . ALA A 1 15  ? 9.951   2.366   1.185   1.00 0.00 ? 15  ALA A HA   7  
ATOM 8813  H HB1  . ALA A 1 15  ? 12.052  3.223   -0.687  1.00 0.00 ? 15  ALA A HB1  7  
ATOM 8814  H HB2  . ALA A 1 15  ? 10.491  2.911   -1.484  1.00 0.00 ? 15  ALA A HB2  7  
ATOM 8815  H HB3  . ALA A 1 15  ? 10.589  4.079   -0.144  1.00 0.00 ? 15  ALA A HB3  7  
ATOM 8816  N N    . PRO A 1 16  ? 11.084  0.060   -0.940  1.00 0.00 ? 16  PRO A N    7  
ATOM 8817  C CA   . PRO A 1 16  ? 10.724  -1.161  -1.640  1.00 0.00 ? 16  PRO A CA   7  
ATOM 8818  C C    . PRO A 1 16  ? 10.569  -2.328  -0.662  1.00 0.00 ? 16  PRO A C    7  
ATOM 8819  O O    . PRO A 1 16  ? 11.451  -3.178  -0.561  1.00 0.00 ? 16  PRO A O    7  
ATOM 8820  C CB   . PRO A 1 16  ? 11.837  -1.378  -2.652  1.00 0.00 ? 16  PRO A CB   7  
ATOM 8821  C CG   . PRO A 1 16  ? 13.007  -0.536  -2.170  1.00 0.00 ? 16  PRO A CG   7  
ATOM 8822  C CD   . PRO A 1 16  ? 12.487  0.424   -1.112  1.00 0.00 ? 16  PRO A CD   7  
ATOM 8823  H HA   . PRO A 1 16  ? 9.834   -1.057  -2.084  1.00 0.00 ? 16  PRO A HA   7  
ATOM 8824  H HB2  . PRO A 1 16  ? 12.112  -2.431  -2.711  1.00 0.00 ? 16  PRO A HB2  7  
ATOM 8825  H HB3  . PRO A 1 16  ? 11.522  -1.074  -3.650  1.00 0.00 ? 16  PRO A HB3  7  
ATOM 8826  H HG2  . PRO A 1 16  ? 13.791  -1.171  -1.757  1.00 0.00 ? 16  PRO A HG2  7  
ATOM 8827  H HG3  . PRO A 1 16  ? 13.449  0.015   -3.001  1.00 0.00 ? 16  PRO A HG3  7  
ATOM 8828  H HD2  . PRO A 1 16  ? 13.040  0.321   -0.178  1.00 0.00 ? 16  PRO A HD2  7  
ATOM 8829  H HD3  . PRO A 1 16  ? 12.592  1.460   -1.432  1.00 0.00 ? 16  PRO A HD3  7  
ATOM 8830  N N    . TRP A 1 17  ? 9.441   -2.330  0.033   1.00 0.00 ? 17  TRP A N    7  
ATOM 8831  C CA   . TRP A 1 17  ? 9.159   -3.378  0.999   1.00 0.00 ? 17  TRP A CA   7  
ATOM 8832  C C    . TRP A 1 17  ? 8.868   -4.667  0.227   1.00 0.00 ? 17  TRP A C    7  
ATOM 8833  O O    . TRP A 1 17  ? 9.031   -5.764  0.759   1.00 0.00 ? 17  TRP A O    7  
ATOM 8834  C CB   . TRP A 1 17  ? 8.018   -2.971  1.933   1.00 0.00 ? 17  TRP A CB   7  
ATOM 8835  C CG   . TRP A 1 17  ? 7.966   -1.472  2.235   1.00 0.00 ? 17  TRP A CG   7  
ATOM 8836  C CD1  . TRP A 1 17  ? 7.332   -0.513  1.547   1.00 0.00 ? 17  TRP A CD1  7  
ATOM 8837  C CD2  . TRP A 1 17  ? 8.603   -0.795  3.339   1.00 0.00 ? 17  TRP A CD2  7  
ATOM 8838  N NE1  . TRP A 1 17  ? 7.512   0.727   2.124   1.00 0.00 ? 17  TRP A NE1  7  
ATOM 8839  C CE2  . TRP A 1 17  ? 8.309   0.550   3.249   1.00 0.00 ? 17  TRP A CE2  7  
ATOM 8840  C CE3  . TRP A 1 17  ? 9.400   -1.303  4.380   1.00 0.00 ? 17  TRP A CE3  7  
ATOM 8841  C CZ2  . TRP A 1 17  ? 8.773   1.499   4.168   1.00 0.00 ? 17  TRP A CZ2  7  
ATOM 8842  C CZ3  . TRP A 1 17  ? 9.855   -0.342  5.291   1.00 0.00 ? 17  TRP A CZ3  7  
ATOM 8843  C CH2  . TRP A 1 17  ? 9.569   1.016   5.214   1.00 0.00 ? 17  TRP A CH2  7  
ATOM 8844  H H    . TRP A 1 17  ? 8.728   -1.634  -0.056  1.00 0.00 ? 17  TRP A H    7  
ATOM 8845  H HA   . TRP A 1 17  ? 10.046  -3.507  1.619   1.00 0.00 ? 17  TRP A HA   7  
ATOM 8846  H HB2  . TRP A 1 17  ? 7.071   -3.274  1.486   1.00 0.00 ? 17  TRP A HB2  7  
ATOM 8847  H HB3  . TRP A 1 17  ? 8.117   -3.517  2.871   1.00 0.00 ? 17  TRP A HB3  7  
ATOM 8848  H HD1  . TRP A 1 17  ? 6.747   -0.690  0.645   1.00 0.00 ? 17  TRP A HD1  7  
ATOM 8849  H HE1  . TRP A 1 17  ? 7.104   1.672   1.765   1.00 0.00 ? 17  TRP A HE1  7  
ATOM 8850  H HE3  . TRP A 1 17  ? 9.645   -2.361  4.474   1.00 0.00 ? 17  TRP A HE3  7  
ATOM 8851  H HZ2  . TRP A 1 17  ? 8.527   2.557   4.075   1.00 0.00 ? 17  TRP A HZ2  7  
ATOM 8852  H HZ3  . TRP A 1 17  ? 10.478  -0.682  6.118   1.00 0.00 ? 17  TRP A HZ3  7  
ATOM 8853  H HH2  . TRP A 1 17  ? 9.962   1.702   5.964   1.00 0.00 ? 17  TRP A HH2  7  
ATOM 8854  N N    . GLY A 1 18  ? 8.444   -4.492  -1.016  1.00 0.00 ? 18  GLY A N    7  
ATOM 8855  C CA   . GLY A 1 18  ? 8.129   -5.627  -1.866  1.00 0.00 ? 18  GLY A CA   7  
ATOM 8856  C C    . GLY A 1 18  ? 6.620   -5.742  -2.092  1.00 0.00 ? 18  GLY A C    7  
ATOM 8857  O O    . GLY A 1 18  ? 6.150   -6.706  -2.694  1.00 0.00 ? 18  GLY A O    7  
ATOM 8858  H H    . GLY A 1 18  ? 8.314   -3.596  -1.442  1.00 0.00 ? 18  GLY A H    7  
ATOM 8859  H HA2  . GLY A 1 18  ? 8.636   -5.519  -2.825  1.00 0.00 ? 18  GLY A HA2  7  
ATOM 8860  H HA3  . GLY A 1 18  ? 8.502   -6.543  -1.409  1.00 0.00 ? 18  GLY A HA3  7  
ATOM 8861  N N    . PHE A 1 19  ? 5.903   -4.744  -1.597  1.00 0.00 ? 19  PHE A N    7  
ATOM 8862  C CA   . PHE A 1 19  ? 4.457   -4.720  -1.737  1.00 0.00 ? 19  PHE A CA   7  
ATOM 8863  C C    . PHE A 1 19  ? 3.990   -3.417  -2.389  1.00 0.00 ? 19  PHE A C    7  
ATOM 8864  O O    . PHE A 1 19  ? 4.721   -2.428  -2.400  1.00 0.00 ? 19  PHE A O    7  
ATOM 8865  C CB   . PHE A 1 19  ? 3.869   -4.810  -0.327  1.00 0.00 ? 19  PHE A CB   7  
ATOM 8866  C CG   . PHE A 1 19  ? 3.886   -3.486  0.440   1.00 0.00 ? 19  PHE A CG   7  
ATOM 8867  C CD1  . PHE A 1 19  ? 3.082   -2.462  0.046   1.00 0.00 ? 19  PHE A CD1  7  
ATOM 8868  C CD2  . PHE A 1 19  ? 4.704   -3.333  1.515   1.00 0.00 ? 19  PHE A CD2  7  
ATOM 8869  C CE1  . PHE A 1 19  ? 3.098   -1.233  0.758   1.00 0.00 ? 19  PHE A CE1  7  
ATOM 8870  C CE2  . PHE A 1 19  ? 4.720   -2.105  2.227   1.00 0.00 ? 19  PHE A CE2  7  
ATOM 8871  C CZ   . PHE A 1 19  ? 3.917   -1.081  1.833   1.00 0.00 ? 19  PHE A CZ   7  
ATOM 8872  H H    . PHE A 1 19  ? 6.293   -3.963  -1.109  1.00 0.00 ? 19  PHE A H    7  
ATOM 8873  H HA   . PHE A 1 19  ? 4.179   -5.562  -2.372  1.00 0.00 ? 19  PHE A HA   7  
ATOM 8874  H HB2  . PHE A 1 19  ? 2.841   -5.166  -0.395  1.00 0.00 ? 19  PHE A HB2  7  
ATOM 8875  H HB3  . PHE A 1 19  ? 4.427   -5.554  0.241   1.00 0.00 ? 19  PHE A HB3  7  
ATOM 8876  H HD1  . PHE A 1 19  ? 2.426   -2.584  -0.816  1.00 0.00 ? 19  PHE A HD1  7  
ATOM 8877  H HD2  . PHE A 1 19  ? 5.349   -4.154  1.831   1.00 0.00 ? 19  PHE A HD2  7  
ATOM 8878  H HE1  . PHE A 1 19  ? 2.454   -0.412  0.442   1.00 0.00 ? 19  PHE A HE1  7  
ATOM 8879  H HE2  . PHE A 1 19  ? 5.376   -1.982  3.088   1.00 0.00 ? 19  PHE A HE2  7  
ATOM 8880  H HZ   . PHE A 1 19  ? 3.928   -0.137  2.379   1.00 0.00 ? 19  PHE A HZ   7  
ATOM 8881  N N    . ARG A 1 20  ? 2.775   -3.459  -2.917  1.00 0.00 ? 20  ARG A N    7  
ATOM 8882  C CA   . ARG A 1 20  ? 2.202   -2.294  -3.569  1.00 0.00 ? 20  ARG A CA   7  
ATOM 8883  C C    . ARG A 1 20  ? 0.862   -1.931  -2.927  1.00 0.00 ? 20  ARG A C    7  
ATOM 8884  O O    . ARG A 1 20  ? 0.377   -2.644  -2.049  1.00 0.00 ? 20  ARG A O    7  
ATOM 8885  C CB   . ARG A 1 20  ? 1.992   -2.547  -5.063  1.00 0.00 ? 20  ARG A CB   7  
ATOM 8886  C CG   . ARG A 1 20  ? 3.272   -2.265  -5.852  1.00 0.00 ? 20  ARG A CG   7  
ATOM 8887  C CD   . ARG A 1 20  ? 2.991   -1.348  -7.044  1.00 0.00 ? 20  ARG A CD   7  
ATOM 8888  N NE   . ARG A 1 20  ? 3.866   -0.156  -6.984  1.00 0.00 ? 20  ARG A NE   7  
ATOM 8889  C CZ   . ARG A 1 20  ? 5.197   -0.193  -7.137  1.00 0.00 ? 20  ARG A CZ   7  
ATOM 8890  N NH1  . ARG A 1 20  ? 5.814   -1.361  -7.360  1.00 0.00 ? 20  ARG A NH1  7  
ATOM 8891  N NH2  . ARG A 1 20  ? 5.911   0.939   -7.067  1.00 0.00 ? 20  ARG A NH2  7  
ATOM 8892  H H    . ARG A 1 20  ? 2.187   -4.268  -2.903  1.00 0.00 ? 20  ARG A H    7  
ATOM 8893  H HA   . ARG A 1 20  ? 2.936   -1.501  -3.419  1.00 0.00 ? 20  ARG A HA   7  
ATOM 8894  H HB2  . ARG A 1 20  ? 1.684   -3.580  -5.221  1.00 0.00 ? 20  ARG A HB2  7  
ATOM 8895  H HB3  . ARG A 1 20  ? 1.186   -1.914  -5.433  1.00 0.00 ? 20  ARG A HB3  7  
ATOM 8896  H HG2  . ARG A 1 20  ? 4.012   -1.801  -5.199  1.00 0.00 ? 20  ARG A HG2  7  
ATOM 8897  H HG3  . ARG A 1 20  ? 3.701   -3.203  -6.204  1.00 0.00 ? 20  ARG A HG3  7  
ATOM 8898  H HD2  . ARG A 1 20  ? 3.160   -1.887  -7.976  1.00 0.00 ? 20  ARG A HD2  7  
ATOM 8899  H HD3  . ARG A 1 20  ? 1.945   -1.041  -7.039  1.00 0.00 ? 20  ARG A HD3  7  
ATOM 8900  H HE   . ARG A 1 20  ? 3.438   0.733   -6.818  1.00 0.00 ? 20  ARG A HE   7  
ATOM 8901  H HH11 . ARG A 1 20  ? 5.281   -2.206  -7.413  1.00 0.00 ? 20  ARG A HH11 7  
ATOM 8902  H HH12 . ARG A 1 20  ? 6.807   -1.389  -7.475  1.00 0.00 ? 20  ARG A HH12 7  
ATOM 8903  H HH21 . ARG A 1 20  ? 5.451   1.811   -6.900  1.00 0.00 ? 20  ARG A HH21 7  
ATOM 8904  H HH22 . ARG A 1 20  ? 6.904   0.912   -7.181  1.00 0.00 ? 20  ARG A HH22 7  
ATOM 8905  N N    . LEU A 1 21  ? 0.300   -0.824  -3.389  1.00 0.00 ? 21  LEU A N    7  
ATOM 8906  C CA   . LEU A 1 21  ? -0.975  -0.358  -2.871  1.00 0.00 ? 21  LEU A CA   7  
ATOM 8907  C C    . LEU A 1 21  ? -1.854  0.106   -4.034  1.00 0.00 ? 21  LEU A C    7  
ATOM 8908  O O    . LEU A 1 21  ? -1.346  0.548   -5.063  1.00 0.00 ? 21  LEU A O    7  
ATOM 8909  C CB   . LEU A 1 21  ? -0.759  0.711   -1.798  1.00 0.00 ? 21  LEU A CB   7  
ATOM 8910  C CG   . LEU A 1 21  ? -0.165  0.223   -0.475  1.00 0.00 ? 21  LEU A CG   7  
ATOM 8911  C CD1  . LEU A 1 21  ? 0.038   1.387   0.497   1.00 0.00 ? 21  LEU A CD1  7  
ATOM 8912  C CD2  . LEU A 1 21  ? -1.022  -0.889  0.133   1.00 0.00 ? 21  LEU A CD2  7  
ATOM 8913  H H    . LEU A 1 21  ? 0.701   -0.250  -4.103  1.00 0.00 ? 21  LEU A H    7  
ATOM 8914  H HA   . LEU A 1 21  ? -1.460  -1.206  -2.388  1.00 0.00 ? 21  LEU A HA   7  
ATOM 8915  H HB2  . LEU A 1 21  ? -0.103  1.480   -2.207  1.00 0.00 ? 21  LEU A HB2  7  
ATOM 8916  H HB3  . LEU A 1 21  ? -1.717  1.187   -1.590  1.00 0.00 ? 21  LEU A HB3  7  
ATOM 8917  H HG   . LEU A 1 21  ? 0.818   -0.202  -0.678  1.00 0.00 ? 21  LEU A HG   7  
ATOM 8918  H HD11 . LEU A 1 21  ? 0.723   2.112   0.058   1.00 0.00 ? 21  LEU A HD11 7  
ATOM 8919  H HD12 . LEU A 1 21  ? -0.921  1.867   0.694   1.00 0.00 ? 21  LEU A HD12 7  
ATOM 8920  H HD13 . LEU A 1 21  ? 0.455   1.012   1.431   1.00 0.00 ? 21  LEU A HD13 7  
ATOM 8921  H HD21 . LEU A 1 21  ? -1.005  -1.760  -0.522  1.00 0.00 ? 21  LEU A HD21 7  
ATOM 8922  H HD22 . LEU A 1 21  ? -0.623  -1.161  1.111   1.00 0.00 ? 21  LEU A HD22 7  
ATOM 8923  H HD23 . LEU A 1 21  ? -2.048  -0.538  0.245   1.00 0.00 ? 21  LEU A HD23 7  
ATOM 8924  N N    . GLN A 1 22  ? -3.158  -0.011  -3.831  1.00 0.00 ? 22  GLN A N    7  
ATOM 8925  C CA   . GLN A 1 22  ? -4.113  0.391   -4.850  1.00 0.00 ? 22  GLN A CA   7  
ATOM 8926  C C    . GLN A 1 22  ? -5.431  0.821   -4.202  1.00 0.00 ? 22  GLN A C    7  
ATOM 8927  O O    . GLN A 1 22  ? -5.799  0.318   -3.142  1.00 0.00 ? 22  GLN A O    7  
ATOM 8928  C CB   . GLN A 1 22  ? -4.341  -0.733  -5.862  1.00 0.00 ? 22  GLN A CB   7  
ATOM 8929  C CG   . GLN A 1 22  ? -4.693  -2.044  -5.155  1.00 0.00 ? 22  GLN A CG   7  
ATOM 8930  C CD   . GLN A 1 22  ? -5.282  -3.057  -6.139  1.00 0.00 ? 22  GLN A CD   7  
ATOM 8931  O OE1  . GLN A 1 22  ? -5.372  -2.821  -7.333  1.00 0.00 ? 22  GLN A OE1  7  
ATOM 8932  N NE2  . GLN A 1 22  ? -5.678  -4.193  -5.574  1.00 0.00 ? 22  GLN A NE2  7  
ATOM 8933  H H    . GLN A 1 22  ? -3.564  -0.372  -2.991  1.00 0.00 ? 22  GLN A H    7  
ATOM 8934  H HA   . GLN A 1 22  ? -3.655  1.240   -5.357  1.00 0.00 ? 22  GLN A HA   7  
ATOM 8935  H HB2  . GLN A 1 22  ? -5.146  -0.457  -6.543  1.00 0.00 ? 22  GLN A HB2  7  
ATOM 8936  H HB3  . GLN A 1 22  ? -3.445  -0.871  -6.466  1.00 0.00 ? 22  GLN A HB3  7  
ATOM 8937  H HG2  . GLN A 1 22  ? -3.799  -2.462  -4.690  1.00 0.00 ? 22  GLN A HG2  7  
ATOM 8938  H HG3  . GLN A 1 22  ? -5.407  -1.850  -4.355  1.00 0.00 ? 22  GLN A HG3  7  
ATOM 8939  H HE21 . GLN A 1 22  ? -5.576  -4.323  -4.587  1.00 0.00 ? 22  GLN A HE21 7  
ATOM 8940  H HE22 . GLN A 1 22  ? -6.078  -4.918  -6.135  1.00 0.00 ? 22  GLN A HE22 7  
ATOM 8941  N N    . GLY A 1 23  ? -6.105  1.748   -4.867  1.00 0.00 ? 23  GLY A N    7  
ATOM 8942  C CA   . GLY A 1 23  ? -7.374  2.252   -4.369  1.00 0.00 ? 23  GLY A CA   7  
ATOM 8943  C C    . GLY A 1 23  ? -7.221  3.668   -3.811  1.00 0.00 ? 23  GLY A C    7  
ATOM 8944  O O    . GLY A 1 23  ? -6.335  4.412   -4.230  1.00 0.00 ? 23  GLY A O    7  
ATOM 8945  H H    . GLY A 1 23  ? -5.799  2.152   -5.728  1.00 0.00 ? 23  GLY A H    7  
ATOM 8946  H HA2  . GLY A 1 23  ? -8.110  2.252   -5.173  1.00 0.00 ? 23  GLY A HA2  7  
ATOM 8947  H HA3  . GLY A 1 23  ? -7.752  1.589   -3.591  1.00 0.00 ? 23  GLY A HA3  7  
ATOM 8948  N N    . GLY A 1 24  ? -8.097  3.998   -2.873  1.00 0.00 ? 24  GLY A N    7  
ATOM 8949  C CA   . GLY A 1 24  ? -8.070  5.312   -2.253  1.00 0.00 ? 24  GLY A CA   7  
ATOM 8950  C C    . GLY A 1 24  ? -9.354  6.087   -2.556  1.00 0.00 ? 24  GLY A C    7  
ATOM 8951  O O    . GLY A 1 24  ? -10.203 5.618   -3.311  1.00 0.00 ? 24  GLY A O    7  
ATOM 8952  H H    . GLY A 1 24  ? -8.814  3.387   -2.538  1.00 0.00 ? 24  GLY A H    7  
ATOM 8953  H HA2  . GLY A 1 24  ? -7.950  5.207   -1.175  1.00 0.00 ? 24  GLY A HA2  7  
ATOM 8954  H HA3  . GLY A 1 24  ? -7.208  5.872   -2.616  1.00 0.00 ? 24  GLY A HA3  7  
ATOM 8955  N N    . LYS A 1 25  ? -9.454  7.262   -1.951  1.00 0.00 ? 25  LYS A N    7  
ATOM 8956  C CA   . LYS A 1 25  ? -10.620 8.107   -2.146  1.00 0.00 ? 25  LYS A CA   7  
ATOM 8957  C C    . LYS A 1 25  ? -10.684 8.550   -3.609  1.00 0.00 ? 25  LYS A C    7  
ATOM 8958  O O    . LYS A 1 25  ? -11.751 8.902   -4.109  1.00 0.00 ? 25  LYS A O    7  
ATOM 8959  C CB   . LYS A 1 25  ? -10.612 9.269   -1.151  1.00 0.00 ? 25  LYS A CB   7  
ATOM 8960  C CG   . LYS A 1 25  ? -11.905 9.301   -0.335  1.00 0.00 ? 25  LYS A CG   7  
ATOM 8961  C CD   . LYS A 1 25  ? -11.789 10.275  0.840   1.00 0.00 ? 25  LYS A CD   7  
ATOM 8962  C CE   . LYS A 1 25  ? -11.719 11.722  0.347   1.00 0.00 ? 25  LYS A CE   7  
ATOM 8963  N NZ   . LYS A 1 25  ? -11.129 12.595  1.386   1.00 0.00 ? 25  LYS A NZ   7  
ATOM 8964  H H    . LYS A 1 25  ? -8.759  7.637   -1.338  1.00 0.00 ? 25  LYS A H    7  
ATOM 8965  H HA   . LYS A 1 25  ? -11.501 7.503   -1.930  1.00 0.00 ? 25  LYS A HA   7  
ATOM 8966  H HB2  . LYS A 1 25  ? -9.757  9.174   -0.482  1.00 0.00 ? 25  LYS A HB2  7  
ATOM 8967  H HB3  . LYS A 1 25  ? -10.493 10.211  -1.687  1.00 0.00 ? 25  LYS A HB3  7  
ATOM 8968  H HG2  . LYS A 1 25  ? -12.737 9.596   -0.975  1.00 0.00 ? 25  LYS A HG2  7  
ATOM 8969  H HG3  . LYS A 1 25  ? -12.129 8.301   0.038   1.00 0.00 ? 25  LYS A HG3  7  
ATOM 8970  H HD2  . LYS A 1 25  ? -12.645 10.153  1.504   1.00 0.00 ? 25  LYS A HD2  7  
ATOM 8971  H HD3  . LYS A 1 25  ? -10.898 10.042  1.423   1.00 0.00 ? 25  LYS A HD3  7  
ATOM 8972  H HE2  . LYS A 1 25  ? -11.122 11.774  -0.563  1.00 0.00 ? 25  LYS A HE2  7  
ATOM 8973  H HE3  . LYS A 1 25  ? -12.719 12.074  0.093   1.00 0.00 ? 25  LYS A HE3  7  
ATOM 8974  H HZ1  . LYS A 1 25  ? -10.161 12.743  1.186   1.00 0.00 ? 25  LYS A HZ1  7  
ATOM 8975  H HZ2  . LYS A 1 25  ? -11.606 13.474  1.393   1.00 0.00 ? 25  LYS A HZ2  7  
ATOM 8976  H HZ3  . LYS A 1 25  ? -11.222 12.158  2.281   1.00 0.00 ? 25  LYS A HZ3  7  
ATOM 8977  N N    . ASP A 1 26  ? -9.527  8.519   -4.255  1.00 0.00 ? 26  ASP A N    7  
ATOM 8978  C CA   . ASP A 1 26  ? -9.438  8.913   -5.650  1.00 0.00 ? 26  ASP A CA   7  
ATOM 8979  C C    . ASP A 1 26  ? -9.938  7.767   -6.532  1.00 0.00 ? 26  ASP A C    7  
ATOM 8980  O O    . ASP A 1 26  ? -10.534 8.002   -7.582  1.00 0.00 ? 26  ASP A O    7  
ATOM 8981  C CB   . ASP A 1 26  ? -7.991  9.217   -6.045  1.00 0.00 ? 26  ASP A CB   7  
ATOM 8982  C CG   . ASP A 1 26  ? -7.733  9.282   -7.552  1.00 0.00 ? 26  ASP A CG   7  
ATOM 8983  O OD1  . ASP A 1 26  ? -8.357  10.151  -8.198  1.00 0.00 ? 26  ASP A OD1  7  
ATOM 8984  O OD2  . ASP A 1 26  ? -6.916  8.462   -8.023  1.00 0.00 ? 26  ASP A OD2  7  
ATOM 8985  H H    . ASP A 1 26  ? -8.663  8.231   -3.841  1.00 0.00 ? 26  ASP A H    7  
ATOM 8986  H HA   . ASP A 1 26  ? -10.057 9.806   -5.736  1.00 0.00 ? 26  ASP A HA   7  
ATOM 8987  H HB2  . ASP A 1 26  ? -7.702  10.170  -5.601  1.00 0.00 ? 26  ASP A HB2  7  
ATOM 8988  H HB3  . ASP A 1 26  ? -7.344  8.454   -5.613  1.00 0.00 ? 26  ASP A HB3  7  
ATOM 8989  N N    . PHE A 1 27  ? -9.676  6.552   -6.073  1.00 0.00 ? 27  PHE A N    7  
ATOM 8990  C CA   . PHE A 1 27  ? -10.092 5.369   -6.808  1.00 0.00 ? 27  PHE A CA   7  
ATOM 8991  C C    . PHE A 1 27  ? -11.452 4.869   -6.316  1.00 0.00 ? 27  PHE A C    7  
ATOM 8992  O O    . PHE A 1 27  ? -11.837 3.734   -6.592  1.00 0.00 ? 27  PHE A O    7  
ATOM 8993  C CB   . PHE A 1 27  ? -9.041  4.289   -6.548  1.00 0.00 ? 27  PHE A CB   7  
ATOM 8994  C CG   . PHE A 1 27  ? -7.731  4.499   -7.310  1.00 0.00 ? 27  PHE A CG   7  
ATOM 8995  C CD1  . PHE A 1 27  ? -6.831  5.420   -6.873  1.00 0.00 ? 27  PHE A CD1  7  
ATOM 8996  C CD2  . PHE A 1 27  ? -7.467  3.765   -8.424  1.00 0.00 ? 27  PHE A CD2  7  
ATOM 8997  C CE1  . PHE A 1 27  ? -5.615  5.616   -7.581  1.00 0.00 ? 27  PHE A CE1  7  
ATOM 8998  C CE2  . PHE A 1 27  ? -6.251  3.961   -9.131  1.00 0.00 ? 27  PHE A CE2  7  
ATOM 8999  C CZ   . PHE A 1 27  ? -5.351  4.882   -8.695  1.00 0.00 ? 27  PHE A CZ   7  
ATOM 9000  H H    . PHE A 1 27  ? -9.191  6.370   -5.218  1.00 0.00 ? 27  PHE A H    7  
ATOM 9001  H HA   . PHE A 1 27  ? -10.168 5.651   -7.858  1.00 0.00 ? 27  PHE A HA   7  
ATOM 9002  H HB2  . PHE A 1 27  ? -8.826  4.254   -5.480  1.00 0.00 ? 27  PHE A HB2  7  
ATOM 9003  H HB3  . PHE A 1 27  ? -9.456  3.319   -6.821  1.00 0.00 ? 27  PHE A HB3  7  
ATOM 9004  H HD1  . PHE A 1 27  ? -7.042  6.009   -5.981  1.00 0.00 ? 27  PHE A HD1  7  
ATOM 9005  H HD2  . PHE A 1 27  ? -8.188  3.027   -8.774  1.00 0.00 ? 27  PHE A HD2  7  
ATOM 9006  H HE1  . PHE A 1 27  ? -4.893  6.354   -7.231  1.00 0.00 ? 27  PHE A HE1  7  
ATOM 9007  H HE2  . PHE A 1 27  ? -6.039  3.372   -10.024 1.00 0.00 ? 27  PHE A HE2  7  
ATOM 9008  H HZ   . PHE A 1 27  ? -4.417  5.032   -9.237  1.00 0.00 ? 27  PHE A HZ   7  
ATOM 9009  N N    . ASN A 1 28  ? -12.143 5.741   -5.596  1.00 0.00 ? 28  ASN A N    7  
ATOM 9010  C CA   . ASN A 1 28  ? -13.452 5.402   -5.064  1.00 0.00 ? 28  ASN A CA   7  
ATOM 9011  C C    . ASN A 1 28  ? -13.372 4.052   -4.348  1.00 0.00 ? 28  ASN A C    7  
ATOM 9012  O O    . ASN A 1 28  ? -14.217 3.183   -4.560  1.00 0.00 ? 28  ASN A O    7  
ATOM 9013  C CB   . ASN A 1 28  ? -14.488 5.284   -6.184  1.00 0.00 ? 28  ASN A CB   7  
ATOM 9014  C CG   . ASN A 1 28  ? -15.183 6.624   -6.432  1.00 0.00 ? 28  ASN A CG   7  
ATOM 9015  O OD1  . ASN A 1 28  ? -14.630 7.689   -6.212  1.00 0.00 ? 28  ASN A OD1  7  
ATOM 9016  N ND2  . ASN A 1 28  ? -16.422 6.512   -6.901  1.00 0.00 ? 28  ASN A ND2  7  
ATOM 9017  H H    . ASN A 1 28  ? -11.823 6.662   -5.376  1.00 0.00 ? 28  ASN A H    7  
ATOM 9018  H HA   . ASN A 1 28  ? -13.706 6.218   -4.388  1.00 0.00 ? 28  ASN A HA   7  
ATOM 9019  H HB2  . ASN A 1 28  ? -14.002 4.946   -7.099  1.00 0.00 ? 28  ASN A HB2  7  
ATOM 9020  H HB3  . ASN A 1 28  ? -15.229 4.529   -5.920  1.00 0.00 ? 28  ASN A HB3  7  
ATOM 9021  H HD21 . ASN A 1 28  ? -16.817 5.607   -7.060  1.00 0.00 ? 28  ASN A HD21 7  
ATOM 9022  H HD22 . ASN A 1 28  ? -16.959 7.333   -7.096  1.00 0.00 ? 28  ASN A HD22 7  
ATOM 9023  N N    . MET A 1 29  ? -12.350 3.919   -3.516  1.00 0.00 ? 29  MET A N    7  
ATOM 9024  C CA   . MET A 1 29  ? -12.150 2.690   -2.768  1.00 0.00 ? 29  MET A CA   7  
ATOM 9025  C C    . MET A 1 29  ? -11.081 2.873   -1.688  1.00 0.00 ? 29  MET A C    7  
ATOM 9026  O O    . MET A 1 29  ? -10.414 3.905   -1.639  1.00 0.00 ? 29  MET A O    7  
ATOM 9027  C CB   . MET A 1 29  ? -11.724 1.574   -3.724  1.00 0.00 ? 29  MET A CB   7  
ATOM 9028  C CG   . MET A 1 29  ? -10.205 1.390   -3.710  1.00 0.00 ? 29  MET A CG   7  
ATOM 9029  S SD   . MET A 1 29  ? -9.720  0.223   -4.971  1.00 0.00 ? 29  MET A SD   7  
ATOM 9030  C CE   . MET A 1 29  ? -9.254  -1.163  -3.947  1.00 0.00 ? 29  MET A CE   7  
ATOM 9031  H H    . MET A 1 29  ? -11.668 4.631   -3.350  1.00 0.00 ? 29  MET A H    7  
ATOM 9032  H HA   . MET A 1 29  ? -13.111 2.469   -2.304  1.00 0.00 ? 29  MET A HA   7  
ATOM 9033  H HB2  . MET A 1 29  ? -12.209 0.640   -3.438  1.00 0.00 ? 29  MET A HB2  7  
ATOM 9034  H HB3  . MET A 1 29  ? -12.057 1.809   -4.735  1.00 0.00 ? 29  MET A HB3  7  
ATOM 9035  H HG2  . MET A 1 29  ? -9.713  2.348   -3.881  1.00 0.00 ? 29  MET A HG2  7  
ATOM 9036  H HG3  . MET A 1 29  ? -9.882  1.036   -2.731  1.00 0.00 ? 29  MET A HG3  7  
ATOM 9037  H HE1  . MET A 1 29  ? -10.107 -1.831  -3.830  1.00 0.00 ? 29  MET A HE1  7  
ATOM 9038  H HE2  . MET A 1 29  ? -8.432  -1.702  -4.418  1.00 0.00 ? 29  MET A HE2  7  
ATOM 9039  H HE3  . MET A 1 29  ? -8.938  -0.802  -2.968  1.00 0.00 ? 29  MET A HE3  7  
ATOM 9040  N N    . PRO A 1 30  ? -10.949 1.828   -0.827  1.00 0.00 ? 30  PRO A N    7  
ATOM 9041  C CA   . PRO A 1 30  ? -9.973  1.864   0.248   1.00 0.00 ? 30  PRO A CA   7  
ATOM 9042  C C    . PRO A 1 30  ? -8.557  1.646   -0.289  1.00 0.00 ? 30  PRO A C    7  
ATOM 9043  O O    . PRO A 1 30  ? -8.311  1.806   -1.483  1.00 0.00 ? 30  PRO A O    7  
ATOM 9044  C CB   . PRO A 1 30  ? -10.415 0.779   1.217   1.00 0.00 ? 30  PRO A CB   7  
ATOM 9045  C CG   . PRO A 1 30  ? -11.343 -0.130  0.428   1.00 0.00 ? 30  PRO A CG   7  
ATOM 9046  C CD   . PRO A 1 30  ? -11.722 0.590   -0.855  1.00 0.00 ? 30  PRO A CD   7  
ATOM 9047  H HA   . PRO A 1 30  ? -9.965  2.766   0.680   1.00 0.00 ? 30  PRO A HA   7  
ATOM 9048  H HB2  . PRO A 1 30  ? -9.558  0.225   1.600   1.00 0.00 ? 30  PRO A HB2  7  
ATOM 9049  H HB3  . PRO A 1 30  ? -10.927 1.208   2.077   1.00 0.00 ? 30  PRO A HB3  7  
ATOM 9050  H HG2  . PRO A 1 30  ? -10.851 -1.077  0.204   1.00 0.00 ? 30  PRO A HG2  7  
ATOM 9051  H HG3  . PRO A 1 30  ? -12.234 -0.365  1.011   1.00 0.00 ? 30  PRO A HG3  7  
ATOM 9052  H HD2  . PRO A 1 30  ? -11.478 -0.009  -1.733  1.00 0.00 ? 30  PRO A HD2  7  
ATOM 9053  H HD3  . PRO A 1 30  ? -12.792 0.792   -0.895  1.00 0.00 ? 30  PRO A HD3  7  
ATOM 9054  N N    . LEU A 1 31  ? -7.663  1.284   0.620   1.00 0.00 ? 31  LEU A N    7  
ATOM 9055  C CA   . LEU A 1 31  ? -6.278  1.043   0.253   1.00 0.00 ? 31  LEU A CA   7  
ATOM 9056  C C    . LEU A 1 31  ? -5.936  -0.426  0.509   1.00 0.00 ? 31  LEU A C    7  
ATOM 9057  O O    . LEU A 1 31  ? -5.772  -0.838  1.657   1.00 0.00 ? 31  LEU A O    7  
ATOM 9058  C CB   . LEU A 1 31  ? -5.353  2.025   0.974   1.00 0.00 ? 31  LEU A CB   7  
ATOM 9059  C CG   . LEU A 1 31  ? -5.495  3.496   0.577   1.00 0.00 ? 31  LEU A CG   7  
ATOM 9060  C CD1  . LEU A 1 31  ? -5.544  4.396   1.813   1.00 0.00 ? 31  LEU A CD1  7  
ATOM 9061  C CD2  . LEU A 1 31  ? -4.386  3.911   -0.392  1.00 0.00 ? 31  LEU A CD2  7  
ATOM 9062  H H    . LEU A 1 31  ? -7.872  1.157   1.590   1.00 0.00 ? 31  LEU A H    7  
ATOM 9063  H HA   . LEU A 1 31  ? -6.185  1.238   -0.816  1.00 0.00 ? 31  LEU A HA   7  
ATOM 9064  H HB2  . LEU A 1 31  ? -5.531  1.940   2.046   1.00 0.00 ? 31  LEU A HB2  7  
ATOM 9065  H HB3  . LEU A 1 31  ? -4.322  1.719   0.797   1.00 0.00 ? 31  LEU A HB3  7  
ATOM 9066  H HG   . LEU A 1 31  ? -6.443  3.618   0.052   1.00 0.00 ? 31  LEU A HG   7  
ATOM 9067  H HD11 . LEU A 1 31  ? -4.802  4.059   2.537   1.00 0.00 ? 31  LEU A HD11 7  
ATOM 9068  H HD12 . LEU A 1 31  ? -5.328  5.424   1.523   1.00 0.00 ? 31  LEU A HD12 7  
ATOM 9069  H HD13 . LEU A 1 31  ? -6.537  4.345   2.260   1.00 0.00 ? 31  LEU A HD13 7  
ATOM 9070  H HD21 . LEU A 1 31  ? -3.624  3.132   -0.428  1.00 0.00 ? 31  LEU A HD21 7  
ATOM 9071  H HD22 . LEU A 1 31  ? -4.807  4.055   -1.387  1.00 0.00 ? 31  LEU A HD22 7  
ATOM 9072  H HD23 . LEU A 1 31  ? -3.936  4.843   -0.050  1.00 0.00 ? 31  LEU A HD23 7  
ATOM 9073  N N    . THR A 1 32  ? -5.838  -1.177  -0.578  1.00 0.00 ? 32  THR A N    7  
ATOM 9074  C CA   . THR A 1 32  ? -5.518  -2.591  -0.485  1.00 0.00 ? 32  THR A CA   7  
ATOM 9075  C C    . THR A 1 32  ? -4.140  -2.867  -1.090  1.00 0.00 ? 32  THR A C    7  
ATOM 9076  O O    . THR A 1 32  ? -3.566  -2.006  -1.755  1.00 0.00 ? 32  THR A O    7  
ATOM 9077  C CB   . THR A 1 32  ? -6.645  -3.376  -1.158  1.00 0.00 ? 32  THR A CB   7  
ATOM 9078  O OG1  . THR A 1 32  ? -7.189  -2.460  -2.105  1.00 0.00 ? 32  THR A OG1  7  
ATOM 9079  C CG2  . THR A 1 32  ? -7.808  -3.663  -0.206  1.00 0.00 ? 32  THR A CG2  7  
ATOM 9080  H H    . THR A 1 32  ? -5.973  -0.834  -1.508  1.00 0.00 ? 32  THR A H    7  
ATOM 9081  H HA   . THR A 1 32  ? -5.464  -2.862  0.569   1.00 0.00 ? 32  THR A HA   7  
ATOM 9082  H HB   . THR A 1 32  ? -6.267  -4.298  -1.600  1.00 0.00 ? 32  THR A HB   7  
ATOM 9083  H HG1  . THR A 1 32  ? -7.739  -2.952  -2.780  1.00 0.00 ? 32  THR A HG1  7  
ATOM 9084  H HG21 . THR A 1 32  ? -7.513  -4.432  0.507   1.00 0.00 ? 32  THR A HG21 7  
ATOM 9085  H HG22 . THR A 1 32  ? -8.072  -2.752  0.331   1.00 0.00 ? 32  THR A HG22 7  
ATOM 9086  H HG23 . THR A 1 32  ? -8.669  -4.009  -0.779  1.00 0.00 ? 32  THR A HG23 7  
ATOM 9087  N N    . ILE A 1 33  ? -3.649  -4.071  -0.837  1.00 0.00 ? 33  ILE A N    7  
ATOM 9088  C CA   . ILE A 1 33  ? -2.349  -4.472  -1.349  1.00 0.00 ? 33  ILE A CA   7  
ATOM 9089  C C    . ILE A 1 33  ? -2.481  -4.850  -2.825  1.00 0.00 ? 33  ILE A C    7  
ATOM 9090  O O    . ILE A 1 33  ? -3.008  -5.912  -3.153  1.00 0.00 ? 33  ILE A O    7  
ATOM 9091  C CB   . ILE A 1 33  ? -1.750  -5.580  -0.481  1.00 0.00 ? 33  ILE A CB   7  
ATOM 9092  C CG1  . ILE A 1 33  ? -1.602  -5.121  0.971   1.00 0.00 ? 33  ILE A CG1  7  
ATOM 9093  C CG2  . ILE A 1 33  ? -0.425  -6.077  -1.063  1.00 0.00 ? 33  ILE A CG2  7  
ATOM 9094  C CD1  . ILE A 1 33  ? -0.467  -4.104  1.111   1.00 0.00 ? 33  ILE A CD1  7  
ATOM 9095  H H    . ILE A 1 33  ? -4.122  -4.766  -0.295  1.00 0.00 ? 33  ILE A H    7  
ATOM 9096  H HA   . ILE A 1 33  ? -1.687  -3.609  -1.271  1.00 0.00 ? 33  ILE A HA   7  
ATOM 9097  H HB   . ILE A 1 33  ? -2.439  -6.425  -0.483  1.00 0.00 ? 33  ILE A HB   7  
ATOM 9098  H HG12 . ILE A 1 33  ? -2.537  -4.677  1.313   1.00 0.00 ? 33  ILE A HG12 7  
ATOM 9099  H HG13 . ILE A 1 33  ? -1.405  -5.982  1.610   1.00 0.00 ? 33  ILE A HG13 7  
ATOM 9100  H HG21 . ILE A 1 33  ? -0.297  -5.676  -2.069  1.00 0.00 ? 33  ILE A HG21 7  
ATOM 9101  H HG22 . ILE A 1 33  ? 0.398   -5.743  -0.431  1.00 0.00 ? 33  ILE A HG22 7  
ATOM 9102  H HG23 . ILE A 1 33  ? -0.432  -7.166  -1.105  1.00 0.00 ? 33  ILE A HG23 7  
ATOM 9103  H HD11 . ILE A 1 33  ? 0.384   -4.575  1.602   1.00 0.00 ? 33  ILE A HD11 7  
ATOM 9104  H HD12 . ILE A 1 33  ? -0.169  -3.754  0.122   1.00 0.00 ? 33  ILE A HD12 7  
ATOM 9105  H HD13 . ILE A 1 33  ? -0.809  -3.258  1.708   1.00 0.00 ? 33  ILE A HD13 7  
ATOM 9106  N N    . SER A 1 34  ? -1.993  -3.960  -3.677  1.00 0.00 ? 34  SER A N    7  
ATOM 9107  C CA   . SER A 1 34  ? -2.050  -4.187  -5.111  1.00 0.00 ? 34  SER A CA   7  
ATOM 9108  C C    . SER A 1 34  ? -1.379  -5.518  -5.457  1.00 0.00 ? 34  SER A C    7  
ATOM 9109  O O    . SER A 1 34  ? -2.007  -6.400  -6.041  1.00 0.00 ? 34  SER A O    7  
ATOM 9110  C CB   . SER A 1 34  ? -1.384  -3.042  -5.877  1.00 0.00 ? 34  SER A CB   7  
ATOM 9111  O OG   . SER A 1 34  ? -0.563  -3.517  -6.940  1.00 0.00 ? 34  SER A OG   7  
ATOM 9112  H H    . SER A 1 34  ? -1.566  -3.099  -3.402  1.00 0.00 ? 34  SER A H    7  
ATOM 9113  H HA   . SER A 1 34  ? -3.111  -4.219  -5.356  1.00 0.00 ? 34  SER A HA   7  
ATOM 9114  H HB2  . SER A 1 34  ? -2.152  -2.381  -6.280  1.00 0.00 ? 34  SER A HB2  7  
ATOM 9115  H HB3  . SER A 1 34  ? -0.781  -2.449  -5.190  1.00 0.00 ? 34  SER A HB3  7  
ATOM 9116  H HG   . SER A 1 34  ? 0.400   -3.351  -6.730  1.00 0.00 ? 34  SER A HG   7  
ATOM 9117  N N    . SER A 1 35  ? -0.113  -5.621  -5.082  1.00 0.00 ? 35  SER A N    7  
ATOM 9118  C CA   . SER A 1 35  ? 0.650   -6.829  -5.346  1.00 0.00 ? 35  SER A CA   7  
ATOM 9119  C C    . SER A 1 35  ? 1.763   -6.982  -4.307  1.00 0.00 ? 35  SER A C    7  
ATOM 9120  O O    . SER A 1 35  ? 1.897   -6.153  -3.409  1.00 0.00 ? 35  SER A O    7  
ATOM 9121  C CB   . SER A 1 35  ? 1.240   -6.811  -6.757  1.00 0.00 ? 35  SER A CB   7  
ATOM 9122  O OG   . SER A 1 35  ? 0.614   -7.767  -7.609  1.00 0.00 ? 35  SER A OG   7  
ATOM 9123  H H    . SER A 1 35  ? 0.390   -4.899  -4.607  1.00 0.00 ? 35  SER A H    7  
ATOM 9124  H HA   . SER A 1 35  ? -0.066  -7.647  -5.262  1.00 0.00 ? 35  SER A HA   7  
ATOM 9125  H HB2  . SER A 1 35  ? 1.127   -5.815  -7.185  1.00 0.00 ? 35  SER A HB2  7  
ATOM 9126  H HB3  . SER A 1 35  ? 2.309   -7.016  -6.706  1.00 0.00 ? 35  SER A HB3  7  
ATOM 9127  H HG   . SER A 1 35  ? -0.359  -7.833  -7.392  1.00 0.00 ? 35  SER A HG   7  
ATOM 9128  N N    . LEU A 1 36  ? 2.534   -8.048  -4.465  1.00 0.00 ? 36  LEU A N    7  
ATOM 9129  C CA   . LEU A 1 36  ? 3.631   -8.321  -3.552  1.00 0.00 ? 36  LEU A CA   7  
ATOM 9130  C C    . LEU A 1 36  ? 4.747   -9.048  -4.305  1.00 0.00 ? 36  LEU A C    7  
ATOM 9131  O O    . LEU A 1 36  ? 4.525   -9.574  -5.395  1.00 0.00 ? 36  LEU A O    7  
ATOM 9132  C CB   . LEU A 1 36  ? 3.128   -9.075  -2.320  1.00 0.00 ? 36  LEU A CB   7  
ATOM 9133  C CG   . LEU A 1 36  ? 3.330   -8.373  -0.975  1.00 0.00 ? 36  LEU A CG   7  
ATOM 9134  C CD1  . LEU A 1 36  ? 2.292   -8.839  0.047   1.00 0.00 ? 36  LEU A CD1  7  
ATOM 9135  C CD2  . LEU A 1 36  ? 4.760   -8.562  -0.467  1.00 0.00 ? 36  LEU A CD2  7  
ATOM 9136  H H    . LEU A 1 36  ? 2.418   -8.718  -5.198  1.00 0.00 ? 36  LEU A H    7  
ATOM 9137  H HA   . LEU A 1 36  ? 4.015   -7.361  -3.208  1.00 0.00 ? 36  LEU A HA   7  
ATOM 9138  H HB2  . LEU A 1 36  ? 2.064   -9.272  -2.448  1.00 0.00 ? 36  LEU A HB2  7  
ATOM 9139  H HB3  . LEU A 1 36  ? 3.629   -10.042 -2.281  1.00 0.00 ? 36  LEU A HB3  7  
ATOM 9140  H HG   . LEU A 1 36  ? 3.179   -7.303  -1.122  1.00 0.00 ? 36  LEU A HG   7  
ATOM 9141  H HD11 . LEU A 1 36  ? 1.429   -9.254  -0.474  1.00 0.00 ? 36  LEU A HD11 7  
ATOM 9142  H HD12 . LEU A 1 36  ? 2.731   -9.603  0.689   1.00 0.00 ? 36  LEU A HD12 7  
ATOM 9143  H HD13 . LEU A 1 36  ? 1.975   -7.992  0.656   1.00 0.00 ? 36  LEU A HD13 7  
ATOM 9144  H HD21 . LEU A 1 36  ? 5.296   -9.238  -1.133  1.00 0.00 ? 36  LEU A HD21 7  
ATOM 9145  H HD22 . LEU A 1 36  ? 5.268   -7.598  -0.443  1.00 0.00 ? 36  LEU A HD22 7  
ATOM 9146  H HD23 . LEU A 1 36  ? 4.736   -8.985  0.537   1.00 0.00 ? 36  LEU A HD23 7  
ATOM 9147  N N    . LYS A 1 37  ? 5.923   -9.053  -3.695  1.00 0.00 ? 37  LYS A N    7  
ATOM 9148  C CA   . LYS A 1 37  ? 7.074   -9.707  -4.295  1.00 0.00 ? 37  LYS A CA   7  
ATOM 9149  C C    . LYS A 1 37  ? 7.213   -11.117 -3.716  1.00 0.00 ? 37  LYS A C    7  
ATOM 9150  O O    . LYS A 1 37  ? 6.882   -11.350 -2.554  1.00 0.00 ? 37  LYS A O    7  
ATOM 9151  C CB   . LYS A 1 37  ? 8.327   -8.846  -4.126  1.00 0.00 ? 37  LYS A CB   7  
ATOM 9152  C CG   . LYS A 1 37  ? 9.538   -9.503  -4.792  1.00 0.00 ? 37  LYS A CG   7  
ATOM 9153  C CD   . LYS A 1 37  ? 10.480  -8.449  -5.378  1.00 0.00 ? 37  LYS A CD   7  
ATOM 9154  C CE   . LYS A 1 37  ? 11.531  -9.096  -6.283  1.00 0.00 ? 37  LYS A CE   7  
ATOM 9155  N NZ   . LYS A 1 37  ? 11.296  -8.724  -7.696  1.00 0.00 ? 37  LYS A NZ   7  
ATOM 9156  H H    . LYS A 1 37  ? 6.095   -8.623  -2.809  1.00 0.00 ? 37  LYS A H    7  
ATOM 9157  H HA   . LYS A 1 37  ? 6.882   -9.790  -5.364  1.00 0.00 ? 37  LYS A HA   7  
ATOM 9158  H HB2  . LYS A 1 37  ? 8.158   -7.861  -4.560  1.00 0.00 ? 37  LYS A HB2  7  
ATOM 9159  H HB3  . LYS A 1 37  ? 8.529   -8.696  -3.065  1.00 0.00 ? 37  LYS A HB3  7  
ATOM 9160  H HG2  . LYS A 1 37  ? 10.074  -10.111 -4.063  1.00 0.00 ? 37  LYS A HG2  7  
ATOM 9161  H HG3  . LYS A 1 37  ? 9.202   -10.175 -5.582  1.00 0.00 ? 37  LYS A HG3  7  
ATOM 9162  H HD2  . LYS A 1 37  ? 9.906   -7.718  -5.946  1.00 0.00 ? 37  LYS A HD2  7  
ATOM 9163  H HD3  . LYS A 1 37  ? 10.974  -7.909  -4.570  1.00 0.00 ? 37  LYS A HD3  7  
ATOM 9164  H HE2  . LYS A 1 37  ? 12.528  -8.778  -5.977  1.00 0.00 ? 37  LYS A HE2  7  
ATOM 9165  H HE3  . LYS A 1 37  ? 11.495  -10.180 -6.175  1.00 0.00 ? 37  LYS A HE3  7  
ATOM 9166  H HZ1  . LYS A 1 37  ? 12.156  -8.420  -8.108  1.00 0.00 ? 37  LYS A HZ1  7  
ATOM 9167  H HZ2  . LYS A 1 37  ? 10.949  -9.517  -8.196  1.00 0.00 ? 37  LYS A HZ2  7  
ATOM 9168  H HZ3  . LYS A 1 37  ? 10.626  -7.983  -7.739  1.00 0.00 ? 37  LYS A HZ3  7  
ATOM 9169  N N    . ASP A 1 38  ? 7.704   -12.019 -4.552  1.00 0.00 ? 38  ASP A N    7  
ATOM 9170  C CA   . ASP A 1 38  ? 7.891   -13.399 -4.138  1.00 0.00 ? 38  ASP A CA   7  
ATOM 9171  C C    . ASP A 1 38  ? 8.738   -13.435 -2.864  1.00 0.00 ? 38  ASP A C    7  
ATOM 9172  O O    . ASP A 1 38  ? 9.917   -13.084 -2.888  1.00 0.00 ? 38  ASP A O    7  
ATOM 9173  C CB   . ASP A 1 38  ? 8.623   -14.203 -5.214  1.00 0.00 ? 38  ASP A CB   7  
ATOM 9174  C CG   . ASP A 1 38  ? 7.800   -14.503 -6.469  1.00 0.00 ? 38  ASP A CG   7  
ATOM 9175  O OD1  . ASP A 1 38  ? 7.851   -13.665 -7.395  1.00 0.00 ? 38  ASP A OD1  7  
ATOM 9176  O OD2  . ASP A 1 38  ? 7.139   -15.564 -6.473  1.00 0.00 ? 38  ASP A OD2  7  
ATOM 9177  H H    . ASP A 1 38  ? 7.971   -11.821 -5.495  1.00 0.00 ? 38  ASP A H    7  
ATOM 9178  H HA   . ASP A 1 38  ? 6.886   -13.790 -3.981  1.00 0.00 ? 38  ASP A HA   7  
ATOM 9179  H HB2  . ASP A 1 38  ? 9.519   -13.657 -5.508  1.00 0.00 ? 38  ASP A HB2  7  
ATOM 9180  H HB3  . ASP A 1 38  ? 8.953   -15.147 -4.781  1.00 0.00 ? 38  ASP A HB3  7  
ATOM 9181  N N    . GLY A 1 39  ? 8.104   -13.861 -1.782  1.00 0.00 ? 39  GLY A N    7  
ATOM 9182  C CA   . GLY A 1 39  ? 8.784   -13.947 -0.501  1.00 0.00 ? 39  GLY A CA   7  
ATOM 9183  C C    . GLY A 1 39  ? 9.244   -12.565 -0.031  1.00 0.00 ? 39  GLY A C    7  
ATOM 9184  O O    . GLY A 1 39  ? 10.285  -12.439 0.612   1.00 0.00 ? 39  GLY A O    7  
ATOM 9185  H H    . GLY A 1 39  ? 7.145   -14.144 -1.771  1.00 0.00 ? 39  GLY A H    7  
ATOM 9186  H HA2  . GLY A 1 39  ? 8.116   -14.383 0.242   1.00 0.00 ? 39  GLY A HA2  7  
ATOM 9187  H HA3  . GLY A 1 39  ? 9.644   -14.611 -0.585  1.00 0.00 ? 39  GLY A HA3  7  
ATOM 9188  N N    . GLY A 1 40  ? 8.446   -11.564 -0.370  1.00 0.00 ? 40  GLY A N    7  
ATOM 9189  C CA   . GLY A 1 40  ? 8.758   -10.196 0.009   1.00 0.00 ? 40  GLY A CA   7  
ATOM 9190  C C    . GLY A 1 40  ? 8.625   -10.002 1.520   1.00 0.00 ? 40  GLY A C    7  
ATOM 9191  O O    . GLY A 1 40  ? 8.270   -10.934 2.241   1.00 0.00 ? 40  GLY A O    7  
ATOM 9192  H H    . GLY A 1 40  ? 7.601   -11.675 -0.894  1.00 0.00 ? 40  GLY A H    7  
ATOM 9193  H HA2  . GLY A 1 40  ? 9.773   -9.951  -0.305  1.00 0.00 ? 40  GLY A HA2  7  
ATOM 9194  H HA3  . GLY A 1 40  ? 8.090   -9.509  -0.511  1.00 0.00 ? 40  GLY A HA3  7  
ATOM 9195  N N    . LYS A 1 41  ? 8.915   -8.785  1.956   1.00 0.00 ? 41  LYS A N    7  
ATOM 9196  C CA   . LYS A 1 41  ? 8.831   -8.457  3.369   1.00 0.00 ? 41  LYS A CA   7  
ATOM 9197  C C    . LYS A 1 41  ? 7.385   -8.618  3.841   1.00 0.00 ? 41  LYS A C    7  
ATOM 9198  O O    . LYS A 1 41  ? 7.116   -9.358  4.786   1.00 0.00 ? 41  LYS A O    7  
ATOM 9199  C CB   . LYS A 1 41  ? 9.412   -7.065  3.631   1.00 0.00 ? 41  LYS A CB   7  
ATOM 9200  C CG   . LYS A 1 41  ? 10.940  -7.089  3.569   1.00 0.00 ? 41  LYS A CG   7  
ATOM 9201  C CD   . LYS A 1 41  ? 11.551  -6.689  4.914   1.00 0.00 ? 41  LYS A CD   7  
ATOM 9202  C CE   . LYS A 1 41  ? 12.211  -7.889  5.595   1.00 0.00 ? 41  LYS A CE   7  
ATOM 9203  N NZ   . LYS A 1 41  ? 11.318  -8.453  6.631   1.00 0.00 ? 41  LYS A NZ   7  
ATOM 9204  H H    . LYS A 1 41  ? 9.202   -8.032  1.364   1.00 0.00 ? 41  LYS A H    7  
ATOM 9205  H HA   . LYS A 1 41  ? 9.453   -9.172  3.908   1.00 0.00 ? 41  LYS A HA   7  
ATOM 9206  H HB2  . LYS A 1 41  ? 9.025   -6.361  2.895   1.00 0.00 ? 41  LYS A HB2  7  
ATOM 9207  H HB3  . LYS A 1 41  ? 9.090   -6.712  4.611   1.00 0.00 ? 41  LYS A HB3  7  
ATOM 9208  H HG2  . LYS A 1 41  ? 11.282  -8.086  3.293   1.00 0.00 ? 41  LYS A HG2  7  
ATOM 9209  H HG3  . LYS A 1 41  ? 11.286  -6.407  2.791   1.00 0.00 ? 41  LYS A HG3  7  
ATOM 9210  H HD2  . LYS A 1 41  ? 12.288  -5.900  4.762   1.00 0.00 ? 41  LYS A HD2  7  
ATOM 9211  H HD3  . LYS A 1 41  ? 10.775  -6.280  5.562   1.00 0.00 ? 41  LYS A HD3  7  
ATOM 9212  H HE2  . LYS A 1 41  ? 12.445  -8.652  4.852   1.00 0.00 ? 41  LYS A HE2  7  
ATOM 9213  H HE3  . LYS A 1 41  ? 13.155  -7.584  6.046   1.00 0.00 ? 41  LYS A HE3  7  
ATOM 9214  H HZ1  . LYS A 1 41  ? 11.557  -8.069  7.522   1.00 0.00 ? 41  LYS A HZ1  7  
ATOM 9215  H HZ2  . LYS A 1 41  ? 10.369  -8.226  6.413   1.00 0.00 ? 41  LYS A HZ2  7  
ATOM 9216  H HZ3  . LYS A 1 41  ? 11.425  -9.447  6.657   1.00 0.00 ? 41  LYS A HZ3  7  
ATOM 9217  N N    . ALA A 1 42  ? 6.492   -7.913  3.162   1.00 0.00 ? 42  ALA A N    7  
ATOM 9218  C CA   . ALA A 1 42  ? 5.080   -7.969  3.500   1.00 0.00 ? 42  ALA A CA   7  
ATOM 9219  C C    . ALA A 1 42  ? 4.666   -9.428  3.701   1.00 0.00 ? 42  ALA A C    7  
ATOM 9220  O O    . ALA A 1 42  ? 3.985   -9.756  4.671   1.00 0.00 ? 42  ALA A O    7  
ATOM 9221  C CB   . ALA A 1 42  ? 4.265   -7.277  2.406   1.00 0.00 ? 42  ALA A CB   7  
ATOM 9222  H H    . ALA A 1 42  ? 6.720   -7.314  2.395   1.00 0.00 ? 42  ALA A H    7  
ATOM 9223  H HA   . ALA A 1 42  ? 4.941   -7.429  4.436   1.00 0.00 ? 42  ALA A HA   7  
ATOM 9224  H HB1  . ALA A 1 42  ? 4.938   -6.893  1.639   1.00 0.00 ? 42  ALA A HB1  7  
ATOM 9225  H HB2  . ALA A 1 42  ? 3.576   -7.993  1.959   1.00 0.00 ? 42  ALA A HB2  7  
ATOM 9226  H HB3  . ALA A 1 42  ? 3.701   -6.452  2.840   1.00 0.00 ? 42  ALA A HB3  7  
ATOM 9227  N N    . SER A 1 43  ? 5.094   -10.266 2.767   1.00 0.00 ? 43  SER A N    7  
ATOM 9228  C CA   . SER A 1 43  ? 4.776   -11.682 2.829   1.00 0.00 ? 43  SER A CA   7  
ATOM 9229  C C    . SER A 1 43  ? 5.281   -12.275 4.146   1.00 0.00 ? 43  SER A C    7  
ATOM 9230  O O    . SER A 1 43  ? 4.580   -13.055 4.789   1.00 0.00 ? 43  SER A O    7  
ATOM 9231  C CB   . SER A 1 43  ? 5.380   -12.435 1.642   1.00 0.00 ? 43  SER A CB   7  
ATOM 9232  O OG   . SER A 1 43  ? 5.095   -13.830 1.693   1.00 0.00 ? 43  SER A OG   7  
ATOM 9233  H H    . SER A 1 43  ? 5.647   -9.991  1.981   1.00 0.00 ? 43  SER A H    7  
ATOM 9234  H HA   . SER A 1 43  ? 3.688   -11.736 2.778   1.00 0.00 ? 43  SER A HA   7  
ATOM 9235  H HB2  . SER A 1 43  ? 4.989   -12.019 0.713   1.00 0.00 ? 43  SER A HB2  7  
ATOM 9236  H HB3  . SER A 1 43  ? 6.459   -12.285 1.629   1.00 0.00 ? 43  SER A HB3  7  
ATOM 9237  H HG   . SER A 1 43  ? 4.341   -14.002 2.327   1.00 0.00 ? 43  SER A HG   7  
ATOM 9238  N N    . GLN A 1 44  ? 6.493   -11.882 4.508   1.00 0.00 ? 44  GLN A N    7  
ATOM 9239  C CA   . GLN A 1 44  ? 7.101   -12.364 5.737   1.00 0.00 ? 44  GLN A CA   7  
ATOM 9240  C C    . GLN A 1 44  ? 6.316   -11.861 6.950   1.00 0.00 ? 44  GLN A C    7  
ATOM 9241  O O    . GLN A 1 44  ? 6.358   -12.470 8.017   1.00 0.00 ? 44  GLN A O    7  
ATOM 9242  C CB   . GLN A 1 44  ? 8.570   -11.948 5.822   1.00 0.00 ? 44  GLN A CB   7  
ATOM 9243  C CG   . GLN A 1 44  ? 9.479   -13.013 5.206   1.00 0.00 ? 44  GLN A CG   7  
ATOM 9244  C CD   . GLN A 1 44  ? 10.910  -12.886 5.734   1.00 0.00 ? 44  GLN A CD   7  
ATOM 9245  O OE1  . GLN A 1 44  ? 11.318  -13.561 6.665   1.00 0.00 ? 44  GLN A OE1  7  
ATOM 9246  N NE2  . GLN A 1 44  ? 11.646  -11.985 5.090   1.00 0.00 ? 44  GLN A NE2  7  
ATOM 9247  H H    . GLN A 1 44  ? 7.057   -11.247 3.979   1.00 0.00 ? 44  GLN A H    7  
ATOM 9248  H HA   . GLN A 1 44  ? 7.040   -13.451 5.682   1.00 0.00 ? 44  GLN A HA   7  
ATOM 9249  H HB2  . GLN A 1 44  ? 8.714   -10.999 5.305   1.00 0.00 ? 44  GLN A HB2  7  
ATOM 9250  H HB3  . GLN A 1 44  ? 8.847   -11.787 6.865   1.00 0.00 ? 44  GLN A HB3  7  
ATOM 9251  H HG2  . GLN A 1 44  ? 9.090   -14.005 5.436   1.00 0.00 ? 44  GLN A HG2  7  
ATOM 9252  H HG3  . GLN A 1 44  ? 9.478   -12.914 4.121   1.00 0.00 ? 44  GLN A HG3  7  
ATOM 9253  H HE21 . GLN A 1 44  ? 11.250  -11.464 4.335   1.00 0.00 ? 44  GLN A HE21 7  
ATOM 9254  H HE22 . GLN A 1 44  ? 12.595  -11.828 5.362   1.00 0.00 ? 44  GLN A HE22 7  
ATOM 9255  N N    . ALA A 1 45  ? 5.619   -10.753 6.746   1.00 0.00 ? 45  ALA A N    7  
ATOM 9256  C CA   . ALA A 1 45  ? 4.827   -10.160 7.809   1.00 0.00 ? 45  ALA A CA   7  
ATOM 9257  C C    . ALA A 1 45  ? 3.418   -10.755 7.782   1.00 0.00 ? 45  ALA A C    7  
ATOM 9258  O O    . ALA A 1 45  ? 2.517   -10.259 8.457   1.00 0.00 ? 45  ALA A O    7  
ATOM 9259  C CB   . ALA A 1 45  ? 4.820   -8.638  7.654   1.00 0.00 ? 45  ALA A CB   7  
ATOM 9260  H H    . ALA A 1 45  ? 5.591   -10.263 5.874   1.00 0.00 ? 45  ALA A H    7  
ATOM 9261  H HA   . ALA A 1 45  ? 5.301   -10.414 8.757   1.00 0.00 ? 45  ALA A HA   7  
ATOM 9262  H HB1  . ALA A 1 45  ? 4.630   -8.380  6.612   1.00 0.00 ? 45  ALA A HB1  7  
ATOM 9263  H HB2  . ALA A 1 45  ? 4.038   -8.212  8.283   1.00 0.00 ? 45  ALA A HB2  7  
ATOM 9264  H HB3  . ALA A 1 45  ? 5.788   -8.238  7.957   1.00 0.00 ? 45  ALA A HB3  7  
ATOM 9265  N N    . HIS A 1 46  ? 3.271   -11.810 6.994   1.00 0.00 ? 46  HIS A N    7  
ATOM 9266  C CA   . HIS A 1 46  ? 1.986   -12.478 6.870   1.00 0.00 ? 46  HIS A CA   7  
ATOM 9267  C C    . HIS A 1 46  ? 0.973   -11.526 6.232   1.00 0.00 ? 46  HIS A C    7  
ATOM 9268  O O    . HIS A 1 46  ? -0.199  -11.518 6.608   1.00 0.00 ? 46  HIS A O    7  
ATOM 9269  C CB   . HIS A 1 46  ? 1.522   -13.019 8.223   1.00 0.00 ? 46  HIS A CB   7  
ATOM 9270  C CG   . HIS A 1 46  ? 2.302   -14.218 8.706   1.00 0.00 ? 46  HIS A CG   7  
ATOM 9271  N ND1  . HIS A 1 46  ? 1.746   -15.482 8.811   1.00 0.00 ? 46  HIS A ND1  7  
ATOM 9272  C CD2  . HIS A 1 46  ? 3.599   -14.334 9.110   1.00 0.00 ? 46  HIS A CD2  7  
ATOM 9273  C CE1  . HIS A 1 46  ? 2.676   -16.312 9.259   1.00 0.00 ? 46  HIS A CE1  7  
ATOM 9274  N NE2  . HIS A 1 46  ? 3.824   -15.599 9.445   1.00 0.00 ? 46  HIS A NE2  7  
ATOM 9275  H H    . HIS A 1 46  ? 4.009   -12.208 6.449   1.00 0.00 ? 46  HIS A H    7  
ATOM 9276  H HA   . HIS A 1 46  ? 2.140   -13.330 6.207   1.00 0.00 ? 46  HIS A HA   7  
ATOM 9277  H HB2  . HIS A 1 46  ? 1.599   -12.225 8.966   1.00 0.00 ? 46  HIS A HB2  7  
ATOM 9278  H HB3  . HIS A 1 46  ? 0.468   -13.288 8.153   1.00 0.00 ? 46  HIS A HB3  7  
ATOM 9279  H HD1  . HIS A 1 46  ? 0.803   -15.726 8.586   1.00 0.00 ? 46  HIS A HD1  7  
ATOM 9280  H HD2  . HIS A 1 46  ? 4.328   -13.525 9.152   1.00 0.00 ? 46  HIS A HD2  7  
ATOM 9281  H HE1  . HIS A 1 46  ? 2.546   -17.378 9.447   1.00 0.00 ? 46  HIS A HE1  7  
ATOM 9282  N N    . VAL A 1 47  ? 1.460   -10.747 5.277   1.00 0.00 ? 47  VAL A N    7  
ATOM 9283  C CA   . VAL A 1 47  ? 0.611   -9.793  4.584   1.00 0.00 ? 47  VAL A CA   7  
ATOM 9284  C C    . VAL A 1 47  ? 0.123   -10.412 3.272   1.00 0.00 ? 47  VAL A C    7  
ATOM 9285  O O    . VAL A 1 47  ? 0.924   -10.712 2.388   1.00 0.00 ? 47  VAL A O    7  
ATOM 9286  C CB   . VAL A 1 47  ? 1.362   -8.476  4.381   1.00 0.00 ? 47  VAL A CB   7  
ATOM 9287  C CG1  . VAL A 1 47  ? 0.513   -7.477  3.591   1.00 0.00 ? 47  VAL A CG1  7  
ATOM 9288  C CG2  . VAL A 1 47  ? 1.800   -7.883  5.722   1.00 0.00 ? 47  VAL A CG2  7  
ATOM 9289  H H    . VAL A 1 47  ? 2.414   -10.760 4.978   1.00 0.00 ? 47  VAL A H    7  
ATOM 9290  H HA   . VAL A 1 47  ? -0.251  -9.596  5.221   1.00 0.00 ? 47  VAL A HA   7  
ATOM 9291  H HB   . VAL A 1 47  ? 2.259   -8.687  3.799   1.00 0.00 ? 47  VAL A HB   7  
ATOM 9292  H HG11 . VAL A 1 47  ? -0.533  -7.784  3.623   1.00 0.00 ? 47  VAL A HG11 7  
ATOM 9293  H HG12 . VAL A 1 47  ? 0.614   -6.486  4.032   1.00 0.00 ? 47  VAL A HG12 7  
ATOM 9294  H HG13 . VAL A 1 47  ? 0.852   -7.451  2.556   1.00 0.00 ? 47  VAL A HG13 7  
ATOM 9295  H HG21 . VAL A 1 47  ? 2.010   -6.820  5.598   1.00 0.00 ? 47  VAL A HG21 7  
ATOM 9296  H HG22 . VAL A 1 47  ? 1.004   -8.013  6.454   1.00 0.00 ? 47  VAL A HG22 7  
ATOM 9297  H HG23 . VAL A 1 47  ? 2.699   -8.393  6.068   1.00 0.00 ? 47  VAL A HG23 7  
ATOM 9298  N N    . ARG A 1 48  ? -1.188  -10.583 3.187   1.00 0.00 ? 48  ARG A N    7  
ATOM 9299  C CA   . ARG A 1 48  ? -1.791  -11.160 1.998   1.00 0.00 ? 48  ARG A CA   7  
ATOM 9300  C C    . ARG A 1 48  ? -2.451  -10.067 1.154   1.00 0.00 ? 48  ARG A C    7  
ATOM 9301  O O    . ARG A 1 48  ? -2.783  -8.999  1.665   1.00 0.00 ? 48  ARG A O    7  
ATOM 9302  C CB   . ARG A 1 48  ? -2.840  -12.211 2.367   1.00 0.00 ? 48  ARG A CB   7  
ATOM 9303  C CG   . ARG A 1 48  ? -2.214  -13.606 2.446   1.00 0.00 ? 48  ARG A CG   7  
ATOM 9304  C CD   . ARG A 1 48  ? -2.646  -14.329 3.723   1.00 0.00 ? 48  ARG A CD   7  
ATOM 9305  N NE   . ARG A 1 48  ? -2.122  -13.618 4.910   1.00 0.00 ? 48  ARG A NE   7  
ATOM 9306  C CZ   . ARG A 1 48  ? -2.505  -13.873 6.168   1.00 0.00 ? 48  ARG A CZ   7  
ATOM 9307  N NH1  . ARG A 1 48  ? -3.417  -14.824 6.411   1.00 0.00 ? 48  ARG A NH1  7  
ATOM 9308  N NH2  . ARG A 1 48  ? -1.975  -13.177 7.184   1.00 0.00 ? 48  ARG A NH2  7  
ATOM 9309  H H    . ARG A 1 48  ? -1.832  -10.336 3.911   1.00 0.00 ? 48  ARG A H    7  
ATOM 9310  H HA   . ARG A 1 48  ? -0.964  -11.624 1.462   1.00 0.00 ? 48  ARG A HA   7  
ATOM 9311  H HB2  . ARG A 1 48  ? -3.292  -11.958 3.326   1.00 0.00 ? 48  ARG A HB2  7  
ATOM 9312  H HB3  . ARG A 1 48  ? -3.639  -12.209 1.627   1.00 0.00 ? 48  ARG A HB3  7  
ATOM 9313  H HG2  . ARG A 1 48  ? -2.510  -14.190 1.574   1.00 0.00 ? 48  ARG A HG2  7  
ATOM 9314  H HG3  . ARG A 1 48  ? -1.128  -13.522 2.420   1.00 0.00 ? 48  ARG A HG3  7  
ATOM 9315  H HD2  . ARG A 1 48  ? -3.734  -14.382 3.771   1.00 0.00 ? 48  ARG A HD2  7  
ATOM 9316  H HD3  . ARG A 1 48  ? -2.278  -15.355 3.711   1.00 0.00 ? 48  ARG A HD3  7  
ATOM 9317  H HE   . ARG A 1 48  ? -1.440  -12.901 4.763   1.00 0.00 ? 48  ARG A HE   7  
ATOM 9318  H HH11 . ARG A 1 48  ? -3.812  -15.343 5.654   1.00 0.00 ? 48  ARG A HH11 7  
ATOM 9319  H HH12 . ARG A 1 48  ? -3.702  -15.014 7.351   1.00 0.00 ? 48  ARG A HH12 7  
ATOM 9320  H HH21 . ARG A 1 48  ? -1.294  -12.467 7.002   1.00 0.00 ? 48  ARG A HH21 7  
ATOM 9321  H HH22 . ARG A 1 48  ? -2.261  -13.367 8.123   1.00 0.00 ? 48  ARG A HH22 7  
ATOM 9322  N N    . ILE A 1 49  ? -2.620  -10.373 -0.124  1.00 0.00 ? 49  ILE A N    7  
ATOM 9323  C CA   . ILE A 1 49  ? -3.233  -9.430  -1.044  1.00 0.00 ? 49  ILE A CA   7  
ATOM 9324  C C    . ILE A 1 49  ? -4.703  -9.237  -0.665  1.00 0.00 ? 49  ILE A C    7  
ATOM 9325  O O    . ILE A 1 49  ? -5.412  -10.206 -0.399  1.00 0.00 ? 49  ILE A O    7  
ATOM 9326  C CB   . ILE A 1 49  ? -3.026  -9.881  -2.491  1.00 0.00 ? 49  ILE A CB   7  
ATOM 9327  C CG1  . ILE A 1 49  ? -1.554  -9.770  -2.894  1.00 0.00 ? 49  ILE A CG1  7  
ATOM 9328  C CG2  . ILE A 1 49  ? -3.940  -9.107  -3.443  1.00 0.00 ? 49  ILE A CG2  7  
ATOM 9329  C CD1  . ILE A 1 49  ? -1.409  -9.645  -4.412  1.00 0.00 ? 49  ILE A CD1  7  
ATOM 9330  H H    . ILE A 1 49  ? -2.347  -11.244 -0.532  1.00 0.00 ? 49  ILE A H    7  
ATOM 9331  H HA   . ILE A 1 49  ? -2.718  -8.476  -0.926  1.00 0.00 ? 49  ILE A HA   7  
ATOM 9332  H HB   . ILE A 1 49  ? -3.301  -10.933 -2.564  1.00 0.00 ? 49  ILE A HB   7  
ATOM 9333  H HG12 . ILE A 1 49  ? -1.104  -8.903  -2.409  1.00 0.00 ? 49  ILE A HG12 7  
ATOM 9334  H HG13 . ILE A 1 49  ? -1.010  -10.648 -2.544  1.00 0.00 ? 49  ILE A HG13 7  
ATOM 9335  H HG21 . ILE A 1 49  ? -3.941  -9.592  -4.419  1.00 0.00 ? 49  ILE A HG21 7  
ATOM 9336  H HG22 . ILE A 1 49  ? -4.954  -9.094  -3.043  1.00 0.00 ? 49  ILE A HG22 7  
ATOM 9337  H HG23 . ILE A 1 49  ? -3.576  -8.085  -3.546  1.00 0.00 ? 49  ILE A HG23 7  
ATOM 9338  H HD11 . ILE A 1 49  ? -1.729  -8.652  -4.727  1.00 0.00 ? 49  ILE A HD11 7  
ATOM 9339  H HD12 . ILE A 1 49  ? -0.366  -9.796  -4.691  1.00 0.00 ? 49  ILE A HD12 7  
ATOM 9340  H HD13 . ILE A 1 49  ? -2.028  -10.398 -4.899  1.00 0.00 ? 49  ILE A HD13 7  
ATOM 9341  N N    . GLY A 1 50  ? -5.117  -7.978  -0.652  1.00 0.00 ? 50  GLY A N    7  
ATOM 9342  C CA   . GLY A 1 50  ? -6.490  -7.646  -0.310  1.00 0.00 ? 50  GLY A CA   7  
ATOM 9343  C C    . GLY A 1 50  ? -6.569  -7.002  1.076   1.00 0.00 ? 50  GLY A C    7  
ATOM 9344  O O    . GLY A 1 50  ? -7.638  -6.569  1.503   1.00 0.00 ? 50  GLY A O    7  
ATOM 9345  H H    . GLY A 1 50  ? -4.534  -7.195  -0.869  1.00 0.00 ? 50  GLY A H    7  
ATOM 9346  H HA2  . GLY A 1 50  ? -6.899  -6.964  -1.055  1.00 0.00 ? 50  GLY A HA2  7  
ATOM 9347  H HA3  . GLY A 1 50  ? -7.102  -8.547  -0.331  1.00 0.00 ? 50  GLY A HA3  7  
ATOM 9348  N N    . ASP A 1 51  ? -5.423  -6.958  1.739   1.00 0.00 ? 51  ASP A N    7  
ATOM 9349  C CA   . ASP A 1 51  ? -5.349  -6.374  3.068   1.00 0.00 ? 51  ASP A CA   7  
ATOM 9350  C C    . ASP A 1 51  ? -5.557  -4.862  2.968   1.00 0.00 ? 51  ASP A C    7  
ATOM 9351  O O    . ASP A 1 51  ? -4.858  -4.183  2.217   1.00 0.00 ? 51  ASP A O    7  
ATOM 9352  C CB   . ASP A 1 51  ? -3.979  -6.621  3.702   1.00 0.00 ? 51  ASP A CB   7  
ATOM 9353  C CG   . ASP A 1 51  ? -3.684  -8.080  4.058   1.00 0.00 ? 51  ASP A CG   7  
ATOM 9354  O OD1  . ASP A 1 51  ? -4.643  -8.881  4.009   1.00 0.00 ? 51  ASP A OD1  7  
ATOM 9355  O OD2  . ASP A 1 51  ? -2.507  -8.362  4.370   1.00 0.00 ? 51  ASP A OD2  7  
ATOM 9356  H H    . ASP A 1 51  ? -4.557  -7.312  1.384   1.00 0.00 ? 51  ASP A H    7  
ATOM 9357  H HA   . ASP A 1 51  ? -6.134  -6.867  3.641   1.00 0.00 ? 51  ASP A HA   7  
ATOM 9358  H HB2  . ASP A 1 51  ? -3.208  -6.267  3.017   1.00 0.00 ? 51  ASP A HB2  7  
ATOM 9359  H HB3  . ASP A 1 51  ? -3.901  -6.020  4.608   1.00 0.00 ? 51  ASP A HB3  7  
ATOM 9360  N N    . VAL A 1 52  ? -6.523  -4.378  3.735   1.00 0.00 ? 52  VAL A N    7  
ATOM 9361  C CA   . VAL A 1 52  ? -6.832  -2.958  3.743   1.00 0.00 ? 52  VAL A CA   7  
ATOM 9362  C C    . VAL A 1 52  ? -5.988  -2.262  4.812   1.00 0.00 ? 52  VAL A C    7  
ATOM 9363  O O    . VAL A 1 52  ? -5.908  -2.729  5.947   1.00 0.00 ? 52  VAL A O    7  
ATOM 9364  C CB   . VAL A 1 52  ? -8.335  -2.752  3.940   1.00 0.00 ? 52  VAL A CB   7  
ATOM 9365  C CG1  . VAL A 1 52  ? -8.670  -1.265  4.083   1.00 0.00 ? 52  VAL A CG1  7  
ATOM 9366  C CG2  . VAL A 1 52  ? -9.131  -3.385  2.796   1.00 0.00 ? 52  VAL A CG2  7  
ATOM 9367  H H    . VAL A 1 52  ? -7.087  -4.937  4.343   1.00 0.00 ? 52  VAL A H    7  
ATOM 9368  H HA   . VAL A 1 52  ? -6.562  -2.558  2.766   1.00 0.00 ? 52  VAL A HA   7  
ATOM 9369  H HB   . VAL A 1 52  ? -8.624  -3.251  4.865   1.00 0.00 ? 52  VAL A HB   7  
ATOM 9370  H HG11 . VAL A 1 52  ? -8.245  -0.715  3.244   1.00 0.00 ? 52  VAL A HG11 7  
ATOM 9371  H HG12 . VAL A 1 52  ? -9.753  -1.136  4.091   1.00 0.00 ? 52  VAL A HG12 7  
ATOM 9372  H HG13 . VAL A 1 52  ? -8.252  -0.887  5.016   1.00 0.00 ? 52  VAL A HG13 7  
ATOM 9373  H HG21 . VAL A 1 52  ? -9.518  -2.601  2.145   1.00 0.00 ? 52  VAL A HG21 7  
ATOM 9374  H HG22 . VAL A 1 52  ? -8.479  -4.045  2.223   1.00 0.00 ? 52  VAL A HG22 7  
ATOM 9375  H HG23 . VAL A 1 52  ? -9.961  -3.960  3.206   1.00 0.00 ? 52  VAL A HG23 7  
ATOM 9376  N N    . VAL A 1 53  ? -5.378  -1.156  4.411   1.00 0.00 ? 53  VAL A N    7  
ATOM 9377  C CA   . VAL A 1 53  ? -4.543  -0.391  5.320   1.00 0.00 ? 53  VAL A CA   7  
ATOM 9378  C C    . VAL A 1 53  ? -5.423  0.548   6.148   1.00 0.00 ? 53  VAL A C    7  
ATOM 9379  O O    . VAL A 1 53  ? -5.865  1.586   5.656   1.00 0.00 ? 53  VAL A O    7  
ATOM 9380  C CB   . VAL A 1 53  ? -3.455  0.346   4.537   1.00 0.00 ? 53  VAL A CB   7  
ATOM 9381  C CG1  . VAL A 1 53  ? -2.473  1.042   5.483   1.00 0.00 ? 53  VAL A CG1  7  
ATOM 9382  C CG2  . VAL A 1 53  ? -2.722  -0.605  3.588   1.00 0.00 ? 53  VAL A CG2  7  
ATOM 9383  H H    . VAL A 1 53  ? -5.448  -0.783  3.486   1.00 0.00 ? 53  VAL A H    7  
ATOM 9384  H HA   . VAL A 1 53  ? -4.055  -1.097  5.992   1.00 0.00 ? 53  VAL A HA   7  
ATOM 9385  H HB   . VAL A 1 53  ? -3.939  1.114   3.933   1.00 0.00 ? 53  VAL A HB   7  
ATOM 9386  H HG11 . VAL A 1 53  ? -2.986  1.844   6.013   1.00 0.00 ? 53  VAL A HG11 7  
ATOM 9387  H HG12 . VAL A 1 53  ? -2.088  0.319   6.201   1.00 0.00 ? 53  VAL A HG12 7  
ATOM 9388  H HG13 . VAL A 1 53  ? -1.647  1.458   4.907   1.00 0.00 ? 53  VAL A HG13 7  
ATOM 9389  H HG21 . VAL A 1 53  ? -3.450  -1.154  2.991   1.00 0.00 ? 53  VAL A HG21 7  
ATOM 9390  H HG22 . VAL A 1 53  ? -2.070  -0.031  2.930   1.00 0.00 ? 53  VAL A HG22 7  
ATOM 9391  H HG23 . VAL A 1 53  ? -2.125  -1.308  4.169   1.00 0.00 ? 53  VAL A HG23 7  
ATOM 9392  N N    . LEU A 1 54  ? -5.653  0.150   7.390   1.00 0.00 ? 54  LEU A N    7  
ATOM 9393  C CA   . LEU A 1 54  ? -6.473  0.943   8.291   1.00 0.00 ? 54  LEU A CA   7  
ATOM 9394  C C    . LEU A 1 54  ? -5.748  2.250   8.616   1.00 0.00 ? 54  LEU A C    7  
ATOM 9395  O O    . LEU A 1 54  ? -6.357  3.319   8.613   1.00 0.00 ? 54  LEU A O    7  
ATOM 9396  C CB   . LEU A 1 54  ? -6.854  0.127   9.527   1.00 0.00 ? 54  LEU A CB   7  
ATOM 9397  C CG   . LEU A 1 54  ? -7.806  -1.047  9.290   1.00 0.00 ? 54  LEU A CG   7  
ATOM 9398  C CD1  . LEU A 1 54  ? -7.779  -2.022  10.468  1.00 0.00 ? 54  LEU A CD1  7  
ATOM 9399  C CD2  . LEU A 1 54  ? -9.222  -0.551  8.988   1.00 0.00 ? 54  LEU A CD2  7  
ATOM 9400  H H    . LEU A 1 54  ? -5.290  -0.695  7.783   1.00 0.00 ? 54  LEU A H    7  
ATOM 9401  H HA   . LEU A 1 54  ? -7.398  1.182   7.765   1.00 0.00 ? 54  LEU A HA   7  
ATOM 9402  H HB2  . LEU A 1 54  ? -5.940  -0.259  9.979   1.00 0.00 ? 54  LEU A HB2  7  
ATOM 9403  H HB3  . LEU A 1 54  ? -7.310  0.798   10.255  1.00 0.00 ? 54  LEU A HB3  7  
ATOM 9404  H HG   . LEU A 1 54  ? -7.462  -1.593  8.411   1.00 0.00 ? 54  LEU A HG   7  
ATOM 9405  H HD11 . LEU A 1 54  ? -8.233  -2.967  10.168  1.00 0.00 ? 54  LEU A HD11 7  
ATOM 9406  H HD12 . LEU A 1 54  ? -6.747  -2.196  10.773  1.00 0.00 ? 54  LEU A HD12 7  
ATOM 9407  H HD13 . LEU A 1 54  ? -8.339  -1.599  11.303  1.00 0.00 ? 54  LEU A HD13 7  
ATOM 9408  H HD21 . LEU A 1 54  ? -9.604  -1.060  8.103   1.00 0.00 ? 54  LEU A HD21 7  
ATOM 9409  H HD22 . LEU A 1 54  ? -9.870  -0.764  9.838   1.00 0.00 ? 54  LEU A HD22 7  
ATOM 9410  H HD23 . LEU A 1 54  ? -9.200  0.523   8.808   1.00 0.00 ? 54  LEU A HD23 7  
ATOM 9411  N N    . SER A 1 55  ? -4.458  2.122   8.888   1.00 0.00 ? 55  SER A N    7  
ATOM 9412  C CA   . SER A 1 55  ? -3.643  3.281   9.215   1.00 0.00 ? 55  SER A CA   7  
ATOM 9413  C C    . SER A 1 55  ? -2.279  3.170   8.532   1.00 0.00 ? 55  SER A C    7  
ATOM 9414  O O    . SER A 1 55  ? -1.941  2.125   7.978   1.00 0.00 ? 55  SER A O    7  
ATOM 9415  C CB   . SER A 1 55  ? -3.470  3.423   10.728  1.00 0.00 ? 55  SER A CB   7  
ATOM 9416  O OG   . SER A 1 55  ? -3.166  2.177   11.350  1.00 0.00 ? 55  SER A OG   7  
ATOM 9417  H H    . SER A 1 55  ? -3.970  1.249   8.889   1.00 0.00 ? 55  SER A H    7  
ATOM 9418  H HA   . SER A 1 55  ? -4.195  4.139   8.831   1.00 0.00 ? 55  SER A HA   7  
ATOM 9419  H HB2  . SER A 1 55  ? -2.672  4.136   10.937  1.00 0.00 ? 55  SER A HB2  7  
ATOM 9420  H HB3  . SER A 1 55  ? -4.383  3.831   11.161  1.00 0.00 ? 55  SER A HB3  7  
ATOM 9421  H HG   . SER A 1 55  ? -3.125  1.453   10.663  1.00 0.00 ? 55  SER A HG   7  
ATOM 9422  N N    . ILE A 1 56  ? -1.531  4.262   8.595   1.00 0.00 ? 56  ILE A N    7  
ATOM 9423  C CA   . ILE A 1 56  ? -0.211  4.301   7.990   1.00 0.00 ? 56  ILE A CA   7  
ATOM 9424  C C    . ILE A 1 56  ? 0.734   5.101   8.889   1.00 0.00 ? 56  ILE A C    7  
ATOM 9425  O O    . ILE A 1 56  ? 0.832   6.320   8.764   1.00 0.00 ? 56  ILE A O    7  
ATOM 9426  C CB   . ILE A 1 56  ? -0.293  4.832   6.558   1.00 0.00 ? 56  ILE A CB   7  
ATOM 9427  C CG1  . ILE A 1 56  ? -1.089  3.878   5.664   1.00 0.00 ? 56  ILE A CG1  7  
ATOM 9428  C CG2  . ILE A 1 56  ? 1.102   5.113   5.996   1.00 0.00 ? 56  ILE A CG2  7  
ATOM 9429  C CD1  . ILE A 1 56  ? -1.456  4.548   4.338   1.00 0.00 ? 56  ILE A CD1  7  
ATOM 9430  H H    . ILE A 1 56  ? -1.813  5.108   9.048   1.00 0.00 ? 56  ILE A H    7  
ATOM 9431  H HA   . ILE A 1 56  ? 0.153   3.275   7.933   1.00 0.00 ? 56  ILE A HA   7  
ATOM 9432  H HB   . ILE A 1 56  ? -0.830  5.780   6.576   1.00 0.00 ? 56  ILE A HB   7  
ATOM 9433  H HG12 . ILE A 1 56  ? -0.503  2.980   5.472   1.00 0.00 ? 56  ILE A HG12 7  
ATOM 9434  H HG13 . ILE A 1 56  ? -1.996  3.563   6.180   1.00 0.00 ? 56  ILE A HG13 7  
ATOM 9435  H HG21 . ILE A 1 56  ? 1.841   5.013   6.791   1.00 0.00 ? 56  ILE A HG21 7  
ATOM 9436  H HG22 . ILE A 1 56  ? 1.324   4.401   5.202   1.00 0.00 ? 56  ILE A HG22 7  
ATOM 9437  H HG23 . ILE A 1 56  ? 1.135   6.126   5.595   1.00 0.00 ? 56  ILE A HG23 7  
ATOM 9438  H HD11 . ILE A 1 56  ? -2.294  4.018   3.884   1.00 0.00 ? 56  ILE A HD11 7  
ATOM 9439  H HD12 . ILE A 1 56  ? -1.738  5.585   4.521   1.00 0.00 ? 56  ILE A HD12 7  
ATOM 9440  H HD13 . ILE A 1 56  ? -0.599  4.517   3.666   1.00 0.00 ? 56  ILE A HD13 7  
ATOM 9441  N N    . ASP A 1 57  ? 1.406   4.381   9.776   1.00 0.00 ? 57  ASP A N    7  
ATOM 9442  C CA   . ASP A 1 57  ? 2.340   5.009   10.696  1.00 0.00 ? 57  ASP A CA   7  
ATOM 9443  C C    . ASP A 1 57  ? 1.564   5.868   11.696  1.00 0.00 ? 57  ASP A C    7  
ATOM 9444  O O    . ASP A 1 57  ? 1.887   7.038   11.896  1.00 0.00 ? 57  ASP A O    7  
ATOM 9445  C CB   . ASP A 1 57  ? 3.320   5.918   9.951   1.00 0.00 ? 57  ASP A CB   7  
ATOM 9446  C CG   . ASP A 1 57  ? 4.631   6.197   10.688  1.00 0.00 ? 57  ASP A CG   7  
ATOM 9447  O OD1  . ASP A 1 57  ? 5.167   5.234   11.278  1.00 0.00 ? 57  ASP A OD1  7  
ATOM 9448  O OD2  . ASP A 1 57  ? 5.068   7.367   10.646  1.00 0.00 ? 57  ASP A OD2  7  
ATOM 9449  H H    . ASP A 1 57  ? 1.321   3.389   9.872   1.00 0.00 ? 57  ASP A H    7  
ATOM 9450  H HA   . ASP A 1 57  ? 2.867   4.184   11.175  1.00 0.00 ? 57  ASP A HA   7  
ATOM 9451  H HB2  . ASP A 1 57  ? 3.552   5.464   8.987   1.00 0.00 ? 57  ASP A HB2  7  
ATOM 9452  H HB3  . ASP A 1 57  ? 2.826   6.868   9.746   1.00 0.00 ? 57  ASP A HB3  7  
ATOM 9453  N N    . GLY A 1 58  ? 0.556   5.255   12.298  1.00 0.00 ? 58  GLY A N    7  
ATOM 9454  C CA   . GLY A 1 58  ? -0.268  5.949   13.272  1.00 0.00 ? 58  GLY A CA   7  
ATOM 9455  C C    . GLY A 1 58  ? -1.193  6.958   12.588  1.00 0.00 ? 58  GLY A C    7  
ATOM 9456  O O    . GLY A 1 58  ? -1.926  7.686   13.256  1.00 0.00 ? 58  GLY A O    7  
ATOM 9457  H H    . GLY A 1 58  ? 0.300   4.303   12.129  1.00 0.00 ? 58  GLY A H    7  
ATOM 9458  H HA2  . GLY A 1 58  ? -0.863  5.227   13.832  1.00 0.00 ? 58  GLY A HA2  7  
ATOM 9459  H HA3  . GLY A 1 58  ? 0.369   6.464   13.992  1.00 0.00 ? 58  GLY A HA3  7  
ATOM 9460  N N    . ILE A 1 59  ? -1.129  6.969   11.265  1.00 0.00 ? 59  ILE A N    7  
ATOM 9461  C CA   . ILE A 1 59  ? -1.951  7.877   10.483  1.00 0.00 ? 59  ILE A CA   7  
ATOM 9462  C C    . ILE A 1 59  ? -3.200  7.138   9.999   1.00 0.00 ? 59  ILE A C    7  
ATOM 9463  O O    . ILE A 1 59  ? -3.146  5.943   9.713   1.00 0.00 ? 59  ILE A O    7  
ATOM 9464  C CB   . ILE A 1 59  ? -1.132  8.505   9.354   1.00 0.00 ? 59  ILE A CB   7  
ATOM 9465  C CG1  . ILE A 1 59  ? 0.196   9.054   9.880   1.00 0.00 ? 59  ILE A CG1  7  
ATOM 9466  C CG2  . ILE A 1 59  ? -1.942  9.574   8.618   1.00 0.00 ? 59  ILE A CG2  7  
ATOM 9467  C CD1  . ILE A 1 59  ? 0.035   10.490  10.383  1.00 0.00 ? 59  ILE A CD1  7  
ATOM 9468  H H    . ILE A 1 59  ? -0.530  6.374   10.729  1.00 0.00 ? 59  ILE A H    7  
ATOM 9469  H HA   . ILE A 1 59  ? -2.263  8.686   11.144  1.00 0.00 ? 59  ILE A HA   7  
ATOM 9470  H HB   . ILE A 1 59  ? -0.894  7.726   8.631   1.00 0.00 ? 59  ILE A HB   7  
ATOM 9471  H HG12 . ILE A 1 59  ? 0.560   8.421   10.689  1.00 0.00 ? 59  ILE A HG12 7  
ATOM 9472  H HG13 . ILE A 1 59  ? 0.945   9.023   9.089   1.00 0.00 ? 59  ILE A HG13 7  
ATOM 9473  H HG21 . ILE A 1 59  ? -2.865  9.133   8.240   1.00 0.00 ? 59  ILE A HG21 7  
ATOM 9474  H HG22 . ILE A 1 59  ? -2.181  10.386  9.304   1.00 0.00 ? 59  ILE A HG22 7  
ATOM 9475  H HG23 . ILE A 1 59  ? -1.357  9.963   7.784   1.00 0.00 ? 59  ILE A HG23 7  
ATOM 9476  H HD11 . ILE A 1 59  ? -0.790  10.536  11.093  1.00 0.00 ? 59  ILE A HD11 7  
ATOM 9477  H HD12 . ILE A 1 59  ? 0.955   10.809  10.872  1.00 0.00 ? 59  ILE A HD12 7  
ATOM 9478  H HD13 . ILE A 1 59  ? -0.174  11.149  9.539   1.00 0.00 ? 59  ILE A HD13 7  
ATOM 9479  N N    . SER A 1 60  ? -4.295  7.879   9.922   1.00 0.00 ? 60  SER A N    7  
ATOM 9480  C CA   . SER A 1 60  ? -5.555  7.309   9.477   1.00 0.00 ? 60  SER A CA   7  
ATOM 9481  C C    . SER A 1 60  ? -5.628  7.327   7.949   1.00 0.00 ? 60  SER A C    7  
ATOM 9482  O O    . SER A 1 60  ? -5.609  8.393   7.336   1.00 0.00 ? 60  SER A O    7  
ATOM 9483  C CB   . SER A 1 60  ? -6.744  8.066   10.073  1.00 0.00 ? 60  SER A CB   7  
ATOM 9484  O OG   . SER A 1 60  ? -7.500  7.254   10.967  1.00 0.00 ? 60  SER A OG   7  
ATOM 9485  H H    . SER A 1 60  ? -4.330  8.851   10.156  1.00 0.00 ? 60  SER A H    7  
ATOM 9486  H HA   . SER A 1 60  ? -5.555  6.284   9.848   1.00 0.00 ? 60  SER A HA   7  
ATOM 9487  H HB2  . SER A 1 60  ? -6.383  8.948   10.603  1.00 0.00 ? 60  SER A HB2  7  
ATOM 9488  H HB3  . SER A 1 60  ? -7.389  8.419   9.269   1.00 0.00 ? 60  SER A HB3  7  
ATOM 9489  H HG   . SER A 1 60  ? -7.351  6.287   10.760  1.00 0.00 ? 60  SER A HG   7  
ATOM 9490  N N    . ALA A 1 61  ? -5.708  6.134   7.378   1.00 0.00 ? 61  ALA A N    7  
ATOM 9491  C CA   . ALA A 1 61  ? -5.783  6.000   5.933   1.00 0.00 ? 61  ALA A CA   7  
ATOM 9492  C C    . ALA A 1 61  ? -7.251  5.943   5.506   1.00 0.00 ? 61  ALA A C    7  
ATOM 9493  O O    . ALA A 1 61  ? -7.583  5.332   4.491   1.00 0.00 ? 61  ALA A O    7  
ATOM 9494  C CB   . ALA A 1 61  ? -5.000  4.760   5.494   1.00 0.00 ? 61  ALA A CB   7  
ATOM 9495  H H    . ALA A 1 61  ? -5.723  5.272   7.884   1.00 0.00 ? 61  ALA A H    7  
ATOM 9496  H HA   . ALA A 1 61  ? -5.319  6.882   5.493   1.00 0.00 ? 61  ALA A HA   7  
ATOM 9497  H HB1  . ALA A 1 61  ? -4.574  4.931   4.506   1.00 0.00 ? 61  ALA A HB1  7  
ATOM 9498  H HB2  . ALA A 1 61  ? -4.199  4.566   6.207   1.00 0.00 ? 61  ALA A HB2  7  
ATOM 9499  H HB3  . ALA A 1 61  ? -5.670  3.902   5.457   1.00 0.00 ? 61  ALA A HB3  7  
ATOM 9500  N N    . GLN A 1 62  ? -8.091  6.589   6.301   1.00 0.00 ? 62  GLN A N    7  
ATOM 9501  C CA   . GLN A 1 62  ? -9.516  6.620   6.018   1.00 0.00 ? 62  GLN A CA   7  
ATOM 9502  C C    . GLN A 1 62  ? -9.822  7.674   4.952   1.00 0.00 ? 62  GLN A C    7  
ATOM 9503  O O    . GLN A 1 62  ? -10.392 7.359   3.909   1.00 0.00 ? 62  GLN A O    7  
ATOM 9504  C CB   . GLN A 1 62  ? -10.323 6.879   7.293   1.00 0.00 ? 62  GLN A CB   7  
ATOM 9505  C CG   . GLN A 1 62  ? -10.764 5.563   7.938   1.00 0.00 ? 62  GLN A CG   7  
ATOM 9506  C CD   . GLN A 1 62  ? -10.583 5.610   9.456   1.00 0.00 ? 62  GLN A CD   7  
ATOM 9507  O OE1  . GLN A 1 62  ? -10.347 6.650   10.048  1.00 0.00 ? 62  GLN A OE1  7  
ATOM 9508  N NE2  . GLN A 1 62  ? -10.706 4.427   10.052  1.00 0.00 ? 62  GLN A NE2  7  
ATOM 9509  H H    . GLN A 1 62  ? -7.813  7.084   7.125   1.00 0.00 ? 62  GLN A H    7  
ATOM 9510  H HA   . GLN A 1 62  ? -9.757  5.628   5.638   1.00 0.00 ? 62  GLN A HA   7  
ATOM 9511  H HB2  . GLN A 1 62  ? -9.720  7.450   7.999   1.00 0.00 ? 62  GLN A HB2  7  
ATOM 9512  H HB3  . GLN A 1 62  ? -11.198 7.484   7.057   1.00 0.00 ? 62  GLN A HB3  7  
ATOM 9513  H HG2  . GLN A 1 62  ? -11.810 5.370   7.699   1.00 0.00 ? 62  GLN A HG2  7  
ATOM 9514  H HG3  . GLN A 1 62  ? -10.185 4.738   7.524   1.00 0.00 ? 62  GLN A HG3  7  
ATOM 9515  H HE21 . GLN A 1 62  ? -10.900 3.611   9.508   1.00 0.00 ? 62  GLN A HE21 7  
ATOM 9516  H HE22 . GLN A 1 62  ? -10.604 4.354   11.044  1.00 0.00 ? 62  GLN A HE22 7  
ATOM 9517  N N    . GLY A 1 63  ? -9.431  8.904   5.252   1.00 0.00 ? 63  GLY A N    7  
ATOM 9518  C CA   . GLY A 1 63  ? -9.657  10.006  4.332   1.00 0.00 ? 63  GLY A CA   7  
ATOM 9519  C C    . GLY A 1 63  ? -8.357  10.414  3.635   1.00 0.00 ? 63  GLY A C    7  
ATOM 9520  O O    . GLY A 1 63  ? -8.007  11.592  3.607   1.00 0.00 ? 63  GLY A O    7  
ATOM 9521  H H    . GLY A 1 63  ? -8.968  9.152   6.103   1.00 0.00 ? 63  GLY A H    7  
ATOM 9522  H HA2  . GLY A 1 63  ? -10.398 9.716   3.587   1.00 0.00 ? 63  GLY A HA2  7  
ATOM 9523  H HA3  . GLY A 1 63  ? -10.066 10.858  4.874   1.00 0.00 ? 63  GLY A HA3  7  
ATOM 9524  N N    . MET A 1 64  ? -7.677  9.416   3.090   1.00 0.00 ? 64  MET A N    7  
ATOM 9525  C CA   . MET A 1 64  ? -6.424  9.656   2.396   1.00 0.00 ? 64  MET A CA   7  
ATOM 9526  C C    . MET A 1 64  ? -6.413  8.966   1.029   1.00 0.00 ? 64  MET A C    7  
ATOM 9527  O O    . MET A 1 64  ? -6.765  7.793   0.920   1.00 0.00 ? 64  MET A O    7  
ATOM 9528  C CB   . MET A 1 64  ? -5.262  9.130   3.241   1.00 0.00 ? 64  MET A CB   7  
ATOM 9529  C CG   . MET A 1 64  ? -5.019  10.027  4.457   1.00 0.00 ? 64  MET A CG   7  
ATOM 9530  S SD   . MET A 1 64  ? -3.285  10.027  4.879   1.00 0.00 ? 64  MET A SD   7  
ATOM 9531  C CE   . MET A 1 64  ? -3.090  8.328   5.389   1.00 0.00 ? 64  MET A CE   7  
ATOM 9532  H H    . MET A 1 64  ? -7.969  8.459   3.118   1.00 0.00 ? 64  MET A H    7  
ATOM 9533  H HA   . MET A 1 64  ? -6.363  10.736  2.266   1.00 0.00 ? 64  MET A HA   7  
ATOM 9534  H HB2  . MET A 1 64  ? -5.479  8.114   3.572   1.00 0.00 ? 64  MET A HB2  7  
ATOM 9535  H HB3  . MET A 1 64  ? -4.358  9.081   2.634   1.00 0.00 ? 64  MET A HB3  7  
ATOM 9536  H HG2  . MET A 1 64  ? -5.349  11.043  4.241   1.00 0.00 ? 64  MET A HG2  7  
ATOM 9537  H HG3  . MET A 1 64  ? -5.608  9.674   5.303   1.00 0.00 ? 64  MET A HG3  7  
ATOM 9538  H HE1  . MET A 1 64  ? -3.521  8.195   6.382   1.00 0.00 ? 64  MET A HE1  7  
ATOM 9539  H HE2  . MET A 1 64  ? -3.600  7.675   4.681   1.00 0.00 ? 64  MET A HE2  7  
ATOM 9540  H HE3  . MET A 1 64  ? -2.030  8.076   5.417   1.00 0.00 ? 64  MET A HE3  7  
ATOM 9541  N N    . THR A 1 65  ? -6.007  9.726   0.022   1.00 0.00 ? 65  THR A N    7  
ATOM 9542  C CA   . THR A 1 65  ? -5.946  9.203   -1.332  1.00 0.00 ? 65  THR A CA   7  
ATOM 9543  C C    . THR A 1 65  ? -4.732  8.286   -1.496  1.00 0.00 ? 65  THR A C    7  
ATOM 9544  O O    . THR A 1 65  ? -3.888  8.204   -0.606  1.00 0.00 ? 65  THR A O    7  
ATOM 9545  C CB   . THR A 1 65  ? -5.946  10.390  -2.297  1.00 0.00 ? 65  THR A CB   7  
ATOM 9546  O OG1  . THR A 1 65  ? -4.768  11.115  -1.956  1.00 0.00 ? 65  THR A OG1  7  
ATOM 9547  C CG2  . THR A 1 65  ? -7.083  11.374  -2.016  1.00 0.00 ? 65  THR A CG2  7  
ATOM 9548  H H    . THR A 1 65  ? -5.723  10.679  0.120   1.00 0.00 ? 65  THR A H    7  
ATOM 9549  H HA   . THR A 1 65  ? -6.833  8.593   -1.505  1.00 0.00 ? 65  THR A HA   7  
ATOM 9550  H HB   . THR A 1 65  ? -5.973  10.049  -3.332  1.00 0.00 ? 65  THR A HB   7  
ATOM 9551  H HG1  . THR A 1 65  ? -4.555  11.778  -2.673  1.00 0.00 ? 65  THR A HG1  7  
ATOM 9552  H HG21 . THR A 1 65  ? -7.244  12.003  -2.891  1.00 0.00 ? 65  THR A HG21 7  
ATOM 9553  H HG22 . THR A 1 65  ? -7.996  10.820  -1.794  1.00 0.00 ? 65  THR A HG22 7  
ATOM 9554  H HG23 . THR A 1 65  ? -6.820  11.998  -1.162  1.00 0.00 ? 65  THR A HG23 7  
ATOM 9555  N N    . HIS A 1 66  ? -4.684  7.620   -2.640  1.00 0.00 ? 66  HIS A N    7  
ATOM 9556  C CA   . HIS A 1 66  ? -3.588  6.712   -2.932  1.00 0.00 ? 66  HIS A CA   7  
ATOM 9557  C C    . HIS A 1 66  ? -2.255  7.441   -2.747  1.00 0.00 ? 66  HIS A C    7  
ATOM 9558  O O    . HIS A 1 66  ? -1.364  6.946   -2.058  1.00 0.00 ? 66  HIS A O    7  
ATOM 9559  C CB   . HIS A 1 66  ? -3.742  6.105   -4.328  1.00 0.00 ? 66  HIS A CB   7  
ATOM 9560  C CG   . HIS A 1 66  ? -3.023  4.789   -4.508  1.00 0.00 ? 66  HIS A CG   7  
ATOM 9561  N ND1  . HIS A 1 66  ? -2.317  4.472   -5.655  1.00 0.00 ? 66  HIS A ND1  7  
ATOM 9562  C CD2  . HIS A 1 66  ? -2.908  3.715   -3.676  1.00 0.00 ? 66  HIS A CD2  7  
ATOM 9563  C CE1  . HIS A 1 66  ? -1.804  3.259   -5.509  1.00 0.00 ? 66  HIS A CE1  7  
ATOM 9564  N NE2  . HIS A 1 66  ? -2.173  2.791   -4.282  1.00 0.00 ? 66  HIS A NE2  7  
ATOM 9565  H H    . HIS A 1 66  ? -5.375  7.693   -3.359  1.00 0.00 ? 66  HIS A H    7  
ATOM 9566  H HA   . HIS A 1 66  ? -3.652  5.901   -2.207  1.00 0.00 ? 66  HIS A HA   7  
ATOM 9567  H HB2  . HIS A 1 66  ? -4.803  5.959   -4.534  1.00 0.00 ? 66  HIS A HB2  7  
ATOM 9568  H HB3  . HIS A 1 66  ? -3.369  6.815   -5.065  1.00 0.00 ? 66  HIS A HB3  7  
ATOM 9569  H HD1  . HIS A 1 66  ? -2.210  5.059   -6.458  1.00 0.00 ? 66  HIS A HD1  7  
ATOM 9570  H HD2  . HIS A 1 66  ? -3.347  3.630   -2.682  1.00 0.00 ? 66  HIS A HD2  7  
ATOM 9571  H HE1  . HIS A 1 66  ? -1.196  2.728   -6.241  1.00 0.00 ? 66  HIS A HE1  7  
ATOM 9572  N N    . LEU A 1 67  ? -2.161  8.604   -3.374  1.00 0.00 ? 67  LEU A N    7  
ATOM 9573  C CA   . LEU A 1 67  ? -0.952  9.406   -3.286  1.00 0.00 ? 67  LEU A CA   7  
ATOM 9574  C C    . LEU A 1 67  ? -0.640  9.692   -1.816  1.00 0.00 ? 67  LEU A C    7  
ATOM 9575  O O    . LEU A 1 67  ? 0.488   9.493   -1.368  1.00 0.00 ? 67  LEU A O    7  
ATOM 9576  C CB   . LEU A 1 67  ? -1.083  10.666  -4.144  1.00 0.00 ? 67  LEU A CB   7  
ATOM 9577  C CG   . LEU A 1 67  ? -0.582  11.965  -3.508  1.00 0.00 ? 67  LEU A CG   7  
ATOM 9578  C CD1  . LEU A 1 67  ? -1.574  12.483  -2.466  1.00 0.00 ? 67  LEU A CD1  7  
ATOM 9579  C CD2  . LEU A 1 67  ? 0.821   11.784  -2.923  1.00 0.00 ? 67  LEU A CD2  7  
ATOM 9580  H H    . LEU A 1 67  ? -2.891  8.999   -3.932  1.00 0.00 ? 67  LEU A H    7  
ATOM 9581  H HA   . LEU A 1 67  ? -0.138  8.815   -3.704  1.00 0.00 ? 67  LEU A HA   7  
ATOM 9582  H HB2  . LEU A 1 67  ? -0.537  10.507  -5.074  1.00 0.00 ? 67  LEU A HB2  7  
ATOM 9583  H HB3  . LEU A 1 67  ? -2.132  10.796  -4.408  1.00 0.00 ? 67  LEU A HB3  7  
ATOM 9584  H HG   . LEU A 1 67  ? -0.510  12.722  -4.288  1.00 0.00 ? 67  LEU A HG   7  
ATOM 9585  H HD11 . LEU A 1 67  ? -2.508  11.926  -2.544  1.00 0.00 ? 67  LEU A HD11 7  
ATOM 9586  H HD12 . LEU A 1 67  ? -1.156  12.351  -1.468  1.00 0.00 ? 67  LEU A HD12 7  
ATOM 9587  H HD13 . LEU A 1 67  ? -1.767  13.541  -2.642  1.00 0.00 ? 67  LEU A HD13 7  
ATOM 9588  H HD21 . LEU A 1 67  ? 1.296   10.917  -3.382  1.00 0.00 ? 67  LEU A HD21 7  
ATOM 9589  H HD22 . LEU A 1 67  ? 1.416   12.674  -3.125  1.00 0.00 ? 67  LEU A HD22 7  
ATOM 9590  H HD23 . LEU A 1 67  ? 0.748   11.631  -1.846  1.00 0.00 ? 67  LEU A HD23 7  
ATOM 9591  N N    . GLU A 1 68  ? -1.659  10.154  -1.107  1.00 0.00 ? 68  GLU A N    7  
ATOM 9592  C CA   . GLU A 1 68  ? -1.508  10.469  0.303   1.00 0.00 ? 68  GLU A CA   7  
ATOM 9593  C C    . GLU A 1 68  ? -0.809  9.319   1.032   1.00 0.00 ? 68  GLU A C    7  
ATOM 9594  O O    . GLU A 1 68  ? 0.263   9.503   1.606   1.00 0.00 ? 68  GLU A O    7  
ATOM 9595  C CB   . GLU A 1 68  ? -2.861  10.782  0.944   1.00 0.00 ? 68  GLU A CB   7  
ATOM 9596  C CG   . GLU A 1 68  ? -3.318  12.200  0.595   1.00 0.00 ? 68  GLU A CG   7  
ATOM 9597  C CD   . GLU A 1 68  ? -3.764  12.956  1.849   1.00 0.00 ? 68  GLU A CD   7  
ATOM 9598  O OE1  . GLU A 1 68  ? -2.886  13.590  2.472   1.00 0.00 ? 68  GLU A OE1  7  
ATOM 9599  O OE2  . GLU A 1 68  ? -4.974  12.883  2.154   1.00 0.00 ? 68  GLU A OE2  7  
ATOM 9600  H H    . GLU A 1 68  ? -2.574  10.313  -1.479  1.00 0.00 ? 68  GLU A H    7  
ATOM 9601  H HA   . GLU A 1 68  ? -0.882  11.361  0.335   1.00 0.00 ? 68  GLU A HA   7  
ATOM 9602  H HB2  . GLU A 1 68  ? -3.605  10.062  0.602   1.00 0.00 ? 68  GLU A HB2  7  
ATOM 9603  H HB3  . GLU A 1 68  ? -2.789  10.675  2.026   1.00 0.00 ? 68  GLU A HB3  7  
ATOM 9604  H HG2  . GLU A 1 68  ? -2.503  12.740  0.112   1.00 0.00 ? 68  GLU A HG2  7  
ATOM 9605  H HG3  . GLU A 1 68  ? -4.140  12.156  -0.119  1.00 0.00 ? 68  GLU A HG3  7  
ATOM 9606  N N    . ALA A 1 69  ? -1.445  8.158   0.985   1.00 0.00 ? 69  ALA A N    7  
ATOM 9607  C CA   . ALA A 1 69  ? -0.898  6.978   1.634   1.00 0.00 ? 69  ALA A CA   7  
ATOM 9608  C C    . ALA A 1 69  ? 0.534   6.751   1.146   1.00 0.00 ? 69  ALA A C    7  
ATOM 9609  O O    . ALA A 1 69  ? 1.442   6.548   1.951   1.00 0.00 ? 69  ALA A O    7  
ATOM 9610  C CB   . ALA A 1 69  ? -1.805  5.777   1.358   1.00 0.00 ? 69  ALA A CB   7  
ATOM 9611  H H    . ALA A 1 69  ? -2.317  8.016   0.516   1.00 0.00 ? 69  ALA A H    7  
ATOM 9612  H HA   . ALA A 1 69  ? -0.883  7.167   2.707   1.00 0.00 ? 69  ALA A HA   7  
ATOM 9613  H HB1  . ALA A 1 69  ? -2.533  5.679   2.163   1.00 0.00 ? 69  ALA A HB1  7  
ATOM 9614  H HB2  . ALA A 1 69  ? -2.327  5.925   0.412   1.00 0.00 ? 69  ALA A HB2  7  
ATOM 9615  H HB3  . ALA A 1 69  ? -1.201  4.871   1.301   1.00 0.00 ? 69  ALA A HB3  7  
ATOM 9616  N N    . GLN A 1 70  ? 0.692   6.794   -0.168  1.00 0.00 ? 70  GLN A N    7  
ATOM 9617  C CA   . GLN A 1 70  ? 1.998   6.596   -0.772  1.00 0.00 ? 70  GLN A CA   7  
ATOM 9618  C C    . GLN A 1 70  ? 3.000   7.608   -0.214  1.00 0.00 ? 70  GLN A C    7  
ATOM 9619  O O    . GLN A 1 70  ? 4.135   7.254   0.103   1.00 0.00 ? 70  GLN A O    7  
ATOM 9620  C CB   . GLN A 1 70  ? 1.917   6.688   -2.297  1.00 0.00 ? 70  GLN A CB   7  
ATOM 9621  C CG   . GLN A 1 70  ? 0.912   5.678   -2.855  1.00 0.00 ? 70  GLN A CG   7  
ATOM 9622  C CD   . GLN A 1 70  ? 1.619   4.597   -3.675  1.00 0.00 ? 70  GLN A CD   7  
ATOM 9623  O OE1  . GLN A 1 70  ? 2.045   3.574   -3.165  1.00 0.00 ? 70  GLN A OE1  7  
ATOM 9624  N NE2  . GLN A 1 70  ? 1.719   4.880   -4.971  1.00 0.00 ? 70  GLN A NE2  7  
ATOM 9625  H H    . GLN A 1 70  ? -0.052  6.960   -0.816  1.00 0.00 ? 70  GLN A H    7  
ATOM 9626  H HA   . GLN A 1 70  ? 2.297   5.586   -0.491  1.00 0.00 ? 70  GLN A HA   7  
ATOM 9627  H HB2  . GLN A 1 70  ? 1.625   7.697   -2.589  1.00 0.00 ? 70  GLN A HB2  7  
ATOM 9628  H HB3  . GLN A 1 70  ? 2.901   6.504   -2.729  1.00 0.00 ? 70  GLN A HB3  7  
ATOM 9629  H HG2  . GLN A 1 70  ? 0.362   5.217   -2.035  1.00 0.00 ? 70  GLN A HG2  7  
ATOM 9630  H HG3  . GLN A 1 70  ? 0.182   6.193   -3.479  1.00 0.00 ? 70  GLN A HG3  7  
ATOM 9631  H HE21 . GLN A 1 70  ? 1.348   5.738   -5.325  1.00 0.00 ? 70  GLN A HE21 7  
ATOM 9632  H HE22 . GLN A 1 70  ? 2.166   4.234   -5.590  1.00 0.00 ? 70  GLN A HE22 7  
ATOM 9633  N N    . ASN A 1 71  ? 2.545   8.848   -0.111  1.00 0.00 ? 71  ASN A N    7  
ATOM 9634  C CA   . ASN A 1 71  ? 3.387   9.915   0.403   1.00 0.00 ? 71  ASN A CA   7  
ATOM 9635  C C    . ASN A 1 71  ? 3.966   9.494   1.755   1.00 0.00 ? 71  ASN A C    7  
ATOM 9636  O O    . ASN A 1 71  ? 5.166   9.628   1.989   1.00 0.00 ? 71  ASN A O    7  
ATOM 9637  C CB   . ASN A 1 71  ? 2.583   11.199  0.612   1.00 0.00 ? 71  ASN A CB   7  
ATOM 9638  C CG   . ASN A 1 71  ? 3.017   12.285  -0.375  1.00 0.00 ? 71  ASN A CG   7  
ATOM 9639  O OD1  . ASN A 1 71  ? 4.158   12.352  -0.801  1.00 0.00 ? 71  ASN A OD1  7  
ATOM 9640  N ND2  . ASN A 1 71  ? 2.046   13.128  -0.713  1.00 0.00 ? 71  ASN A ND2  7  
ATOM 9641  H H    . ASN A 1 71  ? 1.621   9.128   -0.372  1.00 0.00 ? 71  ASN A H    7  
ATOM 9642  H HA   . ASN A 1 71  ? 4.158   10.061  -0.354  1.00 0.00 ? 71  ASN A HA   7  
ATOM 9643  H HB2  . ASN A 1 71  ? 1.520   10.992  0.486   1.00 0.00 ? 71  ASN A HB2  7  
ATOM 9644  H HB3  . ASN A 1 71  ? 2.719   11.556  1.633   1.00 0.00 ? 71  ASN A HB3  7  
ATOM 9645  H HD21 . ASN A 1 71  ? 1.131   13.017  -0.327  1.00 0.00 ? 71  ASN A HD21 7  
ATOM 9646  H HD22 . ASN A 1 71  ? 2.232   13.873  -1.354  1.00 0.00 ? 71  ASN A HD22 7  
ATOM 9647  N N    . LYS A 1 72  ? 3.086   8.994   2.610   1.00 0.00 ? 72  LYS A N    7  
ATOM 9648  C CA   . LYS A 1 72  ? 3.495   8.553   3.933   1.00 0.00 ? 72  LYS A CA   7  
ATOM 9649  C C    . LYS A 1 72  ? 4.561   7.465   3.796   1.00 0.00 ? 72  LYS A C    7  
ATOM 9650  O O    . LYS A 1 72  ? 5.656   7.591   4.342   1.00 0.00 ? 72  LYS A O    7  
ATOM 9651  C CB   . LYS A 1 72  ? 2.278   8.122   4.754   1.00 0.00 ? 72  LYS A CB   7  
ATOM 9652  C CG   . LYS A 1 72  ? 1.528   9.338   5.302   1.00 0.00 ? 72  LYS A CG   7  
ATOM 9653  C CD   . LYS A 1 72  ? 2.398   10.119  6.289   1.00 0.00 ? 72  LYS A CD   7  
ATOM 9654  C CE   . LYS A 1 72  ? 1.536   10.970  7.224   1.00 0.00 ? 72  LYS A CE   7  
ATOM 9655  N NZ   . LYS A 1 72  ? 1.114   12.217  6.548   1.00 0.00 ? 72  LYS A NZ   7  
ATOM 9656  H H    . LYS A 1 72  ? 2.112   8.889   2.412   1.00 0.00 ? 72  LYS A H    7  
ATOM 9657  H HA   . LYS A 1 72  ? 3.939   9.410   4.440   1.00 0.00 ? 72  LYS A HA   7  
ATOM 9658  H HB2  . LYS A 1 72  ? 1.608   7.526   4.133   1.00 0.00 ? 72  LYS A HB2  7  
ATOM 9659  H HB3  . LYS A 1 72  ? 2.598   7.485   5.578   1.00 0.00 ? 72  LYS A HB3  7  
ATOM 9660  H HG2  . LYS A 1 72  ? 1.231   9.988   4.480   1.00 0.00 ? 72  LYS A HG2  7  
ATOM 9661  H HG3  . LYS A 1 72  ? 0.613   9.012   5.797   1.00 0.00 ? 72  LYS A HG3  7  
ATOM 9662  H HD2  . LYS A 1 72  ? 3.002   9.426   6.875   1.00 0.00 ? 72  LYS A HD2  7  
ATOM 9663  H HD3  . LYS A 1 72  ? 3.089   10.760  5.741   1.00 0.00 ? 72  LYS A HD3  7  
ATOM 9664  H HE2  . LYS A 1 72  ? 0.659   10.403  7.537   1.00 0.00 ? 72  LYS A HE2  7  
ATOM 9665  H HE3  . LYS A 1 72  ? 2.098   11.211  8.127   1.00 0.00 ? 72  LYS A HE3  7  
ATOM 9666  H HZ1  . LYS A 1 72  ? 1.917   12.782  6.358   1.00 0.00 ? 72  LYS A HZ1  7  
ATOM 9667  H HZ2  . LYS A 1 72  ? 0.653   11.991  5.690   1.00 0.00 ? 72  LYS A HZ2  7  
ATOM 9668  H HZ3  . LYS A 1 72  ? 0.485   12.721  7.141   1.00 0.00 ? 72  LYS A HZ3  7  
ATOM 9669  N N    . ILE A 1 73  ? 4.204   6.420   3.064   1.00 0.00 ? 73  ILE A N    7  
ATOM 9670  C CA   . ILE A 1 73  ? 5.117   5.310   2.848   1.00 0.00 ? 73  ILE A CA   7  
ATOM 9671  C C    . ILE A 1 73  ? 6.476   5.853   2.401   1.00 0.00 ? 73  ILE A C    7  
ATOM 9672  O O    . ILE A 1 73  ? 7.517   5.359   2.831   1.00 0.00 ? 73  ILE A O    7  
ATOM 9673  C CB   . ILE A 1 73  ? 4.509   4.298   1.875   1.00 0.00 ? 73  ILE A CB   7  
ATOM 9674  C CG1  . ILE A 1 73  ? 3.400   3.487   2.549   1.00 0.00 ? 73  ILE A CG1  7  
ATOM 9675  C CG2  . ILE A 1 73  ? 5.590   3.399   1.273   1.00 0.00 ? 73  ILE A CG2  7  
ATOM 9676  C CD1  . ILE A 1 73  ? 2.264   3.190   1.568   1.00 0.00 ? 73  ILE A CD1  7  
ATOM 9677  H H    . ILE A 1 73  ? 3.312   6.325   2.623   1.00 0.00 ? 73  ILE A H    7  
ATOM 9678  H HA   . ILE A 1 73  ? 5.245   4.802   3.804   1.00 0.00 ? 73  ILE A HA   7  
ATOM 9679  H HB   . ILE A 1 73  ? 4.052   4.847   1.052   1.00 0.00 ? 73  ILE A HB   7  
ATOM 9680  H HG12 . ILE A 1 73  ? 3.809   2.552   2.932   1.00 0.00 ? 73  ILE A HG12 7  
ATOM 9681  H HG13 . ILE A 1 73  ? 3.011   4.039   3.405   1.00 0.00 ? 73  ILE A HG13 7  
ATOM 9682  H HG21 . ILE A 1 73  ? 6.519   3.523   1.830   1.00 0.00 ? 73  ILE A HG21 7  
ATOM 9683  H HG22 . ILE A 1 73  ? 5.270   2.358   1.328   1.00 0.00 ? 73  ILE A HG22 7  
ATOM 9684  H HG23 . ILE A 1 73  ? 5.752   3.673   0.231   1.00 0.00 ? 73  ILE A HG23 7  
ATOM 9685  H HD11 . ILE A 1 73  ? 2.249   3.951   0.788   1.00 0.00 ? 73  ILE A HD11 7  
ATOM 9686  H HD12 . ILE A 1 73  ? 2.421   2.210   1.117   1.00 0.00 ? 73  ILE A HD12 7  
ATOM 9687  H HD13 . ILE A 1 73  ? 1.313   3.197   2.100   1.00 0.00 ? 73  ILE A HD13 7  
ATOM 9688  N N    . LYS A 1 74  ? 6.422   6.861   1.543   1.00 0.00 ? 74  LYS A N    7  
ATOM 9689  C CA   . LYS A 1 74  ? 7.636   7.476   1.034   1.00 0.00 ? 74  LYS A CA   7  
ATOM 9690  C C    . LYS A 1 74  ? 8.409   8.106   2.194   1.00 0.00 ? 74  LYS A C    7  
ATOM 9691  O O    . LYS A 1 74  ? 9.637   8.167   2.165   1.00 0.00 ? 74  LYS A O    7  
ATOM 9692  C CB   . LYS A 1 74  ? 7.307   8.459   -0.092  1.00 0.00 ? 74  LYS A CB   7  
ATOM 9693  C CG   . LYS A 1 74  ? 7.233   7.743   -1.442  1.00 0.00 ? 74  LYS A CG   7  
ATOM 9694  C CD   . LYS A 1 74  ? 7.280   8.744   -2.597  1.00 0.00 ? 74  LYS A CD   7  
ATOM 9695  C CE   . LYS A 1 74  ? 8.435   8.429   -3.550  1.00 0.00 ? 74  LYS A CE   7  
ATOM 9696  N NZ   . LYS A 1 74  ? 7.953   7.638   -4.704  1.00 0.00 ? 74  LYS A NZ   7  
ATOM 9697  H H    . LYS A 1 74  ? 5.571   7.257   1.198   1.00 0.00 ? 74  LYS A H    7  
ATOM 9698  H HA   . LYS A 1 74  ? 8.246   6.684   0.601   1.00 0.00 ? 74  LYS A HA   7  
ATOM 9699  H HB2  . LYS A 1 74  ? 6.356   8.950   0.115   1.00 0.00 ? 74  LYS A HB2  7  
ATOM 9700  H HB3  . LYS A 1 74  ? 8.066   9.240   -0.131  1.00 0.00 ? 74  LYS A HB3  7  
ATOM 9701  H HG2  . LYS A 1 74  ? 8.062   7.041   -1.530  1.00 0.00 ? 74  LYS A HG2  7  
ATOM 9702  H HG3  . LYS A 1 74  ? 6.314   7.159   -1.498  1.00 0.00 ? 74  LYS A HG3  7  
ATOM 9703  H HD2  . LYS A 1 74  ? 6.336   8.719   -3.143  1.00 0.00 ? 74  LYS A HD2  7  
ATOM 9704  H HD3  . LYS A 1 74  ? 7.394   9.754   -2.203  1.00 0.00 ? 74  LYS A HD3  7  
ATOM 9705  H HE2  . LYS A 1 74  ? 8.888   9.356   -3.901  1.00 0.00 ? 74  LYS A HE2  7  
ATOM 9706  H HE3  . LYS A 1 74  ? 9.210   7.876   -3.020  1.00 0.00 ? 74  LYS A HE3  7  
ATOM 9707  H HZ1  . LYS A 1 74  ? 8.736   7.262   -5.200  1.00 0.00 ? 74  LYS A HZ1  7  
ATOM 9708  H HZ2  . LYS A 1 74  ? 7.375   6.890   -4.378  1.00 0.00 ? 74  LYS A HZ2  7  
ATOM 9709  H HZ3  . LYS A 1 74  ? 7.423   8.227   -5.314  1.00 0.00 ? 74  LYS A HZ3  7  
ATOM 9710  N N    . ALA A 1 75  ? 7.658   8.558   3.187   1.00 0.00 ? 75  ALA A N    7  
ATOM 9711  C CA   . ALA A 1 75  ? 8.258   9.181   4.355   1.00 0.00 ? 75  ALA A CA   7  
ATOM 9712  C C    . ALA A 1 75  ? 9.061   8.134   5.130   1.00 0.00 ? 75  ALA A C    7  
ATOM 9713  O O    . ALA A 1 75  ? 10.152  8.422   5.621   1.00 0.00 ? 75  ALA A O    7  
ATOM 9714  C CB   . ALA A 1 75  ? 7.165   9.826   5.208   1.00 0.00 ? 75  ALA A CB   7  
ATOM 9715  H H    . ALA A 1 75  ? 6.660   8.504   3.203   1.00 0.00 ? 75  ALA A H    7  
ATOM 9716  H HA   . ALA A 1 75  ? 8.936   9.960   4.005   1.00 0.00 ? 75  ALA A HA   7  
ATOM 9717  H HB1  . ALA A 1 75  ? 6.588   9.049   5.709   1.00 0.00 ? 75  ALA A HB1  7  
ATOM 9718  H HB2  . ALA A 1 75  ? 7.622   10.476  5.954   1.00 0.00 ? 75  ALA A HB2  7  
ATOM 9719  H HB3  . ALA A 1 75  ? 6.505   10.414  4.570   1.00 0.00 ? 75  ALA A HB3  7  
ATOM 9720  N N    . CYS A 1 76  ? 8.490   6.942   5.216   1.00 0.00 ? 76  CYS A N    7  
ATOM 9721  C CA   . CYS A 1 76  ? 9.139   5.851   5.924   1.00 0.00 ? 76  CYS A CA   7  
ATOM 9722  C C    . CYS A 1 76  ? 10.375  5.429   5.127   1.00 0.00 ? 76  CYS A C    7  
ATOM 9723  O O    . CYS A 1 76  ? 10.256  4.897   4.024   1.00 0.00 ? 76  CYS A O    7  
ATOM 9724  C CB   . CYS A 1 76  ? 8.182   4.679   6.155   1.00 0.00 ? 76  CYS A CB   7  
ATOM 9725  S SG   . CYS A 1 76  ? 6.761   5.223   7.172   1.00 0.00 ? 76  CYS A SG   7  
ATOM 9726  H H    . CYS A 1 76  ? 7.603   6.716   4.814   1.00 0.00 ? 76  CYS A H    7  
ATOM 9727  H HA   . CYS A 1 76  ? 9.422   6.237   6.903   1.00 0.00 ? 76  CYS A HA   7  
ATOM 9728  H HB2  . CYS A 1 76  ? 7.830   4.292   5.199   1.00 0.00 ? 76  CYS A HB2  7  
ATOM 9729  H HB3  . CYS A 1 76  ? 8.707   3.864   6.655   1.00 0.00 ? 76  CYS A HB3  7  
ATOM 9730  H HG   . CYS A 1 76  ? 6.330   6.151   6.323   1.00 0.00 ? 76  CYS A HG   7  
ATOM 9731  N N    . THR A 1 77  ? 11.534  5.684   5.716   1.00 0.00 ? 77  THR A N    7  
ATOM 9732  C CA   . THR A 1 77  ? 12.791  5.338   5.075   1.00 0.00 ? 77  THR A CA   7  
ATOM 9733  C C    . THR A 1 77  ? 13.464  4.178   5.812   1.00 0.00 ? 77  THR A C    7  
ATOM 9734  O O    . THR A 1 77  ? 14.345  3.517   5.263   1.00 0.00 ? 77  THR A O    7  
ATOM 9735  C CB   . THR A 1 77  ? 13.654  6.600   5.012   1.00 0.00 ? 77  THR A CB   7  
ATOM 9736  O OG1  . THR A 1 77  ? 14.761  6.224   4.198   1.00 0.00 ? 77  THR A OG1  7  
ATOM 9737  C CG2  . THR A 1 77  ? 14.284  6.946   6.362   1.00 0.00 ? 77  THR A CG2  7  
ATOM 9738  H H    . THR A 1 77  ? 11.623  6.117   6.613   1.00 0.00 ? 77  THR A H    7  
ATOM 9739  H HA   . THR A 1 77  ? 12.578  4.992   4.063   1.00 0.00 ? 77  THR A HA   7  
ATOM 9740  H HB   . THR A 1 77  ? 13.083  7.442   4.622   1.00 0.00 ? 77  THR A HB   7  
ATOM 9741  H HG1  . THR A 1 77  ? 14.952  6.941   3.527   1.00 0.00 ? 77  THR A HG1  7  
ATOM 9742  H HG21 . THR A 1 77  ? 15.280  6.506   6.421   1.00 0.00 ? 77  THR A HG21 7  
ATOM 9743  H HG22 . THR A 1 77  ? 14.359  8.029   6.462   1.00 0.00 ? 77  THR A HG22 7  
ATOM 9744  H HG23 . THR A 1 77  ? 13.664  6.549   7.166   1.00 0.00 ? 77  THR A HG23 7  
ATOM 9745  N N    . GLY A 1 78  ? 13.025  3.967   7.044   1.00 0.00 ? 78  GLY A N    7  
ATOM 9746  C CA   . GLY A 1 78  ? 13.573  2.899   7.862   1.00 0.00 ? 78  GLY A CA   7  
ATOM 9747  C C    . GLY A 1 78  ? 12.637  1.689   7.883   1.00 0.00 ? 78  GLY A C    7  
ATOM 9748  O O    . GLY A 1 78  ? 12.936  0.657   7.283   1.00 0.00 ? 78  GLY A O    7  
ATOM 9749  H H    . GLY A 1 78  ? 12.308  4.510   7.482   1.00 0.00 ? 78  GLY A H    7  
ATOM 9750  H HA2  . GLY A 1 78  ? 14.548  2.603   7.473   1.00 0.00 ? 78  GLY A HA2  7  
ATOM 9751  H HA3  . GLY A 1 78  ? 13.732  3.259   8.878   1.00 0.00 ? 78  GLY A HA3  7  
ATOM 9752  N N    . SER A 1 79  ? 11.523  1.855   8.581   1.00 0.00 ? 79  SER A N    7  
ATOM 9753  C CA   . SER A 1 79  ? 10.542  0.789   8.689   1.00 0.00 ? 79  SER A CA   7  
ATOM 9754  C C    . SER A 1 79  ? 9.142   1.335   8.397   1.00 0.00 ? 79  SER A C    7  
ATOM 9755  O O    . SER A 1 79  ? 8.927   2.546   8.422   1.00 0.00 ? 79  SER A O    7  
ATOM 9756  C CB   . SER A 1 79  ? 10.580  0.143   10.075  1.00 0.00 ? 79  SER A CB   7  
ATOM 9757  O OG   . SER A 1 79  ? 10.812  1.101   11.104  1.00 0.00 ? 79  SER A OG   7  
ATOM 9758  H H    . SER A 1 79  ? 11.288  2.697   9.066   1.00 0.00 ? 79  SER A H    7  
ATOM 9759  H HA   . SER A 1 79  ? 10.830  0.054   7.938   1.00 0.00 ? 79  SER A HA   7  
ATOM 9760  H HB2  . SER A 1 79  ? 9.637   -0.370  10.262  1.00 0.00 ? 79  SER A HB2  7  
ATOM 9761  H HB3  . SER A 1 79  ? 11.365  -0.613  10.101  1.00 0.00 ? 79  SER A HB3  7  
ATOM 9762  H HG   . SER A 1 79  ? 11.743  1.459   11.036  1.00 0.00 ? 79  SER A HG   7  
ATOM 9763  N N    . LEU A 1 80  ? 8.228   0.415   8.126   1.00 0.00 ? 80  LEU A N    7  
ATOM 9764  C CA   . LEU A 1 80  ? 6.855   0.789   7.830   1.00 0.00 ? 80  LEU A CA   7  
ATOM 9765  C C    . LEU A 1 80  ? 5.929   0.198   8.894   1.00 0.00 ? 80  LEU A C    7  
ATOM 9766  O O    . LEU A 1 80  ? 5.864   -1.019  9.059   1.00 0.00 ? 80  LEU A O    7  
ATOM 9767  C CB   . LEU A 1 80  ? 6.487   0.385   6.401   1.00 0.00 ? 80  LEU A CB   7  
ATOM 9768  C CG   . LEU A 1 80  ? 5.332   1.160   5.762   1.00 0.00 ? 80  LEU A CG   7  
ATOM 9769  C CD1  . LEU A 1 80  ? 5.607   2.665   5.776   1.00 0.00 ? 80  LEU A CD1  7  
ATOM 9770  C CD2  . LEU A 1 80  ? 5.041   0.644   4.351   1.00 0.00 ? 80  LEU A CD2  7  
ATOM 9771  H H    . LEU A 1 80  ? 8.411   -0.568  8.108   1.00 0.00 ? 80  LEU A H    7  
ATOM 9772  H HA   . LEU A 1 80  ? 6.794   1.876   7.884   1.00 0.00 ? 80  LEU A HA   7  
ATOM 9773  H HB2  . LEU A 1 80  ? 7.370   0.503   5.772   1.00 0.00 ? 80  LEU A HB2  7  
ATOM 9774  H HB3  . LEU A 1 80  ? 6.233   -0.675  6.398   1.00 0.00 ? 80  LEU A HB3  7  
ATOM 9775  H HG   . LEU A 1 80  ? 4.436   0.990   6.358   1.00 0.00 ? 80  LEU A HG   7  
ATOM 9776  H HD11 . LEU A 1 80  ? 4.948   3.147   6.498   1.00 0.00 ? 80  LEU A HD11 7  
ATOM 9777  H HD12 . LEU A 1 80  ? 6.645   2.842   6.058   1.00 0.00 ? 80  LEU A HD12 7  
ATOM 9778  H HD13 . LEU A 1 80  ? 5.424   3.077   4.784   1.00 0.00 ? 80  LEU A HD13 7  
ATOM 9779  H HD21 . LEU A 1 80  ? 4.029   0.928   4.062   1.00 0.00 ? 80  LEU A HD21 7  
ATOM 9780  H HD22 . LEU A 1 80  ? 5.754   1.079   3.650   1.00 0.00 ? 80  LEU A HD22 7  
ATOM 9781  H HD23 . LEU A 1 80  ? 5.133   -0.442  4.335   1.00 0.00 ? 80  LEU A HD23 7  
ATOM 9782  N N    . ASN A 1 81  ? 5.235   1.087   9.589   1.00 0.00 ? 81  ASN A N    7  
ATOM 9783  C CA   . ASN A 1 81  ? 4.315   0.668   10.633  1.00 0.00 ? 81  ASN A CA   7  
ATOM 9784  C C    . ASN A 1 81  ? 2.885   1.022   10.218  1.00 0.00 ? 81  ASN A C    7  
ATOM 9785  O O    . ASN A 1 81  ? 2.490   2.185   10.269  1.00 0.00 ? 81  ASN A O    7  
ATOM 9786  C CB   . ASN A 1 81  ? 4.615   1.384   11.951  1.00 0.00 ? 81  ASN A CB   7  
ATOM 9787  C CG   . ASN A 1 81  ? 5.375   0.467   12.913  1.00 0.00 ? 81  ASN A CG   7  
ATOM 9788  O OD1  . ASN A 1 81  ? 4.839   -0.032  13.888  1.00 0.00 ? 81  ASN A OD1  7  
ATOM 9789  N ND2  . ASN A 1 81  ? 6.649   0.275   12.584  1.00 0.00 ? 81  ASN A ND2  7  
ATOM 9790  H H    . ASN A 1 81  ? 5.293   2.076   9.449   1.00 0.00 ? 81  ASN A H    7  
ATOM 9791  H HA   . ASN A 1 81  ? 4.467   -0.406  10.734  1.00 0.00 ? 81  ASN A HA   7  
ATOM 9792  H HB2  . ASN A 1 81  ? 5.204   2.281   11.757  1.00 0.00 ? 81  ASN A HB2  7  
ATOM 9793  H HB3  . ASN A 1 81  ? 3.683   1.709   12.413  1.00 0.00 ? 81  ASN A HB3  7  
ATOM 9794  H HD21 . ASN A 1 81  ? 7.027   0.716   11.769  1.00 0.00 ? 81  ASN A HD21 7  
ATOM 9795  H HD22 . ASN A 1 81  ? 7.229   -0.309  13.151  1.00 0.00 ? 81  ASN A HD22 7  
ATOM 9796  N N    . MET A 1 82  ? 2.149   -0.004  9.818   1.00 0.00 ? 82  MET A N    7  
ATOM 9797  C CA   . MET A 1 82  ? 0.771   0.183   9.395   1.00 0.00 ? 82  MET A CA   7  
ATOM 9798  C C    . MET A 1 82  ? -0.123  -0.940  9.925   1.00 0.00 ? 82  MET A C    7  
ATOM 9799  O O    . MET A 1 82  ? 0.365   -2.014  10.273  1.00 0.00 ? 82  MET A O    7  
ATOM 9800  C CB   . MET A 1 82  ? 0.706   0.209   7.866   1.00 0.00 ? 82  MET A CB   7  
ATOM 9801  C CG   . MET A 1 82  ? 1.821   1.080   7.284   1.00 0.00 ? 82  MET A CG   7  
ATOM 9802  S SD   . MET A 1 82  ? 1.702   1.115   5.504   1.00 0.00 ? 82  MET A SD   7  
ATOM 9803  C CE   . MET A 1 82  ? 1.958   -0.613  5.141   1.00 0.00 ? 82  MET A CE   7  
ATOM 9804  H H    . MET A 1 82  ? 2.478   -0.948  9.779   1.00 0.00 ? 82  MET A H    7  
ATOM 9805  H HA   . MET A 1 82  ? 0.461   1.137   9.822   1.00 0.00 ? 82  MET A HA   7  
ATOM 9806  H HB2  . MET A 1 82  ? 0.792   -0.806  7.478   1.00 0.00 ? 82  MET A HB2  7  
ATOM 9807  H HB3  . MET A 1 82  ? -0.264  0.592   7.547   1.00 0.00 ? 82  MET A HB3  7  
ATOM 9808  H HG2  . MET A 1 82  ? 1.749   2.092   7.682   1.00 0.00 ? 82  MET A HG2  7  
ATOM 9809  H HG3  . MET A 1 82  ? 2.793   0.688   7.584   1.00 0.00 ? 82  MET A HG3  7  
ATOM 9810  H HE1  . MET A 1 82  ? 2.794   -0.720  4.450   1.00 0.00 ? 82  MET A HE1  7  
ATOM 9811  H HE2  . MET A 1 82  ? 2.179   -1.150  6.064   1.00 0.00 ? 82  MET A HE2  7  
ATOM 9812  H HE3  . MET A 1 82  ? 1.057   -1.027  4.688   1.00 0.00 ? 82  MET A HE3  7  
ATOM 9813  N N    . THR A 1 83  ? -1.415  -0.652  9.970   1.00 0.00 ? 83  THR A N    7  
ATOM 9814  C CA   . THR A 1 83  ? -2.382  -1.624  10.453  1.00 0.00 ? 83  THR A CA   7  
ATOM 9815  C C    . THR A 1 83  ? -3.202  -2.183  9.288   1.00 0.00 ? 83  THR A C    7  
ATOM 9816  O O    . THR A 1 83  ? -3.457  -1.482  8.311   1.00 0.00 ? 83  THR A O    7  
ATOM 9817  C CB   . THR A 1 83  ? -3.235  -0.948  11.528  1.00 0.00 ? 83  THR A CB   7  
ATOM 9818  O OG1  . THR A 1 83  ? -2.295  -0.210  12.304  1.00 0.00 ? 83  THR A OG1  7  
ATOM 9819  C CG2  . THR A 1 83  ? -3.831  -1.951  12.518  1.00 0.00 ? 83  THR A CG2  7  
ATOM 9820  H H    . THR A 1 83  ? -1.803  0.224   9.685   1.00 0.00 ? 83  THR A H    7  
ATOM 9821  H HA   . THR A 1 83  ? -1.838  -2.460  10.892  1.00 0.00 ? 83  THR A HA   7  
ATOM 9822  H HB   . THR A 1 83  ? -4.016  -0.336  11.077  1.00 0.00 ? 83  THR A HB   7  
ATOM 9823  H HG1  . THR A 1 83  ? -1.765  0.397   11.713  1.00 0.00 ? 83  THR A HG1  7  
ATOM 9824  H HG21 . THR A 1 83  ? -4.669  -2.468  12.052  1.00 0.00 ? 83  THR A HG21 7  
ATOM 9825  H HG22 . THR A 1 83  ? -3.069  -2.677  12.802  1.00 0.00 ? 83  THR A HG22 7  
ATOM 9826  H HG23 . THR A 1 83  ? -4.178  -1.422  13.406  1.00 0.00 ? 83  THR A HG23 7  
ATOM 9827  N N    . LEU A 1 84  ? -3.592  -3.441  9.432   1.00 0.00 ? 84  LEU A N    7  
ATOM 9828  C CA   . LEU A 1 84  ? -4.378  -4.103  8.404   1.00 0.00 ? 84  LEU A CA   7  
ATOM 9829  C C    . LEU A 1 84  ? -5.762  -4.438  8.964   1.00 0.00 ? 84  LEU A C    7  
ATOM 9830  O O    . LEU A 1 84  ? -5.964  -4.428  10.177  1.00 0.00 ? 84  LEU A O    7  
ATOM 9831  C CB   . LEU A 1 84  ? -3.627  -5.317  7.854   1.00 0.00 ? 84  LEU A CB   7  
ATOM 9832  C CG   . LEU A 1 84  ? -2.195  -5.061  7.379   1.00 0.00 ? 84  LEU A CG   7  
ATOM 9833  C CD1  . LEU A 1 84  ? -1.592  -6.320  6.754   1.00 0.00 ? 84  LEU A CD1  7  
ATOM 9834  C CD2  . LEU A 1 84  ? -2.139  -3.865  6.426   1.00 0.00 ? 84  LEU A CD2  7  
ATOM 9835  H H    . LEU A 1 84  ? -3.380  -4.005  10.230  1.00 0.00 ? 84  LEU A H    7  
ATOM 9836  H HA   . LEU A 1 84  ? -4.499  -3.398  7.581   1.00 0.00 ? 84  LEU A HA   7  
ATOM 9837  H HB2  . LEU A 1 84  ? -3.600  -6.084  8.628   1.00 0.00 ? 84  LEU A HB2  7  
ATOM 9838  H HB3  . LEU A 1 84  ? -4.198  -5.725  7.020   1.00 0.00 ? 84  LEU A HB3  7  
ATOM 9839  H HG   . LEU A 1 84  ? -1.587  -4.809  8.247   1.00 0.00 ? 84  LEU A HG   7  
ATOM 9840  H HD11 . LEU A 1 84  ? -1.325  -7.025  7.542   1.00 0.00 ? 84  LEU A HD11 7  
ATOM 9841  H HD12 . LEU A 1 84  ? -2.321  -6.780  6.087   1.00 0.00 ? 84  LEU A HD12 7  
ATOM 9842  H HD13 . LEU A 1 84  ? -0.699  -6.053  6.188   1.00 0.00 ? 84  LEU A HD13 7  
ATOM 9843  H HD21 . LEU A 1 84  ? -2.939  -3.949  5.690   1.00 0.00 ? 84  LEU A HD21 7  
ATOM 9844  H HD22 . LEU A 1 84  ? -2.263  -2.943  6.993   1.00 0.00 ? 84  LEU A HD22 7  
ATOM 9845  H HD23 . LEU A 1 84  ? -1.176  -3.852  5.916   1.00 0.00 ? 84  LEU A HD23 7  
ATOM 9846  N N    . GLN A 1 85  ? -6.679  -4.727  8.053   1.00 0.00 ? 85  GLN A N    7  
ATOM 9847  C CA   . GLN A 1 85  ? -8.039  -5.064  8.440   1.00 0.00 ? 85  GLN A CA   7  
ATOM 9848  C C    . GLN A 1 85  ? -8.326  -6.536  8.139   1.00 0.00 ? 85  GLN A C    7  
ATOM 9849  O O    . GLN A 1 85  ? -8.181  -6.981  7.002   1.00 0.00 ? 85  GLN A O    7  
ATOM 9850  C CB   . GLN A 1 85  ? -9.050  -4.154  7.740   1.00 0.00 ? 85  GLN A CB   7  
ATOM 9851  C CG   . GLN A 1 85  ? -10.464 -4.730  7.836   1.00 0.00 ? 85  GLN A CG   7  
ATOM 9852  C CD   . GLN A 1 85  ? -11.480 -3.806  7.160   1.00 0.00 ? 85  GLN A CD   7  
ATOM 9853  O OE1  . GLN A 1 85  ? -11.712 -2.684  7.579   1.00 0.00 ? 85  GLN A OE1  7  
ATOM 9854  N NE2  . GLN A 1 85  ? -12.069 -4.339  6.094   1.00 0.00 ? 85  GLN A NE2  7  
ATOM 9855  H H    . GLN A 1 85  ? -6.507  -4.733  7.068   1.00 0.00 ? 85  GLN A H    7  
ATOM 9856  H HA   . GLN A 1 85  ? -8.085  -4.890  9.515   1.00 0.00 ? 85  GLN A HA   7  
ATOM 9857  H HB2  . GLN A 1 85  ? -9.026  -3.162  8.192   1.00 0.00 ? 85  GLN A HB2  7  
ATOM 9858  H HB3  . GLN A 1 85  ? -8.773  -4.034  6.693   1.00 0.00 ? 85  GLN A HB3  7  
ATOM 9859  H HG2  . GLN A 1 85  ? -10.493 -5.713  7.367   1.00 0.00 ? 85  GLN A HG2  7  
ATOM 9860  H HG3  . GLN A 1 85  ? -10.734 -4.868  8.883   1.00 0.00 ? 85  GLN A HG3  7  
ATOM 9861  H HE21 . GLN A 1 85  ? -11.833 -5.266  5.803   1.00 0.00 ? 85  GLN A HE21 7  
ATOM 9862  H HE22 . GLN A 1 85  ? -12.749 -3.812  5.583   1.00 0.00 ? 85  GLN A HE22 7  
ATOM 9863  N N    . ARG A 1 86  ? -8.729  -7.252  9.179   1.00 0.00 ? 86  ARG A N    7  
ATOM 9864  C CA   . ARG A 1 86  ? -9.039  -8.665  9.040   1.00 0.00 ? 86  ARG A CA   7  
ATOM 9865  C C    . ARG A 1 86  ? -10.439 -8.846  8.451   1.00 0.00 ? 86  ARG A C    7  
ATOM 9866  O O    . ARG A 1 86  ? -11.426 -8.412  9.042   1.00 0.00 ? 86  ARG A O    7  
ATOM 9867  C CB   . ARG A 1 86  ? -8.965  -9.380  10.391  1.00 0.00 ? 86  ARG A CB   7  
ATOM 9868  C CG   . ARG A 1 86  ? -7.524  -9.773  10.725  1.00 0.00 ? 86  ARG A CG   7  
ATOM 9869  C CD   . ARG A 1 86  ? -6.594  -8.560  10.652  1.00 0.00 ? 86  ARG A CD   7  
ATOM 9870  N NE   . ARG A 1 86  ? -5.202  -8.972  10.940  1.00 0.00 ? 86  ARG A NE   7  
ATOM 9871  C CZ   . ARG A 1 86  ? -4.376  -9.512  10.033  1.00 0.00 ? 86  ARG A CZ   7  
ATOM 9872  N NH1  . ARG A 1 86  ? -4.796  -9.707  8.776   1.00 0.00 ? 86  ARG A NH1  7  
ATOM 9873  N NH2  . ARG A 1 86  ? -3.129  -9.855  10.384  1.00 0.00 ? 86  ARG A NH2  7  
ATOM 9874  H H    . ARG A 1 86  ? -8.845  -6.882  10.101  1.00 0.00 ? 86  ARG A H    7  
ATOM 9875  H HA   . ARG A 1 86  ? -8.276  -9.052  8.365   1.00 0.00 ? 86  ARG A HA   7  
ATOM 9876  H HB2  . ARG A 1 86  ? -9.359  -8.730  11.172  1.00 0.00 ? 86  ARG A HB2  7  
ATOM 9877  H HB3  . ARG A 1 86  ? -9.593  -10.270 10.370  1.00 0.00 ? 86  ARG A HB3  7  
ATOM 9878  H HG2  . ARG A 1 86  ? -7.484  -10.207 11.724  1.00 0.00 ? 86  ARG A HG2  7  
ATOM 9879  H HG3  . ARG A 1 86  ? -7.183  -10.540 10.031  1.00 0.00 ? 86  ARG A HG3  7  
ATOM 9880  H HD2  . ARG A 1 86  ? -6.651  -8.107  9.663   1.00 0.00 ? 86  ARG A HD2  7  
ATOM 9881  H HD3  . ARG A 1 86  ? -6.913  -7.803  11.368  1.00 0.00 ? 86  ARG A HD3  7  
ATOM 9882  H HE   . ARG A 1 86  ? -4.857  -8.840  11.869  1.00 0.00 ? 86  ARG A HE   7  
ATOM 9883  H HH11 . ARG A 1 86  ? -5.726  -9.451  8.514   1.00 0.00 ? 86  ARG A HH11 7  
ATOM 9884  H HH12 . ARG A 1 86  ? -4.179  -10.110 8.100   1.00 0.00 ? 86  ARG A HH12 7  
ATOM 9885  H HH21 . ARG A 1 86  ? -2.815  -9.709  11.322  1.00 0.00 ? 86  ARG A HH21 7  
ATOM 9886  H HH22 . ARG A 1 86  ? -2.512  -10.258 9.708   1.00 0.00 ? 86  ARG A HH22 7  
ATOM 9887  N N    . ALA A 1 87  ? -10.480 -9.489  7.293   1.00 0.00 ? 87  ALA A N    7  
ATOM 9888  C CA   . ALA A 1 87  ? -11.743 -9.733  6.617   1.00 0.00 ? 87  ALA A CA   7  
ATOM 9889  C C    . ALA A 1 87  ? -12.214 -11.156 6.925   1.00 0.00 ? 87  ALA A C    7  
ATOM 9890  O O    . ALA A 1 87  ? -12.111 -12.044 6.080   1.00 0.00 ? 87  ALA A O    7  
ATOM 9891  C CB   . ALA A 1 87  ? -11.575 -9.486  5.116   1.00 0.00 ? 87  ALA A CB   7  
ATOM 9892  H H    . ALA A 1 87  ? -9.672  -9.839  6.819   1.00 0.00 ? 87  ALA A H    7  
ATOM 9893  H HA   . ALA A 1 87  ? -12.472 -9.025  7.010   1.00 0.00 ? 87  ALA A HA   7  
ATOM 9894  H HB1  . ALA A 1 87  ? -10.610 -9.875  4.790   1.00 0.00 ? 87  ALA A HB1  7  
ATOM 9895  H HB2  . ALA A 1 87  ? -12.373 -9.993  4.573   1.00 0.00 ? 87  ALA A HB2  7  
ATOM 9896  H HB3  . ALA A 1 87  ? -11.622 -8.416  4.917   1.00 0.00 ? 87  ALA A HB3  7  
ATOM 9897  N N    . SER A 1 88  ? -12.721 -11.328 8.137   1.00 0.00 ? 88  SER A N    7  
ATOM 9898  C CA   . SER A 1 88  ? -13.209 -12.627 8.566   1.00 0.00 ? 88  SER A CA   7  
ATOM 9899  C C    . SER A 1 88  ? -14.712 -12.735 8.304   1.00 0.00 ? 88  SER A C    7  
ATOM 9900  O O    . SER A 1 88  ? -15.364 -11.740 7.992   1.00 0.00 ? 88  SER A O    7  
ATOM 9901  C CB   . SER A 1 88  ? -12.910 -12.866 10.048  1.00 0.00 ? 88  SER A CB   7  
ATOM 9902  O OG   . SER A 1 88  ? -13.616 -11.956 10.888  1.00 0.00 ? 88  SER A OG   7  
ATOM 9903  H H    . SER A 1 88  ? -12.801 -10.600 8.818   1.00 0.00 ? 88  SER A H    7  
ATOM 9904  H HA   . SER A 1 88  ? -12.662 -13.354 7.965   1.00 0.00 ? 88  SER A HA   7  
ATOM 9905  H HB2  . SER A 1 88  ? -13.180 -13.888 10.312  1.00 0.00 ? 88  SER A HB2  7  
ATOM 9906  H HB3  . SER A 1 88  ? -11.839 -12.764 10.223  1.00 0.00 ? 88  SER A HB3  7  
ATOM 9907  H HG   . SER A 1 88  ? -14.360 -12.431 11.357  1.00 0.00 ? 88  SER A HG   7  
ATOM 9908  N N    . ALA A 1 89  ? -15.218 -13.952 8.440   1.00 0.00 ? 89  ALA A N    7  
ATOM 9909  C CA   . ALA A 1 89  ? -16.633 -14.203 8.222   1.00 0.00 ? 89  ALA A CA   7  
ATOM 9910  C C    . ALA A 1 89  ? -16.974 -13.931 6.755   1.00 0.00 ? 89  ALA A C    7  
ATOM 9911  O O    . ALA A 1 89  ? -16.116 -13.507 5.983   1.00 0.00 ? 89  ALA A O    7  
ATOM 9912  C CB   . ALA A 1 89  ? -17.458 -13.343 9.181   1.00 0.00 ? 89  ALA A CB   7  
ATOM 9913  H H    . ALA A 1 89  ? -14.681 -14.756 8.694   1.00 0.00 ? 89  ALA A H    7  
ATOM 9914  H HA   . ALA A 1 89  ? -16.821 -15.254 8.441   1.00 0.00 ? 89  ALA A HA   7  
ATOM 9915  H HB1  . ALA A 1 89  ? -16.887 -12.457 9.458   1.00 0.00 ? 89  ALA A HB1  7  
ATOM 9916  H HB2  . ALA A 1 89  ? -18.384 -13.040 8.693   1.00 0.00 ? 89  ALA A HB2  7  
ATOM 9917  H HB3  . ALA A 1 89  ? -17.691 -13.919 10.076  1.00 0.00 ? 89  ALA A HB3  7  
ATOM 9918  N N    . ALA A 1 90  ? -18.229 -14.188 6.415   1.00 0.00 ? 90  ALA A N    7  
ATOM 9919  C CA   . ALA A 1 90  ? -18.694 -13.976 5.055   1.00 0.00 ? 90  ALA A CA   7  
ATOM 9920  C C    . ALA A 1 90  ? -17.842 -14.808 4.094   1.00 0.00 ? 90  ALA A C    7  
ATOM 9921  O O    . ALA A 1 90  ? -17.121 -14.259 3.263   1.00 0.00 ? 90  ALA A O    7  
ATOM 9922  C CB   . ALA A 1 90  ? -18.651 -12.483 4.727   1.00 0.00 ? 90  ALA A CB   7  
ATOM 9923  H H    . ALA A 1 90  ? -18.920 -14.533 7.050   1.00 0.00 ? 90  ALA A H    7  
ATOM 9924  H HA   . ALA A 1 90  ? -19.727 -14.319 5.001   1.00 0.00 ? 90  ALA A HA   7  
ATOM 9925  H HB1  . ALA A 1 90  ? -19.655 -12.065 4.806   1.00 0.00 ? 90  ALA A HB1  7  
ATOM 9926  H HB2  . ALA A 1 90  ? -17.991 -11.975 5.430   1.00 0.00 ? 90  ALA A HB2  7  
ATOM 9927  H HB3  . ALA A 1 90  ? -18.279 -12.344 3.713   1.00 0.00 ? 90  ALA A HB3  7  
ATOM 9928  N N    . ALA A 1 91  ? -17.953 -16.121 4.240   1.00 0.00 ? 91  ALA A N    7  
ATOM 9929  C CA   . ALA A 1 91  ? -17.202 -17.034 3.396   1.00 0.00 ? 91  ALA A CA   7  
ATOM 9930  C C    . ALA A 1 91  ? -18.156 -18.072 2.801   1.00 0.00 ? 91  ALA A C    7  
ATOM 9931  O O    . ALA A 1 91  ? -18.635 -18.957 3.508   1.00 0.00 ? 91  ALA A O    7  
ATOM 9932  C CB   . ALA A 1 91  ? -16.077 -17.675 4.211   1.00 0.00 ? 91  ALA A CB   7  
ATOM 9933  H H    . ALA A 1 91  ? -18.542 -16.560 4.919   1.00 0.00 ? 91  ALA A H    7  
ATOM 9934  H HA   . ALA A 1 91  ? -16.762 -16.451 2.587   1.00 0.00 ? 91  ALA A HA   7  
ATOM 9935  H HB1  . ALA A 1 91  ? -15.927 -18.702 3.877   1.00 0.00 ? 91  ALA A HB1  7  
ATOM 9936  H HB2  . ALA A 1 91  ? -15.157 -17.108 4.069   1.00 0.00 ? 91  ALA A HB2  7  
ATOM 9937  H HB3  . ALA A 1 91  ? -16.347 -17.672 5.267   1.00 0.00 ? 91  ALA A HB3  7  
ATOM 9938  N N    . LYS A 1 92  ? -18.403 -17.929 1.507   1.00 0.00 ? 92  LYS A N    7  
ATOM 9939  C CA   . LYS A 1 92  ? -19.290 -18.844 0.809   1.00 0.00 ? 92  LYS A CA   7  
ATOM 9940  C C    . LYS A 1 92  ? -18.617 -20.212 0.694   1.00 0.00 ? 92  LYS A C    7  
ATOM 9941  O O    . LYS A 1 92  ? -17.638 -20.367 -0.035  1.00 0.00 ? 92  LYS A O    7  
ATOM 9942  C CB   . LYS A 1 92  ? -19.718 -18.253 -0.536  1.00 0.00 ? 92  LYS A CB   7  
ATOM 9943  C CG   . LYS A 1 92  ? -20.864 -17.256 -0.358  1.00 0.00 ? 92  LYS A CG   7  
ATOM 9944  C CD   . LYS A 1 92  ? -20.353 -15.926 0.198   1.00 0.00 ? 92  LYS A CD   7  
ATOM 9945  C CE   . LYS A 1 92  ? -20.963 -14.744 -0.558  1.00 0.00 ? 92  LYS A CE   7  
ATOM 9946  N NZ   . LYS A 1 92  ? -20.300 -13.480 -0.167  1.00 0.00 ? 92  LYS A NZ   7  
ATOM 9947  H H    . LYS A 1 92  ? -18.009 -17.206 0.939   1.00 0.00 ? 92  LYS A H    7  
ATOM 9948  H HA   . LYS A 1 92  ? -20.190 -18.951 1.414   1.00 0.00 ? 92  LYS A HA   7  
ATOM 9949  H HB2  . LYS A 1 92  ? -18.869 -17.756 -1.006  1.00 0.00 ? 92  LYS A HB2  7  
ATOM 9950  H HB3  . LYS A 1 92  ? -20.028 -19.054 -1.207  1.00 0.00 ? 92  LYS A HB3  7  
ATOM 9951  H HG2  . LYS A 1 92  ? -21.357 -17.088 -1.316  1.00 0.00 ? 92  LYS A HG2  7  
ATOM 9952  H HG3  . LYS A 1 92  ? -21.612 -17.673 0.316   1.00 0.00 ? 92  LYS A HG3  7  
ATOM 9953  H HD2  . LYS A 1 92  ? -20.601 -15.851 1.257   1.00 0.00 ? 92  LYS A HD2  7  
ATOM 9954  H HD3  . LYS A 1 92  ? -19.267 -15.889 0.122   1.00 0.00 ? 92  LYS A HD3  7  
ATOM 9955  H HE2  . LYS A 1 92  ? -20.859 -14.899 -1.632  1.00 0.00 ? 92  LYS A HE2  7  
ATOM 9956  H HE3  . LYS A 1 92  ? -22.031 -14.682 -0.347  1.00 0.00 ? 92  LYS A HE3  7  
ATOM 9957  H HZ1  . LYS A 1 92  ? -19.461 -13.365 -0.699  1.00 0.00 ? 92  LYS A HZ1  7  
ATOM 9958  H HZ2  . LYS A 1 92  ? -20.915 -12.712 -0.344  1.00 0.00 ? 92  LYS A HZ2  7  
ATOM 9959  H HZ3  . LYS A 1 92  ? -20.076 -13.509 0.807   1.00 0.00 ? 92  LYS A HZ3  7  
ATOM 9960  N N    . SER A 1 93  ? -19.169 -21.171 1.423   1.00 0.00 ? 93  SER A N    7  
ATOM 9961  C CA   . SER A 1 93  ? -18.634 -22.522 1.412   1.00 0.00 ? 93  SER A CA   7  
ATOM 9962  C C    . SER A 1 93  ? -19.592 -23.458 0.674   1.00 0.00 ? 93  SER A C    7  
ATOM 9963  O O    . SER A 1 93  ? -20.781 -23.165 0.552   1.00 0.00 ? 93  SER A O    7  
ATOM 9964  C CB   . SER A 1 93  ? -18.387 -23.029 2.834   1.00 0.00 ? 93  SER A CB   7  
ATOM 9965  O OG   . SER A 1 93  ? -17.496 -22.182 3.556   1.00 0.00 ? 93  SER A OG   7  
ATOM 9966  H H    . SER A 1 93  ? -19.965 -21.037 2.013   1.00 0.00 ? 93  SER A H    7  
ATOM 9967  H HA   . SER A 1 93  ? -17.684 -22.452 0.882   1.00 0.00 ? 93  SER A HA   7  
ATOM 9968  H HB2  . SER A 1 93  ? -19.336 -23.093 3.366   1.00 0.00 ? 93  SER A HB2  7  
ATOM 9969  H HB3  . SER A 1 93  ? -17.976 -24.037 2.794   1.00 0.00 ? 93  SER A HB3  7  
ATOM 9970  H HG   . SER A 1 93  ? -17.500 -22.428 4.525   1.00 0.00 ? 93  SER A HG   7  
ATOM 9971  N N    . GLU A 1 94  ? -19.040 -24.566 0.201   1.00 0.00 ? 94  GLU A N    7  
ATOM 9972  C CA   . GLU A 1 94  ? -19.831 -25.547 -0.522  1.00 0.00 ? 94  GLU A CA   7  
ATOM 9973  C C    . GLU A 1 94  ? -20.083 -26.776 0.354   1.00 0.00 ? 94  GLU A C    7  
ATOM 9974  O O    . GLU A 1 94  ? -19.140 -27.428 0.800   1.00 0.00 ? 94  GLU A O    7  
ATOM 9975  C CB   . GLU A 1 94  ? -19.151 -25.940 -1.835  1.00 0.00 ? 94  GLU A CB   7  
ATOM 9976  C CG   . GLU A 1 94  ? -19.084 -24.750 -2.795  1.00 0.00 ? 94  GLU A CG   7  
ATOM 9977  C CD   . GLU A 1 94  ? -19.194 -25.213 -4.250  1.00 0.00 ? 94  GLU A CD   7  
ATOM 9978  O OE1  . GLU A 1 94  ? -19.972 -26.162 -4.486  1.00 0.00 ? 94  GLU A OE1  7  
ATOM 9979  O OE2  . GLU A 1 94  ? -18.497 -24.607 -5.092  1.00 0.00 ? 94  GLU A OE2  7  
ATOM 9980  H H    . GLU A 1 94  ? -18.072 -24.797 0.304   1.00 0.00 ? 94  GLU A H    7  
ATOM 9981  H HA   . GLU A 1 94  ? -20.776 -25.051 -0.744  1.00 0.00 ? 94  GLU A HA   7  
ATOM 9982  H HB2  . GLU A 1 94  ? -18.144 -26.305 -1.633  1.00 0.00 ? 94  GLU A HB2  7  
ATOM 9983  H HB3  . GLU A 1 94  ? -19.699 -26.758 -2.302  1.00 0.00 ? 94  GLU A HB3  7  
ATOM 9984  H HG2  . GLU A 1 94  ? -19.889 -24.051 -2.571  1.00 0.00 ? 94  GLU A HG2  7  
ATOM 9985  H HG3  . GLU A 1 94  ? -18.146 -24.214 -2.651  1.00 0.00 ? 94  GLU A HG3  7  
ATOM 9986  N N    . PRO A 1 95  ? -21.393 -27.062 0.580   1.00 0.00 ? 95  PRO A N    7  
ATOM 9987  C CA   . PRO A 1 95  ? -21.781 -28.201 1.394   1.00 0.00 ? 95  PRO A CA   7  
ATOM 9988  C C    . PRO A 1 95  ? -21.590 -29.512 0.630   1.00 0.00 ? 95  PRO A C    7  
ATOM 9989  O O    . PRO A 1 95  ? -21.229 -29.502 -0.546  1.00 0.00 ? 95  PRO A O    7  
ATOM 9990  C CB   . PRO A 1 95  ? -23.229 -27.939 1.773   1.00 0.00 ? 95  PRO A CB   7  
ATOM 9991  C CG   . PRO A 1 95  ? -23.739 -26.906 0.781   1.00 0.00 ? 95  PRO A CG   7  
ATOM 9992  C CD   . PRO A 1 95  ? -22.536 -26.312 0.067   1.00 0.00 ? 95  PRO A CD   7  
ATOM 9993  H HA   . PRO A 1 95  ? -21.193 -28.267 2.201   1.00 0.00 ? 95  PRO A HA   7  
ATOM 9994  H HB2  . PRO A 1 95  ? -23.818 -28.855 1.721   1.00 0.00 ? 95  PRO A HB2  7  
ATOM 9995  H HB3  . PRO A 1 95  ? -23.305 -27.569 2.795   1.00 0.00 ? 95  PRO A HB3  7  
ATOM 9996  H HG2  . PRO A 1 95  ? -24.418 -27.368 0.064   1.00 0.00 ? 95  PRO A HG2  7  
ATOM 9997  H HG3  . PRO A 1 95  ? -24.301 -26.127 1.296   1.00 0.00 ? 95  PRO A HG3  7  
ATOM 9998  H HD2  . PRO A 1 95  ? -22.625 -26.416 -1.014  1.00 0.00 ? 95  PRO A HD2  7  
ATOM 9999  H HD3  . PRO A 1 95  ? -22.437 -25.247 0.277   1.00 0.00 ? 95  PRO A HD3  7  
ATOM 10000 N N    . VAL A 1 96  ? -21.841 -30.610 1.329   1.00 0.00 ? 96  VAL A N    7  
ATOM 10001 C CA   . VAL A 1 96  ? -21.701 -31.926 0.730   1.00 0.00 ? 96  VAL A CA   7  
ATOM 10002 C C    . VAL A 1 96  ? -23.084 -32.567 0.589   1.00 0.00 ? 96  VAL A C    7  
ATOM 10003 O O    . VAL A 1 96  ? -23.950 -32.376 1.441   1.00 0.00 ? 96  VAL A O    7  
ATOM 10004 C CB   . VAL A 1 96  ? -20.730 -32.775 1.554   1.00 0.00 ? 96  VAL A CB   7  
ATOM 10005 C CG1  . VAL A 1 96  ? -20.725 -34.227 1.070   1.00 0.00 ? 96  VAL A CG1  7  
ATOM 10006 C CG2  . VAL A 1 96  ? -19.321 -32.181 1.522   1.00 0.00 ? 96  VAL A CG2  7  
ATOM 10007 H H    . VAL A 1 96  ? -22.134 -30.609 2.285   1.00 0.00 ? 96  VAL A H    7  
ATOM 10008 H HA   . VAL A 1 96  ? -21.273 -31.792 -0.263  1.00 0.00 ? 96  VAL A HA   7  
ATOM 10009 H HB   . VAL A 1 96  ? -21.073 -32.768 2.588   1.00 0.00 ? 96  VAL A HB   7  
ATOM 10010 H HG11 . VAL A 1 96  ? -21.750 -34.554 0.893   1.00 0.00 ? 96  VAL A HG11 7  
ATOM 10011 H HG12 . VAL A 1 96  ? -20.155 -34.299 0.143   1.00 0.00 ? 96  VAL A HG12 7  
ATOM 10012 H HG13 . VAL A 1 96  ? -20.267 -34.861 1.829   1.00 0.00 ? 96  VAL A HG13 7  
ATOM 10013 H HG21 . VAL A 1 96  ? -18.889 -32.324 0.531   1.00 0.00 ? 96  VAL A HG21 7  
ATOM 10014 H HG22 . VAL A 1 96  ? -19.370 -31.116 1.747   1.00 0.00 ? 96  VAL A HG22 7  
ATOM 10015 H HG23 . VAL A 1 96  ? -18.699 -32.681 2.265   1.00 0.00 ? 96  VAL A HG23 7  
ATOM 10016 N N    . SER A 1 97  ? -23.247 -33.313 -0.493  1.00 0.00 ? 97  SER A N    7  
ATOM 10017 C CA   . SER A 1 97  ? -24.509 -33.983 -0.757  1.00 0.00 ? 97  SER A CA   7  
ATOM 10018 C C    . SER A 1 97  ? -24.271 -35.477 -0.986  1.00 0.00 ? 97  SER A C    7  
ATOM 10019 O O    . SER A 1 97  ? -23.545 -35.860 -1.902  1.00 0.00 ? 97  SER A O    7  
ATOM 10020 C CB   . SER A 1 97  ? -25.218 -33.367 -1.965  1.00 0.00 ? 97  SER A CB   7  
ATOM 10021 O OG   . SER A 1 97  ? -24.383 -33.345 -3.119  1.00 0.00 ? 97  SER A OG   7  
ATOM 10022 H H    . SER A 1 97  ? -22.537 -33.463 -1.181  1.00 0.00 ? 97  SER A H    7  
ATOM 10023 H HA   . SER A 1 97  ? -25.112 -33.824 0.137   1.00 0.00 ? 97  SER A HA   7  
ATOM 10024 H HB2  . SER A 1 97  ? -26.123 -33.934 -2.182  1.00 0.00 ? 97  SER A HB2  7  
ATOM 10025 H HB3  . SER A 1 97  ? -25.529 -32.351 -1.723  1.00 0.00 ? 97  SER A HB3  7  
ATOM 10026 H HG   . SER A 1 97  ? -23.953 -34.238 -3.248  1.00 0.00 ? 97  SER A HG   7  
ATOM 10027 N N    . SER A 1 98  ? -24.897 -36.280 -0.138  1.00 0.00 ? 98  SER A N    7  
ATOM 10028 C CA   . SER A 1 98  ? -24.763 -37.723 -0.236  1.00 0.00 ? 98  SER A CA   7  
ATOM 10029 C C    . SER A 1 98  ? -26.016 -38.405 0.318   1.00 0.00 ? 98  SER A C    7  
ATOM 10030 O O    . SER A 1 98  ? -26.618 -37.920 1.274   1.00 0.00 ? 98  SER A O    7  
ATOM 10031 C CB   . SER A 1 98  ? -23.519 -38.213 0.508   1.00 0.00 ? 98  SER A CB   7  
ATOM 10032 O OG   . SER A 1 98  ? -22.338 -38.078 -0.278  1.00 0.00 ? 98  SER A OG   7  
ATOM 10033 H H    . SER A 1 98  ? -25.486 -35.960 0.604   1.00 0.00 ? 98  SER A H    7  
ATOM 10034 H HA   . SER A 1 98  ? -24.653 -37.931 -1.301  1.00 0.00 ? 98  SER A HA   7  
ATOM 10035 H HB2  . SER A 1 98  ? -23.405 -37.648 1.433   1.00 0.00 ? 98  SER A HB2  7  
ATOM 10036 H HB3  . SER A 1 98  ? -23.651 -39.258 0.788   1.00 0.00 ? 98  SER A HB3  7  
ATOM 10037 H HG   . SER A 1 98  ? -21.560 -38.485 0.201   1.00 0.00 ? 98  SER A HG   7  
ATOM 10038 N N    . GLY A 1 99  ? -26.370 -39.518 -0.307  1.00 0.00 ? 99  GLY A N    7  
ATOM 10039 C CA   . GLY A 1 99  ? -27.540 -40.271 0.111   1.00 0.00 ? 99  GLY A CA   7  
ATOM 10040 C C    . GLY A 1 99  ? -28.371 -40.709 -1.096  1.00 0.00 ? 99  GLY A C    7  
ATOM 10041 O O    . GLY A 1 99  ? -28.097 -40.302 -2.224  1.00 0.00 ? 99  GLY A O    7  
ATOM 10042 H H    . GLY A 1 99  ? -25.874 -39.905 -1.084  1.00 0.00 ? 99  GLY A H    7  
ATOM 10043 H HA2  . GLY A 1 99  ? -27.229 -41.147 0.681   1.00 0.00 ? 99  GLY A HA2  7  
ATOM 10044 H HA3  . GLY A 1 99  ? -28.152 -39.660 0.775   1.00 0.00 ? 99  GLY A HA3  7  
ATOM 10045 N N    . PRO A 1 100 ? -29.396 -41.556 -0.812  1.00 0.00 ? 100 PRO A N    7  
ATOM 10046 C CA   . PRO A 1 100 ? -30.269 -42.055 -1.861  1.00 0.00 ? 100 PRO A CA   7  
ATOM 10047 C C    . PRO A 1 100 ? -31.246 -40.972 -2.322  1.00 0.00 ? 100 PRO A C    7  
ATOM 10048 O O    . PRO A 1 100 ? -31.661 -40.127 -1.530  1.00 0.00 ? 100 PRO A O    7  
ATOM 10049 C CB   . PRO A 1 100 ? -30.964 -43.263 -1.254  1.00 0.00 ? 100 PRO A CB   7  
ATOM 10050 C CG   . PRO A 1 100 ? -30.808 -43.121 0.251   1.00 0.00 ? 100 PRO A CG   7  
ATOM 10051 C CD   . PRO A 1 100 ? -29.751 -42.060 0.512   1.00 0.00 ? 100 PRO A CD   7  
ATOM 10052 H HA   . PRO A 1 100 ? -29.734 -42.302 -2.669  1.00 0.00 ? 100 PRO A HA   7  
ATOM 10053 H HB2  . PRO A 1 100 ? -32.016 -43.291 -1.537  1.00 0.00 ? 100 PRO A HB2  7  
ATOM 10054 H HB3  . PRO A 1 100 ? -30.514 -44.191 -1.608  1.00 0.00 ? 100 PRO A HB3  7  
ATOM 10055 H HG2  . PRO A 1 100 ? -31.755 -42.836 0.708   1.00 0.00 ? 100 PRO A HG2  7  
ATOM 10056 H HG3  . PRO A 1 100 ? -30.512 -44.072 0.695   1.00 0.00 ? 100 PRO A HG3  7  
ATOM 10057 H HD2  . PRO A 1 100 ? -30.137 -41.264 1.148   1.00 0.00 ? 100 PRO A HD2  7  
ATOM 10058 H HD3  . PRO A 1 100 ? -28.883 -42.482 1.020   1.00 0.00 ? 100 PRO A HD3  7  
ATOM 10059 N N    . SER A 1 101 ? -31.586 -41.032 -3.601  1.00 0.00 ? 101 SER A N    7  
ATOM 10060 C CA   . SER A 1 101 ? -32.507 -40.066 -4.177  1.00 0.00 ? 101 SER A CA   7  
ATOM 10061 C C    . SER A 1 101 ? -33.950 -40.481 -3.885  1.00 0.00 ? 101 SER A C    7  
ATOM 10062 O O    . SER A 1 101 ? -34.491 -41.366 -4.546  1.00 0.00 ? 101 SER A O    7  
ATOM 10063 C CB   . SER A 1 101 ? -32.289 -39.929 -5.685  1.00 0.00 ? 101 SER A CB   7  
ATOM 10064 O OG   . SER A 1 101 ? -32.122 -38.570 -6.079  1.00 0.00 ? 101 SER A OG   7  
ATOM 10065 H H    . SER A 1 101 ? -31.244 -41.722 -4.239  1.00 0.00 ? 101 SER A H    7  
ATOM 10066 H HA   . SER A 1 101 ? -32.275 -39.120 -3.689  1.00 0.00 ? 101 SER A HA   7  
ATOM 10067 H HB2  . SER A 1 101 ? -31.409 -40.502 -5.978  1.00 0.00 ? 101 SER A HB2  7  
ATOM 10068 H HB3  . SER A 1 101 ? -33.139 -40.358 -6.215  1.00 0.00 ? 101 SER A HB3  7  
ATOM 10069 H HG   . SER A 1 101 ? -31.742 -38.525 -7.003  1.00 0.00 ? 101 SER A HG   7  
ATOM 10070 N N    . SER A 1 102 ? -34.533 -39.823 -2.894  1.00 0.00 ? 102 SER A N    7  
ATOM 10071 C CA   . SER A 1 102 ? -35.903 -40.112 -2.506  1.00 0.00 ? 102 SER A CA   7  
ATOM 10072 C C    . SER A 1 102 ? -36.845 -39.053 -3.083  1.00 0.00 ? 102 SER A C    7  
ATOM 10073 O O    . SER A 1 102 ? -36.573 -37.858 -2.986  1.00 0.00 ? 102 SER A O    7  
ATOM 10074 C CB   . SER A 1 102 ? -36.043 -40.175 -0.984  1.00 0.00 ? 102 SER A CB   7  
ATOM 10075 O OG   . SER A 1 102 ? -37.067 -41.080 -0.579  1.00 0.00 ? 102 SER A OG   7  
ATOM 10076 H H    . SER A 1 102 ? -34.085 -39.105 -2.361  1.00 0.00 ? 102 SER A H    7  
ATOM 10077 H HA   . SER A 1 102 ? -36.122 -41.092 -2.931  1.00 0.00 ? 102 SER A HA   7  
ATOM 10078 H HB2  . SER A 1 102 ? -35.094 -40.482 -0.545  1.00 0.00 ? 102 SER A HB2  7  
ATOM 10079 H HB3  . SER A 1 102 ? -36.265 -39.180 -0.599  1.00 0.00 ? 102 SER A HB3  7  
ATOM 10080 H HG   . SER A 1 102 ? -37.809 -41.079 -1.249  1.00 0.00 ? 102 SER A HG   7  
ATOM 10081 N N    . GLY A 1 103 ? -37.932 -39.531 -3.670  1.00 0.00 ? 103 GLY A N    7  
ATOM 10082 C CA   . GLY A 1 103 ? -38.915 -38.640 -4.262  1.00 0.00 ? 103 GLY A CA   7  
ATOM 10083 C C    . GLY A 1 103 ? -40.080 -38.393 -3.301  1.00 0.00 ? 103 GLY A C    7  
ATOM 10084 O O    . GLY A 1 103 ? -40.795 -39.324 -2.935  1.00 0.00 ? 103 GLY A O    7  
ATOM 10085 H H    . GLY A 1 103 ? -38.145 -40.505 -3.745  1.00 0.00 ? 103 GLY A H    7  
ATOM 10086 H HA2  . GLY A 1 103 ? -38.444 -37.692 -4.520  1.00 0.00 ? 103 GLY A HA2  7  
ATOM 10087 H HA3  . GLY A 1 103 ? -39.290 -39.072 -5.190  1.00 0.00 ? 103 GLY A HA3  7  
ATOM 10088 N N    . GLY A 1 1   ? -9.373  -14.446 11.192  1.00 0.00 ? 1   GLY A N    8  
ATOM 10089 C CA   . GLY A 1 1   ? -10.367 -15.116 12.014  1.00 0.00 ? 1   GLY A CA   8  
ATOM 10090 C C    . GLY A 1 1   ? -11.745 -14.474 11.841  1.00 0.00 ? 1   GLY A C    8  
ATOM 10091 O O    . GLY A 1 1   ? -12.051 -13.929 10.782  1.00 0.00 ? 1   GLY A O    8  
ATOM 10092 H H1   . GLY A 1 1   ? -8.477  -14.332 11.621  1.00 0.00 ? 1   GLY A H1   8  
ATOM 10093 H HA2  . GLY A 1 1   ? -10.416 -16.171 11.744  1.00 0.00 ? 1   GLY A HA2  8  
ATOM 10094 H HA3  . GLY A 1 1   ? -10.069 -15.069 13.062  1.00 0.00 ? 1   GLY A HA3  8  
ATOM 10095 N N    . SER A 1 2   ? -12.539 -14.559 12.898  1.00 0.00 ? 2   SER A N    8  
ATOM 10096 C CA   . SER A 1 2   ? -13.877 -13.994 12.876  1.00 0.00 ? 2   SER A CA   8  
ATOM 10097 C C    . SER A 1 2   ? -13.860 -12.585 13.473  1.00 0.00 ? 2   SER A C    8  
ATOM 10098 O O    . SER A 1 2   ? -14.068 -12.413 14.673  1.00 0.00 ? 2   SER A O    8  
ATOM 10099 C CB   . SER A 1 2   ? -14.863 -14.881 13.638  1.00 0.00 ? 2   SER A CB   8  
ATOM 10100 O OG   . SER A 1 2   ? -16.070 -14.191 13.951  1.00 0.00 ? 2   SER A OG   8  
ATOM 10101 H H    . SER A 1 2   ? -12.282 -15.004 13.756  1.00 0.00 ? 2   SER A H    8  
ATOM 10102 H HA   . SER A 1 2   ? -14.159 -13.960 11.823  1.00 0.00 ? 2   SER A HA   8  
ATOM 10103 H HB2  . SER A 1 2   ? -15.094 -15.763 13.041  1.00 0.00 ? 2   SER A HB2  8  
ATOM 10104 H HB3  . SER A 1 2   ? -14.397 -15.233 14.559  1.00 0.00 ? 2   SER A HB3  8  
ATOM 10105 H HG   . SER A 1 2   ? -16.264 -14.268 14.929  1.00 0.00 ? 2   SER A HG   8  
ATOM 10106 N N    . SER A 1 3   ? -13.609 -11.613 12.608  1.00 0.00 ? 3   SER A N    8  
ATOM 10107 C CA   . SER A 1 3   ? -13.561 -10.225 13.035  1.00 0.00 ? 3   SER A CA   8  
ATOM 10108 C C    . SER A 1 3   ? -12.272 -9.962  13.816  1.00 0.00 ? 3   SER A C    8  
ATOM 10109 O O    . SER A 1 3   ? -11.468 -9.116  13.427  1.00 0.00 ? 3   SER A O    8  
ATOM 10110 C CB   . SER A 1 3   ? -14.780 -9.869  13.887  1.00 0.00 ? 3   SER A CB   8  
ATOM 10111 O OG   . SER A 1 3   ? -14.959 -8.460  14.002  1.00 0.00 ? 3   SER A OG   8  
ATOM 10112 H H    . SER A 1 3   ? -13.440 -11.762 11.633  1.00 0.00 ? 3   SER A H    8  
ATOM 10113 H HA   . SER A 1 3   ? -13.578 -9.640  12.115  1.00 0.00 ? 3   SER A HA   8  
ATOM 10114 H HB2  . SER A 1 3   ? -15.673 -10.313 13.447  1.00 0.00 ? 3   SER A HB2  8  
ATOM 10115 H HB3  . SER A 1 3   ? -14.667 -10.302 14.881  1.00 0.00 ? 3   SER A HB3  8  
ATOM 10116 H HG   . SER A 1 3   ? -14.542 -8.130  14.848  1.00 0.00 ? 3   SER A HG   8  
ATOM 10117 N N    . GLY A 1 4   ? -12.115 -10.702 14.903  1.00 0.00 ? 4   GLY A N    8  
ATOM 10118 C CA   . GLY A 1 4   ? -10.938 -10.559 15.742  1.00 0.00 ? 4   GLY A CA   8  
ATOM 10119 C C    . GLY A 1 4   ? -10.754 -9.106  16.186  1.00 0.00 ? 4   GLY A C    8  
ATOM 10120 O O    . GLY A 1 4   ? -11.674 -8.499  16.732  1.00 0.00 ? 4   GLY A O    8  
ATOM 10121 H H    . GLY A 1 4   ? -12.774 -11.388 15.213  1.00 0.00 ? 4   GLY A H    8  
ATOM 10122 H HA2  . GLY A 1 4   ? -11.030 -11.202 16.618  1.00 0.00 ? 4   GLY A HA2  8  
ATOM 10123 H HA3  . GLY A 1 4   ? -10.055 -10.890 15.195  1.00 0.00 ? 4   GLY A HA3  8  
ATOM 10124 N N    . SER A 1 5   ? -9.559  -8.591  15.936  1.00 0.00 ? 5   SER A N    8  
ATOM 10125 C CA   . SER A 1 5   ? -9.243  -7.221  16.303  1.00 0.00 ? 5   SER A CA   8  
ATOM 10126 C C    . SER A 1 5   ? -8.114  -6.689  15.418  1.00 0.00 ? 5   SER A C    8  
ATOM 10127 O O    . SER A 1 5   ? -7.288  -7.459  14.931  1.00 0.00 ? 5   SER A O    8  
ATOM 10128 C CB   . SER A 1 5   ? -8.852  -7.123  17.779  1.00 0.00 ? 5   SER A CB   8  
ATOM 10129 O OG   . SER A 1 5   ? -9.406  -5.967  18.402  1.00 0.00 ? 5   SER A OG   8  
ATOM 10130 H H    . SER A 1 5   ? -8.816  -9.091  15.491  1.00 0.00 ? 5   SER A H    8  
ATOM 10131 H HA   . SER A 1 5   ? -10.161 -6.658  16.133  1.00 0.00 ? 5   SER A HA   8  
ATOM 10132 H HB2  . SER A 1 5   ? -9.191  -8.016  18.304  1.00 0.00 ? 5   SER A HB2  8  
ATOM 10133 H HB3  . SER A 1 5   ? -7.766  -7.095  17.865  1.00 0.00 ? 5   SER A HB3  8  
ATOM 10134 H HG   . SER A 1 5   ? -8.674  -5.379  18.745  1.00 0.00 ? 5   SER A HG   8  
ATOM 10135 N N    . SER A 1 6   ? -8.116  -5.377  15.237  1.00 0.00 ? 6   SER A N    8  
ATOM 10136 C CA   . SER A 1 6   ? -7.102  -4.733  14.419  1.00 0.00 ? 6   SER A CA   8  
ATOM 10137 C C    . SER A 1 6   ? -5.707  -5.145  14.895  1.00 0.00 ? 6   SER A C    8  
ATOM 10138 O O    . SER A 1 6   ? -5.568  -5.815  15.916  1.00 0.00 ? 6   SER A O    8  
ATOM 10139 C CB   . SER A 1 6   ? -7.248  -3.210  14.458  1.00 0.00 ? 6   SER A CB   8  
ATOM 10140 O OG   . SER A 1 6   ? -8.594  -2.797  14.239  1.00 0.00 ? 6   SER A OG   8  
ATOM 10141 H H    . SER A 1 6   ? -8.792  -4.758  15.637  1.00 0.00 ? 6   SER A H    8  
ATOM 10142 H HA   . SER A 1 6   ? -7.280  -5.089  13.405  1.00 0.00 ? 6   SER A HA   8  
ATOM 10143 H HB2  . SER A 1 6   ? -6.907  -2.838  15.424  1.00 0.00 ? 6   SER A HB2  8  
ATOM 10144 H HB3  . SER A 1 6   ? -6.604  -2.765  13.700  1.00 0.00 ? 6   SER A HB3  8  
ATOM 10145 H HG   . SER A 1 6   ? -9.109  -3.531  13.797  1.00 0.00 ? 6   SER A HG   8  
ATOM 10146 N N    . GLY A 1 7   ? -4.709  -4.725  14.131  1.00 0.00 ? 7   GLY A N    8  
ATOM 10147 C CA   . GLY A 1 7   ? -3.330  -5.042  14.462  1.00 0.00 ? 7   GLY A CA   8  
ATOM 10148 C C    . GLY A 1 7   ? -2.362  -4.336  13.510  1.00 0.00 ? 7   GLY A C    8  
ATOM 10149 O O    . GLY A 1 7   ? -2.560  -4.347  12.296  1.00 0.00 ? 7   GLY A O    8  
ATOM 10150 H H    . GLY A 1 7   ? -4.830  -4.180  13.302  1.00 0.00 ? 7   GLY A H    8  
ATOM 10151 H HA2  . GLY A 1 7   ? -3.120  -4.742  15.488  1.00 0.00 ? 7   GLY A HA2  8  
ATOM 10152 H HA3  . GLY A 1 7   ? -3.177  -6.120  14.407  1.00 0.00 ? 7   GLY A HA3  8  
ATOM 10153 N N    . SER A 1 8   ? -1.335  -3.739  14.097  1.00 0.00 ? 8   SER A N    8  
ATOM 10154 C CA   . SER A 1 8   ? -0.335  -3.030  13.317  1.00 0.00 ? 8   SER A CA   8  
ATOM 10155 C C    . SER A 1 8   ? 0.865   -3.940  13.052  1.00 0.00 ? 8   SER A C    8  
ATOM 10156 O O    . SER A 1 8   ? 1.048   -4.947  13.735  1.00 0.00 ? 8   SER A O    8  
ATOM 10157 C CB   . SER A 1 8   ? 0.114   -1.752  14.028  1.00 0.00 ? 8   SER A CB   8  
ATOM 10158 O OG   . SER A 1 8   ? 1.153   -1.083  13.319  1.00 0.00 ? 8   SER A OG   8  
ATOM 10159 H H    . SER A 1 8   ? -1.180  -3.736  15.085  1.00 0.00 ? 8   SER A H    8  
ATOM 10160 H HA   . SER A 1 8   ? -0.831  -2.769  12.382  1.00 0.00 ? 8   SER A HA   8  
ATOM 10161 H HB2  . SER A 1 8   ? -0.738  -1.081  14.141  1.00 0.00 ? 8   SER A HB2  8  
ATOM 10162 H HB3  . SER A 1 8   ? 0.460   -1.999  15.032  1.00 0.00 ? 8   SER A HB3  8  
ATOM 10163 H HG   . SER A 1 8   ? 1.928   -1.700  13.186  1.00 0.00 ? 8   SER A HG   8  
ATOM 10164 N N    . VAL A 1 9   ? 1.654   -3.553  12.060  1.00 0.00 ? 9   VAL A N    8  
ATOM 10165 C CA   . VAL A 1 9   ? 2.832   -4.322  11.697  1.00 0.00 ? 9   VAL A CA   8  
ATOM 10166 C C    . VAL A 1 9   ? 3.982   -3.365  11.379  1.00 0.00 ? 9   VAL A C    8  
ATOM 10167 O O    . VAL A 1 9   ? 3.765   -2.170  11.187  1.00 0.00 ? 9   VAL A O    8  
ATOM 10168 C CB   . VAL A 1 9   ? 2.504   -5.268  10.540  1.00 0.00 ? 9   VAL A CB   8  
ATOM 10169 C CG1  . VAL A 1 9   ? 1.688   -4.552  9.461   1.00 0.00 ? 9   VAL A CG1  8  
ATOM 10170 C CG2  . VAL A 1 9   ? 3.778   -5.876  9.951   1.00 0.00 ? 9   VAL A CG2  8  
ATOM 10171 H H    . VAL A 1 9   ? 1.498   -2.733  11.510  1.00 0.00 ? 9   VAL A H    8  
ATOM 10172 H HA   . VAL A 1 9   ? 3.108   -4.928  12.560  1.00 0.00 ? 9   VAL A HA   8  
ATOM 10173 H HB   . VAL A 1 9   ? 1.895   -6.082  10.934  1.00 0.00 ? 9   VAL A HB   8  
ATOM 10174 H HG11 . VAL A 1 9   ? 1.991   -3.506  9.412   1.00 0.00 ? 9   VAL A HG11 8  
ATOM 10175 H HG12 . VAL A 1 9   ? 1.866   -5.027  8.496   1.00 0.00 ? 9   VAL A HG12 8  
ATOM 10176 H HG13 . VAL A 1 9   ? 0.628   -4.613  9.707   1.00 0.00 ? 9   VAL A HG13 8  
ATOM 10177 H HG21 . VAL A 1 9   ? 3.512   -6.597  9.177   1.00 0.00 ? 9   VAL A HG21 8  
ATOM 10178 H HG22 . VAL A 1 9   ? 4.391   -5.086  9.516   1.00 0.00 ? 9   VAL A HG22 8  
ATOM 10179 H HG23 . VAL A 1 9   ? 4.339   -6.379  10.739  1.00 0.00 ? 9   VAL A HG23 8  
ATOM 10180 N N    . SER A 1 10  ? 5.181   -3.926  11.333  1.00 0.00 ? 10  SER A N    8  
ATOM 10181 C CA   . SER A 1 10  ? 6.366   -3.137  11.042  1.00 0.00 ? 10  SER A CA   8  
ATOM 10182 C C    . SER A 1 10  ? 7.213   -3.838  9.977   1.00 0.00 ? 10  SER A C    8  
ATOM 10183 O O    . SER A 1 10  ? 7.403   -5.052  10.031  1.00 0.00 ? 10  SER A O    8  
ATOM 10184 C CB   . SER A 1 10  ? 7.194   -2.899  12.306  1.00 0.00 ? 10  SER A CB   8  
ATOM 10185 O OG   . SER A 1 10  ? 8.311   -2.049  12.060  1.00 0.00 ? 10  SER A OG   8  
ATOM 10186 H H    . SER A 1 10  ? 5.350   -4.899  11.491  1.00 0.00 ? 10  SER A H    8  
ATOM 10187 H HA   . SER A 1 10  ? 5.993   -2.184  10.667  1.00 0.00 ? 10  SER A HA   8  
ATOM 10188 H HB2  . SER A 1 10  ? 6.562   -2.454  13.075  1.00 0.00 ? 10  SER A HB2  8  
ATOM 10189 H HB3  . SER A 1 10  ? 7.545   -3.855  12.695  1.00 0.00 ? 10  SER A HB3  8  
ATOM 10190 H HG   . SER A 1 10  ? 8.784   -2.337  11.227  1.00 0.00 ? 10  SER A HG   8  
ATOM 10191 N N    . LEU A 1 11  ? 7.698   -3.043  9.035   1.00 0.00 ? 11  LEU A N    8  
ATOM 10192 C CA   . LEU A 1 11  ? 8.520   -3.572  7.960   1.00 0.00 ? 11  LEU A CA   8  
ATOM 10193 C C    . LEU A 1 11  ? 9.847   -2.811  7.916   1.00 0.00 ? 11  LEU A C    8  
ATOM 10194 O O    . LEU A 1 11  ? 9.898   -1.626  8.241   1.00 0.00 ? 11  LEU A O    8  
ATOM 10195 C CB   . LEU A 1 11  ? 7.752   -3.547  6.636   1.00 0.00 ? 11  LEU A CB   8  
ATOM 10196 C CG   . LEU A 1 11  ? 6.323   -4.091  6.680   1.00 0.00 ? 11  LEU A CG   8  
ATOM 10197 C CD1  . LEU A 1 11  ? 5.645   -3.959  5.314   1.00 0.00 ? 11  LEU A CD1  8  
ATOM 10198 C CD2  . LEU A 1 11  ? 6.300   -5.532  7.194   1.00 0.00 ? 11  LEU A CD2  8  
ATOM 10199 H H    . LEU A 1 11  ? 7.539   -2.057  8.999   1.00 0.00 ? 11  LEU A H    8  
ATOM 10200 H HA   . LEU A 1 11  ? 8.728   -4.617  8.191   1.00 0.00 ? 11  LEU A HA   8  
ATOM 10201 H HB2  . LEU A 1 11  ? 7.718   -2.517  6.279   1.00 0.00 ? 11  LEU A HB2  8  
ATOM 10202 H HB3  . LEU A 1 11  ? 8.317   -4.120  5.901   1.00 0.00 ? 11  LEU A HB3  8  
ATOM 10203 H HG   . LEU A 1 11  ? 5.749   -3.488  7.384   1.00 0.00 ? 11  LEU A HG   8  
ATOM 10204 H HD11 . LEU A 1 11  ? 5.964   -4.778  4.670   1.00 0.00 ? 11  LEU A HD11 8  
ATOM 10205 H HD12 . LEU A 1 11  ? 4.563   -3.996  5.441   1.00 0.00 ? 11  LEU A HD12 8  
ATOM 10206 H HD13 . LEU A 1 11  ? 5.925   -3.009  4.860   1.00 0.00 ? 11  LEU A HD13 8  
ATOM 10207 H HD21 . LEU A 1 11  ? 5.724   -5.578  8.118   1.00 0.00 ? 11  LEU A HD21 8  
ATOM 10208 H HD22 . LEU A 1 11  ? 5.841   -6.178  6.446   1.00 0.00 ? 11  LEU A HD22 8  
ATOM 10209 H HD23 . LEU A 1 11  ? 7.320   -5.865  7.385   1.00 0.00 ? 11  LEU A HD23 8  
ATOM 10210 N N    . VAL A 1 12  ? 10.888  -3.524  7.511   1.00 0.00 ? 12  VAL A N    8  
ATOM 10211 C CA   . VAL A 1 12  ? 12.211  -2.930  7.420   1.00 0.00 ? 12  VAL A CA   8  
ATOM 10212 C C    . VAL A 1 12  ? 12.653  -2.901  5.956   1.00 0.00 ? 12  VAL A C    8  
ATOM 10213 O O    . VAL A 1 12  ? 12.981  -3.939  5.382   1.00 0.00 ? 12  VAL A O    8  
ATOM 10214 C CB   . VAL A 1 12  ? 13.187  -3.687  8.324   1.00 0.00 ? 12  VAL A CB   8  
ATOM 10215 C CG1  . VAL A 1 12  ? 13.230  -5.173  7.962   1.00 0.00 ? 12  VAL A CG1  8  
ATOM 10216 C CG2  . VAL A 1 12  ? 14.584  -3.067  8.263   1.00 0.00 ? 12  VAL A CG2  8  
ATOM 10217 H H    . VAL A 1 12  ? 10.838  -4.487  7.248   1.00 0.00 ? 12  VAL A H    8  
ATOM 10218 H HA   . VAL A 1 12  ? 12.138  -1.906  7.785   1.00 0.00 ? 12  VAL A HA   8  
ATOM 10219 H HB   . VAL A 1 12  ? 12.828  -3.602  9.350   1.00 0.00 ? 12  VAL A HB   8  
ATOM 10220 H HG11 . VAL A 1 12  ? 13.889  -5.696  8.655   1.00 0.00 ? 12  VAL A HG11 8  
ATOM 10221 H HG12 . VAL A 1 12  ? 12.226  -5.592  8.028   1.00 0.00 ? 12  VAL A HG12 8  
ATOM 10222 H HG13 . VAL A 1 12  ? 13.606  -5.288  6.946   1.00 0.00 ? 12  VAL A HG13 8  
ATOM 10223 H HG21 . VAL A 1 12  ? 15.059  -3.335  7.319   1.00 0.00 ? 12  VAL A HG21 8  
ATOM 10224 H HG22 . VAL A 1 12  ? 14.504  -1.982  8.334   1.00 0.00 ? 12  VAL A HG22 8  
ATOM 10225 H HG23 . VAL A 1 12  ? 15.185  -3.442  9.091   1.00 0.00 ? 12  VAL A HG23 8  
ATOM 10226 N N    . GLY A 1 13  ? 12.647  -1.702  5.393   1.00 0.00 ? 13  GLY A N    8  
ATOM 10227 C CA   . GLY A 1 13  ? 13.043  -1.524  4.006   1.00 0.00 ? 13  GLY A CA   8  
ATOM 10228 C C    . GLY A 1 13  ? 13.139  -0.039  3.649   1.00 0.00 ? 13  GLY A C    8  
ATOM 10229 O O    . GLY A 1 13  ? 12.480  0.795   4.268   1.00 0.00 ? 13  GLY A O    8  
ATOM 10230 H H    . GLY A 1 13  ? 12.378  -0.863  5.866   1.00 0.00 ? 13  GLY A H    8  
ATOM 10231 H HA2  . GLY A 1 13  ? 14.005  -2.006  3.834   1.00 0.00 ? 13  GLY A HA2  8  
ATOM 10232 H HA3  . GLY A 1 13  ? 12.321  -2.013  3.352   1.00 0.00 ? 13  GLY A HA3  8  
ATOM 10233 N N    . PRO A 1 14  ? 13.987  0.252   2.627   1.00 0.00 ? 14  PRO A N    8  
ATOM 10234 C CA   . PRO A 1 14  ? 14.178  1.622   2.180   1.00 0.00 ? 14  PRO A CA   8  
ATOM 10235 C C    . PRO A 1 14  ? 12.975  2.106   1.367   1.00 0.00 ? 14  PRO A C    8  
ATOM 10236 O O    . PRO A 1 14  ? 12.898  3.279   1.004   1.00 0.00 ? 14  PRO A O    8  
ATOM 10237 C CB   . PRO A 1 14  ? 15.467  1.598   1.376   1.00 0.00 ? 14  PRO A CB   8  
ATOM 10238 C CG   . PRO A 1 14  ? 15.704  0.141   1.011   1.00 0.00 ? 14  PRO A CG   8  
ATOM 10239 C CD   . PRO A 1 14  ? 14.783  -0.710  1.871   1.00 0.00 ? 14  PRO A CD   8  
ATOM 10240 H HA   . PRO A 1 14  ? 14.242  2.237   2.966   1.00 0.00 ? 14  PRO A HA   8  
ATOM 10241 H HB2  . PRO A 1 14  ? 15.382  2.215   0.482   1.00 0.00 ? 14  PRO A HB2  8  
ATOM 10242 H HB3  . PRO A 1 14  ? 16.299  1.994   1.959   1.00 0.00 ? 14  PRO A HB3  8  
ATOM 10243 H HG2  . PRO A 1 14  ? 15.500  -0.026  -0.046  1.00 0.00 ? 14  PRO A HG2  8  
ATOM 10244 H HG3  . PRO A 1 14  ? 16.745  -0.131  1.182   1.00 0.00 ? 14  PRO A HG3  8  
ATOM 10245 H HD2  . PRO A 1 14  ? 14.151  -1.353  1.259   1.00 0.00 ? 14  PRO A HD2  8  
ATOM 10246 H HD3  . PRO A 1 14  ? 15.352  -1.361  2.535   1.00 0.00 ? 14  PRO A HD3  8  
ATOM 10247 N N    . ALA A 1 15  ? 12.066  1.179   1.105   1.00 0.00 ? 15  ALA A N    8  
ATOM 10248 C CA   . ALA A 1 15  ? 10.871  1.496   0.342   1.00 0.00 ? 15  ALA A CA   8  
ATOM 10249 C C    . ALA A 1 15  ? 10.259  0.203   -0.200  1.00 0.00 ? 15  ALA A C    8  
ATOM 10250 O O    . ALA A 1 15  ? 9.061   -0.032  -0.048  1.00 0.00 ? 15  ALA A O    8  
ATOM 10251 C CB   . ALA A 1 15  ? 11.224  2.485   -0.771  1.00 0.00 ? 15  ALA A CB   8  
ATOM 10252 H H    . ALA A 1 15  ? 12.136  0.227   1.404   1.00 0.00 ? 15  ALA A H    8  
ATOM 10253 H HA   . ALA A 1 15  ? 10.161  1.969   1.020   1.00 0.00 ? 15  ALA A HA   8  
ATOM 10254 H HB1  . ALA A 1 15  ? 10.914  3.488   -0.477  1.00 0.00 ? 15  ALA A HB1  8  
ATOM 10255 H HB2  . ALA A 1 15  ? 12.301  2.472   -0.940  1.00 0.00 ? 15  ALA A HB2  8  
ATOM 10256 H HB3  . ALA A 1 15  ? 10.708  2.199   -1.688  1.00 0.00 ? 15  ALA A HB3  8  
ATOM 10257 N N    . PRO A 1 16  ? 11.131  -0.624  -0.836  1.00 0.00 ? 16  PRO A N    8  
ATOM 10258 C CA   . PRO A 1 16  ? 10.688  -1.887  -1.401  1.00 0.00 ? 16  PRO A CA   8  
ATOM 10259 C C    . PRO A 1 16  ? 10.452  -2.926  -0.303  1.00 0.00 ? 16  PRO A C    8  
ATOM 10260 O O    . PRO A 1 16  ? 11.298  -3.787  -0.066  1.00 0.00 ? 16  PRO A O    8  
ATOM 10261 C CB   . PRO A 1 16  ? 11.786  -2.289  -2.373  1.00 0.00 ? 16  PRO A CB   8  
ATOM 10262 C CG   . PRO A 1 16  ? 13.011  -1.481  -1.977  1.00 0.00 ? 16  PRO A CG   8  
ATOM 10263 C CD   . PRO A 1 16  ? 12.556  -0.378  -1.035  1.00 0.00 ? 16  PRO A CD   8  
ATOM 10264 H HA   . PRO A 1 16  ? 9.809   -1.772  -1.863  1.00 0.00 ? 16  PRO A HA   8  
ATOM 10265 H HB2  . PRO A 1 16  ? 11.987  -3.359  -2.314  1.00 0.00 ? 16  PRO A HB2  8  
ATOM 10266 H HB3  . PRO A 1 16  ? 11.494  -2.076  -3.402  1.00 0.00 ? 16  PRO A HB3  8  
ATOM 10267 H HG2  . PRO A 1 16  ? 13.747  -2.120  -1.490  1.00 0.00 ? 16  PRO A HG2  8  
ATOM 10268 H HG3  . PRO A 1 16  ? 13.490  -1.057  -2.859  1.00 0.00 ? 16  PRO A HG3  8  
ATOM 10269 H HD2  . PRO A 1 16  ? 13.100  -0.415  -0.091  1.00 0.00 ? 16  PRO A HD2  8  
ATOM 10270 H HD3  . PRO A 1 16  ? 12.732  0.608   -1.465  1.00 0.00 ? 16  PRO A HD3  8  
ATOM 10271 N N    . TRP A 1 17  ? 9.298   -2.811  0.337   1.00 0.00 ? 17  TRP A N    8  
ATOM 10272 C CA   . TRP A 1 17  ? 8.940   -3.729  1.404   1.00 0.00 ? 17  TRP A CA   8  
ATOM 10273 C C    . TRP A 1 17  ? 8.544   -5.063  0.767   1.00 0.00 ? 17  TRP A C    8  
ATOM 10274 O O    . TRP A 1 17  ? 8.606   -6.107  1.415   1.00 0.00 ? 17  TRP A O    8  
ATOM 10275 C CB   . TRP A 1 17  ? 7.839   -3.140  2.289   1.00 0.00 ? 17  TRP A CB   8  
ATOM 10276 C CG   . TRP A 1 17  ? 7.913   -1.619  2.443   1.00 0.00 ? 17  TRP A CG   8  
ATOM 10277 C CD1  . TRP A 1 17  ? 7.359   -0.683  1.661   1.00 0.00 ? 17  TRP A CD1  8  
ATOM 10278 C CD2  . TRP A 1 17  ? 8.606   -0.893  3.480   1.00 0.00 ? 17  TRP A CD2  8  
ATOM 10279 N NE1  . TRP A 1 17  ? 7.643   0.589   2.116   1.00 0.00 ? 17  TRP A NE1  8  
ATOM 10280 C CE2  . TRP A 1 17  ? 8.425   0.457   3.257   1.00 0.00 ? 17  TRP A CE2  8  
ATOM 10281 C CE3  . TRP A 1 17  ? 9.360   -1.361  4.570   1.00 0.00 ? 17  TRP A CE3  8  
ATOM 10282 C CZ2  . TRP A 1 17  ? 8.968   1.450   4.082   1.00 0.00 ? 17  TRP A CZ2  8  
ATOM 10283 C CZ3  . TRP A 1 17  ? 9.896   -0.356  5.385   1.00 0.00 ? 17  TRP A CZ3  8  
ATOM 10284 C CH2  . TRP A 1 17  ? 9.723   1.007   5.174   1.00 0.00 ? 17  TRP A CH2  8  
ATOM 10285 H H    . TRP A 1 17  ? 8.615   -2.108  0.138   1.00 0.00 ? 17  TRP A H    8  
ATOM 10286 H HA   . TRP A 1 17  ? 9.817   -3.864  2.037   1.00 0.00 ? 17  TRP A HA   8  
ATOM 10287 H HB2  . TRP A 1 17  ? 6.869   -3.406  1.870   1.00 0.00 ? 17  TRP A HB2  8  
ATOM 10288 H HB3  . TRP A 1 17  ? 7.897   -3.598  3.276   1.00 0.00 ? 17  TRP A HB3  8  
ATOM 10289 H HD1  . TRP A 1 17  ? 6.759   -0.899  0.777   1.00 0.00 ? 17  TRP A HD1  8  
ATOM 10290 H HE1  . TRP A 1 17  ? 7.314   1.524   1.663   1.00 0.00 ? 17  TRP A HE1  8  
ATOM 10291 H HE3  . TRP A 1 17  ? 9.518   -2.421  4.768   1.00 0.00 ? 17  TRP A HE3  8  
ATOM 10292 H HZ2  . TRP A 1 17  ? 8.810   2.510   3.884   1.00 0.00 ? 17  TRP A HZ2  8  
ATOM 10293 H HZ3  . TRP A 1 17  ? 10.490  -0.664  6.245   1.00 0.00 ? 17  TRP A HZ3  8  
ATOM 10294 H HH2  . TRP A 1 17  ? 10.174  1.728   5.856   1.00 0.00 ? 17  TRP A HH2  8  
ATOM 10295 N N    . GLY A 1 18  ? 8.146   -4.985  -0.494  1.00 0.00 ? 18  GLY A N    8  
ATOM 10296 C CA   . GLY A 1 18  ? 7.740   -6.173  -1.226  1.00 0.00 ? 18  GLY A CA   8  
ATOM 10297 C C    . GLY A 1 18  ? 6.218   -6.234  -1.372  1.00 0.00 ? 18  GLY A C    8  
ATOM 10298 O O    . GLY A 1 18  ? 5.644   -7.316  -1.477  1.00 0.00 ? 18  GLY A O    8  
ATOM 10299 H H    . GLY A 1 18  ? 8.098   -4.132  -1.013  1.00 0.00 ? 18  GLY A H    8  
ATOM 10300 H HA2  . GLY A 1 18  ? 8.204   -6.173  -2.212  1.00 0.00 ? 18  GLY A HA2  8  
ATOM 10301 H HA3  . GLY A 1 18  ? 8.095   -7.063  -0.706  1.00 0.00 ? 18  GLY A HA3  8  
ATOM 10302 N N    . PHE A 1 19  ? 5.608   -5.057  -1.373  1.00 0.00 ? 19  PHE A N    8  
ATOM 10303 C CA   . PHE A 1 19  ? 4.164   -4.963  -1.505  1.00 0.00 ? 19  PHE A CA   8  
ATOM 10304 C C    . PHE A 1 19  ? 3.760   -3.652  -2.181  1.00 0.00 ? 19  PHE A C    8  
ATOM 10305 O O    . PHE A 1 19  ? 4.469   -2.652  -2.079  1.00 0.00 ? 19  PHE A O    8  
ATOM 10306 C CB   . PHE A 1 19  ? 3.583   -4.994  -0.090  1.00 0.00 ? 19  PHE A CB   8  
ATOM 10307 C CG   . PHE A 1 19  ? 3.649   -3.650  0.639   1.00 0.00 ? 19  PHE A CG   8  
ATOM 10308 C CD1  . PHE A 1 19  ? 2.868   -2.615  0.228   1.00 0.00 ? 19  PHE A CD1  8  
ATOM 10309 C CD2  . PHE A 1 19  ? 4.488   -3.491  1.698   1.00 0.00 ? 19  PHE A CD2  8  
ATOM 10310 C CE1  . PHE A 1 19  ? 2.929   -1.368  0.904   1.00 0.00 ? 19  PHE A CE1  8  
ATOM 10311 C CE2  . PHE A 1 19  ? 4.548   -2.244  2.374   1.00 0.00 ? 19  PHE A CE2  8  
ATOM 10312 C CZ   . PHE A 1 19  ? 3.768   -1.208  1.963   1.00 0.00 ? 19  PHE A CZ   8  
ATOM 10313 H H    . PHE A 1 19  ? 6.083   -4.181  -1.287  1.00 0.00 ? 19  PHE A H    8  
ATOM 10314 H HA   . PHE A 1 19  ? 3.840   -5.803  -2.120  1.00 0.00 ? 19  PHE A HA   8  
ATOM 10315 H HB2  . PHE A 1 19  ? 2.544   -5.317  -0.141  1.00 0.00 ? 19  PHE A HB2  8  
ATOM 10316 H HB3  . PHE A 1 19  ? 4.120   -5.740  0.497   1.00 0.00 ? 19  PHE A HB3  8  
ATOM 10317 H HD1  . PHE A 1 19  ? 2.196   -2.743  -0.620  1.00 0.00 ? 19  PHE A HD1  8  
ATOM 10318 H HD2  . PHE A 1 19  ? 5.113   -4.320  2.027   1.00 0.00 ? 19  PHE A HD2  8  
ATOM 10319 H HE1  . PHE A 1 19  ? 2.303   -0.538  0.575   1.00 0.00 ? 19  PHE A HE1  8  
ATOM 10320 H HE2  . PHE A 1 19  ? 5.220   -2.116  3.223   1.00 0.00 ? 19  PHE A HE2  8  
ATOM 10321 H HZ   . PHE A 1 19  ? 3.814   -0.251  2.482   1.00 0.00 ? 19  PHE A HZ   8  
ATOM 10322 N N    . ARG A 1 20  ? 2.621   -3.699  -2.857  1.00 0.00 ? 20  ARG A N    8  
ATOM 10323 C CA   . ARG A 1 20  ? 2.113   -2.527  -3.550  1.00 0.00 ? 20  ARG A CA   8  
ATOM 10324 C C    . ARG A 1 20  ? 0.746   -2.129  -2.989  1.00 0.00 ? 20  ARG A C    8  
ATOM 10325 O O    . ARG A 1 20  ? 0.119   -2.902  -2.266  1.00 0.00 ? 20  ARG A O    8  
ATOM 10326 C CB   . ARG A 1 20  ? 1.985   -2.788  -5.052  1.00 0.00 ? 20  ARG A CB   8  
ATOM 10327 C CG   . ARG A 1 20  ? 3.343   -2.675  -5.747  1.00 0.00 ? 20  ARG A CG   8  
ATOM 10328 C CD   . ARG A 1 20  ? 3.497   -1.315  -6.432  1.00 0.00 ? 20  ARG A CD   8  
ATOM 10329 N NE   . ARG A 1 20  ? 4.804   -1.241  -7.121  1.00 0.00 ? 20  ARG A NE   8  
ATOM 10330 C CZ   . ARG A 1 20  ? 5.965   -0.979  -6.505  1.00 0.00 ? 20  ARG A CZ   8  
ATOM 10331 N NH1  . ARG A 1 20  ? 5.988   -0.765  -5.183  1.00 0.00 ? 20  ARG A NH1  8  
ATOM 10332 N NH2  . ARG A 1 20  ? 7.103   -0.932  -7.211  1.00 0.00 ? 20  ARG A NH2  8  
ATOM 10333 H H    . ARG A 1 20  ? 2.050   -4.516  -2.935  1.00 0.00 ? 20  ARG A H    8  
ATOM 10334 H HA   . ARG A 1 20  ? 2.855   -1.750  -3.363  1.00 0.00 ? 20  ARG A HA   8  
ATOM 10335 H HB2  . ARG A 1 20  ? 1.569   -3.782  -5.217  1.00 0.00 ? 20  ARG A HB2  8  
ATOM 10336 H HB3  . ARG A 1 20  ? 1.287   -2.074  -5.490  1.00 0.00 ? 20  ARG A HB3  8  
ATOM 10337 H HG2  . ARG A 1 20  ? 4.141   -2.810  -5.017  1.00 0.00 ? 20  ARG A HG2  8  
ATOM 10338 H HG3  . ARG A 1 20  ? 3.446   -3.471  -6.484  1.00 0.00 ? 20  ARG A HG3  8  
ATOM 10339 H HD2  . ARG A 1 20  ? 2.689   -1.167  -7.148  1.00 0.00 ? 20  ARG A HD2  8  
ATOM 10340 H HD3  . ARG A 1 20  ? 3.420   -0.516  -5.694  1.00 0.00 ? 20  ARG A HD3  8  
ATOM 10341 H HE   . ARG A 1 20  ? 4.823   -1.396  -8.109  1.00 0.00 ? 20  ARG A HE   8  
ATOM 10342 H HH11 . ARG A 1 20  ? 5.139   -0.801  -4.656  1.00 0.00 ? 20  ARG A HH11 8  
ATOM 10343 H HH12 . ARG A 1 20  ? 6.854   -0.570  -4.723  1.00 0.00 ? 20  ARG A HH12 8  
ATOM 10344 H HH21 . ARG A 1 20  ? 7.086   -1.092  -8.199  1.00 0.00 ? 20  ARG A HH21 8  
ATOM 10345 H HH22 . ARG A 1 20  ? 7.969   -0.736  -6.752  1.00 0.00 ? 20  ARG A HH22 8  
ATOM 10346 N N    . LEU A 1 21  ? 0.325   -0.924  -3.344  1.00 0.00 ? 21  LEU A N    8  
ATOM 10347 C CA   . LEU A 1 21  ? -0.956  -0.415  -2.885  1.00 0.00 ? 21  LEU A CA   8  
ATOM 10348 C C    . LEU A 1 21  ? -1.783  0.034   -4.092  1.00 0.00 ? 21  LEU A C    8  
ATOM 10349 O O    . LEU A 1 21  ? -1.230  0.365   -5.140  1.00 0.00 ? 21  LEU A O    8  
ATOM 10350 C CB   . LEU A 1 21  ? -0.753  0.681   -1.837  1.00 0.00 ? 21  LEU A CB   8  
ATOM 10351 C CG   . LEU A 1 21  ? -0.105  0.240   -0.523  1.00 0.00 ? 21  LEU A CG   8  
ATOM 10352 C CD1  . LEU A 1 21  ? 0.181   1.443   0.378   1.00 0.00 ? 21  LEU A CD1  8  
ATOM 10353 C CD2  . LEU A 1 21  ? -0.959  -0.814  0.183   1.00 0.00 ? 21  LEU A CD2  8  
ATOM 10354 H H    . LEU A 1 21  ? 0.841   -0.302  -3.932  1.00 0.00 ? 21  LEU A H    8  
ATOM 10355 H HA   . LEU A 1 21  ? -1.478  -1.237  -2.395  1.00 0.00 ? 21  LEU A HA   8  
ATOM 10356 H HB2  . LEU A 1 21  ? -0.139  1.467   -2.276  1.00 0.00 ? 21  LEU A HB2  8  
ATOM 10357 H HB3  . LEU A 1 21  ? -1.723  1.124   -1.610  1.00 0.00 ? 21  LEU A HB3  8  
ATOM 10358 H HG   . LEU A 1 21  ? 0.854   -0.224  -0.754  1.00 0.00 ? 21  LEU A HG   8  
ATOM 10359 H HD11 . LEU A 1 21  ? 0.784   2.170   -0.167  1.00 0.00 ? 21  LEU A HD11 8  
ATOM 10360 H HD12 . LEU A 1 21  ? -0.760  1.904   0.678   1.00 0.00 ? 21  LEU A HD12 8  
ATOM 10361 H HD13 . LEU A 1 21  ? 0.723   1.113   1.264   1.00 0.00 ? 21  LEU A HD13 8  
ATOM 10362 H HD21 . LEU A 1 21  ? -0.450  -1.150  1.086   1.00 0.00 ? 21  LEU A HD21 8  
ATOM 10363 H HD22 . LEU A 1 21  ? -1.924  -0.382  0.450   1.00 0.00 ? 21  LEU A HD22 8  
ATOM 10364 H HD23 . LEU A 1 21  ? -1.114  -1.663  -0.484  1.00 0.00 ? 21  LEU A HD23 8  
ATOM 10365 N N    . GLN A 1 22  ? -3.095  0.032   -3.904  1.00 0.00 ? 22  GLN A N    8  
ATOM 10366 C CA   . GLN A 1 22  ? -4.003  0.435   -4.964  1.00 0.00 ? 22  GLN A CA   8  
ATOM 10367 C C    . GLN A 1 22  ? -5.323  0.932   -4.371  1.00 0.00 ? 22  GLN A C    8  
ATOM 10368 O O    . GLN A 1 22  ? -5.740  0.478   -3.306  1.00 0.00 ? 22  GLN A O    8  
ATOM 10369 C CB   . GLN A 1 22  ? -4.242  -0.713  -5.947  1.00 0.00 ? 22  GLN A CB   8  
ATOM 10370 C CG   . GLN A 1 22  ? -4.884  -1.911  -5.246  1.00 0.00 ? 22  GLN A CG   8  
ATOM 10371 C CD   . GLN A 1 22  ? -5.378  -2.942  -6.263  1.00 0.00 ? 22  GLN A CD   8  
ATOM 10372 O OE1  . GLN A 1 22  ? -4.611  -3.672  -6.868  1.00 0.00 ? 22  GLN A OE1  8  
ATOM 10373 N NE2  . GLN A 1 22  ? -6.699  -2.960  -6.417  1.00 0.00 ? 22  GLN A NE2  8  
ATOM 10374 H H    . GLN A 1 22  ? -3.537  -0.238  -3.049  1.00 0.00 ? 22  GLN A H    8  
ATOM 10375 H HA   . GLN A 1 22  ? -3.500  1.251   -5.483  1.00 0.00 ? 22  GLN A HA   8  
ATOM 10376 H HB2  . GLN A 1 22  ? -4.886  -0.373  -6.758  1.00 0.00 ? 22  GLN A HB2  8  
ATOM 10377 H HB3  . GLN A 1 22  ? -3.296  -1.014  -6.397  1.00 0.00 ? 22  GLN A HB3  8  
ATOM 10378 H HG2  . GLN A 1 22  ? -4.161  -2.375  -4.575  1.00 0.00 ? 22  GLN A HG2  8  
ATOM 10379 H HG3  . GLN A 1 22  ? -5.718  -1.573  -4.631  1.00 0.00 ? 22  GLN A HG3  8  
ATOM 10380 H HE21 . GLN A 1 22  ? -7.273  -2.333  -5.890  1.00 0.00 ? 22  GLN A HE21 8  
ATOM 10381 H HE22 . GLN A 1 22  ? -7.119  -3.600  -7.061  1.00 0.00 ? 22  GLN A HE22 8  
ATOM 10382 N N    . GLY A 1 23  ? -5.944  1.859   -5.086  1.00 0.00 ? 23  GLY A N    8  
ATOM 10383 C CA   . GLY A 1 23  ? -7.208  2.423   -4.644  1.00 0.00 ? 23  GLY A CA   8  
ATOM 10384 C C    . GLY A 1 23  ? -7.006  3.810   -4.032  1.00 0.00 ? 23  GLY A C    8  
ATOM 10385 O O    . GLY A 1 23  ? -5.978  4.448   -4.257  1.00 0.00 ? 23  GLY A O    8  
ATOM 10386 H H    . GLY A 1 23  ? -5.599  2.223   -5.951  1.00 0.00 ? 23  GLY A H    8  
ATOM 10387 H HA2  . GLY A 1 23  ? -7.895  2.490   -5.488  1.00 0.00 ? 23  GLY A HA2  8  
ATOM 10388 H HA3  . GLY A 1 23  ? -7.669  1.761   -3.910  1.00 0.00 ? 23  GLY A HA3  8  
ATOM 10389 N N    . GLY A 1 24  ? -8.002  4.237   -3.270  1.00 0.00 ? 24  GLY A N    8  
ATOM 10390 C CA   . GLY A 1 24  ? -7.945  5.537   -2.624  1.00 0.00 ? 24  GLY A CA   8  
ATOM 10391 C C    . GLY A 1 24  ? -9.186  6.369   -2.956  1.00 0.00 ? 24  GLY A C    8  
ATOM 10392 O O    . GLY A 1 24  ? -10.120 5.873   -3.584  1.00 0.00 ? 24  GLY A O    8  
ATOM 10393 H H    . GLY A 1 24  ? -8.834  3.712   -3.092  1.00 0.00 ? 24  GLY A H    8  
ATOM 10394 H HA2  . GLY A 1 24  ? -7.868  5.408   -1.544  1.00 0.00 ? 24  GLY A HA2  8  
ATOM 10395 H HA3  . GLY A 1 24  ? -7.050  6.069   -2.946  1.00 0.00 ? 24  GLY A HA3  8  
ATOM 10396 N N    . LYS A 1 25  ? -9.156  7.619   -2.519  1.00 0.00 ? 25  LYS A N    8  
ATOM 10397 C CA   . LYS A 1 25  ? -10.266 8.524   -2.762  1.00 0.00 ? 25  LYS A CA   8  
ATOM 10398 C C    . LYS A 1 25  ? -10.364 8.813   -4.262  1.00 0.00 ? 25  LYS A C    8  
ATOM 10399 O O    . LYS A 1 25  ? -11.438 8.700   -4.850  1.00 0.00 ? 25  LYS A O    8  
ATOM 10400 C CB   . LYS A 1 25  ? -10.131 9.782   -1.901  1.00 0.00 ? 25  LYS A CB   8  
ATOM 10401 C CG   . LYS A 1 25  ? -11.387 10.006  -1.057  1.00 0.00 ? 25  LYS A CG   8  
ATOM 10402 C CD   . LYS A 1 25  ? -11.122 9.688   0.416   1.00 0.00 ? 25  LYS A CD   8  
ATOM 10403 C CE   . LYS A 1 25  ? -10.504 8.297   0.574   1.00 0.00 ? 25  LYS A CE   8  
ATOM 10404 N NZ   . LYS A 1 25  ? -11.477 7.364   1.184   1.00 0.00 ? 25  LYS A NZ   8  
ATOM 10405 H H    . LYS A 1 25  ? -8.392  8.015   -2.009  1.00 0.00 ? 25  LYS A H    8  
ATOM 10406 H HA   . LYS A 1 25  ? -11.177 8.015   -2.448  1.00 0.00 ? 25  LYS A HA   8  
ATOM 10407 H HB2  . LYS A 1 25  ? -9.262  9.689   -1.250  1.00 0.00 ? 25  LYS A HB2  8  
ATOM 10408 H HB3  . LYS A 1 25  ? -9.959  10.648  -2.541  1.00 0.00 ? 25  LYS A HB3  8  
ATOM 10409 H HG2  . LYS A 1 25  ? -11.716 11.040  -1.156  1.00 0.00 ? 25  LYS A HG2  8  
ATOM 10410 H HG3  . LYS A 1 25  ? -12.196 9.377   -1.429  1.00 0.00 ? 25  LYS A HG3  8  
ATOM 10411 H HD2  . LYS A 1 25  ? -10.453 10.438  0.838   1.00 0.00 ? 25  LYS A HD2  8  
ATOM 10412 H HD3  . LYS A 1 25  ? -12.055 9.741   0.977   1.00 0.00 ? 25  LYS A HD3  8  
ATOM 10413 H HE2  . LYS A 1 25  ? -10.189 7.920   -0.399  1.00 0.00 ? 25  LYS A HE2  8  
ATOM 10414 H HE3  . LYS A 1 25  ? -9.611  8.359   1.196   1.00 0.00 ? 25  LYS A HE3  8  
ATOM 10415 H HZ1  . LYS A 1 25  ? -12.395 7.756   1.127   1.00 0.00 ? 25  LYS A HZ1  8  
ATOM 10416 H HZ2  . LYS A 1 25  ? -11.455 6.493   0.694   1.00 0.00 ? 25  LYS A HZ2  8  
ATOM 10417 H HZ3  . LYS A 1 25  ? -11.238 7.213   2.143   1.00 0.00 ? 25  LYS A HZ3  8  
ATOM 10418 N N    . ASP A 1 26  ? -9.228  9.180   -4.837  1.00 0.00 ? 26  ASP A N    8  
ATOM 10419 C CA   . ASP A 1 26  ? -9.173  9.486   -6.256  1.00 0.00 ? 26  ASP A CA   8  
ATOM 10420 C C    . ASP A 1 26  ? -9.573  8.245   -7.057  1.00 0.00 ? 26  ASP A C    8  
ATOM 10421 O O    . ASP A 1 26  ? -9.953  8.350   -8.222  1.00 0.00 ? 26  ASP A O    8  
ATOM 10422 C CB   . ASP A 1 26  ? -7.757  9.885   -6.678  1.00 0.00 ? 26  ASP A CB   8  
ATOM 10423 C CG   . ASP A 1 26  ? -7.515  9.907   -8.189  1.00 0.00 ? 26  ASP A CG   8  
ATOM 10424 O OD1  . ASP A 1 26  ? -7.506  8.805   -8.778  1.00 0.00 ? 26  ASP A OD1  8  
ATOM 10425 O OD2  . ASP A 1 26  ? -7.345  11.026  -8.720  1.00 0.00 ? 26  ASP A OD2  8  
ATOM 10426 H H    . ASP A 1 26  ? -8.359  9.269   -4.351  1.00 0.00 ? 26  ASP A H    8  
ATOM 10427 H HA   . ASP A 1 26  ? -9.866  10.315  -6.398  1.00 0.00 ? 26  ASP A HA   8  
ATOM 10428 H HB2  . ASP A 1 26  ? -7.540  10.874  -6.276  1.00 0.00 ? 26  ASP A HB2  8  
ATOM 10429 H HB3  . ASP A 1 26  ? -7.050  9.193   -6.222  1.00 0.00 ? 26  ASP A HB3  8  
ATOM 10430 N N    . PHE A 1 27  ? -9.474  7.099   -6.400  1.00 0.00 ? 27  PHE A N    8  
ATOM 10431 C CA   . PHE A 1 27  ? -9.821  5.839   -7.036  1.00 0.00 ? 27  PHE A CA   8  
ATOM 10432 C C    . PHE A 1 27  ? -11.254 5.428   -6.693  1.00 0.00 ? 27  PHE A C    8  
ATOM 10433 O O    . PHE A 1 27  ? -11.834 4.572   -7.359  1.00 0.00 ? 27  PHE A O    8  
ATOM 10434 C CB   . PHE A 1 27  ? -8.856  4.783   -6.492  1.00 0.00 ? 27  PHE A CB   8  
ATOM 10435 C CG   . PHE A 1 27  ? -7.449  4.859   -7.089  1.00 0.00 ? 27  PHE A CG   8  
ATOM 10436 C CD1  . PHE A 1 27  ? -6.718  5.999   -6.964  1.00 0.00 ? 27  PHE A CD1  8  
ATOM 10437 C CD2  . PHE A 1 27  ? -6.930  3.786   -7.744  1.00 0.00 ? 27  PHE A CD2  8  
ATOM 10438 C CE1  . PHE A 1 27  ? -5.413  6.069   -7.517  1.00 0.00 ? 27  PHE A CE1  8  
ATOM 10439 C CE2  . PHE A 1 27  ? -5.624  3.857   -8.298  1.00 0.00 ? 27  PHE A CE2  8  
ATOM 10440 C CZ   . PHE A 1 27  ? -4.893  4.997   -8.173  1.00 0.00 ? 27  PHE A CZ   8  
ATOM 10441 H H    . PHE A 1 27  ? -9.164  7.022   -5.452  1.00 0.00 ? 27  PHE A H    8  
ATOM 10442 H HA   . PHE A 1 27  ? -9.734  5.986   -8.113  1.00 0.00 ? 27  PHE A HA   8  
ATOM 10443 H HB2  . PHE A 1 27  ? -8.787  4.891   -5.410  1.00 0.00 ? 27  PHE A HB2  8  
ATOM 10444 H HB3  . PHE A 1 27  ? -9.269  3.793   -6.688  1.00 0.00 ? 27  PHE A HB3  8  
ATOM 10445 H HD1  . PHE A 1 27  ? -7.135  6.858   -6.438  1.00 0.00 ? 27  PHE A HD1  8  
ATOM 10446 H HD2  . PHE A 1 27  ? -7.516  2.873   -7.844  1.00 0.00 ? 27  PHE A HD2  8  
ATOM 10447 H HE1  . PHE A 1 27  ? -4.827  6.983   -7.417  1.00 0.00 ? 27  PHE A HE1  8  
ATOM 10448 H HE2  . PHE A 1 27  ? -5.208  2.997   -8.823  1.00 0.00 ? 27  PHE A HE2  8  
ATOM 10449 H HZ   . PHE A 1 27  ? -3.891  5.051   -8.597  1.00 0.00 ? 27  PHE A HZ   8  
ATOM 10450 N N    . ASN A 1 28  ? -11.784 6.058   -5.655  1.00 0.00 ? 28  ASN A N    8  
ATOM 10451 C CA   . ASN A 1 28  ? -13.138 5.769   -5.216  1.00 0.00 ? 28  ASN A CA   8  
ATOM 10452 C C    . ASN A 1 28  ? -13.184 4.365   -4.608  1.00 0.00 ? 28  ASN A C    8  
ATOM 10453 O O    . ASN A 1 28  ? -14.153 3.633   -4.801  1.00 0.00 ? 28  ASN A O    8  
ATOM 10454 C CB   . ASN A 1 28  ? -14.118 5.808   -6.390  1.00 0.00 ? 28  ASN A CB   8  
ATOM 10455 C CG   . ASN A 1 28  ? -15.361 6.628   -6.040  1.00 0.00 ? 28  ASN A CG   8  
ATOM 10456 O OD1  . ASN A 1 28  ? -15.319 7.839   -5.902  1.00 0.00 ? 28  ASN A OD1  8  
ATOM 10457 N ND2  . ASN A 1 28  ? -16.468 5.903   -5.906  1.00 0.00 ? 28  ASN A ND2  8  
ATOM 10458 H H    . ASN A 1 28  ? -11.305 6.753   -5.119  1.00 0.00 ? 28  ASN A H    8  
ATOM 10459 H HA   . ASN A 1 28  ? -13.376 6.546   -4.490  1.00 0.00 ? 28  ASN A HA   8  
ATOM 10460 H HB2  . ASN A 1 28  ? -13.628 6.238   -7.264  1.00 0.00 ? 28  ASN A HB2  8  
ATOM 10461 H HB3  . ASN A 1 28  ? -14.412 4.792   -6.658  1.00 0.00 ? 28  ASN A HB3  8  
ATOM 10462 H HD21 . ASN A 1 28  ? -16.435 4.911   -6.034  1.00 0.00 ? 28  ASN A HD21 8  
ATOM 10463 H HD22 . ASN A 1 28  ? -17.334 6.349   -5.678  1.00 0.00 ? 28  ASN A HD22 8  
ATOM 10464 N N    . MET A 1 29  ? -12.124 4.033   -3.887  1.00 0.00 ? 29  MET A N    8  
ATOM 10465 C CA   . MET A 1 29  ? -12.031 2.730   -3.250  1.00 0.00 ? 29  MET A CA   8  
ATOM 10466 C C    . MET A 1 29  ? -11.061 2.766   -2.067  1.00 0.00 ? 29  MET A C    8  
ATOM 10467 O O    . MET A 1 29  ? -10.281 3.707   -1.928  1.00 0.00 ? 29  MET A O    8  
ATOM 10468 C CB   . MET A 1 29  ? -11.554 1.695   -4.271  1.00 0.00 ? 29  MET A CB   8  
ATOM 10469 C CG   . MET A 1 29  ? -10.026 1.614   -4.295  1.00 0.00 ? 29  MET A CG   8  
ATOM 10470 S SD   . MET A 1 29  ? -9.497  0.458   -5.548  1.00 0.00 ? 29  MET A SD   8  
ATOM 10471 C CE   . MET A 1 29  ? -8.793  -0.817  -4.516  1.00 0.00 ? 29  MET A CE   8  
ATOM 10472 H H    . MET A 1 29  ? -11.340 4.634   -3.735  1.00 0.00 ? 29  MET A H    8  
ATOM 10473 H HA   . MET A 1 29  ? -13.037 2.504   -2.897  1.00 0.00 ? 29  MET A HA   8  
ATOM 10474 H HB2  . MET A 1 29  ? -11.970 0.718   -4.025  1.00 0.00 ? 29  MET A HB2  8  
ATOM 10475 H HB3  . MET A 1 29  ? -11.924 1.959   -5.261  1.00 0.00 ? 29  MET A HB3  8  
ATOM 10476 H HG2  . MET A 1 29  ? -9.604  2.598   -4.496  1.00 0.00 ? 29  MET A HG2  8  
ATOM 10477 H HG3  . MET A 1 29  ? -9.655  1.300   -3.320  1.00 0.00 ? 29  MET A HG3  8  
ATOM 10478 H HE1  . MET A 1 29  ? -9.216  -0.748  -3.514  1.00 0.00 ? 29  MET A HE1  8  
ATOM 10479 H HE2  . MET A 1 29  ? -9.022  -1.795  -4.940  1.00 0.00 ? 29  MET A HE2  8  
ATOM 10480 H HE3  . MET A 1 29  ? -7.712  -0.688  -4.465  1.00 0.00 ? 29  MET A HE3  8  
ATOM 10481 N N    . PRO A 1 30  ? -11.144 1.702   -1.223  1.00 0.00 ? 30  PRO A N    8  
ATOM 10482 C CA   . PRO A 1 30  ? -10.283 1.604   -0.057  1.00 0.00 ? 30  PRO A CA   8  
ATOM 10483 C C    . PRO A 1 30  ? -8.857  1.218   -0.459  1.00 0.00 ? 30  PRO A C    8  
ATOM 10484 O O    . PRO A 1 30  ? -8.646  0.617   -1.511  1.00 0.00 ? 30  PRO A O    8  
ATOM 10485 C CB   . PRO A 1 30  ? -10.948 0.570   0.836   1.00 0.00 ? 30  PRO A CB   8  
ATOM 10486 C CG   . PRO A 1 30  ? -11.897 -0.208  -0.061  1.00 0.00 ? 30  PRO A CG   8  
ATOM 10487 C CD   . PRO A 1 30  ? -12.056 0.570   -1.357  1.00 0.00 ? 30  PRO A CD   8  
ATOM 10488 H HA   . PRO A 1 30  ? -10.208 2.492   0.396   1.00 0.00 ? 30  PRO A HA   8  
ATOM 10489 H HB2  . PRO A 1 30  ? -10.207 -0.091  1.287   1.00 0.00 ? 30  PRO A HB2  8  
ATOM 10490 H HB3  . PRO A 1 30  ? -11.487 1.049   1.654   1.00 0.00 ? 30  PRO A HB3  8  
ATOM 10491 H HG2  . PRO A 1 30  ? -11.504 -1.205  -0.259  1.00 0.00 ? 30  PRO A HG2  8  
ATOM 10492 H HG3  . PRO A 1 30  ? -12.863 -0.337  0.427   1.00 0.00 ? 30  PRO A HG3  8  
ATOM 10493 H HD2  . PRO A 1 30  ? -11.801 -0.044  -2.221  1.00 0.00 ? 30  PRO A HD2  8  
ATOM 10494 H HD3  . PRO A 1 30  ? -13.084 0.904   -1.495  1.00 0.00 ? 30  PRO A HD3  8  
ATOM 10495 N N    . LEU A 1 31  ? -7.916  1.580   0.400   1.00 0.00 ? 31  LEU A N    8  
ATOM 10496 C CA   . LEU A 1 31  ? -6.517  1.280   0.148   1.00 0.00 ? 31  LEU A CA   8  
ATOM 10497 C C    . LEU A 1 31  ? -6.264  -0.206  0.410   1.00 0.00 ? 31  LEU A C    8  
ATOM 10498 O O    . LEU A 1 31  ? -6.345  -0.662  1.549   1.00 0.00 ? 31  LEU A O    8  
ATOM 10499 C CB   . LEU A 1 31  ? -5.614  2.210   0.961   1.00 0.00 ? 31  LEU A CB   8  
ATOM 10500 C CG   . LEU A 1 31  ? -5.440  3.627   0.409   1.00 0.00 ? 31  LEU A CG   8  
ATOM 10501 C CD1  . LEU A 1 31  ? -5.228  4.634   1.540   1.00 0.00 ? 31  LEU A CD1  8  
ATOM 10502 C CD2  . LEU A 1 31  ? -4.312  3.678   -0.624  1.00 0.00 ? 31  LEU A CD2  8  
ATOM 10503 H H    . LEU A 1 31  ? -8.096  2.069   1.254   1.00 0.00 ? 31  LEU A H    8  
ATOM 10504 H HA   . LEU A 1 31  ? -6.324  1.483   -0.905  1.00 0.00 ? 31  LEU A HA   8  
ATOM 10505 H HB2  . LEU A 1 31  ? -6.016  2.283   1.971   1.00 0.00 ? 31  LEU A HB2  8  
ATOM 10506 H HB3  . LEU A 1 31  ? -4.630  1.750   1.041   1.00 0.00 ? 31  LEU A HB3  8  
ATOM 10507 H HG   . LEU A 1 31  ? -6.359  3.909   -0.105  1.00 0.00 ? 31  LEU A HG   8  
ATOM 10508 H HD11 . LEU A 1 31  ? -5.815  4.335   2.408   1.00 0.00 ? 31  LEU A HD11 8  
ATOM 10509 H HD12 . LEU A 1 31  ? -4.171  4.662   1.809   1.00 0.00 ? 31  LEU A HD12 8  
ATOM 10510 H HD13 . LEU A 1 31  ? -5.545  5.623   1.211   1.00 0.00 ? 31  LEU A HD13 8  
ATOM 10511 H HD21 . LEU A 1 31  ? -3.351  3.586   -0.117  1.00 0.00 ? 31  LEU A HD21 8  
ATOM 10512 H HD22 . LEU A 1 31  ? -4.430  2.857   -1.331  1.00 0.00 ? 31  LEU A HD22 8  
ATOM 10513 H HD23 . LEU A 1 31  ? -4.352  4.627   -1.158  1.00 0.00 ? 31  LEU A HD23 8  
ATOM 10514 N N    . THR A 1 32  ? -5.961  -0.920  -0.664  1.00 0.00 ? 32  THR A N    8  
ATOM 10515 C CA   . THR A 1 32  ? -5.695  -2.345  -0.565  1.00 0.00 ? 32  THR A CA   8  
ATOM 10516 C C    . THR A 1 32  ? -4.294  -2.664  -1.091  1.00 0.00 ? 32  THR A C    8  
ATOM 10517 O O    . THR A 1 32  ? -3.654  -1.819  -1.714  1.00 0.00 ? 32  THR A O    8  
ATOM 10518 C CB   . THR A 1 32  ? -6.807  -3.087  -1.310  1.00 0.00 ? 32  THR A CB   8  
ATOM 10519 O OG1  . THR A 1 32  ? -7.211  -2.175  -2.327  1.00 0.00 ? 32  THR A OG1  8  
ATOM 10520 C CG2  . THR A 1 32  ? -8.062  -3.271  -0.455  1.00 0.00 ? 32  THR A CG2  8  
ATOM 10521 H H    . THR A 1 32  ? -5.897  -0.542  -1.588  1.00 0.00 ? 32  THR A H    8  
ATOM 10522 H HA   . THR A 1 32  ? -5.713  -2.625  0.488   1.00 0.00 ? 32  THR A HA   8  
ATOM 10523 H HB   . THR A 1 32  ? -6.450  -4.044  -1.689  1.00 0.00 ? 32  THR A HB   8  
ATOM 10524 H HG1  . THR A 1 32  ? -8.014  -2.530  -2.806  1.00 0.00 ? 32  THR A HG1  8  
ATOM 10525 H HG21 . THR A 1 32  ? -7.936  -4.139  0.193   1.00 0.00 ? 32  THR A HG21 8  
ATOM 10526 H HG22 . THR A 1 32  ? -8.220  -2.382  0.155   1.00 0.00 ? 32  THR A HG22 8  
ATOM 10527 H HG23 . THR A 1 32  ? -8.924  -3.425  -1.104  1.00 0.00 ? 32  THR A HG23 8  
ATOM 10528 N N    . ILE A 1 33  ? -3.859  -3.886  -0.819  1.00 0.00 ? 33  ILE A N    8  
ATOM 10529 C CA   . ILE A 1 33  ? -2.546  -4.327  -1.257  1.00 0.00 ? 33  ILE A CA   8  
ATOM 10530 C C    . ILE A 1 33  ? -2.604  -4.694  -2.741  1.00 0.00 ? 33  ILE A C    8  
ATOM 10531 O O    . ILE A 1 33  ? -3.139  -5.741  -3.104  1.00 0.00 ? 33  ILE A O    8  
ATOM 10532 C CB   . ILE A 1 33  ? -2.035  -5.459  -0.363  1.00 0.00 ? 33  ILE A CB   8  
ATOM 10533 C CG1  . ILE A 1 33  ? -1.859  -4.981  1.080   1.00 0.00 ? 33  ILE A CG1  8  
ATOM 10534 C CG2  . ILE A 1 33  ? -0.748  -6.065  -0.927  1.00 0.00 ? 33  ILE A CG2  8  
ATOM 10535 C CD1  . ILE A 1 33  ? -0.693  -3.996  1.193   1.00 0.00 ? 33  ILE A CD1  8  
ATOM 10536 H H    . ILE A 1 33  ? -4.386  -4.567  -0.311  1.00 0.00 ? 33  ILE A H    8  
ATOM 10537 H HA   . ILE A 1 33  ? -1.862  -3.487  -1.136  1.00 0.00 ? 33  ILE A HA   8  
ATOM 10538 H HB   . ILE A 1 33  ? -2.785  -6.249  -0.351  1.00 0.00 ? 33  ILE A HB   8  
ATOM 10539 H HG12 . ILE A 1 33  ? -2.777  -4.504  1.423   1.00 0.00 ? 33  ILE A HG12 8  
ATOM 10540 H HG13 . ILE A 1 33  ? -1.682  -5.836  1.731   1.00 0.00 ? 33  ILE A HG13 8  
ATOM 10541 H HG21 . ILE A 1 33  ? -0.559  -5.657  -1.920  1.00 0.00 ? 33  ILE A HG21 8  
ATOM 10542 H HG22 . ILE A 1 33  ? 0.086   -5.822  -0.269  1.00 0.00 ? 33  ILE A HG22 8  
ATOM 10543 H HG23 . ILE A 1 33  ? -0.856  -7.148  -0.993  1.00 0.00 ? 33  ILE A HG23 8  
ATOM 10544 H HD11 . ILE A 1 33  ? 0.091   -4.431  1.813   1.00 0.00 ? 33  ILE A HD11 8  
ATOM 10545 H HD12 . ILE A 1 33  ? -0.296  -3.788  0.200   1.00 0.00 ? 33  ILE A HD12 8  
ATOM 10546 H HD13 . ILE A 1 33  ? -1.043  -3.069  1.647   1.00 0.00 ? 33  ILE A HD13 8  
ATOM 10547 N N    . SER A 1 34  ? -2.047  -3.813  -3.558  1.00 0.00 ? 34  SER A N    8  
ATOM 10548 C CA   . SER A 1 34  ? -2.029  -4.032  -4.995  1.00 0.00 ? 34  SER A CA   8  
ATOM 10549 C C    . SER A 1 34  ? -1.530  -5.445  -5.303  1.00 0.00 ? 34  SER A C    8  
ATOM 10550 O O    . SER A 1 34  ? -2.261  -6.254  -5.873  1.00 0.00 ? 34  SER A O    8  
ATOM 10551 C CB   . SER A 1 34  ? -1.152  -2.995  -5.699  1.00 0.00 ? 34  SER A CB   8  
ATOM 10552 O OG   . SER A 1 34  ? -0.192  -3.603  -6.559  1.00 0.00 ? 34  SER A OG   8  
ATOM 10553 H H    . SER A 1 34  ? -1.613  -2.965  -3.255  1.00 0.00 ? 34  SER A H    8  
ATOM 10554 H HA   . SER A 1 34  ? -3.063  -3.912  -5.318  1.00 0.00 ? 34  SER A HA   8  
ATOM 10555 H HB2  . SER A 1 34  ? -1.782  -2.321  -6.279  1.00 0.00 ? 34  SER A HB2  8  
ATOM 10556 H HB3  . SER A 1 34  ? -0.638  -2.388  -4.953  1.00 0.00 ? 34  SER A HB3  8  
ATOM 10557 H HG   . SER A 1 34  ? -0.655  -4.107  -7.287  1.00 0.00 ? 34  SER A HG   8  
ATOM 10558 N N    . SER A 1 35  ? -0.290  -5.699  -4.912  1.00 0.00 ? 35  SER A N    8  
ATOM 10559 C CA   . SER A 1 35  ? 0.315   -7.001  -5.139  1.00 0.00 ? 35  SER A CA   8  
ATOM 10560 C C    . SER A 1 35  ? 1.331   -7.306  -4.037  1.00 0.00 ? 35  SER A C    8  
ATOM 10561 O O    . SER A 1 35  ? 1.603   -6.459  -3.188  1.00 0.00 ? 35  SER A O    8  
ATOM 10562 C CB   . SER A 1 35  ? 0.987   -7.064  -6.513  1.00 0.00 ? 35  SER A CB   8  
ATOM 10563 O OG   . SER A 1 35  ? 0.313   -7.955  -7.396  1.00 0.00 ? 35  SER A OG   8  
ATOM 10564 H H    . SER A 1 35  ? 0.298   -5.035  -4.449  1.00 0.00 ? 35  SER A H    8  
ATOM 10565 H HA   . SER A 1 35  ? -0.511  -7.712  -5.107  1.00 0.00 ? 35  SER A HA   8  
ATOM 10566 H HB2  . SER A 1 35  ? 1.009   -6.066  -6.951  1.00 0.00 ? 35  SER A HB2  8  
ATOM 10567 H HB3  . SER A 1 35  ? 2.022   -7.383  -6.395  1.00 0.00 ? 35  SER A HB3  8  
ATOM 10568 H HG   . SER A 1 35  ? -0.441  -7.481  -7.852  1.00 0.00 ? 35  SER A HG   8  
ATOM 10569 N N    . LEU A 1 36  ? 1.863   -8.518  -4.086  1.00 0.00 ? 36  LEU A N    8  
ATOM 10570 C CA   . LEU A 1 36  ? 2.843   -8.945  -3.101  1.00 0.00 ? 36  LEU A CA   8  
ATOM 10571 C C    . LEU A 1 36  ? 4.150   -9.304  -3.812  1.00 0.00 ? 36  LEU A C    8  
ATOM 10572 O O    . LEU A 1 36  ? 4.144   -9.655  -4.991  1.00 0.00 ? 36  LEU A O    8  
ATOM 10573 C CB   . LEU A 1 36  ? 2.279   -10.078 -2.241  1.00 0.00 ? 36  LEU A CB   8  
ATOM 10574 C CG   . LEU A 1 36  ? 2.111   -9.769  -0.752  1.00 0.00 ? 36  LEU A CG   8  
ATOM 10575 C CD1  . LEU A 1 36  ? 3.411   -10.027 0.012   1.00 0.00 ? 36  LEU A CD1  8  
ATOM 10576 C CD2  . LEU A 1 36  ? 1.597   -8.343  -0.542  1.00 0.00 ? 36  LEU A CD2  8  
ATOM 10577 H H    . LEU A 1 36  ? 1.636   -9.201  -4.780  1.00 0.00 ? 36  LEU A H    8  
ATOM 10578 H HA   . LEU A 1 36  ? 3.031   -8.100  -2.439  1.00 0.00 ? 36  LEU A HA   8  
ATOM 10579 H HB2  . LEU A 1 36  ? 1.308   -10.365 -2.644  1.00 0.00 ? 36  LEU A HB2  8  
ATOM 10580 H HB3  . LEU A 1 36  ? 2.934   -10.943 -2.340  1.00 0.00 ? 36  LEU A HB3  8  
ATOM 10581 H HG   . LEU A 1 36  ? 1.359   -10.445 -0.345  1.00 0.00 ? 36  LEU A HG   8  
ATOM 10582 H HD11 . LEU A 1 36  ? 3.840   -9.077  0.331   1.00 0.00 ? 36  LEU A HD11 8  
ATOM 10583 H HD12 . LEU A 1 36  ? 3.203   -10.643 0.886   1.00 0.00 ? 36  LEU A HD12 8  
ATOM 10584 H HD13 . LEU A 1 36  ? 4.118   -10.545 -0.637  1.00 0.00 ? 36  LEU A HD13 8  
ATOM 10585 H HD21 . LEU A 1 36  ? 2.432   -7.644  -0.593  1.00 0.00 ? 36  LEU A HD21 8  
ATOM 10586 H HD22 . LEU A 1 36  ? 0.873   -8.100  -1.320  1.00 0.00 ? 36  LEU A HD22 8  
ATOM 10587 H HD23 . LEU A 1 36  ? 1.119   -8.269  0.435   1.00 0.00 ? 36  LEU A HD23 8  
ATOM 10588 N N    . LYS A 1 37  ? 5.239   -9.204  -3.064  1.00 0.00 ? 37  LYS A N    8  
ATOM 10589 C CA   . LYS A 1 37  ? 6.551   -9.514  -3.607  1.00 0.00 ? 37  LYS A CA   8  
ATOM 10590 C C    . LYS A 1 37  ? 6.960   -10.921 -3.168  1.00 0.00 ? 37  LYS A C    8  
ATOM 10591 O O    . LYS A 1 37  ? 6.801   -11.283 -2.003  1.00 0.00 ? 37  LYS A O    8  
ATOM 10592 C CB   . LYS A 1 37  ? 7.560   -8.431  -3.222  1.00 0.00 ? 37  LYS A CB   8  
ATOM 10593 C CG   . LYS A 1 37  ? 8.931   -8.713  -3.841  1.00 0.00 ? 37  LYS A CG   8  
ATOM 10594 C CD   . LYS A 1 37  ? 9.331   -7.604  -4.816  1.00 0.00 ? 37  LYS A CD   8  
ATOM 10595 C CE   . LYS A 1 37  ? 9.334   -8.117  -6.257  1.00 0.00 ? 37  LYS A CE   8  
ATOM 10596 N NZ   . LYS A 1 37  ? 7.955   -8.168  -6.792  1.00 0.00 ? 37  LYS A NZ   8  
ATOM 10597 H H    . LYS A 1 37  ? 5.235   -8.918  -2.106  1.00 0.00 ? 37  LYS A H    8  
ATOM 10598 H HA   . LYS A 1 37  ? 6.465   -9.503  -4.694  1.00 0.00 ? 37  LYS A HA   8  
ATOM 10599 H HB2  . LYS A 1 37  ? 7.200   -7.458  -3.555  1.00 0.00 ? 37  LYS A HB2  8  
ATOM 10600 H HB3  . LYS A 1 37  ? 7.650   -8.383  -2.137  1.00 0.00 ? 37  LYS A HB3  8  
ATOM 10601 H HG2  . LYS A 1 37  ? 9.679   -8.797  -3.053  1.00 0.00 ? 37  LYS A HG2  8  
ATOM 10602 H HG3  . LYS A 1 37  ? 8.908   -9.670  -4.362  1.00 0.00 ? 37  LYS A HG3  8  
ATOM 10603 H HD2  . LYS A 1 37  ? 8.638   -6.768  -4.725  1.00 0.00 ? 37  LYS A HD2  8  
ATOM 10604 H HD3  . LYS A 1 37  ? 10.321  -7.228  -4.557  1.00 0.00 ? 37  LYS A HD3  8  
ATOM 10605 H HE2  . LYS A 1 37  ? 9.948   -7.466  -6.879  1.00 0.00 ? 37  LYS A HE2  8  
ATOM 10606 H HE3  . LYS A 1 37  ? 9.783   -9.110  -6.296  1.00 0.00 ? 37  LYS A HE3  8  
ATOM 10607 H HZ1  . LYS A 1 37  ? 7.978   -8.473  -7.745  1.00 0.00 ? 37  LYS A HZ1  8  
ATOM 10608 H HZ2  . LYS A 1 37  ? 7.411   -8.809  -6.251  1.00 0.00 ? 37  LYS A HZ2  8  
ATOM 10609 H HZ3  . LYS A 1 37  ? 7.544   -7.258  -6.743  1.00 0.00 ? 37  LYS A HZ3  8  
ATOM 10610 N N    . ASP A 1 38  ? 7.481   -11.677 -4.124  1.00 0.00 ? 38  ASP A N    8  
ATOM 10611 C CA   . ASP A 1 38  ? 7.915   -13.036 -3.850  1.00 0.00 ? 38  ASP A CA   8  
ATOM 10612 C C    . ASP A 1 38  ? 8.807   -13.042 -2.607  1.00 0.00 ? 38  ASP A C    8  
ATOM 10613 O O    . ASP A 1 38  ? 9.819   -12.343 -2.561  1.00 0.00 ? 38  ASP A O    8  
ATOM 10614 C CB   . ASP A 1 38  ? 8.727   -13.601 -5.017  1.00 0.00 ? 38  ASP A CB   8  
ATOM 10615 C CG   . ASP A 1 38  ? 9.281   -15.010 -4.798  1.00 0.00 ? 38  ASP A CG   8  
ATOM 10616 O OD1  . ASP A 1 38  ? 8.531   -15.832 -4.228  1.00 0.00 ? 38  ASP A OD1  8  
ATOM 10617 O OD2  . ASP A 1 38  ? 10.441  -15.234 -5.205  1.00 0.00 ? 38  ASP A OD2  8  
ATOM 10618 H H    . ASP A 1 38  ? 7.608   -11.375 -5.069  1.00 0.00 ? 38  ASP A H    8  
ATOM 10619 H HA   . ASP A 1 38  ? 6.997   -13.607 -3.707  1.00 0.00 ? 38  ASP A HA   8  
ATOM 10620 H HB2  . ASP A 1 38  ? 8.098   -13.608 -5.908  1.00 0.00 ? 38  ASP A HB2  8  
ATOM 10621 H HB3  . ASP A 1 38  ? 9.559   -12.927 -5.220  1.00 0.00 ? 38  ASP A HB3  8  
ATOM 10622 N N    . GLY A 1 39  ? 8.400   -13.837 -1.629  1.00 0.00 ? 39  GLY A N    8  
ATOM 10623 C CA   . GLY A 1 39  ? 9.149   -13.943 -0.389  1.00 0.00 ? 39  GLY A CA   8  
ATOM 10624 C C    . GLY A 1 39  ? 9.588   -12.563 0.106   1.00 0.00 ? 39  GLY A C    8  
ATOM 10625 O O    . GLY A 1 39  ? 10.761  -12.353 0.410   1.00 0.00 ? 39  GLY A O    8  
ATOM 10626 H H    . GLY A 1 39  ? 7.576   -14.402 -1.674  1.00 0.00 ? 39  GLY A H    8  
ATOM 10627 H HA2  . GLY A 1 39  ? 8.536   -14.427 0.371   1.00 0.00 ? 39  GLY A HA2  8  
ATOM 10628 H HA3  . GLY A 1 39  ? 10.025  -14.574 -0.542  1.00 0.00 ? 39  GLY A HA3  8  
ATOM 10629 N N    . GLY A 1 40  ? 8.622   -11.659 0.171   1.00 0.00 ? 40  GLY A N    8  
ATOM 10630 C CA   . GLY A 1 40  ? 8.894   -10.305 0.623   1.00 0.00 ? 40  GLY A CA   8  
ATOM 10631 C C    . GLY A 1 40  ? 8.515   -10.132 2.096   1.00 0.00 ? 40  GLY A C    8  
ATOM 10632 O O    . GLY A 1 40  ? 8.041   -11.072 2.733   1.00 0.00 ? 40  GLY A O    8  
ATOM 10633 H H    . GLY A 1 40  ? 7.670   -11.838 -0.078  1.00 0.00 ? 40  GLY A H    8  
ATOM 10634 H HA2  . GLY A 1 40  ? 9.951   -10.077 0.487   1.00 0.00 ? 40  GLY A HA2  8  
ATOM 10635 H HA3  . GLY A 1 40  ? 8.334   -9.595  0.015   1.00 0.00 ? 40  GLY A HA3  8  
ATOM 10636 N N    . LYS A 1 41  ? 8.738   -8.925  2.593   1.00 0.00 ? 41  LYS A N    8  
ATOM 10637 C CA   . LYS A 1 41  ? 8.425   -8.617  3.979   1.00 0.00 ? 41  LYS A CA   8  
ATOM 10638 C C    . LYS A 1 41  ? 6.919   -8.764  4.202   1.00 0.00 ? 41  LYS A C    8  
ATOM 10639 O O    . LYS A 1 41  ? 6.487   -9.529  5.063   1.00 0.00 ? 41  LYS A O    8  
ATOM 10640 C CB   . LYS A 1 41  ? 8.972   -7.239  4.358   1.00 0.00 ? 41  LYS A CB   8  
ATOM 10641 C CG   . LYS A 1 41  ? 10.474  -7.304  4.642   1.00 0.00 ? 41  LYS A CG   8  
ATOM 10642 C CD   . LYS A 1 41  ? 10.824  -6.544  5.923   1.00 0.00 ? 41  LYS A CD   8  
ATOM 10643 C CE   . LYS A 1 41  ? 11.090  -7.511  7.078   1.00 0.00 ? 41  LYS A CE   8  
ATOM 10644 N NZ   . LYS A 1 41  ? 10.247  -7.168  8.246   1.00 0.00 ? 41  LYS A NZ   8  
ATOM 10645 H H    . LYS A 1 41  ? 9.123   -8.166  2.069   1.00 0.00 ? 41  LYS A H    8  
ATOM 10646 H HA   . LYS A 1 41  ? 8.940   -9.350  4.600   1.00 0.00 ? 41  LYS A HA   8  
ATOM 10647 H HB2  . LYS A 1 41  ? 8.781   -6.533  3.550   1.00 0.00 ? 41  LYS A HB2  8  
ATOM 10648 H HB3  . LYS A 1 41  ? 8.448   -6.865  5.237   1.00 0.00 ? 41  LYS A HB3  8  
ATOM 10649 H HG2  . LYS A 1 41  ? 10.785  -8.345  4.736   1.00 0.00 ? 41  LYS A HG2  8  
ATOM 10650 H HG3  . LYS A 1 41  ? 11.025  -6.881  3.802   1.00 0.00 ? 41  LYS A HG3  8  
ATOM 10651 H HD2  . LYS A 1 41  ? 11.703  -5.923  5.753   1.00 0.00 ? 41  LYS A HD2  8  
ATOM 10652 H HD3  . LYS A 1 41  ? 10.006  -5.873  6.186   1.00 0.00 ? 41  LYS A HD3  8  
ATOM 10653 H HE2  . LYS A 1 41  ? 10.883  -8.532  6.761   1.00 0.00 ? 41  LYS A HE2  8  
ATOM 10654 H HE3  . LYS A 1 41  ? 12.143  -7.471  7.358   1.00 0.00 ? 41  LYS A HE3  8  
ATOM 10655 H HZ1  . LYS A 1 41  ? 9.993   -8.004  8.730   1.00 0.00 ? 41  LYS A HZ1  8  
ATOM 10656 H HZ2  . LYS A 1 41  ? 10.759  -6.568  8.861   1.00 0.00 ? 41  LYS A HZ2  8  
ATOM 10657 H HZ3  . LYS A 1 41  ? 9.421   -6.698  7.934   1.00 0.00 ? 41  LYS A HZ3  8  
ATOM 10658 N N    . ALA A 1 42  ? 6.160   -8.018  3.412   1.00 0.00 ? 42  ALA A N    8  
ATOM 10659 C CA   . ALA A 1 42  ? 4.711   -8.056  3.513   1.00 0.00 ? 42  ALA A CA   8  
ATOM 10660 C C    . ALA A 1 42  ? 4.255   -9.504  3.698   1.00 0.00 ? 42  ALA A C    8  
ATOM 10661 O O    . ALA A 1 42  ? 3.653   -9.844  4.716   1.00 0.00 ? 42  ALA A O    8  
ATOM 10662 C CB   . ALA A 1 42  ? 4.096   -7.405  2.272   1.00 0.00 ? 42  ALA A CB   8  
ATOM 10663 H H    . ALA A 1 42  ? 6.520   -7.399  2.714   1.00 0.00 ? 42  ALA A H    8  
ATOM 10664 H HA   . ALA A 1 42  ? 4.425   -7.478  4.391   1.00 0.00 ? 42  ALA A HA   8  
ATOM 10665 H HB1  . ALA A 1 42  ? 3.733   -6.409  2.527   1.00 0.00 ? 42  ALA A HB1  8  
ATOM 10666 H HB2  . ALA A 1 42  ? 4.852   -7.327  1.490   1.00 0.00 ? 42  ALA A HB2  8  
ATOM 10667 H HB3  . ALA A 1 42  ? 3.266   -8.015  1.916   1.00 0.00 ? 42  ALA A HB3  8  
ATOM 10668 N N    . SER A 1 43  ? 4.558   -10.320 2.699   1.00 0.00 ? 43  SER A N    8  
ATOM 10669 C CA   . SER A 1 43  ? 4.186   -11.724 2.739   1.00 0.00 ? 43  SER A CA   8  
ATOM 10670 C C    . SER A 1 43  ? 4.564   -12.326 4.094   1.00 0.00 ? 43  SER A C    8  
ATOM 10671 O O    . SER A 1 43  ? 3.751   -12.999 4.726   1.00 0.00 ? 43  SER A O    8  
ATOM 10672 C CB   . SER A 1 43  ? 4.856   -12.503 1.606   1.00 0.00 ? 43  SER A CB   8  
ATOM 10673 O OG   . SER A 1 43  ? 4.472   -13.876 1.603   1.00 0.00 ? 43  SER A OG   8  
ATOM 10674 H H    . SER A 1 43  ? 5.048   -10.036 1.874   1.00 0.00 ? 43  SER A H    8  
ATOM 10675 H HA   . SER A 1 43  ? 3.105   -11.740 2.601   1.00 0.00 ? 43  SER A HA   8  
ATOM 10676 H HB2  . SER A 1 43  ? 4.593   -12.051 0.649   1.00 0.00 ? 43  SER A HB2  8  
ATOM 10677 H HB3  . SER A 1 43  ? 5.939   -12.430 1.706   1.00 0.00 ? 43  SER A HB3  8  
ATOM 10678 H HG   . SER A 1 43  ? 3.924   -14.076 0.791   1.00 0.00 ? 43  SER A HG   8  
ATOM 10679 N N    . GLN A 1 44  ? 5.798   -12.064 4.499   1.00 0.00 ? 44  GLN A N    8  
ATOM 10680 C CA   . GLN A 1 44  ? 6.293   -12.572 5.767   1.00 0.00 ? 44  GLN A CA   8  
ATOM 10681 C C    . GLN A 1 44  ? 5.395   -12.103 6.914   1.00 0.00 ? 44  GLN A C    8  
ATOM 10682 O O    . GLN A 1 44  ? 5.301   -12.768 7.944   1.00 0.00 ? 44  GLN A O    8  
ATOM 10683 C CB   . GLN A 1 44  ? 7.745   -12.147 5.998   1.00 0.00 ? 44  GLN A CB   8  
ATOM 10684 C CG   . GLN A 1 44  ? 8.716   -13.160 5.389   1.00 0.00 ? 44  GLN A CG   8  
ATOM 10685 C CD   . GLN A 1 44  ? 10.158  -12.852 5.798   1.00 0.00 ? 44  GLN A CD   8  
ATOM 10686 O OE1  . GLN A 1 44  ? 10.966  -12.384 5.013   1.00 0.00 ? 44  GLN A OE1  8  
ATOM 10687 N NE2  . GLN A 1 44  ? 10.433  -13.139 7.067   1.00 0.00 ? 44  GLN A NE2  8  
ATOM 10688 H H    . GLN A 1 44  ? 6.453   -11.516 3.978   1.00 0.00 ? 44  GLN A H    8  
ATOM 10689 H HA   . GLN A 1 44  ? 6.248   -13.657 5.681   1.00 0.00 ? 44  GLN A HA   8  
ATOM 10690 H HB2  . GLN A 1 44  ? 7.915   -11.165 5.558   1.00 0.00 ? 44  GLN A HB2  8  
ATOM 10691 H HB3  . GLN A 1 44  ? 7.934   -12.054 7.068   1.00 0.00 ? 44  GLN A HB3  8  
ATOM 10692 H HG2  . GLN A 1 44  ? 8.449   -14.166 5.714   1.00 0.00 ? 44  GLN A HG2  8  
ATOM 10693 H HG3  . GLN A 1 44  ? 8.631   -13.143 4.302   1.00 0.00 ? 44  GLN A HG3  8  
ATOM 10694 H HE21 . GLN A 1 44  ? 9.724   -13.522 7.658   1.00 0.00 ? 44  GLN A HE21 8  
ATOM 10695 H HE22 . GLN A 1 44  ? 11.351  -12.973 7.429   1.00 0.00 ? 44  GLN A HE22 8  
ATOM 10696 N N    . ALA A 1 45  ? 4.759   -10.961 6.696   1.00 0.00 ? 45  ALA A N    8  
ATOM 10697 C CA   . ALA A 1 45  ? 3.872   -10.396 7.699   1.00 0.00 ? 45  ALA A CA   8  
ATOM 10698 C C    . ALA A 1 45  ? 2.468   -10.974 7.515   1.00 0.00 ? 45  ALA A C    8  
ATOM 10699 O O    . ALA A 1 45  ? 1.508   -10.484 8.109   1.00 0.00 ? 45  ALA A O    8  
ATOM 10700 C CB   . ALA A 1 45  ? 3.893   -8.870  7.596   1.00 0.00 ? 45  ALA A CB   8  
ATOM 10701 H H    . ALA A 1 45  ? 4.842   -10.427 5.855   1.00 0.00 ? 45  ALA A H    8  
ATOM 10702 H HA   . ALA A 1 45  ? 4.251   -10.687 8.679   1.00 0.00 ? 45  ALA A HA   8  
ATOM 10703 H HB1  . ALA A 1 45  ? 2.949   -8.468  7.965   1.00 0.00 ? 45  ALA A HB1  8  
ATOM 10704 H HB2  . ALA A 1 45  ? 4.714   -8.476  8.196   1.00 0.00 ? 45  ALA A HB2  8  
ATOM 10705 H HB3  . ALA A 1 45  ? 4.030   -8.577  6.555   1.00 0.00 ? 45  ALA A HB3  8  
ATOM 10706 N N    . HIS A 1 46  ? 2.391   -12.007 6.689   1.00 0.00 ? 46  HIS A N    8  
ATOM 10707 C CA   . HIS A 1 46  ? 1.119   -12.656 6.419   1.00 0.00 ? 46  HIS A CA   8  
ATOM 10708 C C    . HIS A 1 46  ? 0.155   -11.653 5.783   1.00 0.00 ? 46  HIS A C    8  
ATOM 10709 O O    . HIS A 1 46  ? -1.043  -11.676 6.061   1.00 0.00 ? 46  HIS A O    8  
ATOM 10710 C CB   . HIS A 1 46  ? 0.556   -13.297 7.689   1.00 0.00 ? 46  HIS A CB   8  
ATOM 10711 C CG   . HIS A 1 46  ? 1.385   -14.443 8.218   1.00 0.00 ? 46  HIS A CG   8  
ATOM 10712 N ND1  . HIS A 1 46  ? 0.934   -15.751 8.231   1.00 0.00 ? 46  HIS A ND1  8  
ATOM 10713 C CD2  . HIS A 1 46  ? 2.640   -14.463 8.752   1.00 0.00 ? 46  HIS A CD2  8  
ATOM 10714 C CE1  . HIS A 1 46  ? 1.883   -16.515 8.752   1.00 0.00 ? 46  HIS A CE1  8  
ATOM 10715 N NE2  . HIS A 1 46  ? 2.939   -15.715 9.074   1.00 0.00 ? 46  HIS A NE2  8  
ATOM 10716 H H    . HIS A 1 46  ? 3.176   -12.399 6.209   1.00 0.00 ? 46  HIS A H    8  
ATOM 10717 H HA   . HIS A 1 46  ? 1.321   -13.455 5.705   1.00 0.00 ? 46  HIS A HA   8  
ATOM 10718 H HB2  . HIS A 1 46  ? 0.474   -12.534 8.463   1.00 0.00 ? 46  HIS A HB2  8  
ATOM 10719 H HB3  . HIS A 1 46  ? -0.453  -13.655 7.486   1.00 0.00 ? 46  HIS A HB3  8  
ATOM 10720 H HD1  . HIS A 1 46  ? 0.044   -16.066 7.903   1.00 0.00 ? 46  HIS A HD1  8  
ATOM 10721 H HD2  . HIS A 1 46  ? 3.288   -13.597 8.890   1.00 0.00 ? 46  HIS A HD2  8  
ATOM 10722 H HE1  . HIS A 1 46  ? 1.829   -17.594 8.897   1.00 0.00 ? 46  HIS A HE1  8  
ATOM 10723 N N    . VAL A 1 47  ? 0.714   -10.795 4.942   1.00 0.00 ? 47  VAL A N    8  
ATOM 10724 C CA   . VAL A 1 47  ? -0.082  -9.785  4.265   1.00 0.00 ? 47  VAL A CA   8  
ATOM 10725 C C    . VAL A 1 47  ? -0.503  -10.311 2.891   1.00 0.00 ? 47  VAL A C    8  
ATOM 10726 O O    . VAL A 1 47  ? 0.327   -10.453 1.995   1.00 0.00 ? 47  VAL A O    8  
ATOM 10727 C CB   . VAL A 1 47  ? 0.697   -8.470  4.189   1.00 0.00 ? 47  VAL A CB   8  
ATOM 10728 C CG1  . VAL A 1 47  ? -0.069  -7.426  3.373   1.00 0.00 ? 47  VAL A CG1  8  
ATOM 10729 C CG2  . VAL A 1 47  ? 1.021   -7.943  5.588   1.00 0.00 ? 47  VAL A CG2  8  
ATOM 10730 H H    . VAL A 1 47  ? 1.689   -10.783 4.722   1.00 0.00 ? 47  VAL A H    8  
ATOM 10731 H HA   . VAL A 1 47  ? -0.976  -9.614  4.865   1.00 0.00 ? 47  VAL A HA   8  
ATOM 10732 H HB   . VAL A 1 47  ? 1.640   -8.668  3.679   1.00 0.00 ? 47  VAL A HB   8  
ATOM 10733 H HG11 . VAL A 1 47  ? -1.013  -7.852  3.033   1.00 0.00 ? 47  VAL A HG11 8  
ATOM 10734 H HG12 . VAL A 1 47  ? -0.266  -6.553  3.994   1.00 0.00 ? 47  VAL A HG12 8  
ATOM 10735 H HG13 . VAL A 1 47  ? 0.528   -7.131  2.510   1.00 0.00 ? 47  VAL A HG13 8  
ATOM 10736 H HG21 . VAL A 1 47  ? 2.041   -8.220  5.853   1.00 0.00 ? 47  VAL A HG21 8  
ATOM 10737 H HG22 . VAL A 1 47  ? 0.925   -6.857  5.598   1.00 0.00 ? 47  VAL A HG22 8  
ATOM 10738 H HG23 . VAL A 1 47  ? 0.328   -8.376  6.309   1.00 0.00 ? 47  VAL A HG23 8  
ATOM 10739 N N    . ARG A 1 48  ? -1.794  -10.585 2.769   1.00 0.00 ? 48  ARG A N    8  
ATOM 10740 C CA   . ARG A 1 48  ? -2.336  -11.092 1.519   1.00 0.00 ? 48  ARG A CA   8  
ATOM 10741 C C    . ARG A 1 48  ? -3.047  -9.972  0.756   1.00 0.00 ? 48  ARG A C    8  
ATOM 10742 O O    . ARG A 1 48  ? -3.386  -8.941  1.334   1.00 0.00 ? 48  ARG A O    8  
ATOM 10743 C CB   . ARG A 1 48  ? -3.322  -12.235 1.770   1.00 0.00 ? 48  ARG A CB   8  
ATOM 10744 C CG   . ARG A 1 48  ? -2.599  -13.583 1.812   1.00 0.00 ? 48  ARG A CG   8  
ATOM 10745 C CD   . ARG A 1 48  ? -3.010  -14.387 3.048   1.00 0.00 ? 48  ARG A CD   8  
ATOM 10746 N NE   . ARG A 1 48  ? -2.769  -13.592 4.272   1.00 0.00 ? 48  ARG A NE   8  
ATOM 10747 C CZ   . ARG A 1 48  ? -3.350  -13.838 5.454   1.00 0.00 ? 48  ARG A CZ   8  
ATOM 10748 N NH1  . ARG A 1 48  ? -4.210  -14.858 5.579   1.00 0.00 ? 48  ARG A NH1  8  
ATOM 10749 N NH2  . ARG A 1 48  ? -3.072  -13.064 6.512   1.00 0.00 ? 48  ARG A NH2  8  
ATOM 10750 H H    . ARG A 1 48  ? -2.463  -10.466 3.502   1.00 0.00 ? 48  ARG A H    8  
ATOM 10751 H HA   . ARG A 1 48  ? -1.469  -11.454 0.967   1.00 0.00 ? 48  ARG A HA   8  
ATOM 10752 H HB2  . ARG A 1 48  ? -3.844  -12.069 2.712   1.00 0.00 ? 48  ARG A HB2  8  
ATOM 10753 H HB3  . ARG A 1 48  ? -4.077  -12.248 0.984   1.00 0.00 ? 48  ARG A HB3  8  
ATOM 10754 H HG2  . ARG A 1 48  ? -2.828  -14.151 0.911   1.00 0.00 ? 48  ARG A HG2  8  
ATOM 10755 H HG3  . ARG A 1 48  ? -1.521  -13.421 1.822   1.00 0.00 ? 48  ARG A HG3  8  
ATOM 10756 H HD2  . ARG A 1 48  ? -4.064  -14.657 2.981   1.00 0.00 ? 48  ARG A HD2  8  
ATOM 10757 H HD3  . ARG A 1 48  ? -2.444  -15.317 3.091   1.00 0.00 ? 48  ARG A HD3  8  
ATOM 10758 H HE   . ARG A 1 48  ? -2.133  -12.823 4.214   1.00 0.00 ? 48  ARG A HE   8  
ATOM 10759 H HH11 . ARG A 1 48  ? -4.418  -15.436 4.789   1.00 0.00 ? 48  ARG A HH11 8  
ATOM 10760 H HH12 . ARG A 1 48  ? -4.644  -15.042 6.461   1.00 0.00 ? 48  ARG A HH12 8  
ATOM 10761 H HH21 . ARG A 1 48  ? -2.430  -12.303 6.420   1.00 0.00 ? 48  ARG A HH21 8  
ATOM 10762 H HH22 . ARG A 1 48  ? -3.506  -13.248 7.394   1.00 0.00 ? 48  ARG A HH22 8  
ATOM 10763 N N    . ILE A 1 49  ? -3.252  -10.214 -0.530  1.00 0.00 ? 49  ILE A N    8  
ATOM 10764 C CA   . ILE A 1 49  ? -3.917  -9.239  -1.378  1.00 0.00 ? 49  ILE A CA   8  
ATOM 10765 C C    . ILE A 1 49  ? -5.337  -9.003  -0.860  1.00 0.00 ? 49  ILE A C    8  
ATOM 10766 O O    . ILE A 1 49  ? -6.067  -9.953  -0.584  1.00 0.00 ? 49  ILE A O    8  
ATOM 10767 C CB   . ILE A 1 49  ? -3.862  -9.677  -2.843  1.00 0.00 ? 49  ILE A CB   8  
ATOM 10768 C CG1  . ILE A 1 49  ? -2.433  -9.597  -3.386  1.00 0.00 ? 49  ILE A CG1  8  
ATOM 10769 C CG2  . ILE A 1 49  ? -4.844  -8.871  -3.694  1.00 0.00 ? 49  ILE A CG2  8  
ATOM 10770 C CD1  . ILE A 1 49  ? -2.433  -9.433  -4.907  1.00 0.00 ? 49  ILE A CD1  8  
ATOM 10771 H H    . ILE A 1 49  ? -2.973  -11.056 -0.992  1.00 0.00 ? 49  ILE A H    8  
ATOM 10772 H HA   . ILE A 1 49  ? -3.360  -8.305  -1.300  1.00 0.00 ? 49  ILE A HA   8  
ATOM 10773 H HB   . ILE A 1 49  ? -4.169  -10.722 -2.899  1.00 0.00 ? 49  ILE A HB   8  
ATOM 10774 H HG12 . ILE A 1 49  ? -1.912  -8.758  -2.926  1.00 0.00 ? 49  ILE A HG12 8  
ATOM 10775 H HG13 . ILE A 1 49  ? -1.886  -10.500 -3.114  1.00 0.00 ? 49  ILE A HG13 8  
ATOM 10776 H HG21 . ILE A 1 49  ? -4.950  -9.341  -4.671  1.00 0.00 ? 49  ILE A HG21 8  
ATOM 10777 H HG22 . ILE A 1 49  ? -5.815  -8.841  -3.198  1.00 0.00 ? 49  ILE A HG22 8  
ATOM 10778 H HG23 . ILE A 1 49  ? -4.469  -7.855  -3.818  1.00 0.00 ? 49  ILE A HG23 8  
ATOM 10779 H HD11 . ILE A 1 49  ? -2.858  -8.463  -5.167  1.00 0.00 ? 49  ILE A HD11 8  
ATOM 10780 H HD12 . ILE A 1 49  ? -1.411  -9.493  -5.279  1.00 0.00 ? 49  ILE A HD12 8  
ATOM 10781 H HD13 . ILE A 1 49  ? -3.031  -10.224 -5.358  1.00 0.00 ? 49  ILE A HD13 8  
ATOM 10782 N N    . GLY A 1 50  ? -5.686  -7.730  -0.743  1.00 0.00 ? 50  GLY A N    8  
ATOM 10783 C CA   . GLY A 1 50  ? -7.005  -7.357  -0.263  1.00 0.00 ? 50  GLY A CA   8  
ATOM 10784 C C    . GLY A 1 50  ? -6.916  -6.643  1.087   1.00 0.00 ? 50  GLY A C    8  
ATOM 10785 O O    . GLY A 1 50  ? -7.855  -5.963  1.497   1.00 0.00 ? 50  GLY A O    8  
ATOM 10786 H H    . GLY A 1 50  ? -5.086  -6.963  -0.970  1.00 0.00 ? 50  GLY A H    8  
ATOM 10787 H HA2  . GLY A 1 50  ? -7.490  -6.706  -0.991  1.00 0.00 ? 50  GLY A HA2  8  
ATOM 10788 H HA3  . GLY A 1 50  ? -7.627  -8.247  -0.167  1.00 0.00 ? 50  GLY A HA3  8  
ATOM 10789 N N    . ASP A 1 51  ? -5.777  -6.822  1.740   1.00 0.00 ? 51  ASP A N    8  
ATOM 10790 C CA   . ASP A 1 51  ? -5.552  -6.203  3.036   1.00 0.00 ? 51  ASP A CA   8  
ATOM 10791 C C    . ASP A 1 51  ? -5.804  -4.698  2.928   1.00 0.00 ? 51  ASP A C    8  
ATOM 10792 O O    . ASP A 1 51  ? -5.193  -4.021  2.102   1.00 0.00 ? 51  ASP A O    8  
ATOM 10793 C CB   . ASP A 1 51  ? -4.110  -6.409  3.502   1.00 0.00 ? 51  ASP A CB   8  
ATOM 10794 C CG   . ASP A 1 51  ? -3.739  -7.856  3.836   1.00 0.00 ? 51  ASP A CG   8  
ATOM 10795 O OD1  . ASP A 1 51  ? -4.521  -8.748  3.441   1.00 0.00 ? 51  ASP A OD1  8  
ATOM 10796 O OD2  . ASP A 1 51  ? -2.682  -8.037  4.479   1.00 0.00 ? 51  ASP A OD2  8  
ATOM 10797 H H    . ASP A 1 51  ? -5.018  -7.376  1.400   1.00 0.00 ? 51  ASP A H    8  
ATOM 10798 H HA   . ASP A 1 51  ? -6.251  -6.695  3.713   1.00 0.00 ? 51  ASP A HA   8  
ATOM 10799 H HB2  . ASP A 1 51  ? -3.437  -6.048  2.725   1.00 0.00 ? 51  ASP A HB2  8  
ATOM 10800 H HB3  . ASP A 1 51  ? -3.938  -5.793  4.385   1.00 0.00 ? 51  ASP A HB3  8  
ATOM 10801 N N    . VAL A 1 52  ? -6.703  -4.218  3.774   1.00 0.00 ? 52  VAL A N    8  
ATOM 10802 C CA   . VAL A 1 52  ? -7.042  -2.805  3.784   1.00 0.00 ? 52  VAL A CA   8  
ATOM 10803 C C    . VAL A 1 52  ? -6.193  -2.088  4.835   1.00 0.00 ? 52  VAL A C    8  
ATOM 10804 O O    . VAL A 1 52  ? -6.137  -2.513  5.988   1.00 0.00 ? 52  VAL A O    8  
ATOM 10805 C CB   . VAL A 1 52  ? -8.546  -2.629  4.009   1.00 0.00 ? 52  VAL A CB   8  
ATOM 10806 C CG1  . VAL A 1 52  ? -8.910  -1.150  4.148   1.00 0.00 ? 52  VAL A CG1  8  
ATOM 10807 C CG2  . VAL A 1 52  ? -9.349  -3.289  2.887   1.00 0.00 ? 52  VAL A CG2  8  
ATOM 10808 H H    . VAL A 1 52  ? -7.195  -4.775  4.443   1.00 0.00 ? 52  VAL A H    8  
ATOM 10809 H HA   . VAL A 1 52  ? -6.799  -2.401  2.801   1.00 0.00 ? 52  VAL A HA   8  
ATOM 10810 H HB   . VAL A 1 52  ? -8.805  -3.127  4.944   1.00 0.00 ? 52  VAL A HB   8  
ATOM 10811 H HG11 . VAL A 1 52  ? -9.737  -1.044  4.849   1.00 0.00 ? 52  VAL A HG11 8  
ATOM 10812 H HG12 . VAL A 1 52  ? -8.047  -0.596  4.517   1.00 0.00 ? 52  VAL A HG12 8  
ATOM 10813 H HG13 . VAL A 1 52  ? -9.205  -0.756  3.175   1.00 0.00 ? 52  VAL A HG13 8  
ATOM 10814 H HG21 . VAL A 1 52  ? -10.174 -3.858  3.316   1.00 0.00 ? 52  VAL A HG21 8  
ATOM 10815 H HG22 . VAL A 1 52  ? -9.745  -2.521  2.223   1.00 0.00 ? 52  VAL A HG22 8  
ATOM 10816 H HG23 . VAL A 1 52  ? -8.701  -3.959  2.321   1.00 0.00 ? 52  VAL A HG23 8  
ATOM 10817 N N    . VAL A 1 53  ? -5.552  -1.013  4.399   1.00 0.00 ? 53  VAL A N    8  
ATOM 10818 C CA   . VAL A 1 53  ? -4.708  -0.234  5.288   1.00 0.00 ? 53  VAL A CA   8  
ATOM 10819 C C    . VAL A 1 53  ? -5.583  0.699   6.128   1.00 0.00 ? 53  VAL A C    8  
ATOM 10820 O O    . VAL A 1 53  ? -6.176  1.640   5.603   1.00 0.00 ? 53  VAL A O    8  
ATOM 10821 C CB   . VAL A 1 53  ? -3.644  0.512   4.480   1.00 0.00 ? 53  VAL A CB   8  
ATOM 10822 C CG1  . VAL A 1 53  ? -2.630  1.191   5.402   1.00 0.00 ? 53  VAL A CG1  8  
ATOM 10823 C CG2  . VAL A 1 53  ? -2.946  -0.428  3.495   1.00 0.00 ? 53  VAL A CG2  8  
ATOM 10824 H H    . VAL A 1 53  ? -5.603  -0.675  3.460   1.00 0.00 ? 53  VAL A H    8  
ATOM 10825 H HA   . VAL A 1 53  ? -4.199  -0.931  5.954   1.00 0.00 ? 53  VAL A HA   8  
ATOM 10826 H HB   . VAL A 1 53  ? -4.145  1.289   3.903   1.00 0.00 ? 53  VAL A HB   8  
ATOM 10827 H HG11 . VAL A 1 53  ? -1.795  1.567   4.811   1.00 0.00 ? 53  VAL A HG11 8  
ATOM 10828 H HG12 . VAL A 1 53  ? -3.110  2.020   5.922   1.00 0.00 ? 53  VAL A HG12 8  
ATOM 10829 H HG13 . VAL A 1 53  ? -2.262  0.469   6.132   1.00 0.00 ? 53  VAL A HG13 8  
ATOM 10830 H HG21 . VAL A 1 53  ? -2.484  0.157   2.700   1.00 0.00 ? 53  VAL A HG21 8  
ATOM 10831 H HG22 . VAL A 1 53  ? -2.179  -0.998  4.018   1.00 0.00 ? 53  VAL A HG22 8  
ATOM 10832 H HG23 . VAL A 1 53  ? -3.677  -1.112  3.064   1.00 0.00 ? 53  VAL A HG23 8  
ATOM 10833 N N    . LEU A 1 54  ? -5.637  0.405   7.419   1.00 0.00 ? 54  LEU A N    8  
ATOM 10834 C CA   . LEU A 1 54  ? -6.429  1.206   8.336   1.00 0.00 ? 54  LEU A CA   8  
ATOM 10835 C C    . LEU A 1 54  ? -5.688  2.508   8.642   1.00 0.00 ? 54  LEU A C    8  
ATOM 10836 O O    . LEU A 1 54  ? -6.305  3.566   8.758   1.00 0.00 ? 54  LEU A O    8  
ATOM 10837 C CB   . LEU A 1 54  ? -6.787  0.395   9.584   1.00 0.00 ? 54  LEU A CB   8  
ATOM 10838 C CG   . LEU A 1 54  ? -7.744  -0.779  9.369   1.00 0.00 ? 54  LEU A CG   8  
ATOM 10839 C CD1  . LEU A 1 54  ? -7.680  -1.761  10.541  1.00 0.00 ? 54  LEU A CD1  8  
ATOM 10840 C CD2  . LEU A 1 54  ? -9.169  -0.285  9.112   1.00 0.00 ? 54  LEU A CD2  8  
ATOM 10841 H H    . LEU A 1 54  ? -5.151  -0.362  7.838   1.00 0.00 ? 54  LEU A H    8  
ATOM 10842 H HA   . LEU A 1 54  ? -7.364  1.451   7.832   1.00 0.00 ? 54  LEU A HA   8  
ATOM 10843 H HB2  . LEU A 1 54  ? -5.865  0.011   10.020  1.00 0.00 ? 54  LEU A HB2  8  
ATOM 10844 H HB3  . LEU A 1 54  ? -7.230  1.069   10.316  1.00 0.00 ? 54  LEU A HB3  8  
ATOM 10845 H HG   . LEU A 1 54  ? -7.426  -1.321  8.478   1.00 0.00 ? 54  LEU A HG   8  
ATOM 10846 H HD11 . LEU A 1 54  ? -8.248  -2.658  10.295  1.00 0.00 ? 54  LEU A HD11 8  
ATOM 10847 H HD12 . LEU A 1 54  ? -6.641  -2.030  10.733  1.00 0.00 ? 54  LEU A HD12 8  
ATOM 10848 H HD13 . LEU A 1 54  ? -8.105  -1.294  11.429  1.00 0.00 ? 54  LEU A HD13 8  
ATOM 10849 H HD21 . LEU A 1 54  ? -9.146  0.775   8.861   1.00 0.00 ? 54  LEU A HD21 8  
ATOM 10850 H HD22 . LEU A 1 54  ? -9.604  -0.846  8.284   1.00 0.00 ? 54  LEU A HD22 8  
ATOM 10851 H HD23 . LEU A 1 54  ? -9.772  -0.434  10.008  1.00 0.00 ? 54  LEU A HD23 8  
ATOM 10852 N N    . SER A 1 55  ? -4.373  2.389   8.763   1.00 0.00 ? 55  SER A N    8  
ATOM 10853 C CA   . SER A 1 55  ? -3.541  3.544   9.052   1.00 0.00 ? 55  SER A CA   8  
ATOM 10854 C C    . SER A 1 55  ? -2.133  3.327   8.495   1.00 0.00 ? 55  SER A C    8  
ATOM 10855 O O    . SER A 1 55  ? -1.718  2.191   8.270   1.00 0.00 ? 55  SER A O    8  
ATOM 10856 C CB   . SER A 1 55  ? -3.480  3.816   10.557  1.00 0.00 ? 55  SER A CB   8  
ATOM 10857 O OG   . SER A 1 55  ? -4.779  3.907   11.136  1.00 0.00 ? 55  SER A OG   8  
ATOM 10858 H H    . SER A 1 55  ? -3.879  1.526   8.666   1.00 0.00 ? 55  SER A H    8  
ATOM 10859 H HA   . SER A 1 55  ? -4.026  4.382   8.551   1.00 0.00 ? 55  SER A HA   8  
ATOM 10860 H HB2  . SER A 1 55  ? -2.919  3.020   11.046  1.00 0.00 ? 55  SER A HB2  8  
ATOM 10861 H HB3  . SER A 1 55  ? -2.938  4.745   10.736  1.00 0.00 ? 55  SER A HB3  8  
ATOM 10862 H HG   . SER A 1 55  ? -4.706  4.133   12.107  1.00 0.00 ? 55  SER A HG   8  
ATOM 10863 N N    . ILE A 1 56  ? -1.436  4.435   8.288   1.00 0.00 ? 56  ILE A N    8  
ATOM 10864 C CA   . ILE A 1 56  ? -0.083  4.380   7.761   1.00 0.00 ? 56  ILE A CA   8  
ATOM 10865 C C    . ILE A 1 56  ? 0.824   5.282   8.601   1.00 0.00 ? 56  ILE A C    8  
ATOM 10866 O O    . ILE A 1 56  ? 0.495   6.441   8.849   1.00 0.00 ? 56  ILE A O    8  
ATOM 10867 C CB   . ILE A 1 56  ? -0.074  4.718   6.269   1.00 0.00 ? 56  ILE A CB   8  
ATOM 10868 C CG1  . ILE A 1 56  ? -0.604  3.547   5.438   1.00 0.00 ? 56  ILE A CG1  8  
ATOM 10869 C CG2  . ILE A 1 56  ? 1.318   5.160   5.814   1.00 0.00 ? 56  ILE A CG2  8  
ATOM 10870 C CD1  . ILE A 1 56  ? -0.502  3.847   3.941   1.00 0.00 ? 56  ILE A CD1  8  
ATOM 10871 H H    . ILE A 1 56  ? -1.780  5.355   8.473   1.00 0.00 ? 56  ILE A H    8  
ATOM 10872 H HA   . ILE A 1 56  ? 0.265   3.352   7.860   1.00 0.00 ? 56  ILE A HA   8  
ATOM 10873 H HB   . ILE A 1 56  ? -0.748  5.560   6.106   1.00 0.00 ? 56  ILE A HB   8  
ATOM 10874 H HG12 . ILE A 1 56  ? -0.038  2.646   5.672   1.00 0.00 ? 56  ILE A HG12 8  
ATOM 10875 H HG13 . ILE A 1 56  ? -1.643  3.349   5.704   1.00 0.00 ? 56  ILE A HG13 8  
ATOM 10876 H HG21 . ILE A 1 56  ? 2.071   4.525   6.282   1.00 0.00 ? 56  ILE A HG21 8  
ATOM 10877 H HG22 . ILE A 1 56  ? 1.391   5.072   4.730   1.00 0.00 ? 56  ILE A HG22 8  
ATOM 10878 H HG23 . ILE A 1 56  ? 1.484   6.196   6.107   1.00 0.00 ? 56  ILE A HG23 8  
ATOM 10879 H HD11 . ILE A 1 56  ? 0.512   3.643   3.598   1.00 0.00 ? 56  ILE A HD11 8  
ATOM 10880 H HD12 . ILE A 1 56  ? -1.204  3.215   3.396   1.00 0.00 ? 56  ILE A HD12 8  
ATOM 10881 H HD13 . ILE A 1 56  ? -0.743  4.895   3.763   1.00 0.00 ? 56  ILE A HD13 8  
ATOM 10882 N N    . ASP A 1 57  ? 1.948   4.716   9.015   1.00 0.00 ? 57  ASP A N    8  
ATOM 10883 C CA   . ASP A 1 57  ? 2.905   5.455   9.822   1.00 0.00 ? 57  ASP A CA   8  
ATOM 10884 C C    . ASP A 1 57  ? 2.197   6.020   11.054  1.00 0.00 ? 57  ASP A C    8  
ATOM 10885 O O    . ASP A 1 57  ? 2.592   7.060   11.579  1.00 0.00 ? 57  ASP A O    8  
ATOM 10886 C CB   . ASP A 1 57  ? 3.498   6.627   9.038   1.00 0.00 ? 57  ASP A CB   8  
ATOM 10887 C CG   . ASP A 1 57  ? 4.778   7.219   9.630   1.00 0.00 ? 57  ASP A CG   8  
ATOM 10888 O OD1  . ASP A 1 57  ? 5.343   6.563   10.531  1.00 0.00 ? 57  ASP A OD1  8  
ATOM 10889 O OD2  . ASP A 1 57  ? 5.163   8.315   9.168   1.00 0.00 ? 57  ASP A OD2  8  
ATOM 10890 H H    . ASP A 1 57  ? 2.208   3.773   8.809   1.00 0.00 ? 57  ASP A H    8  
ATOM 10891 H HA   . ASP A 1 57  ? 3.679   4.733   10.081  1.00 0.00 ? 57  ASP A HA   8  
ATOM 10892 H HB2  . ASP A 1 57  ? 3.705   6.296   8.020   1.00 0.00 ? 57  ASP A HB2  8  
ATOM 10893 H HB3  . ASP A 1 57  ? 2.748   7.415   8.970   1.00 0.00 ? 57  ASP A HB3  8  
ATOM 10894 N N    . GLY A 1 58  ? 1.162   5.310   11.481  1.00 0.00 ? 58  GLY A N    8  
ATOM 10895 C CA   . GLY A 1 58  ? 0.395   5.729   12.642  1.00 0.00 ? 58  GLY A CA   8  
ATOM 10896 C C    . GLY A 1 58  ? -0.693  6.729   12.249  1.00 0.00 ? 58  GLY A C    8  
ATOM 10897 O O    . GLY A 1 58  ? -1.433  7.215   13.103  1.00 0.00 ? 58  GLY A O    8  
ATOM 10898 H H    . GLY A 1 58  ? 0.848   4.466   11.049  1.00 0.00 ? 58  GLY A H    8  
ATOM 10899 H HA2  . GLY A 1 58  ? -0.059  4.858   13.115  1.00 0.00 ? 58  GLY A HA2  8  
ATOM 10900 H HA3  . GLY A 1 58  ? 1.060   6.180   13.378  1.00 0.00 ? 58  GLY A HA3  8  
ATOM 10901 N N    . ILE A 1 59  ? -0.757  7.008   10.955  1.00 0.00 ? 59  ILE A N    8  
ATOM 10902 C CA   . ILE A 1 59  ? -1.742  7.942   10.438  1.00 0.00 ? 59  ILE A CA   8  
ATOM 10903 C C    . ILE A 1 59  ? -2.970  7.166   9.958   1.00 0.00 ? 59  ILE A C    8  
ATOM 10904 O O    . ILE A 1 59  ? -2.851  6.244   9.152   1.00 0.00 ? 59  ILE A O    8  
ATOM 10905 C CB   . ILE A 1 59  ? -1.121  8.836   9.364   1.00 0.00 ? 59  ILE A CB   8  
ATOM 10906 C CG1  . ILE A 1 59  ? 0.259   9.335   9.796   1.00 0.00 ? 59  ILE A CG1  8  
ATOM 10907 C CG2  . ILE A 1 59  ? -2.059  9.990   9.001   1.00 0.00 ? 59  ILE A CG2  8  
ATOM 10908 C CD1  . ILE A 1 59  ? 0.138   10.449  10.838  1.00 0.00 ? 59  ILE A CD1  8  
ATOM 10909 H H    . ILE A 1 59  ? -0.151  6.609   10.267  1.00 0.00 ? 59  ILE A H    8  
ATOM 10910 H HA   . ILE A 1 59  ? -2.043  8.589   11.262  1.00 0.00 ? 59  ILE A HA   8  
ATOM 10911 H HB   . ILE A 1 59  ? -0.980  8.240   8.462   1.00 0.00 ? 59  ILE A HB   8  
ATOM 10912 H HG12 . ILE A 1 59  ? 0.836   8.507   10.209  1.00 0.00 ? 59  ILE A HG12 8  
ATOM 10913 H HG13 . ILE A 1 59  ? 0.806   9.702   8.928   1.00 0.00 ? 59  ILE A HG13 8  
ATOM 10914 H HG21 . ILE A 1 59  ? -1.477  10.901  8.862   1.00 0.00 ? 59  ILE A HG21 8  
ATOM 10915 H HG22 . ILE A 1 59  ? -2.587  9.752   8.077   1.00 0.00 ? 59  ILE A HG22 8  
ATOM 10916 H HG23 . ILE A 1 59  ? -2.781  10.137  9.804   1.00 0.00 ? 59  ILE A HG23 8  
ATOM 10917 H HD11 . ILE A 1 59  ? 0.790   10.228  11.683  1.00 0.00 ? 59  ILE A HD11 8  
ATOM 10918 H HD12 . ILE A 1 59  ? 0.433   11.398  10.390  1.00 0.00 ? 59  ILE A HD12 8  
ATOM 10919 H HD13 . ILE A 1 59  ? -0.894  10.515  11.182  1.00 0.00 ? 59  ILE A HD13 8  
ATOM 10920 N N    . SER A 1 60  ? -4.123  7.568   10.472  1.00 0.00 ? 60  SER A N    8  
ATOM 10921 C CA   . SER A 1 60  ? -5.372  6.922   10.106  1.00 0.00 ? 60  SER A CA   8  
ATOM 10922 C C    . SER A 1 60  ? -5.680  7.178   8.629   1.00 0.00 ? 60  SER A C    8  
ATOM 10923 O O    . SER A 1 60  ? -5.763  8.327   8.199   1.00 0.00 ? 60  SER A O    8  
ATOM 10924 C CB   . SER A 1 60  ? -6.525  7.416   10.982  1.00 0.00 ? 60  SER A CB   8  
ATOM 10925 O OG   . SER A 1 60  ? -7.086  6.368   11.768  1.00 0.00 ? 60  SER A OG   8  
ATOM 10926 H H    . SER A 1 60  ? -4.212  8.319   11.127  1.00 0.00 ? 60  SER A H    8  
ATOM 10927 H HA   . SER A 1 60  ? -5.211  5.859   10.284  1.00 0.00 ? 60  SER A HA   8  
ATOM 10928 H HB2  . SER A 1 60  ? -6.168  8.210   11.638  1.00 0.00 ? 60  SER A HB2  8  
ATOM 10929 H HB3  . SER A 1 60  ? -7.301  7.849   10.350  1.00 0.00 ? 60  SER A HB3  8  
ATOM 10930 H HG   . SER A 1 60  ? -6.358  5.787   12.131  1.00 0.00 ? 60  SER A HG   8  
ATOM 10931 N N    . ALA A 1 61  ? -5.841  6.088   7.894   1.00 0.00 ? 61  ALA A N    8  
ATOM 10932 C CA   . ALA A 1 61  ? -6.138  6.179   6.474   1.00 0.00 ? 61  ALA A CA   8  
ATOM 10933 C C    . ALA A 1 61  ? -7.654  6.232   6.277   1.00 0.00 ? 61  ALA A C    8  
ATOM 10934 O O    . ALA A 1 61  ? -8.192  5.572   5.389   1.00 0.00 ? 61  ALA A O    8  
ATOM 10935 C CB   . ALA A 1 61  ? -5.495  5.000   5.741   1.00 0.00 ? 61  ALA A CB   8  
ATOM 10936 H H    . ALA A 1 61  ? -5.772  5.156   8.252   1.00 0.00 ? 61  ALA A H    8  
ATOM 10937 H HA   . ALA A 1 61  ? -5.699  7.105   6.103   1.00 0.00 ? 61  ALA A HA   8  
ATOM 10938 H HB1  . ALA A 1 61  ? -4.414  5.033   5.878   1.00 0.00 ? 61  ALA A HB1  8  
ATOM 10939 H HB2  . ALA A 1 61  ? -5.885  4.066   6.144   1.00 0.00 ? 61  ALA A HB2  8  
ATOM 10940 H HB3  . ALA A 1 61  ? -5.728  5.063   4.678   1.00 0.00 ? 61  ALA A HB3  8  
ATOM 10941 N N    . GLN A 1 62  ? -8.301  7.024   7.120   1.00 0.00 ? 62  GLN A N    8  
ATOM 10942 C CA   . GLN A 1 62  ? -9.745  7.171   7.049   1.00 0.00 ? 62  GLN A CA   8  
ATOM 10943 C C    . GLN A 1 62  ? -10.115 8.338   6.130   1.00 0.00 ? 62  GLN A C    8  
ATOM 10944 O O    . GLN A 1 62  ? -10.722 9.312   6.572   1.00 0.00 ? 62  GLN A O    8  
ATOM 10945 C CB   . GLN A 1 62  ? -10.346 7.360   8.443   1.00 0.00 ? 62  GLN A CB   8  
ATOM 10946 C CG   . GLN A 1 62  ? -10.997 6.067   8.939   1.00 0.00 ? 62  GLN A CG   8  
ATOM 10947 C CD   . GLN A 1 62  ? -12.216 5.705   8.088   1.00 0.00 ? 62  GLN A CD   8  
ATOM 10948 O OE1  . GLN A 1 62  ? -13.002 6.551   7.692   1.00 0.00 ? 62  GLN A OE1  8  
ATOM 10949 N NE2  . GLN A 1 62  ? -12.328 4.406   7.828   1.00 0.00 ? 62  GLN A NE2  8  
ATOM 10950 H H    . GLN A 1 62  ? -7.857  7.558   7.839   1.00 0.00 ? 62  GLN A H    8  
ATOM 10951 H HA   . GLN A 1 62  ? -10.111 6.236   6.626   1.00 0.00 ? 62  GLN A HA   8  
ATOM 10952 H HB2  . GLN A 1 62  ? -9.567  7.669   9.140   1.00 0.00 ? 62  GLN A HB2  8  
ATOM 10953 H HB3  . GLN A 1 62  ? -11.087 8.158   8.419   1.00 0.00 ? 62  GLN A HB3  8  
ATOM 10954 H HG2  . GLN A 1 62  ? -10.271 5.254   8.906   1.00 0.00 ? 62  GLN A HG2  8  
ATOM 10955 H HG3  . GLN A 1 62  ? -11.298 6.183   9.980   1.00 0.00 ? 62  GLN A HG3  8  
ATOM 10956 H HE21 . GLN A 1 62  ? -11.648 3.764   8.183   1.00 0.00 ? 62  GLN A HE21 8  
ATOM 10957 H HE22 . GLN A 1 62  ? -13.093 4.070   7.278   1.00 0.00 ? 62  GLN A HE22 8  
ATOM 10958 N N    . GLY A 1 63  ? -9.734  8.200   4.869   1.00 0.00 ? 63  GLY A N    8  
ATOM 10959 C CA   . GLY A 1 63  ? -10.019 9.230   3.884   1.00 0.00 ? 63  GLY A CA   8  
ATOM 10960 C C    . GLY A 1 63  ? -8.727  9.775   3.273   1.00 0.00 ? 63  GLY A C    8  
ATOM 10961 O O    . GLY A 1 63  ? -8.580  10.984  3.100   1.00 0.00 ? 63  GLY A O    8  
ATOM 10962 H H    . GLY A 1 63  ? -9.241  7.404   4.518   1.00 0.00 ? 63  GLY A H    8  
ATOM 10963 H HA2  . GLY A 1 63  ? -10.653 8.821   3.098   1.00 0.00 ? 63  GLY A HA2  8  
ATOM 10964 H HA3  . GLY A 1 63  ? -10.575 10.042  4.353   1.00 0.00 ? 63  GLY A HA3  8  
ATOM 10965 N N    . MET A 1 64  ? -7.823  8.858   2.963   1.00 0.00 ? 64  MET A N    8  
ATOM 10966 C CA   . MET A 1 64  ? -6.548  9.232   2.374   1.00 0.00 ? 64  MET A CA   8  
ATOM 10967 C C    . MET A 1 64  ? -6.414  8.673   0.956   1.00 0.00 ? 64  MET A C    8  
ATOM 10968 O O    . MET A 1 64  ? -6.770  7.524   0.702   1.00 0.00 ? 64  MET A O    8  
ATOM 10969 C CB   . MET A 1 64  ? -5.408  8.698   3.244   1.00 0.00 ? 64  MET A CB   8  
ATOM 10970 C CG   . MET A 1 64  ? -5.229  9.553   4.500   1.00 0.00 ? 64  MET A CG   8  
ATOM 10971 S SD   . MET A 1 64  ? -3.494  9.844   4.799   1.00 0.00 ? 64  MET A SD   8  
ATOM 10972 C CE   . MET A 1 64  ? -2.936  8.166   5.046   1.00 0.00 ? 64  MET A CE   8  
ATOM 10973 H H    . MET A 1 64  ? -7.950  7.876   3.107   1.00 0.00 ? 64  MET A H    8  
ATOM 10974 H HA   . MET A 1 64  ? -6.548  10.321  2.345   1.00 0.00 ? 64  MET A HA   8  
ATOM 10975 H HB2  . MET A 1 64  ? -5.615  7.666   3.528   1.00 0.00 ? 64  MET A HB2  8  
ATOM 10976 H HB3  . MET A 1 64  ? -4.481  8.690   2.670   1.00 0.00 ? 64  MET A HB3  8  
ATOM 10977 H HG2  . MET A 1 64  ? -5.750  10.503  4.380   1.00 0.00 ? 64  MET A HG2  8  
ATOM 10978 H HG3  . MET A 1 64  ? -5.675  9.051   5.358   1.00 0.00 ? 64  MET A HG3  8  
ATOM 10979 H HE1  . MET A 1 64  ? -3.520  7.702   5.841   1.00 0.00 ? 64  MET A HE1  8  
ATOM 10980 H HE2  . MET A 1 64  ? -3.066  7.600   4.123   1.00 0.00 ? 64  MET A HE2  8  
ATOM 10981 H HE3  . MET A 1 64  ? -1.883  8.170   5.324   1.00 0.00 ? 64  MET A HE3  8  
ATOM 10982 N N    . THR A 1 65  ? -5.898  9.513   0.070   1.00 0.00 ? 65  THR A N    8  
ATOM 10983 C CA   . THR A 1 65  ? -5.712  9.117   -1.315  1.00 0.00 ? 65  THR A CA   8  
ATOM 10984 C C    . THR A 1 65  ? -4.434  8.291   -1.467  1.00 0.00 ? 65  THR A C    8  
ATOM 10985 O O    . THR A 1 65  ? -3.585  8.285   -0.577  1.00 0.00 ? 65  THR A O    8  
ATOM 10986 C CB   . THR A 1 65  ? -5.722  10.383  -2.174  1.00 0.00 ? 65  THR A CB   8  
ATOM 10987 O OG1  . THR A 1 65  ? -4.952  11.318  -1.423  1.00 0.00 ? 65  THR A OG1  8  
ATOM 10988 C CG2  . THR A 1 65  ? -7.109  11.025  -2.255  1.00 0.00 ? 65  THR A CG2  8  
ATOM 10989 H H    . THR A 1 65  ? -5.610  10.446  0.286   1.00 0.00 ? 65  THR A H    8  
ATOM 10990 H HA   . THR A 1 65  ? -6.544  8.475   -1.604  1.00 0.00 ? 65  THR A HA   8  
ATOM 10991 H HB   . THR A 1 65  ? -5.327  10.182  -3.170  1.00 0.00 ? 65  THR A HB   8  
ATOM 10992 H HG1  . THR A 1 65  ? -4.110  10.886  -1.101  1.00 0.00 ? 65  THR A HG1  8  
ATOM 10993 H HG21 . THR A 1 65  ? -7.553  11.057  -1.260  1.00 0.00 ? 65  THR A HG21 8  
ATOM 10994 H HG22 . THR A 1 65  ? -7.019  12.038  -2.646  1.00 0.00 ? 65  THR A HG22 8  
ATOM 10995 H HG23 . THR A 1 65  ? -7.744  10.435  -2.917  1.00 0.00 ? 65  THR A HG23 8  
ATOM 10996 N N    . HIS A 1 66  ? -4.337  7.612   -2.601  1.00 0.00 ? 66  HIS A N    8  
ATOM 10997 C CA   . HIS A 1 66  ? -3.176  6.784   -2.881  1.00 0.00 ? 66  HIS A CA   8  
ATOM 10998 C C    . HIS A 1 66  ? -1.900  7.606   -2.689  1.00 0.00 ? 66  HIS A C    8  
ATOM 10999 O O    . HIS A 1 66  ? -1.030  7.234   -1.903  1.00 0.00 ? 66  HIS A O    8  
ATOM 11000 C CB   . HIS A 1 66  ? -3.276  6.162   -4.275  1.00 0.00 ? 66  HIS A CB   8  
ATOM 11001 C CG   . HIS A 1 66  ? -2.595  4.820   -4.400  1.00 0.00 ? 66  HIS A CG   8  
ATOM 11002 N ND1  . HIS A 1 66  ? -1.995  4.389   -5.570  1.00 0.00 ? 66  HIS A ND1  8  
ATOM 11003 C CD2  . HIS A 1 66  ? -2.424  3.820   -3.488  1.00 0.00 ? 66  HIS A CD2  8  
ATOM 11004 C CE1  . HIS A 1 66  ? -1.490  3.182   -5.362  1.00 0.00 ? 66  HIS A CE1  8  
ATOM 11005 N NE2  . HIS A 1 66  ? -1.757  2.831   -4.071  1.00 0.00 ? 66  HIS A NE2  8  
ATOM 11006 H H    . HIS A 1 66  ? -5.032  7.623   -3.320  1.00 0.00 ? 66  HIS A H    8  
ATOM 11007 H HA   . HIS A 1 66  ? -3.188  5.973   -2.154  1.00 0.00 ? 66  HIS A HA   8  
ATOM 11008 H HB2  . HIS A 1 66  ? -4.328  6.050   -4.537  1.00 0.00 ? 66  HIS A HB2  8  
ATOM 11009 H HB3  . HIS A 1 66  ? -2.839  6.849   -5.000  1.00 0.00 ? 66  HIS A HB3  8  
ATOM 11010 H HD1  . HIS A 1 66  ? -1.951  4.902   -6.428  1.00 0.00 ? 66  HIS A HD1  8  
ATOM 11011 H HD2  . HIS A 1 66  ? -2.775  3.831   -2.457  1.00 0.00 ? 66  HIS A HD2  8  
ATOM 11012 H HE1  . HIS A 1 66  ? -0.955  2.576   -6.093  1.00 0.00 ? 66  HIS A HE1  8  
ATOM 11013 N N    . LEU A 1 67  ? -1.830  8.709   -3.420  1.00 0.00 ? 67  LEU A N    8  
ATOM 11014 C CA   . LEU A 1 67  ? -0.675  9.587   -3.339  1.00 0.00 ? 67  LEU A CA   8  
ATOM 11015 C C    . LEU A 1 67  ? -0.325  9.830   -1.870  1.00 0.00 ? 67  LEU A C    8  
ATOM 11016 O O    . LEU A 1 67  ? 0.825   9.666   -1.466  1.00 0.00 ? 67  LEU A O    8  
ATOM 11017 C CB   . LEU A 1 67  ? -0.922  10.872  -4.133  1.00 0.00 ? 67  LEU A CB   8  
ATOM 11018 C CG   . LEU A 1 67  ? -0.014  12.056  -3.793  1.00 0.00 ? 67  LEU A CG   8  
ATOM 11019 C CD1  . LEU A 1 67  ? 1.459   11.688  -3.979  1.00 0.00 ? 67  LEU A CD1  8  
ATOM 11020 C CD2  . LEU A 1 67  ? -0.403  13.294  -4.602  1.00 0.00 ? 67  LEU A CD2  8  
ATOM 11021 H H    . LEU A 1 67  ? -2.542  9.005   -4.057  1.00 0.00 ? 67  LEU A H    8  
ATOM 11022 H HA   . LEU A 1 67  ? 0.161   9.072   -3.813  1.00 0.00 ? 67  LEU A HA   8  
ATOM 11023 H HB2  . LEU A 1 67  ? -0.811  10.647  -5.194  1.00 0.00 ? 67  LEU A HB2  8  
ATOM 11024 H HB3  . LEU A 1 67  ? -1.957  11.177  -3.979  1.00 0.00 ? 67  LEU A HB3  8  
ATOM 11025 H HG   . LEU A 1 67  ? -0.154  12.302  -2.740  1.00 0.00 ? 67  LEU A HG   8  
ATOM 11026 H HD11 . LEU A 1 67  ? 1.822   12.105  -4.918  1.00 0.00 ? 67  LEU A HD11 8  
ATOM 11027 H HD12 . LEU A 1 67  ? 2.042   12.093  -3.152  1.00 0.00 ? 67  LEU A HD12 8  
ATOM 11028 H HD13 . LEU A 1 67  ? 1.563   10.603  -3.999  1.00 0.00 ? 67  LEU A HD13 8  
ATOM 11029 H HD21 . LEU A 1 67  ? 0.326   14.086  -4.427  1.00 0.00 ? 67  LEU A HD21 8  
ATOM 11030 H HD22 . LEU A 1 67  ? -0.420  13.044  -5.663  1.00 0.00 ? 67  LEU A HD22 8  
ATOM 11031 H HD23 . LEU A 1 67  ? -1.391  13.635  -4.293  1.00 0.00 ? 67  LEU A HD23 8  
ATOM 11032 N N    . GLU A 1 68  ? -1.339  10.217  -1.110  1.00 0.00 ? 68  GLU A N    8  
ATOM 11033 C CA   . GLU A 1 68  ? -1.153  10.484  0.306   1.00 0.00 ? 68  GLU A CA   8  
ATOM 11034 C C    . GLU A 1 68  ? -0.443  9.308   0.980   1.00 0.00 ? 68  GLU A C    8  
ATOM 11035 O O    . GLU A 1 68  ? 0.711   9.427   1.390   1.00 0.00 ? 68  GLU A O    8  
ATOM 11036 C CB   . GLU A 1 68  ? -2.490  10.779  0.989   1.00 0.00 ? 68  GLU A CB   8  
ATOM 11037 C CG   . GLU A 1 68  ? -2.913  12.232  0.760   1.00 0.00 ? 68  GLU A CG   8  
ATOM 11038 C CD   . GLU A 1 68  ? -2.869  13.028  2.067   1.00 0.00 ? 68  GLU A CD   8  
ATOM 11039 O OE1  . GLU A 1 68  ? -3.764  12.790  2.906   1.00 0.00 ? 68  GLU A OE1  8  
ATOM 11040 O OE2  . GLU A 1 68  ? -1.942  13.856  2.196   1.00 0.00 ? 68  GLU A OE2  8  
ATOM 11041 H H    . GLU A 1 68  ? -2.272  10.348  -1.446  1.00 0.00 ? 68  GLU A H    8  
ATOM 11042 H HA   . GLU A 1 68  ? -0.524  11.373  0.354   1.00 0.00 ? 68  GLU A HA   8  
ATOM 11043 H HB2  . GLU A 1 68  ? -3.257  10.109  0.601   1.00 0.00 ? 68  GLU A HB2  8  
ATOM 11044 H HB3  . GLU A 1 68  ? -2.408  10.585  2.058   1.00 0.00 ? 68  GLU A HB3  8  
ATOM 11045 H HG2  . GLU A 1 68  ? -2.254  12.695  0.026   1.00 0.00 ? 68  GLU A HG2  8  
ATOM 11046 H HG3  . GLU A 1 68  ? -3.921  12.260  0.347   1.00 0.00 ? 68  GLU A HG3  8  
ATOM 11047 N N    . ALA A 1 69  ? -1.161  8.198   1.072   1.00 0.00 ? 69  ALA A N    8  
ATOM 11048 C CA   . ALA A 1 69  ? -0.613  7.002   1.689   1.00 0.00 ? 69  ALA A CA   8  
ATOM 11049 C C    . ALA A 1 69  ? 0.783   6.736   1.123   1.00 0.00 ? 69  ALA A C    8  
ATOM 11050 O O    . ALA A 1 69  ? 1.711   6.429   1.871   1.00 0.00 ? 69  ALA A O    8  
ATOM 11051 C CB   . ALA A 1 69  ? -1.568  5.828   1.462   1.00 0.00 ? 69  ALA A CB   8  
ATOM 11052 H H    . ALA A 1 69  ? -2.098  8.109   0.737   1.00 0.00 ? 69  ALA A H    8  
ATOM 11053 H HA   . ALA A 1 69  ? -0.533  7.187   2.760   1.00 0.00 ? 69  ALA A HA   8  
ATOM 11054 H HB1  . ALA A 1 69  ? -2.219  6.048   0.616   1.00 0.00 ? 69  ALA A HB1  8  
ATOM 11055 H HB2  . ALA A 1 69  ? -0.992  4.927   1.252   1.00 0.00 ? 69  ALA A HB2  8  
ATOM 11056 H HB3  . ALA A 1 69  ? -2.173  5.673   2.355   1.00 0.00 ? 69  ALA A HB3  8  
ATOM 11057 N N    . GLN A 1 70  ? 0.889   6.862   -0.191  1.00 0.00 ? 70  GLN A N    8  
ATOM 11058 C CA   . GLN A 1 70  ? 2.156   6.639   -0.865  1.00 0.00 ? 70  GLN A CA   8  
ATOM 11059 C C    . GLN A 1 70  ? 3.221   7.593   -0.322  1.00 0.00 ? 70  GLN A C    8  
ATOM 11060 O O    . GLN A 1 70  ? 4.370   7.200   -0.126  1.00 0.00 ? 70  GLN A O    8  
ATOM 11061 C CB   . GLN A 1 70  ? 2.006   6.790   -2.380  1.00 0.00 ? 70  GLN A CB   8  
ATOM 11062 C CG   . GLN A 1 70  ? 1.224   5.616   -2.974  1.00 0.00 ? 70  GLN A CG   8  
ATOM 11063 C CD   . GLN A 1 70  ? 2.170   4.502   -3.429  1.00 0.00 ? 70  GLN A CD   8  
ATOM 11064 O OE1  . GLN A 1 70  ? 2.935   3.947   -2.657  1.00 0.00 ? 70  GLN A OE1  8  
ATOM 11065 N NE2  . GLN A 1 70  ? 2.075   4.207   -4.723  1.00 0.00 ? 70  GLN A NE2  8  
ATOM 11066 H H    . GLN A 1 70  ? 0.129   7.111   -0.792  1.00 0.00 ? 70  GLN A H    8  
ATOM 11067 H HA   . GLN A 1 70  ? 2.430   5.609   -0.635  1.00 0.00 ? 70  GLN A HA   8  
ATOM 11068 H HB2  . GLN A 1 70  ? 1.493   7.724   -2.607  1.00 0.00 ? 70  GLN A HB2  8  
ATOM 11069 H HB3  . GLN A 1 70  ? 2.991   6.847   -2.843  1.00 0.00 ? 70  GLN A HB3  8  
ATOM 11070 H HG2  . GLN A 1 70  ? 0.528   5.226   -2.231  1.00 0.00 ? 70  GLN A HG2  8  
ATOM 11071 H HG3  . GLN A 1 70  ? 0.629   5.961   -3.819  1.00 0.00 ? 70  GLN A HG3  8  
ATOM 11072 H HE21 . GLN A 1 70  ? 1.426   4.701   -5.302  1.00 0.00 ? 70  GLN A HE21 8  
ATOM 11073 H HE22 . GLN A 1 70  ? 2.652   3.492   -5.116  1.00 0.00 ? 70  GLN A HE22 8  
ATOM 11074 N N    . ASN A 1 71  ? 2.802   8.829   -0.094  1.00 0.00 ? 71  ASN A N    8  
ATOM 11075 C CA   . ASN A 1 71  ? 3.706   9.843   0.422   1.00 0.00 ? 71  ASN A CA   8  
ATOM 11076 C C    . ASN A 1 71  ? 4.306   9.359   1.743   1.00 0.00 ? 71  ASN A C    8  
ATOM 11077 O O    . ASN A 1 71  ? 5.523   9.387   1.924   1.00 0.00 ? 71  ASN A O    8  
ATOM 11078 C CB   . ASN A 1 71  ? 2.966   11.155  0.692   1.00 0.00 ? 71  ASN A CB   8  
ATOM 11079 C CG   . ASN A 1 71  ? 3.536   12.290  -0.161  1.00 0.00 ? 71  ASN A CG   8  
ATOM 11080 O OD1  . ASN A 1 71  ? 4.735   12.425  -0.340  1.00 0.00 ? 71  ASN A OD1  8  
ATOM 11081 N ND2  . ASN A 1 71  ? 2.611   13.097  -0.675  1.00 0.00 ? 71  ASN A ND2  8  
ATOM 11082 H H    . ASN A 1 71  ? 1.866   9.141   -0.257  1.00 0.00 ? 71  ASN A H    8  
ATOM 11083 H HA   . ASN A 1 71  ? 4.459   9.977   -0.354  1.00 0.00 ? 71  ASN A HA   8  
ATOM 11084 H HB2  . ASN A 1 71  ? 1.905   11.029  0.475   1.00 0.00 ? 71  ASN A HB2  8  
ATOM 11085 H HB3  . ASN A 1 71  ? 3.047   11.412  1.748   1.00 0.00 ? 71  ASN A HB3  8  
ATOM 11086 H HD21 . ASN A 1 71  ? 1.643   12.930  -0.489  1.00 0.00 ? 71  ASN A HD21 8  
ATOM 11087 H HD22 . ASN A 1 71  ? 2.884   13.870  -1.247  1.00 0.00 ? 71  ASN A HD22 8  
ATOM 11088 N N    . LYS A 1 72  ? 3.426   8.926   2.634   1.00 0.00 ? 72  LYS A N    8  
ATOM 11089 C CA   . LYS A 1 72  ? 3.854   8.437   3.933   1.00 0.00 ? 72  LYS A CA   8  
ATOM 11090 C C    . LYS A 1 72  ? 4.920   7.357   3.741   1.00 0.00 ? 72  LYS A C    8  
ATOM 11091 O O    . LYS A 1 72  ? 6.038   7.488   4.236   1.00 0.00 ? 72  LYS A O    8  
ATOM 11092 C CB   . LYS A 1 72  ? 2.649   7.973   4.754   1.00 0.00 ? 72  LYS A CB   8  
ATOM 11093 C CG   . LYS A 1 72  ? 1.813   9.165   5.224   1.00 0.00 ? 72  LYS A CG   8  
ATOM 11094 C CD   . LYS A 1 72  ? 2.263   9.639   6.608   1.00 0.00 ? 72  LYS A CD   8  
ATOM 11095 C CE   . LYS A 1 72  ? 1.546   10.931  7.005   1.00 0.00 ? 72  LYS A CE   8  
ATOM 11096 N NZ   . LYS A 1 72  ? 2.203   11.548  8.179   1.00 0.00 ? 72  LYS A NZ   8  
ATOM 11097 H H    . LYS A 1 72  ? 2.438   8.907   2.479   1.00 0.00 ? 72  LYS A H    8  
ATOM 11098 H HA   . LYS A 1 72  ? 4.303   9.275   4.466   1.00 0.00 ? 72  LYS A HA   8  
ATOM 11099 H HB2  . LYS A 1 72  ? 2.031   7.305   4.155   1.00 0.00 ? 72  LYS A HB2  8  
ATOM 11100 H HB3  . LYS A 1 72  ? 2.991   7.401   5.617   1.00 0.00 ? 72  LYS A HB3  8  
ATOM 11101 H HG2  . LYS A 1 72  ? 1.905   9.983   4.509   1.00 0.00 ? 72  LYS A HG2  8  
ATOM 11102 H HG3  . LYS A 1 72  ? 0.760   8.886   5.256   1.00 0.00 ? 72  LYS A HG3  8  
ATOM 11103 H HD2  . LYS A 1 72  ? 2.057   8.863   7.346   1.00 0.00 ? 72  LYS A HD2  8  
ATOM 11104 H HD3  . LYS A 1 72  ? 3.341   9.801   6.608   1.00 0.00 ? 72  LYS A HD3  8  
ATOM 11105 H HE2  . LYS A 1 72  ? 1.553   11.629  6.168   1.00 0.00 ? 72  LYS A HE2  8  
ATOM 11106 H HE3  . LYS A 1 72  ? 0.502   10.719  7.235   1.00 0.00 ? 72  LYS A HE3  8  
ATOM 11107 H HZ1  . LYS A 1 72  ? 2.809   12.283  7.873   1.00 0.00 ? 72  LYS A HZ1  8  
ATOM 11108 H HZ2  . LYS A 1 72  ? 1.507   11.923  8.791   1.00 0.00 ? 72  LYS A HZ2  8  
ATOM 11109 H HZ3  . LYS A 1 72  ? 2.737   10.856  8.664   1.00 0.00 ? 72  LYS A HZ3  8  
ATOM 11110 N N    . ILE A 1 73  ? 4.536   6.313   3.020   1.00 0.00 ? 73  ILE A N    8  
ATOM 11111 C CA   . ILE A 1 73  ? 5.444   5.211   2.756   1.00 0.00 ? 73  ILE A CA   8  
ATOM 11112 C C    . ILE A 1 73  ? 6.814   5.768   2.362   1.00 0.00 ? 73  ILE A C    8  
ATOM 11113 O O    . ILE A 1 73  ? 7.840   5.325   2.877   1.00 0.00 ? 73  ILE A O    8  
ATOM 11114 C CB   . ILE A 1 73  ? 4.846   4.259   1.718   1.00 0.00 ? 73  ILE A CB   8  
ATOM 11115 C CG1  . ILE A 1 73  ? 3.667   3.480   2.304   1.00 0.00 ? 73  ILE A CG1  8  
ATOM 11116 C CG2  . ILE A 1 73  ? 5.917   3.331   1.142   1.00 0.00 ? 73  ILE A CG2  8  
ATOM 11117 C CD1  . ILE A 1 73  ? 2.528   3.363   1.289   1.00 0.00 ? 73  ILE A CD1  8  
ATOM 11118 H H    . ILE A 1 73  ? 3.624   6.214   2.621   1.00 0.00 ? 73  ILE A H    8  
ATOM 11119 H HA   . ILE A 1 73  ? 5.554   4.648   3.683   1.00 0.00 ? 73  ILE A HA   8  
ATOM 11120 H HB   . ILE A 1 73  ? 4.459   4.856   0.891   1.00 0.00 ? 73  ILE A HB   8  
ATOM 11121 H HG12 . ILE A 1 73  ? 3.996   2.485   2.603   1.00 0.00 ? 73  ILE A HG12 8  
ATOM 11122 H HG13 . ILE A 1 73  ? 3.307   3.980   3.203   1.00 0.00 ? 73  ILE A HG13 8  
ATOM 11123 H HG21 . ILE A 1 73  ? 6.822   3.403   1.746   1.00 0.00 ? 73  ILE A HG21 8  
ATOM 11124 H HG22 . ILE A 1 73  ? 5.552   2.304   1.155   1.00 0.00 ? 73  ILE A HG22 8  
ATOM 11125 H HG23 . ILE A 1 73  ? 6.140   3.625   0.117   1.00 0.00 ? 73  ILE A HG23 8  
ATOM 11126 H HD11 . ILE A 1 73  ? 1.637   3.851   1.684   1.00 0.00 ? 73  ILE A HD11 8  
ATOM 11127 H HD12 . ILE A 1 73  ? 2.822   3.843   0.356   1.00 0.00 ? 73  ILE A HD12 8  
ATOM 11128 H HD13 . ILE A 1 73  ? 2.313   2.310   1.104   1.00 0.00 ? 73  ILE A HD13 8  
ATOM 11129 N N    . LYS A 1 74  ? 6.786   6.730   1.452   1.00 0.00 ? 74  LYS A N    8  
ATOM 11130 C CA   . LYS A 1 74  ? 8.013   7.353   0.983   1.00 0.00 ? 74  LYS A CA   8  
ATOM 11131 C C    . LYS A 1 74  ? 8.729   8.011   2.163   1.00 0.00 ? 74  LYS A C    8  
ATOM 11132 O O    . LYS A 1 74  ? 9.955   7.964   2.255   1.00 0.00 ? 74  LYS A O    8  
ATOM 11133 C CB   . LYS A 1 74  ? 7.719   8.313   -0.172  1.00 0.00 ? 74  LYS A CB   8  
ATOM 11134 C CG   . LYS A 1 74  ? 8.331   7.803   -1.478  1.00 0.00 ? 74  LYS A CG   8  
ATOM 11135 C CD   . LYS A 1 74  ? 8.273   8.877   -2.566  1.00 0.00 ? 74  LYS A CD   8  
ATOM 11136 C CE   . LYS A 1 74  ? 8.797   8.336   -3.898  1.00 0.00 ? 74  LYS A CE   8  
ATOM 11137 N NZ   . LYS A 1 74  ? 7.954   7.215   -4.371  1.00 0.00 ? 74  LYS A NZ   8  
ATOM 11138 H H    . LYS A 1 74  ? 5.948   7.085   1.038   1.00 0.00 ? 74  LYS A H    8  
ATOM 11139 H HA   . LYS A 1 74  ? 8.651   6.561   0.589   1.00 0.00 ? 74  LYS A HA   8  
ATOM 11140 H HB2  . LYS A 1 74  ? 6.641   8.426   -0.291  1.00 0.00 ? 74  LYS A HB2  8  
ATOM 11141 H HB3  . LYS A 1 74  ? 8.119   9.300   0.061   1.00 0.00 ? 74  LYS A HB3  8  
ATOM 11142 H HG2  . LYS A 1 74  ? 9.367   7.508   -1.308  1.00 0.00 ? 74  LYS A HG2  8  
ATOM 11143 H HG3  . LYS A 1 74  ? 7.797   6.913   -1.811  1.00 0.00 ? 74  LYS A HG3  8  
ATOM 11144 H HD2  . LYS A 1 74  ? 7.246   9.221   -2.688  1.00 0.00 ? 74  LYS A HD2  8  
ATOM 11145 H HD3  . LYS A 1 74  ? 8.865   9.740   -2.262  1.00 0.00 ? 74  LYS A HD3  8  
ATOM 11146 H HE2  . LYS A 1 74  ? 8.805   9.132   -4.643  1.00 0.00 ? 74  LYS A HE2  8  
ATOM 11147 H HE3  . LYS A 1 74  ? 9.827   7.999   -3.781  1.00 0.00 ? 74  LYS A HE3  8  
ATOM 11148 H HZ1  . LYS A 1 74  ? 7.758   7.333   -5.344  1.00 0.00 ? 74  LYS A HZ1  8  
ATOM 11149 H HZ2  . LYS A 1 74  ? 8.438   6.352   -4.230  1.00 0.00 ? 74  LYS A HZ2  8  
ATOM 11150 H HZ3  . LYS A 1 74  ? 7.096   7.204   -3.857  1.00 0.00 ? 74  LYS A HZ3  8  
ATOM 11151 N N    . ALA A 1 75  ? 7.934   8.611   3.037   1.00 0.00 ? 75  ALA A N    8  
ATOM 11152 C CA   . ALA A 1 75  ? 8.477   9.279   4.208   1.00 0.00 ? 75  ALA A CA   8  
ATOM 11153 C C    . ALA A 1 75  ? 9.275   8.272   5.039   1.00 0.00 ? 75  ALA A C    8  
ATOM 11154 O O    . ALA A 1 75  ? 10.402  8.552   5.444   1.00 0.00 ? 75  ALA A O    8  
ATOM 11155 C CB   . ALA A 1 75  ? 7.338   9.920   5.004   1.00 0.00 ? 75  ALA A CB   8  
ATOM 11156 H H    . ALA A 1 75  ? 6.938   8.645   2.955   1.00 0.00 ? 75  ALA A H    8  
ATOM 11157 H HA   . ALA A 1 75  ? 9.148   10.064  3.861   1.00 0.00 ? 75  ALA A HA   8  
ATOM 11158 H HB1  . ALA A 1 75  ? 6.422   9.894   4.414   1.00 0.00 ? 75  ALA A HB1  8  
ATOM 11159 H HB2  . ALA A 1 75  ? 7.188   9.368   5.932   1.00 0.00 ? 75  ALA A HB2  8  
ATOM 11160 H HB3  . ALA A 1 75  ? 7.593   10.954  5.233   1.00 0.00 ? 75  ALA A HB3  8  
ATOM 11161 N N    . CYS A 1 76  ? 8.659   7.122   5.269   1.00 0.00 ? 76  CYS A N    8  
ATOM 11162 C CA   . CYS A 1 76  ? 9.297   6.073   6.045   1.00 0.00 ? 76  CYS A CA   8  
ATOM 11163 C C    . CYS A 1 76  ? 10.613  5.700   5.358   1.00 0.00 ? 76  CYS A C    8  
ATOM 11164 O O    . CYS A 1 76  ? 10.610  5.031   4.326   1.00 0.00 ? 76  CYS A O    8  
ATOM 11165 C CB   . CYS A 1 76  ? 8.381   4.860   6.219   1.00 0.00 ? 76  CYS A CB   8  
ATOM 11166 S SG   . CYS A 1 76  ? 7.066   5.239   7.434   1.00 0.00 ? 76  CYS A SG   8  
ATOM 11167 H H    . CYS A 1 76  ? 7.741   6.903   4.937   1.00 0.00 ? 76  CYS A H    8  
ATOM 11168 H HA   . CYS A 1 76  ? 9.482   6.485   7.037   1.00 0.00 ? 76  CYS A HA   8  
ATOM 11169 H HB2  . CYS A 1 76  ? 7.936   4.590   5.261   1.00 0.00 ? 76  CYS A HB2  8  
ATOM 11170 H HB3  . CYS A 1 76  ? 8.961   4.001   6.555   1.00 0.00 ? 76  CYS A HB3  8  
ATOM 11171 H HG   . CYS A 1 76  ? 7.225   6.559   7.404   1.00 0.00 ? 76  CYS A HG   8  
ATOM 11172 N N    . THR A 1 77  ? 11.705  6.150   5.958   1.00 0.00 ? 77  THR A N    8  
ATOM 11173 C CA   . THR A 1 77  ? 13.024  5.872   5.416   1.00 0.00 ? 77  THR A CA   8  
ATOM 11174 C C    . THR A 1 77  ? 13.669  4.700   6.158   1.00 0.00 ? 77  THR A C    8  
ATOM 11175 O O    . THR A 1 77  ? 14.688  4.169   5.720   1.00 0.00 ? 77  THR A O    8  
ATOM 11176 C CB   . THR A 1 77  ? 13.845  7.162   5.486   1.00 0.00 ? 77  THR A CB   8  
ATOM 11177 O OG1  . THR A 1 77  ? 15.071  6.828   4.841   1.00 0.00 ? 77  THR A OG1  8  
ATOM 11178 C CG2  . THR A 1 77  ? 14.260  7.515   6.916   1.00 0.00 ? 77  THR A CG2  8  
ATOM 11179 H H    . THR A 1 77  ? 11.698  6.694   6.797   1.00 0.00 ? 77  THR A H    8  
ATOM 11180 H HA   . THR A 1 77  ? 12.912  5.569   4.376   1.00 0.00 ? 77  THR A HA   8  
ATOM 11181 H HB   . THR A 1 77  ? 13.310  7.989   5.021   1.00 0.00 ? 77  THR A HB   8  
ATOM 11182 H HG1  . THR A 1 77  ? 14.927  6.745   3.855   1.00 0.00 ? 77  THR A HG1  8  
ATOM 11183 H HG21 . THR A 1 77  ? 14.018  8.558   7.118   1.00 0.00 ? 77  THR A HG21 8  
ATOM 11184 H HG22 . THR A 1 77  ? 13.725  6.875   7.618   1.00 0.00 ? 77  THR A HG22 8  
ATOM 11185 H HG23 . THR A 1 77  ? 15.333  7.362   7.031   1.00 0.00 ? 77  THR A HG23 8  
ATOM 11186 N N    . GLY A 1 78  ? 13.049  4.332   7.270   1.00 0.00 ? 78  GLY A N    8  
ATOM 11187 C CA   . GLY A 1 78  ? 13.550  3.232   8.077   1.00 0.00 ? 78  GLY A CA   8  
ATOM 11188 C C    . GLY A 1 78  ? 12.631  2.014   7.975   1.00 0.00 ? 78  GLY A C    8  
ATOM 11189 O O    . GLY A 1 78  ? 12.923  1.071   7.242   1.00 0.00 ? 78  GLY A O    8  
ATOM 11190 H H    . GLY A 1 78  ? 12.221  4.770   7.619   1.00 0.00 ? 78  GLY A H    8  
ATOM 11191 H HA2  . GLY A 1 78  ? 14.554  2.963   7.748   1.00 0.00 ? 78  GLY A HA2  8  
ATOM 11192 H HA3  . GLY A 1 78  ? 13.629  3.547   9.118   1.00 0.00 ? 78  GLY A HA3  8  
ATOM 11193 N N    . SER A 1 79  ? 11.538  2.074   8.722   1.00 0.00 ? 79  SER A N    8  
ATOM 11194 C CA   . SER A 1 79  ? 10.573  0.987   8.725   1.00 0.00 ? 79  SER A CA   8  
ATOM 11195 C C    . SER A 1 79  ? 9.176   1.526   8.411   1.00 0.00 ? 79  SER A C    8  
ATOM 11196 O O    . SER A 1 79  ? 8.931   2.727   8.520   1.00 0.00 ? 79  SER A O    8  
ATOM 11197 C CB   . SER A 1 79  ? 10.570  0.257   10.070  1.00 0.00 ? 79  SER A CB   8  
ATOM 11198 O OG   . SER A 1 79  ? 10.877  1.132   11.152  1.00 0.00 ? 79  SER A OG   8  
ATOM 11199 H H    . SER A 1 79  ? 11.307  2.845   9.315   1.00 0.00 ? 79  SER A H    8  
ATOM 11200 H HA   . SER A 1 79  ? 10.905  0.304   7.943   1.00 0.00 ? 79  SER A HA   8  
ATOM 11201 H HB2  . SER A 1 79  ? 9.592   -0.194  10.235  1.00 0.00 ? 79  SER A HB2  8  
ATOM 11202 H HB3  . SER A 1 79  ? 11.296  -0.555  10.043  1.00 0.00 ? 79  SER A HB3  8  
ATOM 11203 H HG   . SER A 1 79  ? 11.762  0.888   11.549  1.00 0.00 ? 79  SER A HG   8  
ATOM 11204 N N    . LEU A 1 80  ? 8.297   0.613   8.027   1.00 0.00 ? 80  LEU A N    8  
ATOM 11205 C CA   . LEU A 1 80  ? 6.931   0.981   7.696   1.00 0.00 ? 80  LEU A CA   8  
ATOM 11206 C C    . LEU A 1 80  ? 5.985   0.431   8.765   1.00 0.00 ? 80  LEU A C    8  
ATOM 11207 O O    . LEU A 1 80  ? 5.943   -0.776  8.999   1.00 0.00 ? 80  LEU A O    8  
ATOM 11208 C CB   . LEU A 1 80  ? 6.583   0.530   6.276   1.00 0.00 ? 80  LEU A CB   8  
ATOM 11209 C CG   . LEU A 1 80  ? 5.571   1.397   5.525   1.00 0.00 ? 80  LEU A CG   8  
ATOM 11210 C CD1  . LEU A 1 80  ? 6.118   2.809   5.301   1.00 0.00 ? 80  LEU A CD1  8  
ATOM 11211 C CD2  . LEU A 1 80  ? 5.145   0.733   4.214   1.00 0.00 ? 80  LEU A CD2  8  
ATOM 11212 H H    . LEU A 1 80  ? 8.504   -0.362  7.941   1.00 0.00 ? 80  LEU A H    8  
ATOM 11213 H HA   . LEU A 1 80  ? 6.873   2.070   7.711   1.00 0.00 ? 80  LEU A HA   8  
ATOM 11214 H HB2  . LEU A 1 80  ? 7.503   0.492   5.692   1.00 0.00 ? 80  LEU A HB2  8  
ATOM 11215 H HB3  . LEU A 1 80  ? 6.195   -0.487  6.324   1.00 0.00 ? 80  LEU A HB3  8  
ATOM 11216 H HG   . LEU A 1 80  ? 4.678   1.493   6.142   1.00 0.00 ? 80  LEU A HG   8  
ATOM 11217 H HD11 . LEU A 1 80  ? 6.995   2.962   5.929   1.00 0.00 ? 80  LEU A HD11 8  
ATOM 11218 H HD12 . LEU A 1 80  ? 6.395   2.929   4.254   1.00 0.00 ? 80  LEU A HD12 8  
ATOM 11219 H HD13 . LEU A 1 80  ? 5.353   3.540   5.561   1.00 0.00 ? 80  LEU A HD13 8  
ATOM 11220 H HD21 . LEU A 1 80  ? 5.188   -0.350  4.325   1.00 0.00 ? 80  LEU A HD21 8  
ATOM 11221 H HD22 . LEU A 1 80  ? 4.126   1.034   3.969   1.00 0.00 ? 80  LEU A HD22 8  
ATOM 11222 H HD23 . LEU A 1 80  ? 5.818   1.043   3.414   1.00 0.00 ? 80  LEU A HD23 8  
ATOM 11223 N N    . ASN A 1 81  ? 5.249   1.342   9.384   1.00 0.00 ? 81  ASN A N    8  
ATOM 11224 C CA   . ASN A 1 81  ? 4.307   0.962   10.423  1.00 0.00 ? 81  ASN A CA   8  
ATOM 11225 C C    . ASN A 1 81  ? 2.887   1.304   9.967   1.00 0.00 ? 81  ASN A C    8  
ATOM 11226 O O    . ASN A 1 81  ? 2.497   2.471   9.961   1.00 0.00 ? 81  ASN A O    8  
ATOM 11227 C CB   . ASN A 1 81  ? 4.582   1.723   11.721  1.00 0.00 ? 81  ASN A CB   8  
ATOM 11228 C CG   . ASN A 1 81  ? 5.292   0.830   12.741  1.00 0.00 ? 81  ASN A CG   8  
ATOM 11229 O OD1  . ASN A 1 81  ? 4.722   0.393   13.726  1.00 0.00 ? 81  ASN A OD1  8  
ATOM 11230 N ND2  . ASN A 1 81  ? 6.566   0.583   12.449  1.00 0.00 ? 81  ASN A ND2  8  
ATOM 11231 H H    . ASN A 1 81  ? 5.289   2.321   9.187   1.00 0.00 ? 81  ASN A H    8  
ATOM 11232 H HA   . ASN A 1 81  ? 4.453   -0.109  10.565  1.00 0.00 ? 81  ASN A HA   8  
ATOM 11233 H HB2  . ASN A 1 81  ? 5.196   2.599   11.511  1.00 0.00 ? 81  ASN A HB2  8  
ATOM 11234 H HB3  . ASN A 1 81  ? 3.644   2.085   12.141  1.00 0.00 ? 81  ASN A HB3  8  
ATOM 11235 H HD21 . ASN A 1 81  ? 6.974   0.972   11.623  1.00 0.00 ? 81  ASN A HD21 8  
ATOM 11236 H HD22 . ASN A 1 81  ? 7.116   0.008   13.055  1.00 0.00 ? 81  ASN A HD22 8  
ATOM 11237 N N    . MET A 1 82  ? 2.153   0.265   9.596   1.00 0.00 ? 82  MET A N    8  
ATOM 11238 C CA   . MET A 1 82  ? 0.785   0.441   9.139   1.00 0.00 ? 82  MET A CA   8  
ATOM 11239 C C    . MET A 1 82  ? -0.136  -0.622  9.742   1.00 0.00 ? 82  MET A C    8  
ATOM 11240 O O    . MET A 1 82  ? 0.321   -1.698  10.126  1.00 0.00 ? 82  MET A O    8  
ATOM 11241 C CB   . MET A 1 82  ? 0.740   0.349   7.613   1.00 0.00 ? 82  MET A CB   8  
ATOM 11242 C CG   . MET A 1 82  ? 1.943   1.056   6.985   1.00 0.00 ? 82  MET A CG   8  
ATOM 11243 S SD   . MET A 1 82  ? 1.858   0.942   5.206   1.00 0.00 ? 82  MET A SD   8  
ATOM 11244 C CE   . MET A 1 82  ? 2.248   -0.786  4.987   1.00 0.00 ? 82  MET A CE   8  
ATOM 11245 H H    . MET A 1 82  ? 2.478   -0.680  9.604   1.00 0.00 ? 82  MET A H    8  
ATOM 11246 H HA   . MET A 1 82  ? 0.485   1.430   9.486   1.00 0.00 ? 82  MET A HA   8  
ATOM 11247 H HB2  . MET A 1 82  ? 0.729   -0.698  7.308   1.00 0.00 ? 82  MET A HB2  8  
ATOM 11248 H HB3  . MET A 1 82  ? -0.183  0.797   7.245   1.00 0.00 ? 82  MET A HB3  8  
ATOM 11249 H HG2  . MET A 1 82  ? 1.960   2.102   7.290   1.00 0.00 ? 82  MET A HG2  8  
ATOM 11250 H HG3  . MET A 1 82  ? 2.868   0.604   7.343   1.00 0.00 ? 82  MET A HG3  8  
ATOM 11251 H HE1  . MET A 1 82  ? 1.669   -1.187  4.156   1.00 0.00 ? 82  MET A HE1  8  
ATOM 11252 H HE2  . MET A 1 82  ? 3.312   -0.895  4.774   1.00 0.00 ? 82  MET A HE2  8  
ATOM 11253 H HE3  . MET A 1 82  ? 2.003   -1.332  5.898   1.00 0.00 ? 82  MET A HE3  8  
ATOM 11254 N N    . THR A 1 83  ? -1.415  -0.284  9.807   1.00 0.00 ? 83  THR A N    8  
ATOM 11255 C CA   . THR A 1 83  ? -2.403  -1.196  10.357  1.00 0.00 ? 83  THR A CA   8  
ATOM 11256 C C    . THR A 1 83  ? -3.225  -1.833  9.234   1.00 0.00 ? 83  THR A C    8  
ATOM 11257 O O    . THR A 1 83  ? -3.488  -1.196  8.215   1.00 0.00 ? 83  THR A O    8  
ATOM 11258 C CB   . THR A 1 83  ? -3.252  -0.421  11.367  1.00 0.00 ? 83  THR A CB   8  
ATOM 11259 O OG1  . THR A 1 83  ? -2.314  0.412   12.041  1.00 0.00 ? 83  THR A OG1  8  
ATOM 11260 C CG2  . THR A 1 83  ? -3.814  -1.319  12.471  1.00 0.00 ? 83  THR A CG2  8  
ATOM 11261 H H    . THR A 1 83  ? -1.778  0.593   9.493   1.00 0.00 ? 83  THR A H    8  
ATOM 11262 H HA   . THR A 1 83  ? -1.879  -2.005  10.867  1.00 0.00 ? 83  THR A HA   8  
ATOM 11263 H HB   . THR A 1 83  ? -4.050  0.126   10.866  1.00 0.00 ? 83  THR A HB   8  
ATOM 11264 H HG1  . THR A 1 83  ? -1.874  1.030   11.389  1.00 0.00 ? 83  THR A HG1  8  
ATOM 11265 H HG21 . THR A 1 83  ? -3.049  -2.028  12.787  1.00 0.00 ? 83  THR A HG21 8  
ATOM 11266 H HG22 . THR A 1 83  ? -4.114  -0.706  13.321  1.00 0.00 ? 83  THR A HG22 8  
ATOM 11267 H HG23 . THR A 1 83  ? -4.679  -1.863  12.092  1.00 0.00 ? 83  THR A HG23 8  
ATOM 11268 N N    . LEU A 1 84  ? -3.608  -3.081  9.459   1.00 0.00 ? 84  LEU A N    8  
ATOM 11269 C CA   . LEU A 1 84  ? -4.394  -3.810  8.478   1.00 0.00 ? 84  LEU A CA   8  
ATOM 11270 C C    . LEU A 1 84  ? -5.769  -4.129  9.069   1.00 0.00 ? 84  LEU A C    8  
ATOM 11271 O O    . LEU A 1 84  ? -5.953  -4.079  10.284  1.00 0.00 ? 84  LEU A O    8  
ATOM 11272 C CB   . LEU A 1 84  ? -3.633  -5.045  7.991   1.00 0.00 ? 84  LEU A CB   8  
ATOM 11273 C CG   . LEU A 1 84  ? -2.206  -4.800  7.496   1.00 0.00 ? 84  LEU A CG   8  
ATOM 11274 C CD1  . LEU A 1 84  ? -1.576  -6.095  6.979   1.00 0.00 ? 84  LEU A CD1  8  
ATOM 11275 C CD2  . LEU A 1 84  ? -2.173  -3.688  6.445   1.00 0.00 ? 84  LEU A CD2  8  
ATOM 11276 H H    . LEU A 1 84  ? -3.390  -3.592  10.290  1.00 0.00 ? 84  LEU A H    8  
ATOM 11277 H HA   . LEU A 1 84  ? -4.532  -3.156  7.617   1.00 0.00 ? 84  LEU A HA   8  
ATOM 11278 H HB2  . LEU A 1 84  ? -3.594  -5.768  8.806   1.00 0.00 ? 84  LEU A HB2  8  
ATOM 11279 H HB3  . LEU A 1 84  ? -4.203  -5.504  7.184   1.00 0.00 ? 84  LEU A HB3  8  
ATOM 11280 H HG   . LEU A 1 84  ? -1.604  -4.464  8.340   1.00 0.00 ? 84  LEU A HG   8  
ATOM 11281 H HD11 . LEU A 1 84  ? -0.658  -6.298  7.532   1.00 0.00 ? 84  LEU A HD11 8  
ATOM 11282 H HD12 . LEU A 1 84  ? -2.274  -6.920  7.119   1.00 0.00 ? 84  LEU A HD12 8  
ATOM 11283 H HD13 . LEU A 1 84  ? -1.345  -5.990  5.919   1.00 0.00 ? 84  LEU A HD13 8  
ATOM 11284 H HD21 . LEU A 1 84  ? -3.021  -3.802  5.769   1.00 0.00 ? 84  LEU A HD21 8  
ATOM 11285 H HD22 . LEU A 1 84  ? -2.231  -2.719  6.940   1.00 0.00 ? 84  LEU A HD22 8  
ATOM 11286 H HD23 . LEU A 1 84  ? -1.245  -3.752  5.878   1.00 0.00 ? 84  LEU A HD23 8  
ATOM 11287 N N    . GLN A 1 85  ? -6.699  -4.451  8.182   1.00 0.00 ? 85  GLN A N    8  
ATOM 11288 C CA   . GLN A 1 85  ? -8.051  -4.778  8.601   1.00 0.00 ? 85  GLN A CA   8  
ATOM 11289 C C    . GLN A 1 85  ? -8.328  -6.267  8.386   1.00 0.00 ? 85  GLN A C    8  
ATOM 11290 O O    . GLN A 1 85  ? -8.268  -6.758  7.260   1.00 0.00 ? 85  GLN A O    8  
ATOM 11291 C CB   . GLN A 1 85  ? -9.078  -3.918  7.860   1.00 0.00 ? 85  GLN A CB   8  
ATOM 11292 C CG   . GLN A 1 85  ? -10.480 -4.519  7.973   1.00 0.00 ? 85  GLN A CG   8  
ATOM 11293 C CD   . GLN A 1 85  ? -11.501 -3.678  7.204   1.00 0.00 ? 85  GLN A CD   8  
ATOM 11294 O OE1  . GLN A 1 85  ? -12.150 -2.796  7.743   1.00 0.00 ? 85  GLN A OE1  8  
ATOM 11295 N NE2  . GLN A 1 85  ? -11.606 -3.998  5.917   1.00 0.00 ? 85  GLN A NE2  8  
ATOM 11296 H H    . GLN A 1 85  ? -6.541  -4.489  7.195   1.00 0.00 ? 85  GLN A H    8  
ATOM 11297 H HA   . GLN A 1 85  ? -8.090  -4.543  9.664   1.00 0.00 ? 85  GLN A HA   8  
ATOM 11298 H HB2  . GLN A 1 85  ? -9.076  -2.909  8.271   1.00 0.00 ? 85  GLN A HB2  8  
ATOM 11299 H HB3  . GLN A 1 85  ? -8.798  -3.834  6.810   1.00 0.00 ? 85  GLN A HB3  8  
ATOM 11300 H HG2  . GLN A 1 85  ? -10.476 -5.537  7.584   1.00 0.00 ? 85  GLN A HG2  8  
ATOM 11301 H HG3  . GLN A 1 85  ? -10.770 -4.579  9.022   1.00 0.00 ? 85  GLN A HG3  8  
ATOM 11302 H HE21 . GLN A 1 85  ? -11.043 -4.733  5.537   1.00 0.00 ? 85  GLN A HE21 8  
ATOM 11303 H HE22 . GLN A 1 85  ? -12.247 -3.504  5.330   1.00 0.00 ? 85  GLN A HE22 8  
ATOM 11304 N N    . ARG A 1 86  ? -8.624  -6.946  9.485   1.00 0.00 ? 86  ARG A N    8  
ATOM 11305 C CA   . ARG A 1 86  ? -8.909  -8.369  9.432   1.00 0.00 ? 86  ARG A CA   8  
ATOM 11306 C C    . ARG A 1 86  ? -10.336 -8.606  8.934   1.00 0.00 ? 86  ARG A C    8  
ATOM 11307 O O    . ARG A 1 86  ? -11.297 -8.154  9.556   1.00 0.00 ? 86  ARG A O    8  
ATOM 11308 C CB   . ARG A 1 86  ? -8.742  -9.017  10.808  1.00 0.00 ? 86  ARG A CB   8  
ATOM 11309 C CG   . ARG A 1 86  ? -7.279  -9.383  11.068  1.00 0.00 ? 86  ARG A CG   8  
ATOM 11310 C CD   . ARG A 1 86  ? -6.379  -8.150  10.964  1.00 0.00 ? 86  ARG A CD   8  
ATOM 11311 N NE   . ARG A 1 86  ? -4.988  -8.507  11.321  1.00 0.00 ? 86  ARG A NE   8  
ATOM 11312 C CZ   . ARG A 1 86  ? -4.543  -8.628  12.580  1.00 0.00 ? 86  ARG A CZ   8  
ATOM 11313 N NH1  . ARG A 1 86  ? -5.377  -8.420  13.608  1.00 0.00 ? 86  ARG A NH1  8  
ATOM 11314 N NH2  . ARG A 1 86  ? -3.264  -8.956  12.810  1.00 0.00 ? 86  ARG A NH2  8  
ATOM 11315 H H    . ARG A 1 86  ? -8.670  -6.539  10.398  1.00 0.00 ? 86  ARG A H    8  
ATOM 11316 H HA   . ARG A 1 86  ? -8.178  -8.774  8.733   1.00 0.00 ? 86  ARG A HA   8  
ATOM 11317 H HB2  . ARG A 1 86  ? -9.092  -8.332  11.581  1.00 0.00 ? 86  ARG A HB2  8  
ATOM 11318 H HB3  . ARG A 1 86  ? -9.361  -9.911  10.871  1.00 0.00 ? 86  ARG A HB3  8  
ATOM 11319 H HG2  . ARG A 1 86  ? -7.182  -9.825  12.059  1.00 0.00 ? 86  ARG A HG2  8  
ATOM 11320 H HG3  . ARG A 1 86  ? -6.956  -10.136 10.350  1.00 0.00 ? 86  ARG A HG3  8  
ATOM 11321 H HD2  . ARG A 1 86  ? -6.411  -7.751  9.950   1.00 0.00 ? 86  ARG A HD2  8  
ATOM 11322 H HD3  . ARG A 1 86  ? -6.743  -7.366  11.627  1.00 0.00 ? 86  ARG A HD3  8  
ATOM 11323 H HE   . ARG A 1 86  ? -4.339  -8.669  10.577  1.00 0.00 ? 86  ARG A HE   8  
ATOM 11324 H HH11 . ARG A 1 86  ? -6.331  -8.175  13.436  1.00 0.00 ? 86  ARG A HH11 8  
ATOM 11325 H HH12 . ARG A 1 86  ? -5.045  -8.509  14.547  1.00 0.00 ? 86  ARG A HH12 8  
ATOM 11326 H HH21 . ARG A 1 86  ? -2.642  -9.111  12.042  1.00 0.00 ? 86  ARG A HH21 8  
ATOM 11327 H HH22 . ARG A 1 86  ? -2.932  -9.045  13.749  1.00 0.00 ? 86  ARG A HH22 8  
ATOM 11328 N N    . ALA A 1 87  ? -10.430 -9.314  7.819   1.00 0.00 ? 87  ALA A N    8  
ATOM 11329 C CA   . ALA A 1 87  ? -11.724 -9.617  7.231   1.00 0.00 ? 87  ALA A CA   8  
ATOM 11330 C C    . ALA A 1 87  ? -11.649 -10.964 6.510   1.00 0.00 ? 87  ALA A C    8  
ATOM 11331 O O    . ALA A 1 87  ? -11.528 -11.012 5.287   1.00 0.00 ? 87  ALA A O    8  
ATOM 11332 C CB   . ALA A 1 87  ? -12.139 -8.478  6.297   1.00 0.00 ? 87  ALA A CB   8  
ATOM 11333 H H    . ALA A 1 87  ? -9.644  -9.678  7.319   1.00 0.00 ? 87  ALA A H    8  
ATOM 11334 H HA   . ALA A 1 87  ? -12.449 -9.687  8.042   1.00 0.00 ? 87  ALA A HA   8  
ATOM 11335 H HB1  . ALA A 1 87  ? -11.251 -8.040  5.841   1.00 0.00 ? 87  ALA A HB1  8  
ATOM 11336 H HB2  . ALA A 1 87  ? -12.793 -8.868  5.517   1.00 0.00 ? 87  ALA A HB2  8  
ATOM 11337 H HB3  . ALA A 1 87  ? -12.669 -7.715  6.867   1.00 0.00 ? 87  ALA A HB3  8  
ATOM 11338 N N    . SER A 1 88  ? -11.725 -12.026 7.299   1.00 0.00 ? 88  SER A N    8  
ATOM 11339 C CA   . SER A 1 88  ? -11.668 -13.371 6.751   1.00 0.00 ? 88  SER A CA   8  
ATOM 11340 C C    . SER A 1 88  ? -13.080 -13.869 6.439   1.00 0.00 ? 88  SER A C    8  
ATOM 11341 O O    . SER A 1 88  ? -14.064 -13.234 6.816   1.00 0.00 ? 88  SER A O    8  
ATOM 11342 C CB   . SER A 1 88  ? -10.968 -14.329 7.717   1.00 0.00 ? 88  SER A CB   8  
ATOM 11343 O OG   . SER A 1 88  ? -9.746  -14.829 7.181   1.00 0.00 ? 88  SER A OG   8  
ATOM 11344 H H    . SER A 1 88  ? -11.824 -11.978 8.293   1.00 0.00 ? 88  SER A H    8  
ATOM 11345 H HA   . SER A 1 88  ? -11.081 -13.285 5.837   1.00 0.00 ? 88  SER A HA   8  
ATOM 11346 H HB2  . SER A 1 88  ? -10.768 -13.815 8.657   1.00 0.00 ? 88  SER A HB2  8  
ATOM 11347 H HB3  . SER A 1 88  ? -11.632 -15.163 7.945   1.00 0.00 ? 88  SER A HB3  8  
ATOM 11348 H HG   . SER A 1 88  ? -9.848  -15.003 6.202   1.00 0.00 ? 88  SER A HG   8  
ATOM 11349 N N    . ALA A 1 89  ? -13.135 -15.001 5.753   1.00 0.00 ? 89  ALA A N    8  
ATOM 11350 C CA   . ALA A 1 89  ? -14.411 -15.592 5.385   1.00 0.00 ? 89  ALA A CA   8  
ATOM 11351 C C    . ALA A 1 89  ? -15.292 -15.707 6.630   1.00 0.00 ? 89  ALA A C    8  
ATOM 11352 O O    . ALA A 1 89  ? -14.802 -16.016 7.716   1.00 0.00 ? 89  ALA A O    8  
ATOM 11353 C CB   . ALA A 1 89  ? -14.172 -16.945 4.712   1.00 0.00 ? 89  ALA A CB   8  
ATOM 11354 H H    . ALA A 1 89  ? -12.330 -15.511 5.450   1.00 0.00 ? 89  ALA A H    8  
ATOM 11355 H HA   . ALA A 1 89  ? -14.892 -14.925 4.670   1.00 0.00 ? 89  ALA A HA   8  
ATOM 11356 H HB1  . ALA A 1 89  ? -13.197 -17.332 5.010   1.00 0.00 ? 89  ALA A HB1  8  
ATOM 11357 H HB2  . ALA A 1 89  ? -14.950 -17.645 5.019   1.00 0.00 ? 89  ALA A HB2  8  
ATOM 11358 H HB3  . ALA A 1 89  ? -14.200 -16.823 3.630   1.00 0.00 ? 89  ALA A HB3  8  
ATOM 11359 N N    . ALA A 1 90  ? -16.578 -15.454 6.432   1.00 0.00 ? 90  ALA A N    8  
ATOM 11360 C CA   . ALA A 1 90  ? -17.532 -15.525 7.526   1.00 0.00 ? 90  ALA A CA   8  
ATOM 11361 C C    . ALA A 1 90  ? -18.416 -16.760 7.345   1.00 0.00 ? 90  ALA A C    8  
ATOM 11362 O O    . ALA A 1 90  ? -19.339 -16.754 6.532   1.00 0.00 ? 90  ALA A O    8  
ATOM 11363 C CB   . ALA A 1 90  ? -18.344 -14.229 7.580   1.00 0.00 ? 90  ALA A CB   8  
ATOM 11364 H H    . ALA A 1 90  ? -16.968 -15.203 5.546   1.00 0.00 ? 90  ALA A H    8  
ATOM 11365 H HA   . ALA A 1 90  ? -16.967 -15.625 8.453   1.00 0.00 ? 90  ALA A HA   8  
ATOM 11366 H HB1  . ALA A 1 90  ? -17.770 -13.421 7.127   1.00 0.00 ? 90  ALA A HB1  8  
ATOM 11367 H HB2  . ALA A 1 90  ? -19.278 -14.363 7.034   1.00 0.00 ? 90  ALA A HB2  8  
ATOM 11368 H HB3  . ALA A 1 90  ? -18.563 -13.981 8.619   1.00 0.00 ? 90  ALA A HB3  8  
ATOM 11369 N N    . ALA A 1 91  ? -18.103 -17.791 8.118   1.00 0.00 ? 91  ALA A N    8  
ATOM 11370 C CA   . ALA A 1 91  ? -18.858 -19.030 8.053   1.00 0.00 ? 91  ALA A CA   8  
ATOM 11371 C C    . ALA A 1 91  ? -19.426 -19.349 9.438   1.00 0.00 ? 91  ALA A C    8  
ATOM 11372 O O    . ALA A 1 91  ? -18.970 -18.803 10.441  1.00 0.00 ? 91  ALA A O    8  
ATOM 11373 C CB   . ALA A 1 91  ? -17.960 -20.148 7.520   1.00 0.00 ? 91  ALA A CB   8  
ATOM 11374 H H    . ALA A 1 91  ? -17.352 -17.787 8.777   1.00 0.00 ? 91  ALA A H    8  
ATOM 11375 H HA   . ALA A 1 91  ? -19.683 -18.881 7.357   1.00 0.00 ? 91  ALA A HA   8  
ATOM 11376 H HB1  . ALA A 1 91  ? -18.002 -21.002 8.196   1.00 0.00 ? 91  ALA A HB1  8  
ATOM 11377 H HB2  . ALA A 1 91  ? -18.304 -20.451 6.531   1.00 0.00 ? 91  ALA A HB2  8  
ATOM 11378 H HB3  . ALA A 1 91  ? -16.933 -19.788 7.453   1.00 0.00 ? 91  ALA A HB3  8  
ATOM 11379 N N    . LYS A 1 92  ? -20.414 -20.232 9.448   1.00 0.00 ? 92  LYS A N    8  
ATOM 11380 C CA   . LYS A 1 92  ? -21.049 -20.630 10.693  1.00 0.00 ? 92  LYS A CA   8  
ATOM 11381 C C    . LYS A 1 92  ? -20.816 -22.125 10.924  1.00 0.00 ? 92  LYS A C    8  
ATOM 11382 O O    . LYS A 1 92  ? -20.356 -22.831 10.028  1.00 0.00 ? 92  LYS A O    8  
ATOM 11383 C CB   . LYS A 1 92  ? -22.526 -20.231 10.692  1.00 0.00 ? 92  LYS A CB   8  
ATOM 11384 C CG   . LYS A 1 92  ? -22.688 -18.729 10.932  1.00 0.00 ? 92  LYS A CG   8  
ATOM 11385 C CD   . LYS A 1 92  ? -22.528 -17.945 9.627   1.00 0.00 ? 92  LYS A CD   8  
ATOM 11386 C CE   . LYS A 1 92  ? -23.805 -18.013 8.787   1.00 0.00 ? 92  LYS A CE   8  
ATOM 11387 N NZ   . LYS A 1 92  ? -23.478 -17.984 7.344   1.00 0.00 ? 92  LYS A NZ   8  
ATOM 11388 H H    . LYS A 1 92  ? -20.779 -20.672 8.627   1.00 0.00 ? 92  LYS A H    8  
ATOM 11389 H HA   . LYS A 1 92  ? -20.566 -20.077 11.498  1.00 0.00 ? 92  LYS A HA   8  
ATOM 11390 H HB2  . LYS A 1 92  ? -22.980 -20.502 9.739   1.00 0.00 ? 92  LYS A HB2  8  
ATOM 11391 H HB3  . LYS A 1 92  ? -23.057 -20.786 11.466  1.00 0.00 ? 92  LYS A HB3  8  
ATOM 11392 H HG2  . LYS A 1 92  ? -23.669 -18.529 11.362  1.00 0.00 ? 92  LYS A HG2  8  
ATOM 11393 H HG3  . LYS A 1 92  ? -21.947 -18.390 11.656  1.00 0.00 ? 92  LYS A HG3  8  
ATOM 11394 H HD2  . LYS A 1 92  ? -22.291 -16.905 9.851   1.00 0.00 ? 92  LYS A HD2  8  
ATOM 11395 H HD3  . LYS A 1 92  ? -21.691 -18.348 9.057   1.00 0.00 ? 92  LYS A HD3  8  
ATOM 11396 H HE2  . LYS A 1 92  ? -24.354 -18.925 9.023   1.00 0.00 ? 92  LYS A HE2  8  
ATOM 11397 H HE3  . LYS A 1 92  ? -24.456 -17.175 9.036   1.00 0.00 ? 92  LYS A HE3  8  
ATOM 11398 H HZ1  . LYS A 1 92  ? -22.793 -18.685 7.143   1.00 0.00 ? 92  LYS A HZ1  8  
ATOM 11399 H HZ2  . LYS A 1 92  ? -24.305 -18.163 6.811   1.00 0.00 ? 92  LYS A HZ2  8  
ATOM 11400 H HZ3  . LYS A 1 92  ? -23.115 -17.084 7.103   1.00 0.00 ? 92  LYS A HZ3  8  
ATOM 11401 N N    . SER A 1 93  ? -21.144 -22.562 12.131  1.00 0.00 ? 93  SER A N    8  
ATOM 11402 C CA   . SER A 1 93  ? -20.976 -23.960 12.491  1.00 0.00 ? 93  SER A CA   8  
ATOM 11403 C C    . SER A 1 93  ? -22.287 -24.517 13.049  1.00 0.00 ? 93  SER A C    8  
ATOM 11404 O O    . SER A 1 93  ? -22.640 -24.252 14.197  1.00 0.00 ? 93  SER A O    8  
ATOM 11405 C CB   . SER A 1 93  ? -19.849 -24.134 13.511  1.00 0.00 ? 93  SER A CB   8  
ATOM 11406 O OG   . SER A 1 93  ? -18.853 -25.045 13.055  1.00 0.00 ? 93  SER A OG   8  
ATOM 11407 H H    . SER A 1 93  ? -21.517 -21.981 12.854  1.00 0.00 ? 93  SER A H    8  
ATOM 11408 H HA   . SER A 1 93  ? -20.708 -24.467 11.564  1.00 0.00 ? 93  SER A HA   8  
ATOM 11409 H HB2  . SER A 1 93  ? -19.390 -23.166 13.713  1.00 0.00 ? 93  SER A HB2  8  
ATOM 11410 H HB3  . SER A 1 93  ? -20.264 -24.493 14.453  1.00 0.00 ? 93  SER A HB3  8  
ATOM 11411 H HG   . SER A 1 93  ? -18.760 -25.803 13.701  1.00 0.00 ? 93  SER A HG   8  
ATOM 11412 N N    . GLU A 1 94  ? -22.973 -25.280 12.210  1.00 0.00 ? 94  GLU A N    8  
ATOM 11413 C CA   . GLU A 1 94  ? -24.237 -25.878 12.605  1.00 0.00 ? 94  GLU A CA   8  
ATOM 11414 C C    . GLU A 1 94  ? -24.096 -27.397 12.712  1.00 0.00 ? 94  GLU A C    8  
ATOM 11415 O O    . GLU A 1 94  ? -23.924 -28.081 11.705  1.00 0.00 ? 94  GLU A O    8  
ATOM 11416 C CB   . GLU A 1 94  ? -25.352 -25.498 11.628  1.00 0.00 ? 94  GLU A CB   8  
ATOM 11417 C CG   . GLU A 1 94  ? -26.528 -24.852 12.362  1.00 0.00 ? 94  GLU A CG   8  
ATOM 11418 C CD   . GLU A 1 94  ? -27.854 -25.487 11.939  1.00 0.00 ? 94  GLU A CD   8  
ATOM 11419 O OE1  . GLU A 1 94  ? -28.115 -25.497 10.717  1.00 0.00 ? 94  GLU A OE1  8  
ATOM 11420 O OE2  . GLU A 1 94  ? -28.578 -25.949 12.848  1.00 0.00 ? 94  GLU A OE2  8  
ATOM 11421 H H    . GLU A 1 94  ? -22.679 -25.491 11.278  1.00 0.00 ? 94  GLU A H    8  
ATOM 11422 H HA   . GLU A 1 94  ? -24.463 -25.457 13.585  1.00 0.00 ? 94  GLU A HA   8  
ATOM 11423 H HB2  . GLU A 1 94  ? -24.964 -24.809 10.878  1.00 0.00 ? 94  GLU A HB2  8  
ATOM 11424 H HB3  . GLU A 1 94  ? -25.694 -26.387 11.098  1.00 0.00 ? 94  GLU A HB3  8  
ATOM 11425 H HG2  . GLU A 1 94  ? -26.395 -24.962 13.438  1.00 0.00 ? 94  GLU A HG2  8  
ATOM 11426 H HG3  . GLU A 1 94  ? -26.550 -23.783 12.151  1.00 0.00 ? 94  GLU A HG3  8  
ATOM 11427 N N    . PRO A 1 95  ? -24.176 -27.894 13.976  1.00 0.00 ? 95  PRO A N    8  
ATOM 11428 C CA   . PRO A 1 95  ? -24.059 -29.320 14.228  1.00 0.00 ? 95  PRO A CA   8  
ATOM 11429 C C    . PRO A 1 95  ? -25.337 -30.056 13.820  1.00 0.00 ? 95  PRO A C    8  
ATOM 11430 O O    . PRO A 1 95  ? -26.327 -29.428 13.448  1.00 0.00 ? 95  PRO A O    8  
ATOM 11431 C CB   . PRO A 1 95  ? -23.756 -29.434 15.713  1.00 0.00 ? 95  PRO A CB   8  
ATOM 11432 C CG   . PRO A 1 95  ? -24.173 -28.107 16.326  1.00 0.00 ? 95  PRO A CG   8  
ATOM 11433 C CD   . PRO A 1 95  ? -24.379 -27.115 15.193  1.00 0.00 ? 95  PRO A CD   8  
ATOM 11434 H HA   . PRO A 1 95  ? -23.328 -29.713 13.669  1.00 0.00 ? 95  PRO A HA   8  
ATOM 11435 H HB2  . PRO A 1 95  ? -24.306 -30.261 16.162  1.00 0.00 ? 95  PRO A HB2  8  
ATOM 11436 H HB3  . PRO A 1 95  ? -22.697 -29.626 15.882  1.00 0.00 ? 95  PRO A HB3  8  
ATOM 11437 H HG2  . PRO A 1 95  ? -25.091 -28.224 16.903  1.00 0.00 ? 95  PRO A HG2  8  
ATOM 11438 H HG3  . PRO A 1 95  ? -23.408 -27.747 17.014  1.00 0.00 ? 95  PRO A HG3  8  
ATOM 11439 H HD2  . PRO A 1 95  ? -25.379 -26.681 15.224  1.00 0.00 ? 95  PRO A HD2  8  
ATOM 11440 H HD3  . PRO A 1 95  ? -23.672 -26.288 15.257  1.00 0.00 ? 95  PRO A HD3  8  
ATOM 11441 N N    . VAL A 1 96  ? -25.274 -31.377 13.905  1.00 0.00 ? 96  VAL A N    8  
ATOM 11442 C CA   . VAL A 1 96  ? -26.414 -32.205 13.550  1.00 0.00 ? 96  VAL A CA   8  
ATOM 11443 C C    . VAL A 1 96  ? -27.199 -32.554 14.816  1.00 0.00 ? 96  VAL A C    8  
ATOM 11444 O O    . VAL A 1 96  ? -26.610 -32.873 15.847  1.00 0.00 ? 96  VAL A O    8  
ATOM 11445 C CB   . VAL A 1 96  ? -25.944 -33.439 12.778  1.00 0.00 ? 96  VAL A CB   8  
ATOM 11446 C CG1  . VAL A 1 96  ? -27.111 -34.389 12.499  1.00 0.00 ? 96  VAL A CG1  8  
ATOM 11447 C CG2  . VAL A 1 96  ? -25.241 -33.039 11.479  1.00 0.00 ? 96  VAL A CG2  8  
ATOM 11448 H H    . VAL A 1 96  ? -24.465 -31.880 14.209  1.00 0.00 ? 96  VAL A H    8  
ATOM 11449 H HA   . VAL A 1 96  ? -27.054 -31.618 12.891  1.00 0.00 ? 96  VAL A HA   8  
ATOM 11450 H HB   . VAL A 1 96  ? -25.222 -33.968 13.400  1.00 0.00 ? 96  VAL A HB   8  
ATOM 11451 H HG11 . VAL A 1 96  ? -26.815 -35.409 12.744  1.00 0.00 ? 96  VAL A HG11 8  
ATOM 11452 H HG12 . VAL A 1 96  ? -27.966 -34.102 13.111  1.00 0.00 ? 96  VAL A HG12 8  
ATOM 11453 H HG13 . VAL A 1 96  ? -27.382 -34.332 11.445  1.00 0.00 ? 96  VAL A HG13 8  
ATOM 11454 H HG21 . VAL A 1 96  ? -25.926 -32.460 10.859  1.00 0.00 ? 96  VAL A HG21 8  
ATOM 11455 H HG22 . VAL A 1 96  ? -24.363 -32.436 11.712  1.00 0.00 ? 96  VAL A HG22 8  
ATOM 11456 H HG23 . VAL A 1 96  ? -24.934 -33.935 10.941  1.00 0.00 ? 96  VAL A HG23 8  
ATOM 11457 N N    . SER A 1 97  ? -28.517 -32.483 14.695  1.00 0.00 ? 97  SER A N    8  
ATOM 11458 C CA   . SER A 1 97  ? -29.388 -32.788 15.817  1.00 0.00 ? 97  SER A CA   8  
ATOM 11459 C C    . SER A 1 97  ? -29.944 -34.206 15.677  1.00 0.00 ? 97  SER A C    8  
ATOM 11460 O O    . SER A 1 97  ? -30.657 -34.506 14.720  1.00 0.00 ? 97  SER A O    8  
ATOM 11461 C CB   . SER A 1 97  ? -30.533 -31.777 15.916  1.00 0.00 ? 97  SER A CB   8  
ATOM 11462 O OG   . SER A 1 97  ? -31.355 -32.011 17.056  1.00 0.00 ? 97  SER A OG   8  
ATOM 11463 H H    . SER A 1 97  ? -28.988 -32.223 13.852  1.00 0.00 ? 97  SER A H    8  
ATOM 11464 H HA   . SER A 1 97  ? -28.758 -32.710 16.702  1.00 0.00 ? 97  SER A HA   8  
ATOM 11465 H HB2  . SER A 1 97  ? -30.122 -30.768 15.966  1.00 0.00 ? 97  SER A HB2  8  
ATOM 11466 H HB3  . SER A 1 97  ? -31.141 -31.828 15.013  1.00 0.00 ? 97  SER A HB3  8  
ATOM 11467 H HG   . SER A 1 97  ? -31.788 -32.910 16.986  1.00 0.00 ? 97  SER A HG   8  
ATOM 11468 N N    . SER A 1 98  ? -29.597 -35.042 16.645  1.00 0.00 ? 98  SER A N    8  
ATOM 11469 C CA   . SER A 1 98  ? -30.053 -36.422 16.641  1.00 0.00 ? 98  SER A CA   8  
ATOM 11470 C C    . SER A 1 98  ? -29.693 -37.094 17.968  1.00 0.00 ? 98  SER A C    8  
ATOM 11471 O O    . SER A 1 98  ? -28.774 -36.660 18.659  1.00 0.00 ? 98  SER A O    8  
ATOM 11472 C CB   . SER A 1 98  ? -29.447 -37.199 15.471  1.00 0.00 ? 98  SER A CB   8  
ATOM 11473 O OG   . SER A 1 98  ? -30.110 -36.915 14.242  1.00 0.00 ? 98  SER A OG   8  
ATOM 11474 H H    . SER A 1 98  ? -29.017 -34.790 17.419  1.00 0.00 ? 98  SER A H    8  
ATOM 11475 H HA   . SER A 1 98  ? -31.134 -36.368 16.520  1.00 0.00 ? 98  SER A HA   8  
ATOM 11476 H HB2  . SER A 1 98  ? -28.390 -36.949 15.378  1.00 0.00 ? 98  SER A HB2  8  
ATOM 11477 H HB3  . SER A 1 98  ? -29.505 -38.268 15.676  1.00 0.00 ? 98  SER A HB3  8  
ATOM 11478 H HG   . SER A 1 98  ? -31.064 -37.210 14.292  1.00 0.00 ? 98  SER A HG   8  
ATOM 11479 N N    . GLY A 1 99  ? -30.438 -38.144 18.283  1.00 0.00 ? 99  GLY A N    8  
ATOM 11480 C CA   . GLY A 1 99  ? -30.209 -38.881 19.514  1.00 0.00 ? 99  GLY A CA   8  
ATOM 11481 C C    . GLY A 1 99  ? -29.036 -39.852 19.362  1.00 0.00 ? 99  GLY A C    8  
ATOM 11482 O O    . GLY A 1 99  ? -28.314 -39.807 18.368  1.00 0.00 ? 99  GLY A O    8  
ATOM 11483 H H    . GLY A 1 99  ? -31.184 -38.491 17.714  1.00 0.00 ? 99  GLY A H    8  
ATOM 11484 H HA2  . GLY A 1 99  ? -30.007 -38.184 20.327  1.00 0.00 ? 99  GLY A HA2  8  
ATOM 11485 H HA3  . GLY A 1 99  ? -31.110 -39.433 19.784  1.00 0.00 ? 99  GLY A HA3  8  
ATOM 11486 N N    . PRO A 1 100 ? -28.879 -40.729 20.390  1.00 0.00 ? 100 PRO A N    8  
ATOM 11487 C CA   . PRO A 1 100 ? -27.806 -41.708 20.380  1.00 0.00 ? 100 PRO A CA   8  
ATOM 11488 C C    . PRO A 1 100 ? -28.114 -42.849 19.408  1.00 0.00 ? 100 PRO A C    8  
ATOM 11489 O O    . PRO A 1 100 ? -28.186 -44.010 19.810  1.00 0.00 ? 100 PRO A O    8  
ATOM 11490 C CB   . PRO A 1 100 ? -27.686 -42.173 21.822  1.00 0.00 ? 100 PRO A CB   8  
ATOM 11491 C CG   . PRO A 1 100 ? -28.992 -41.787 22.496  1.00 0.00 ? 100 PRO A CG   8  
ATOM 11492 C CD   . PRO A 1 100 ? -29.716 -40.810 21.583  1.00 0.00 ? 100 PRO A CD   8  
ATOM 11493 H HA   . PRO A 1 100 ? -26.959 -41.292 20.053  1.00 0.00 ? 100 PRO A HA   8  
ATOM 11494 H HB2  . PRO A 1 100 ? -27.523 -43.250 21.873  1.00 0.00 ? 100 PRO A HB2  8  
ATOM 11495 H HB3  . PRO A 1 100 ? -26.837 -41.699 22.316  1.00 0.00 ? 100 PRO A HB3  8  
ATOM 11496 H HG2  . PRO A 1 100 ? -29.606 -42.670 22.673  1.00 0.00 ? 100 PRO A HG2  8  
ATOM 11497 H HG3  . PRO A 1 100 ? -28.801 -41.332 23.468  1.00 0.00 ? 100 PRO A HG3  8  
ATOM 11498 H HD2  . PRO A 1 100 ? -30.718 -41.163 21.341  1.00 0.00 ? 100 PRO A HD2  8  
ATOM 11499 H HD3  . PRO A 1 100 ? -29.828 -39.835 22.056  1.00 0.00 ? 100 PRO A HD3  8  
ATOM 11500 N N    . SER A 1 101 ? -28.288 -42.479 18.148  1.00 0.00 ? 101 SER A N    8  
ATOM 11501 C CA   . SER A 1 101 ? -28.586 -43.457 17.115  1.00 0.00 ? 101 SER A CA   8  
ATOM 11502 C C    . SER A 1 101 ? -27.471 -43.468 16.068  1.00 0.00 ? 101 SER A C    8  
ATOM 11503 O O    . SER A 1 101 ? -27.071 -42.417 15.571  1.00 0.00 ? 101 SER A O    8  
ATOM 11504 C CB   . SER A 1 101 ? -29.934 -43.165 16.453  1.00 0.00 ? 101 SER A CB   8  
ATOM 11505 O OG   . SER A 1 101 ? -30.973 -43.992 16.970  1.00 0.00 ? 101 SER A OG   8  
ATOM 11506 H H    . SER A 1 101 ? -28.228 -41.533 17.829  1.00 0.00 ? 101 SER A H    8  
ATOM 11507 H HA   . SER A 1 101 ? -28.636 -44.416 17.632  1.00 0.00 ? 101 SER A HA   8  
ATOM 11508 H HB2  . SER A 1 101 ? -30.194 -42.118 16.607  1.00 0.00 ? 101 SER A HB2  8  
ATOM 11509 H HB3  . SER A 1 101 ? -29.850 -43.318 15.377  1.00 0.00 ? 101 SER A HB3  8  
ATOM 11510 H HG   . SER A 1 101 ? -31.609 -43.443 17.512  1.00 0.00 ? 101 SER A HG   8  
ATOM 11511 N N    . SER A 1 102 ? -27.002 -44.669 15.762  1.00 0.00 ? 102 SER A N    8  
ATOM 11512 C CA   . SER A 1 102 ? -25.941 -44.831 14.782  1.00 0.00 ? 102 SER A CA   8  
ATOM 11513 C C    . SER A 1 102 ? -26.541 -45.012 13.387  1.00 0.00 ? 102 SER A C    8  
ATOM 11514 O O    . SER A 1 102 ? -26.820 -46.135 12.968  1.00 0.00 ? 102 SER A O    8  
ATOM 11515 C CB   . SER A 1 102 ? -25.044 -46.020 15.133  1.00 0.00 ? 102 SER A CB   8  
ATOM 11516 O OG   . SER A 1 102 ? -23.840 -45.609 15.775  1.00 0.00 ? 102 SER A OG   8  
ATOM 11517 H H    . SER A 1 102 ? -27.333 -45.520 16.171  1.00 0.00 ? 102 SER A H    8  
ATOM 11518 H HA   . SER A 1 102 ? -25.359 -43.911 14.832  1.00 0.00 ? 102 SER A HA   8  
ATOM 11519 H HB2  . SER A 1 102 ? -25.588 -46.704 15.785  1.00 0.00 ? 102 SER A HB2  8  
ATOM 11520 H HB3  . SER A 1 102 ? -24.802 -46.571 14.225  1.00 0.00 ? 102 SER A HB3  8  
ATOM 11521 H HG   . SER A 1 102 ? -23.256 -46.403 15.946  1.00 0.00 ? 102 SER A HG   8  
ATOM 11522 N N    . GLY A 1 103 ? -26.722 -43.890 12.705  1.00 0.00 ? 103 GLY A N    8  
ATOM 11523 C CA   . GLY A 1 103 ? -27.284 -43.911 11.365  1.00 0.00 ? 103 GLY A CA   8  
ATOM 11524 C C    . GLY A 1 103 ? -26.571 -42.908 10.456  1.00 0.00 ? 103 GLY A C    8  
ATOM 11525 O O    . GLY A 1 103 ? -26.814 -41.706 10.541  1.00 0.00 ? 103 GLY A O    8  
ATOM 11526 H H    . GLY A 1 103 ? -26.492 -42.981 13.053  1.00 0.00 ? 103 GLY A H    8  
ATOM 11527 H HA2  . GLY A 1 103 ? -27.197 -44.914 10.946  1.00 0.00 ? 103 GLY A HA2  8  
ATOM 11528 H HA3  . GLY A 1 103 ? -28.347 -43.675 11.409  1.00 0.00 ? 103 GLY A HA3  8  
ATOM 11529 N N    . GLY A 1 1   ? -14.178 0.813   26.564  1.00 0.00 ? 1   GLY A N    9  
ATOM 11530 C CA   . GLY A 1 1   ? -14.101 -0.369  25.722  1.00 0.00 ? 1   GLY A CA   9  
ATOM 11531 C C    . GLY A 1 1   ? -13.381 -0.060  24.407  1.00 0.00 ? 1   GLY A C    9  
ATOM 11532 O O    . GLY A 1 1   ? -13.920 0.637   23.550  1.00 0.00 ? 1   GLY A O    9  
ATOM 11533 H H1   . GLY A 1 1   ? -13.325 1.329   26.647  1.00 0.00 ? 1   GLY A H1   9  
ATOM 11534 H HA2  . GLY A 1 1   ? -13.574 -1.163  26.251  1.00 0.00 ? 1   GLY A HA2  9  
ATOM 11535 H HA3  . GLY A 1 1   ? -15.105 -0.737  25.513  1.00 0.00 ? 1   GLY A HA3  9  
ATOM 11536 N N    . SER A 1 2   ? -12.175 -0.595  24.291  1.00 0.00 ? 2   SER A N    9  
ATOM 11537 C CA   . SER A 1 2   ? -11.376 -0.386  23.095  1.00 0.00 ? 2   SER A CA   9  
ATOM 11538 C C    . SER A 1 2   ? -11.74