data_1WFN
# 
_entry.id   1WFN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1WFN         
RCSB  RCSB023526   
WWPDB D_1000023526 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002101486.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WFN 
_pdbx_database_status.recvd_initial_deposition_date   2004-05-26 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nagashima, T.'                                          1 
'Hayashi, F.'                                            2 
'Yokoyama, S.'                                           3 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 
# 
_citation.id                        primary 
_citation.title                     'The fourth FN3 domain of human sidekick-2' 
_citation.journal_abbrev            'TO BE PUBLISHED' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nagashima, T.' 1 
primary 'Hayashi, F.'   2 
primary 'Yokoyama, S.'  3 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'sidekick 2' 
_entity.formula_weight             12635.885 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'FN3 domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Drosophila sidekick-like, chicken sidekick 2-like' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTG
LTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTG
LTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002101486.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   PRO n 
1 9   GLN n 
1 10  LEU n 
1 11  VAL n 
1 12  ARG n 
1 13  THR n 
1 14  HIS n 
1 15  GLU n 
1 16  ASP n 
1 17  VAL n 
1 18  PRO n 
1 19  GLY n 
1 20  PRO n 
1 21  VAL n 
1 22  GLY n 
1 23  HIS n 
1 24  LEU n 
1 25  SER n 
1 26  PHE n 
1 27  SER n 
1 28  GLU n 
1 29  ILE n 
1 30  LEU n 
1 31  ASP n 
1 32  THR n 
1 33  SER n 
1 34  LEU n 
1 35  LYS n 
1 36  VAL n 
1 37  SER n 
1 38  TRP n 
1 39  GLN n 
1 40  GLU n 
1 41  PRO n 
1 42  GLY n 
1 43  GLU n 
1 44  LYS n 
1 45  ASN n 
1 46  GLY n 
1 47  ILE n 
1 48  LEU n 
1 49  THR n 
1 50  GLY n 
1 51  TYR n 
1 52  ARG n 
1 53  ILE n 
1 54  SER n 
1 55  TRP n 
1 56  GLU n 
1 57  GLU n 
1 58  TYR n 
1 59  ASN n 
1 60  ARG n 
1 61  THR n 
1 62  ASN n 
1 63  THR n 
1 64  ARG n 
1 65  VAL n 
1 66  THR n 
1 67  HIS n 
1 68  TYR n 
1 69  LEU n 
1 70  PRO n 
1 71  ASN n 
1 72  VAL n 
1 73  THR n 
1 74  LEU n 
1 75  GLU n 
1 76  TYR n 
1 77  ARG n 
1 78  VAL n 
1 79  THR n 
1 80  GLY n 
1 81  LEU n 
1 82  THR n 
1 83  ALA n 
1 84  LEU n 
1 85  THR n 
1 86  THR n 
1 87  TYR n 
1 88  THR n 
1 89  ILE n 
1 90  GLU n 
1 91  VAL n 
1 92  ALA n 
1 93  ALA n 
1 94  MET n 
1 95  THR n 
1 96  SER n 
1 97  LYS n 
1 98  GLY n 
1 99  GLN n 
1 100 GLY n 
1 101 GLN n 
1 102 VAL n 
1 103 SER n 
1 104 ALA n 
1 105 SER n 
1 106 THR n 
1 107 ILE n 
1 108 SER n 
1 109 SER n 
1 110 GLY n 
1 111 VAL n 
1 112 PRO n 
1 113 PRO n 
1 114 SER n 
1 115 GLY n 
1 116 PRO n 
1 117 SER n 
1 118 SER n 
1 119 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'Kazusa cDNA fh00815' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040223-46 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q58EX2_HUMAN 
_struct_ref.pdbx_db_accession          Q58EX2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTY
TIEVAAMTSKGQGQVSASTISSGVPP
;
_struct_ref.pdbx_align_begin           509 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WFN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 113 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q58EX2 
_struct_ref_seq.db_align_beg                  509 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  614 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       113 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WFN GLY A 1   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 1   1  
1 1WFN SER A 2   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 2   2  
1 1WFN SER A 3   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 3   3  
1 1WFN GLY A 4   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 4   4  
1 1WFN SER A 5   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 5   5  
1 1WFN SER A 6   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 6   6  
1 1WFN GLY A 7   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 7   7  
1 1WFN SER A 114 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 114 8  
1 1WFN GLY A 115 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 115 9  
1 1WFN PRO A 116 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 116 10 
1 1WFN SER A 117 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 117 11 
1 1WFN SER A 118 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 118 12 
1 1WFN GLY A 119 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 119 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.21mM 13C/15N-labeled protein; 20mM d-TRIS, 100mM NaCl, 1mM d-DTT, 0.02% NaN3' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian INOVA 900 
2 ? Varian INOVA 800 
# 
_pdbx_nmr_refine.entry_id           1WFN 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1WFN 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1WFN 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
VNMR    6.1C     collection           Varian          1 
NMRPipe 20020425 processing           'Delaglio, F.'  2 
NMRView 5.0.4    'data analysis'      'Johnson, B.A.' 3 
Kujira  0.8992   'data analysis'      'Kobayashi, N.' 4 
CYANA   1.0.7    'structure solution' 'Guentert, P.'  5 
CYANA   1.0.7    refinement           'Guentert, P.'  6 
# 
_exptl.entry_id          1WFN 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1WFN 
_struct.title                     'The fourth FN3 domain of human sidekick-2' 
_struct.pdbx_descriptor           'sidekick 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WFN 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
'sidekick-2, fn3, cell adhesion, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ARG 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        60 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ARG 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        64 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ARG 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         60 
_struct_conf.end_auth_comp_id        ARG 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         64 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 25 ? SER A 27  ? SER A 25 SER A 27  
A 2 SER A 33 ? SER A 37  ? SER A 33 SER A 37  
A 3 GLU A 75 ? THR A 79  ? GLU A 75 THR A 79  
B 1 HIS A 67 ? LEU A 69  ? HIS A 67 LEU A 69  
B 2 GLY A 50 ? GLU A 57  ? GLY A 50 GLU A 57  
B 3 THR A 86 ? MET A 94  ? THR A 86 MET A 94  
B 4 GLN A 99 ? SER A 108 ? GLN A 99 SER A 108 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 25 ? N SER A 25 O SER A 37  ? O SER A 37  
A 2 3 N LEU A 34 ? N LEU A 34 O VAL A 78  ? O VAL A 78  
B 1 2 O LEU A 69 ? O LEU A 69 N TYR A 51  ? N TYR A 51  
B 2 3 N GLU A 56 ? N GLU A 56 O THR A 88  ? O THR A 88  
B 3 4 N TYR A 87 ? N TYR A 87 O ILE A 107 ? O ILE A 107 
# 
_database_PDB_matrix.entry_id          1WFN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WFN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 18.449  -6.587  12.636  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 19.394  -5.862  11.803  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 18.851  -5.684  10.384  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 17.916  -4.915  10.165  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 17.600  -6.099  12.835  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 19.597  -4.886  12.244  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 20.341  -6.400  11.769  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 19.459  -6.409  9.457   1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 19.049  -6.341  8.065   1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 19.248  -7.701  7.393   1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 20.300  -7.962  6.811   1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 19.826  -5.259  7.313   1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 19.119  -4.022  7.276   1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 20.219  -7.032  9.643   1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 17.991  -6.077  8.089   1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 20.794  -5.109  7.792   1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 20.023  -5.595  6.295   1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 18.274  -4.127  6.751   1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 18.222  -8.532  7.496   1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 18.271  -9.859  6.906   1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 17.218  -9.981  5.802   1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 16.360  -9.111  5.660   1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 18.056  -10.942 7.966   1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 19.251  -11.669 8.236   1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 17.369  -8.313  7.971   1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 19.274  -9.953  6.490   1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 17.696  -10.482 8.886   1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 17.281  -11.630 7.629   1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 20.005  -11.036 8.410   1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 17.319  -11.066 5.049   1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 16.387  -11.312 3.962   1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 15.409  -12.432 4.323   1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 15.069  -12.613 5.491   1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 18.021  -11.768 5.171   1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 15.834  -10.399 3.739   1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 16.936  -11.580 3.060   1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 14.983  -13.155 3.297   1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 14.051  -14.253 3.491   1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 13.750  -14.927 2.151   1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 13.049  -14.362 1.312   1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 12.755  -13.766 4.143   1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 11.971  -12.979 3.251   1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 15.264  -13.002 2.350   1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 14.557  -14.946 4.163   1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 12.173  -14.625 4.476   1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 12.994  -13.179 5.030   1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 12.471  -12.151 2.996   1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 14.295  -16.124 1.991   1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 14.094  -16.880 0.767   1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 14.640  -16.097 -0.428  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 14.854  -14.889 -0.338  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 12.613  -17.204 0.557   1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 12.044  -17.859 1.688   1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 14.864  -16.575 2.678   1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 14.651  -17.806 0.905   1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 12.065  -16.283 0.358   1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 12.502  -17.838 -0.323  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 12.602  -17.687 2.499   1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 14.851  -16.817 -1.520  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 15.369  -16.205 -2.732  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 14.242  -15.578 -3.554  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 13.083  -15.969 -3.425  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 14.675  -17.799 -1.585  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 16.103  -15.442 -2.473  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 15.887  -16.955 -3.330  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . PRO A 1 8   ? 14.631  -14.591 -4.405  1.00 0.00 ? 8   PRO A N    1  
ATOM 67    C CA   . PRO A 1 8   ? 13.667  -13.906 -5.249  1.00 0.00 ? 8   PRO A CA   1  
ATOM 68    C C    . PRO A 1 8   ? 13.236  -14.792 -6.419  1.00 0.00 ? 8   PRO A C    1  
ATOM 69    O O    . PRO A 1 8   ? 14.061  -15.181 -7.245  1.00 0.00 ? 8   PRO A O    1  
ATOM 70    C CB   . PRO A 1 8   ? 14.367  -12.633 -5.694  1.00 0.00 ? 8   PRO A CB   1  
ATOM 71    C CG   . PRO A 1 8   ? 15.851  -12.872 -5.467  1.00 0.00 ? 8   PRO A CG   1  
ATOM 72    C CD   . PRO A 1 8   ? 15.995  -14.102 -4.585  1.00 0.00 ? 8   PRO A CD   1  
ATOM 73    H HA   . PRO A 1 8   ? 12.832  -13.710 -4.733  1.00 0.00 ? 8   PRO A HA   1  
ATOM 74    H HB2  . PRO A 1 8   ? 14.162  -12.421 -6.743  1.00 0.00 ? 8   PRO A HB2  1  
ATOM 75    H HB3  . PRO A 1 8   ? 14.018  -11.774 -5.121  1.00 0.00 ? 8   PRO A HB3  1  
ATOM 76    H HG2  . PRO A 1 8   ? 16.363  -13.022 -6.417  1.00 0.00 ? 8   PRO A HG2  1  
ATOM 77    H HG3  . PRO A 1 8   ? 16.309  -12.006 -4.991  1.00 0.00 ? 8   PRO A HG3  1  
ATOM 78    H HD2  . PRO A 1 8   ? 16.627  -14.855 -5.056  1.00 0.00 ? 8   PRO A HD2  1  
ATOM 79    H HD3  . PRO A 1 8   ? 16.456  -13.853 -3.630  1.00 0.00 ? 8   PRO A HD3  1  
ATOM 80    N N    . GLN A 1 9   ? 11.944  -15.086 -6.454  1.00 0.00 ? 9   GLN A N    1  
ATOM 81    C CA   . GLN A 1 9   ? 11.394  -15.919 -7.509  1.00 0.00 ? 9   GLN A CA   1  
ATOM 82    C C    . GLN A 1 9   ? 10.398  -15.119 -8.352  1.00 0.00 ? 9   GLN A C    1  
ATOM 83    O O    . GLN A 1 9   ? 9.192   -15.347 -8.276  1.00 0.00 ? 9   GLN A O    1  
ATOM 84    C CB   . GLN A 1 9   ? 10.739  -17.175 -6.932  1.00 0.00 ? 9   GLN A CB   1  
ATOM 85    C CG   . GLN A 1 9   ? 10.698  -18.299 -7.969  1.00 0.00 ? 9   GLN A CG   1  
ATOM 86    C CD   . GLN A 1 9   ? 10.982  -19.655 -7.320  1.00 0.00 ? 9   GLN A CD   1  
ATOM 87    O OE1  . GLN A 1 9   ? 10.274  -20.110 -6.437  1.00 0.00 ? 9   GLN A OE1  1  
ATOM 88    N NE2  . GLN A 1 9   ? 12.054  -20.273 -7.807  1.00 0.00 ? 9   GLN A NE2  1  
ATOM 89    H H    . GLN A 1 9   ? 11.280  -14.766 -5.778  1.00 0.00 ? 9   GLN A H    1  
ATOM 90    H HA   . GLN A 1 9   ? 12.247  -16.211 -8.123  1.00 0.00 ? 9   GLN A HA   1  
ATOM 91    H HB2  . GLN A 1 9   ? 11.292  -17.507 -6.053  1.00 0.00 ? 9   GLN A HB2  1  
ATOM 92    H HB3  . GLN A 1 9   ? 9.726   -16.943 -6.602  1.00 0.00 ? 9   GLN A HB3  1  
ATOM 93    H HG2  . GLN A 1 9   ? 9.720   -18.319 -8.450  1.00 0.00 ? 9   GLN A HG2  1  
ATOM 94    H HG3  . GLN A 1 9   ? 11.433  -18.104 -8.750  1.00 0.00 ? 9   GLN A HG3  1  
ATOM 95    H HE21 . GLN A 1 9   ? 12.592  -19.845 -8.532  1.00 0.00 ? 9   GLN A HE21 1  
ATOM 96    H HE22 . GLN A 1 9   ? 12.322  -21.167 -7.446  1.00 0.00 ? 9   GLN A HE22 1  
ATOM 97    N N    . LEU A 1 10  ? 10.940  -14.198 -9.135  1.00 0.00 ? 10  LEU A N    1  
ATOM 98    C CA   . LEU A 1 10  ? 10.114  -13.363 -9.991  1.00 0.00 ? 10  LEU A CA   1  
ATOM 99    C C    . LEU A 1 10  ? 10.992  -12.711 -11.061 1.00 0.00 ? 10  LEU A C    1  
ATOM 100   O O    . LEU A 1 10  ? 12.167  -12.439 -10.822 1.00 0.00 ? 10  LEU A O    1  
ATOM 101   C CB   . LEU A 1 10  ? 9.317   -12.361 -9.153  1.00 0.00 ? 10  LEU A CB   1  
ATOM 102   C CG   . LEU A 1 10  ? 7.800   -12.380 -9.348  1.00 0.00 ? 10  LEU A CG   1  
ATOM 103   C CD1  . LEU A 1 10  ? 7.091   -12.875 -8.086  1.00 0.00 ? 10  LEU A CD1  1  
ATOM 104   C CD2  . LEU A 1 10  ? 7.287   -11.009 -9.793  1.00 0.00 ? 10  LEU A CD2  1  
ATOM 105   H H    . LEU A 1 10  ? 11.922  -14.019 -9.191  1.00 0.00 ? 10  LEU A H    1  
ATOM 106   H HA   . LEU A 1 10  ? 9.393   -14.015 -10.485 1.00 0.00 ? 10  LEU A HA   1  
ATOM 107   H HB2  . LEU A 1 10  ? 9.531   -12.546 -8.101  1.00 0.00 ? 10  LEU A HB2  1  
ATOM 108   H HB3  . LEU A 1 10  ? 9.680   -11.359 -9.381  1.00 0.00 ? 10  LEU A HB3  1  
ATOM 109   H HG   . LEU A 1 10  ? 7.567   -13.086 -10.146 1.00 0.00 ? 10  LEU A HG   1  
ATOM 110   H HD11 . LEU A 1 10  ? 7.474   -12.336 -7.219  1.00 0.00 ? 10  LEU A HD11 1  
ATOM 111   H HD12 . LEU A 1 10  ? 6.019   -12.700 -8.179  1.00 0.00 ? 10  LEU A HD12 1  
ATOM 112   H HD13 . LEU A 1 10  ? 7.276   -13.942 -7.960  1.00 0.00 ? 10  LEU A HD13 1  
ATOM 113   H HD21 . LEU A 1 10  ? 7.143   -11.009 -10.874 1.00 0.00 ? 10  LEU A HD21 1  
ATOM 114   H HD22 . LEU A 1 10  ? 6.337   -10.799 -9.300  1.00 0.00 ? 10  LEU A HD22 1  
ATOM 115   H HD23 . LEU A 1 10  ? 8.014   -10.244 -9.523  1.00 0.00 ? 10  LEU A HD23 1  
ATOM 116   N N    . VAL A 1 11  ? 10.387  -12.479 -12.216 1.00 0.00 ? 11  VAL A N    1  
ATOM 117   C CA   . VAL A 1 11  ? 11.099  -11.864 -13.323 1.00 0.00 ? 11  VAL A CA   1  
ATOM 118   C C    . VAL A 1 11  ? 11.939  -10.698 -12.798 1.00 0.00 ? 11  VAL A C    1  
ATOM 119   O O    . VAL A 1 11  ? 11.426  -9.821  -12.105 1.00 0.00 ? 11  VAL A O    1  
ATOM 120   C CB   . VAL A 1 11  ? 10.110  -11.444 -14.413 1.00 0.00 ? 11  VAL A CB   1  
ATOM 121   C CG1  . VAL A 1 11  ? 9.222   -10.294 -13.935 1.00 0.00 ? 11  VAL A CG1  1  
ATOM 122   C CG2  . VAL A 1 11  ? 10.842  -11.072 -15.704 1.00 0.00 ? 11  VAL A CG2  1  
ATOM 123   H H    . VAL A 1 11  ? 9.430   -12.704 -12.402 1.00 0.00 ? 11  VAL A H    1  
ATOM 124   H HA   . VAL A 1 11  ? 11.766  -12.616 -13.744 1.00 0.00 ? 11  VAL A HA   1  
ATOM 125   H HB   . VAL A 1 11  ? 9.466   -12.298 -14.627 1.00 0.00 ? 11  VAL A HB   1  
ATOM 126   H HG11 . VAL A 1 11  ? 8.369   -10.191 -14.605 1.00 0.00 ? 11  VAL A HG11 1  
ATOM 127   H HG12 . VAL A 1 11  ? 8.868   -10.504 -12.926 1.00 0.00 ? 11  VAL A HG12 1  
ATOM 128   H HG13 . VAL A 1 11  ? 9.797   -9.368  -13.933 1.00 0.00 ? 11  VAL A HG13 1  
ATOM 129   H HG21 . VAL A 1 11  ? 10.409  -11.623 -16.539 1.00 0.00 ? 11  VAL A HG21 1  
ATOM 130   H HG22 . VAL A 1 11  ? 10.742  -10.002 -15.883 1.00 0.00 ? 11  VAL A HG22 1  
ATOM 131   H HG23 . VAL A 1 11  ? 11.898  -11.327 -15.610 1.00 0.00 ? 11  VAL A HG23 1  
ATOM 132   N N    . ARG A 1 12  ? 13.217  -10.726 -13.149 1.00 0.00 ? 12  ARG A N    1  
ATOM 133   C CA   . ARG A 1 12  ? 14.133  -9.682  -12.722 1.00 0.00 ? 12  ARG A CA   1  
ATOM 134   C C    . ARG A 1 12  ? 14.627  -8.883  -13.929 1.00 0.00 ? 12  ARG A C    1  
ATOM 135   O O    . ARG A 1 12  ? 14.406  -7.676  -14.012 1.00 0.00 ? 12  ARG A O    1  
ATOM 136   C CB   . ARG A 1 12  ? 15.336  -10.274 -11.984 1.00 0.00 ? 12  ARG A CB   1  
ATOM 137   C CG   . ARG A 1 12  ? 16.243  -9.168  -11.440 1.00 0.00 ? 12  ARG A CG   1  
ATOM 138   C CD   . ARG A 1 12  ? 17.417  -9.759  -10.656 1.00 0.00 ? 12  ARG A CD   1  
ATOM 139   N NE   . ARG A 1 12  ? 18.662  -9.645  -11.447 1.00 0.00 ? 12  ARG A NE   1  
ATOM 140   C CZ   . ARG A 1 12  ? 19.863  -10.063 -11.023 1.00 0.00 ? 12  ARG A CZ   1  
ATOM 141   N NH1  . ARG A 1 12  ? 19.987  -10.624 -9.812  1.00 0.00 ? 12  ARG A NH1  1  
ATOM 142   N NH2  . ARG A 1 12  ? 20.939  -9.920  -11.808 1.00 0.00 ? 12  ARG A NH2  1  
ATOM 143   H H    . ARG A 1 12  ? 13.626  -11.443 -13.713 1.00 0.00 ? 12  ARG A H    1  
ATOM 144   H HA   . ARG A 1 12  ? 13.548  -9.055  -12.050 1.00 0.00 ? 12  ARG A HA   1  
ATOM 145   H HB2  . ARG A 1 12  ? 14.990  -10.902 -11.162 1.00 0.00 ? 12  ARG A HB2  1  
ATOM 146   H HB3  . ARG A 1 12  ? 15.902  -10.915 -12.659 1.00 0.00 ? 12  ARG A HB3  1  
ATOM 147   H HG2  . ARG A 1 12  ? 16.620  -8.564  -12.265 1.00 0.00 ? 12  ARG A HG2  1  
ATOM 148   H HG3  . ARG A 1 12  ? 15.668  -8.504  -10.796 1.00 0.00 ? 12  ARG A HG3  1  
ATOM 149   H HD2  . ARG A 1 12  ? 17.530  -9.235  -9.707  1.00 0.00 ? 12  ARG A HD2  1  
ATOM 150   H HD3  . ARG A 1 12  ? 17.219  -10.804 -10.422 1.00 0.00 ? 12  ARG A HD3  1  
ATOM 151   H HE   . ARG A 1 12  ? 18.605  -9.231  -12.356 1.00 0.00 ? 12  ARG A HE   1  
ATOM 152   H HH11 . ARG A 1 12  ? 19.184  -10.731 -9.225  1.00 0.00 ? 12  ARG A HH11 1  
ATOM 153   H HH12 . ARG A 1 12  ? 20.883  -10.935 -9.495  1.00 0.00 ? 12  ARG A HH12 1  
ATOM 154   H HH21 . ARG A 1 12  ? 20.846  -9.501  -12.712 1.00 0.00 ? 12  ARG A HH21 1  
ATOM 155   H HH22 . ARG A 1 12  ? 21.834  -10.231 -11.492 1.00 0.00 ? 12  ARG A HH22 1  
ATOM 156   N N    . THR A 1 13  ? 15.288  -9.589  -14.836 1.00 0.00 ? 13  THR A N    1  
ATOM 157   C CA   . THR A 1 13  ? 15.815  -8.960  -16.035 1.00 0.00 ? 13  THR A CA   1  
ATOM 158   C C    . THR A 1 13  ? 16.533  -7.656  -15.682 1.00 0.00 ? 13  THR A C    1  
ATOM 159   O O    . THR A 1 13  ? 16.791  -7.383  -14.511 1.00 0.00 ? 13  THR A O    1  
ATOM 160   C CB   . THR A 1 13  ? 14.658  -8.770  -17.017 1.00 0.00 ? 13  THR A CB   1  
ATOM 161   O OG1  . THR A 1 13  ? 13.741  -7.933  -16.316 1.00 0.00 ? 13  THR A OG1  1  
ATOM 162   C CG2  . THR A 1 13  ? 13.874  -10.062 -17.257 1.00 0.00 ? 13  THR A CG2  1  
ATOM 163   H H    . THR A 1 13  ? 15.463  -10.570 -14.761 1.00 0.00 ? 13  THR A H    1  
ATOM 164   H HA   . THR A 1 13  ? 16.559  -9.626  -16.473 1.00 0.00 ? 13  THR A HA   1  
ATOM 165   H HB   . THR A 1 13  ? 15.011  -8.349  -17.958 1.00 0.00 ? 13  THR A HB   1  
ATOM 166   H HG1  . THR A 1 13  ? 13.571  -7.099  -16.840 1.00 0.00 ? 13  THR A HG1  1  
ATOM 167   H HG21 . THR A 1 13  ? 14.369  -10.887 -16.743 1.00 0.00 ? 13  THR A HG21 1  
ATOM 168   H HG22 . THR A 1 13  ? 12.861  -9.950  -16.871 1.00 0.00 ? 13  THR A HG22 1  
ATOM 169   H HG23 . THR A 1 13  ? 13.835  -10.271 -18.326 1.00 0.00 ? 13  THR A HG23 1  
ATOM 170   N N    . HIS A 1 14  ? 16.835  -6.885  -16.716 1.00 0.00 ? 14  HIS A N    1  
ATOM 171   C CA   . HIS A 1 14  ? 17.518  -5.616  -16.530 1.00 0.00 ? 14  HIS A CA   1  
ATOM 172   C C    . HIS A 1 14  ? 16.526  -4.570  -16.016 1.00 0.00 ? 14  HIS A C    1  
ATOM 173   O O    . HIS A 1 14  ? 15.558  -4.240  -16.699 1.00 0.00 ? 14  HIS A O    1  
ATOM 174   C CB   . HIS A 1 14  ? 18.222  -5.184  -17.818 1.00 0.00 ? 14  HIS A CB   1  
ATOM 175   C CG   . HIS A 1 14  ? 17.279  -4.791  -18.930 1.00 0.00 ? 14  HIS A CG   1  
ATOM 176   N ND1  . HIS A 1 14  ? 16.565  -5.717  -19.670 1.00 0.00 ? 14  HIS A ND1  1  
ATOM 177   C CD2  . HIS A 1 14  ? 16.941  -3.564  -19.420 1.00 0.00 ? 14  HIS A CD2  1  
ATOM 178   C CE1  . HIS A 1 14  ? 15.834  -5.066  -20.563 1.00 0.00 ? 14  HIS A CE1  1  
ATOM 179   N NE2  . HIS A 1 14  ? 16.069  -3.731  -20.406 1.00 0.00 ? 14  HIS A NE2  1  
ATOM 180   H H    . HIS A 1 14  ? 16.621  -7.115  -17.666 1.00 0.00 ? 14  HIS A H    1  
ATOM 181   H HA   . HIS A 1 14  ? 18.284  -5.782  -15.772 1.00 0.00 ? 14  HIS A HA   1  
ATOM 182   H HB2  . HIS A 1 14  ? 18.877  -4.342  -17.596 1.00 0.00 ? 14  HIS A HB2  1  
ATOM 183   H HB3  . HIS A 1 14  ? 18.856  -5.999  -18.164 1.00 0.00 ? 14  HIS A HB3  1  
ATOM 184   H HD1  . HIS A 1 14  ? 16.596  -6.710  -19.552 1.00 0.00 ? 14  HIS A HD1  1  
ATOM 185   H HD2  . HIS A 1 14  ? 17.322  -2.607  -19.062 1.00 0.00 ? 14  HIS A HD2  1  
ATOM 186   H HE1  . HIS A 1 14  ? 15.163  -5.517  -21.294 1.00 0.00 ? 14  HIS A HE1  1  
ATOM 187   N N    . GLU A 1 15  ? 16.802  -4.079  -14.817 1.00 0.00 ? 15  GLU A N    1  
ATOM 188   C CA   . GLU A 1 15  ? 15.947  -3.077  -14.204 1.00 0.00 ? 15  GLU A CA   1  
ATOM 189   C C    . GLU A 1 15  ? 16.745  -2.237  -13.205 1.00 0.00 ? 15  GLU A C    1  
ATOM 190   O O    . GLU A 1 15  ? 17.563  -2.768  -12.456 1.00 0.00 ? 15  GLU A O    1  
ATOM 191   C CB   . GLU A 1 15  ? 14.737  -3.728  -13.530 1.00 0.00 ? 15  GLU A CB   1  
ATOM 192   C CG   . GLU A 1 15  ? 13.595  -3.928  -14.529 1.00 0.00 ? 15  GLU A CG   1  
ATOM 193   C CD   . GLU A 1 15  ? 12.296  -3.310  -14.008 1.00 0.00 ? 15  GLU A CD   1  
ATOM 194   O OE1  . GLU A 1 15  ? 12.338  -2.109  -13.662 1.00 0.00 ? 15  GLU A OE1  1  
ATOM 195   O OE2  . GLU A 1 15  ? 11.291  -4.051  -13.968 1.00 0.00 ? 15  GLU A OE2  1  
ATOM 196   H H    . GLU A 1 15  ? 17.592  -4.353  -14.269 1.00 0.00 ? 15  GLU A H    1  
ATOM 197   H HA   . GLU A 1 15  ? 15.603  -2.448  -15.025 1.00 0.00 ? 15  GLU A HA   1  
ATOM 198   H HB2  . GLU A 1 15  ? 15.026  -4.689  -13.105 1.00 0.00 ? 15  GLU A HB2  1  
ATOM 199   H HB3  . GLU A 1 15  ? 14.397  -3.103  -12.704 1.00 0.00 ? 15  GLU A HB3  1  
ATOM 200   H HG2  . GLU A 1 15  ? 13.859  -3.476  -15.485 1.00 0.00 ? 15  GLU A HG2  1  
ATOM 201   H HG3  . GLU A 1 15  ? 13.448  -4.993  -14.710 1.00 0.00 ? 15  GLU A HG3  1  
ATOM 202   N N    . ASP A 1 16  ? 16.479  -0.939  -13.227 1.00 0.00 ? 16  ASP A N    1  
ATOM 203   C CA   . ASP A 1 16  ? 17.162  -0.020  -12.332 1.00 0.00 ? 16  ASP A CA   1  
ATOM 204   C C    . ASP A 1 16  ? 16.372  0.096   -11.027 1.00 0.00 ? 16  ASP A C    1  
ATOM 205   O O    . ASP A 1 16  ? 16.864  -0.279  -9.964  1.00 0.00 ? 16  ASP A O    1  
ATOM 206   C CB   . ASP A 1 16  ? 17.264  1.376   -12.949 1.00 0.00 ? 16  ASP A CB   1  
ATOM 207   C CG   . ASP A 1 16  ? 18.338  2.277   -12.337 1.00 0.00 ? 16  ASP A CG   1  
ATOM 208   O OD1  . ASP A 1 16  ? 18.788  1.944   -11.219 1.00 0.00 ? 16  ASP A OD1  1  
ATOM 209   O OD2  . ASP A 1 16  ? 18.684  3.278   -13.000 1.00 0.00 ? 16  ASP A OD2  1  
ATOM 210   H H    . ASP A 1 16  ? 15.812  -0.515  -13.839 1.00 0.00 ? 16  ASP A H    1  
ATOM 211   H HA   . ASP A 1 16  ? 18.153  -0.449  -12.183 1.00 0.00 ? 16  ASP A HA   1  
ATOM 212   H HB2  . ASP A 1 16  ? 17.463  1.272   -14.016 1.00 0.00 ? 16  ASP A HB2  1  
ATOM 213   H HB3  . ASP A 1 16  ? 16.297  1.871   -12.852 1.00 0.00 ? 16  ASP A HB3  1  
ATOM 214   N N    . VAL A 1 17  ? 15.160  0.617   -11.150 1.00 0.00 ? 17  VAL A N    1  
ATOM 215   C CA   . VAL A 1 17  ? 14.297  0.787   -9.994  1.00 0.00 ? 17  VAL A CA   1  
ATOM 216   C C    . VAL A 1 17  ? 14.380  -0.461  -9.113  1.00 0.00 ? 17  VAL A C    1  
ATOM 217   O O    . VAL A 1 17  ? 14.866  -1.503  -9.551  1.00 0.00 ? 17  VAL A O    1  
ATOM 218   C CB   . VAL A 1 17  ? 12.871  1.106   -10.447 1.00 0.00 ? 17  VAL A CB   1  
ATOM 219   C CG1  . VAL A 1 17  ? 12.715  2.596   -10.758 1.00 0.00 ? 17  VAL A CG1  1  
ATOM 220   C CG2  . VAL A 1 17  ? 12.475  0.250   -11.651 1.00 0.00 ? 17  VAL A CG2  1  
ATOM 221   H H    . VAL A 1 17  ? 14.767  0.919   -12.019 1.00 0.00 ? 17  VAL A H    1  
ATOM 222   H HA   . VAL A 1 17  ? 14.671  1.641   -9.428  1.00 0.00 ? 17  VAL A HA   1  
ATOM 223   H HB   . VAL A 1 17  ? 12.197  0.863   -9.626  1.00 0.00 ? 17  VAL A HB   1  
ATOM 224   H HG11 . VAL A 1 17  ? 12.707  3.162   -9.826  1.00 0.00 ? 17  VAL A HG11 1  
ATOM 225   H HG12 . VAL A 1 17  ? 13.549  2.928   -11.377 1.00 0.00 ? 17  VAL A HG12 1  
ATOM 226   H HG13 . VAL A 1 17  ? 11.779  2.760   -11.291 1.00 0.00 ? 17  VAL A HG13 1  
ATOM 227   H HG21 . VAL A 1 17  ? 11.389  0.243   -11.750 1.00 0.00 ? 17  VAL A HG21 1  
ATOM 228   H HG22 . VAL A 1 17  ? 12.919  0.667   -12.555 1.00 0.00 ? 17  VAL A HG22 1  
ATOM 229   H HG23 . VAL A 1 17  ? 12.833  -0.769  -11.507 1.00 0.00 ? 17  VAL A HG23 1  
ATOM 230   N N    . PRO A 1 18  ? 13.884  -0.312  -7.855  1.00 0.00 ? 18  PRO A N    1  
ATOM 231   C CA   . PRO A 1 18  ? 13.897  -1.414  -6.910  1.00 0.00 ? 18  PRO A CA   1  
ATOM 232   C C    . PRO A 1 18  ? 12.816  -2.442  -7.251  1.00 0.00 ? 18  PRO A C    1  
ATOM 233   O O    . PRO A 1 18  ? 12.099  -2.290  -8.239  1.00 0.00 ? 18  PRO A O    1  
ATOM 234   C CB   . PRO A 1 18  ? 13.694  -0.768  -5.549  1.00 0.00 ? 18  PRO A CB   1  
ATOM 235   C CG   . PRO A 1 18  ? 13.113  0.609   -5.824  1.00 0.00 ? 18  PRO A CG   1  
ATOM 236   C CD   . PRO A 1 18  ? 13.301  0.907   -7.303  1.00 0.00 ? 18  PRO A CD   1  
ATOM 237   H HA   . PRO A 1 18  ? 14.767  -1.906  -6.961  1.00 0.00 ? 18  PRO A HA   1  
ATOM 238   H HB2  . PRO A 1 18  ? 13.019  -1.361  -4.932  1.00 0.00 ? 18  PRO A HB2  1  
ATOM 239   H HB3  . PRO A 1 18  ? 14.638  -0.693  -5.008  1.00 0.00 ? 18  PRO A HB3  1  
ATOM 240   H HG2  . PRO A 1 18  ? 12.056  0.637   -5.560  1.00 0.00 ? 18  PRO A HG2  1  
ATOM 241   H HG3  . PRO A 1 18  ? 13.614  1.363   -5.216  1.00 0.00 ? 18  PRO A HG3  1  
ATOM 242   H HD2  . PRO A 1 18  ? 12.351  1.144   -7.782  1.00 0.00 ? 18  PRO A HD2  1  
ATOM 243   H HD3  . PRO A 1 18  ? 13.957  1.764   -7.454  1.00 0.00 ? 18  PRO A HD3  1  
ATOM 244   N N    . GLY A 1 19  ? 12.731  -3.465  -6.413  1.00 0.00 ? 19  GLY A N    1  
ATOM 245   C CA   . GLY A 1 19  ? 11.750  -4.517  -6.613  1.00 0.00 ? 19  GLY A CA   1  
ATOM 246   C C    . GLY A 1 19  ? 10.603  -4.396  -5.607  1.00 0.00 ? 19  GLY A C    1  
ATOM 247   O O    . GLY A 1 19  ? 10.321  -3.307  -5.111  1.00 0.00 ? 19  GLY A O    1  
ATOM 248   H H    . GLY A 1 19  ? 13.318  -3.581  -5.612  1.00 0.00 ? 19  GLY A H    1  
ATOM 249   H HA2  . GLY A 1 19  ? 11.355  -4.463  -7.628  1.00 0.00 ? 19  GLY A HA2  1  
ATOM 250   H HA3  . GLY A 1 19  ? 12.228  -5.491  -6.509  1.00 0.00 ? 19  GLY A HA3  1  
ATOM 251   N N    . PRO A 1 20  ? 9.957   -5.560  -5.330  1.00 0.00 ? 20  PRO A N    1  
ATOM 252   C CA   . PRO A 1 20  ? 8.847   -5.595  -4.392  1.00 0.00 ? 20  PRO A CA   1  
ATOM 253   C C    . PRO A 1 20  ? 9.346   -5.487  -2.949  1.00 0.00 ? 20  PRO A C    1  
ATOM 254   O O    . PRO A 1 20  ? 10.305  -6.157  -2.569  1.00 0.00 ? 20  PRO A O    1  
ATOM 255   C CB   . PRO A 1 20  ? 8.132   -6.905  -4.677  1.00 0.00 ? 20  PRO A CB   1  
ATOM 256   C CG   . PRO A 1 20  ? 9.128   -7.767  -5.437  1.00 0.00 ? 20  PRO A CG   1  
ATOM 257   C CD   . PRO A 1 20  ? 10.264  -6.869  -5.899  1.00 0.00 ? 20  PRO A CD   1  
ATOM 258   H HA   . PRO A 1 20  ? 8.248   -4.807  -4.534  1.00 0.00 ? 20  PRO A HA   1  
ATOM 259   H HB2  . PRO A 1 20  ? 7.822   -7.390  -3.752  1.00 0.00 ? 20  PRO A HB2  1  
ATOM 260   H HB3  . PRO A 1 20  ? 7.231   -6.738  -5.267  1.00 0.00 ? 20  PRO A HB3  1  
ATOM 261   H HG2  . PRO A 1 20  ? 9.507   -8.565  -4.799  1.00 0.00 ? 20  PRO A HG2  1  
ATOM 262   H HG3  . PRO A 1 20  ? 8.646   -8.243  -6.291  1.00 0.00 ? 20  PRO A HG3  1  
ATOM 263   H HD2  . PRO A 1 20  ? 11.228  -7.237  -5.549  1.00 0.00 ? 20  PRO A HD2  1  
ATOM 264   H HD3  . PRO A 1 20  ? 10.316  -6.825  -6.987  1.00 0.00 ? 20  PRO A HD3  1  
ATOM 265   N N    . VAL A 1 21  ? 8.672   -4.640  -2.186  1.00 0.00 ? 21  VAL A N    1  
ATOM 266   C CA   . VAL A 1 21  ? 9.034   -4.436  -0.794  1.00 0.00 ? 21  VAL A CA   1  
ATOM 267   C C    . VAL A 1 21  ? 9.006   -5.779  -0.062  1.00 0.00 ? 21  VAL A C    1  
ATOM 268   O O    . VAL A 1 21  ? 8.558   -6.783  -0.616  1.00 0.00 ? 21  VAL A O    1  
ATOM 269   C CB   . VAL A 1 21  ? 8.112   -3.391  -0.161  1.00 0.00 ? 21  VAL A CB   1  
ATOM 270   C CG1  . VAL A 1 21  ? 8.562   -1.974  -0.520  1.00 0.00 ? 21  VAL A CG1  1  
ATOM 271   C CG2  . VAL A 1 21  ? 6.656   -3.625  -0.570  1.00 0.00 ? 21  VAL A CG2  1  
ATOM 272   H H    . VAL A 1 21  ? 7.893   -4.099  -2.504  1.00 0.00 ? 21  VAL A H    1  
ATOM 273   H HA   . VAL A 1 21  ? 10.051  -4.046  -0.772  1.00 0.00 ? 21  VAL A HA   1  
ATOM 274   H HB   . VAL A 1 21  ? 8.177   -3.499  0.922   1.00 0.00 ? 21  VAL A HB   1  
ATOM 275   H HG11 . VAL A 1 21  ? 8.243   -1.283  0.260   1.00 0.00 ? 21  VAL A HG11 1  
ATOM 276   H HG12 . VAL A 1 21  ? 9.648   -1.948  -0.607  1.00 0.00 ? 21  VAL A HG12 1  
ATOM 277   H HG13 . VAL A 1 21  ? 8.114   -1.680  -1.470  1.00 0.00 ? 21  VAL A HG13 1  
ATOM 278   H HG21 . VAL A 1 21  ? 6.028   -3.648  0.321   1.00 0.00 ? 21  VAL A HG21 1  
ATOM 279   H HG22 . VAL A 1 21  ? 6.329   -2.817  -1.224  1.00 0.00 ? 21  VAL A HG22 1  
ATOM 280   H HG23 . VAL A 1 21  ? 6.575   -4.575  -1.097  1.00 0.00 ? 21  VAL A HG23 1  
ATOM 281   N N    . GLY A 1 22  ? 9.490   -5.756  1.171   1.00 0.00 ? 22  GLY A N    1  
ATOM 282   C CA   . GLY A 1 22  ? 9.526   -6.959  1.984   1.00 0.00 ? 22  GLY A CA   1  
ATOM 283   C C    . GLY A 1 22  ? 8.258   -7.793  1.787   1.00 0.00 ? 22  GLY A C    1  
ATOM 284   O O    . GLY A 1 22  ? 8.242   -8.724  0.984   1.00 0.00 ? 22  GLY A O    1  
ATOM 285   H H    . GLY A 1 22  ? 9.852   -4.935  1.614   1.00 0.00 ? 22  GLY A H    1  
ATOM 286   H HA2  . GLY A 1 22  ? 10.401  -7.554  1.721   1.00 0.00 ? 22  GLY A HA2  1  
ATOM 287   H HA3  . GLY A 1 22  ? 9.628   -6.689  3.035   1.00 0.00 ? 22  GLY A HA3  1  
ATOM 288   N N    . HIS A 1 23  ? 7.226   -7.427  2.533   1.00 0.00 ? 23  HIS A N    1  
ATOM 289   C CA   . HIS A 1 23  ? 5.957   -8.129  2.451   1.00 0.00 ? 23  HIS A CA   1  
ATOM 290   C C    . HIS A 1 23  ? 4.845   -7.248  3.024   1.00 0.00 ? 23  HIS A C    1  
ATOM 291   O O    . HIS A 1 23  ? 5.015   -6.633  4.075   1.00 0.00 ? 23  HIS A O    1  
ATOM 292   C CB   . HIS A 1 23  ? 6.045   -9.494  3.137   1.00 0.00 ? 23  HIS A CB   1  
ATOM 293   C CG   . HIS A 1 23  ? 6.111   -9.421  4.643   1.00 0.00 ? 23  HIS A CG   1  
ATOM 294   N ND1  . HIS A 1 23  ? 5.154   -9.992  5.464   1.00 0.00 ? 23  HIS A ND1  1  
ATOM 295   C CD2  . HIS A 1 23  ? 7.028   -8.839  5.469   1.00 0.00 ? 23  HIS A CD2  1  
ATOM 296   C CE1  . HIS A 1 23  ? 5.489   -9.758  6.724   1.00 0.00 ? 23  HIS A CE1  1  
ATOM 297   N NE2  . HIS A 1 23  ? 6.651   -9.043  6.725   1.00 0.00 ? 23  HIS A NE2  1  
ATOM 298   H H    . HIS A 1 23  ? 7.248   -6.668  3.184   1.00 0.00 ? 23  HIS A H    1  
ATOM 299   H HA   . HIS A 1 23  ? 5.763   -8.301  1.392   1.00 0.00 ? 23  HIS A HA   1  
ATOM 300   H HB2  . HIS A 1 23  ? 5.179   -10.090 2.849   1.00 0.00 ? 23  HIS A HB2  1  
ATOM 301   H HB3  . HIS A 1 23  ? 6.928   -10.017 2.770   1.00 0.00 ? 23  HIS A HB3  1  
ATOM 302   H HD1  . HIS A 1 23  ? 4.346   -10.496 5.158   1.00 0.00 ? 23  HIS A HD1  1  
ATOM 303   H HD2  . HIS A 1 23  ? 7.919   -8.299  5.150   1.00 0.00 ? 23  HIS A HD2  1  
ATOM 304   H HE1  . HIS A 1 23  ? 4.935   -10.080 7.605   1.00 0.00 ? 23  HIS A HE1  1  
ATOM 305   N N    . LEU A 1 24  ? 3.731   -7.216  2.308   1.00 0.00 ? 24  LEU A N    1  
ATOM 306   C CA   . LEU A 1 24  ? 2.591   -6.421  2.732   1.00 0.00 ? 24  LEU A CA   1  
ATOM 307   C C    . LEU A 1 24  ? 2.100   -6.925  4.090   1.00 0.00 ? 24  LEU A C    1  
ATOM 308   O O    . LEU A 1 24  ? 2.094   -8.129  4.344   1.00 0.00 ? 24  LEU A O    1  
ATOM 309   C CB   . LEU A 1 24  ? 1.509   -6.415  1.650   1.00 0.00 ? 24  LEU A CB   1  
ATOM 310   C CG   . LEU A 1 24  ? 1.487   -5.193  0.730   1.00 0.00 ? 24  LEU A CG   1  
ATOM 311   C CD1  . LEU A 1 24  ? 0.644   -4.068  1.334   1.00 0.00 ? 24  LEU A CD1  1  
ATOM 312   C CD2  . LEU A 1 24  ? 2.907   -4.731  0.398   1.00 0.00 ? 24  LEU A CD2  1  
ATOM 313   H H    . LEU A 1 24  ? 3.600   -7.720  1.454   1.00 0.00 ? 24  LEU A H    1  
ATOM 314   H HA   . LEU A 1 24  ? 2.935   -5.393  2.849   1.00 0.00 ? 24  LEU A HA   1  
ATOM 315   H HB2  . LEU A 1 24  ? 1.634   -7.306  1.035   1.00 0.00 ? 24  LEU A HB2  1  
ATOM 316   H HB3  . LEU A 1 24  ? 0.537   -6.497  2.136   1.00 0.00 ? 24  LEU A HB3  1  
ATOM 317   H HG   . LEU A 1 24  ? 1.014   -5.481  -0.209  1.00 0.00 ? 24  LEU A HG   1  
ATOM 318   H HD11 . LEU A 1 24  ? 1.100   -3.106  1.099   1.00 0.00 ? 24  LEU A HD11 1  
ATOM 319   H HD12 . LEU A 1 24  ? -0.363  -4.104  0.917   1.00 0.00 ? 24  LEU A HD12 1  
ATOM 320   H HD13 . LEU A 1 24  ? 0.594   -4.191  2.416   1.00 0.00 ? 24  LEU A HD13 1  
ATOM 321   H HD21 . LEU A 1 24  ? 2.936   -4.350  -0.623  1.00 0.00 ? 24  LEU A HD21 1  
ATOM 322   H HD22 . LEU A 1 24  ? 3.203   -3.941  1.089   1.00 0.00 ? 24  LEU A HD22 1  
ATOM 323   H HD23 . LEU A 1 24  ? 3.594   -5.571  0.492   1.00 0.00 ? 24  LEU A HD23 1  
ATOM 324   N N    . SER A 1 25  ? 1.700   -5.980  4.928   1.00 0.00 ? 25  SER A N    1  
ATOM 325   C CA   . SER A 1 25  ? 1.208   -6.313  6.254   1.00 0.00 ? 25  SER A CA   1  
ATOM 326   C C    . SER A 1 25  ? 0.056   -5.382  6.634   1.00 0.00 ? 25  SER A C    1  
ATOM 327   O O    . SER A 1 25  ? 0.173   -4.163  6.515   1.00 0.00 ? 25  SER A O    1  
ATOM 328   C CB   . SER A 1 25  ? 2.327   -6.226  7.294   1.00 0.00 ? 25  SER A CB   1  
ATOM 329   O OG   . SER A 1 25  ? 3.506   -6.903  6.868   1.00 0.00 ? 25  SER A OG   1  
ATOM 330   H H    . SER A 1 25  ? 1.708   -5.003  4.713   1.00 0.00 ? 25  SER A H    1  
ATOM 331   H HA   . SER A 1 25  ? 0.860   -7.344  6.182   1.00 0.00 ? 25  SER A HA   1  
ATOM 332   H HB2  . SER A 1 25  ? 2.560   -5.179  7.489   1.00 0.00 ? 25  SER A HB2  1  
ATOM 333   H HB3  . SER A 1 25  ? 1.982   -6.656  8.234   1.00 0.00 ? 25  SER A HB3  1  
ATOM 334   H HG   . SER A 1 25  ? 3.953   -7.338  7.650   1.00 0.00 ? 25  SER A HG   1  
ATOM 335   N N    . PHE A 1 26  ? -1.031  -5.991  7.084   1.00 0.00 ? 26  PHE A N    1  
ATOM 336   C CA   . PHE A 1 26  ? -2.204  -5.231  7.483   1.00 0.00 ? 26  PHE A CA   1  
ATOM 337   C C    . PHE A 1 26  ? -2.584  -5.531  8.934   1.00 0.00 ? 26  PHE A C    1  
ATOM 338   O O    . PHE A 1 26  ? -2.673  -6.693  9.329   1.00 0.00 ? 26  PHE A O    1  
ATOM 339   C CB   . PHE A 1 26  ? -3.350  -5.665  6.568   1.00 0.00 ? 26  PHE A CB   1  
ATOM 340   C CG   . PHE A 1 26  ? -3.059  -5.483  5.077   1.00 0.00 ? 26  PHE A CG   1  
ATOM 341   C CD1  . PHE A 1 26  ? -2.291  -4.443  4.656   1.00 0.00 ? 26  PHE A CD1  1  
ATOM 342   C CD2  . PHE A 1 26  ? -3.569  -6.362  4.172   1.00 0.00 ? 26  PHE A CD2  1  
ATOM 343   C CE1  . PHE A 1 26  ? -2.021  -4.274  3.272   1.00 0.00 ? 26  PHE A CE1  1  
ATOM 344   C CE2  . PHE A 1 26  ? -3.299  -6.193  2.788   1.00 0.00 ? 26  PHE A CE2  1  
ATOM 345   C CZ   . PHE A 1 26  ? -2.531  -5.153  2.367   1.00 0.00 ? 26  PHE A CZ   1  
ATOM 346   H H    . PHE A 1 26  ? -1.118  -6.983  7.178   1.00 0.00 ? 26  PHE A H    1  
ATOM 347   H HA   . PHE A 1 26  ? -1.953  -4.175  7.386   1.00 0.00 ? 26  PHE A HA   1  
ATOM 348   H HB2  . PHE A 1 26  ? -3.577  -6.715  6.758   1.00 0.00 ? 26  PHE A HB2  1  
ATOM 349   H HB3  . PHE A 1 26  ? -4.243  -5.095  6.825   1.00 0.00 ? 26  PHE A HB3  1  
ATOM 350   H HD1  . PHE A 1 26  ? -1.883  -3.739  5.381   1.00 0.00 ? 26  PHE A HD1  1  
ATOM 351   H HD2  . PHE A 1 26  ? -4.185  -7.196  4.509   1.00 0.00 ? 26  PHE A HD2  1  
ATOM 352   H HE1  . PHE A 1 26  ? -1.405  -3.440  2.934   1.00 0.00 ? 26  PHE A HE1  1  
ATOM 353   H HE2  . PHE A 1 26  ? -3.707  -6.897  2.063   1.00 0.00 ? 26  PHE A HE2  1  
ATOM 354   H HZ   . PHE A 1 26  ? -2.323  -5.023  1.305   1.00 0.00 ? 26  PHE A HZ   1  
ATOM 355   N N    . SER A 1 27  ? -2.799  -4.464  9.689   1.00 0.00 ? 27  SER A N    1  
ATOM 356   C CA   . SER A 1 27  ? -3.168  -4.598  11.088  1.00 0.00 ? 27  SER A CA   1  
ATOM 357   C C    . SER A 1 27  ? -4.171  -3.509  11.471  1.00 0.00 ? 27  SER A C    1  
ATOM 358   O O    . SER A 1 27  ? -4.487  -2.638  10.662  1.00 0.00 ? 27  SER A O    1  
ATOM 359   C CB   . SER A 1 27  ? -1.935  -4.526  11.992  1.00 0.00 ? 27  SER A CB   1  
ATOM 360   O OG   . SER A 1 27  ? -1.225  -3.301  11.830  1.00 0.00 ? 27  SER A OG   1  
ATOM 361   H H    . SER A 1 27  ? -2.725  -3.522  9.360   1.00 0.00 ? 27  SER A H    1  
ATOM 362   H HA   . SER A 1 27  ? -3.623  -5.585  11.173  1.00 0.00 ? 27  SER A HA   1  
ATOM 363   H HB2  . SER A 1 27  ? -2.242  -4.632  13.032  1.00 0.00 ? 27  SER A HB2  1  
ATOM 364   H HB3  . SER A 1 27  ? -1.272  -5.362  11.768  1.00 0.00 ? 27  SER A HB3  1  
ATOM 365   H HG   . SER A 1 27  ? -1.827  -2.528  12.030  1.00 0.00 ? 27  SER A HG   1  
ATOM 366   N N    . GLU A 1 28  ? -4.645  -3.593  12.706  1.00 0.00 ? 28  GLU A N    1  
ATOM 367   C CA   . GLU A 1 28  ? -5.606  -2.626  13.206  1.00 0.00 ? 28  GLU A CA   1  
ATOM 368   C C    . GLU A 1 28  ? -6.651  -2.311  12.133  1.00 0.00 ? 28  GLU A C    1  
ATOM 369   O O    . GLU A 1 28  ? -7.012  -1.152  11.934  1.00 0.00 ? 28  GLU A O    1  
ATOM 370   C CB   . GLU A 1 28  ? -4.906  -1.351  13.680  1.00 0.00 ? 28  GLU A CB   1  
ATOM 371   C CG   . GLU A 1 28  ? -4.119  -1.604  14.968  1.00 0.00 ? 28  GLU A CG   1  
ATOM 372   C CD   . GLU A 1 28  ? -5.000  -1.388  16.200  1.00 0.00 ? 28  GLU A CD   1  
ATOM 373   O OE1  . GLU A 1 28  ? -6.074  -2.026  16.248  1.00 0.00 ? 28  GLU A OE1  1  
ATOM 374   O OE2  . GLU A 1 28  ? -4.580  -0.591  17.066  1.00 0.00 ? 28  GLU A OE2  1  
ATOM 375   H H    . GLU A 1 28  ? -4.383  -4.305  13.358  1.00 0.00 ? 28  GLU A H    1  
ATOM 376   H HA   . GLU A 1 28  ? -6.086  -3.108  14.059  1.00 0.00 ? 28  GLU A HA   1  
ATOM 377   H HB2  . GLU A 1 28  ? -4.231  -0.992  12.902  1.00 0.00 ? 28  GLU A HB2  1  
ATOM 378   H HB3  . GLU A 1 28  ? -5.644  -0.567  13.849  1.00 0.00 ? 28  GLU A HB3  1  
ATOM 379   H HG2  . GLU A 1 28  ? -3.731  -2.622  14.967  1.00 0.00 ? 28  GLU A HG2  1  
ATOM 380   H HG3  . GLU A 1 28  ? -3.259  -0.935  15.010  1.00 0.00 ? 28  GLU A HG3  1  
ATOM 381   N N    . ILE A 1 29  ? -7.107  -3.363  11.470  1.00 0.00 ? 29  ILE A N    1  
ATOM 382   C CA   . ILE A 1 29  ? -8.102  -3.214  10.422  1.00 0.00 ? 29  ILE A CA   1  
ATOM 383   C C    . ILE A 1 29  ? -9.463  -2.917  11.056  1.00 0.00 ? 29  ILE A C    1  
ATOM 384   O O    . ILE A 1 29  ? -9.737  -3.346  12.176  1.00 0.00 ? 29  ILE A O    1  
ATOM 385   C CB   . ILE A 1 29  ? -8.105  -4.440  9.506   1.00 0.00 ? 29  ILE A CB   1  
ATOM 386   C CG1  . ILE A 1 29  ? -6.678  -4.852  9.139   1.00 0.00 ? 29  ILE A CG1  1  
ATOM 387   C CG2  . ILE A 1 29  ? -8.968  -4.196  8.267   1.00 0.00 ? 29  ILE A CG2  1  
ATOM 388   C CD1  . ILE A 1 29  ? -6.635  -5.508  7.757   1.00 0.00 ? 29  ILE A CD1  1  
ATOM 389   H H    . ILE A 1 29  ? -6.808  -4.303  11.638  1.00 0.00 ? 29  ILE A H    1  
ATOM 390   H HA   . ILE A 1 29  ? -7.810  -2.358  9.814   1.00 0.00 ? 29  ILE A HA   1  
ATOM 391   H HB   . ILE A 1 29  ? -8.550  -5.272  10.051  1.00 0.00 ? 29  ILE A HB   1  
ATOM 392   H HG12 . ILE A 1 29  ? -6.028  -3.977  9.151   1.00 0.00 ? 29  ILE A HG12 1  
ATOM 393   H HG13 . ILE A 1 29  ? -6.292  -5.546  9.886   1.00 0.00 ? 29  ILE A HG13 1  
ATOM 394   H HG21 . ILE A 1 29  ? -9.817  -3.567  8.533   1.00 0.00 ? 29  ILE A HG21 1  
ATOM 395   H HG22 . ILE A 1 29  ? -8.373  -3.699  7.501   1.00 0.00 ? 29  ILE A HG22 1  
ATOM 396   H HG23 . ILE A 1 29  ? -9.330  -5.150  7.883   1.00 0.00 ? 29  ILE A HG23 1  
ATOM 397   H HD11 . ILE A 1 29  ? -5.768  -6.165  7.693   1.00 0.00 ? 29  ILE A HD11 1  
ATOM 398   H HD12 . ILE A 1 29  ? -7.544  -6.089  7.603   1.00 0.00 ? 29  ILE A HD12 1  
ATOM 399   H HD13 . ILE A 1 29  ? -6.564  -4.736  6.991   1.00 0.00 ? 29  ILE A HD13 1  
ATOM 400   N N    . LEU A 1 30  ? -10.279 -2.185  10.312  1.00 0.00 ? 30  LEU A N    1  
ATOM 401   C CA   . LEU A 1 30  ? -11.604 -1.826  10.787  1.00 0.00 ? 30  LEU A CA   1  
ATOM 402   C C    . LEU A 1 30  ? -12.628 -2.099  9.684   1.00 0.00 ? 30  LEU A C    1  
ATOM 403   O O    . LEU A 1 30  ? -12.550 -3.117  8.997   1.00 0.00 ? 30  LEU A O    1  
ATOM 404   C CB   . LEU A 1 30  ? -11.618 -0.383  11.295  1.00 0.00 ? 30  LEU A CB   1  
ATOM 405   C CG   . LEU A 1 30  ? -10.508 -0.007  12.279  1.00 0.00 ? 30  LEU A CG   1  
ATOM 406   C CD1  . LEU A 1 30  ? -10.195 1.489   12.208  1.00 0.00 ? 30  LEU A CD1  1  
ATOM 407   C CD2  . LEU A 1 30  ? -10.861 -0.452  13.700  1.00 0.00 ? 30  LEU A CD2  1  
ATOM 408   H H    . LEU A 1 30  ? -10.048 -1.840  9.402   1.00 0.00 ? 30  LEU A H    1  
ATOM 409   H HA   . LEU A 1 30  ? -11.832 -2.469  11.637  1.00 0.00 ? 30  LEU A HA   1  
ATOM 410   H HB2  . LEU A 1 30  ? -11.556 0.285   10.436  1.00 0.00 ? 30  LEU A HB2  1  
ATOM 411   H HB3  . LEU A 1 30  ? -12.579 -0.197  11.775  1.00 0.00 ? 30  LEU A HB3  1  
ATOM 412   H HG   . LEU A 1 30  ? -9.602  -0.540  11.991  1.00 0.00 ? 30  LEU A HG   1  
ATOM 413   H HD11 . LEU A 1 30  ? -11.127 2.054   12.174  1.00 0.00 ? 30  LEU A HD11 1  
ATOM 414   H HD12 . LEU A 1 30  ? -9.624  1.783   13.088  1.00 0.00 ? 30  LEU A HD12 1  
ATOM 415   H HD13 . LEU A 1 30  ? -9.612  1.696   11.310  1.00 0.00 ? 30  LEU A HD13 1  
ATOM 416   H HD21 . LEU A 1 30  ? -10.329 -1.374  13.935  1.00 0.00 ? 30  LEU A HD21 1  
ATOM 417   H HD22 . LEU A 1 30  ? -10.571 0.325   14.407  1.00 0.00 ? 30  LEU A HD22 1  
ATOM 418   H HD23 . LEU A 1 30  ? -11.935 -0.625  13.770  1.00 0.00 ? 30  LEU A HD23 1  
ATOM 419   N N    . ASP A 1 31  ? -13.566 -1.172  9.548   1.00 0.00 ? 31  ASP A N    1  
ATOM 420   C CA   . ASP A 1 31  ? -14.604 -1.301  8.540   1.00 0.00 ? 31  ASP A CA   1  
ATOM 421   C C    . ASP A 1 31  ? -14.292 -0.365  7.370   1.00 0.00 ? 31  ASP A C    1  
ATOM 422   O O    . ASP A 1 31  ? -14.712 -0.615  6.241   1.00 0.00 ? 31  ASP A O    1  
ATOM 423   C CB   . ASP A 1 31  ? -15.971 -0.911  9.104   1.00 0.00 ? 31  ASP A CB   1  
ATOM 424   C CG   . ASP A 1 31  ? -15.942 0.187   10.169  1.00 0.00 ? 31  ASP A CG   1  
ATOM 425   O OD1  . ASP A 1 31  ? -15.222 -0.013  11.171  1.00 0.00 ? 31  ASP A OD1  1  
ATOM 426   O OD2  . ASP A 1 31  ? -16.640 1.202   9.958   1.00 0.00 ? 31  ASP A OD2  1  
ATOM 427   H H    . ASP A 1 31  ? -13.622 -0.348  10.110  1.00 0.00 ? 31  ASP A H    1  
ATOM 428   H HA   . ASP A 1 31  ? -14.592 -2.351  8.248   1.00 0.00 ? 31  ASP A HA   1  
ATOM 429   H HB2  . ASP A 1 31  ? -16.607 -0.582  8.282   1.00 0.00 ? 31  ASP A HB2  1  
ATOM 430   H HB3  . ASP A 1 31  ? -16.438 -1.799  9.532   1.00 0.00 ? 31  ASP A HB3  1  
ATOM 431   N N    . THR A 1 32  ? -13.556 0.692   7.680   1.00 0.00 ? 32  THR A N    1  
ATOM 432   C CA   . THR A 1 32  ? -13.182 1.666   6.668   1.00 0.00 ? 32  THR A CA   1  
ATOM 433   C C    . THR A 1 32  ? -11.838 2.309   7.017   1.00 0.00 ? 32  THR A C    1  
ATOM 434   O O    . THR A 1 32  ? -11.579 3.453   6.649   1.00 0.00 ? 32  THR A O    1  
ATOM 435   C CB   . THR A 1 32  ? -14.324 2.677   6.541   1.00 0.00 ? 32  THR A CB   1  
ATOM 436   O OG1  . THR A 1 32  ? -14.288 3.399   7.769   1.00 0.00 ? 32  THR A OG1  1  
ATOM 437   C CG2  . THR A 1 32  ? -15.700 2.009   6.541   1.00 0.00 ? 32  THR A CG2  1  
ATOM 438   H H    . THR A 1 32  ? -13.218 0.888   8.600   1.00 0.00 ? 32  THR A H    1  
ATOM 439   H HA   . THR A 1 32  ? -13.051 1.144   5.721   1.00 0.00 ? 32  THR A HA   1  
ATOM 440   H HB   . THR A 1 32  ? -14.194 3.301   5.656   1.00 0.00 ? 32  THR A HB   1  
ATOM 441   H HG1  . THR A 1 32  ? -14.596 2.814   8.519   1.00 0.00 ? 32  THR A HG1  1  
ATOM 442   H HG21 . THR A 1 32  ? -15.774 1.328   5.693   1.00 0.00 ? 32  THR A HG21 1  
ATOM 443   H HG22 . THR A 1 32  ? -15.832 1.450   7.468   1.00 0.00 ? 32  THR A HG22 1  
ATOM 444   H HG23 . THR A 1 32  ? -16.475 2.772   6.463   1.00 0.00 ? 32  THR A HG23 1  
ATOM 445   N N    . SER A 1 33  ? -11.019 1.544   7.724   1.00 0.00 ? 33  SER A N    1  
ATOM 446   C CA   . SER A 1 33  ? -9.708  2.024   8.127   1.00 0.00 ? 33  SER A CA   1  
ATOM 447   C C    . SER A 1 33  ? -8.825  0.847   8.546   1.00 0.00 ? 33  SER A C    1  
ATOM 448   O O    . SER A 1 33  ? -9.224  0.032   9.376   1.00 0.00 ? 33  SER A O    1  
ATOM 449   C CB   . SER A 1 33  ? -9.820  3.037   9.269   1.00 0.00 ? 33  SER A CB   1  
ATOM 450   O OG   . SER A 1 33  ? -11.008 2.851   10.033  1.00 0.00 ? 33  SER A OG   1  
ATOM 451   H H    . SER A 1 33  ? -11.238 0.614   8.020   1.00 0.00 ? 33  SER A H    1  
ATOM 452   H HA   . SER A 1 33  ? -9.297  2.516   7.246   1.00 0.00 ? 33  SER A HA   1  
ATOM 453   H HB2  . SER A 1 33  ? -8.951  2.944   9.922   1.00 0.00 ? 33  SER A HB2  1  
ATOM 454   H HB3  . SER A 1 33  ? -9.805  4.047   8.861   1.00 0.00 ? 33  SER A HB3  1  
ATOM 455   H HG   . SER A 1 33  ? -11.057 3.535   10.761  1.00 0.00 ? 33  SER A HG   1  
ATOM 456   N N    . LEU A 1 34  ? -7.642  0.795   7.951   1.00 0.00 ? 34  LEU A N    1  
ATOM 457   C CA   . LEU A 1 34  ? -6.700  -0.269  8.252   1.00 0.00 ? 34  LEU A CA   1  
ATOM 458   C C    . LEU A 1 34  ? -5.273  0.256   8.079   1.00 0.00 ? 34  LEU A C    1  
ATOM 459   O O    . LEU A 1 34  ? -5.036  1.172   7.294   1.00 0.00 ? 34  LEU A O    1  
ATOM 460   C CB   . LEU A 1 34  ? -7.005  -1.509  7.410   1.00 0.00 ? 34  LEU A CB   1  
ATOM 461   C CG   . LEU A 1 34  ? -6.671  -1.407  5.920   1.00 0.00 ? 34  LEU A CG   1  
ATOM 462   C CD1  . LEU A 1 34  ? -5.161  -1.295  5.704   1.00 0.00 ? 34  LEU A CD1  1  
ATOM 463   C CD2  . LEU A 1 34  ? -7.277  -2.577  5.142   1.00 0.00 ? 34  LEU A CD2  1  
ATOM 464   H H    . LEU A 1 34  ? -7.326  1.462   7.277   1.00 0.00 ? 34  LEU A H    1  
ATOM 465   H HA   . LEU A 1 34  ? -6.842  -0.546  9.297   1.00 0.00 ? 34  LEU A HA   1  
ATOM 466   H HB2  . LEU A 1 34  ? -6.456  -2.353  7.829   1.00 0.00 ? 34  LEU A HB2  1  
ATOM 467   H HB3  . LEU A 1 34  ? -8.066  -1.739  7.509   1.00 0.00 ? 34  LEU A HB3  1  
ATOM 468   H HG   . LEU A 1 34  ? -7.121  -0.494  5.531   1.00 0.00 ? 34  LEU A HG   1  
ATOM 469   H HD11 . LEU A 1 34  ? -4.911  -0.275  5.413   1.00 0.00 ? 34  LEU A HD11 1  
ATOM 470   H HD12 . LEU A 1 34  ? -4.641  -1.547  6.628   1.00 0.00 ? 34  LEU A HD12 1  
ATOM 471   H HD13 . LEU A 1 34  ? -4.855  -1.983  4.916   1.00 0.00 ? 34  LEU A HD13 1  
ATOM 472   H HD21 . LEU A 1 34  ? -6.549  -3.385  5.076   1.00 0.00 ? 34  LEU A HD21 1  
ATOM 473   H HD22 . LEU A 1 34  ? -8.169  -2.933  5.656   1.00 0.00 ? 34  LEU A HD22 1  
ATOM 474   H HD23 . LEU A 1 34  ? -7.543  -2.246  4.138   1.00 0.00 ? 34  LEU A HD23 1  
ATOM 475   N N    . LYS A 1 35  ? -4.360  -0.349  8.826   1.00 0.00 ? 35  LYS A N    1  
ATOM 476   C CA   . LYS A 1 35  ? -2.963  0.046   8.765   1.00 0.00 ? 35  LYS A CA   1  
ATOM 477   C C    . LYS A 1 35  ? -2.217  -0.880  7.802   1.00 0.00 ? 35  LYS A C    1  
ATOM 478   O O    . LYS A 1 35  ? -2.473  -2.083  7.770   1.00 0.00 ? 35  LYS A O    1  
ATOM 479   C CB   . LYS A 1 35  ? -2.357  0.091   10.169  1.00 0.00 ? 35  LYS A CB   1  
ATOM 480   C CG   . LYS A 1 35  ? -0.838  0.260   10.106  1.00 0.00 ? 35  LYS A CG   1  
ATOM 481   C CD   . LYS A 1 35  ? -0.379  1.424   10.987  1.00 0.00 ? 35  LYS A CD   1  
ATOM 482   C CE   . LYS A 1 35  ? 0.320   2.500   10.153  1.00 0.00 ? 35  LYS A CE   1  
ATOM 483   N NZ   . LYS A 1 35  ? 0.614   3.689   10.984  1.00 0.00 ? 35  LYS A NZ   1  
ATOM 484   H H    . LYS A 1 35  ? -4.561  -1.093  9.462   1.00 0.00 ? 35  LYS A H    1  
ATOM 485   H HA   . LYS A 1 35  ? -2.927  1.060   8.366   1.00 0.00 ? 35  LYS A HA   1  
ATOM 486   H HB2  . LYS A 1 35  ? -2.795  0.914   10.733  1.00 0.00 ? 35  LYS A HB2  1  
ATOM 487   H HB3  . LYS A 1 35  ? -2.602  -0.827  10.704  1.00 0.00 ? 35  LYS A HB3  1  
ATOM 488   H HG2  . LYS A 1 35  ? -0.352  -0.660  10.430  1.00 0.00 ? 35  LYS A HG2  1  
ATOM 489   H HG3  . LYS A 1 35  ? -0.531  0.436   9.075   1.00 0.00 ? 35  LYS A HG3  1  
ATOM 490   H HD2  . LYS A 1 35  ? -1.237  1.857   11.500  1.00 0.00 ? 35  LYS A HD2  1  
ATOM 491   H HD3  . LYS A 1 35  ? 0.301   1.056   11.756  1.00 0.00 ? 35  LYS A HD3  1  
ATOM 492   H HE2  . LYS A 1 35  ? 1.245   2.102   9.736   1.00 0.00 ? 35  LYS A HE2  1  
ATOM 493   H HE3  . LYS A 1 35  ? -0.312  2.784   9.312   1.00 0.00 ? 35  LYS A HE3  1  
ATOM 494   H HZ1  . LYS A 1 35  ? 0.026   4.447   10.701  1.00 0.00 ? 35  LYS A HZ1  1  
ATOM 495   H HZ2  . LYS A 1 35  ? 0.442   3.475   11.945  1.00 0.00 ? 35  LYS A HZ2  1  
ATOM 496   H HZ3  . LYS A 1 35  ? 1.573   3.949   10.866  1.00 0.00 ? 35  LYS A HZ3  1  
ATOM 497   N N    . VAL A 1 36  ? -1.310  -0.285  7.042   1.00 0.00 ? 36  VAL A N    1  
ATOM 498   C CA   . VAL A 1 36  ? -0.526  -1.042  6.081   1.00 0.00 ? 36  VAL A CA   1  
ATOM 499   C C    . VAL A 1 36  ? 0.956   -0.950  6.454   1.00 0.00 ? 36  VAL A C    1  
ATOM 500   O O    . VAL A 1 36  ? 1.466   0.137   6.719   1.00 0.00 ? 36  VAL A O    1  
ATOM 501   C CB   . VAL A 1 36  ? -0.817  -0.548  4.663   1.00 0.00 ? 36  VAL A CB   1  
ATOM 502   C CG1  . VAL A 1 36  ? 0.189   -1.123  3.664   1.00 0.00 ? 36  VAL A CG1  1  
ATOM 503   C CG2  . VAL A 1 36  ? -2.252  -0.883  4.250   1.00 0.00 ? 36  VAL A CG2  1  
ATOM 504   H H    . VAL A 1 36  ? -1.108  0.694   7.075   1.00 0.00 ? 36  VAL A H    1  
ATOM 505   H HA   . VAL A 1 36  ? -0.840  -2.083  6.148   1.00 0.00 ? 36  VAL A HA   1  
ATOM 506   H HB   . VAL A 1 36  ? -0.712  0.537   4.657   1.00 0.00 ? 36  VAL A HB   1  
ATOM 507   H HG11 . VAL A 1 36  ? 1.202   -0.947  4.027   1.00 0.00 ? 36  VAL A HG11 1  
ATOM 508   H HG12 . VAL A 1 36  ? 0.023   -2.195  3.557   1.00 0.00 ? 36  VAL A HG12 1  
ATOM 509   H HG13 . VAL A 1 36  ? 0.060   -0.637  2.697   1.00 0.00 ? 36  VAL A HG13 1  
ATOM 510   H HG21 . VAL A 1 36  ? -2.683  -0.037  3.715   1.00 0.00 ? 36  VAL A HG21 1  
ATOM 511   H HG22 . VAL A 1 36  ? -2.248  -1.759  3.601   1.00 0.00 ? 36  VAL A HG22 1  
ATOM 512   H HG23 . VAL A 1 36  ? -2.847  -1.091  5.139   1.00 0.00 ? 36  VAL A HG23 1  
ATOM 513   N N    . SER A 1 37  ? 1.604   -2.105  6.462   1.00 0.00 ? 37  SER A N    1  
ATOM 514   C CA   . SER A 1 37  ? 3.016   -2.169  6.797   1.00 0.00 ? 37  SER A CA   1  
ATOM 515   C C    . SER A 1 37  ? 3.756   -3.043  5.783   1.00 0.00 ? 37  SER A C    1  
ATOM 516   O O    . SER A 1 37  ? 3.150   -3.892  5.130   1.00 0.00 ? 37  SER A O    1  
ATOM 517   C CB   . SER A 1 37  ? 3.222   -2.709  8.214   1.00 0.00 ? 37  SER A CB   1  
ATOM 518   O OG   . SER A 1 37  ? 4.287   -3.654  8.275   1.00 0.00 ? 37  SER A OG   1  
ATOM 519   H H    . SER A 1 37  ? 1.181   -2.985  6.245   1.00 0.00 ? 37  SER A H    1  
ATOM 520   H HA   . SER A 1 37  ? 3.371   -1.140  6.746   1.00 0.00 ? 37  SER A HA   1  
ATOM 521   H HB2  . SER A 1 37  ? 3.432   -1.881  8.891   1.00 0.00 ? 37  SER A HB2  1  
ATOM 522   H HB3  . SER A 1 37  ? 2.301   -3.178  8.560   1.00 0.00 ? 37  SER A HB3  1  
ATOM 523   H HG   . SER A 1 37  ? 5.143   -3.190  8.506   1.00 0.00 ? 37  SER A HG   1  
ATOM 524   N N    . TRP A 1 38  ? 5.056   -2.806  5.682   1.00 0.00 ? 38  TRP A N    1  
ATOM 525   C CA   . TRP A 1 38  ? 5.885   -3.561  4.758   1.00 0.00 ? 38  TRP A CA   1  
ATOM 526   C C    . TRP A 1 38  ? 7.330   -3.491  5.254   1.00 0.00 ? 38  TRP A C    1  
ATOM 527   O O    . TRP A 1 38  ? 7.587   -3.036  6.367   1.00 0.00 ? 38  TRP A O    1  
ATOM 528   C CB   . TRP A 1 38  ? 5.718   -3.048  3.326   1.00 0.00 ? 38  TRP A CB   1  
ATOM 529   C CG   . TRP A 1 38  ? 6.031   -1.560  3.158   1.00 0.00 ? 38  TRP A CG   1  
ATOM 530   C CD1  . TRP A 1 38  ? 7.217   -0.990  2.908   1.00 0.00 ? 38  TRP A CD1  1  
ATOM 531   C CD2  . TRP A 1 38  ? 5.090   -0.469  3.239   1.00 0.00 ? 38  TRP A CD2  1  
ATOM 532   N NE1  . TRP A 1 38  ? 7.111   0.383   2.822   1.00 0.00 ? 38  TRP A NE1  1  
ATOM 533   C CE2  . TRP A 1 38  ? 5.776   0.710   3.029   1.00 0.00 ? 38  TRP A CE2  1  
ATOM 534   C CE3  . TRP A 1 38  ? 3.705   -0.478  3.481   1.00 0.00 ? 38  TRP A CE3  1  
ATOM 535   C CZ2  . TRP A 1 38  ? 5.160   1.968   3.041   1.00 0.00 ? 38  TRP A CZ2  1  
ATOM 536   C CZ3  . TRP A 1 38  ? 3.105   0.787   3.489   1.00 0.00 ? 38  TRP A CZ3  1  
ATOM 537   C CH2  . TRP A 1 38  ? 3.781   1.983   3.280   1.00 0.00 ? 38  TRP A CH2  1  
ATOM 538   H H    . TRP A 1 38  ? 5.541   -2.114  6.216   1.00 0.00 ? 38  TRP A H    1  
ATOM 539   H HA   . TRP A 1 38  ? 5.537   -4.595  4.767   1.00 0.00 ? 38  TRP A HA   1  
ATOM 540   H HB2  . TRP A 1 38  ? 6.368   -3.623  2.667   1.00 0.00 ? 38  TRP A HB2  1  
ATOM 541   H HB3  . TRP A 1 38  ? 4.693   -3.232  3.002   1.00 0.00 ? 38  TRP A HB3  1  
ATOM 542   H HD1  . TRP A 1 38  ? 8.150   -1.541  2.787   1.00 0.00 ? 38  TRP A HD1  1  
ATOM 543   H HE1  . TRP A 1 38  ? 7.923   1.083   2.626   1.00 0.00 ? 38  TRP A HE1  1  
ATOM 544   H HE3  . TRP A 1 38  ? 3.141   -1.395  3.650   1.00 0.00 ? 38  TRP A HE3  1  
ATOM 545   H HZ2  . TRP A 1 38  ? 5.724   2.885   2.872   1.00 0.00 ? 38  TRP A HZ2  1  
ATOM 546   H HZ3  . TRP A 1 38  ? 2.031   0.837   3.673   1.00 0.00 ? 38  TRP A HZ3  1  
ATOM 547   H HH2  . TRP A 1 38  ? 3.240   2.929   3.302   1.00 0.00 ? 38  TRP A HH2  1  
ATOM 548   N N    . GLN A 1 39  ? 8.237   -3.947  4.403   1.00 0.00 ? 39  GLN A N    1  
ATOM 549   C CA   . GLN A 1 39  ? 9.650   -3.942  4.740   1.00 0.00 ? 39  GLN A CA   1  
ATOM 550   C C    . GLN A 1 39  ? 10.478  -3.447  3.552   1.00 0.00 ? 39  GLN A C    1  
ATOM 551   O O    . GLN A 1 39  ? 9.929   -3.126  2.499   1.00 0.00 ? 39  GLN A O    1  
ATOM 552   C CB   . GLN A 1 39  ? 10.112  -5.329  5.190   1.00 0.00 ? 39  GLN A CB   1  
ATOM 553   C CG   . GLN A 1 39  ? 10.332  -5.370  6.704   1.00 0.00 ? 39  GLN A CG   1  
ATOM 554   C CD   . GLN A 1 39  ? 11.807  -5.157  7.050   1.00 0.00 ? 39  GLN A CD   1  
ATOM 555   O OE1  . GLN A 1 39  ? 12.677  -5.153  6.195   1.00 0.00 ? 39  GLN A OE1  1  
ATOM 556   N NE2  . GLN A 1 39  ? 12.038  -4.980  8.348   1.00 0.00 ? 39  GLN A NE2  1  
ATOM 557   H H    . GLN A 1 39  ? 8.020   -4.316  3.499   1.00 0.00 ? 39  GLN A H    1  
ATOM 558   H HA   . GLN A 1 39  ? 9.746   -3.246  5.574   1.00 0.00 ? 39  GLN A HA   1  
ATOM 559   H HB2  . GLN A 1 39  ? 9.368   -6.074  4.907   1.00 0.00 ? 39  GLN A HB2  1  
ATOM 560   H HB3  . GLN A 1 39  ? 11.038  -5.592  4.678   1.00 0.00 ? 39  GLN A HB3  1  
ATOM 561   H HG2  . GLN A 1 39  ? 9.727   -4.600  7.183   1.00 0.00 ? 39  GLN A HG2  1  
ATOM 562   H HG3  . GLN A 1 39  ? 9.997   -6.330  7.097   1.00 0.00 ? 39  GLN A HG3  1  
ATOM 563   H HE21 . GLN A 1 39  ? 11.277  -4.994  8.997   1.00 0.00 ? 39  GLN A HE21 1  
ATOM 564   H HE22 . GLN A 1 39  ? 12.971  -4.832  8.674   1.00 0.00 ? 39  GLN A HE22 1  
ATOM 565   N N    . GLU A 1 40  ? 11.785  -3.400  3.761   1.00 0.00 ? 40  GLU A N    1  
ATOM 566   C CA   . GLU A 1 40  ? 12.694  -2.949  2.721   1.00 0.00 ? 40  GLU A CA   1  
ATOM 567   C C    . GLU A 1 40  ? 12.970  -4.082  1.730   1.00 0.00 ? 40  GLU A C    1  
ATOM 568   O O    . GLU A 1 40  ? 13.206  -5.220  2.134   1.00 0.00 ? 40  GLU A O    1  
ATOM 569   C CB   . GLU A 1 40  ? 13.996  -2.417  3.323   1.00 0.00 ? 40  GLU A CB   1  
ATOM 570   C CG   . GLU A 1 40  ? 14.079  -0.895  3.192   1.00 0.00 ? 40  GLU A CG   1  
ATOM 571   C CD   . GLU A 1 40  ? 15.128  -0.319  4.145   1.00 0.00 ? 40  GLU A CD   1  
ATOM 572   O OE1  . GLU A 1 40  ? 15.523  -1.062  5.070   1.00 0.00 ? 40  GLU A OE1  1  
ATOM 573   O OE2  . GLU A 1 40  ? 15.512  0.850   3.927   1.00 0.00 ? 40  GLU A OE2  1  
ATOM 574   H H    . GLU A 1 40  ? 12.224  -3.662  4.621   1.00 0.00 ? 40  GLU A H    1  
ATOM 575   H HA   . GLU A 1 40  ? 12.175  -2.135  2.216   1.00 0.00 ? 40  GLU A HA   1  
ATOM 576   H HB2  . GLU A 1 40  ? 14.057  -2.700  4.374   1.00 0.00 ? 40  GLU A HB2  1  
ATOM 577   H HB3  . GLU A 1 40  ? 14.847  -2.876  2.819   1.00 0.00 ? 40  GLU A HB3  1  
ATOM 578   H HG2  . GLU A 1 40  ? 14.328  -0.627  2.166   1.00 0.00 ? 40  GLU A HG2  1  
ATOM 579   H HG3  . GLU A 1 40  ? 13.105  -0.455  3.409   1.00 0.00 ? 40  GLU A HG3  1  
ATOM 580   N N    . PRO A 1 41  ? 12.931  -3.722  0.420   1.00 0.00 ? 41  PRO A N    1  
ATOM 581   C CA   . PRO A 1 41  ? 13.175  -4.695  -0.632  1.00 0.00 ? 41  PRO A CA   1  
ATOM 582   C C    . PRO A 1 41  ? 14.664  -5.032  -0.733  1.00 0.00 ? 41  PRO A C    1  
ATOM 583   O O    . PRO A 1 41  ? 15.515  -4.199  -0.426  1.00 0.00 ? 41  PRO A O    1  
ATOM 584   C CB   . PRO A 1 41  ? 12.624  -4.056  -1.895  1.00 0.00 ? 41  PRO A CB   1  
ATOM 585   C CG   . PRO A 1 41  ? 12.515  -2.569  -1.597  1.00 0.00 ? 41  PRO A CG   1  
ATOM 586   C CD   . PRO A 1 41  ? 12.656  -2.384  -0.095  1.00 0.00 ? 41  PRO A CD   1  
ATOM 587   H HA   . PRO A 1 41  ? 12.713  -5.557  -0.421  1.00 0.00 ? 41  PRO A HA   1  
ATOM 588   H HB2  . PRO A 1 41  ? 13.283  -4.236  -2.744  1.00 0.00 ? 41  PRO A HB2  1  
ATOM 589   H HB3  . PRO A 1 41  ? 11.651  -4.474  -2.153  1.00 0.00 ? 41  PRO A HB3  1  
ATOM 590   H HG2  . PRO A 1 41  ? 13.292  -2.016  -2.124  1.00 0.00 ? 41  PRO A HG2  1  
ATOM 591   H HG3  . PRO A 1 41  ? 11.557  -2.180  -1.941  1.00 0.00 ? 41  PRO A HG3  1  
ATOM 592   H HD2  . PRO A 1 41  ? 13.464  -1.693  0.145   1.00 0.00 ? 41  PRO A HD2  1  
ATOM 593   H HD3  . PRO A 1 41  ? 11.745  -1.972  0.340   1.00 0.00 ? 41  PRO A HD3  1  
ATOM 594   N N    . GLY A 1 42  ? 14.933  -6.256  -1.163  1.00 0.00 ? 42  GLY A N    1  
ATOM 595   C CA   . GLY A 1 42  ? 16.304  -6.714  -1.309  1.00 0.00 ? 42  GLY A CA   1  
ATOM 596   C C    . GLY A 1 42  ? 16.928  -6.177  -2.599  1.00 0.00 ? 42  GLY A C    1  
ATOM 597   O O    . GLY A 1 42  ? 18.129  -6.325  -2.821  1.00 0.00 ? 42  GLY A O    1  
ATOM 598   H H    . GLY A 1 42  ? 14.235  -6.928  -1.411  1.00 0.00 ? 42  GLY A H    1  
ATOM 599   H HA2  . GLY A 1 42  ? 16.894  -6.386  -0.452  1.00 0.00 ? 42  GLY A HA2  1  
ATOM 600   H HA3  . GLY A 1 42  ? 16.329  -7.803  -1.314  1.00 0.00 ? 42  GLY A HA3  1  
ATOM 601   N N    . GLU A 1 43  ? 16.083  -5.566  -3.417  1.00 0.00 ? 43  GLU A N    1  
ATOM 602   C CA   . GLU A 1 43  ? 16.536  -5.007  -4.679  1.00 0.00 ? 43  GLU A CA   1  
ATOM 603   C C    . GLU A 1 43  ? 16.573  -3.479  -4.600  1.00 0.00 ? 43  GLU A C    1  
ATOM 604   O O    . GLU A 1 43  ? 16.218  -2.796  -5.559  1.00 0.00 ? 43  GLU A O    1  
ATOM 605   C CB   . GLU A 1 43  ? 15.650  -5.475  -5.835  1.00 0.00 ? 43  GLU A CB   1  
ATOM 606   C CG   . GLU A 1 43  ? 16.140  -6.812  -6.395  1.00 0.00 ? 43  GLU A CG   1  
ATOM 607   C CD   . GLU A 1 43  ? 17.433  -6.632  -7.192  1.00 0.00 ? 43  GLU A CD   1  
ATOM 608   O OE1  . GLU A 1 43  ? 17.345  -6.040  -8.290  1.00 0.00 ? 43  GLU A OE1  1  
ATOM 609   O OE2  . GLU A 1 43  ? 18.481  -7.090  -6.687  1.00 0.00 ? 43  GLU A OE2  1  
ATOM 610   H H    . GLU A 1 43  ? 15.108  -5.450  -3.229  1.00 0.00 ? 43  GLU A H    1  
ATOM 611   H HA   . GLU A 1 43  ? 17.545  -5.394  -4.822  1.00 0.00 ? 43  GLU A HA   1  
ATOM 612   H HB2  . GLU A 1 43  ? 14.621  -5.576  -5.492  1.00 0.00 ? 43  GLU A HB2  1  
ATOM 613   H HB3  . GLU A 1 43  ? 15.650  -4.724  -6.625  1.00 0.00 ? 43  GLU A HB3  1  
ATOM 614   H HG2  . GLU A 1 43  ? 16.308  -7.513  -5.577  1.00 0.00 ? 43  GLU A HG2  1  
ATOM 615   H HG3  . GLU A 1 43  ? 15.371  -7.246  -7.034  1.00 0.00 ? 43  GLU A HG3  1  
ATOM 616   N N    . LYS A 1 44  ? 17.006  -2.988  -3.448  1.00 0.00 ? 44  LYS A N    1  
ATOM 617   C CA   . LYS A 1 44  ? 17.094  -1.554  -3.232  1.00 0.00 ? 44  LYS A CA   1  
ATOM 618   C C    . LYS A 1 44  ? 17.612  -0.881  -4.505  1.00 0.00 ? 44  LYS A C    1  
ATOM 619   O O    . LYS A 1 44  ? 17.191  0.224   -4.842  1.00 0.00 ? 44  LYS A O    1  
ATOM 620   C CB   . LYS A 1 44  ? 17.934  -1.250  -1.990  1.00 0.00 ? 44  LYS A CB   1  
ATOM 621   C CG   . LYS A 1 44  ? 17.264  -1.796  -0.727  1.00 0.00 ? 44  LYS A CG   1  
ATOM 622   C CD   . LYS A 1 44  ? 17.783  -1.080  0.522   1.00 0.00 ? 44  LYS A CD   1  
ATOM 623   C CE   . LYS A 1 44  ? 16.918  -1.408  1.741   1.00 0.00 ? 44  LYS A CE   1  
ATOM 624   N NZ   . LYS A 1 44  ? 17.710  -2.135  2.758   1.00 0.00 ? 44  LYS A NZ   1  
ATOM 625   H H    . LYS A 1 44  ? 17.293  -3.551  -2.673  1.00 0.00 ? 44  LYS A H    1  
ATOM 626   H HA   . LYS A 1 44  ? 16.085  -1.191  -3.035  1.00 0.00 ? 44  LYS A HA   1  
ATOM 627   H HB2  . LYS A 1 44  ? 18.925  -1.692  -2.099  1.00 0.00 ? 44  LYS A HB2  1  
ATOM 628   H HB3  . LYS A 1 44  ? 18.074  -0.174  -1.896  1.00 0.00 ? 44  LYS A HB3  1  
ATOM 629   H HG2  . LYS A 1 44  ? 16.184  -1.669  -0.801  1.00 0.00 ? 44  LYS A HG2  1  
ATOM 630   H HG3  . LYS A 1 44  ? 17.454  -2.866  -0.643  1.00 0.00 ? 44  LYS A HG3  1  
ATOM 631   H HD2  . LYS A 1 44  ? 18.814  -1.377  0.713   1.00 0.00 ? 44  LYS A HD2  1  
ATOM 632   H HD3  . LYS A 1 44  ? 17.787  -0.004  0.353   1.00 0.00 ? 44  LYS A HD3  1  
ATOM 633   H HE2  . LYS A 1 44  ? 16.521  -0.488  2.169   1.00 0.00 ? 44  LYS A HE2  1  
ATOM 634   H HE3  . LYS A 1 44  ? 16.064  -2.013  1.436   1.00 0.00 ? 44  LYS A HE3  1  
ATOM 635   H HZ1  . LYS A 1 44  ? 17.965  -1.506  3.493   1.00 0.00 ? 44  LYS A HZ1  1  
ATOM 636   H HZ2  . LYS A 1 44  ? 17.164  -2.883  3.134   1.00 0.00 ? 44  LYS A HZ2  1  
ATOM 637   H HZ3  . LYS A 1 44  ? 18.537  -2.505  2.334   1.00 0.00 ? 44  LYS A HZ3  1  
ATOM 638   N N    . ASN A 1 45  ? 18.517  -1.577  -5.177  1.00 0.00 ? 45  ASN A N    1  
ATOM 639   C CA   . ASN A 1 45  ? 19.097  -1.061  -6.405  1.00 0.00 ? 45  ASN A CA   1  
ATOM 640   C C    . ASN A 1 45  ? 19.346  0.441   -6.255  1.00 0.00 ? 45  ASN A C    1  
ATOM 641   O O    . ASN A 1 45  ? 18.886  1.235   -7.074  1.00 0.00 ? 45  ASN A O    1  
ATOM 642   C CB   . ASN A 1 45  ? 18.150  -1.267  -7.590  1.00 0.00 ? 45  ASN A CB   1  
ATOM 643   C CG   . ASN A 1 45  ? 18.423  -2.603  -8.284  1.00 0.00 ? 45  ASN A CG   1  
ATOM 644   O OD1  . ASN A 1 45  ? 19.492  -2.846  -8.820  1.00 0.00 ? 45  ASN A OD1  1  
ATOM 645   N ND2  . ASN A 1 45  ? 17.401  -3.452  -8.245  1.00 0.00 ? 45  ASN A ND2  1  
ATOM 646   H H    . ASN A 1 45  ? 18.853  -2.476  -4.896  1.00 0.00 ? 45  ASN A H    1  
ATOM 647   H HA   . ASN A 1 45  ? 20.019  -1.625  -6.546  1.00 0.00 ? 45  ASN A HA   1  
ATOM 648   H HB2  . ASN A 1 45  ? 17.117  -1.237  -7.244  1.00 0.00 ? 45  ASN A HB2  1  
ATOM 649   H HB3  . ASN A 1 45  ? 18.271  -0.451  -8.303  1.00 0.00 ? 45  ASN A HB3  1  
ATOM 650   H HD21 . ASN A 1 45  ? 16.550  -3.189  -7.788  1.00 0.00 ? 45  ASN A HD21 1  
ATOM 651   H HD22 . ASN A 1 45  ? 17.482  -4.352  -8.672  1.00 0.00 ? 45  ASN A HD22 1  
ATOM 652   N N    . GLY A 1 46  ? 20.072  0.785   -5.202  1.00 0.00 ? 46  GLY A N    1  
ATOM 653   C CA   . GLY A 1 46  ? 20.388  2.178   -4.933  1.00 0.00 ? 46  GLY A CA   1  
ATOM 654   C C    . GLY A 1 46  ? 19.954  2.576   -3.521  1.00 0.00 ? 46  GLY A C    1  
ATOM 655   O O    . GLY A 1 46  ? 19.776  1.719   -2.658  1.00 0.00 ? 46  GLY A O    1  
ATOM 656   H H    . GLY A 1 46  ? 20.443  0.133   -4.540  1.00 0.00 ? 46  GLY A H    1  
ATOM 657   H HA2  . GLY A 1 46  ? 21.460  2.340   -5.047  1.00 0.00 ? 46  GLY A HA2  1  
ATOM 658   H HA3  . GLY A 1 46  ? 19.890  2.815   -5.664  1.00 0.00 ? 46  GLY A HA3  1  
ATOM 659   N N    . ILE A 1 47  ? 19.797  3.878   -3.330  1.00 0.00 ? 47  ILE A N    1  
ATOM 660   C CA   . ILE A 1 47  ? 19.387  4.400   -2.037  1.00 0.00 ? 47  ILE A CA   1  
ATOM 661   C C    . ILE A 1 47  ? 17.921  4.833   -2.109  1.00 0.00 ? 47  ILE A C    1  
ATOM 662   O O    . ILE A 1 47  ? 17.614  5.919   -2.599  1.00 0.00 ? 47  ILE A O    1  
ATOM 663   C CB   . ILE A 1 47  ? 20.335  5.512   -1.584  1.00 0.00 ? 47  ILE A CB   1  
ATOM 664   C CG1  . ILE A 1 47  ? 21.678  4.935   -1.131  1.00 0.00 ? 47  ILE A CG1  1  
ATOM 665   C CG2  . ILE A 1 47  ? 19.688  6.376   -0.500  1.00 0.00 ? 47  ILE A CG2  1  
ATOM 666   C CD1  . ILE A 1 47  ? 21.480  3.846   -0.076  1.00 0.00 ? 47  ILE A CD1  1  
ATOM 667   H H    . ILE A 1 47  ? 19.944  4.569   -4.038  1.00 0.00 ? 47  ILE A H    1  
ATOM 668   H HA   . ILE A 1 47  ? 19.472  3.589   -1.315  1.00 0.00 ? 47  ILE A HA   1  
ATOM 669   H HB   . ILE A 1 47  ? 20.534  6.160   -2.437  1.00 0.00 ? 47  ILE A HB   1  
ATOM 670   H HG12 . ILE A 1 47  ? 22.209  4.523   -1.989  1.00 0.00 ? 47  ILE A HG12 1  
ATOM 671   H HG13 . ILE A 1 47  ? 22.301  5.732   -0.723  1.00 0.00 ? 47  ILE A HG13 1  
ATOM 672   H HG21 . ILE A 1 47  ? 18.817  5.861   -0.096  1.00 0.00 ? 47  ILE A HG21 1  
ATOM 673   H HG22 . ILE A 1 47  ? 20.407  6.556   0.299   1.00 0.00 ? 47  ILE A HG22 1  
ATOM 674   H HG23 . ILE A 1 47  ? 19.379  7.328   -0.932  1.00 0.00 ? 47  ILE A HG23 1  
ATOM 675   H HD11 . ILE A 1 47  ? 21.343  2.883   -0.569  1.00 0.00 ? 47  ILE A HD11 1  
ATOM 676   H HD12 . ILE A 1 47  ? 22.356  3.801   0.571   1.00 0.00 ? 47  ILE A HD12 1  
ATOM 677   H HD13 . ILE A 1 47  ? 20.598  4.076   0.523   1.00 0.00 ? 47  ILE A HD13 1  
ATOM 678   N N    . LEU A 1 48  ? 17.055  3.962   -1.612  1.00 0.00 ? 48  LEU A N    1  
ATOM 679   C CA   . LEU A 1 48  ? 15.629  4.241   -1.613  1.00 0.00 ? 48  LEU A CA   1  
ATOM 680   C C    . LEU A 1 48  ? 15.400  5.709   -1.247  1.00 0.00 ? 48  LEU A C    1  
ATOM 681   O O    . LEU A 1 48  ? 16.018  6.224   -0.316  1.00 0.00 ? 48  LEU A O    1  
ATOM 682   C CB   . LEU A 1 48  ? 14.890  3.258   -0.703  1.00 0.00 ? 48  LEU A CB   1  
ATOM 683   C CG   . LEU A 1 48  ? 15.096  1.774   -1.012  1.00 0.00 ? 48  LEU A CG   1  
ATOM 684   C CD1  . LEU A 1 48  ? 14.374  0.896   0.012   1.00 0.00 ? 48  LEU A CD1  1  
ATOM 685   C CD2  . LEU A 1 48  ? 14.672  1.448   -2.446  1.00 0.00 ? 48  LEU A CD2  1  
ATOM 686   H H    . LEU A 1 48  ? 17.313  3.082   -1.215  1.00 0.00 ? 48  LEU A H    1  
ATOM 687   H HA   . LEU A 1 48  ? 15.265  4.077   -2.628  1.00 0.00 ? 48  LEU A HA   1  
ATOM 688   H HB2  . LEU A 1 48  ? 15.201  3.442   0.325   1.00 0.00 ? 48  LEU A HB2  1  
ATOM 689   H HB3  . LEU A 1 48  ? 13.823  3.476   -0.757  1.00 0.00 ? 48  LEU A HB3  1  
ATOM 690   H HG   . LEU A 1 48  ? 16.160  1.553   -0.932  1.00 0.00 ? 48  LEU A HG   1  
ATOM 691   H HD11 . LEU A 1 48  ? 13.333  0.773   -0.284  1.00 0.00 ? 48  LEU A HD11 1  
ATOM 692   H HD12 . LEU A 1 48  ? 14.857  -0.081  0.058   1.00 0.00 ? 48  LEU A HD12 1  
ATOM 693   H HD13 . LEU A 1 48  ? 14.419  1.369   0.993   1.00 0.00 ? 48  LEU A HD13 1  
ATOM 694   H HD21 . LEU A 1 48  ? 13.637  1.754   -2.597  1.00 0.00 ? 48  LEU A HD21 1  
ATOM 695   H HD22 . LEU A 1 48  ? 15.315  1.983   -3.145  1.00 0.00 ? 48  LEU A HD22 1  
ATOM 696   H HD23 . LEU A 1 48  ? 14.763  0.375   -2.616  1.00 0.00 ? 48  LEU A HD23 1  
ATOM 697   N N    . THR A 1 49  ? 14.512  6.342   -1.999  1.00 0.00 ? 49  THR A N    1  
ATOM 698   C CA   . THR A 1 49  ? 14.194  7.740   -1.765  1.00 0.00 ? 49  THR A CA   1  
ATOM 699   C C    . THR A 1 49  ? 12.822  7.872   -1.103  1.00 0.00 ? 49  THR A C    1  
ATOM 700   O O    . THR A 1 49  ? 12.470  8.939   -0.601  1.00 0.00 ? 49  THR A O    1  
ATOM 701   C CB   . THR A 1 49  ? 14.297  8.478   -3.102  1.00 0.00 ? 49  THR A CB   1  
ATOM 702   O OG1  . THR A 1 49  ? 13.719  7.576   -4.042  1.00 0.00 ? 49  THR A OG1  1  
ATOM 703   C CG2  . THR A 1 49  ? 15.744  8.634   -3.575  1.00 0.00 ? 49  THR A CG2  1  
ATOM 704   H H    . THR A 1 49  ? 14.014  5.916   -2.755  1.00 0.00 ? 49  THR A H    1  
ATOM 705   H HA   . THR A 1 49  ? 14.927  8.147   -1.068  1.00 0.00 ? 49  THR A HA   1  
ATOM 706   H HB   . THR A 1 49  ? 13.798  9.446   -3.051  1.00 0.00 ? 49  THR A HB   1  
ATOM 707   H HG1  . THR A 1 49  ? 13.079  8.064   -4.635  1.00 0.00 ? 49  THR A HG1  1  
ATOM 708   H HG21 . THR A 1 49  ? 15.814  8.356   -4.627  1.00 0.00 ? 49  THR A HG21 1  
ATOM 709   H HG22 . THR A 1 49  ? 16.057  9.671   -3.452  1.00 0.00 ? 49  THR A HG22 1  
ATOM 710   H HG23 . THR A 1 49  ? 16.391  7.986   -2.984  1.00 0.00 ? 49  THR A HG23 1  
ATOM 711   N N    . GLY A 1 50  ? 12.083  6.772   -1.121  1.00 0.00 ? 50  GLY A N    1  
ATOM 712   C CA   . GLY A 1 50  ? 10.757  6.751   -0.528  1.00 0.00 ? 50  GLY A CA   1  
ATOM 713   C C    . GLY A 1 50  ? 9.962   5.534   -1.006  1.00 0.00 ? 50  GLY A C    1  
ATOM 714   O O    . GLY A 1 50  ? 10.500  4.667   -1.692  1.00 0.00 ? 50  GLY A O    1  
ATOM 715   H H    . GLY A 1 50  ? 12.377  5.908   -1.531  1.00 0.00 ? 50  GLY A H    1  
ATOM 716   H HA2  . GLY A 1 50  ? 10.841  6.731   0.559   1.00 0.00 ? 50  GLY A HA2  1  
ATOM 717   H HA3  . GLY A 1 50  ? 10.223  7.665   -0.790  1.00 0.00 ? 50  GLY A HA3  1  
ATOM 718   N N    . TYR A 1 51  ? 8.693   5.510   -0.625  1.00 0.00 ? 51  TYR A N    1  
ATOM 719   C CA   . TYR A 1 51  ? 7.818   4.414   -1.006  1.00 0.00 ? 51  TYR A CA   1  
ATOM 720   C C    . TYR A 1 51  ? 6.449   4.934   -1.449  1.00 0.00 ? 51  TYR A C    1  
ATOM 721   O O    . TYR A 1 51  ? 5.857   5.781   -0.782  1.00 0.00 ? 51  TYR A O    1  
ATOM 722   C CB   . TYR A 1 51  ? 7.644   3.558   0.249   1.00 0.00 ? 51  TYR A CB   1  
ATOM 723   C CG   . TYR A 1 51  ? 8.890   2.758   0.636   1.00 0.00 ? 51  TYR A CG   1  
ATOM 724   C CD1  . TYR A 1 51  ? 9.237   1.632   -0.083  1.00 0.00 ? 51  TYR A CD1  1  
ATOM 725   C CD2  . TYR A 1 51  ? 9.666   3.163   1.702   1.00 0.00 ? 51  TYR A CD2  1  
ATOM 726   C CE1  . TYR A 1 51  ? 10.410  0.880   0.280   1.00 0.00 ? 51  TYR A CE1  1  
ATOM 727   C CE2  . TYR A 1 51  ? 10.839  2.410   2.066   1.00 0.00 ? 51  TYR A CE2  1  
ATOM 728   C CZ   . TYR A 1 51  ? 11.153  1.306   1.337   1.00 0.00 ? 51  TYR A CZ   1  
ATOM 729   O OH   . TYR A 1 51  ? 12.261  0.595   1.680   1.00 0.00 ? 51  TYR A OH   1  
ATOM 730   H H    . TYR A 1 51  ? 8.263   6.220   -0.068  1.00 0.00 ? 51  TYR A H    1  
ATOM 731   H HA   . TYR A 1 51  ? 8.284   3.885   -1.838  1.00 0.00 ? 51  TYR A HA   1  
ATOM 732   H HB2  . TYR A 1 51  ? 7.367   4.204   1.082   1.00 0.00 ? 51  TYR A HB2  1  
ATOM 733   H HB3  . TYR A 1 51  ? 6.815   2.867   0.093   1.00 0.00 ? 51  TYR A HB3  1  
ATOM 734   H HD1  . TYR A 1 51  ? 8.624   1.312   -0.925  1.00 0.00 ? 51  TYR A HD1  1  
ATOM 735   H HD2  . TYR A 1 51  ? 9.392   4.052   2.270   1.00 0.00 ? 51  TYR A HD2  1  
ATOM 736   H HE1  . TYR A 1 51  ? 10.696  -0.012  -0.278  1.00 0.00 ? 51  TYR A HE1  1  
ATOM 737   H HE2  . TYR A 1 51  ? 11.461  2.719   2.906   1.00 0.00 ? 51  TYR A HE2  1  
ATOM 738   H HH   . TYR A 1 51  ? 12.863  1.155   2.249   1.00 0.00 ? 51  TYR A HH   1  
ATOM 739   N N    . ARG A 1 52  ? 5.986   4.405   -2.572  1.00 0.00 ? 52  ARG A N    1  
ATOM 740   C CA   . ARG A 1 52  ? 4.697   4.804   -3.111  1.00 0.00 ? 52  ARG A CA   1  
ATOM 741   C C    . ARG A 1 52  ? 3.630   3.766   -2.761  1.00 0.00 ? 52  ARG A C    1  
ATOM 742   O O    . ARG A 1 52  ? 3.706   2.619   -3.201  1.00 0.00 ? 52  ARG A O    1  
ATOM 743   C CB   . ARG A 1 52  ? 4.763   4.966   -4.631  1.00 0.00 ? 52  ARG A CB   1  
ATOM 744   C CG   . ARG A 1 52  ? 3.360   5.073   -5.233  1.00 0.00 ? 52  ARG A CG   1  
ATOM 745   C CD   . ARG A 1 52  ? 3.260   6.267   -6.184  1.00 0.00 ? 52  ARG A CD   1  
ATOM 746   N NE   . ARG A 1 52  ? 3.085   5.792   -7.575  1.00 0.00 ? 52  ARG A NE   1  
ATOM 747   C CZ   . ARG A 1 52  ? 4.097   5.458   -8.388  1.00 0.00 ? 52  ARG A CZ   1  
ATOM 748   N NH1  . ARG A 1 52  ? 5.362   5.544   -7.954  1.00 0.00 ? 52  ARG A NH1  1  
ATOM 749   N NH2  . ARG A 1 52  ? 3.844   5.038   -9.635  1.00 0.00 ? 52  ARG A NH2  1  
ATOM 750   H H    . ARG A 1 52  ? 6.473   3.716   -3.109  1.00 0.00 ? 52  ARG A H    1  
ATOM 751   H HA   . ARG A 1 52  ? 4.482   5.763   -2.638  1.00 0.00 ? 52  ARG A HA   1  
ATOM 752   H HB2  . ARG A 1 52  ? 5.338   5.857   -4.881  1.00 0.00 ? 52  ARG A HB2  1  
ATOM 753   H HB3  . ARG A 1 52  ? 5.286   4.116   -5.069  1.00 0.00 ? 52  ARG A HB3  1  
ATOM 754   H HG2  . ARG A 1 52  ? 3.120   4.155   -5.769  1.00 0.00 ? 52  ARG A HG2  1  
ATOM 755   H HG3  . ARG A 1 52  ? 2.625   5.177   -4.434  1.00 0.00 ? 52  ARG A HG3  1  
ATOM 756   H HD2  . ARG A 1 52  ? 2.421   6.900   -5.899  1.00 0.00 ? 52  ARG A HD2  1  
ATOM 757   H HD3  . ARG A 1 52  ? 4.160   6.877   -6.110  1.00 0.00 ? 52  ARG A HD3  1  
ATOM 758   H HE   . ARG A 1 52  ? 2.154   5.716   -7.931  1.00 0.00 ? 52  ARG A HE   1  
ATOM 759   H HH11 . ARG A 1 52  ? 5.551   5.858   -7.023  1.00 0.00 ? 52  ARG A HH11 1  
ATOM 760   H HH12 . ARG A 1 52  ? 6.117   5.295   -8.560  1.00 0.00 ? 52  ARG A HH12 1  
ATOM 761   H HH21 . ARG A 1 52  ? 2.900   4.973   -9.959  1.00 0.00 ? 52  ARG A HH21 1  
ATOM 762   H HH22 . ARG A 1 52  ? 4.599   4.788   -10.241 1.00 0.00 ? 52  ARG A HH22 1  
ATOM 763   N N    . ILE A 1 53  ? 2.659   4.204   -1.974  1.00 0.00 ? 53  ILE A N    1  
ATOM 764   C CA   . ILE A 1 53  ? 1.577   3.327   -1.560  1.00 0.00 ? 53  ILE A CA   1  
ATOM 765   C C    . ILE A 1 53  ? 0.291   3.733   -2.284  1.00 0.00 ? 53  ILE A C    1  
ATOM 766   O O    . ILE A 1 53  ? 0.083   4.910   -2.572  1.00 0.00 ? 53  ILE A O    1  
ATOM 767   C CB   . ILE A 1 53  ? 1.448   3.318   -0.036  1.00 0.00 ? 53  ILE A CB   1  
ATOM 768   C CG1  . ILE A 1 53  ? 0.418   2.282   0.421   1.00 0.00 ? 53  ILE A CG1  1  
ATOM 769   C CG2  . ILE A 1 53  ? 1.129   4.717   0.496   1.00 0.00 ? 53  ILE A CG2  1  
ATOM 770   C CD1  . ILE A 1 53  ? 0.359   2.205   1.948   1.00 0.00 ? 53  ILE A CD1  1  
ATOM 771   H H    . ILE A 1 53  ? 2.604   5.138   -1.621  1.00 0.00 ? 53  ILE A H    1  
ATOM 772   H HA   . ILE A 1 53  ? 1.841   2.315   -1.867  1.00 0.00 ? 53  ILE A HA   1  
ATOM 773   H HB   . ILE A 1 53  ? 2.409   3.024   0.387   1.00 0.00 ? 53  ILE A HB   1  
ATOM 774   H HG12 . ILE A 1 53  ? -0.564  2.544   0.029   1.00 0.00 ? 53  ILE A HG12 1  
ATOM 775   H HG13 . ILE A 1 53  ? 0.675   1.305   0.014   1.00 0.00 ? 53  ILE A HG13 1  
ATOM 776   H HG21 . ILE A 1 53  ? 1.876   5.002   1.237   1.00 0.00 ? 53  ILE A HG21 1  
ATOM 777   H HG22 . ILE A 1 53  ? 1.144   5.430   -0.328  1.00 0.00 ? 53  ILE A HG22 1  
ATOM 778   H HG23 . ILE A 1 53  ? 0.142   4.714   0.957   1.00 0.00 ? 53  ILE A HG23 1  
ATOM 779   H HD11 . ILE A 1 53  ? 0.660   1.209   2.273   1.00 0.00 ? 53  ILE A HD11 1  
ATOM 780   H HD12 . ILE A 1 53  ? 1.034   2.946   2.376   1.00 0.00 ? 53  ILE A HD12 1  
ATOM 781   H HD13 . ILE A 1 53  ? -0.659  2.405   2.283   1.00 0.00 ? 53  ILE A HD13 1  
ATOM 782   N N    . SER A 1 54  ? -0.537  2.735   -2.556  1.00 0.00 ? 54  SER A N    1  
ATOM 783   C CA   . SER A 1 54  ? -1.796  2.974   -3.240  1.00 0.00 ? 54  SER A CA   1  
ATOM 784   C C    . SER A 1 54  ? -2.819  1.908   -2.842  1.00 0.00 ? 54  SER A C    1  
ATOM 785   O O    . SER A 1 54  ? -2.638  0.728   -3.139  1.00 0.00 ? 54  SER A O    1  
ATOM 786   C CB   . SER A 1 54  ? -1.605  2.985   -4.758  1.00 0.00 ? 54  SER A CB   1  
ATOM 787   O OG   . SER A 1 54  ? -0.241  3.174   -5.123  1.00 0.00 ? 54  SER A OG   1  
ATOM 788   H H    . SER A 1 54  ? -0.360  1.780   -2.318  1.00 0.00 ? 54  SER A H    1  
ATOM 789   H HA   . SER A 1 54  ? -2.123  3.960   -2.908  1.00 0.00 ? 54  SER A HA   1  
ATOM 790   H HB2  . SER A 1 54  ? -1.965  2.044   -5.176  1.00 0.00 ? 54  SER A HB2  1  
ATOM 791   H HB3  . SER A 1 54  ? -2.211  3.779   -5.194  1.00 0.00 ? 54  SER A HB3  1  
ATOM 792   H HG   . SER A 1 54  ? 0.200   2.289   -5.269  1.00 0.00 ? 54  SER A HG   1  
ATOM 793   N N    . TRP A 1 55  ? -3.870  2.361   -2.175  1.00 0.00 ? 55  TRP A N    1  
ATOM 794   C CA   . TRP A 1 55  ? -4.921  1.460   -1.732  1.00 0.00 ? 55  TRP A CA   1  
ATOM 795   C C    . TRP A 1 55  ? -6.111  1.621   -2.681  1.00 0.00 ? 55  TRP A C    1  
ATOM 796   O O    . TRP A 1 55  ? -6.352  2.709   -3.201  1.00 0.00 ? 55  TRP A O    1  
ATOM 797   C CB   . TRP A 1 55  ? -5.284  1.718   -0.269  1.00 0.00 ? 55  TRP A CB   1  
ATOM 798   C CG   . TRP A 1 55  ? -5.943  3.076   -0.021  1.00 0.00 ? 55  TRP A CG   1  
ATOM 799   C CD1  . TRP A 1 55  ? -7.172  3.474   -0.378  1.00 0.00 ? 55  TRP A CD1  1  
ATOM 800   C CD2  . TRP A 1 55  ? -5.356  4.206   0.658   1.00 0.00 ? 55  TRP A CD2  1  
ATOM 801   N NE1  . TRP A 1 55  ? -7.418  4.773   0.018   1.00 0.00 ? 55  TRP A NE1  1  
ATOM 802   C CE2  . TRP A 1 55  ? -6.279  5.232   0.669   1.00 0.00 ? 55  TRP A CE2  1  
ATOM 803   C CE3  . TRP A 1 55  ? -4.087  4.356   1.244   1.00 0.00 ? 55  TRP A CE3  1  
ATOM 804   C CZ2  . TRP A 1 55  ? -6.031  6.480   1.253   1.00 0.00 ? 55  TRP A CZ2  1  
ATOM 805   C CZ3  . TRP A 1 55  ? -3.854  5.610   1.823   1.00 0.00 ? 55  TRP A CZ3  1  
ATOM 806   C CH2  . TRP A 1 55  ? -4.773  6.653   1.842   1.00 0.00 ? 55  TRP A CH2  1  
ATOM 807   H H    . TRP A 1 55  ? -4.009  3.322   -1.937  1.00 0.00 ? 55  TRP A H    1  
ATOM 808   H HA   . TRP A 1 55  ? -4.534  0.443   -1.789  1.00 0.00 ? 55  TRP A HA   1  
ATOM 809   H HB2  . TRP A 1 55  ? -5.957  0.931   0.072   1.00 0.00 ? 55  TRP A HB2  1  
ATOM 810   H HB3  . TRP A 1 55  ? -4.380  1.649   0.337   1.00 0.00 ? 55  TRP A HB3  1  
ATOM 811   H HD1  . TRP A 1 55  ? -7.887  2.851   -0.916  1.00 0.00 ? 55  TRP A HD1  1  
ATOM 812   H HE1  . TRP A 1 55  ? -8.337  5.335   -0.148  1.00 0.00 ? 55  TRP A HE1  1  
ATOM 813   H HE3  . TRP A 1 55  ? -3.341  3.562   1.249   1.00 0.00 ? 55  TRP A HE3  1  
ATOM 814   H HZ2  . TRP A 1 55  ? -6.777  7.275   1.248   1.00 0.00 ? 55  TRP A HZ2  1  
ATOM 815   H HZ3  . TRP A 1 55  ? -2.885  5.780   2.292   1.00 0.00 ? 55  TRP A HZ3  1  
ATOM 816   H HH2  . TRP A 1 55  ? -4.515  7.601   2.314   1.00 0.00 ? 55  TRP A HH2  1  
ATOM 817   N N    . GLU A 1 56  ? -6.823  0.521   -2.876  1.00 0.00 ? 56  GLU A N    1  
ATOM 818   C CA   . GLU A 1 56  ? -7.982  0.526   -3.752  1.00 0.00 ? 56  GLU A CA   1  
ATOM 819   C C    . GLU A 1 56  ? -8.787  -0.763  -3.576  1.00 0.00 ? 56  GLU A C    1  
ATOM 820   O O    . GLU A 1 56  ? -8.229  -1.806  -3.238  1.00 0.00 ? 56  GLU A O    1  
ATOM 821   C CB   . GLU A 1 56  ? -7.565  0.717   -5.212  1.00 0.00 ? 56  GLU A CB   1  
ATOM 822   C CG   . GLU A 1 56  ? -6.987  -0.576  -5.791  1.00 0.00 ? 56  GLU A CG   1  
ATOM 823   C CD   . GLU A 1 56  ? -6.700  -0.427  -7.286  1.00 0.00 ? 56  GLU A CD   1  
ATOM 824   O OE1  . GLU A 1 56  ? -5.613  0.100   -7.606  1.00 0.00 ? 56  GLU A OE1  1  
ATOM 825   O OE2  . GLU A 1 56  ? -7.575  -0.844  -8.076  1.00 0.00 ? 56  GLU A OE2  1  
ATOM 826   H H    . GLU A 1 56  ? -6.620  -0.360  -2.449  1.00 0.00 ? 56  GLU A H    1  
ATOM 827   H HA   . GLU A 1 56  ? -8.580  1.381   -3.437  1.00 0.00 ? 56  GLU A HA   1  
ATOM 828   H HB2  . GLU A 1 56  ? -8.426  1.031   -5.802  1.00 0.00 ? 56  GLU A HB2  1  
ATOM 829   H HB3  . GLU A 1 56  ? -6.824  1.514   -5.281  1.00 0.00 ? 56  GLU A HB3  1  
ATOM 830   H HG2  . GLU A 1 56  ? -6.068  -0.835  -5.265  1.00 0.00 ? 56  GLU A HG2  1  
ATOM 831   H HG3  . GLU A 1 56  ? -7.688  -1.395  -5.631  1.00 0.00 ? 56  GLU A HG3  1  
ATOM 832   N N    . GLU A 1 57  ? -10.085 -0.650  -3.814  1.00 0.00 ? 57  GLU A N    1  
ATOM 833   C CA   . GLU A 1 57  ? -10.972 -1.794  -3.685  1.00 0.00 ? 57  GLU A CA   1  
ATOM 834   C C    . GLU A 1 57  ? -10.409 -2.991  -4.454  1.00 0.00 ? 57  GLU A C    1  
ATOM 835   O O    . GLU A 1 57  ? -9.342  -2.899  -5.058  1.00 0.00 ? 57  GLU A O    1  
ATOM 836   C CB   . GLU A 1 57  ? -12.384 -1.450  -4.164  1.00 0.00 ? 57  GLU A CB   1  
ATOM 837   C CG   . GLU A 1 57  ? -13.276 -1.039  -2.991  1.00 0.00 ? 57  GLU A CG   1  
ATOM 838   C CD   . GLU A 1 57  ? -14.667 -1.665  -3.115  1.00 0.00 ? 57  GLU A CD   1  
ATOM 839   O OE1  . GLU A 1 57  ? -14.726 -2.912  -3.155  1.00 0.00 ? 57  GLU A OE1  1  
ATOM 840   O OE2  . GLU A 1 57  ? -15.639 -0.881  -3.166  1.00 0.00 ? 57  GLU A OE2  1  
ATOM 841   H H    . GLU A 1 57  ? -10.531 0.202   -4.088  1.00 0.00 ? 57  GLU A H    1  
ATOM 842   H HA   . GLU A 1 57  ? -11.002 -2.019  -2.619  1.00 0.00 ? 57  GLU A HA   1  
ATOM 843   H HB2  . GLU A 1 57  ? -12.337 -0.639  -4.891  1.00 0.00 ? 57  GLU A HB2  1  
ATOM 844   H HB3  . GLU A 1 57  ? -12.819 -2.310  -4.673  1.00 0.00 ? 57  GLU A HB3  1  
ATOM 845   H HG2  . GLU A 1 57  ? -12.815 -1.350  -2.053  1.00 0.00 ? 57  GLU A HG2  1  
ATOM 846   H HG3  . GLU A 1 57  ? -13.363 0.047   -2.959  1.00 0.00 ? 57  GLU A HG3  1  
ATOM 847   N N    . TYR A 1 58  ? -11.152 -4.087  -4.406  1.00 0.00 ? 58  TYR A N    1  
ATOM 848   C CA   . TYR A 1 58  ? -10.740 -5.301  -5.091  1.00 0.00 ? 58  TYR A CA   1  
ATOM 849   C C    . TYR A 1 58  ? -10.499 -5.037  -6.578  1.00 0.00 ? 58  TYR A C    1  
ATOM 850   O O    . TYR A 1 58  ? -9.383  -5.200  -7.069  1.00 0.00 ? 58  TYR A O    1  
ATOM 851   C CB   . TYR A 1 58  ? -11.902 -6.284  -4.941  1.00 0.00 ? 58  TYR A CB   1  
ATOM 852   C CG   . TYR A 1 58  ? -11.850 -7.462  -5.916  1.00 0.00 ? 58  TYR A CG   1  
ATOM 853   C CD1  . TYR A 1 58  ? -10.753 -8.299  -5.928  1.00 0.00 ? 58  TYR A CD1  1  
ATOM 854   C CD2  . TYR A 1 58  ? -12.900 -7.688  -6.782  1.00 0.00 ? 58  TYR A CD2  1  
ATOM 855   C CE1  . TYR A 1 58  ? -10.704 -9.408  -6.846  1.00 0.00 ? 58  TYR A CE1  1  
ATOM 856   C CE2  . TYR A 1 58  ? -12.851 -8.797  -7.700  1.00 0.00 ? 58  TYR A CE2  1  
ATOM 857   C CZ   . TYR A 1 58  ? -11.755 -9.602  -7.686  1.00 0.00 ? 58  TYR A CZ   1  
ATOM 858   O OH   . TYR A 1 58  ? -11.708 -10.649 -8.553  1.00 0.00 ? 58  TYR A OH   1  
ATOM 859   H H    . TYR A 1 58  ? -12.019 -4.154  -3.912  1.00 0.00 ? 58  TYR A H    1  
ATOM 860   H HA   . TYR A 1 58  ? -9.811  -5.645  -4.635  1.00 0.00 ? 58  TYR A HA   1  
ATOM 861   H HB2  . TYR A 1 58  ? -11.910 -6.670  -3.921  1.00 0.00 ? 58  TYR A HB2  1  
ATOM 862   H HB3  . TYR A 1 58  ? -12.840 -5.748  -5.085  1.00 0.00 ? 58  TYR A HB3  1  
ATOM 863   H HD1  . TYR A 1 58  ? -9.924  -8.121  -5.244  1.00 0.00 ? 58  TYR A HD1  1  
ATOM 864   H HD2  . TYR A 1 58  ? -13.767 -7.027  -6.772  1.00 0.00 ? 58  TYR A HD2  1  
ATOM 865   H HE1  . TYR A 1 58  ? -9.843  -10.077 -6.866  1.00 0.00 ? 58  TYR A HE1  1  
ATOM 866   H HE2  . TYR A 1 58  ? -13.673 -8.986  -8.390  1.00 0.00 ? 58  TYR A HE2  1  
ATOM 867   H HH   . TYR A 1 58  ? -10.783 -11.028 -8.582  1.00 0.00 ? 58  TYR A HH   1  
ATOM 868   N N    . ASN A 1 59  ? -11.565 -4.633  -7.255  1.00 0.00 ? 59  ASN A N    1  
ATOM 869   C CA   . ASN A 1 59  ? -11.483 -4.344  -8.676  1.00 0.00 ? 59  ASN A CA   1  
ATOM 870   C C    . ASN A 1 59  ? -12.160 -3.002  -8.959  1.00 0.00 ? 59  ASN A C    1  
ATOM 871   O O    . ASN A 1 59  ? -13.046 -2.916  -9.809  1.00 0.00 ? 59  ASN A O    1  
ATOM 872   C CB   . ASN A 1 59  ? -12.200 -5.417  -9.498  1.00 0.00 ? 59  ASN A CB   1  
ATOM 873   C CG   . ASN A 1 59  ? -13.661 -5.556  -9.064  1.00 0.00 ? 59  ASN A CG   1  
ATOM 874   O OD1  . ASN A 1 59  ? -14.128 -4.900  -8.147  1.00 0.00 ? 59  ASN A OD1  1  
ATOM 875   N ND2  . ASN A 1 59  ? -14.354 -6.443  -9.772  1.00 0.00 ? 59  ASN A ND2  1  
ATOM 876   H H    . ASN A 1 59  ? -12.469 -4.502  -6.848  1.00 0.00 ? 59  ASN A H    1  
ATOM 877   H HA   . ASN A 1 59  ? -10.418 -4.331  -8.905  1.00 0.00 ? 59  ASN A HA   1  
ATOM 878   H HB2  . ASN A 1 59  ? -12.154 -5.162  -10.556 1.00 0.00 ? 59  ASN A HB2  1  
ATOM 879   H HB3  . ASN A 1 59  ? -11.690 -6.373  -9.379  1.00 0.00 ? 59  ASN A HB3  1  
ATOM 880   H HD21 . ASN A 1 59  ? -13.910 -6.948  -10.512 1.00 0.00 ? 59  ASN A HD21 1  
ATOM 881   H HD22 . ASN A 1 59  ? -15.318 -6.605  -9.564  1.00 0.00 ? 59  ASN A HD22 1  
ATOM 882   N N    . ARG A 1 60  ? -11.718 -1.987  -8.231  1.00 0.00 ? 60  ARG A N    1  
ATOM 883   C CA   . ARG A 1 60  ? -12.270 -0.653  -8.394  1.00 0.00 ? 60  ARG A CA   1  
ATOM 884   C C    . ARG A 1 60  ? -11.169 0.399   -8.244  1.00 0.00 ? 60  ARG A C    1  
ATOM 885   O O    . ARG A 1 60  ? -10.979 0.955   -7.164  1.00 0.00 ? 60  ARG A O    1  
ATOM 886   C CB   . ARG A 1 60  ? -13.368 -0.382  -7.363  1.00 0.00 ? 60  ARG A CB   1  
ATOM 887   C CG   . ARG A 1 60  ? -14.756 -0.578  -7.976  1.00 0.00 ? 60  ARG A CG   1  
ATOM 888   C CD   . ARG A 1 60  ? -15.851 -0.398  -6.923  1.00 0.00 ? 60  ARG A CD   1  
ATOM 889   N NE   . ARG A 1 60  ? -17.091 0.098   -7.561  1.00 0.00 ? 60  ARG A NE   1  
ATOM 890   C CZ   . ARG A 1 60  ? -17.987 -0.689  -8.172  1.00 0.00 ? 60  ARG A CZ   1  
ATOM 891   N NH1  . ARG A 1 60  ? -17.786 -2.012  -8.232  1.00 0.00 ? 60  ARG A NH1  1  
ATOM 892   N NH2  . ARG A 1 60  ? -19.084 -0.152  -8.724  1.00 0.00 ? 60  ARG A NH2  1  
ATOM 893   H H    . ARG A 1 60  ? -10.997 -2.065  -7.542  1.00 0.00 ? 60  ARG A H    1  
ATOM 894   H HA   . ARG A 1 60  ? -12.687 -0.644  -9.401  1.00 0.00 ? 60  ARG A HA   1  
ATOM 895   H HB2  . ARG A 1 60  ? -13.245 -1.050  -6.511  1.00 0.00 ? 60  ARG A HB2  1  
ATOM 896   H HB3  . ARG A 1 60  ? -13.274 0.636   -6.985  1.00 0.00 ? 60  ARG A HB3  1  
ATOM 897   H HG2  . ARG A 1 60  ? -14.904 0.136   -8.786  1.00 0.00 ? 60  ARG A HG2  1  
ATOM 898   H HG3  . ARG A 1 60  ? -14.827 -1.574  -8.413  1.00 0.00 ? 60  ARG A HG3  1  
ATOM 899   H HD2  . ARG A 1 60  ? -16.044 -1.346  -6.421  1.00 0.00 ? 60  ARG A HD2  1  
ATOM 900   H HD3  . ARG A 1 60  ? -15.520 0.305   -6.158  1.00 0.00 ? 60  ARG A HD3  1  
ATOM 901   H HE   . ARG A 1 60  ? -17.271 1.081   -7.535  1.00 0.00 ? 60  ARG A HE   1  
ATOM 902   H HH11 . ARG A 1 60  ? -16.968 -2.413  -7.820  1.00 0.00 ? 60  ARG A HH11 1  
ATOM 903   H HH12 . ARG A 1 60  ? -18.455 -2.600  -8.688  1.00 0.00 ? 60  ARG A HH12 1  
ATOM 904   H HH21 . ARG A 1 60  ? -19.233 0.836   -8.680  1.00 0.00 ? 60  ARG A HH21 1  
ATOM 905   H HH22 . ARG A 1 60  ? -19.752 -0.739  -9.180  1.00 0.00 ? 60  ARG A HH22 1  
ATOM 906   N N    . THR A 1 61  ? -10.472 0.640   -9.345  1.00 0.00 ? 61  THR A N    1  
ATOM 907   C CA   . THR A 1 61  ? -9.395  1.615   -9.350  1.00 0.00 ? 61  THR A CA   1  
ATOM 908   C C    . THR A 1 61  ? -9.940  3.014   -9.052  1.00 0.00 ? 61  THR A C    1  
ATOM 909   O O    . THR A 1 61  ? -9.249  3.839   -8.457  1.00 0.00 ? 61  THR A O    1  
ATOM 910   C CB   . THR A 1 61  ? -8.675  1.518   -10.697 1.00 0.00 ? 61  THR A CB   1  
ATOM 911   O OG1  . THR A 1 61  ? -8.018  0.254   -10.649 1.00 0.00 ? 61  THR A OG1  1  
ATOM 912   C CG2  . THR A 1 61  ? -7.532  2.527   -10.824 1.00 0.00 ? 61  THR A CG2  1  
ATOM 913   H H    . THR A 1 61  ? -10.633 0.184   -10.220 1.00 0.00 ? 61  THR A H    1  
ATOM 914   H HA   . THR A 1 61  ? -8.701  1.365   -8.548  1.00 0.00 ? 61  THR A HA   1  
ATOM 915   H HB   . THR A 1 61  ? -9.379  1.621   -11.522 1.00 0.00 ? 61  THR A HB   1  
ATOM 916   H HG1  . THR A 1 61  ? -7.486  0.177   -9.806  1.00 0.00 ? 61  THR A HG1  1  
ATOM 917   H HG21 . THR A 1 61  ? -6.935  2.517   -9.913  1.00 0.00 ? 61  THR A HG21 1  
ATOM 918   H HG22 . THR A 1 61  ? -6.904  2.259   -11.673 1.00 0.00 ? 61  THR A HG22 1  
ATOM 919   H HG23 . THR A 1 61  ? -7.944  3.525   -10.977 1.00 0.00 ? 61  THR A HG23 1  
ATOM 920   N N    . ASN A 1 62  ? -11.174 3.236   -9.478  1.00 0.00 ? 62  ASN A N    1  
ATOM 921   C CA   . ASN A 1 62  ? -11.820 4.520   -9.265  1.00 0.00 ? 62  ASN A CA   1  
ATOM 922   C C    . ASN A 1 62  ? -11.667 4.925   -7.797  1.00 0.00 ? 62  ASN A C    1  
ATOM 923   O O    . ASN A 1 62  ? -11.728 6.108   -7.466  1.00 0.00 ? 62  ASN A O    1  
ATOM 924   C CB   . ASN A 1 62  ? -13.315 4.444   -9.581  1.00 0.00 ? 62  ASN A CB   1  
ATOM 925   C CG   . ASN A 1 62  ? -13.901 5.841   -9.797  1.00 0.00 ? 62  ASN A CG   1  
ATOM 926   O OD1  . ASN A 1 62  ? -13.235 6.852   -9.648  1.00 0.00 ? 62  ASN A OD1  1  
ATOM 927   N ND2  . ASN A 1 62  ? -15.182 5.840   -10.156 1.00 0.00 ? 62  ASN A ND2  1  
ATOM 928   H H    . ASN A 1 62  ? -11.729 2.559   -9.961  1.00 0.00 ? 62  ASN A H    1  
ATOM 929   H HA   . ASN A 1 62  ? -11.317 5.210   -9.942  1.00 0.00 ? 62  ASN A HA   1  
ATOM 930   H HB2  . ASN A 1 62  ? -13.471 3.838   -10.473 1.00 0.00 ? 62  ASN A HB2  1  
ATOM 931   H HB3  . ASN A 1 62  ? -13.839 3.949   -8.763  1.00 0.00 ? 62  ASN A HB3  1  
ATOM 932   H HD21 . ASN A 1 62  ? -15.671 4.974   -10.261 1.00 0.00 ? 62  ASN A HD21 1  
ATOM 933   H HD22 . ASN A 1 62  ? -15.655 6.705   -10.321 1.00 0.00 ? 62  ASN A HD22 1  
ATOM 934   N N    . THR A 1 63  ? -11.472 3.920   -6.956  1.00 0.00 ? 63  THR A N    1  
ATOM 935   C CA   . THR A 1 63  ? -11.309 4.156   -5.532  1.00 0.00 ? 63  THR A CA   1  
ATOM 936   C C    . THR A 1 63  ? -9.846  3.977   -5.125  1.00 0.00 ? 63  THR A C    1  
ATOM 937   O O    . THR A 1 63  ? -9.556  3.501   -4.028  1.00 0.00 ? 63  THR A O    1  
ATOM 938   C CB   . THR A 1 63  ? -12.266 3.223   -4.786  1.00 0.00 ? 63  THR A CB   1  
ATOM 939   O OG1  . THR A 1 63  ? -11.756 1.919   -5.051  1.00 0.00 ? 63  THR A OG1  1  
ATOM 940   C CG2  . THR A 1 63  ? -13.667 3.208   -5.401  1.00 0.00 ? 63  THR A CG2  1  
ATOM 941   H H    . THR A 1 63  ? -11.423 2.960   -7.234  1.00 0.00 ? 63  THR A H    1  
ATOM 942   H HA   . THR A 1 63  ? -11.575 5.192   -5.323  1.00 0.00 ? 63  THR A HA   1  
ATOM 943   H HB   . THR A 1 63  ? -12.308 3.475   -3.727  1.00 0.00 ? 63  THR A HB   1  
ATOM 944   H HG1  . THR A 1 63  ? -12.134 1.265   -4.396  1.00 0.00 ? 63  THR A HG1  1  
ATOM 945   H HG21 . THR A 1 63  ? -14.375 3.654   -4.702  1.00 0.00 ? 63  THR A HG21 1  
ATOM 946   H HG22 . THR A 1 63  ? -13.663 3.780   -6.328  1.00 0.00 ? 63  THR A HG22 1  
ATOM 947   H HG23 . THR A 1 63  ? -13.961 2.179   -5.609  1.00 0.00 ? 63  THR A HG23 1  
ATOM 948   N N    . ARG A 1 64  ? -8.961  4.369   -6.030  1.00 0.00 ? 64  ARG A N    1  
ATOM 949   C CA   . ARG A 1 64  ? -7.534  4.258   -5.779  1.00 0.00 ? 64  ARG A CA   1  
ATOM 950   C C    . ARG A 1 64  ? -6.958  5.618   -5.381  1.00 0.00 ? 64  ARG A C    1  
ATOM 951   O O    . ARG A 1 64  ? -7.442  6.657   -5.829  1.00 0.00 ? 64  ARG A O    1  
ATOM 952   C CB   . ARG A 1 64  ? -6.796  3.741   -7.015  1.00 0.00 ? 64  ARG A CB   1  
ATOM 953   C CG   . ARG A 1 64  ? -5.429  3.167   -6.637  1.00 0.00 ? 64  ARG A CG   1  
ATOM 954   C CD   . ARG A 1 64  ? -4.341  3.671   -7.587  1.00 0.00 ? 64  ARG A CD   1  
ATOM 955   N NE   . ARG A 1 64  ? -3.381  2.583   -7.881  1.00 0.00 ? 64  ARG A NE   1  
ATOM 956   C CZ   . ARG A 1 64  ? -2.530  2.591   -8.916  1.00 0.00 ? 64  ARG A CZ   1  
ATOM 957   N NH1  . ARG A 1 64  ? -2.514  3.630   -9.762  1.00 0.00 ? 64  ARG A NH1  1  
ATOM 958   N NH2  . ARG A 1 64  ? -1.695  1.560   -9.105  1.00 0.00 ? 64  ARG A NH2  1  
ATOM 959   H H    . ARG A 1 64  ? -9.204  4.756   -6.919  1.00 0.00 ? 64  ARG A H    1  
ATOM 960   H HA   . ARG A 1 64  ? -7.450  3.542   -4.961  1.00 0.00 ? 64  ARG A HA   1  
ATOM 961   H HB2  . ARG A 1 64  ? -7.394  2.973   -7.505  1.00 0.00 ? 64  ARG A HB2  1  
ATOM 962   H HB3  . ARG A 1 64  ? -6.668  4.552   -7.732  1.00 0.00 ? 64  ARG A HB3  1  
ATOM 963   H HG2  . ARG A 1 64  ? -5.182  3.449   -5.614  1.00 0.00 ? 64  ARG A HG2  1  
ATOM 964   H HG3  . ARG A 1 64  ? -5.467  2.078   -6.667  1.00 0.00 ? 64  ARG A HG3  1  
ATOM 965   H HD2  . ARG A 1 64  ? -4.792  4.029   -8.513  1.00 0.00 ? 64  ARG A HD2  1  
ATOM 966   H HD3  . ARG A 1 64  ? -3.818  4.517   -7.140  1.00 0.00 ? 64  ARG A HD3  1  
ATOM 967   H HE   . ARG A 1 64  ? -3.367  1.793   -7.269  1.00 0.00 ? 64  ARG A HE   1  
ATOM 968   H HH11 . ARG A 1 64  ? -3.137  4.400   -9.621  1.00 0.00 ? 64  ARG A HH11 1  
ATOM 969   H HH12 . ARG A 1 64  ? -1.879  3.636   -10.535 1.00 0.00 ? 64  ARG A HH12 1  
ATOM 970   H HH21 . ARG A 1 64  ? -1.707  0.785   -8.474  1.00 0.00 ? 64  ARG A HH21 1  
ATOM 971   H HH22 . ARG A 1 64  ? -1.060  1.566   -9.877  1.00 0.00 ? 64  ARG A HH22 1  
ATOM 972   N N    . VAL A 1 65  ? -5.932  5.568   -4.543  1.00 0.00 ? 65  VAL A N    1  
ATOM 973   C CA   . VAL A 1 65  ? -5.285  6.784   -4.080  1.00 0.00 ? 65  VAL A CA   1  
ATOM 974   C C    . VAL A 1 65  ? -3.777  6.677   -4.319  1.00 0.00 ? 65  VAL A C    1  
ATOM 975   O O    . VAL A 1 65  ? -3.248  5.579   -4.486  1.00 0.00 ? 65  VAL A O    1  
ATOM 976   C CB   . VAL A 1 65  ? -5.641  7.040   -2.614  1.00 0.00 ? 65  VAL A CB   1  
ATOM 977   C CG1  . VAL A 1 65  ? -4.929  6.046   -1.695  1.00 0.00 ? 65  VAL A CG1  1  
ATOM 978   C CG2  . VAL A 1 65  ? -5.319  8.482   -2.216  1.00 0.00 ? 65  VAL A CG2  1  
ATOM 979   H H    . VAL A 1 65  ? -5.544  4.720   -4.184  1.00 0.00 ? 65  VAL A H    1  
ATOM 980   H HA   . VAL A 1 65  ? -5.676  7.611   -4.672  1.00 0.00 ? 65  VAL A HA   1  
ATOM 981   H HB   . VAL A 1 65  ? -6.715  6.893   -2.499  1.00 0.00 ? 65  VAL A HB   1  
ATOM 982   H HG11 . VAL A 1 65  ? -3.959  5.787   -2.121  1.00 0.00 ? 65  VAL A HG11 1  
ATOM 983   H HG12 . VAL A 1 65  ? -4.786  6.496   -0.713  1.00 0.00 ? 65  VAL A HG12 1  
ATOM 984   H HG13 . VAL A 1 65  ? -5.534  5.144   -1.596  1.00 0.00 ? 65  VAL A HG13 1  
ATOM 985   H HG21 . VAL A 1 65  ? -5.258  9.101   -3.111  1.00 0.00 ? 65  VAL A HG21 1  
ATOM 986   H HG22 . VAL A 1 65  ? -6.105  8.863   -1.564  1.00 0.00 ? 65  VAL A HG22 1  
ATOM 987   H HG23 . VAL A 1 65  ? -4.365  8.509   -1.689  1.00 0.00 ? 65  VAL A HG23 1  
ATOM 988   N N    . THR A 1 66  ? -3.128  7.832   -4.328  1.00 0.00 ? 66  THR A N    1  
ATOM 989   C CA   . THR A 1 66  ? -1.692  7.882   -4.544  1.00 0.00 ? 66  THR A CA   1  
ATOM 990   C C    . THR A 1 66  ? -1.013  8.682   -3.430  1.00 0.00 ? 66  THR A C    1  
ATOM 991   O O    . THR A 1 66  ? -1.102  9.908   -3.399  1.00 0.00 ? 66  THR A O    1  
ATOM 992   C CB   . THR A 1 66  ? -1.444  8.454   -5.941  1.00 0.00 ? 66  THR A CB   1  
ATOM 993   O OG1  . THR A 1 66  ? -2.081  7.525   -6.814  1.00 0.00 ? 66  THR A OG1  1  
ATOM 994   C CG2  . THR A 1 66  ? 0.031   8.394   -6.344  1.00 0.00 ? 66  THR A CG2  1  
ATOM 995   H H    . THR A 1 66  ? -3.566  8.720   -4.191  1.00 0.00 ? 66  THR A H    1  
ATOM 996   H HA   . THR A 1 66  ? -1.302  6.866   -4.491  1.00 0.00 ? 66  THR A HA   1  
ATOM 997   H HB   . THR A 1 66  ? -1.828  9.471   -6.019  1.00 0.00 ? 66  THR A HB   1  
ATOM 998   H HG1  . THR A 1 66  ? -1.606  6.645   -6.782  1.00 0.00 ? 66  THR A HG1  1  
ATOM 999   H HG21 . THR A 1 66  ? 0.359   9.381   -6.668  1.00 0.00 ? 66  THR A HG21 1  
ATOM 1000  H HG22 . THR A 1 66  ? 0.628   8.074   -5.490  1.00 0.00 ? 66  THR A HG22 1  
ATOM 1001  H HG23 . THR A 1 66  ? 0.155   7.683   -7.161  1.00 0.00 ? 66  THR A HG23 1  
ATOM 1002  N N    . HIS A 1 67  ? -0.350  7.955   -2.543  1.00 0.00 ? 67  HIS A N    1  
ATOM 1003  C CA   . HIS A 1 67  ? 0.344   8.581   -1.431  1.00 0.00 ? 67  HIS A CA   1  
ATOM 1004  C C    . HIS A 1 67  ? 1.850   8.355   -1.573  1.00 0.00 ? 67  HIS A C    1  
ATOM 1005  O O    . HIS A 1 67  ? 2.282   7.453   -2.289  1.00 0.00 ? 67  HIS A O    1  
ATOM 1006  C CB   . HIS A 1 67  ? -0.207  8.079   -0.094  1.00 0.00 ? 67  HIS A CB   1  
ATOM 1007  C CG   . HIS A 1 67  ? -1.295  8.949   0.487   1.00 0.00 ? 67  HIS A CG   1  
ATOM 1008  N ND1  . HIS A 1 67  ? -1.334  10.321  0.307   1.00 0.00 ? 67  HIS A ND1  1  
ATOM 1009  C CD2  . HIS A 1 67  ? -2.382  8.629   1.246   1.00 0.00 ? 67  HIS A CD2  1  
ATOM 1010  C CE1  . HIS A 1 67  ? -2.401  10.795  0.934   1.00 0.00 ? 67  HIS A CE1  1  
ATOM 1011  N NE2  . HIS A 1 67  ? -3.049  9.745   1.516   1.00 0.00 ? 67  HIS A NE2  1  
ATOM 1012  H H    . HIS A 1 67  ? -0.283  6.957   -2.575  1.00 0.00 ? 67  HIS A H    1  
ATOM 1013  H HA   . HIS A 1 67  ? 0.137   9.649   -1.495  1.00 0.00 ? 67  HIS A HA   1  
ATOM 1014  H HB2  . HIS A 1 67  ? -0.597  7.070   -0.230  1.00 0.00 ? 67  HIS A HB2  1  
ATOM 1015  H HB3  . HIS A 1 67  ? 0.612   8.011   0.622   1.00 0.00 ? 67  HIS A HB3  1  
ATOM 1016  H HD1  . HIS A 1 67  ? -0.671  10.862  -0.209  1.00 0.00 ? 67  HIS A HD1  1  
ATOM 1017  H HD2  . HIS A 1 67  ? -2.657  7.627   1.575   1.00 0.00 ? 67  HIS A HD2  1  
ATOM 1018  H HE1  . HIS A 1 67  ? -2.707  11.840  0.977   1.00 0.00 ? 67  HIS A HE1  1  
ATOM 1019  N N    . TYR A 1 68  ? 2.610   9.191   -0.880  1.00 0.00 ? 68  TYR A N    1  
ATOM 1020  C CA   . TYR A 1 68  ? 4.059   9.094   -0.920  1.00 0.00 ? 68  TYR A CA   1  
ATOM 1021  C C    . TYR A 1 68  ? 4.650   9.131   0.490   1.00 0.00 ? 68  TYR A C    1  
ATOM 1022  O O    . TYR A 1 68  ? 4.195   9.897   1.338   1.00 0.00 ? 68  TYR A O    1  
ATOM 1023  C CB   . TYR A 1 68  ? 4.542   10.322  -1.695  1.00 0.00 ? 68  TYR A CB   1  
ATOM 1024  C CG   . TYR A 1 68  ? 4.445   10.176  -3.215  1.00 0.00 ? 68  TYR A CG   1  
ATOM 1025  C CD1  . TYR A 1 68  ? 5.134   9.168   -3.857  1.00 0.00 ? 68  TYR A CD1  1  
ATOM 1026  C CD2  . TYR A 1 68  ? 3.668   11.054  -3.944  1.00 0.00 ? 68  TYR A CD2  1  
ATOM 1027  C CE1  . TYR A 1 68  ? 5.042   9.031   -5.288  1.00 0.00 ? 68  TYR A CE1  1  
ATOM 1028  C CE2  . TYR A 1 68  ? 3.576   10.917  -5.374  1.00 0.00 ? 68  TYR A CE2  1  
ATOM 1029  C CZ   . TYR A 1 68  ? 4.268   9.912   -5.976  1.00 0.00 ? 68  TYR A CZ   1  
ATOM 1030  O OH   . TYR A 1 68  ? 4.181   9.783   -7.327  1.00 0.00 ? 68  TYR A OH   1  
ATOM 1031  H H    . TYR A 1 68  ? 2.251   9.923   -0.300  1.00 0.00 ? 68  TYR A H    1  
ATOM 1032  H HA   . TYR A 1 68  ? 4.320   8.147   -1.391  1.00 0.00 ? 68  TYR A HA   1  
ATOM 1033  H HB2  . TYR A 1 68  ? 3.957   11.188  -1.385  1.00 0.00 ? 68  TYR A HB2  1  
ATOM 1034  H HB3  . TYR A 1 68  ? 5.579   10.524  -1.426  1.00 0.00 ? 68  TYR A HB3  1  
ATOM 1035  H HD1  . TYR A 1 68  ? 5.747   8.475   -3.282  1.00 0.00 ? 68  TYR A HD1  1  
ATOM 1036  H HD2  . TYR A 1 68  ? 3.124   11.851  -3.436  1.00 0.00 ? 68  TYR A HD2  1  
ATOM 1037  H HE1  . TYR A 1 68  ? 5.581   8.239   -5.808  1.00 0.00 ? 68  TYR A HE1  1  
ATOM 1038  H HE2  . TYR A 1 68  ? 2.966   11.603  -5.962  1.00 0.00 ? 68  TYR A HE2  1  
ATOM 1039  H HH   . TYR A 1 68  ? 4.378   10.659  -7.768  1.00 0.00 ? 68  TYR A HH   1  
ATOM 1040  N N    . LEU A 1 69  ? 5.656   8.294   0.698   1.00 0.00 ? 69  LEU A N    1  
ATOM 1041  C CA   . LEU A 1 69  ? 6.315   8.221   1.991   1.00 0.00 ? 69  LEU A CA   1  
ATOM 1042  C C    . LEU A 1 69  ? 7.831   8.208   1.786   1.00 0.00 ? 69  LEU A C    1  
ATOM 1043  O O    . LEU A 1 69  ? 8.312   7.882   0.702   1.00 0.00 ? 69  LEU A O    1  
ATOM 1044  C CB   . LEU A 1 69  ? 5.791   7.027   2.792   1.00 0.00 ? 69  LEU A CB   1  
ATOM 1045  C CG   . LEU A 1 69  ? 4.281   6.790   2.733   1.00 0.00 ? 69  LEU A CG   1  
ATOM 1046  C CD1  . LEU A 1 69  ? 3.937   5.348   3.113   1.00 0.00 ? 69  LEU A CD1  1  
ATOM 1047  C CD2  . LEU A 1 69  ? 3.532   7.805   3.598   1.00 0.00 ? 69  LEU A CD2  1  
ATOM 1048  H H    . LEU A 1 69  ? 6.021   7.675   0.002   1.00 0.00 ? 69  LEU A H    1  
ATOM 1049  H HA   . LEU A 1 69  ? 6.049   9.122   2.544   1.00 0.00 ? 69  LEU A HA   1  
ATOM 1050  H HB2  . LEU A 1 69  ? 6.295   6.128   2.437   1.00 0.00 ? 69  LEU A HB2  1  
ATOM 1051  H HB3  . LEU A 1 69  ? 6.078   7.162   3.835   1.00 0.00 ? 69  LEU A HB3  1  
ATOM 1052  H HG   . LEU A 1 69  ? 3.952   6.939   1.705   1.00 0.00 ? 69  LEU A HG   1  
ATOM 1053  H HD11 . LEU A 1 69  ? 2.962   5.324   3.599   1.00 0.00 ? 69  LEU A HD11 1  
ATOM 1054  H HD12 . LEU A 1 69  ? 3.911   4.732   2.215   1.00 0.00 ? 69  LEU A HD12 1  
ATOM 1055  H HD13 . LEU A 1 69  ? 4.694   4.963   3.797   1.00 0.00 ? 69  LEU A HD13 1  
ATOM 1056  H HD21 . LEU A 1 69  ? 3.777   8.815   3.268   1.00 0.00 ? 69  LEU A HD21 1  
ATOM 1057  H HD22 . LEU A 1 69  ? 2.459   7.642   3.503   1.00 0.00 ? 69  LEU A HD22 1  
ATOM 1058  H HD23 . LEU A 1 69  ? 3.827   7.682   4.641   1.00 0.00 ? 69  LEU A HD23 1  
ATOM 1059  N N    . PRO A 1 70  ? 8.561   8.574   2.874   1.00 0.00 ? 70  PRO A N    1  
ATOM 1060  C CA   . PRO A 1 70  ? 10.013  8.607   2.824   1.00 0.00 ? 70  PRO A CA   1  
ATOM 1061  C C    . PRO A 1 70  ? 10.595  7.193   2.867   1.00 0.00 ? 70  PRO A C    1  
ATOM 1062  O O    . PRO A 1 70  ? 9.854   6.215   2.955   1.00 0.00 ? 70  PRO A O    1  
ATOM 1063  C CB   . PRO A 1 70  ? 10.428  9.457   4.014   1.00 0.00 ? 70  PRO A CB   1  
ATOM 1064  C CG   . PRO A 1 70  ? 9.228   9.482   4.947   1.00 0.00 ? 70  PRO A CG   1  
ATOM 1065  C CD   . PRO A 1 70  ? 8.025   8.966   4.174   1.00 0.00 ? 70  PRO A CD   1  
ATOM 1066  H HA   . PRO A 1 70  ? 10.321  9.004   1.959   1.00 0.00 ? 70  PRO A HA   1  
ATOM 1067  H HB2  . PRO A 1 70  ? 11.301  9.034   4.511   1.00 0.00 ? 70  PRO A HB2  1  
ATOM 1068  H HB3  . PRO A 1 70  ? 10.698  10.465  3.699   1.00 0.00 ? 70  PRO A HB3  1  
ATOM 1069  H HG2  . PRO A 1 70  ? 9.414   8.860   5.824   1.00 0.00 ? 70  PRO A HG2  1  
ATOM 1070  H HG3  . PRO A 1 70  ? 9.045   10.494  5.307   1.00 0.00 ? 70  PRO A HG3  1  
ATOM 1071  H HD2  . PRO A 1 70  ? 7.561   8.121   4.682   1.00 0.00 ? 70  PRO A HD2  1  
ATOM 1072  H HD3  . PRO A 1 70  ? 7.261   9.736   4.072   1.00 0.00 ? 70  PRO A HD3  1  
ATOM 1073  N N    . ASN A 1 71  ? 11.917  7.130   2.803   1.00 0.00 ? 71  ASN A N    1  
ATOM 1074  C CA   . ASN A 1 71  ? 12.607  5.852   2.833   1.00 0.00 ? 71  ASN A CA   1  
ATOM 1075  C C    . ASN A 1 71  ? 12.852  5.444   4.287   1.00 0.00 ? 71  ASN A C    1  
ATOM 1076  O O    . ASN A 1 71  ? 13.708  4.604   4.565   1.00 0.00 ? 71  ASN A O    1  
ATOM 1077  C CB   . ASN A 1 71  ? 13.964  5.942   2.132   1.00 0.00 ? 71  ASN A CB   1  
ATOM 1078  C CG   . ASN A 1 71  ? 14.852  6.999   2.790   1.00 0.00 ? 71  ASN A CG   1  
ATOM 1079  O OD1  . ASN A 1 71  ? 14.389  8.010   3.293   1.00 0.00 ? 71  ASN A OD1  1  
ATOM 1080  N ND2  . ASN A 1 71  ? 16.150  6.711   2.759   1.00 0.00 ? 71  ASN A ND2  1  
ATOM 1081  H H    . ASN A 1 71  ? 12.512  7.930   2.731   1.00 0.00 ? 71  ASN A H    1  
ATOM 1082  H HA   . ASN A 1 71  ? 11.948  5.158   2.311   1.00 0.00 ? 71  ASN A HA   1  
ATOM 1083  H HB2  . ASN A 1 71  ? 14.461  4.972   2.167   1.00 0.00 ? 71  ASN A HB2  1  
ATOM 1084  H HB3  . ASN A 1 71  ? 13.818  6.187   1.080   1.00 0.00 ? 71  ASN A HB3  1  
ATOM 1085  H HD21 . ASN A 1 71  ? 16.464  5.864   2.331   1.00 0.00 ? 71  ASN A HD21 1  
ATOM 1086  H HD22 . ASN A 1 71  ? 16.812  7.342   3.164   1.00 0.00 ? 71  ASN A HD22 1  
ATOM 1087  N N    . VAL A 1 72  ? 12.086  6.057   5.178   1.00 0.00 ? 72  VAL A N    1  
ATOM 1088  C CA   . VAL A 1 72  ? 12.210  5.768   6.596   1.00 0.00 ? 72  VAL A CA   1  
ATOM 1089  C C    . VAL A 1 72  ? 10.933  5.081   7.085   1.00 0.00 ? 72  VAL A C    1  
ATOM 1090  O O    . VAL A 1 72  ? 10.964  4.322   8.053   1.00 0.00 ? 72  VAL A O    1  
ATOM 1091  C CB   . VAL A 1 72  ? 12.529  7.052   7.366   1.00 0.00 ? 72  VAL A CB   1  
ATOM 1092  C CG1  . VAL A 1 72  ? 13.714  7.788   6.736   1.00 0.00 ? 72  VAL A CG1  1  
ATOM 1093  C CG2  . VAL A 1 72  ? 11.302  7.960   7.451   1.00 0.00 ? 72  VAL A CG2  1  
ATOM 1094  H H    . VAL A 1 72  ? 11.393  6.739   4.944   1.00 0.00 ? 72  VAL A H    1  
ATOM 1095  H HA   . VAL A 1 72  ? 13.047  5.082   6.721   1.00 0.00 ? 72  VAL A HA   1  
ATOM 1096  H HB   . VAL A 1 72  ? 12.811  6.772   8.381   1.00 0.00 ? 72  VAL A HB   1  
ATOM 1097  H HG11 . VAL A 1 72  ? 14.619  7.193   6.861   1.00 0.00 ? 72  VAL A HG11 1  
ATOM 1098  H HG12 . VAL A 1 72  ? 13.523  7.940   5.673   1.00 0.00 ? 72  VAL A HG12 1  
ATOM 1099  H HG13 . VAL A 1 72  ? 13.843  8.753   7.224   1.00 0.00 ? 72  VAL A HG13 1  
ATOM 1100  H HG21 . VAL A 1 72  ? 11.547  8.942   7.045   1.00 0.00 ? 72  VAL A HG21 1  
ATOM 1101  H HG22 . VAL A 1 72  ? 10.485  7.523   6.876   1.00 0.00 ? 72  VAL A HG22 1  
ATOM 1102  H HG23 . VAL A 1 72  ? 10.998  8.063   8.493   1.00 0.00 ? 72  VAL A HG23 1  
ATOM 1103  N N    . THR A 1 73  ? 9.841   5.371   6.394   1.00 0.00 ? 73  THR A N    1  
ATOM 1104  C CA   . THR A 1 73  ? 8.556   4.790   6.746   1.00 0.00 ? 73  THR A CA   1  
ATOM 1105  C C    . THR A 1 73  ? 8.254   3.584   5.854   1.00 0.00 ? 73  THR A C    1  
ATOM 1106  O O    . THR A 1 73  ? 8.573   3.591   4.666   1.00 0.00 ? 73  THR A O    1  
ATOM 1107  C CB   . THR A 1 73  ? 7.499   5.892   6.656   1.00 0.00 ? 73  THR A CB   1  
ATOM 1108  O OG1  . THR A 1 73  ? 7.693   6.657   7.843   1.00 0.00 ? 73  THR A OG1  1  
ATOM 1109  C CG2  . THR A 1 73  ? 6.074   5.350   6.792   1.00 0.00 ? 73  THR A CG2  1  
ATOM 1110  H H    . THR A 1 73  ? 9.824   5.990   5.609   1.00 0.00 ? 73  THR A H    1  
ATOM 1111  H HA   . THR A 1 73  ? 8.614   4.424   7.771   1.00 0.00 ? 73  THR A HA   1  
ATOM 1112  H HB   . THR A 1 73  ? 7.611   6.466   5.736   1.00 0.00 ? 73  THR A HB   1  
ATOM 1113  H HG1  . THR A 1 73  ? 7.709   6.054   8.640   1.00 0.00 ? 73  THR A HG1  1  
ATOM 1114  H HG21 . THR A 1 73  ? 6.041   4.614   7.595   1.00 0.00 ? 73  THR A HG21 1  
ATOM 1115  H HG22 . THR A 1 73  ? 5.394   6.169   7.021   1.00 0.00 ? 73  THR A HG22 1  
ATOM 1116  H HG23 . THR A 1 73  ? 5.774   4.879   5.855   1.00 0.00 ? 73  THR A HG23 1  
ATOM 1117  N N    . LEU A 1 74  ? 7.643   2.578   6.462   1.00 0.00 ? 74  LEU A N    1  
ATOM 1118  C CA   . LEU A 1 74  ? 7.294   1.368   5.738   1.00 0.00 ? 74  LEU A CA   1  
ATOM 1119  C C    . LEU A 1 74  ? 5.867   0.954   6.102   1.00 0.00 ? 74  LEU A C    1  
ATOM 1120  O O    . LEU A 1 74  ? 5.423   -0.137  5.746   1.00 0.00 ? 74  LEU A O    1  
ATOM 1121  C CB   . LEU A 1 74  ? 8.334   0.274   5.990   1.00 0.00 ? 74  LEU A CB   1  
ATOM 1122  C CG   . LEU A 1 74  ? 9.784   0.745   6.122   1.00 0.00 ? 74  LEU A CG   1  
ATOM 1123  C CD1  . LEU A 1 74  ? 10.536  -0.083  7.166   1.00 0.00 ? 74  LEU A CD1  1  
ATOM 1124  C CD2  . LEU A 1 74  ? 10.490  0.736   4.765   1.00 0.00 ? 74  LEU A CD2  1  
ATOM 1125  H H    . LEU A 1 74  ? 7.387   2.581   7.429   1.00 0.00 ? 74  LEU A H    1  
ATOM 1126  H HA   . LEU A 1 74  ? 7.325   1.603   4.674   1.00 0.00 ? 74  LEU A HA   1  
ATOM 1127  H HB2  . LEU A 1 74  ? 8.061   -0.257  6.902   1.00 0.00 ? 74  LEU A HB2  1  
ATOM 1128  H HB3  . LEU A 1 74  ? 8.280   -0.446  5.173   1.00 0.00 ? 74  LEU A HB3  1  
ATOM 1129  H HG   . LEU A 1 74  ? 9.777   1.777   6.474   1.00 0.00 ? 74  LEU A HG   1  
ATOM 1130  H HD11 . LEU A 1 74  ? 10.580  -1.123  6.841   1.00 0.00 ? 74  LEU A HD11 1  
ATOM 1131  H HD12 . LEU A 1 74  ? 11.549  0.306   7.277   1.00 0.00 ? 74  LEU A HD12 1  
ATOM 1132  H HD13 . LEU A 1 74  ? 10.017  -0.022  8.122   1.00 0.00 ? 74  LEU A HD13 1  
ATOM 1133  H HD21 . LEU A 1 74  ? 11.358  0.078   4.812   1.00 0.00 ? 74  LEU A HD21 1  
ATOM 1134  H HD22 . LEU A 1 74  ? 9.802   0.376   4.000   1.00 0.00 ? 74  LEU A HD22 1  
ATOM 1135  H HD23 . LEU A 1 74  ? 10.813  1.747   4.517   1.00 0.00 ? 74  LEU A HD23 1  
ATOM 1136  N N    . GLU A 1 75  ? 5.187   1.847   6.807   1.00 0.00 ? 75  GLU A N    1  
ATOM 1137  C CA   . GLU A 1 75  ? 3.819   1.588   7.223   1.00 0.00 ? 75  GLU A CA   1  
ATOM 1138  C C    . GLU A 1 75  ? 2.983   2.866   7.121   1.00 0.00 ? 75  GLU A C    1  
ATOM 1139  O O    . GLU A 1 75  ? 3.508   3.969   7.267   1.00 0.00 ? 75  GLU A O    1  
ATOM 1140  C CB   . GLU A 1 75  ? 3.777   1.017   8.641   1.00 0.00 ? 75  GLU A CB   1  
ATOM 1141  C CG   . GLU A 1 75  ? 4.057   2.105   9.679   1.00 0.00 ? 75  GLU A CG   1  
ATOM 1142  C CD   . GLU A 1 75  ? 5.244   1.724   10.567  1.00 0.00 ? 75  GLU A CD   1  
ATOM 1143  O OE1  . GLU A 1 75  ? 6.387   1.919   10.101  1.00 0.00 ? 75  GLU A OE1  1  
ATOM 1144  O OE2  . GLU A 1 75  ? 4.981   1.245   11.691  1.00 0.00 ? 75  GLU A OE2  1  
ATOM 1145  H H    . GLU A 1 75  ? 5.556   2.732   7.092   1.00 0.00 ? 75  GLU A H    1  
ATOM 1146  H HA   . GLU A 1 75  ? 3.441   0.841   6.525   1.00 0.00 ? 75  GLU A HA   1  
ATOM 1147  H HB2  . GLU A 1 75  ? 2.799   0.574   8.829   1.00 0.00 ? 75  GLU A HB2  1  
ATOM 1148  H HB3  . GLU A 1 75  ? 4.512   0.219   8.738   1.00 0.00 ? 75  GLU A HB3  1  
ATOM 1149  H HG2  . GLU A 1 75  ? 4.264   3.049   9.175   1.00 0.00 ? 75  GLU A HG2  1  
ATOM 1150  H HG3  . GLU A 1 75  ? 3.172   2.261   10.297  1.00 0.00 ? 75  GLU A HG3  1  
ATOM 1151  N N    . TYR A 1 76  ? 1.696   2.674   6.870   1.00 0.00 ? 76  TYR A N    1  
ATOM 1152  C CA   . TYR A 1 76  ? 0.782   3.797   6.746   1.00 0.00 ? 76  TYR A CA   1  
ATOM 1153  C C    . TYR A 1 76  ? -0.661  3.359   7.003   1.00 0.00 ? 76  TYR A C    1  
ATOM 1154  O O    . TYR A 1 76  ? -1.059  2.261   6.618   1.00 0.00 ? 76  TYR A O    1  
ATOM 1155  C CB   . TYR A 1 76  ? 0.906   4.283   5.301   1.00 0.00 ? 76  TYR A CB   1  
ATOM 1156  C CG   . TYR A 1 76  ? 0.025   5.491   4.974   1.00 0.00 ? 76  TYR A CG   1  
ATOM 1157  C CD1  . TYR A 1 76  ? -1.317  5.314   4.705   1.00 0.00 ? 76  TYR A CD1  1  
ATOM 1158  C CD2  . TYR A 1 76  ? 0.573   6.758   4.948   1.00 0.00 ? 76  TYR A CD2  1  
ATOM 1159  C CE1  . TYR A 1 76  ? -2.146  6.451   4.398   1.00 0.00 ? 76  TYR A CE1  1  
ATOM 1160  C CE2  . TYR A 1 76  ? -0.256  7.894   4.641   1.00 0.00 ? 76  TYR A CE2  1  
ATOM 1161  C CZ   . TYR A 1 76  ? -1.574  7.685   4.380   1.00 0.00 ? 76  TYR A CZ   1  
ATOM 1162  O OH   . TYR A 1 76  ? -2.357  8.758   4.090   1.00 0.00 ? 76  TYR A OH   1  
ATOM 1163  H H    . TYR A 1 76  ? 1.278   1.773   6.752   1.00 0.00 ? 76  TYR A H    1  
ATOM 1164  H HA   . TYR A 1 76  ? 1.065   4.544   7.488   1.00 0.00 ? 76  TYR A HA   1  
ATOM 1165  H HB2  . TYR A 1 76  ? 1.946   4.541   5.103   1.00 0.00 ? 76  TYR A HB2  1  
ATOM 1166  H HB3  . TYR A 1 76  ? 0.646   3.465   4.629   1.00 0.00 ? 76  TYR A HB3  1  
ATOM 1167  H HD1  . TYR A 1 76  ? -1.749  4.314   4.726   1.00 0.00 ? 76  TYR A HD1  1  
ATOM 1168  H HD2  . TYR A 1 76  ? 1.633   6.898   5.161   1.00 0.00 ? 76  TYR A HD2  1  
ATOM 1169  H HE1  . TYR A 1 76  ? -3.207  6.325   4.183   1.00 0.00 ? 76  TYR A HE1  1  
ATOM 1170  H HE2  . TYR A 1 76  ? 0.164   8.900   4.617   1.00 0.00 ? 76  TYR A HE2  1  
ATOM 1171  H HH   . TYR A 1 76  ? -1.965  9.586   4.492   1.00 0.00 ? 76  TYR A HH   1  
ATOM 1172  N N    . ARG A 1 77  ? -1.406  4.242   7.653   1.00 0.00 ? 77  ARG A N    1  
ATOM 1173  C CA   . ARG A 1 77  ? -2.797  3.961   7.966   1.00 0.00 ? 77  ARG A CA   1  
ATOM 1174  C C    . ARG A 1 77  ? -3.700  4.400   6.812   1.00 0.00 ? 77  ARG A C    1  
ATOM 1175  O O    . ARG A 1 77  ? -3.617  5.538   6.353   1.00 0.00 ? 77  ARG A O    1  
ATOM 1176  C CB   . ARG A 1 77  ? -3.230  4.680   9.245   1.00 0.00 ? 77  ARG A CB   1  
ATOM 1177  C CG   . ARG A 1 77  ? -4.697  4.390   9.568   1.00 0.00 ? 77  ARG A CG   1  
ATOM 1178  C CD   . ARG A 1 77  ? -4.885  4.111   11.060  1.00 0.00 ? 77  ARG A CD   1  
ATOM 1179  N NE   . ARG A 1 77  ? -4.419  5.269   11.855  1.00 0.00 ? 77  ARG A NE   1  
ATOM 1180  C CZ   . ARG A 1 77  ? -3.218  5.341   12.445  1.00 0.00 ? 77  ARG A CZ   1  
ATOM 1181  N NH1  . ARG A 1 77  ? -2.355  4.322   12.334  1.00 0.00 ? 77  ARG A NH1  1  
ATOM 1182  N NH2  . ARG A 1 77  ? -2.881  6.431   13.147  1.00 0.00 ? 77  ARG A NH2  1  
ATOM 1183  H H    . ARG A 1 77  ? -1.075  5.133   7.963   1.00 0.00 ? 77  ARG A H    1  
ATOM 1184  H HA   . ARG A 1 77  ? -2.838  2.881   8.108   1.00 0.00 ? 77  ARG A HA   1  
ATOM 1185  H HB2  . ARG A 1 77  ? -2.601  4.361   10.077  1.00 0.00 ? 77  ARG A HB2  1  
ATOM 1186  H HB3  . ARG A 1 77  ? -3.084  5.754   9.130   1.00 0.00 ? 77  ARG A HB3  1  
ATOM 1187  H HG2  . ARG A 1 77  ? -5.313  5.240   9.272   1.00 0.00 ? 77  ARG A HG2  1  
ATOM 1188  H HG3  . ARG A 1 77  ? -5.038  3.533   8.988   1.00 0.00 ? 77  ARG A HG3  1  
ATOM 1189  H HD2  . ARG A 1 77  ? -5.936  3.913   11.272  1.00 0.00 ? 77  ARG A HD2  1  
ATOM 1190  H HD3  . ARG A 1 77  ? -4.330  3.217   11.344  1.00 0.00 ? 77  ARG A HD3  1  
ATOM 1191  H HE   . ARG A 1 77  ? -5.039  6.047   11.958  1.00 0.00 ? 77  ARG A HE   1  
ATOM 1192  H HH11 . ARG A 1 77  ? -2.607  3.508   11.810  1.00 0.00 ? 77  ARG A HH11 1  
ATOM 1193  H HH12 . ARG A 1 77  ? -1.459  4.375   12.774  1.00 0.00 ? 77  ARG A HH12 1  
ATOM 1194  H HH21 . ARG A 1 77  ? -3.525  7.192   13.230  1.00 0.00 ? 77  ARG A HH21 1  
ATOM 1195  H HH22 . ARG A 1 77  ? -1.985  6.485   13.587  1.00 0.00 ? 77  ARG A HH22 1  
ATOM 1196  N N    . VAL A 1 78  ? -4.541  3.474   6.376   1.00 0.00 ? 78  VAL A N    1  
ATOM 1197  C CA   . VAL A 1 78  ? -5.459  3.751   5.284   1.00 0.00 ? 78  VAL A CA   1  
ATOM 1198  C C    . VAL A 1 78  ? -6.832  4.110   5.856   1.00 0.00 ? 78  VAL A C    1  
ATOM 1199  O O    . VAL A 1 78  ? -7.206  3.633   6.926   1.00 0.00 ? 78  VAL A O    1  
ATOM 1200  C CB   . VAL A 1 78  ? -5.504  2.561   4.323   1.00 0.00 ? 78  VAL A CB   1  
ATOM 1201  C CG1  . VAL A 1 78  ? -6.484  2.818   3.177   1.00 0.00 ? 78  VAL A CG1  1  
ATOM 1202  C CG2  . VAL A 1 78  ? -4.108  2.234   3.789   1.00 0.00 ? 78  VAL A CG2  1  
ATOM 1203  H H    . VAL A 1 78  ? -4.602  2.550   6.755   1.00 0.00 ? 78  VAL A H    1  
ATOM 1204  H HA   . VAL A 1 78  ? -5.070  4.610   4.738   1.00 0.00 ? 78  VAL A HA   1  
ATOM 1205  H HB   . VAL A 1 78  ? -5.860  1.694   4.881   1.00 0.00 ? 78  VAL A HB   1  
ATOM 1206  H HG11 . VAL A 1 78  ? -6.115  2.340   2.270   1.00 0.00 ? 78  VAL A HG11 1  
ATOM 1207  H HG12 . VAL A 1 78  ? -7.460  2.405   3.434   1.00 0.00 ? 78  VAL A HG12 1  
ATOM 1208  H HG13 . VAL A 1 78  ? -6.576  3.891   3.011   1.00 0.00 ? 78  VAL A HG13 1  
ATOM 1209  H HG21 . VAL A 1 78  ? -3.489  1.851   4.600   1.00 0.00 ? 78  VAL A HG21 1  
ATOM 1210  H HG22 . VAL A 1 78  ? -4.187  1.481   3.004   1.00 0.00 ? 78  VAL A HG22 1  
ATOM 1211  H HG23 . VAL A 1 78  ? -3.655  3.138   3.381   1.00 0.00 ? 78  VAL A HG23 1  
ATOM 1212  N N    . THR A 1 79  ? -7.544  4.948   5.117   1.00 0.00 ? 79  THR A N    1  
ATOM 1213  C CA   . THR A 1 79  ? -8.868  5.376   5.537   1.00 0.00 ? 79  THR A CA   1  
ATOM 1214  C C    . THR A 1 79  ? -9.722  5.738   4.320   1.00 0.00 ? 79  THR A C    1  
ATOM 1215  O O    . THR A 1 79  ? -9.200  6.192   3.303   1.00 0.00 ? 79  THR A O    1  
ATOM 1216  C CB   . THR A 1 79  ? -8.699  6.531   6.526   1.00 0.00 ? 79  THR A CB   1  
ATOM 1217  O OG1  . THR A 1 79  ? -8.013  7.532   5.778   1.00 0.00 ? 79  THR A OG1  1  
ATOM 1218  C CG2  . THR A 1 79  ? -7.734  6.191   7.664   1.00 0.00 ? 79  THR A CG2  1  
ATOM 1219  H H    . THR A 1 79  ? -7.232  5.331   4.247   1.00 0.00 ? 79  THR A H    1  
ATOM 1220  H HA   . THR A 1 79  ? -9.358  4.540   6.034   1.00 0.00 ? 79  THR A HA   1  
ATOM 1221  H HB   . THR A 1 79  ? -9.664  6.853   6.917   1.00 0.00 ? 79  THR A HB   1  
ATOM 1222  H HG1  . THR A 1 79  ? -7.231  7.128   5.304   1.00 0.00 ? 79  THR A HG1  1  
ATOM 1223  H HG21 . THR A 1 79  ? -6.736  6.028   7.258   1.00 0.00 ? 79  THR A HG21 1  
ATOM 1224  H HG22 . THR A 1 79  ? -7.707  7.016   8.376   1.00 0.00 ? 79  THR A HG22 1  
ATOM 1225  H HG23 . THR A 1 79  ? -8.073  5.286   8.169   1.00 0.00 ? 79  THR A HG23 1  
ATOM 1226  N N    . GLY A 1 80  ? -11.022 5.524   4.466   1.00 0.00 ? 80  GLY A N    1  
ATOM 1227  C CA   . GLY A 1 80  ? -11.954 5.822   3.391   1.00 0.00 ? 80  GLY A CA   1  
ATOM 1228  C C    . GLY A 1 80  ? -12.308 4.558   2.606   1.00 0.00 ? 80  GLY A C    1  
ATOM 1229  O O    . GLY A 1 80  ? -12.629 4.629   1.421   1.00 0.00 ? 80  GLY A O    1  
ATOM 1230  H H    . GLY A 1 80  ? -11.438 5.155   5.296   1.00 0.00 ? 80  GLY A H    1  
ATOM 1231  H HA2  . GLY A 1 80  ? -12.860 6.265   3.804   1.00 0.00 ? 80  GLY A HA2  1  
ATOM 1232  H HA3  . GLY A 1 80  ? -11.516 6.561   2.720   1.00 0.00 ? 80  GLY A HA3  1  
ATOM 1233  N N    . LEU A 1 81  ? -12.238 3.431   3.299   1.00 0.00 ? 81  LEU A N    1  
ATOM 1234  C CA   . LEU A 1 81  ? -12.547 2.152   2.682   1.00 0.00 ? 81  LEU A CA   1  
ATOM 1235  C C    . LEU A 1 81  ? -14.021 1.819   2.920   1.00 0.00 ? 81  LEU A C    1  
ATOM 1236  O O    . LEU A 1 81  ? -14.829 2.711   3.176   1.00 0.00 ? 81  LEU A O    1  
ATOM 1237  C CB   . LEU A 1 81  ? -11.585 1.071   3.177   1.00 0.00 ? 81  LEU A CB   1  
ATOM 1238  C CG   . LEU A 1 81  ? -10.142 1.519   3.423   1.00 0.00 ? 81  LEU A CG   1  
ATOM 1239  C CD1  . LEU A 1 81  ? -9.457  0.619   4.453   1.00 0.00 ? 81  LEU A CD1  1  
ATOM 1240  C CD2  . LEU A 1 81  ? -9.358  1.590   2.111   1.00 0.00 ? 81  LEU A CD2  1  
ATOM 1241  H H    . LEU A 1 81  ? -11.976 3.382   4.263   1.00 0.00 ? 81  LEU A H    1  
ATOM 1242  H HA   . LEU A 1 81  ? -12.387 2.260   1.609   1.00 0.00 ? 81  LEU A HA   1  
ATOM 1243  H HB2  . LEU A 1 81  ? -11.980 0.658   4.105   1.00 0.00 ? 81  LEU A HB2  1  
ATOM 1244  H HB3  . LEU A 1 81  ? -11.573 0.262   2.447   1.00 0.00 ? 81  LEU A HB3  1  
ATOM 1245  H HG   . LEU A 1 81  ? -10.164 2.526   3.840   1.00 0.00 ? 81  LEU A HG   1  
ATOM 1246  H HD11 . LEU A 1 81  ? -8.643  0.074   3.975   1.00 0.00 ? 81  LEU A HD11 1  
ATOM 1247  H HD12 . LEU A 1 81  ? -9.059  1.230   5.263   1.00 0.00 ? 81  LEU A HD12 1  
ATOM 1248  H HD13 . LEU A 1 81  ? -10.181 -0.090  4.855   1.00 0.00 ? 81  LEU A HD13 1  
ATOM 1249  H HD21 . LEU A 1 81  ? -8.954  2.594   1.984   1.00 0.00 ? 81  LEU A HD21 1  
ATOM 1250  H HD22 . LEU A 1 81  ? -8.541  0.869   2.138   1.00 0.00 ? 81  LEU A HD22 1  
ATOM 1251  H HD23 . LEU A 1 81  ? -10.022 1.356   1.279   1.00 0.00 ? 81  LEU A HD23 1  
ATOM 1252  N N    . THR A 1 82  ? -14.327 0.533   2.828   1.00 0.00 ? 82  THR A N    1  
ATOM 1253  C CA   . THR A 1 82  ? -15.689 0.071   3.030   1.00 0.00 ? 82  THR A CA   1  
ATOM 1254  C C    . THR A 1 82  ? -15.708 -1.142  3.962   1.00 0.00 ? 82  THR A C    1  
ATOM 1255  O O    . THR A 1 82  ? -14.802 -1.973  3.924   1.00 0.00 ? 82  THR A O    1  
ATOM 1256  C CB   . THR A 1 82  ? -16.303 -0.207  1.657   1.00 0.00 ? 82  THR A CB   1  
ATOM 1257  O OG1  . THR A 1 82  ? -16.246 1.050   0.989   1.00 0.00 ? 82  THR A OG1  1  
ATOM 1258  C CG2  . THR A 1 82  ? -17.799 -0.519  1.736   1.00 0.00 ? 82  THR A CG2  1  
ATOM 1259  H H    . THR A 1 82  ? -13.664 -0.185  2.619   1.00 0.00 ? 82  THR A H    1  
ATOM 1260  H HA   . THR A 1 82  ? -16.251 0.863   3.526   1.00 0.00 ? 82  THR A HA   1  
ATOM 1261  H HB   . THR A 1 82  ? -15.766 -1.006  1.145   1.00 0.00 ? 82  THR A HB   1  
ATOM 1262  H HG1  . THR A 1 82  ? -15.298 1.362   0.928   1.00 0.00 ? 82  THR A HG1  1  
ATOM 1263  H HG21 . THR A 1 82  ? -17.997 -1.128  2.619   1.00 0.00 ? 82  THR A HG21 1  
ATOM 1264  H HG22 . THR A 1 82  ? -18.361 0.413   1.804   1.00 0.00 ? 82  THR A HG22 1  
ATOM 1265  H HG23 . THR A 1 82  ? -18.105 -1.063  0.843   1.00 0.00 ? 82  THR A HG23 1  
ATOM 1266  N N    . ALA A 1 83  ? -16.751 -1.206  4.777   1.00 0.00 ? 83  ALA A N    1  
ATOM 1267  C CA   . ALA A 1 83  ? -16.900 -2.305  5.717   1.00 0.00 ? 83  ALA A CA   1  
ATOM 1268  C C    . ALA A 1 83  ? -17.195 -3.593  4.946   1.00 0.00 ? 83  ALA A C    1  
ATOM 1269  O O    . ALA A 1 83  ? -17.915 -3.573  3.949   1.00 0.00 ? 83  ALA A O    1  
ATOM 1270  C CB   . ALA A 1 83  ? -17.996 -1.966  6.729   1.00 0.00 ? 83  ALA A CB   1  
ATOM 1271  H H    . ALA A 1 83  ? -17.484 -0.527  4.802   1.00 0.00 ? 83  ALA A H    1  
ATOM 1272  H HA   . ALA A 1 83  ? -15.955 -2.417  6.248   1.00 0.00 ? 83  ALA A HA   1  
ATOM 1273  H HB1  . ALA A 1 83  ? -18.907 -2.507  6.472   1.00 0.00 ? 83  ALA A HB1  1  
ATOM 1274  H HB2  . ALA A 1 83  ? -17.670 -2.255  7.728   1.00 0.00 ? 83  ALA A HB2  1  
ATOM 1275  H HB3  . ALA A 1 83  ? -18.192 -0.894  6.707   1.00 0.00 ? 83  ALA A HB3  1  
ATOM 1276  N N    . LEU A 1 84  ? -16.625 -4.683  5.438   1.00 0.00 ? 84  LEU A N    1  
ATOM 1277  C CA   . LEU A 1 84  ? -16.818 -5.978  4.808   1.00 0.00 ? 84  LEU A CA   1  
ATOM 1278  C C    . LEU A 1 84  ? -16.694 -5.826  3.291   1.00 0.00 ? 84  LEU A C    1  
ATOM 1279  O O    . LEU A 1 84  ? -17.625 -6.144  2.553   1.00 0.00 ? 84  LEU A O    1  
ATOM 1280  C CB   . LEU A 1 84  ? -18.142 -6.600  5.257   1.00 0.00 ? 84  LEU A CB   1  
ATOM 1281  C CG   . LEU A 1 84  ? -18.329 -6.761  6.767   1.00 0.00 ? 84  LEU A CG   1  
ATOM 1282  C CD1  . LEU A 1 84  ? -19.432 -7.774  7.078   1.00 0.00 ? 84  LEU A CD1  1  
ATOM 1283  C CD2  . LEU A 1 84  ? -17.008 -7.126  7.448   1.00 0.00 ? 84  LEU A CD2  1  
ATOM 1284  H H    . LEU A 1 84  ? -16.041 -4.691  6.249   1.00 0.00 ? 84  LEU A H    1  
ATOM 1285  H HA   . LEU A 1 84  ? -16.020 -6.633  5.156   1.00 0.00 ? 84  LEU A HA   1  
ATOM 1286  H HB2  . LEU A 1 84  ? -18.957 -5.987  4.874   1.00 0.00 ? 84  LEU A HB2  1  
ATOM 1287  H HB3  . LEU A 1 84  ? -18.236 -7.581  4.793   1.00 0.00 ? 84  LEU A HB3  1  
ATOM 1288  H HG   . LEU A 1 84  ? -18.648 -5.802  7.176   1.00 0.00 ? 84  LEU A HG   1  
ATOM 1289  H HD11 . LEU A 1 84  ? -20.280 -7.604  6.414   1.00 0.00 ? 84  LEU A HD11 1  
ATOM 1290  H HD12 . LEU A 1 84  ? -19.051 -8.785  6.928   1.00 0.00 ? 84  LEU A HD12 1  
ATOM 1291  H HD13 . LEU A 1 84  ? -19.753 -7.657  8.113   1.00 0.00 ? 84  LEU A HD13 1  
ATOM 1292  H HD21 . LEU A 1 84  ? -16.574 -7.996  6.956   1.00 0.00 ? 84  LEU A HD21 1  
ATOM 1293  H HD22 . LEU A 1 84  ? -16.318 -6.285  7.374   1.00 0.00 ? 84  LEU A HD22 1  
ATOM 1294  H HD23 . LEU A 1 84  ? -17.191 -7.355  8.497   1.00 0.00 ? 84  LEU A HD23 1  
ATOM 1295  N N    . THR A 1 85  ? -15.535 -5.340  2.870   1.00 0.00 ? 85  THR A N    1  
ATOM 1296  C CA   . THR A 1 85  ? -15.277 -5.142  1.454   1.00 0.00 ? 85  THR A CA   1  
ATOM 1297  C C    . THR A 1 85  ? -13.833 -5.519  1.117   1.00 0.00 ? 85  THR A C    1  
ATOM 1298  O O    . THR A 1 85  ? -12.921 -5.263  1.903   1.00 0.00 ? 85  THR A O    1  
ATOM 1299  C CB   . THR A 1 85  ? -15.623 -3.692  1.108   1.00 0.00 ? 85  THR A CB   1  
ATOM 1300  O OG1  . THR A 1 85  ? -17.038 -3.702  0.946   1.00 0.00 ? 85  THR A OG1  1  
ATOM 1301  C CG2  . THR A 1 85  ? -15.093 -3.275  -0.265  1.00 0.00 ? 85  THR A CG2  1  
ATOM 1302  H H    . THR A 1 85  ? -14.783 -5.084  3.477   1.00 0.00 ? 85  THR A H    1  
ATOM 1303  H HA   . THR A 1 85  ? -15.923 -5.815  0.889   1.00 0.00 ? 85  THR A HA   1  
ATOM 1304  H HB   . THR A 1 85  ? -15.270 -3.013  1.884   1.00 0.00 ? 85  THR A HB   1  
ATOM 1305  H HG1  . THR A 1 85  ? -17.460 -4.265  1.657   1.00 0.00 ? 85  THR A HG1  1  
ATOM 1306  H HG21 . THR A 1 85  ? -14.750 -2.241  -0.224  1.00 0.00 ? 85  THR A HG21 1  
ATOM 1307  H HG22 . THR A 1 85  ? -14.262 -3.923  -0.546  1.00 0.00 ? 85  THR A HG22 1  
ATOM 1308  H HG23 . THR A 1 85  ? -15.889 -3.365  -1.004  1.00 0.00 ? 85  THR A HG23 1  
ATOM 1309  N N    . THR A 1 86  ? -13.669 -6.122  -0.051  1.00 0.00 ? 86  THR A N    1  
ATOM 1310  C CA   . THR A 1 86  ? -12.352 -6.537  -0.501  1.00 0.00 ? 86  THR A CA   1  
ATOM 1311  C C    . THR A 1 86  ? -11.577 -5.341  -1.057  1.00 0.00 ? 86  THR A C    1  
ATOM 1312  O O    . THR A 1 86  ? -12.103 -4.577  -1.865  1.00 0.00 ? 86  THR A O    1  
ATOM 1313  C CB   . THR A 1 86  ? -12.533 -7.668  -1.515  1.00 0.00 ? 86  THR A CB   1  
ATOM 1314  O OG1  . THR A 1 86  ? -13.266 -8.660  -0.802  1.00 0.00 ? 86  THR A OG1  1  
ATOM 1315  C CG2  . THR A 1 86  ? -11.213 -8.359  -1.864  1.00 0.00 ? 86  THR A CG2  1  
ATOM 1316  H H    . THR A 1 86  ? -14.416 -6.327  -0.684  1.00 0.00 ? 86  THR A H    1  
ATOM 1317  H HA   . THR A 1 86  ? -11.795 -6.906  0.360   1.00 0.00 ? 86  THR A HA   1  
ATOM 1318  H HB   . THR A 1 86  ? -13.033 -7.308  -2.414  1.00 0.00 ? 86  THR A HB   1  
ATOM 1319  H HG1  . THR A 1 86  ? -13.402 -9.466  -1.378  1.00 0.00 ? 86  THR A HG1  1  
ATOM 1320  H HG21 . THR A 1 86  ? -11.389 -9.113  -2.631  1.00 0.00 ? 86  THR A HG21 1  
ATOM 1321  H HG22 . THR A 1 86  ? -10.503 -7.620  -2.237  1.00 0.00 ? 86  THR A HG22 1  
ATOM 1322  H HG23 . THR A 1 86  ? -10.806 -8.836  -0.972  1.00 0.00 ? 86  THR A HG23 1  
ATOM 1323  N N    . TYR A 1 87  ? -10.338 -5.215  -0.603  1.00 0.00 ? 87  TYR A N    1  
ATOM 1324  C CA   . TYR A 1 87  ? -9.486  -4.125  -1.045  1.00 0.00 ? 87  TYR A CA   1  
ATOM 1325  C C    . TYR A 1 87  ? -8.072  -4.624  -1.352  1.00 0.00 ? 87  TYR A C    1  
ATOM 1326  O O    . TYR A 1 87  ? -7.674  -5.694  -0.893  1.00 0.00 ? 87  TYR A O    1  
ATOM 1327  C CB   . TYR A 1 87  ? -9.422  -3.139  0.123   1.00 0.00 ? 87  TYR A CB   1  
ATOM 1328  C CG   . TYR A 1 87  ? -10.574 -2.131  0.150   1.00 0.00 ? 87  TYR A CG   1  
ATOM 1329  C CD1  . TYR A 1 87  ? -10.454 -0.929  -0.516  1.00 0.00 ? 87  TYR A CD1  1  
ATOM 1330  C CD2  . TYR A 1 87  ? -11.732 -2.425  0.841   1.00 0.00 ? 87  TYR A CD2  1  
ATOM 1331  C CE1  . TYR A 1 87  ? -11.537 0.019   -0.491  1.00 0.00 ? 87  TYR A CE1  1  
ATOM 1332  C CE2  . TYR A 1 87  ? -12.815 -1.477  0.866   1.00 0.00 ? 87  TYR A CE2  1  
ATOM 1333  C CZ   . TYR A 1 87  ? -12.664 -0.301  0.199   1.00 0.00 ? 87  TYR A CZ   1  
ATOM 1334  O OH   . TYR A 1 87  ? -13.688 0.594   0.223   1.00 0.00 ? 87  TYR A OH   1  
ATOM 1335  H H    . TYR A 1 87  ? -9.918  -5.841  0.054   1.00 0.00 ? 87  TYR A H    1  
ATOM 1336  H HA   . TYR A 1 87  ? -9.920  -3.705  -1.952  1.00 0.00 ? 87  TYR A HA   1  
ATOM 1337  H HB2  . TYR A 1 87  ? -9.422  -3.699  1.059   1.00 0.00 ? 87  TYR A HB2  1  
ATOM 1338  H HB3  . TYR A 1 87  ? -8.479  -2.596  0.076   1.00 0.00 ? 87  TYR A HB3  1  
ATOM 1339  H HD1  . TYR A 1 87  ? -9.539  -0.697  -1.062  1.00 0.00 ? 87  TYR A HD1  1  
ATOM 1340  H HD2  . TYR A 1 87  ? -11.826 -3.375  1.368   1.00 0.00 ? 87  TYR A HD2  1  
ATOM 1341  H HE1  . TYR A 1 87  ? -11.456 0.973   -1.013  1.00 0.00 ? 87  TYR A HE1  1  
ATOM 1342  H HE2  . TYR A 1 87  ? -13.735 -1.696  1.408   1.00 0.00 ? 87  TYR A HE2  1  
ATOM 1343  H HH   . TYR A 1 87  ? -14.324 0.406   -0.525  1.00 0.00 ? 87  TYR A HH   1  
ATOM 1344  N N    . THR A 1 88  ? -7.353  -3.826  -2.127  1.00 0.00 ? 88  THR A N    1  
ATOM 1345  C CA   . THR A 1 88  ? -5.993  -4.173  -2.502  1.00 0.00 ? 88  THR A CA   1  
ATOM 1346  C C    . THR A 1 88  ? -5.054  -2.991  -2.257  1.00 0.00 ? 88  THR A C    1  
ATOM 1347  O O    . THR A 1 88  ? -5.241  -1.916  -2.825  1.00 0.00 ? 88  THR A O    1  
ATOM 1348  C CB   . THR A 1 88  ? -6.009  -4.645  -3.957  1.00 0.00 ? 88  THR A CB   1  
ATOM 1349  O OG1  . THR A 1 88  ? -6.015  -6.067  -3.861  1.00 0.00 ? 88  THR A OG1  1  
ATOM 1350  C CG2  . THR A 1 88  ? -4.704  -4.327  -4.690  1.00 0.00 ? 88  THR A CG2  1  
ATOM 1351  H H    . THR A 1 88  ? -7.685  -2.958  -2.497  1.00 0.00 ? 88  THR A H    1  
ATOM 1352  H HA   . THR A 1 88  ? -5.657  -4.987  -1.859  1.00 0.00 ? 88  THR A HA   1  
ATOM 1353  H HB   . THR A 1 88  ? -6.865  -4.233  -4.491  1.00 0.00 ? 88  THR A HB   1  
ATOM 1354  H HG1  . THR A 1 88  ? -6.857  -6.376  -3.418  1.00 0.00 ? 88  THR A HG1  1  
ATOM 1355  H HG21 . THR A 1 88  ? -4.458  -3.274  -4.554  1.00 0.00 ? 88  THR A HG21 1  
ATOM 1356  H HG22 . THR A 1 88  ? -3.900  -4.943  -4.285  1.00 0.00 ? 88  THR A HG22 1  
ATOM 1357  H HG23 . THR A 1 88  ? -4.823  -4.539  -5.753  1.00 0.00 ? 88  THR A HG23 1  
ATOM 1358  N N    . ILE A 1 89  ? -4.063  -3.228  -1.409  1.00 0.00 ? 89  ILE A N    1  
ATOM 1359  C CA   . ILE A 1 89  ? -3.095  -2.196  -1.082  1.00 0.00 ? 89  ILE A CA   1  
ATOM 1360  C C    . ILE A 1 89  ? -1.775  -2.496  -1.797  1.00 0.00 ? 89  ILE A C    1  
ATOM 1361  O O    . ILE A 1 89  ? -1.184  -3.556  -1.597  1.00 0.00 ? 89  ILE A O    1  
ATOM 1362  C CB   . ILE A 1 89  ? -2.954  -2.055  0.435   1.00 0.00 ? 89  ILE A CB   1  
ATOM 1363  C CG1  . ILE A 1 89  ? -4.305  -2.233  1.130   1.00 0.00 ? 89  ILE A CG1  1  
ATOM 1364  C CG2  . ILE A 1 89  ? -2.291  -0.726  0.803   1.00 0.00 ? 89  ILE A CG2  1  
ATOM 1365  C CD1  . ILE A 1 89  ? -5.372  -1.341  0.491   1.00 0.00 ? 89  ILE A CD1  1  
ATOM 1366  H H    . ILE A 1 89  ? -3.918  -4.105  -0.951  1.00 0.00 ? 89  ILE A H    1  
ATOM 1367  H HA   . ILE A 1 89  ? -3.485  -1.251  -1.459  1.00 0.00 ? 89  ILE A HA   1  
ATOM 1368  H HB   . ILE A 1 89  ? -2.301  -2.851  0.793   1.00 0.00 ? 89  ILE A HB   1  
ATOM 1369  H HG12 . ILE A 1 89  ? -4.615  -3.276  1.069   1.00 0.00 ? 89  ILE A HG12 1  
ATOM 1370  H HG13 . ILE A 1 89  ? -4.209  -1.990  2.188   1.00 0.00 ? 89  ILE A HG13 1  
ATOM 1371  H HG21 . ILE A 1 89  ? -2.952  0.097   0.532   1.00 0.00 ? 89  ILE A HG21 1  
ATOM 1372  H HG22 . ILE A 1 89  ? -2.099  -0.700  1.875   1.00 0.00 ? 89  ILE A HG22 1  
ATOM 1373  H HG23 . ILE A 1 89  ? -1.349  -0.628  0.263   1.00 0.00 ? 89  ILE A HG23 1  
ATOM 1374  H HD11 . ILE A 1 89  ? -6.128  -1.964  0.013   1.00 0.00 ? 89  ILE A HD11 1  
ATOM 1375  H HD12 . ILE A 1 89  ? -5.841  -0.728  1.260   1.00 0.00 ? 89  ILE A HD12 1  
ATOM 1376  H HD13 . ILE A 1 89  ? -4.907  -0.696  -0.255  1.00 0.00 ? 89  ILE A HD13 1  
ATOM 1377  N N    . GLU A 1 90  ? -1.353  -1.543  -2.615  1.00 0.00 ? 90  GLU A N    1  
ATOM 1378  C CA   . GLU A 1 90  ? -0.114  -1.692  -3.360  1.00 0.00 ? 90  GLU A CA   1  
ATOM 1379  C C    . GLU A 1 90  ? 0.970   -0.784  -2.775  1.00 0.00 ? 90  GLU A C    1  
ATOM 1380  O O    . GLU A 1 90  ? 0.798   0.433   -2.713  1.00 0.00 ? 90  GLU A O    1  
ATOM 1381  C CB   . GLU A 1 90  ? -0.330  -1.401  -4.846  1.00 0.00 ? 90  GLU A CB   1  
ATOM 1382  C CG   . GLU A 1 90  ? -1.564  -2.135  -5.375  1.00 0.00 ? 90  GLU A CG   1  
ATOM 1383  C CD   . GLU A 1 90  ? -2.551  -1.157  -6.016  1.00 0.00 ? 90  GLU A CD   1  
ATOM 1384  O OE1  . GLU A 1 90  ? -3.042  -0.279  -5.274  1.00 0.00 ? 90  GLU A OE1  1  
ATOM 1385  O OE2  . GLU A 1 90  ? -2.793  -1.310  -7.233  1.00 0.00 ? 90  GLU A OE2  1  
ATOM 1386  H H    . GLU A 1 90  ? -1.839  -0.684  -2.771  1.00 0.00 ? 90  GLU A H    1  
ATOM 1387  H HA   . GLU A 1 90  ? 0.173   -2.736  -3.239  1.00 0.00 ? 90  GLU A HA   1  
ATOM 1388  H HB2  . GLU A 1 90  ? -0.449  -0.328  -4.997  1.00 0.00 ? 90  GLU A HB2  1  
ATOM 1389  H HB3  . GLU A 1 90  ? 0.550   -1.706  -5.412  1.00 0.00 ? 90  GLU A HB3  1  
ATOM 1390  H HG2  . GLU A 1 90  ? -1.260  -2.883  -6.108  1.00 0.00 ? 90  GLU A HG2  1  
ATOM 1391  H HG3  . GLU A 1 90  ? -2.052  -2.667  -4.559  1.00 0.00 ? 90  GLU A HG3  1  
ATOM 1392  N N    . VAL A 1 91  ? 2.061   -1.410  -2.361  1.00 0.00 ? 91  VAL A N    1  
ATOM 1393  C CA   . VAL A 1 91  ? 3.173   -0.674  -1.783  1.00 0.00 ? 91  VAL A CA   1  
ATOM 1394  C C    . VAL A 1 91  ? 4.392   -0.797  -2.700  1.00 0.00 ? 91  VAL A C    1  
ATOM 1395  O O    . VAL A 1 91  ? 4.912   -1.893  -2.902  1.00 0.00 ? 91  VAL A O    1  
ATOM 1396  C CB   . VAL A 1 91  ? 3.443   -1.165  -0.360  1.00 0.00 ? 91  VAL A CB   1  
ATOM 1397  C CG1  . VAL A 1 91  ? 4.711   -0.527  0.209   1.00 0.00 ? 91  VAL A CG1  1  
ATOM 1398  C CG2  . VAL A 1 91  ? 2.240   -0.900  0.549   1.00 0.00 ? 91  VAL A CG2  1  
ATOM 1399  H H    . VAL A 1 91  ? 2.193   -2.400  -2.415  1.00 0.00 ? 91  VAL A H    1  
ATOM 1400  H HA   . VAL A 1 91  ? 2.880   0.375   -1.729  1.00 0.00 ? 91  VAL A HA   1  
ATOM 1401  H HB   . VAL A 1 91  ? 3.600   -2.243  -0.401  1.00 0.00 ? 91  VAL A HB   1  
ATOM 1402  H HG11 . VAL A 1 91  ? 5.281   -0.068  -0.599  1.00 0.00 ? 91  VAL A HG11 1  
ATOM 1403  H HG12 . VAL A 1 91  ? 4.438   0.235   0.940   1.00 0.00 ? 91  VAL A HG12 1  
ATOM 1404  H HG13 . VAL A 1 91  ? 5.318   -1.292  0.693   1.00 0.00 ? 91  VAL A HG13 1  
ATOM 1405  H HG21 . VAL A 1 91  ? 2.205   0.159   0.804   1.00 0.00 ? 91  VAL A HG21 1  
ATOM 1406  H HG22 . VAL A 1 91  ? 1.324   -1.180  0.029   1.00 0.00 ? 91  VAL A HG22 1  
ATOM 1407  H HG23 . VAL A 1 91  ? 2.336   -1.491  1.460   1.00 0.00 ? 91  VAL A HG23 1  
ATOM 1408  N N    . ALA A 1 92  ? 4.812   0.342   -3.229  1.00 0.00 ? 92  ALA A N    1  
ATOM 1409  C CA   . ALA A 1 92  ? 5.960   0.375   -4.119  1.00 0.00 ? 92  ALA A CA   1  
ATOM 1410  C C    . ALA A 1 92  ? 7.100   1.141   -3.445  1.00 0.00 ? 92  ALA A C    1  
ATOM 1411  O O    . ALA A 1 92  ? 6.893   1.804   -2.430  1.00 0.00 ? 92  ALA A O    1  
ATOM 1412  C CB   . ALA A 1 92  ? 5.552   0.996   -5.457  1.00 0.00 ? 92  ALA A CB   1  
ATOM 1413  H H    . ALA A 1 92  ? 4.383   1.230   -3.060  1.00 0.00 ? 92  ALA A H    1  
ATOM 1414  H HA   . ALA A 1 92  ? 6.276   -0.653  -4.292  1.00 0.00 ? 92  ALA A HA   1  
ATOM 1415  H HB1  . ALA A 1 92  ? 5.539   0.225   -6.227  1.00 0.00 ? 92  ALA A HB1  1  
ATOM 1416  H HB2  . ALA A 1 92  ? 4.558   1.434   -5.366  1.00 0.00 ? 92  ALA A HB2  1  
ATOM 1417  H HB3  . ALA A 1 92  ? 6.267   1.771   -5.731  1.00 0.00 ? 92  ALA A HB3  1  
ATOM 1418  N N    . ALA A 1 93  ? 8.280   1.024   -4.037  1.00 0.00 ? 93  ALA A N    1  
ATOM 1419  C CA   . ALA A 1 93  ? 9.454   1.696   -3.506  1.00 0.00 ? 93  ALA A CA   1  
ATOM 1420  C C    . ALA A 1 93  ? 9.971   2.700   -4.539  1.00 0.00 ? 93  ALA A C    1  
ATOM 1421  O O    . ALA A 1 93  ? 9.934   2.436   -5.739  1.00 0.00 ? 93  ALA A O    1  
ATOM 1422  C CB   . ALA A 1 93  ? 10.509  0.657   -3.123  1.00 0.00 ? 93  ALA A CB   1  
ATOM 1423  H H    . ALA A 1 93  ? 8.440   0.482   -4.862  1.00 0.00 ? 93  ALA A H    1  
ATOM 1424  H HA   . ALA A 1 93  ? 9.150   2.235   -2.609  1.00 0.00 ? 93  ALA A HA   1  
ATOM 1425  H HB1  . ALA A 1 93  ? 10.885  0.172   -4.024  1.00 0.00 ? 93  ALA A HB1  1  
ATOM 1426  H HB2  . ALA A 1 93  ? 11.332  1.148   -2.605  1.00 0.00 ? 93  ALA A HB2  1  
ATOM 1427  H HB3  . ALA A 1 93  ? 10.061  -0.091  -2.469  1.00 0.00 ? 93  ALA A HB3  1  
ATOM 1428  N N    . MET A 1 94  ? 10.442  3.831   -4.033  1.00 0.00 ? 94  MET A N    1  
ATOM 1429  C CA   . MET A 1 94  ? 10.967  4.875   -4.897  1.00 0.00 ? 94  MET A CA   1  
ATOM 1430  C C    . MET A 1 94  ? 12.454  5.113   -4.628  1.00 0.00 ? 94  MET A C    1  
ATOM 1431  O O    . MET A 1 94  ? 12.879  5.172   -3.475  1.00 0.00 ? 94  MET A O    1  
ATOM 1432  C CB   . MET A 1 94  ? 10.191  6.172   -4.659  1.00 0.00 ? 94  MET A CB   1  
ATOM 1433  C CG   . MET A 1 94  ? 8.704   5.987   -4.970  1.00 0.00 ? 94  MET A CG   1  
ATOM 1434  S SD   . MET A 1 94  ? 7.831   7.522   -4.713  1.00 0.00 ? 94  MET A SD   1  
ATOM 1435  C CE   . MET A 1 94  ? 8.405   7.934   -3.074  1.00 0.00 ? 94  MET A CE   1  
ATOM 1436  H H    . MET A 1 94  ? 10.469  4.038   -3.055  1.00 0.00 ? 94  MET A H    1  
ATOM 1437  H HA   . MET A 1 94  ? 10.828  4.510   -5.915  1.00 0.00 ? 94  MET A HA   1  
ATOM 1438  H HB2  . MET A 1 94  ? 10.313  6.487   -3.622  1.00 0.00 ? 94  MET A HB2  1  
ATOM 1439  H HB3  . MET A 1 94  ? 10.601  6.965   -5.284  1.00 0.00 ? 94  MET A HB3  1  
ATOM 1440  H HG2  . MET A 1 94  ? 8.579   5.656   -6.001  1.00 0.00 ? 94  MET A HG2  1  
ATOM 1441  H HG3  . MET A 1 94  ? 8.285   5.209   -4.332  1.00 0.00 ? 94  MET A HG3  1  
ATOM 1442  H HE1  . MET A 1 94  ? 8.277   7.074   -2.417  1.00 0.00 ? 94  MET A HE1  1  
ATOM 1443  H HE2  . MET A 1 94  ? 9.459   8.206   -3.115  1.00 0.00 ? 94  MET A HE2  1  
ATOM 1444  H HE3  . MET A 1 94  ? 7.828   8.775   -2.687  1.00 0.00 ? 94  MET A HE3  1  
ATOM 1445  N N    . THR A 1 95  ? 13.205  5.242   -5.712  1.00 0.00 ? 95  THR A N    1  
ATOM 1446  C CA   . THR A 1 95  ? 14.636  5.472   -5.608  1.00 0.00 ? 95  THR A CA   1  
ATOM 1447  C C    . THR A 1 95  ? 15.012  6.800   -6.268  1.00 0.00 ? 95  THR A C    1  
ATOM 1448  O O    . THR A 1 95  ? 14.140  7.602   -6.598  1.00 0.00 ? 95  THR A O    1  
ATOM 1449  C CB   . THR A 1 95  ? 15.354  4.266   -6.217  1.00 0.00 ? 95  THR A CB   1  
ATOM 1450  O OG1  . THR A 1 95  ? 14.523  3.883   -7.310  1.00 0.00 ? 95  THR A OG1  1  
ATOM 1451  C CG2  . THR A 1 95  ? 15.339  3.047   -5.292  1.00 0.00 ? 95  THR A CG2  1  
ATOM 1452  H H    . THR A 1 95  ? 12.852  5.192   -6.646  1.00 0.00 ? 95  THR A H    1  
ATOM 1453  H HA   . THR A 1 95  ? 14.895  5.555   -4.553  1.00 0.00 ? 95  THR A HA   1  
ATOM 1454  H HB   . THR A 1 95  ? 16.373  4.524   -6.505  1.00 0.00 ? 95  THR A HB   1  
ATOM 1455  H HG1  . THR A 1 95  ? 15.072  3.433   -8.015  1.00 0.00 ? 95  THR A HG1  1  
ATOM 1456  H HG21 . THR A 1 95  ? 16.237  3.050   -4.673  1.00 0.00 ? 95  THR A HG21 1  
ATOM 1457  H HG22 . THR A 1 95  ? 14.457  3.086   -4.654  1.00 0.00 ? 95  THR A HG22 1  
ATOM 1458  H HG23 . THR A 1 95  ? 15.314  2.137   -5.891  1.00 0.00 ? 95  THR A HG23 1  
ATOM 1459  N N    . SER A 1 96  ? 16.312  6.991   -6.441  1.00 0.00 ? 96  SER A N    1  
ATOM 1460  C CA   . SER A 1 96  ? 16.814  8.208   -7.056  1.00 0.00 ? 96  SER A CA   1  
ATOM 1461  C C    . SER A 1 96  ? 16.593  8.160   -8.569  1.00 0.00 ? 96  SER A C    1  
ATOM 1462  O O    . SER A 1 96  ? 16.944  9.099   -9.281  1.00 0.00 ? 96  SER A O    1  
ATOM 1463  C CB   . SER A 1 96  ? 18.298  8.411   -6.743  1.00 0.00 ? 96  SER A CB   1  
ATOM 1464  O OG   . SER A 1 96  ? 18.775  9.668   -7.214  1.00 0.00 ? 96  SER A OG   1  
ATOM 1465  H H    . SER A 1 96  ? 17.014  6.333   -6.170  1.00 0.00 ? 96  SER A H    1  
ATOM 1466  H HA   . SER A 1 96  ? 16.235  9.017   -6.610  1.00 0.00 ? 96  SER A HA   1  
ATOM 1467  H HB2  . SER A 1 96  ? 18.453  8.345   -5.666  1.00 0.00 ? 96  SER A HB2  1  
ATOM 1468  H HB3  . SER A 1 96  ? 18.878  7.609   -7.198  1.00 0.00 ? 96  SER A HB3  1  
ATOM 1469  H HG   . SER A 1 96  ? 18.188  10.003  -7.951  1.00 0.00 ? 96  SER A HG   1  
ATOM 1470  N N    . LYS A 1 97  ? 16.012  7.056   -9.015  1.00 0.00 ? 97  LYS A N    1  
ATOM 1471  C CA   . LYS A 1 97  ? 15.740  6.873   -10.431 1.00 0.00 ? 97  LYS A CA   1  
ATOM 1472  C C    . LYS A 1 97  ? 14.230  6.937   -10.668 1.00 0.00 ? 97  LYS A C    1  
ATOM 1473  O O    . LYS A 1 97  ? 13.776  7.527   -11.647 1.00 0.00 ? 97  LYS A O    1  
ATOM 1474  C CB   . LYS A 1 97  ? 16.388  5.584   -10.939 1.00 0.00 ? 97  LYS A CB   1  
ATOM 1475  C CG   . LYS A 1 97  ? 15.344  4.652   -11.557 1.00 0.00 ? 97  LYS A CG   1  
ATOM 1476  C CD   . LYS A 1 97  ? 14.949  5.123   -12.958 1.00 0.00 ? 97  LYS A CD   1  
ATOM 1477  C CE   . LYS A 1 97  ? 13.441  4.987   -13.178 1.00 0.00 ? 97  LYS A CE   1  
ATOM 1478  N NZ   . LYS A 1 97  ? 13.004  5.833   -14.311 1.00 0.00 ? 97  LYS A NZ   1  
ATOM 1479  H H    . LYS A 1 97  ? 15.729  6.297   -8.429  1.00 0.00 ? 97  LYS A H    1  
ATOM 1480  H HA   . LYS A 1 97  ? 16.208  7.701   -10.963 1.00 0.00 ? 97  LYS A HA   1  
ATOM 1481  H HB2  . LYS A 1 97  ? 17.151  5.823   -11.679 1.00 0.00 ? 97  LYS A HB2  1  
ATOM 1482  H HB3  . LYS A 1 97  ? 16.892  5.077   -10.116 1.00 0.00 ? 97  LYS A HB3  1  
ATOM 1483  H HG2  . LYS A 1 97  ? 15.742  3.638   -11.609 1.00 0.00 ? 97  LYS A HG2  1  
ATOM 1484  H HG3  . LYS A 1 97  ? 14.461  4.615   -10.919 1.00 0.00 ? 97  LYS A HG3  1  
ATOM 1485  H HD2  . LYS A 1 97  ? 15.248  6.163   -13.093 1.00 0.00 ? 97  LYS A HD2  1  
ATOM 1486  H HD3  . LYS A 1 97  ? 15.483  4.538   -13.707 1.00 0.00 ? 97  LYS A HD3  1  
ATOM 1487  H HE2  . LYS A 1 97  ? 13.189  3.945   -13.375 1.00 0.00 ? 97  LYS A HE2  1  
ATOM 1488  H HE3  . LYS A 1 97  ? 12.908  5.279   -12.272 1.00 0.00 ? 97  LYS A HE3  1  
ATOM 1489  H HZ1  . LYS A 1 97  ? 12.026  5.697   -14.471 1.00 0.00 ? 97  LYS A HZ1  1  
ATOM 1490  H HZ2  . LYS A 1 97  ? 13.176  6.794   -14.096 1.00 0.00 ? 97  LYS A HZ2  1  
ATOM 1491  H HZ3  . LYS A 1 97  ? 13.514  5.578   -15.133 1.00 0.00 ? 97  LYS A HZ3  1  
ATOM 1492  N N    . GLY A 1 98  ? 13.493  6.321   -9.755  1.00 0.00 ? 98  GLY A N    1  
ATOM 1493  C CA   . GLY A 1 98  ? 12.043  6.300   -9.852  1.00 0.00 ? 98  GLY A CA   1  
ATOM 1494  C C    . GLY A 1 98  ? 11.450  5.198   -8.972  1.00 0.00 ? 98  GLY A C    1  
ATOM 1495  O O    . GLY A 1 98  ? 12.069  4.778   -7.995  1.00 0.00 ? 98  GLY A O    1  
ATOM 1496  H H    . GLY A 1 98  ? 13.870  5.844   -8.961  1.00 0.00 ? 98  GLY A H    1  
ATOM 1497  H HA2  . GLY A 1 98  ? 11.641  7.268   -9.550  1.00 0.00 ? 98  GLY A HA2  1  
ATOM 1498  H HA3  . GLY A 1 98  ? 11.747  6.142   -10.889 1.00 0.00 ? 98  GLY A HA3  1  
ATOM 1499  N N    . GLN A 1 99  ? 10.258  4.761   -9.350  1.00 0.00 ? 99  GLN A N    1  
ATOM 1500  C CA   . GLN A 1 99  ? 9.575   3.716   -8.608  1.00 0.00 ? 99  GLN A CA   1  
ATOM 1501  C C    . GLN A 1 99  ? 9.765   2.363   -9.297  1.00 0.00 ? 99  GLN A C    1  
ATOM 1502  O O    . GLN A 1 99  ? 9.809   2.289   -10.524 1.00 0.00 ? 99  GLN A O    1  
ATOM 1503  C CB   . GLN A 1 99  ? 8.089   4.042   -8.442  1.00 0.00 ? 99  GLN A CB   1  
ATOM 1504  C CG   . GLN A 1 99  ? 7.396   3.008   -7.553  1.00 0.00 ? 99  GLN A CG   1  
ATOM 1505  C CD   . GLN A 1 99  ? 6.179   2.405   -8.259  1.00 0.00 ? 99  GLN A CD   1  
ATOM 1506  O OE1  . GLN A 1 99  ? 6.292   1.595   -9.164  1.00 0.00 ? 99  GLN A OE1  1  
ATOM 1507  N NE2  . GLN A 1 99  ? 5.013   2.845   -7.796  1.00 0.00 ? 99  GLN A NE2  1  
ATOM 1508  H H    . GLN A 1 99  ? 9.762   5.108   -10.146 1.00 0.00 ? 99  GLN A H    1  
ATOM 1509  H HA   . GLN A 1 99  ? 10.048  3.700   -7.626  1.00 0.00 ? 99  GLN A HA   1  
ATOM 1510  H HB2  . GLN A 1 99  ? 7.978   5.035   -8.006  1.00 0.00 ? 99  GLN A HB2  1  
ATOM 1511  H HB3  . GLN A 1 99  ? 7.608   4.068   -9.420  1.00 0.00 ? 99  GLN A HB3  1  
ATOM 1512  H HG2  . GLN A 1 99  ? 8.099   2.216   -7.294  1.00 0.00 ? 99  GLN A HG2  1  
ATOM 1513  H HG3  . GLN A 1 99  ? 7.084   3.476   -6.620  1.00 0.00 ? 99  GLN A HG3  1  
ATOM 1514  H HE21 . GLN A 1 99  ? 4.990   3.511   -7.051  1.00 0.00 ? 99  GLN A HE21 1  
ATOM 1515  H HE22 . GLN A 1 99  ? 4.158   2.510   -8.194  1.00 0.00 ? 99  GLN A HE22 1  
ATOM 1516  N N    . GLY A 1 100 ? 9.873   1.327   -8.479  1.00 0.00 ? 100 GLY A N    1  
ATOM 1517  C CA   . GLY A 1 100 ? 10.057  -0.018  -8.995  1.00 0.00 ? 100 GLY A CA   1  
ATOM 1518  C C    . GLY A 1 100 ? 8.800   -0.865  -8.782  1.00 0.00 ? 100 GLY A C    1  
ATOM 1519  O O    . GLY A 1 100 ? 7.697   -0.330  -8.689  1.00 0.00 ? 100 GLY A O    1  
ATOM 1520  H H    . GLY A 1 100 ? 9.836   1.396   -7.482  1.00 0.00 ? 100 GLY A H    1  
ATOM 1521  H HA2  . GLY A 1 100 ? 10.295  0.025   -10.057 1.00 0.00 ? 100 GLY A HA2  1  
ATOM 1522  H HA3  . GLY A 1 100 ? 10.905  -0.489  -8.497  1.00 0.00 ? 100 GLY A HA3  1  
ATOM 1523  N N    . GLN A 1 101 ? 9.010   -2.171  -8.712  1.00 0.00 ? 101 GLN A N    1  
ATOM 1524  C CA   . GLN A 1 101 ? 7.907   -3.096  -8.513  1.00 0.00 ? 101 GLN A CA   1  
ATOM 1525  C C    . GLN A 1 101 ? 6.977   -2.583  -7.412  1.00 0.00 ? 101 GLN A C    1  
ATOM 1526  O O    . GLN A 1 101 ? 7.310   -1.633  -6.705  1.00 0.00 ? 101 GLN A O    1  
ATOM 1527  C CB   . GLN A 1 101 ? 8.422   -4.499  -8.186  1.00 0.00 ? 101 GLN A CB   1  
ATOM 1528  C CG   . GLN A 1 101 ? 7.713   -5.555  -9.037  1.00 0.00 ? 101 GLN A CG   1  
ATOM 1529  C CD   . GLN A 1 101 ? 8.715   -6.557  -9.614  1.00 0.00 ? 101 GLN A CD   1  
ATOM 1530  O OE1  . GLN A 1 101 ? 9.815   -6.213  -10.016 1.00 0.00 ? 101 GLN A OE1  1  
ATOM 1531  N NE2  . GLN A 1 101 ? 8.275   -7.812  -9.634  1.00 0.00 ? 101 GLN A NE2  1  
ATOM 1532  H H    . GLN A 1 101 ? 9.911   -2.598  -8.789  1.00 0.00 ? 101 GLN A H    1  
ATOM 1533  H HA   . GLN A 1 101 ? 7.376   -3.123  -9.464  1.00 0.00 ? 101 GLN A HA   1  
ATOM 1534  H HB2  . GLN A 1 101 ? 9.496   -4.547  -8.361  1.00 0.00 ? 101 GLN A HB2  1  
ATOM 1535  H HB3  . GLN A 1 101 ? 8.262   -4.712  -7.129  1.00 0.00 ? 101 GLN A HB3  1  
ATOM 1536  H HG2  . GLN A 1 101 ? 6.976   -6.081  -8.430  1.00 0.00 ? 101 GLN A HG2  1  
ATOM 1537  H HG3  . GLN A 1 101 ? 7.170   -5.069  -9.848  1.00 0.00 ? 101 GLN A HG3  1  
ATOM 1538  H HE21 . GLN A 1 101 ? 7.362   -8.027  -9.289  1.00 0.00 ? 101 GLN A HE21 1  
ATOM 1539  H HE22 . GLN A 1 101 ? 8.859   -8.540  -9.993  1.00 0.00 ? 101 GLN A HE22 1  
ATOM 1540  N N    . VAL A 1 102 ? 5.828   -3.234  -7.302  1.00 0.00 ? 102 VAL A N    1  
ATOM 1541  C CA   . VAL A 1 102 ? 4.846   -2.855  -6.300  1.00 0.00 ? 102 VAL A CA   1  
ATOM 1542  C C    . VAL A 1 102 ? 4.220   -4.117  -5.703  1.00 0.00 ? 102 VAL A C    1  
ATOM 1543  O O    . VAL A 1 102 ? 3.902   -5.059  -6.428  1.00 0.00 ? 102 VAL A O    1  
ATOM 1544  C CB   . VAL A 1 102 ? 3.813   -1.906  -6.911  1.00 0.00 ? 102 VAL A CB   1  
ATOM 1545  C CG1  . VAL A 1 102 ? 2.592   -2.677  -7.415  1.00 0.00 ? 102 VAL A CG1  1  
ATOM 1546  C CG2  . VAL A 1 102 ? 3.404   -0.824  -5.910  1.00 0.00 ? 102 VAL A CG2  1  
ATOM 1547  H H    . VAL A 1 102 ? 5.564   -4.005  -7.881  1.00 0.00 ? 102 VAL A H    1  
ATOM 1548  H HA   . VAL A 1 102 ? 5.373   -2.318  -5.510  1.00 0.00 ? 102 VAL A HA   1  
ATOM 1549  H HB   . VAL A 1 102 ? 4.276   -1.414  -7.766  1.00 0.00 ? 102 VAL A HB   1  
ATOM 1550  H HG11 . VAL A 1 102 ? 2.902   -3.663  -7.762  1.00 0.00 ? 102 VAL A HG11 1  
ATOM 1551  H HG12 . VAL A 1 102 ? 1.872   -2.788  -6.604  1.00 0.00 ? 102 VAL A HG12 1  
ATOM 1552  H HG13 . VAL A 1 102 ? 2.131   -2.130  -8.238  1.00 0.00 ? 102 VAL A HG13 1  
ATOM 1553  H HG21 . VAL A 1 102 ? 2.389   -1.016  -5.562  1.00 0.00 ? 102 VAL A HG21 1  
ATOM 1554  H HG22 . VAL A 1 102 ? 4.088   -0.836  -5.061  1.00 0.00 ? 102 VAL A HG22 1  
ATOM 1555  H HG23 . VAL A 1 102 ? 3.443   0.152   -6.394  1.00 0.00 ? 102 VAL A HG23 1  
ATOM 1556  N N    . SER A 1 103 ? 4.061   -4.096  -4.388  1.00 0.00 ? 103 SER A N    1  
ATOM 1557  C CA   . SER A 1 103 ? 3.478   -5.227  -3.686  1.00 0.00 ? 103 SER A CA   1  
ATOM 1558  C C    . SER A 1 103 ? 2.003   -4.954  -3.388  1.00 0.00 ? 103 SER A C    1  
ATOM 1559  O O    . SER A 1 103 ? 1.681   -4.161  -2.504  1.00 0.00 ? 103 SER A O    1  
ATOM 1560  C CB   . SER A 1 103 ? 4.236   -5.521  -2.390  1.00 0.00 ? 103 SER A CB   1  
ATOM 1561  O OG   . SER A 1 103 ? 5.371   -6.354  -2.612  1.00 0.00 ? 103 SER A OG   1  
ATOM 1562  H H    . SER A 1 103 ? 4.322   -3.326  -3.806  1.00 0.00 ? 103 SER A H    1  
ATOM 1563  H HA   . SER A 1 103 ? 3.581   -6.072  -4.366  1.00 0.00 ? 103 SER A HA   1  
ATOM 1564  H HB2  . SER A 1 103 ? 4.559   -4.583  -1.938  1.00 0.00 ? 103 SER A HB2  1  
ATOM 1565  H HB3  . SER A 1 103 ? 3.566   -6.003  -1.679  1.00 0.00 ? 103 SER A HB3  1  
ATOM 1566  H HG   . SER A 1 103 ? 6.202   -5.800  -2.640  1.00 0.00 ? 103 SER A HG   1  
ATOM 1567  N N    . ALA A 1 104 ? 1.145   -5.625  -4.142  1.00 0.00 ? 104 ALA A N    1  
ATOM 1568  C CA   . ALA A 1 104 ? -0.288  -5.465  -3.970  1.00 0.00 ? 104 ALA A CA   1  
ATOM 1569  C C    . ALA A 1 104 ? -0.864  -6.724  -3.319  1.00 0.00 ? 104 ALA A C    1  
ATOM 1570  O O    . ALA A 1 104 ? -0.779  -7.813  -3.885  1.00 0.00 ? 104 ALA A O    1  
ATOM 1571  C CB   . ALA A 1 104 ? -0.935  -5.160  -5.323  1.00 0.00 ? 104 ALA A CB   1  
ATOM 1572  H H    . ALA A 1 104 ? 1.415   -6.268  -4.859  1.00 0.00 ? 104 ALA A H    1  
ATOM 1573  H HA   . ALA A 1 104 ? -0.450  -4.616  -3.305  1.00 0.00 ? 104 ALA A HA   1  
ATOM 1574  H HB1  . ALA A 1 104 ? -0.224  -4.626  -5.953  1.00 0.00 ? 104 ALA A HB1  1  
ATOM 1575  H HB2  . ALA A 1 104 ? -1.220  -6.094  -5.808  1.00 0.00 ? 104 ALA A HB2  1  
ATOM 1576  H HB3  . ALA A 1 104 ? -1.821  -4.544  -5.171  1.00 0.00 ? 104 ALA A HB3  1  
ATOM 1577  N N    . SER A 1 105 ? -1.436  -6.534  -2.140  1.00 0.00 ? 105 SER A N    1  
ATOM 1578  C CA   . SER A 1 105 ? -2.025  -7.642  -1.406  1.00 0.00 ? 105 SER A CA   1  
ATOM 1579  C C    . SER A 1 105 ? -3.512  -7.377  -1.164  1.00 0.00 ? 105 SER A C    1  
ATOM 1580  O O    . SER A 1 105 ? -3.893  -6.278  -0.764  1.00 0.00 ? 105 SER A O    1  
ATOM 1581  C CB   . SER A 1 105 ? -1.303  -7.868  -0.077  1.00 0.00 ? 105 SER A CB   1  
ATOM 1582  O OG   . SER A 1 105 ? -0.635  -9.127  -0.040  1.00 0.00 ? 105 SER A OG   1  
ATOM 1583  H H    . SER A 1 105 ? -1.500  -5.645  -1.686  1.00 0.00 ? 105 SER A H    1  
ATOM 1584  H HA   . SER A 1 105 ? -1.891  -8.515  -2.045  1.00 0.00 ? 105 SER A HA   1  
ATOM 1585  H HB2  . SER A 1 105 ? -0.579  -7.069  0.083   1.00 0.00 ? 105 SER A HB2  1  
ATOM 1586  H HB3  . SER A 1 105 ? -2.022  -7.816  0.740   1.00 0.00 ? 105 SER A HB3  1  
ATOM 1587  H HG   . SER A 1 105 ? 0.355   -8.989  -0.067  1.00 0.00 ? 105 SER A HG   1  
ATOM 1588  N N    . THR A 1 106 ? -4.312  -8.402  -1.416  1.00 0.00 ? 106 THR A N    1  
ATOM 1589  C CA   . THR A 1 106 ? -5.749  -8.294  -1.230  1.00 0.00 ? 106 THR A CA   1  
ATOM 1590  C C    . THR A 1 106 ? -6.104  -8.392  0.255   1.00 0.00 ? 106 THR A C    1  
ATOM 1591  O O    . THR A 1 106 ? -5.612  -9.274  0.957   1.00 0.00 ? 106 THR A O    1  
ATOM 1592  C CB   . THR A 1 106 ? -6.419  -9.370  -2.087  1.00 0.00 ? 106 THR A CB   1  
ATOM 1593  O OG1  . THR A 1 106 ? -5.541  -9.526  -3.198  1.00 0.00 ? 106 THR A OG1  1  
ATOM 1594  C CG2  . THR A 1 106 ? -7.730  -8.888  -2.713  1.00 0.00 ? 106 THR A CG2  1  
ATOM 1595  H H    . THR A 1 106 ? -3.994  -9.293  -1.741  1.00 0.00 ? 106 THR A H    1  
ATOM 1596  H HA   . THR A 1 106 ? -6.066  -7.308  -1.570  1.00 0.00 ? 106 THR A HA   1  
ATOM 1597  H HB   . THR A 1 106 ? -6.575  -10.283 -1.514  1.00 0.00 ? 106 THR A HB   1  
ATOM 1598  H HG1  . THR A 1 106 ? -5.573  -10.469 -3.530  1.00 0.00 ? 106 THR A HG1  1  
ATOM 1599  H HG21 . THR A 1 106 ? -8.560  -9.466  -2.308  1.00 0.00 ? 106 THR A HG21 1  
ATOM 1600  H HG22 . THR A 1 106 ? -7.875  -7.832  -2.483  1.00 0.00 ? 106 THR A HG22 1  
ATOM 1601  H HG23 . THR A 1 106 ? -7.687  -9.022  -3.794  1.00 0.00 ? 106 THR A HG23 1  
ATOM 1602  N N    . ILE A 1 107 ? -6.955  -7.474  0.689   1.00 0.00 ? 107 ILE A N    1  
ATOM 1603  C CA   . ILE A 1 107 ? -7.381  -7.446  2.078   1.00 0.00 ? 107 ILE A CA   1  
ATOM 1604  C C    . ILE A 1 107 ? -8.827  -6.953  2.153   1.00 0.00 ? 107 ILE A C    1  
ATOM 1605  O O    . ILE A 1 107 ? -9.170  -5.931  1.560   1.00 0.00 ? 107 ILE A O    1  
ATOM 1606  C CB   . ILE A 1 107 ? -6.406  -6.622  2.921   1.00 0.00 ? 107 ILE A CB   1  
ATOM 1607  C CG1  . ILE A 1 107 ? -6.919  -6.462  4.353   1.00 0.00 ? 107 ILE A CG1  1  
ATOM 1608  C CG2  . ILE A 1 107 ? -6.115  -5.273  2.261   1.00 0.00 ? 107 ILE A CG2  1  
ATOM 1609  C CD1  . ILE A 1 107 ? -6.748  -7.759  5.146   1.00 0.00 ? 107 ILE A CD1  1  
ATOM 1610  H H    . ILE A 1 107 ? -7.351  -6.760  0.111   1.00 0.00 ? 107 ILE A H    1  
ATOM 1611  H HA   . ILE A 1 107 ? -7.345  -8.469  2.451   1.00 0.00 ? 107 ILE A HA   1  
ATOM 1612  H HB   . ILE A 1 107 ? -5.461  -7.163  2.976   1.00 0.00 ? 107 ILE A HB   1  
ATOM 1613  H HG12 . ILE A 1 107 ? -6.379  -5.655  4.849   1.00 0.00 ? 107 ILE A HG12 1  
ATOM 1614  H HG13 . ILE A 1 107 ? -7.971  -6.177  4.336   1.00 0.00 ? 107 ILE A HG13 1  
ATOM 1615  H HG21 . ILE A 1 107 ? -6.971  -4.972  1.657   1.00 0.00 ? 107 ILE A HG21 1  
ATOM 1616  H HG22 . ILE A 1 107 ? -5.934  -4.523  3.032   1.00 0.00 ? 107 ILE A HG22 1  
ATOM 1617  H HG23 . ILE A 1 107 ? -5.234  -5.361  1.626   1.00 0.00 ? 107 ILE A HG23 1  
ATOM 1618  H HD11 . ILE A 1 107 ? -6.554  -7.523  6.192   1.00 0.00 ? 107 ILE A HD11 1  
ATOM 1619  H HD12 . ILE A 1 107 ? -7.659  -8.354  5.071   1.00 0.00 ? 107 ILE A HD12 1  
ATOM 1620  H HD13 . ILE A 1 107 ? -5.911  -8.326  4.739   1.00 0.00 ? 107 ILE A HD13 1  
ATOM 1621  N N    . SER A 1 108 ? -9.637  -7.702  2.887   1.00 0.00 ? 108 SER A N    1  
ATOM 1622  C CA   . SER A 1 108 ? -11.038 -7.353  3.048   1.00 0.00 ? 108 SER A CA   1  
ATOM 1623  C C    . SER A 1 108 ? -11.259 -6.683  4.406   1.00 0.00 ? 108 SER A C    1  
ATOM 1624  O O    . SER A 1 108 ? -10.966 -7.270  5.446   1.00 0.00 ? 108 SER A O    1  
ATOM 1625  C CB   . SER A 1 108 ? -11.932 -8.588  2.914   1.00 0.00 ? 108 SER A CB   1  
ATOM 1626  O OG   . SER A 1 108 ? -13.266 -8.331  3.345   1.00 0.00 ? 108 SER A OG   1  
ATOM 1627  H H    . SER A 1 108 ? -9.350  -8.531  3.367   1.00 0.00 ? 108 SER A H    1  
ATOM 1628  H HA   . SER A 1 108 ? -11.257 -6.658  2.238   1.00 0.00 ? 108 SER A HA   1  
ATOM 1629  H HB2  . SER A 1 108 ? -11.943 -8.916  1.875   1.00 0.00 ? 108 SER A HB2  1  
ATOM 1630  H HB3  . SER A 1 108 ? -11.512 -9.405  3.501   1.00 0.00 ? 108 SER A HB3  1  
ATOM 1631  H HG   . SER A 1 108 ? -13.272 -8.095  4.316   1.00 0.00 ? 108 SER A HG   1  
ATOM 1632  N N    . SER A 1 109 ? -11.773 -5.463  4.351   1.00 0.00 ? 109 SER A N    1  
ATOM 1633  C CA   . SER A 1 109 ? -12.036 -4.708  5.564   1.00 0.00 ? 109 SER A CA   1  
ATOM 1634  C C    . SER A 1 109 ? -12.491 -5.650  6.680   1.00 0.00 ? 109 SER A C    1  
ATOM 1635  O O    . SER A 1 109 ? -13.152 -6.654  6.419   1.00 0.00 ? 109 SER A O    1  
ATOM 1636  C CB   . SER A 1 109 ? -13.091 -3.626  5.321   1.00 0.00 ? 109 SER A CB   1  
ATOM 1637  O OG   . SER A 1 109 ? -14.278 -4.158  4.740   1.00 0.00 ? 109 SER A OG   1  
ATOM 1638  H H    . SER A 1 109 ? -12.009 -4.993  3.501   1.00 0.00 ? 109 SER A H    1  
ATOM 1639  H HA   . SER A 1 109 ? -11.088 -4.238  5.823   1.00 0.00 ? 109 SER A HA   1  
ATOM 1640  H HB2  . SER A 1 109 ? -13.335 -3.139  6.265   1.00 0.00 ? 109 SER A HB2  1  
ATOM 1641  H HB3  . SER A 1 109 ? -12.679 -2.859  4.664   1.00 0.00 ? 109 SER A HB3  1  
ATOM 1642  H HG   . SER A 1 109 ? -14.874 -3.415  4.438   1.00 0.00 ? 109 SER A HG   1  
ATOM 1643  N N    . GLY A 1 110 ? -12.118 -5.294  7.900   1.00 0.00 ? 110 GLY A N    1  
ATOM 1644  C CA   . GLY A 1 110 ? -12.479 -6.095  9.057   1.00 0.00 ? 110 GLY A CA   1  
ATOM 1645  C C    . GLY A 1 110 ? -13.998 -6.158  9.228   1.00 0.00 ? 110 GLY A C    1  
ATOM 1646  O O    . GLY A 1 110 ? -14.664 -6.976  8.596   1.00 0.00 ? 110 GLY A O    1  
ATOM 1647  H H    . GLY A 1 110 ? -11.580 -4.476  8.104   1.00 0.00 ? 110 GLY A H    1  
ATOM 1648  H HA2  . GLY A 1 110 ? -12.080 -7.103  8.944   1.00 0.00 ? 110 GLY A HA2  1  
ATOM 1649  H HA3  . GLY A 1 110 ? -12.026 -5.672  9.953   1.00 0.00 ? 110 GLY A HA3  1  
ATOM 1650  N N    . VAL A 1 111 ? -14.502 -5.283  10.086  1.00 0.00 ? 111 VAL A N    1  
ATOM 1651  C CA   . VAL A 1 111 ? -15.930 -5.229  10.348  1.00 0.00 ? 111 VAL A CA   1  
ATOM 1652  C C    . VAL A 1 111 ? -16.254 -3.948  11.120  1.00 0.00 ? 111 VAL A C    1  
ATOM 1653  O O    . VAL A 1 111 ? -15.482 -3.524  11.978  1.00 0.00 ? 111 VAL A O    1  
ATOM 1654  C CB   . VAL A 1 111 ? -16.377 -6.496  11.079  1.00 0.00 ? 111 VAL A CB   1  
ATOM 1655  C CG1  . VAL A 1 111 ? -15.603 -6.676  12.387  1.00 0.00 ? 111 VAL A CG1  1  
ATOM 1656  C CG2  . VAL A 1 111 ? -17.885 -6.481  11.332  1.00 0.00 ? 111 VAL A CG2  1  
ATOM 1657  H H    . VAL A 1 111 ? -13.953 -4.621  10.596  1.00 0.00 ? 111 VAL A H    1  
ATOM 1658  H HA   . VAL A 1 111 ? -16.440 -5.197  9.385   1.00 0.00 ? 111 VAL A HA   1  
ATOM 1659  H HB   . VAL A 1 111 ? -16.153 -7.349  10.438  1.00 0.00 ? 111 VAL A HB   1  
ATOM 1660  H HG11 . VAL A 1 111 ? -15.757 -5.804  13.023  1.00 0.00 ? 111 VAL A HG11 1  
ATOM 1661  H HG12 . VAL A 1 111 ? -15.961 -7.568  12.901  1.00 0.00 ? 111 VAL A HG12 1  
ATOM 1662  H HG13 . VAL A 1 111 ? -14.541 -6.784  12.169  1.00 0.00 ? 111 VAL A HG13 1  
ATOM 1663  H HG21 . VAL A 1 111 ? -18.145 -7.276  12.031  1.00 0.00 ? 111 VAL A HG21 1  
ATOM 1664  H HG22 . VAL A 1 111 ? -18.173 -5.518  11.754  1.00 0.00 ? 111 VAL A HG22 1  
ATOM 1665  H HG23 . VAL A 1 111 ? -18.413 -6.638  10.391  1.00 0.00 ? 111 VAL A HG23 1  
ATOM 1666  N N    . PRO A 1 112 ? -17.428 -3.352  10.777  1.00 0.00 ? 112 PRO A N    1  
ATOM 1667  C CA   . PRO A 1 112 ? -17.864 -2.128  11.428  1.00 0.00 ? 112 PRO A CA   1  
ATOM 1668  C C    . PRO A 1 112 ? -18.380 -2.412  12.840  1.00 0.00 ? 112 PRO A C    1  
ATOM 1669  O O    . PRO A 1 112 ? -19.256 -3.255  13.027  1.00 0.00 ? 112 PRO A O    1  
ATOM 1670  C CB   . PRO A 1 112 ? -18.930 -1.553  10.510  1.00 0.00 ? 112 PRO A CB   1  
ATOM 1671  C CG   . PRO A 1 112 ? -19.381 -2.702  9.623   1.00 0.00 ? 112 PRO A CG   1  
ATOM 1672  C CD   . PRO A 1 112 ? -18.367 -3.826  9.765   1.00 0.00 ? 112 PRO A CD   1  
ATOM 1673  H HA   . PRO A 1 112 ? -17.093 -1.501  11.540  1.00 0.00 ? 112 PRO A HA   1  
ATOM 1674  H HB2  . PRO A 1 112 ? -19.765 -1.152  11.085  1.00 0.00 ? 112 PRO A HB2  1  
ATOM 1675  H HB3  . PRO A 1 112 ? -18.530 -0.732  9.914   1.00 0.00 ? 112 PRO A HB3  1  
ATOM 1676  H HG2  . PRO A 1 112 ? -20.373 -3.044  9.917   1.00 0.00 ? 112 PRO A HG2  1  
ATOM 1677  H HG3  . PRO A 1 112 ? -19.449 -2.378  8.585   1.00 0.00 ? 112 PRO A HG3  1  
ATOM 1678  H HD2  . PRO A 1 112 ? -18.846 -4.755  10.073  1.00 0.00 ? 112 PRO A HD2  1  
ATOM 1679  H HD3  . PRO A 1 112 ? -17.863 -4.026  8.819   1.00 0.00 ? 112 PRO A HD3  1  
ATOM 1680  N N    . PRO A 1 113 ? -17.800 -1.673  13.823  1.00 0.00 ? 113 PRO A N    1  
ATOM 1681  C CA   . PRO A 1 113 ? -18.193 -1.837  15.213  1.00 0.00 ? 113 PRO A CA   1  
ATOM 1682  C C    . PRO A 1 113 ? -19.552 -1.188  15.479  1.00 0.00 ? 113 PRO A C    1  
ATOM 1683  O O    . PRO A 1 113 ? -20.256 -1.572  16.412  1.00 0.00 ? 113 PRO A O    1  
ATOM 1684  C CB   . PRO A 1 113 ? -17.066 -1.208  16.017  1.00 0.00 ? 113 PRO A CB   1  
ATOM 1685  C CG   . PRO A 1 113 ? -16.316 -0.307  15.049  1.00 0.00 ? 113 PRO A CG   1  
ATOM 1686  C CD   . PRO A 1 113 ? -16.760 -0.666  13.640  1.00 0.00 ? 113 PRO A CD   1  
ATOM 1687  H HA   . PRO A 1 113 ? -18.306 -2.807  15.430  1.00 0.00 ? 113 PRO A HA   1  
ATOM 1688  H HB2  . PRO A 1 113 ? -17.459 -0.636  16.857  1.00 0.00 ? 113 PRO A HB2  1  
ATOM 1689  H HB3  . PRO A 1 113 ? -16.408 -1.971  16.430  1.00 0.00 ? 113 PRO A HB3  1  
ATOM 1690  H HG2  . PRO A 1 113 ? -16.527 0.741   15.260  1.00 0.00 ? 113 PRO A HG2  1  
ATOM 1691  H HG3  . PRO A 1 113 ? -15.240 -0.444  15.156  1.00 0.00 ? 113 PRO A HG3  1  
ATOM 1692  H HD2  . PRO A 1 113 ? -17.143 0.207   13.111  1.00 0.00 ? 113 PRO A HD2  1  
ATOM 1693  H HD3  . PRO A 1 113 ? -15.930 -1.056  13.051  1.00 0.00 ? 113 PRO A HD3  1  
ATOM 1694  N N    . SER A 1 114 ? -19.881 -0.214  14.643  1.00 0.00 ? 114 SER A N    1  
ATOM 1695  C CA   . SER A 1 114 ? -21.144 0.492   14.776  1.00 0.00 ? 114 SER A CA   1  
ATOM 1696  C C    . SER A 1 114 ? -21.467 0.712   16.255  1.00 0.00 ? 114 SER A C    1  
ATOM 1697  O O    . SER A 1 114 ? -22.299 0.006   16.823  1.00 0.00 ? 114 SER A O    1  
ATOM 1698  C CB   . SER A 1 114 ? -22.278 -0.274  14.092  1.00 0.00 ? 114 SER A CB   1  
ATOM 1699  O OG   . SER A 1 114 ? -22.862 0.473   13.028  1.00 0.00 ? 114 SER A OG   1  
ATOM 1700  H H    . SER A 1 114 ? -19.303 0.093   13.886  1.00 0.00 ? 114 SER A H    1  
ATOM 1701  H HA   . SER A 1 114 ? -20.995 1.447   14.271  1.00 0.00 ? 114 SER A HA   1  
ATOM 1702  H HB2  . SER A 1 114 ? -21.896 -1.219  13.705  1.00 0.00 ? 114 SER A HB2  1  
ATOM 1703  H HB3  . SER A 1 114 ? -23.045 -0.518  14.828  1.00 0.00 ? 114 SER A HB3  1  
ATOM 1704  H HG   . SER A 1 114 ? -23.719 0.046   12.741  1.00 0.00 ? 114 SER A HG   1  
ATOM 1705  N N    . GLY A 1 115 ? -20.792 1.693   16.836  1.00 0.00 ? 115 GLY A N    1  
ATOM 1706  C CA   . GLY A 1 115 ? -20.997 2.014   18.238  1.00 0.00 ? 115 GLY A CA   1  
ATOM 1707  C C    . GLY A 1 115 ? -20.173 1.092   19.138  1.00 0.00 ? 115 GLY A C    1  
ATOM 1708  O O    . GLY A 1 115 ? -19.696 0.049   18.694  1.00 0.00 ? 115 GLY A O    1  
ATOM 1709  H H    . GLY A 1 115 ? -20.117 2.262   16.366  1.00 0.00 ? 115 GLY A H    1  
ATOM 1710  H HA2  . GLY A 1 115 ? -20.719 3.052   18.421  1.00 0.00 ? 115 GLY A HA2  1  
ATOM 1711  H HA3  . GLY A 1 115 ? -22.055 1.920   18.485  1.00 0.00 ? 115 GLY A HA3  1  
ATOM 1712  N N    . PRO A 1 116 ? -20.026 1.521   20.420  1.00 0.00 ? 116 PRO A N    1  
ATOM 1713  C CA   . PRO A 1 116 ? -19.267 0.746   21.387  1.00 0.00 ? 116 PRO A CA   1  
ATOM 1714  C C    . PRO A 1 116 ? -20.059 -0.478  21.851  1.00 0.00 ? 116 PRO A C    1  
ATOM 1715  O O    . PRO A 1 116 ? -21.209 -0.355  22.270  1.00 0.00 ? 116 PRO A O    1  
ATOM 1716  C CB   . PRO A 1 116 ? -18.959 1.717   22.515  1.00 0.00 ? 116 PRO A CB   1  
ATOM 1717  C CG   . PRO A 1 116 ? -19.945 2.863   22.360  1.00 0.00 ? 116 PRO A CG   1  
ATOM 1718  C CD   . PRO A 1 116 ? -20.576 2.752   20.981  1.00 0.00 ? 116 PRO A CD   1  
ATOM 1719  H HA   . PRO A 1 116 ? -18.433 0.389   20.967  1.00 0.00 ? 116 PRO A HA   1  
ATOM 1720  H HB2  . PRO A 1 116 ? -19.069 1.235   23.486  1.00 0.00 ? 116 PRO A HB2  1  
ATOM 1721  H HB3  . PRO A 1 116 ? -17.931 2.075   22.452  1.00 0.00 ? 116 PRO A HB3  1  
ATOM 1722  H HG2  . PRO A 1 116 ? -20.710 2.815   23.135  1.00 0.00 ? 116 PRO A HG2  1  
ATOM 1723  H HG3  . PRO A 1 116 ? -19.438 3.821   22.472  1.00 0.00 ? 116 PRO A HG3  1  
ATOM 1724  H HD2  . PRO A 1 116 ? -21.663 2.706   21.046  1.00 0.00 ? 116 PRO A HD2  1  
ATOM 1725  H HD3  . PRO A 1 116 ? -20.329 3.614   20.362  1.00 0.00 ? 116 PRO A HD3  1  
ATOM 1726  N N    . SER A 1 117 ? -19.412 -1.631  21.761  1.00 0.00 ? 117 SER A N    1  
ATOM 1727  C CA   . SER A 1 117 ? -20.042 -2.876  22.167  1.00 0.00 ? 117 SER A CA   1  
ATOM 1728  C C    . SER A 1 117 ? -21.131 -3.262  21.165  1.00 0.00 ? 117 SER A C    1  
ATOM 1729  O O    . SER A 1 117 ? -21.033 -4.293  20.502  1.00 0.00 ? 117 SER A O    1  
ATOM 1730  C CB   . SER A 1 117 ? -20.631 -2.762  23.574  1.00 0.00 ? 117 SER A CB   1  
ATOM 1731  O OG   . SER A 1 117 ? -20.873 -4.040  24.156  1.00 0.00 ? 117 SER A OG   1  
ATOM 1732  H H    . SER A 1 117 ? -18.477 -1.722  21.419  1.00 0.00 ? 117 SER A H    1  
ATOM 1733  H HA   . SER A 1 117 ? -19.242 -3.616  22.167  1.00 0.00 ? 117 SER A HA   1  
ATOM 1734  H HB2  . SER A 1 117 ? -19.948 -2.198  24.209  1.00 0.00 ? 117 SER A HB2  1  
ATOM 1735  H HB3  . SER A 1 117 ? -21.564 -2.200  23.532  1.00 0.00 ? 117 SER A HB3  1  
ATOM 1736  H HG   . SER A 1 117 ? -21.771 -4.050  24.597  1.00 0.00 ? 117 SER A HG   1  
ATOM 1737  N N    . SER A 1 118 ? -22.146 -2.413  21.085  1.00 0.00 ? 118 SER A N    1  
ATOM 1738  C CA   . SER A 1 118 ? -23.253 -2.653  20.175  1.00 0.00 ? 118 SER A CA   1  
ATOM 1739  C C    . SER A 1 118 ? -24.169 -1.428  20.132  1.00 0.00 ? 118 SER A C    1  
ATOM 1740  O O    . SER A 1 118 ? -24.392 -0.852  19.069  1.00 0.00 ? 118 SER A O    1  
ATOM 1741  C CB   . SER A 1 118 ? -24.045 -3.895  20.587  1.00 0.00 ? 118 SER A CB   1  
ATOM 1742  O OG   . SER A 1 118 ? -24.413 -3.862  21.963  1.00 0.00 ? 118 SER A OG   1  
ATOM 1743  H H    . SER A 1 118 ? -22.218 -1.576  21.628  1.00 0.00 ? 118 SER A H    1  
ATOM 1744  H HA   . SER A 1 118 ? -22.794 -2.821  19.201  1.00 0.00 ? 118 SER A HA   1  
ATOM 1745  H HB2  . SER A 1 118 ? -24.943 -3.972  19.974  1.00 0.00 ? 118 SER A HB2  1  
ATOM 1746  H HB3  . SER A 1 118 ? -23.449 -4.786  20.392  1.00 0.00 ? 118 SER A HB3  1  
ATOM 1747  H HG   . SER A 1 118 ? -25.260 -4.375  22.103  1.00 0.00 ? 118 SER A HG   1  
ATOM 1748  N N    . GLY A 1 119 ? -24.676 -1.067  21.302  1.00 0.00 ? 119 GLY A N    1  
ATOM 1749  C CA   . GLY A 1 119 ? -25.563 0.078   21.412  1.00 0.00 ? 119 GLY A CA   1  
ATOM 1750  C C    . GLY A 1 119 ? -26.648 0.037   20.333  1.00 0.00 ? 119 GLY A C    1  
ATOM 1751  O O    . GLY A 1 119 ? -27.745 -0.465  20.570  1.00 0.00 ? 119 GLY A O    1  
ATOM 1752  H H    . GLY A 1 119 ? -24.490 -1.541  22.163  1.00 0.00 ? 119 GLY A H    1  
ATOM 1753  H HA2  . GLY A 1 119 ? -26.027 0.091   22.398  1.00 0.00 ? 119 GLY A HA2  1  
ATOM 1754  H HA3  . GLY A 1 119 ? -24.988 0.999   21.318  1.00 0.00 ? 119 GLY A HA3  1  
ATOM 1755  N N    . GLY A 1 1   ? 19.888  -6.705  4.371   1.00 0.00 ? 1   GLY A N    2  
ATOM 1756  C CA   . GLY A 1 1   ? 19.202  -6.811  3.095   1.00 0.00 ? 1   GLY A CA   2  
ATOM 1757  C C    . GLY A 1 1   ? 18.745  -8.248  2.835   1.00 0.00 ? 1   GLY A C    2  
ATOM 1758  O O    . GLY A 1 1   ? 19.521  -9.072  2.353   1.00 0.00 ? 1   GLY A O    2  
ATOM 1759  H H1   . GLY A 1 1   ? 20.141  -7.578  4.789   1.00 0.00 ? 1   GLY A H1   2  
ATOM 1760  H HA2  . GLY A 1 1   ? 18.340  -6.144  3.085   1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1761  H HA3  . GLY A 1 1   ? 19.865  -6.486  2.293   1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1762  N N    . SER A 1 2   ? 17.488  -8.504  3.167   1.00 0.00 ? 2   SER A N    2  
ATOM 1763  C CA   . SER A 1 2   ? 16.919  -9.828  2.975   1.00 0.00 ? 2   SER A CA   2  
ATOM 1764  C C    . SER A 1 2   ? 15.543  -9.715  2.316   1.00 0.00 ? 2   SER A C    2  
ATOM 1765  O O    . SER A 1 2   ? 14.831  -8.732  2.520   1.00 0.00 ? 2   SER A O    2  
ATOM 1766  C CB   . SER A 1 2   ? 16.811  -10.578 4.304   1.00 0.00 ? 2   SER A CB   2  
ATOM 1767  O OG   . SER A 1 2   ? 17.588  -11.772 4.308   1.00 0.00 ? 2   SER A OG   2  
ATOM 1768  H H    . SER A 1 2   ? 16.864  -7.828  3.558   1.00 0.00 ? 2   SER A H    2  
ATOM 1769  H HA   . SER A 1 2   ? 17.616  -10.350 2.320   1.00 0.00 ? 2   SER A HA   2  
ATOM 1770  H HB2  . SER A 1 2   ? 17.141  -9.928  5.115   1.00 0.00 ? 2   SER A HB2  2  
ATOM 1771  H HB3  . SER A 1 2   ? 15.767  -10.824 4.498   1.00 0.00 ? 2   SER A HB3  2  
ATOM 1772  H HG   . SER A 1 2   ? 17.027  -12.544 4.609   1.00 0.00 ? 2   SER A HG   2  
ATOM 1773  N N    . SER A 1 3   ? 15.209  -10.735 1.539   1.00 0.00 ? 3   SER A N    2  
ATOM 1774  C CA   . SER A 1 3   ? 13.931  -10.762 0.848   1.00 0.00 ? 3   SER A CA   2  
ATOM 1775  C C    . SER A 1 3   ? 13.345  -12.175 0.889   1.00 0.00 ? 3   SER A C    2  
ATOM 1776  O O    . SER A 1 3   ? 14.035  -13.127 1.251   1.00 0.00 ? 3   SER A O    2  
ATOM 1777  C CB   . SER A 1 3   ? 14.077  -10.290 -0.600  1.00 0.00 ? 3   SER A CB   2  
ATOM 1778  O OG   . SER A 1 3   ? 12.843  -10.354 -1.310  1.00 0.00 ? 3   SER A OG   2  
ATOM 1779  H H    . SER A 1 3   ? 15.794  -11.530 1.378   1.00 0.00 ? 3   SER A H    2  
ATOM 1780  H HA   . SER A 1 3   ? 13.293  -10.067 1.394   1.00 0.00 ? 3   SER A HA   2  
ATOM 1781  H HB2  . SER A 1 3   ? 14.449  -9.265  -0.611  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1782  H HB3  . SER A 1 3   ? 14.821  -10.904 -1.109  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1783  H HG   . SER A 1 3   ? 12.339  -9.498  -1.198  1.00 0.00 ? 3   SER A HG   2  
ATOM 1784  N N    . GLY A 1 4   ? 12.078  -12.266 0.512   1.00 0.00 ? 4   GLY A N    2  
ATOM 1785  C CA   . GLY A 1 4   ? 11.391  -13.547 0.501   1.00 0.00 ? 4   GLY A CA   2  
ATOM 1786  C C    . GLY A 1 4   ? 11.264  -14.088 -0.925  1.00 0.00 ? 4   GLY A C    2  
ATOM 1787  O O    . GLY A 1 4   ? 11.627  -13.411 -1.885  1.00 0.00 ? 4   GLY A O    2  
ATOM 1788  H H    . GLY A 1 4   ? 11.524  -11.487 0.218   1.00 0.00 ? 4   GLY A H    2  
ATOM 1789  H HA2  . GLY A 1 4   ? 11.937  -14.261 1.117   1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1790  H HA3  . GLY A 1 4   ? 10.401  -13.436 0.941   1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1791  N N    . SER A 1 5   ? 10.746  -15.305 -1.017  1.00 0.00 ? 5   SER A N    2  
ATOM 1792  C CA   . SER A 1 5   ? 10.566  -15.945 -2.309  1.00 0.00 ? 5   SER A CA   2  
ATOM 1793  C C    . SER A 1 5   ? 11.909  -16.043 -3.037  1.00 0.00 ? 5   SER A C    2  
ATOM 1794  O O    . SER A 1 5   ? 12.872  -15.374 -2.663  1.00 0.00 ? 5   SER A O    2  
ATOM 1795  C CB   . SER A 1 5   ? 9.553   -15.182 -3.165  1.00 0.00 ? 5   SER A CB   2  
ATOM 1796  O OG   . SER A 1 5   ? 10.156  -14.098 -3.867  1.00 0.00 ? 5   SER A OG   2  
ATOM 1797  H H    . SER A 1 5   ? 10.454  -15.849 -0.231  1.00 0.00 ? 5   SER A H    2  
ATOM 1798  H HA   . SER A 1 5   ? 10.178  -16.939 -2.087  1.00 0.00 ? 5   SER A HA   2  
ATOM 1799  H HB2  . SER A 1 5   ? 9.094   -15.866 -3.880  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1800  H HB3  . SER A 1 5   ? 8.754   -14.802 -2.529  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1801  H HG   . SER A 1 5   ? 10.206  -14.309 -4.844  1.00 0.00 ? 5   SER A HG   2  
ATOM 1802  N N    . SER A 1 6   ? 11.930  -16.881 -4.062  1.00 0.00 ? 6   SER A N    2  
ATOM 1803  C CA   . SER A 1 6   ? 13.139  -17.075 -4.845  1.00 0.00 ? 6   SER A CA   2  
ATOM 1804  C C    . SER A 1 6   ? 12.906  -16.624 -6.288  1.00 0.00 ? 6   SER A C    2  
ATOM 1805  O O    . SER A 1 6   ? 13.592  -15.731 -6.782  1.00 0.00 ? 6   SER A O    2  
ATOM 1806  C CB   . SER A 1 6   ? 13.588  -18.537 -4.812  1.00 0.00 ? 6   SER A CB   2  
ATOM 1807  O OG   . SER A 1 6   ? 15.007  -18.661 -4.853  1.00 0.00 ? 6   SER A OG   2  
ATOM 1808  H H    . SER A 1 6   ? 11.143  -17.421 -4.359  1.00 0.00 ? 6   SER A H    2  
ATOM 1809  H HA   . SER A 1 6   ? 13.895  -16.453 -4.367  1.00 0.00 ? 6   SER A HA   2  
ATOM 1810  H HB2  . SER A 1 6   ? 13.208  -19.013 -3.908  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1811  H HB3  . SER A 1 6   ? 13.153  -19.069 -5.658  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1812  H HG   . SER A 1 6   ? 15.311  -19.330 -4.174  1.00 0.00 ? 6   SER A HG   2  
ATOM 1813  N N    . GLY A 1 7   ? 11.934  -17.262 -6.924  1.00 0.00 ? 7   GLY A N    2  
ATOM 1814  C CA   . GLY A 1 7   ? 11.602  -16.938 -8.301  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1815  C C    . GLY A 1 7   ? 12.316  -17.878 -9.274  1.00 0.00 ? 7   GLY A C    2  
ATOM 1816  O O    . GLY A 1 7   ? 13.482  -17.668 -9.604  1.00 0.00 ? 7   GLY A O    2  
ATOM 1817  H H    . GLY A 1 7   ? 11.380  -17.987 -6.516  1.00 0.00 ? 7   GLY A H    2  
ATOM 1818  H HA2  . GLY A 1 7   ? 10.524  -17.009 -8.445  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1819  H HA3  . GLY A 1 7   ? 11.884  -15.906 -8.514  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1820  N N    . PRO A 1 8   ? 11.567  -18.923 -9.717  1.00 0.00 ? 8   PRO A N    2  
ATOM 1821  C CA   . PRO A 1 8   ? 12.115  -19.897 -10.646 1.00 0.00 ? 8   PRO A CA   2  
ATOM 1822  C C    . PRO A 1 8   ? 12.205  -19.317 -12.059 1.00 0.00 ? 8   PRO A C    2  
ATOM 1823  O O    . PRO A 1 8   ? 11.508  -18.358 -12.386 1.00 0.00 ? 8   PRO A O    2  
ATOM 1824  C CB   . PRO A 1 8   ? 11.185  -21.096 -10.554 1.00 0.00 ? 8   PRO A CB   2  
ATOM 1825  C CG   . PRO A 1 8   ? 9.898   -20.578 -9.933  1.00 0.00 ? 8   PRO A CG   2  
ATOM 1826  C CD   . PRO A 1 8   ? 10.182  -19.204 -9.348  1.00 0.00 ? 8   PRO A CD   2  
ATOM 1827  H HA   . PRO A 1 8   ? 13.052  -20.134 -10.387 1.00 0.00 ? 8   PRO A HA   2  
ATOM 1828  H HB2  . PRO A 1 8   ? 11.000  -21.523 -11.539 1.00 0.00 ? 8   PRO A HB2  2  
ATOM 1829  H HB3  . PRO A 1 8   ? 11.624  -21.885 -9.942  1.00 0.00 ? 8   PRO A HB3  2  
ATOM 1830  H HG2  . PRO A 1 8   ? 9.110   -20.518 -10.683 1.00 0.00 ? 8   PRO A HG2  2  
ATOM 1831  H HG3  . PRO A 1 8   ? 9.548   -21.259 -9.157  1.00 0.00 ? 8   PRO A HG3  2  
ATOM 1832  H HD2  . PRO A 1 8   ? 9.504   -18.453 -9.753  1.00 0.00 ? 8   PRO A HD2  2  
ATOM 1833  H HD3  . PRO A 1 8   ? 10.053  -19.200 -8.266  1.00 0.00 ? 8   PRO A HD3  2  
ATOM 1834  N N    . GLN A 1 9   ? 13.070  -19.923 -12.859 1.00 0.00 ? 9   GLN A N    2  
ATOM 1835  C CA   . GLN A 1 9   ? 13.261  -19.479 -14.229 1.00 0.00 ? 9   GLN A CA   2  
ATOM 1836  C C    . GLN A 1 9   ? 13.561  -17.980 -14.264 1.00 0.00 ? 9   GLN A C    2  
ATOM 1837  O O    . GLN A 1 9   ? 12.645  -17.159 -14.275 1.00 0.00 ? 9   GLN A O    2  
ATOM 1838  C CB   . GLN A 1 9   ? 12.040  -19.814 -15.088 1.00 0.00 ? 9   GLN A CB   2  
ATOM 1839  C CG   . GLN A 1 9   ? 11.912  -21.325 -15.294 1.00 0.00 ? 9   GLN A CG   2  
ATOM 1840  C CD   . GLN A 1 9   ? 10.450  -21.728 -15.498 1.00 0.00 ? 9   GLN A CD   2  
ATOM 1841  O OE1  . GLN A 1 9   ? 9.945   -21.790 -16.607 1.00 0.00 ? 9   GLN A OE1  2  
ATOM 1842  N NE2  . GLN A 1 9   ? 9.800   -21.998 -14.370 1.00 0.00 ? 9   GLN A NE2  2  
ATOM 1843  H H    . GLN A 1 9   ? 13.634  -20.703 -12.585 1.00 0.00 ? 9   GLN A H    2  
ATOM 1844  H HA   . GLN A 1 9   ? 14.121  -20.038 -14.598 1.00 0.00 ? 9   GLN A HA   2  
ATOM 1845  H HB2  . GLN A 1 9   ? 11.138  -19.431 -14.610 1.00 0.00 ? 9   GLN A HB2  2  
ATOM 1846  H HB3  . GLN A 1 9   ? 12.124  -19.318 -16.055 1.00 0.00 ? 9   GLN A HB3  2  
ATOM 1847  H HG2  . GLN A 1 9   ? 12.501  -21.629 -16.159 1.00 0.00 ? 9   GLN A HG2  2  
ATOM 1848  H HG3  . GLN A 1 9   ? 12.320  -21.849 -14.430 1.00 0.00 ? 9   GLN A HG3  2  
ATOM 1849  H HE21 . GLN A 1 9   ? 10.273  -21.927 -13.491 1.00 0.00 ? 9   GLN A HE21 2  
ATOM 1850  H HE22 . GLN A 1 9   ? 8.839   -22.271 -14.399 1.00 0.00 ? 9   GLN A HE22 2  
ATOM 1851  N N    . LEU A 1 10  ? 14.849  -17.667 -14.280 1.00 0.00 ? 10  LEU A N    2  
ATOM 1852  C CA   . LEU A 1 10  ? 15.282  -16.280 -14.314 1.00 0.00 ? 10  LEU A CA   2  
ATOM 1853  C C    . LEU A 1 10  ? 16.242  -16.079 -15.488 1.00 0.00 ? 10  LEU A C    2  
ATOM 1854  O O    . LEU A 1 10  ? 16.609  -17.037 -16.166 1.00 0.00 ? 10  LEU A O    2  
ATOM 1855  C CB   . LEU A 1 10  ? 15.868  -15.869 -12.962 1.00 0.00 ? 10  LEU A CB   2  
ATOM 1856  C CG   . LEU A 1 10  ? 14.981  -14.981 -12.088 1.00 0.00 ? 10  LEU A CG   2  
ATOM 1857  C CD1  . LEU A 1 10  ? 14.771  -13.610 -12.735 1.00 0.00 ? 10  LEU A CD1  2  
ATOM 1858  C CD2  . LEU A 1 10  ? 13.655  -15.674 -11.770 1.00 0.00 ? 10  LEU A CD2  2  
ATOM 1859  H H    . LEU A 1 10  ? 15.588  -18.340 -14.271 1.00 0.00 ? 10  LEU A H    2  
ATOM 1860  H HA   . LEU A 1 10  ? 14.397  -15.666 -14.481 1.00 0.00 ? 10  LEU A HA   2  
ATOM 1861  H HB2  . LEU A 1 10  ? 16.107  -16.773 -12.402 1.00 0.00 ? 10  LEU A HB2  2  
ATOM 1862  H HB3  . LEU A 1 10  ? 16.809  -15.347 -13.140 1.00 0.00 ? 10  LEU A HB3  2  
ATOM 1863  H HG   . LEU A 1 10  ? 15.493  -14.814 -11.140 1.00 0.00 ? 10  LEU A HG   2  
ATOM 1864  H HD11 . LEU A 1 10  ? 15.621  -12.967 -12.508 1.00 0.00 ? 10  LEU A HD11 2  
ATOM 1865  H HD12 . LEU A 1 10  ? 14.682  -13.728 -13.815 1.00 0.00 ? 10  LEU A HD12 2  
ATOM 1866  H HD13 . LEU A 1 10  ? 13.859  -13.159 -12.342 1.00 0.00 ? 10  LEU A HD13 2  
ATOM 1867  H HD21 . LEU A 1 10  ? 13.665  -16.683 -12.181 1.00 0.00 ? 10  LEU A HD21 2  
ATOM 1868  H HD22 . LEU A 1 10  ? 13.521  -15.723 -10.689 1.00 0.00 ? 10  LEU A HD22 2  
ATOM 1869  H HD23 . LEU A 1 10  ? 12.834  -15.109 -12.213 1.00 0.00 ? 10  LEU A HD23 2  
ATOM 1870  N N    . VAL A 1 11  ? 16.621  -14.826 -15.692 1.00 0.00 ? 11  VAL A N    2  
ATOM 1871  C CA   . VAL A 1 11  ? 17.532  -14.486 -16.772 1.00 0.00 ? 11  VAL A CA   2  
ATOM 1872  C C    . VAL A 1 11  ? 18.157  -13.117 -16.495 1.00 0.00 ? 11  VAL A C    2  
ATOM 1873  O O    . VAL A 1 11  ? 17.622  -12.334 -15.712 1.00 0.00 ? 11  VAL A O    2  
ATOM 1874  C CB   . VAL A 1 11  ? 16.798  -14.548 -18.114 1.00 0.00 ? 11  VAL A CB   2  
ATOM 1875  C CG1  . VAL A 1 11  ? 15.728  -13.458 -18.204 1.00 0.00 ? 11  VAL A CG1  2  
ATOM 1876  C CG2  . VAL A 1 11  ? 17.782  -14.449 -19.281 1.00 0.00 ? 11  VAL A CG2  2  
ATOM 1877  H H    . VAL A 1 11  ? 16.318  -14.052 -15.136 1.00 0.00 ? 11  VAL A H    2  
ATOM 1878  H HA   . VAL A 1 11  ? 18.322  -15.237 -16.785 1.00 0.00 ? 11  VAL A HA   2  
ATOM 1879  H HB   . VAL A 1 11  ? 16.298  -15.514 -18.178 1.00 0.00 ? 11  VAL A HB   2  
ATOM 1880  H HG11 . VAL A 1 11  ? 14.946  -13.773 -18.895 1.00 0.00 ? 11  VAL A HG11 2  
ATOM 1881  H HG12 . VAL A 1 11  ? 15.295  -13.291 -17.218 1.00 0.00 ? 11  VAL A HG12 2  
ATOM 1882  H HG13 . VAL A 1 11  ? 16.180  -12.534 -18.564 1.00 0.00 ? 11  VAL A HG13 2  
ATOM 1883  H HG21 . VAL A 1 11  ? 17.872  -13.408 -19.593 1.00 0.00 ? 11  VAL A HG21 2  
ATOM 1884  H HG22 . VAL A 1 11  ? 18.757  -14.820 -18.967 1.00 0.00 ? 11  VAL A HG22 2  
ATOM 1885  H HG23 . VAL A 1 11  ? 17.417  -15.048 -20.116 1.00 0.00 ? 11  VAL A HG23 2  
ATOM 1886  N N    . ARG A 1 12  ? 19.280  -12.871 -17.154 1.00 0.00 ? 12  ARG A N    2  
ATOM 1887  C CA   . ARG A 1 12  ? 19.984  -11.611 -16.988 1.00 0.00 ? 12  ARG A CA   2  
ATOM 1888  C C    . ARG A 1 12  ? 18.986  -10.454 -16.897 1.00 0.00 ? 12  ARG A C    2  
ATOM 1889  O O    . ARG A 1 12  ? 17.915  -10.504 -17.500 1.00 0.00 ? 12  ARG A O    2  
ATOM 1890  C CB   . ARG A 1 12  ? 20.942  -11.358 -18.153 1.00 0.00 ? 12  ARG A CB   2  
ATOM 1891  C CG   . ARG A 1 12  ? 22.383  -11.687 -17.759 1.00 0.00 ? 12  ARG A CG   2  
ATOM 1892  C CD   . ARG A 1 12  ? 23.371  -11.161 -18.803 1.00 0.00 ? 12  ARG A CD   2  
ATOM 1893  N NE   . ARG A 1 12  ? 24.520  -10.513 -18.131 1.00 0.00 ? 12  ARG A NE   2  
ATOM 1894  C CZ   . ARG A 1 12  ? 25.464  -11.177 -17.450 1.00 0.00 ? 12  ARG A CZ   2  
ATOM 1895  N NH1  . ARG A 1 12  ? 25.401  -12.512 -17.346 1.00 0.00 ? 12  ARG A NH1  2  
ATOM 1896  N NH2  . ARG A 1 12  ? 26.470  -10.507 -16.873 1.00 0.00 ? 12  ARG A NH2  2  
ATOM 1897  H H    . ARG A 1 12  ? 19.708  -13.514 -17.789 1.00 0.00 ? 12  ARG A H    2  
ATOM 1898  H HA   . ARG A 1 12  ? 20.541  -11.722 -16.058 1.00 0.00 ? 12  ARG A HA   2  
ATOM 1899  H HB2  . ARG A 1 12  ? 20.648  -11.965 -19.009 1.00 0.00 ? 12  ARG A HB2  2  
ATOM 1900  H HB3  . ARG A 1 12  ? 20.875  -10.315 -18.464 1.00 0.00 ? 12  ARG A HB3  2  
ATOM 1901  H HG2  . ARG A 1 12  ? 22.608  -11.248 -16.787 1.00 0.00 ? 12  ARG A HG2  2  
ATOM 1902  H HG3  . ARG A 1 12  ? 22.498  -12.766 -17.655 1.00 0.00 ? 12  ARG A HG3  2  
ATOM 1903  H HD2  . ARG A 1 12  ? 23.721  -11.981 -19.430 1.00 0.00 ? 12  ARG A HD2  2  
ATOM 1904  H HD3  . ARG A 1 12  ? 22.873  -10.448 -19.459 1.00 0.00 ? 12  ARG A HD3  2  
ATOM 1905  H HE   . ARG A 1 12  ? 24.597  -9.518  -18.190 1.00 0.00 ? 12  ARG A HE   2  
ATOM 1906  H HH11 . ARG A 1 12  ? 24.650  -13.012 -17.776 1.00 0.00 ? 12  ARG A HH11 2  
ATOM 1907  H HH12 . ARG A 1 12  ? 26.106  -13.007 -16.837 1.00 0.00 ? 12  ARG A HH12 2  
ATOM 1908  H HH21 . ARG A 1 12  ? 26.517  -9.511  -16.951 1.00 0.00 ? 12  ARG A HH21 2  
ATOM 1909  H HH22 . ARG A 1 12  ? 27.175  -11.002 -16.365 1.00 0.00 ? 12  ARG A HH22 2  
ATOM 1910  N N    . THR A 1 13  ? 19.373  -9.439  -16.138 1.00 0.00 ? 13  THR A N    2  
ATOM 1911  C CA   . THR A 1 13  ? 18.526  -8.272  -15.960 1.00 0.00 ? 13  THR A CA   2  
ATOM 1912  C C    . THR A 1 13  ? 19.290  -7.165  -15.231 1.00 0.00 ? 13  THR A C    2  
ATOM 1913  O O    . THR A 1 13  ? 20.356  -7.409  -14.667 1.00 0.00 ? 13  THR A O    2  
ATOM 1914  C CB   . THR A 1 13  ? 17.257  -8.716  -15.230 1.00 0.00 ? 13  THR A CB   2  
ATOM 1915  O OG1  . THR A 1 13  ? 16.687  -7.500  -14.754 1.00 0.00 ? 13  THR A OG1  2  
ATOM 1916  C CG2  . THR A 1 13  ? 17.560  -9.509  -13.957 1.00 0.00 ? 13  THR A CG2  2  
ATOM 1917  H H    . THR A 1 13  ? 20.246  -9.407  -15.651 1.00 0.00 ? 13  THR A H    2  
ATOM 1918  H HA   . THR A 1 13  ? 18.264  -7.885  -16.944 1.00 0.00 ? 13  THR A HA   2  
ATOM 1919  H HB   . THR A 1 13  ? 16.603  -9.281  -15.895 1.00 0.00 ? 13  THR A HB   2  
ATOM 1920  H HG1  . THR A 1 13  ? 16.278  -6.994  -15.514 1.00 0.00 ? 13  THR A HG1  2  
ATOM 1921  H HG21 . THR A 1 13  ? 18.547  -9.234  -13.584 1.00 0.00 ? 13  THR A HG21 2  
ATOM 1922  H HG22 . THR A 1 13  ? 16.809  -9.281  -13.200 1.00 0.00 ? 13  THR A HG22 2  
ATOM 1923  H HG23 . THR A 1 13  ? 17.540  -10.575 -14.180 1.00 0.00 ? 13  THR A HG23 2  
ATOM 1924  N N    . HIS A 1 14  ? 18.716  -5.972  -15.267 1.00 0.00 ? 14  HIS A N    2  
ATOM 1925  C CA   . HIS A 1 14  ? 19.329  -4.826  -14.617 1.00 0.00 ? 14  HIS A CA   2  
ATOM 1926  C C    . HIS A 1 14  ? 18.301  -3.702  -14.480 1.00 0.00 ? 14  HIS A C    2  
ATOM 1927  O O    . HIS A 1 14  ? 18.233  -2.812  -15.327 1.00 0.00 ? 14  HIS A O    2  
ATOM 1928  C CB   . HIS A 1 14  ? 20.591  -4.388  -15.364 1.00 0.00 ? 14  HIS A CB   2  
ATOM 1929  C CG   . HIS A 1 14  ? 21.856  -4.489  -14.545 1.00 0.00 ? 14  HIS A CG   2  
ATOM 1930  N ND1  . HIS A 1 14  ? 22.896  -5.340  -14.875 1.00 0.00 ? 14  HIS A ND1  2  
ATOM 1931  C CD2  . HIS A 1 14  ? 22.236  -3.836  -13.410 1.00 0.00 ? 14  HIS A CD2  2  
ATOM 1932  C CE1  . HIS A 1 14  ? 23.854  -5.199  -13.971 1.00 0.00 ? 14  HIS A CE1  2  
ATOM 1933  N NE2  . HIS A 1 14  ? 23.443  -4.267  -13.063 1.00 0.00 ? 14  HIS A NE2  2  
ATOM 1934  H H    . HIS A 1 14  ? 17.849  -5.782  -15.728 1.00 0.00 ? 14  HIS A H    2  
ATOM 1935  H HA   . HIS A 1 14  ? 19.630  -5.155  -13.622 1.00 0.00 ? 14  HIS A HA   2  
ATOM 1936  H HB2  . HIS A 1 14  ? 20.700  -5.000  -16.260 1.00 0.00 ? 14  HIS A HB2  2  
ATOM 1937  H HB3  . HIS A 1 14  ? 20.465  -3.358  -15.695 1.00 0.00 ? 14  HIS A HB3  2  
ATOM 1938  H HD1  . HIS A 1 14  ? 22.921  -5.957  -15.661 1.00 0.00 ? 14  HIS A HD1  2  
ATOM 1939  H HD2  . HIS A 1 14  ? 21.649  -3.088  -12.877 1.00 0.00 ? 14  HIS A HD2  2  
ATOM 1940  H HE1  . HIS A 1 14  ? 24.804  -5.733  -13.955 1.00 0.00 ? 14  HIS A HE1  2  
ATOM 1941  N N    . GLU A 1 15  ? 17.526  -3.778  -13.408 1.00 0.00 ? 15  GLU A N    2  
ATOM 1942  C CA   . GLU A 1 15  ? 16.504  -2.778  -13.150 1.00 0.00 ? 15  GLU A CA   2  
ATOM 1943  C C    . GLU A 1 15  ? 17.075  -1.646  -12.294 1.00 0.00 ? 15  GLU A C    2  
ATOM 1944  O O    . GLU A 1 15  ? 17.627  -1.890  -11.222 1.00 0.00 ? 15  GLU A O    2  
ATOM 1945  C CB   . GLU A 1 15  ? 15.279  -3.406  -12.483 1.00 0.00 ? 15  GLU A CB   2  
ATOM 1946  C CG   . GLU A 1 15  ? 14.266  -3.876  -13.529 1.00 0.00 ? 15  GLU A CG   2  
ATOM 1947  C CD   . GLU A 1 15  ? 13.682  -5.239  -13.153 1.00 0.00 ? 15  GLU A CD   2  
ATOM 1948  O OE1  . GLU A 1 15  ? 13.113  -5.326  -12.043 1.00 0.00 ? 15  GLU A OE1  2  
ATOM 1949  O OE2  . GLU A 1 15  ? 13.817  -6.164  -13.984 1.00 0.00 ? 15  GLU A OE2  2  
ATOM 1950  H H    . GLU A 1 15  ? 17.588  -4.506  -12.725 1.00 0.00 ? 15  GLU A H    2  
ATOM 1951  H HA   . GLU A 1 15  ? 16.220  -2.394  -14.130 1.00 0.00 ? 15  GLU A HA   2  
ATOM 1952  H HB2  . GLU A 1 15  ? 15.588  -4.250  -11.866 1.00 0.00 ? 15  GLU A HB2  2  
ATOM 1953  H HB3  . GLU A 1 15  ? 14.810  -2.680  -11.819 1.00 0.00 ? 15  GLU A HB3  2  
ATOM 1954  H HG2  . GLU A 1 15  ? 13.463  -3.144  -13.618 1.00 0.00 ? 15  GLU A HG2  2  
ATOM 1955  H HG3  . GLU A 1 15  ? 14.748  -3.940  -14.505 1.00 0.00 ? 15  GLU A HG3  2  
ATOM 1956  N N    . ASP A 1 16  ? 16.921  -0.430  -12.799 1.00 0.00 ? 16  ASP A N    2  
ATOM 1957  C CA   . ASP A 1 16  ? 17.414  0.741   -12.093 1.00 0.00 ? 16  ASP A CA   2  
ATOM 1958  C C    . ASP A 1 16  ? 16.571  0.966   -10.836 1.00 0.00 ? 16  ASP A C    2  
ATOM 1959  O O    . ASP A 1 16  ? 17.086  1.412   -9.812  1.00 0.00 ? 16  ASP A O    2  
ATOM 1960  C CB   . ASP A 1 16  ? 17.307  1.994   -12.965 1.00 0.00 ? 16  ASP A CB   2  
ATOM 1961  C CG   . ASP A 1 16  ? 18.137  3.186   -12.487 1.00 0.00 ? 16  ASP A CG   2  
ATOM 1962  O OD1  . ASP A 1 16  ? 18.559  3.149   -11.311 1.00 0.00 ? 16  ASP A OD1  2  
ATOM 1963  O OD2  . ASP A 1 16  ? 18.332  4.108   -13.308 1.00 0.00 ? 16  ASP A OD2  2  
ATOM 1964  H H    . ASP A 1 16  ? 16.471  -0.240  -13.671 1.00 0.00 ? 16  ASP A H    2  
ATOM 1965  H HA   . ASP A 1 16  ? 18.456  0.519   -11.863 1.00 0.00 ? 16  ASP A HA   2  
ATOM 1966  H HB2  . ASP A 1 16  ? 17.614  1.740   -13.979 1.00 0.00 ? 16  ASP A HB2  2  
ATOM 1967  H HB3  . ASP A 1 16  ? 16.261  2.295   -13.014 1.00 0.00 ? 16  ASP A HB3  2  
ATOM 1968  N N    . VAL A 1 17  ? 15.291  0.646   -10.956 1.00 0.00 ? 17  VAL A N    2  
ATOM 1969  C CA   . VAL A 1 17  ? 14.372  0.808   -9.842  1.00 0.00 ? 17  VAL A CA   2  
ATOM 1970  C C    . VAL A 1 17  ? 14.422  -0.442  -8.960  1.00 0.00 ? 17  VAL A C    2  
ATOM 1971  O O    . VAL A 1 17  ? 14.937  -1.479  -9.375  1.00 0.00 ? 17  VAL A O    2  
ATOM 1972  C CB   . VAL A 1 17  ? 12.967  1.116   -10.362 1.00 0.00 ? 17  VAL A CB   2  
ATOM 1973  C CG1  . VAL A 1 17  ? 12.823  2.600   -10.705 1.00 0.00 ? 17  VAL A CG1  2  
ATOM 1974  C CG2  . VAL A 1 17  ? 12.625  0.239   -11.569 1.00 0.00 ? 17  VAL A CG2  2  
ATOM 1975  H H    . VAL A 1 17  ? 14.881  0.283   -11.792 1.00 0.00 ? 17  VAL A H    2  
ATOM 1976  H HA   . VAL A 1 17  ? 14.711  1.663   -9.257  1.00 0.00 ? 17  VAL A HA   2  
ATOM 1977  H HB   . VAL A 1 17  ? 12.257  0.885   -9.568  1.00 0.00 ? 17  VAL A HB   2  
ATOM 1978  H HG11 . VAL A 1 17  ? 13.779  2.986   -11.060 1.00 0.00 ? 17  VAL A HG11 2  
ATOM 1979  H HG12 . VAL A 1 17  ? 12.070  2.722   -11.483 1.00 0.00 ? 17  VAL A HG12 2  
ATOM 1980  H HG13 . VAL A 1 17  ? 12.518  3.151   -9.815  1.00 0.00 ? 17  VAL A HG13 2  
ATOM 1981  H HG21 . VAL A 1 17  ? 11.543  0.206   -11.698 1.00 0.00 ? 17  VAL A HG21 2  
ATOM 1982  H HG22 . VAL A 1 17  ? 13.086  0.657   -12.464 1.00 0.00 ? 17  VAL A HG22 2  
ATOM 1983  H HG23 . VAL A 1 17  ? 13.002  -0.770  -11.403 1.00 0.00 ? 17  VAL A HG23 2  
ATOM 1984  N N    . PRO A 1 18  ? 13.866  -0.298  -7.727  1.00 0.00 ? 18  PRO A N    2  
ATOM 1985  C CA   . PRO A 1 18  ? 13.842  -1.402  -6.783  1.00 0.00 ? 18  PRO A CA   2  
ATOM 1986  C C    . PRO A 1 18  ? 12.786  -2.437  -7.177  1.00 0.00 ? 18  PRO A C    2  
ATOM 1987  O O    . PRO A 1 18  ? 12.102  -2.278  -8.187  1.00 0.00 ? 18  PRO A O    2  
ATOM 1988  C CB   . PRO A 1 18  ? 13.570  -0.760  -5.433  1.00 0.00 ? 18  PRO A CB   2  
ATOM 1989  C CG   . PRO A 1 18  ? 12.992  0.614   -5.734  1.00 0.00 ? 18  PRO A CG   2  
ATOM 1990  C CD   . PRO A 1 18  ? 13.248  0.916   -7.201  1.00 0.00 ? 18  PRO A CD   2  
ATOM 1991  H HA   . PRO A 1 18  ? 14.717  -1.887  -6.794  1.00 0.00 ? 18  PRO A HA   2  
ATOM 1992  H HB2  . PRO A 1 18  ? 12.870  -1.359  -4.849  1.00 0.00 ? 18  PRO A HB2  2  
ATOM 1993  H HB3  . PRO A 1 18  ? 14.486  -0.679  -4.847  1.00 0.00 ? 18  PRO A HB3  2  
ATOM 1994  H HG2  . PRO A 1 18  ? 11.923  0.633   -5.520  1.00 0.00 ? 18  PRO A HG2  2  
ATOM 1995  H HG3  . PRO A 1 18  ? 13.457  1.370   -5.102  1.00 0.00 ? 18  PRO A HG3  2  
ATOM 1996  H HD2  . PRO A 1 18  ? 12.320  1.146   -7.725  1.00 0.00 ? 18  PRO A HD2  2  
ATOM 1997  H HD3  . PRO A 1 18  ? 13.904  1.778   -7.320  1.00 0.00 ? 18  PRO A HD3  2  
ATOM 1998  N N    . GLY A 1 19  ? 12.687  -3.474  -6.359  1.00 0.00 ? 19  GLY A N    2  
ATOM 1999  C CA   . GLY A 1 19  ? 11.725  -4.535  -6.609  1.00 0.00 ? 19  GLY A CA   2  
ATOM 2000  C C    . GLY A 1 19  ? 10.577  -4.483  -5.599  1.00 0.00 ? 19  GLY A C    2  
ATOM 2001  O O    . GLY A 1 19  ? 10.276  -3.425  -5.049  1.00 0.00 ? 19  GLY A O    2  
ATOM 2002  H H    . GLY A 1 19  ? 13.247  -3.596  -5.539  1.00 0.00 ? 19  GLY A H    2  
ATOM 2003  H HA2  . GLY A 1 19  ? 11.330  -4.441  -7.620  1.00 0.00 ? 19  GLY A HA2  2  
ATOM 2004  H HA3  . GLY A 1 19  ? 12.223  -5.503  -6.549  1.00 0.00 ? 19  GLY A HA3  2  
ATOM 2005  N N    . PRO A 1 20  ? 9.950   -5.671  -5.380  1.00 0.00 ? 20  PRO A N    2  
ATOM 2006  C CA   . PRO A 1 20  ? 8.842   -5.771  -4.446  1.00 0.00 ? 20  PRO A CA   2  
ATOM 2007  C C    . PRO A 1 20  ? 9.337   -5.726  -3.000  1.00 0.00 ? 20  PRO A C    2  
ATOM 2008  O O    . PRO A 1 20  ? 10.287  -6.422  -2.643  1.00 0.00 ? 20  PRO A O    2  
ATOM 2009  C CB   . PRO A 1 20  ? 8.149   -7.077  -4.797  1.00 0.00 ? 20  PRO A CB   2  
ATOM 2010  C CG   . PRO A 1 20  ? 9.159   -7.883  -5.597  1.00 0.00 ? 20  PRO A CG   2  
ATOM 2011  C CD   . PRO A 1 20  ? 10.280  -6.944  -6.013  1.00 0.00 ? 20  PRO A CD   2  
ATOM 2012  H HA   . PRO A 1 20  ? 8.229   -4.987  -4.550  1.00 0.00 ? 20  PRO A HA   2  
ATOM 2013  H HB2  . PRO A 1 20  ? 7.847   -7.613  -3.897  1.00 0.00 ? 20  PRO A HB2  2  
ATOM 2014  H HB3  . PRO A 1 20  ? 7.245   -6.897  -5.378  1.00 0.00 ? 20  PRO A HB3  2  
ATOM 2015  H HG2  . PRO A 1 20  ? 9.552   -8.705  -4.998  1.00 0.00 ? 20  PRO A HG2  2  
ATOM 2016  H HG3  . PRO A 1 20  ? 8.686   -8.325  -6.474  1.00 0.00 ? 20  PRO A HG3  2  
ATOM 2017  H HD2  . PRO A 1 20  ? 11.250  -7.313  -5.680  1.00 0.00 ? 20  PRO A HD2  2  
ATOM 2018  H HD3  . PRO A 1 20  ? 10.332  -6.846  -7.097  1.00 0.00 ? 20  PRO A HD3  2  
ATOM 2019  N N    . VAL A 1 21  ? 8.672   -4.900  -2.205  1.00 0.00 ? 21  VAL A N    2  
ATOM 2020  C CA   . VAL A 1 21  ? 9.033   -4.756  -0.805  1.00 0.00 ? 21  VAL A CA   2  
ATOM 2021  C C    . VAL A 1 21  ? 8.928   -6.116  -0.113  1.00 0.00 ? 21  VAL A C    2  
ATOM 2022  O O    . VAL A 1 21  ? 8.378   -7.062  -0.675  1.00 0.00 ? 21  VAL A O    2  
ATOM 2023  C CB   . VAL A 1 21  ? 8.163   -3.682  -0.149  1.00 0.00 ? 21  VAL A CB   2  
ATOM 2024  C CG1  . VAL A 1 21  ? 8.672   -2.280  -0.490  1.00 0.00 ? 21  VAL A CG1  2  
ATOM 2025  C CG2  . VAL A 1 21  ? 6.695   -3.845  -0.549  1.00 0.00 ? 21  VAL A CG2  2  
ATOM 2026  H H    . VAL A 1 21  ? 7.901   -4.338  -2.503  1.00 0.00 ? 21  VAL A H    2  
ATOM 2027  H HA   . VAL A 1 21  ? 10.070  -4.421  -0.766  1.00 0.00 ? 21  VAL A HA   2  
ATOM 2028  H HB   . VAL A 1 21  ? 8.232   -3.809  0.932   1.00 0.00 ? 21  VAL A HB   2  
ATOM 2029  H HG11 . VAL A 1 21  ? 8.105   -1.540  0.075   1.00 0.00 ? 21  VAL A HG11 2  
ATOM 2030  H HG12 . VAL A 1 21  ? 9.728   -2.204  -0.232  1.00 0.00 ? 21  VAL A HG12 2  
ATOM 2031  H HG13 . VAL A 1 21  ? 8.545   -2.097  -1.557  1.00 0.00 ? 21  VAL A HG13 2  
ATOM 2032  H HG21 . VAL A 1 21  ? 6.565   -4.792  -1.073  1.00 0.00 ? 21  VAL A HG21 2  
ATOM 2033  H HG22 . VAL A 1 21  ? 6.072   -3.836  0.346   1.00 0.00 ? 21  VAL A HG22 2  
ATOM 2034  H HG23 . VAL A 1 21  ? 6.404   -3.024  -1.203  1.00 0.00 ? 21  VAL A HG23 2  
ATOM 2035  N N    . GLY A 1 22  ? 9.464   -6.171  1.098   1.00 0.00 ? 22  GLY A N    2  
ATOM 2036  C CA   . GLY A 1 22  ? 9.437   -7.400  1.873   1.00 0.00 ? 22  GLY A CA   2  
ATOM 2037  C C    . GLY A 1 22  ? 8.113   -8.142  1.678   1.00 0.00 ? 22  GLY A C    2  
ATOM 2038  O O    . GLY A 1 22  ? 8.026   -9.059  0.864   1.00 0.00 ? 22  GLY A O    2  
ATOM 2039  H H    . GLY A 1 22  ? 9.909   -5.397  1.548   1.00 0.00 ? 22  GLY A H    2  
ATOM 2040  H HA2  . GLY A 1 22  ? 10.265  -8.041  1.573   1.00 0.00 ? 22  GLY A HA2  2  
ATOM 2041  H HA3  . GLY A 1 22  ? 9.578   -7.171  2.929   1.00 0.00 ? 22  GLY A HA3  2  
ATOM 2042  N N    . HIS A 1 23  ? 7.116   -7.717  2.440   1.00 0.00 ? 23  HIS A N    2  
ATOM 2043  C CA   . HIS A 1 23  ? 5.801   -8.330  2.362   1.00 0.00 ? 23  HIS A CA   2  
ATOM 2044  C C    . HIS A 1 23  ? 4.754   -7.374  2.936   1.00 0.00 ? 23  HIS A C    2  
ATOM 2045  O O    . HIS A 1 23  ? 5.035   -6.632  3.876   1.00 0.00 ? 23  HIS A O    2  
ATOM 2046  C CB   . HIS A 1 23  ? 5.797   -9.697  3.050   1.00 0.00 ? 23  HIS A CB   2  
ATOM 2047  C CG   . HIS A 1 23  ? 5.336   -9.659  4.487   1.00 0.00 ? 23  HIS A CG   2  
ATOM 2048  N ND1  . HIS A 1 23  ? 4.077   -10.074 4.882   1.00 0.00 ? 23  HIS A ND1  2  
ATOM 2049  C CD2  . HIS A 1 23  ? 5.981   -9.253  5.619   1.00 0.00 ? 23  HIS A CD2  2  
ATOM 2050  C CE1  . HIS A 1 23  ? 3.978   -9.919  6.195   1.00 0.00 ? 23  HIS A CE1  2  
ATOM 2051  N NE2  . HIS A 1 23  ? 5.158   -9.410  6.649   1.00 0.00 ? 23  HIS A NE2  2  
ATOM 2052  H H    . HIS A 1 23  ? 7.195   -6.971  3.100   1.00 0.00 ? 23  HIS A H    2  
ATOM 2053  H HA   . HIS A 1 23  ? 5.593   -8.490  1.304   1.00 0.00 ? 23  HIS A HA   2  
ATOM 2054  H HB2  . HIS A 1 23  ? 5.150   -10.372 2.489   1.00 0.00 ? 23  HIS A HB2  2  
ATOM 2055  H HB3  . HIS A 1 23  ? 6.803   -10.115 3.012   1.00 0.00 ? 23  HIS A HB3  2  
ATOM 2056  H HD1  . HIS A 1 23  ? 3.362   -10.430 4.280   1.00 0.00 ? 23  HIS A HD1  2  
ATOM 2057  H HD2  . HIS A 1 23  ? 6.998   -8.866  5.668   1.00 0.00 ? 23  HIS A HD2  2  
ATOM 2058  H HE1  . HIS A 1 23  ? 3.106   -10.157 6.804   1.00 0.00 ? 23  HIS A HE1  2  
ATOM 2059  N N    . LEU A 1 24  ? 3.568   -7.423  2.346   1.00 0.00 ? 24  LEU A N    2  
ATOM 2060  C CA   . LEU A 1 24  ? 2.478   -6.570  2.788   1.00 0.00 ? 24  LEU A CA   2  
ATOM 2061  C C    . LEU A 1 24  ? 1.968   -7.062  4.144   1.00 0.00 ? 24  LEU A C    2  
ATOM 2062  O O    . LEU A 1 24  ? 1.937   -8.264  4.400   1.00 0.00 ? 24  LEU A O    2  
ATOM 2063  C CB   . LEU A 1 24  ? 1.390   -6.492  1.714   1.00 0.00 ? 24  LEU A CB   2  
ATOM 2064  C CG   . LEU A 1 24  ? 1.439   -5.267  0.798   1.00 0.00 ? 24  LEU A CG   2  
ATOM 2065  C CD1  . LEU A 1 24  ? 0.733   -4.072  1.442   1.00 0.00 ? 24  LEU A CD1  2  
ATOM 2066  C CD2  . LEU A 1 24  ? 2.879   -4.936  0.401   1.00 0.00 ? 24  LEU A CD2  2  
ATOM 2067  H H    . LEU A 1 24  ? 3.348   -8.029  1.582   1.00 0.00 ? 24  LEU A H    2  
ATOM 2068  H HA   . LEU A 1 24  ? 2.879   -5.565  2.913   1.00 0.00 ? 24  LEU A HA   2  
ATOM 2069  H HB2  . LEU A 1 24  ? 1.454   -7.387  1.095   1.00 0.00 ? 24  LEU A HB2  2  
ATOM 2070  H HB3  . LEU A 1 24  ? 0.419   -6.514  2.207   1.00 0.00 ? 24  LEU A HB3  2  
ATOM 2071  H HG   . LEU A 1 24  ? 0.899   -5.504  -0.118  1.00 0.00 ? 24  LEU A HG   2  
ATOM 2072  H HD11 . LEU A 1 24  ? -0.246  -3.938  0.982   1.00 0.00 ? 24  LEU A HD11 2  
ATOM 2073  H HD12 . LEU A 1 24  ? 0.611   -4.255  2.510   1.00 0.00 ? 24  LEU A HD12 2  
ATOM 2074  H HD13 . LEU A 1 24  ? 1.331   -3.173  1.294   1.00 0.00 ? 24  LEU A HD13 2  
ATOM 2075  H HD21 . LEU A 1 24  ? 2.884   -4.445  -0.572  1.00 0.00 ? 24  LEU A HD21 2  
ATOM 2076  H HD22 . LEU A 1 24  ? 3.318   -4.272  1.146   1.00 0.00 ? 24  LEU A HD22 2  
ATOM 2077  H HD23 . LEU A 1 24  ? 3.461   -5.856  0.347   1.00 0.00 ? 24  LEU A HD23 2  
ATOM 2078  N N    . SER A 1 25  ? 1.582   -6.107  4.977   1.00 0.00 ? 25  SER A N    2  
ATOM 2079  C CA   . SER A 1 25  ? 1.075   -6.428  6.300   1.00 0.00 ? 25  SER A CA   2  
ATOM 2080  C C    . SER A 1 25  ? -0.081  -5.492  6.659   1.00 0.00 ? 25  SER A C    2  
ATOM 2081  O O    . SER A 1 25  ? -0.063  -4.313  6.306   1.00 0.00 ? 25  SER A O    2  
ATOM 2082  C CB   . SER A 1 25  ? 2.182   -6.332  7.352   1.00 0.00 ? 25  SER A CB   2  
ATOM 2083  O OG   . SER A 1 25  ? 3.420   -6.850  6.873   1.00 0.00 ? 25  SER A OG   2  
ATOM 2084  H H    . SER A 1 25  ? 1.610   -5.131  4.760   1.00 0.00 ? 25  SER A H    2  
ATOM 2085  H HA   . SER A 1 25  ? 0.726   -7.458  6.234   1.00 0.00 ? 25  SER A HA   2  
ATOM 2086  H HB2  . SER A 1 25  ? 2.314   -5.290  7.645   1.00 0.00 ? 25  SER A HB2  2  
ATOM 2087  H HB3  . SER A 1 25  ? 1.882   -6.879  8.246   1.00 0.00 ? 25  SER A HB3  2  
ATOM 2088  H HG   . SER A 1 25  ? 3.660   -6.414  6.006   1.00 0.00 ? 25  SER A HG   2  
ATOM 2089  N N    . PHE A 1 26  ? -1.058  -6.051  7.357   1.00 0.00 ? 26  PHE A N    2  
ATOM 2090  C CA   . PHE A 1 26  ? -2.220  -5.281  7.768   1.00 0.00 ? 26  PHE A CA   2  
ATOM 2091  C C    . PHE A 1 26  ? -2.592  -5.583  9.221   1.00 0.00 ? 26  PHE A C    2  
ATOM 2092  O O    . PHE A 1 26  ? -2.789  -6.740  9.588   1.00 0.00 ? 26  PHE A O    2  
ATOM 2093  C CB   . PHE A 1 26  ? -3.378  -5.700  6.860   1.00 0.00 ? 26  PHE A CB   2  
ATOM 2094  C CG   . PHE A 1 26  ? -3.099  -5.510  5.368   1.00 0.00 ? 26  PHE A CG   2  
ATOM 2095  C CD1  . PHE A 1 26  ? -2.523  -4.360  4.925   1.00 0.00 ? 26  PHE A CD1  2  
ATOM 2096  C CD2  . PHE A 1 26  ? -3.428  -6.490  4.484   1.00 0.00 ? 26  PHE A CD2  2  
ATOM 2097  C CE1  . PHE A 1 26  ? -2.264  -4.183  3.540   1.00 0.00 ? 26  PHE A CE1  2  
ATOM 2098  C CE2  . PHE A 1 26  ? -3.169  -6.313  3.099   1.00 0.00 ? 26  PHE A CE2  2  
ATOM 2099  C CZ   . PHE A 1 26  ? -2.593  -5.164  2.657   1.00 0.00 ? 26  PHE A CZ   2  
ATOM 2100  H H    . PHE A 1 26  ? -1.065  -7.010  7.641   1.00 0.00 ? 26  PHE A H    2  
ATOM 2101  H HA   . PHE A 1 26  ? -1.960  -4.227  7.673   1.00 0.00 ? 26  PHE A HA   2  
ATOM 2102  H HB2  . PHE A 1 26  ? -3.610  -6.749  7.045   1.00 0.00 ? 26  PHE A HB2  2  
ATOM 2103  H HB3  . PHE A 1 26  ? -4.264  -5.125  7.130   1.00 0.00 ? 26  PHE A HB3  2  
ATOM 2104  H HD1  . PHE A 1 26  ? -2.260  -3.574  5.633   1.00 0.00 ? 26  PHE A HD1  2  
ATOM 2105  H HD2  . PHE A 1 26  ? -3.889  -7.411  4.839   1.00 0.00 ? 26  PHE A HD2  2  
ATOM 2106  H HE1  . PHE A 1 26  ? -1.803  -3.262  3.185   1.00 0.00 ? 26  PHE A HE1  2  
ATOM 2107  H HE2  . PHE A 1 26  ? -3.432  -7.099  2.391   1.00 0.00 ? 26  PHE A HE2  2  
ATOM 2108  H HZ   . PHE A 1 26  ? -2.394  -5.028  1.593   1.00 0.00 ? 26  PHE A HZ   2  
ATOM 2109  N N    . SER A 1 27  ? -2.676  -4.521  10.009  1.00 0.00 ? 27  SER A N    2  
ATOM 2110  C CA   . SER A 1 27  ? -3.021  -4.658  11.414  1.00 0.00 ? 27  SER A CA   2  
ATOM 2111  C C    . SER A 1 27  ? -4.039  -3.586  11.810  1.00 0.00 ? 27  SER A C    2  
ATOM 2112  O O    . SER A 1 27  ? -4.327  -2.680  11.029  1.00 0.00 ? 27  SER A O    2  
ATOM 2113  C CB   . SER A 1 27  ? -1.776  -4.560  12.299  1.00 0.00 ? 27  SER A CB   2  
ATOM 2114  O OG   . SER A 1 27  ? -1.178  -3.268  12.237  1.00 0.00 ? 27  SER A OG   2  
ATOM 2115  H H    . SER A 1 27  ? -2.515  -3.583  9.703   1.00 0.00 ? 27  SER A H    2  
ATOM 2116  H HA   . SER A 1 27  ? -3.456  -5.652  11.509  1.00 0.00 ? 27  SER A HA   2  
ATOM 2117  H HB2  . SER A 1 27  ? -2.046  -4.786  13.331  1.00 0.00 ? 27  SER A HB2  2  
ATOM 2118  H HB3  . SER A 1 27  ? -1.051  -5.311  11.988  1.00 0.00 ? 27  SER A HB3  2  
ATOM 2119  H HG   . SER A 1 27  ? -1.832  -2.605  11.875  1.00 0.00 ? 27  SER A HG   2  
ATOM 2120  N N    . GLU A 1 28  ? -4.555  -3.725  13.022  1.00 0.00 ? 28  GLU A N    2  
ATOM 2121  C CA   . GLU A 1 28  ? -5.535  -2.780  13.531  1.00 0.00 ? 28  GLU A CA   2  
ATOM 2122  C C    . GLU A 1 28  ? -6.514  -2.383  12.424  1.00 0.00 ? 28  GLU A C    2  
ATOM 2123  O O    . GLU A 1 28  ? -6.774  -1.198  12.217  1.00 0.00 ? 28  GLU A O    2  
ATOM 2124  C CB   . GLU A 1 28  ? -4.850  -1.547  14.126  1.00 0.00 ? 28  GLU A CB   2  
ATOM 2125  C CG   . GLU A 1 28  ? -4.121  -1.898  15.424  1.00 0.00 ? 28  GLU A CG   2  
ATOM 2126  C CD   . GLU A 1 28  ? -5.104  -2.389  16.489  1.00 0.00 ? 28  GLU A CD   2  
ATOM 2127  O OE1  . GLU A 1 28  ? -5.685  -1.518  17.171  1.00 0.00 ? 28  GLU A OE1  2  
ATOM 2128  O OE2  . GLU A 1 28  ? -5.252  -3.626  16.597  1.00 0.00 ? 28  GLU A OE2  2  
ATOM 2129  H H    . GLU A 1 28  ? -4.315  -4.464  13.651  1.00 0.00 ? 28  GLU A H    2  
ATOM 2130  H HA   . GLU A 1 28  ? -6.065  -3.310  14.322  1.00 0.00 ? 28  GLU A HA   2  
ATOM 2131  H HB2  . GLU A 1 28  ? -4.141  -1.138  13.406  1.00 0.00 ? 28  GLU A HB2  2  
ATOM 2132  H HB3  . GLU A 1 28  ? -5.592  -0.772  14.319  1.00 0.00 ? 28  GLU A HB3  2  
ATOM 2133  H HG2  . GLU A 1 28  ? -3.375  -2.668  15.230  1.00 0.00 ? 28  GLU A HG2  2  
ATOM 2134  H HG3  . GLU A 1 28  ? -3.587  -1.022  15.794  1.00 0.00 ? 28  GLU A HG3  2  
ATOM 2135  N N    . ILE A 1 29  ? -7.030  -3.395  11.744  1.00 0.00 ? 29  ILE A N    2  
ATOM 2136  C CA   . ILE A 1 29  ? -7.975  -3.167  10.664  1.00 0.00 ? 29  ILE A CA   2  
ATOM 2137  C C    . ILE A 1 29  ? -9.342  -2.817  11.254  1.00 0.00 ? 29  ILE A C    2  
ATOM 2138  O O    . ILE A 1 29  ? -9.706  -3.308  12.321  1.00 0.00 ? 29  ILE A O    2  
ATOM 2139  C CB   . ILE A 1 29  ? -8.003  -4.366  9.714   1.00 0.00 ? 29  ILE A CB   2  
ATOM 2140  C CG1  . ILE A 1 29  ? -6.593  -4.726  9.243   1.00 0.00 ? 29  ILE A CG1  2  
ATOM 2141  C CG2  . ILE A 1 29  ? -8.953  -4.114  8.541   1.00 0.00 ? 29  ILE A CG2  2  
ATOM 2142  C CD1  . ILE A 1 29  ? -6.641  -5.632  8.010   1.00 0.00 ? 29  ILE A CD1  2  
ATOM 2143  H H    . ILE A 1 29  ? -6.813  -4.355  11.919  1.00 0.00 ? 29  ILE A H    2  
ATOM 2144  H HA   . ILE A 1 29  ? -7.616  -2.311  10.091  1.00 0.00 ? 29  ILE A HA   2  
ATOM 2145  H HB   . ILE A 1 29  ? -8.389  -5.226  10.261  1.00 0.00 ? 29  ILE A HB   2  
ATOM 2146  H HG12 . ILE A 1 29  ? -6.041  -3.816  9.008   1.00 0.00 ? 29  ILE A HG12 2  
ATOM 2147  H HG13 . ILE A 1 29  ? -6.054  -5.228  10.046  1.00 0.00 ? 29  ILE A HG13 2  
ATOM 2148  H HG21 . ILE A 1 29  ? -9.290  -3.078  8.562   1.00 0.00 ? 29  ILE A HG21 2  
ATOM 2149  H HG22 . ILE A 1 29  ? -8.432  -4.308  7.604   1.00 0.00 ? 29  ILE A HG22 2  
ATOM 2150  H HG23 . ILE A 1 29  ? -9.814  -4.778  8.622   1.00 0.00 ? 29  ILE A HG23 2  
ATOM 2151  H HD11 . ILE A 1 29  ? -5.783  -6.303  8.020   1.00 0.00 ? 29  ILE A HD11 2  
ATOM 2152  H HD12 . ILE A 1 29  ? -7.560  -6.217  8.026   1.00 0.00 ? 29  ILE A HD12 2  
ATOM 2153  H HD13 . ILE A 1 29  ? -6.614  -5.020  7.109   1.00 0.00 ? 29  ILE A HD13 2  
ATOM 2154  N N    . LEU A 1 30  ? -10.063 -1.971  10.532  1.00 0.00 ? 30  LEU A N    2  
ATOM 2155  C CA   . LEU A 1 30  ? -11.383 -1.549  10.971  1.00 0.00 ? 30  LEU A CA   2  
ATOM 2156  C C    . LEU A 1 30  ? -12.417 -1.946  9.916   1.00 0.00 ? 30  LEU A C    2  
ATOM 2157  O O    . LEU A 1 30  ? -12.317 -3.014  9.314   1.00 0.00 ? 30  LEU A O    2  
ATOM 2158  C CB   . LEU A 1 30  ? -11.385 -0.056  11.303  1.00 0.00 ? 30  LEU A CB   2  
ATOM 2159  C CG   . LEU A 1 30  ? -10.251 0.433   12.206  1.00 0.00 ? 30  LEU A CG   2  
ATOM 2160  C CD1  . LEU A 1 30  ? -9.943  1.909   11.950  1.00 0.00 ? 30  LEU A CD1  2  
ATOM 2161  C CD2  . LEU A 1 30  ? -10.565 0.159   13.678  1.00 0.00 ? 30  LEU A CD2  2  
ATOM 2162  H H    . LEU A 1 30  ? -9.760  -1.576  9.665   1.00 0.00 ? 30  LEU A H    2  
ATOM 2163  H HA   . LEU A 1 30  ? -11.607 -2.085  11.894  1.00 0.00 ? 30  LEU A HA   2  
ATOM 2164  H HB2  . LEU A 1 30  ? -11.346 0.504   10.369  1.00 0.00 ? 30  LEU A HB2  2  
ATOM 2165  H HB3  . LEU A 1 30  ? -12.334 0.188   11.782  1.00 0.00 ? 30  LEU A HB3  2  
ATOM 2166  H HG   . LEU A 1 30  ? -9.351  -0.131  11.959  1.00 0.00 ? 30  LEU A HG   2  
ATOM 2167  H HD11 . LEU A 1 30  ? -9.362  2.006   11.033  1.00 0.00 ? 30  LEU A HD11 2  
ATOM 2168  H HD12 . LEU A 1 30  ? -10.877 2.463   11.849  1.00 0.00 ? 30  LEU A HD12 2  
ATOM 2169  H HD13 . LEU A 1 30  ? -9.371  2.312   12.787  1.00 0.00 ? 30  LEU A HD13 2  
ATOM 2170  H HD21 . LEU A 1 30  ? -10.319 1.040   14.272  1.00 0.00 ? 30  LEU A HD21 2  
ATOM 2171  H HD22 . LEU A 1 30  ? -11.625 -0.068  13.787  1.00 0.00 ? 30  LEU A HD22 2  
ATOM 2172  H HD23 . LEU A 1 30  ? -9.974  -0.689  14.025  1.00 0.00 ? 30  LEU A HD23 2  
ATOM 2173  N N    . ASP A 1 31  ? -13.388 -1.065  9.724   1.00 0.00 ? 31  ASP A N    2  
ATOM 2174  C CA   . ASP A 1 31  ? -14.440 -1.310  8.753   1.00 0.00 ? 31  ASP A CA   2  
ATOM 2175  C C    . ASP A 1 31  ? -14.200 -0.439  7.518   1.00 0.00 ? 31  ASP A C    2  
ATOM 2176  O O    . ASP A 1 31  ? -14.697 -0.743  6.434   1.00 0.00 ? 31  ASP A O    2  
ATOM 2177  C CB   . ASP A 1 31  ? -15.813 -0.952  9.325   1.00 0.00 ? 31  ASP A CB   2  
ATOM 2178  C CG   . ASP A 1 31  ? -15.855 0.338   10.145  1.00 0.00 ? 31  ASP A CG   2  
ATOM 2179  O OD1  . ASP A 1 31  ? -14.787 0.705   10.681  1.00 0.00 ? 31  ASP A OD1  2  
ATOM 2180  O OD2  . ASP A 1 31  ? -16.954 0.929   10.218  1.00 0.00 ? 31  ASP A OD2  2  
ATOM 2181  H H    . ASP A 1 31  ? -13.462 -0.199  10.218  1.00 0.00 ? 31  ASP A H    2  
ATOM 2182  H HA   . ASP A 1 31  ? -14.381 -2.376  8.529   1.00 0.00 ? 31  ASP A HA   2  
ATOM 2183  H HB2  . ASP A 1 31  ? -16.521 -0.865  8.501   1.00 0.00 ? 31  ASP A HB2  2  
ATOM 2184  H HB3  . ASP A 1 31  ? -16.154 -1.776  9.952   1.00 0.00 ? 31  ASP A HB3  2  
ATOM 2185  N N    . THR A 1 32  ? -13.440 0.626   7.723   1.00 0.00 ? 32  THR A N    2  
ATOM 2186  C CA   . THR A 1 32  ? -13.129 1.543   6.639   1.00 0.00 ? 32  THR A CA   2  
ATOM 2187  C C    . THR A 1 32  ? -11.767 2.201   6.872   1.00 0.00 ? 32  THR A C    2  
ATOM 2188  O O    . THR A 1 32  ? -11.519 3.307   6.396   1.00 0.00 ? 32  THR A O    2  
ATOM 2189  C CB   . THR A 1 32  ? -14.277 2.547   6.526   1.00 0.00 ? 32  THR A CB   2  
ATOM 2190  O OG1  . THR A 1 32  ? -14.213 3.287   7.742   1.00 0.00 ? 32  THR A OG1  2  
ATOM 2191  C CG2  . THR A 1 32  ? -15.650 1.874   6.570   1.00 0.00 ? 32  THR A CG2  2  
ATOM 2192  H H    . THR A 1 32  ? -13.040 0.866   8.607   1.00 0.00 ? 32  THR A H    2  
ATOM 2193  H HA   . THR A 1 32  ? -13.053 0.970   5.715   1.00 0.00 ? 32  THR A HA   2  
ATOM 2194  H HB   . THR A 1 32  ? -14.172 3.159   5.630   1.00 0.00 ? 32  THR A HB   2  
ATOM 2195  H HG1  . THR A 1 32  ? -14.171 2.661   8.521   1.00 0.00 ? 32  THR A HG1  2  
ATOM 2196  H HG21 . THR A 1 32  ? -15.711 1.119   5.786   1.00 0.00 ? 32  THR A HG21 2  
ATOM 2197  H HG22 . THR A 1 32  ? -15.792 1.401   7.542   1.00 0.00 ? 32  THR A HG22 2  
ATOM 2198  H HG23 . THR A 1 32  ? -16.427 2.623   6.415   1.00 0.00 ? 32  THR A HG23 2  
ATOM 2199  N N    . SER A 1 33  ? -10.920 1.492   7.604   1.00 0.00 ? 33  SER A N    2  
ATOM 2200  C CA   . SER A 1 33  ? -9.590  1.993   7.906   1.00 0.00 ? 33  SER A CA   2  
ATOM 2201  C C    . SER A 1 33  ? -8.714  0.860   8.444   1.00 0.00 ? 33  SER A C    2  
ATOM 2202  O O    . SER A 1 33  ? -9.101  0.162   9.380   1.00 0.00 ? 33  SER A O    2  
ATOM 2203  C CB   . SER A 1 33  ? -9.650  3.142   8.914   1.00 0.00 ? 33  SER A CB   2  
ATOM 2204  O OG   . SER A 1 33  ? -10.803 3.061   9.748   1.00 0.00 ? 33  SER A OG   2  
ATOM 2205  H H    . SER A 1 33  ? -11.130 0.592   7.988   1.00 0.00 ? 33  SER A H    2  
ATOM 2206  H HA   . SER A 1 33  ? -9.199  2.362   6.958   1.00 0.00 ? 33  SER A HA   2  
ATOM 2207  H HB2  . SER A 1 33  ? -8.753  3.129   9.533   1.00 0.00 ? 33  SER A HB2  2  
ATOM 2208  H HB3  . SER A 1 33  ? -9.655  4.092   8.380   1.00 0.00 ? 33  SER A HB3  2  
ATOM 2209  H HG   . SER A 1 33  ? -10.902 3.904   10.277  1.00 0.00 ? 33  SER A HG   2  
ATOM 2210  N N    . LEU A 1 34  ? -7.550  0.712   7.830   1.00 0.00 ? 34  LEU A N    2  
ATOM 2211  C CA   . LEU A 1 34  ? -6.615  -0.324  8.235   1.00 0.00 ? 34  LEU A CA   2  
ATOM 2212  C C    . LEU A 1 34  ? -5.186  0.210   8.120   1.00 0.00 ? 34  LEU A C    2  
ATOM 2213  O O    . LEU A 1 34  ? -4.918  1.108   7.323   1.00 0.00 ? 34  LEU A O    2  
ATOM 2214  C CB   . LEU A 1 34  ? -6.858  -1.607  7.438   1.00 0.00 ? 34  LEU A CB   2  
ATOM 2215  C CG   . LEU A 1 34  ? -6.826  -1.466  5.915   1.00 0.00 ? 34  LEU A CG   2  
ATOM 2216  C CD1  . LEU A 1 34  ? -5.388  -1.369  5.403   1.00 0.00 ? 34  LEU A CD1  2  
ATOM 2217  C CD2  . LEU A 1 34  ? -7.599  -2.603  5.242   1.00 0.00 ? 34  LEU A CD2  2  
ATOM 2218  H H    . LEU A 1 34  ? -7.242  1.284   7.069   1.00 0.00 ? 34  LEU A H    2  
ATOM 2219  H HA   . LEU A 1 34  ? -6.815  -0.552  9.282   1.00 0.00 ? 34  LEU A HA   2  
ATOM 2220  H HB2  . LEU A 1 34  ? -6.108  -2.341  7.731   1.00 0.00 ? 34  LEU A HB2  2  
ATOM 2221  H HB3  . LEU A 1 34  ? -7.829  -2.011  7.725   1.00 0.00 ? 34  LEU A HB3  2  
ATOM 2222  H HG   . LEU A 1 34  ? -7.326  -0.535  5.647   1.00 0.00 ? 34  LEU A HG   2  
ATOM 2223  H HD11 . LEU A 1 34  ? -4.842  -2.272  5.680   1.00 0.00 ? 34  LEU A HD11 2  
ATOM 2224  H HD12 . LEU A 1 34  ? -5.394  -1.267  4.318   1.00 0.00 ? 34  LEU A HD12 2  
ATOM 2225  H HD13 . LEU A 1 34  ? -4.902  -0.501  5.847   1.00 0.00 ? 34  LEU A HD13 2  
ATOM 2226  H HD21 . LEU A 1 34  ? -8.219  -2.197  4.443   1.00 0.00 ? 34  LEU A HD21 2  
ATOM 2227  H HD22 . LEU A 1 34  ? -6.895  -3.324  4.827   1.00 0.00 ? 34  LEU A HD22 2  
ATOM 2228  H HD23 . LEU A 1 34  ? -8.233  -3.096  5.979   1.00 0.00 ? 34  LEU A HD23 2  
ATOM 2229  N N    . LYS A 1 35  ? -4.307  -0.364  8.927   1.00 0.00 ? 35  LYS A N    2  
ATOM 2230  C CA   . LYS A 1 35  ? -2.912  0.043   8.926   1.00 0.00 ? 35  LYS A CA   2  
ATOM 2231  C C    . LYS A 1 35  ? -2.119  -0.872  7.991   1.00 0.00 ? 35  LYS A C    2  
ATOM 2232  O O    . LYS A 1 35  ? -2.185  -2.095  8.110   1.00 0.00 ? 35  LYS A O    2  
ATOM 2233  C CB   . LYS A 1 35  ? -2.365  0.086   10.354  1.00 0.00 ? 35  LYS A CB   2  
ATOM 2234  C CG   . LYS A 1 35  ? -1.103  0.948   10.432  1.00 0.00 ? 35  LYS A CG   2  
ATOM 2235  C CD   . LYS A 1 35  ? 0.044   0.182   11.093  1.00 0.00 ? 35  LYS A CD   2  
ATOM 2236  C CE   . LYS A 1 35  ? 0.752   -0.723  10.083  1.00 0.00 ? 35  LYS A CE   2  
ATOM 2237  N NZ   . LYS A 1 35  ? 0.290   -2.122  10.228  1.00 0.00 ? 35  LYS A NZ   2  
ATOM 2238  H H    . LYS A 1 35  ? -4.533  -1.094  9.573   1.00 0.00 ? 35  LYS A H    2  
ATOM 2239  H HA   . LYS A 1 35  ? -2.869  1.059   8.533   1.00 0.00 ? 35  LYS A HA   2  
ATOM 2240  H HB2  . LYS A 1 35  ? -3.124  0.485   11.027  1.00 0.00 ? 35  LYS A HB2  2  
ATOM 2241  H HB3  . LYS A 1 35  ? -2.140  -0.925  10.692  1.00 0.00 ? 35  LYS A HB3  2  
ATOM 2242  H HG2  . LYS A 1 35  ? -0.809  1.259   9.430   1.00 0.00 ? 35  LYS A HG2  2  
ATOM 2243  H HG3  . LYS A 1 35  ? -1.313  1.856   10.999  1.00 0.00 ? 35  LYS A HG3  2  
ATOM 2244  H HD2  . LYS A 1 35  ? 0.759   0.887   11.518  1.00 0.00 ? 35  LYS A HD2  2  
ATOM 2245  H HD3  . LYS A 1 35  ? -0.341  -0.418  11.917  1.00 0.00 ? 35  LYS A HD3  2  
ATOM 2246  H HE2  . LYS A 1 35  ? 0.554   -0.373  9.070   1.00 0.00 ? 35  LYS A HE2  2  
ATOM 2247  H HE3  . LYS A 1 35  ? 1.830   -0.673  10.233  1.00 0.00 ? 35  LYS A HE3  2  
ATOM 2248  H HZ1  . LYS A 1 35  ? -0.056  -2.264  11.156  1.00 0.00 ? 35  LYS A HZ1  2  
ATOM 2249  H HZ2  . LYS A 1 35  ? -0.440  -2.303  9.569   1.00 0.00 ? 35  LYS A HZ2  2  
ATOM 2250  H HZ3  . LYS A 1 35  ? 1.054   -2.745  10.059  1.00 0.00 ? 35  LYS A HZ3  2  
ATOM 2251  N N    . VAL A 1 36  ? -1.387  -0.246  7.082   1.00 0.00 ? 36  VAL A N    2  
ATOM 2252  C CA   . VAL A 1 36  ? -0.582  -0.988  6.128   1.00 0.00 ? 36  VAL A CA   2  
ATOM 2253  C C    . VAL A 1 36  ? 0.883   -0.959  6.570   1.00 0.00 ? 36  VAL A C    2  
ATOM 2254  O O    . VAL A 1 36  ? 1.364   0.056   7.070   1.00 0.00 ? 36  VAL A O    2  
ATOM 2255  C CB   . VAL A 1 36  ? -0.792  -0.430  4.719   1.00 0.00 ? 36  VAL A CB   2  
ATOM 2256  C CG1  . VAL A 1 36  ? 0.172   -1.077  3.723   1.00 0.00 ? 36  VAL A CG1  2  
ATOM 2257  C CG2  . VAL A 1 36  ? -2.244  -0.605  4.270   1.00 0.00 ? 36  VAL A CG2  2  
ATOM 2258  H H    . VAL A 1 36  ? -1.338  0.749   6.992   1.00 0.00 ? 36  VAL A H    2  
ATOM 2259  H HA   . VAL A 1 36  ? -0.930  -2.021  6.136   1.00 0.00 ? 36  VAL A HA   2  
ATOM 2260  H HB   . VAL A 1 36  ? -0.577  0.639   4.747   1.00 0.00 ? 36  VAL A HB   2  
ATOM 2261  H HG11 . VAL A 1 36  ? 0.294   -0.425  2.858   1.00 0.00 ? 36  VAL A HG11 2  
ATOM 2262  H HG12 . VAL A 1 36  ? 1.139   -1.232  4.201   1.00 0.00 ? 36  VAL A HG12 2  
ATOM 2263  H HG13 . VAL A 1 36  ? -0.231  -2.037  3.399   1.00 0.00 ? 36  VAL A HG13 2  
ATOM 2264  H HG21 . VAL A 1 36  ? -2.848  -0.933  5.116   1.00 0.00 ? 36  VAL A HG21 2  
ATOM 2265  H HG22 . VAL A 1 36  ? -2.626  0.345   3.897   1.00 0.00 ? 36  VAL A HG22 2  
ATOM 2266  H HG23 . VAL A 1 36  ? -2.292  -1.352  3.478   1.00 0.00 ? 36  VAL A HG23 2  
ATOM 2267  N N    . SER A 1 37  ? 1.551   -2.086  6.370   1.00 0.00 ? 37  SER A N    2  
ATOM 2268  C CA   . SER A 1 37  ? 2.950   -2.202  6.742   1.00 0.00 ? 37  SER A CA   2  
ATOM 2269  C C    . SER A 1 37  ? 3.696   -3.055  5.713   1.00 0.00 ? 37  SER A C    2  
ATOM 2270  O O    . SER A 1 37  ? 3.083   -3.834  4.985   1.00 0.00 ? 37  SER A O    2  
ATOM 2271  C CB   . SER A 1 37  ? 3.100   -2.806  8.140   1.00 0.00 ? 37  SER A CB   2  
ATOM 2272  O OG   . SER A 1 37  ? 4.077   -3.842  8.172   1.00 0.00 ? 37  SER A OG   2  
ATOM 2273  H H    . SER A 1 37  ? 1.152   -2.908  5.962   1.00 0.00 ? 37  SER A H    2  
ATOM 2274  H HA   . SER A 1 37  ? 3.334   -1.182  6.744   1.00 0.00 ? 37  SER A HA   2  
ATOM 2275  H HB2  . SER A 1 37  ? 3.380   -2.022  8.845   1.00 0.00 ? 37  SER A HB2  2  
ATOM 2276  H HB3  . SER A 1 37  ? 2.140   -3.202  8.469   1.00 0.00 ? 37  SER A HB3  2  
ATOM 2277  H HG   . SER A 1 37  ? 3.789   -4.564  8.801   1.00 0.00 ? 37  SER A HG   2  
ATOM 2278  N N    . TRP A 1 38  ? 5.009   -2.878  5.686   1.00 0.00 ? 38  TRP A N    2  
ATOM 2279  C CA   . TRP A 1 38  ? 5.845   -3.621  4.758   1.00 0.00 ? 38  TRP A CA   2  
ATOM 2280  C C    . TRP A 1 38  ? 7.289   -3.547  5.259   1.00 0.00 ? 38  TRP A C    2  
ATOM 2281  O O    . TRP A 1 38  ? 7.545   -3.045  6.353   1.00 0.00 ? 38  TRP A O    2  
ATOM 2282  C CB   . TRP A 1 38  ? 5.680   -3.097  3.331   1.00 0.00 ? 38  TRP A CB   2  
ATOM 2283  C CG   . TRP A 1 38  ? 5.976   -1.603  3.178   1.00 0.00 ? 38  TRP A CG   2  
ATOM 2284  C CD1  . TRP A 1 38  ? 7.156   -1.017  2.935   1.00 0.00 ? 38  TRP A CD1  2  
ATOM 2285  C CD2  . TRP A 1 38  ? 5.022   -0.524  3.268   1.00 0.00 ? 38  TRP A CD2  2  
ATOM 2286  N NE1  . TRP A 1 38  ? 7.033   0.356   2.863   1.00 0.00 ? 38  TRP A NE1  2  
ATOM 2287  C CE2  . TRP A 1 38  ? 5.694   0.665   3.071   1.00 0.00 ? 38  TRP A CE2  2  
ATOM 2288  C CE3  . TRP A 1 38  ? 3.637   -0.552  3.507   1.00 0.00 ? 38  TRP A CE3  2  
ATOM 2289  C CZ2  . TRP A 1 38  ? 5.063   1.915   3.094   1.00 0.00 ? 38  TRP A CZ2  2  
ATOM 2290  C CZ3  . TRP A 1 38  ? 3.021   0.705   3.527   1.00 0.00 ? 38  TRP A CZ3  2  
ATOM 2291  C CH2  . TRP A 1 38  ? 3.683   1.911   3.331   1.00 0.00 ? 38  TRP A CH2  2  
ATOM 2292  H H    . TRP A 1 38  ? 5.500   -2.242  6.281   1.00 0.00 ? 38  TRP A H    2  
ATOM 2293  H HA   . TRP A 1 38  ? 5.503   -4.656  4.758   1.00 0.00 ? 38  TRP A HA   2  
ATOM 2294  H HB2  . TRP A 1 38  ? 6.342   -3.657  2.670   1.00 0.00 ? 38  TRP A HB2  2  
ATOM 2295  H HB3  . TRP A 1 38  ? 4.660   -3.290  2.999   1.00 0.00 ? 38  TRP A HB3  2  
ATOM 2296  H HD1  . TRP A 1 38  ? 8.095   -1.556  2.811   1.00 0.00 ? 38  TRP A HD1  2  
ATOM 2297  H HE1  . TRP A 1 38  ? 7.838   1.067   2.676   1.00 0.00 ? 38  TRP A HE1  2  
ATOM 2298  H HE3  . TRP A 1 38  ? 3.083   -1.478  3.665   1.00 0.00 ? 38  TRP A HE3  2  
ATOM 2299  H HZ2  . TRP A 1 38  ? 5.616   2.840   2.936   1.00 0.00 ? 38  TRP A HZ2  2  
ATOM 2300  H HZ3  . TRP A 1 38  ? 1.947   0.741   3.709   1.00 0.00 ? 38  TRP A HZ3  2  
ATOM 2301  H HH2  . TRP A 1 38  ? 3.131   2.850   3.362   1.00 0.00 ? 38  TRP A HH2  2  
ATOM 2302  N N    . GLN A 1 39  ? 8.194   -4.053  4.435   1.00 0.00 ? 39  GLN A N    2  
ATOM 2303  C CA   . GLN A 1 39  ? 9.605   -4.051  4.781   1.00 0.00 ? 39  GLN A CA   2  
ATOM 2304  C C    . GLN A 1 39  ? 10.442  -3.569  3.594   1.00 0.00 ? 39  GLN A C    2  
ATOM 2305  O O    . GLN A 1 39  ? 9.904   -3.291  2.523   1.00 0.00 ? 39  GLN A O    2  
ATOM 2306  C CB   . GLN A 1 39  ? 10.059  -5.436  5.246   1.00 0.00 ? 39  GLN A CB   2  
ATOM 2307  C CG   . GLN A 1 39  ? 9.771   -5.636  6.735   1.00 0.00 ? 39  GLN A CG   2  
ATOM 2308  C CD   . GLN A 1 39  ? 10.818  -6.548  7.378   1.00 0.00 ? 39  GLN A CD   2  
ATOM 2309  O OE1  . GLN A 1 39  ? 11.450  -7.365  6.728   1.00 0.00 ? 39  GLN A OE1  2  
ATOM 2310  N NE2  . GLN A 1 39  ? 10.966  -6.364  8.687   1.00 0.00 ? 39  GLN A NE2  2  
ATOM 2311  H H    . GLN A 1 39  ? 7.977   -4.459  3.547   1.00 0.00 ? 39  GLN A H    2  
ATOM 2312  H HA   . GLN A 1 39  ? 9.700   -3.348  5.609   1.00 0.00 ? 39  GLN A HA   2  
ATOM 2313  H HB2  . GLN A 1 39  ? 9.546   -6.204  4.666   1.00 0.00 ? 39  GLN A HB2  2  
ATOM 2314  H HB3  . GLN A 1 39  ? 11.126  -5.555  5.058   1.00 0.00 ? 39  GLN A HB3  2  
ATOM 2315  H HG2  . GLN A 1 39  ? 9.765   -4.671  7.241   1.00 0.00 ? 39  GLN A HG2  2  
ATOM 2316  H HG3  . GLN A 1 39  ? 8.779   -6.069  6.863   1.00 0.00 ? 39  GLN A HG3  2  
ATOM 2317  H HE21 . GLN A 1 39  ? 10.415  -5.676  9.160   1.00 0.00 ? 39  GLN A HE21 2  
ATOM 2318  H HE22 . GLN A 1 39  ? 11.627  -6.913  9.197   1.00 0.00 ? 39  GLN A HE22 2  
ATOM 2319  N N    . GLU A 1 40  ? 11.744  -3.486  3.824   1.00 0.00 ? 40  GLU A N    2  
ATOM 2320  C CA   . GLU A 1 40  ? 12.660  -3.043  2.786   1.00 0.00 ? 40  GLU A CA   2  
ATOM 2321  C C    . GLU A 1 40  ? 12.987  -4.199  1.838   1.00 0.00 ? 40  GLU A C    2  
ATOM 2322  O O    . GLU A 1 40  ? 13.267  -5.311  2.282   1.00 0.00 ? 40  GLU A O    2  
ATOM 2323  C CB   . GLU A 1 40  ? 13.935  -2.456  3.395   1.00 0.00 ? 40  GLU A CB   2  
ATOM 2324  C CG   . GLU A 1 40  ? 13.953  -0.932  3.267   1.00 0.00 ? 40  GLU A CG   2  
ATOM 2325  C CD   . GLU A 1 40  ? 15.132  -0.331  4.034   1.00 0.00 ? 40  GLU A CD   2  
ATOM 2326  O OE1  . GLU A 1 40  ? 15.590  -0.999  4.986   1.00 0.00 ? 40  GLU A OE1  2  
ATOM 2327  O OE2  . GLU A 1 40  ? 15.550  0.783   3.651   1.00 0.00 ? 40  GLU A OE2  2  
ATOM 2328  H H    . GLU A 1 40  ? 12.174  -3.714  4.697   1.00 0.00 ? 40  GLU A H    2  
ATOM 2329  H HA   . GLU A 1 40  ? 12.129  -2.260  2.246   1.00 0.00 ? 40  GLU A HA   2  
ATOM 2330  H HB2  . GLU A 1 40  ? 14.004  -2.738  4.445   1.00 0.00 ? 40  GLU A HB2  2  
ATOM 2331  H HB3  . GLU A 1 40  ? 14.808  -2.877  2.895   1.00 0.00 ? 40  GLU A HB3  2  
ATOM 2332  H HG2  . GLU A 1 40  ? 14.017  -0.652  2.216   1.00 0.00 ? 40  GLU A HG2  2  
ATOM 2333  H HG3  . GLU A 1 40  ? 13.018  -0.521  3.650   1.00 0.00 ? 40  GLU A HG3  2  
ATOM 2334  N N    . PRO A 1 41  ? 12.938  -3.888  0.515   1.00 0.00 ? 41  PRO A N    2  
ATOM 2335  C CA   . PRO A 1 41  ? 13.225  -4.887  -0.500  1.00 0.00 ? 41  PRO A CA   2  
ATOM 2336  C C    . PRO A 1 41  ? 14.727  -5.166  -0.585  1.00 0.00 ? 41  PRO A C    2  
ATOM 2337  O O    . PRO A 1 41  ? 15.542  -4.298  -0.275  1.00 0.00 ? 41  PRO A O    2  
ATOM 2338  C CB   . PRO A 1 41  ? 12.653  -4.316  -1.787  1.00 0.00 ? 41  PRO A CB   2  
ATOM 2339  C CG   . PRO A 1 41  ? 12.483  -2.826  -1.543  1.00 0.00 ? 41  PRO A CG   2  
ATOM 2340  C CD   . PRO A 1 41  ? 12.610  -2.581  -0.048  1.00 0.00 ? 41  PRO A CD   2  
ATOM 2341  H HA   . PRO A 1 41  ? 12.799  -5.759  -0.259  1.00 0.00 ? 41  PRO A HA   2  
ATOM 2342  H HB2  . PRO A 1 41  ? 13.323  -4.500  -2.628  1.00 0.00 ? 41  PRO A HB2  2  
ATOM 2343  H HB3  . PRO A 1 41  ? 11.700  -4.784  -2.032  1.00 0.00 ? 41  PRO A HB3  2  
ATOM 2344  H HG2  . PRO A 1 41  ? 13.239  -2.260  -2.088  1.00 0.00 ? 41  PRO A HG2  2  
ATOM 2345  H HG3  . PRO A 1 41  ? 11.511  -2.488  -1.903  1.00 0.00 ? 41  PRO A HG3  2  
ATOM 2346  H HD2  . PRO A 1 41  ? 13.388  -1.850  0.169   1.00 0.00 ? 41  PRO A HD2  2  
ATOM 2347  H HD3  . PRO A 1 41  ? 11.682  -2.192  0.370   1.00 0.00 ? 41  PRO A HD3  2  
ATOM 2348  N N    . GLY A 1 42  ? 15.048  -6.380  -1.008  1.00 0.00 ? 42  GLY A N    2  
ATOM 2349  C CA   . GLY A 1 42  ? 16.438  -6.784  -1.138  1.00 0.00 ? 42  GLY A CA   2  
ATOM 2350  C C    . GLY A 1 42  ? 17.011  -6.352  -2.489  1.00 0.00 ? 42  GLY A C    2  
ATOM 2351  O O    . GLY A 1 42  ? 18.200  -6.528  -2.748  1.00 0.00 ? 42  GLY A O    2  
ATOM 2352  H H    . GLY A 1 42  ? 14.379  -7.080  -1.258  1.00 0.00 ? 42  GLY A H    2  
ATOM 2353  H HA2  . GLY A 1 42  ? 17.025  -6.344  -0.332  1.00 0.00 ? 42  GLY A HA2  2  
ATOM 2354  H HA3  . GLY A 1 42  ? 16.516  -7.867  -1.035  1.00 0.00 ? 42  GLY A HA3  2  
ATOM 2355  N N    . GLU A 1 43  ? 16.137  -5.793  -3.314  1.00 0.00 ? 43  GLU A N    2  
ATOM 2356  C CA   . GLU A 1 43  ? 16.541  -5.334  -4.632  1.00 0.00 ? 43  GLU A CA   2  
ATOM 2357  C C    . GLU A 1 43  ? 16.435  -3.810  -4.719  1.00 0.00 ? 43  GLU A C    2  
ATOM 2358  O O    . GLU A 1 43  ? 16.054  -3.269  -5.756  1.00 0.00 ? 43  GLU A O    2  
ATOM 2359  C CB   . GLU A 1 43  ? 15.708  -6.005  -5.726  1.00 0.00 ? 43  GLU A CB   2  
ATOM 2360  C CG   . GLU A 1 43  ? 14.378  -6.514  -5.167  1.00 0.00 ? 43  GLU A CG   2  
ATOM 2361  C CD   . GLU A 1 43  ? 13.654  -7.394  -6.189  1.00 0.00 ? 43  GLU A CD   2  
ATOM 2362  O OE1  . GLU A 1 43  ? 13.611  -6.978  -7.367  1.00 0.00 ? 43  GLU A OE1  2  
ATOM 2363  O OE2  . GLU A 1 43  ? 13.161  -8.463  -5.769  1.00 0.00 ? 43  GLU A OE2  2  
ATOM 2364  H H    . GLU A 1 43  ? 15.172  -5.654  -3.096  1.00 0.00 ? 43  GLU A H    2  
ATOM 2365  H HA   . GLU A 1 43  ? 17.582  -5.639  -4.739  1.00 0.00 ? 43  GLU A HA   2  
ATOM 2366  H HB2  . GLU A 1 43  ? 15.520  -5.296  -6.532  1.00 0.00 ? 43  GLU A HB2  2  
ATOM 2367  H HB3  . GLU A 1 43  ? 16.267  -6.836  -6.156  1.00 0.00 ? 43  GLU A HB3  2  
ATOM 2368  H HG2  . GLU A 1 43  ? 14.556  -7.082  -4.254  1.00 0.00 ? 43  GLU A HG2  2  
ATOM 2369  H HG3  . GLU A 1 43  ? 13.745  -5.668  -4.898  1.00 0.00 ? 43  GLU A HG3  2  
ATOM 2370  N N    . LYS A 1 44  ? 16.779  -3.161  -3.616  1.00 0.00 ? 44  LYS A N    2  
ATOM 2371  C CA   . LYS A 1 44  ? 16.727  -1.711  -3.554  1.00 0.00 ? 44  LYS A CA   2  
ATOM 2372  C C    . LYS A 1 44  ? 17.231  -1.130  -4.877  1.00 0.00 ? 44  LYS A C    2  
ATOM 2373  O O    . LYS A 1 44  ? 16.804  -0.053  -5.289  1.00 0.00 ? 44  LYS A O    2  
ATOM 2374  C CB   . LYS A 1 44  ? 17.486  -1.199  -2.329  1.00 0.00 ? 44  LYS A CB   2  
ATOM 2375  C CG   . LYS A 1 44  ? 16.801  -1.643  -1.035  1.00 0.00 ? 44  LYS A CG   2  
ATOM 2376  C CD   . LYS A 1 44  ? 17.380  -0.905  0.174   1.00 0.00 ? 44  LYS A CD   2  
ATOM 2377  C CE   . LYS A 1 44  ? 16.701  -1.355  1.469   1.00 0.00 ? 44  LYS A CE   2  
ATOM 2378  N NZ   . LYS A 1 44  ? 17.703  -1.539  2.543   1.00 0.00 ? 44  LYS A NZ   2  
ATOM 2379  H H    . LYS A 1 44  ? 17.087  -3.609  -2.777  1.00 0.00 ? 44  LYS A H    2  
ATOM 2380  H HA   . LYS A 1 44  ? 15.682  -1.426  -3.428  1.00 0.00 ? 44  LYS A HA   2  
ATOM 2381  H HB2  . LYS A 1 44  ? 18.510  -1.571  -2.348  1.00 0.00 ? 44  LYS A HB2  2  
ATOM 2382  H HB3  . LYS A 1 44  ? 17.542  -0.111  -2.359  1.00 0.00 ? 44  LYS A HB3  2  
ATOM 2383  H HG2  . LYS A 1 44  ? 15.730  -1.453  -1.102  1.00 0.00 ? 44  LYS A HG2  2  
ATOM 2384  H HG3  . LYS A 1 44  ? 16.926  -2.718  -0.903  1.00 0.00 ? 44  LYS A HG3  2  
ATOM 2385  H HD2  . LYS A 1 44  ? 18.453  -1.090  0.238   1.00 0.00 ? 44  LYS A HD2  2  
ATOM 2386  H HD3  . LYS A 1 44  ? 17.250  0.169   0.045   1.00 0.00 ? 44  LYS A HD3  2  
ATOM 2387  H HE2  . LYS A 1 44  ? 15.963  -0.615  1.775   1.00 0.00 ? 44  LYS A HE2  2  
ATOM 2388  H HE3  . LYS A 1 44  ? 16.165  -2.289  1.300   1.00 0.00 ? 44  LYS A HE3  2  
ATOM 2389  H HZ1  . LYS A 1 44  ? 17.998  -2.495  2.563   1.00 0.00 ? 44  LYS A HZ1  2  
ATOM 2390  H HZ2  . LYS A 1 44  ? 18.492  -0.951  2.367   1.00 0.00 ? 44  LYS A HZ2  2  
ATOM 2391  H HZ3  . LYS A 1 44  ? 17.296  -1.297  3.423   1.00 0.00 ? 44  LYS A HZ3  2  
ATOM 2392  N N    . ASN A 1 45  ? 18.133  -1.870  -5.505  1.00 0.00 ? 45  ASN A N    2  
ATOM 2393  C CA   . ASN A 1 45  ? 18.701  -1.442  -6.773  1.00 0.00 ? 45  ASN A CA   2  
ATOM 2394  C C    . ASN A 1 45  ? 18.987  0.060   -6.717  1.00 0.00 ? 45  ASN A C    2  
ATOM 2395  O O    . ASN A 1 45  ? 18.873  0.755   -7.726  1.00 0.00 ? 45  ASN A O    2  
ATOM 2396  C CB   . ASN A 1 45  ? 17.728  -1.695  -7.925  1.00 0.00 ? 45  ASN A CB   2  
ATOM 2397  C CG   . ASN A 1 45  ? 17.822  -3.142  -8.414  1.00 0.00 ? 45  ASN A CG   2  
ATOM 2398  O OD1  . ASN A 1 45  ? 18.773  -3.545  -9.063  1.00 0.00 ? 45  ASN A OD1  2  
ATOM 2399  N ND2  . ASN A 1 45  ? 16.784  -3.898  -8.068  1.00 0.00 ? 45  ASN A ND2  2  
ATOM 2400  H H    . ASN A 1 45  ? 18.476  -2.745  -5.163  1.00 0.00 ? 45  ASN A H    2  
ATOM 2401  H HA   . ASN A 1 45  ? 19.607  -2.034  -6.895  1.00 0.00 ? 45  ASN A HA   2  
ATOM 2402  H HB2  . ASN A 1 45  ? 16.709  -1.483  -7.600  1.00 0.00 ? 45  ASN A HB2  2  
ATOM 2403  H HB3  . ASN A 1 45  ? 17.947  -1.015  -8.748  1.00 0.00 ? 45  ASN A HB3  2  
ATOM 2404  H HD21 . ASN A 1 45  ? 16.035  -3.506  -7.535  1.00 0.00 ? 45  ASN A HD21 2  
ATOM 2405  H HD22 . ASN A 1 45  ? 16.753  -4.860  -8.341  1.00 0.00 ? 45  ASN A HD22 2  
ATOM 2406  N N    . GLY A 1 46  ? 19.353  0.517   -5.528  1.00 0.00 ? 46  GLY A N    2  
ATOM 2407  C CA   . GLY A 1 46  ? 19.656  1.924   -5.328  1.00 0.00 ? 46  GLY A CA   2  
ATOM 2408  C C    . GLY A 1 46  ? 19.186  2.395   -3.950  1.00 0.00 ? 46  GLY A C    2  
ATOM 2409  O O    . GLY A 1 46  ? 18.589  1.627   -3.198  1.00 0.00 ? 46  GLY A O    2  
ATOM 2410  H H    . GLY A 1 46  ? 19.443  -0.055  -4.713  1.00 0.00 ? 46  GLY A H    2  
ATOM 2411  H HA2  . GLY A 1 46  ? 20.729  2.086   -5.425  1.00 0.00 ? 46  GLY A HA2  2  
ATOM 2412  H HA3  . GLY A 1 46  ? 19.172  2.518   -6.104  1.00 0.00 ? 46  GLY A HA3  2  
ATOM 2413  N N    . ILE A 1 47  ? 19.474  3.656   -3.662  1.00 0.00 ? 47  ILE A N    2  
ATOM 2414  C CA   . ILE A 1 47  ? 19.089  4.239   -2.388  1.00 0.00 ? 47  ILE A CA   2  
ATOM 2415  C C    . ILE A 1 47  ? 17.613  4.637   -2.439  1.00 0.00 ? 47  ILE A C    2  
ATOM 2416  O O    . ILE A 1 47  ? 17.223  5.488   -3.238  1.00 0.00 ? 47  ILE A O    2  
ATOM 2417  C CB   . ILE A 1 47  ? 20.025  5.393   -2.021  1.00 0.00 ? 47  ILE A CB   2  
ATOM 2418  C CG1  . ILE A 1 47  ? 21.423  4.876   -1.675  1.00 0.00 ? 47  ILE A CG1  2  
ATOM 2419  C CG2  . ILE A 1 47  ? 19.433  6.243   -0.896  1.00 0.00 ? 47  ILE A CG2  2  
ATOM 2420  C CD1  . ILE A 1 47  ? 21.348  3.724   -0.671  1.00 0.00 ? 47  ILE A CD1  2  
ATOM 2421  H H    . ILE A 1 47  ? 19.960  4.274   -4.279  1.00 0.00 ? 47  ILE A H    2  
ATOM 2422  H HA   . ILE A 1 47  ? 19.213  3.469   -1.626  1.00 0.00 ? 47  ILE A HA   2  
ATOM 2423  H HB   . ILE A 1 47  ? 20.127  6.039   -2.893  1.00 0.00 ? 47  ILE A HB   2  
ATOM 2424  H HG12 . ILE A 1 47  ? 21.925  4.540   -2.582  1.00 0.00 ? 47  ILE A HG12 2  
ATOM 2425  H HG13 . ILE A 1 47  ? 22.021  5.687   -1.260  1.00 0.00 ? 47  ILE A HG13 2  
ATOM 2426  H HG21 . ILE A 1 47  ? 20.195  6.427   -0.139  1.00 0.00 ? 47  ILE A HG21 2  
ATOM 2427  H HG22 . ILE A 1 47  ? 19.087  7.194   -1.302  1.00 0.00 ? 47  ILE A HG22 2  
ATOM 2428  H HG23 . ILE A 1 47  ? 18.593  5.714   -0.444  1.00 0.00 ? 47  ILE A HG23 2  
ATOM 2429  H HD11 . ILE A 1 47  ? 20.487  3.867   -0.018  1.00 0.00 ? 47  ILE A HD11 2  
ATOM 2430  H HD12 . ILE A 1 47  ? 21.245  2.781   -1.207  1.00 0.00 ? 47  ILE A HD12 2  
ATOM 2431  H HD13 . ILE A 1 47  ? 22.259  3.705   -0.072  1.00 0.00 ? 47  ILE A HD13 2  
ATOM 2432  N N    . LEU A 1 48  ? 16.831  4.004   -1.577  1.00 0.00 ? 48  LEU A N    2  
ATOM 2433  C CA   . LEU A 1 48  ? 15.406  4.281   -1.515  1.00 0.00 ? 48  LEU A CA   2  
ATOM 2434  C C    . LEU A 1 48  ? 15.193  5.737   -1.095  1.00 0.00 ? 48  LEU A C    2  
ATOM 2435  O O    . LEU A 1 48  ? 15.748  6.185   -0.093  1.00 0.00 ? 48  LEU A O    2  
ATOM 2436  C CB   . LEU A 1 48  ? 14.702  3.270   -0.608  1.00 0.00 ? 48  LEU A CB   2  
ATOM 2437  C CG   . LEU A 1 48  ? 14.928  1.795   -0.947  1.00 0.00 ? 48  LEU A CG   2  
ATOM 2438  C CD1  . LEU A 1 48  ? 14.302  0.887   0.114   1.00 0.00 ? 48  LEU A CD1  2  
ATOM 2439  C CD2  . LEU A 1 48  ? 14.417  1.471   -2.352  1.00 0.00 ? 48  LEU A CD2  2  
ATOM 2440  H H    . LEU A 1 48  ? 17.156  3.313   -0.931  1.00 0.00 ? 48  LEU A H    2  
ATOM 2441  H HA   . LEU A 1 48  ? 15.003  4.149   -2.519  1.00 0.00 ? 48  LEU A HA   2  
ATOM 2442  H HB2  . LEU A 1 48  ? 15.031  3.441   0.417   1.00 0.00 ? 48  LEU A HB2  2  
ATOM 2443  H HB3  . LEU A 1 48  ? 13.631  3.470   -0.637  1.00 0.00 ? 48  LEU A HB3  2  
ATOM 2444  H HG   . LEU A 1 48  ? 16.001  1.603   -0.942  1.00 0.00 ? 48  LEU A HG   2  
ATOM 2445  H HD11 . LEU A 1 48  ? 14.617  1.215   1.105   1.00 0.00 ? 48  LEU A HD11 2  
ATOM 2446  H HD12 . LEU A 1 48  ? 13.216  0.940   0.043   1.00 0.00 ? 48  LEU A HD12 2  
ATOM 2447  H HD13 . LEU A 1 48  ? 14.628  -0.140  -0.049  1.00 0.00 ? 48  LEU A HD13 2  
ATOM 2448  H HD21 . LEU A 1 48  ? 13.494  2.021   -2.539  1.00 0.00 ? 48  LEU A HD21 2  
ATOM 2449  H HD22 . LEU A 1 48  ? 15.168  1.760   -3.087  1.00 0.00 ? 48  LEU A HD22 2  
ATOM 2450  H HD23 . LEU A 1 48  ? 14.224  0.401   -2.431  1.00 0.00 ? 48  LEU A HD23 2  
ATOM 2451  N N    . THR A 1 49  ? 14.387  6.435   -1.882  1.00 0.00 ? 49  THR A N    2  
ATOM 2452  C CA   . THR A 1 49  ? 14.093  7.830   -1.604  1.00 0.00 ? 49  THR A CA   2  
ATOM 2453  C C    . THR A 1 49  ? 12.713  7.966   -0.958  1.00 0.00 ? 49  THR A C    2  
ATOM 2454  O O    . THR A 1 49  ? 12.365  9.029   -0.446  1.00 0.00 ? 49  THR A O    2  
ATOM 2455  C CB   . THR A 1 49  ? 14.231  8.612   -2.912  1.00 0.00 ? 49  THR A CB   2  
ATOM 2456  O OG1  . THR A 1 49  ? 13.588  7.787   -3.879  1.00 0.00 ? 49  THR A OG1  2  
ATOM 2457  C CG2  . THR A 1 49  ? 15.681  8.693   -3.395  1.00 0.00 ? 49  THR A CG2  2  
ATOM 2458  H H    . THR A 1 49  ? 13.939  6.062   -2.695  1.00 0.00 ? 49  THR A H    2  
ATOM 2459  H HA   . THR A 1 49  ? 14.822  8.197   -0.881  1.00 0.00 ? 49  THR A HA   2  
ATOM 2460  H HB   . THR A 1 49  ? 13.796  9.607   -2.818  1.00 0.00 ? 49  THR A HB   2  
ATOM 2461  H HG1  . THR A 1 49  ? 13.005  8.343   -4.470  1.00 0.00 ? 49  THR A HG1  2  
ATOM 2462  H HG21 . THR A 1 49  ? 16.142  7.708   -3.327  1.00 0.00 ? 49  THR A HG21 2  
ATOM 2463  H HG22 . THR A 1 49  ? 15.700  9.033   -4.431  1.00 0.00 ? 49  THR A HG22 2  
ATOM 2464  H HG23 . THR A 1 49  ? 16.233  9.396   -2.772  1.00 0.00 ? 49  THR A HG23 2  
ATOM 2465  N N    . GLY A 1 50  ? 11.963  6.874   -1.003  1.00 0.00 ? 50  GLY A N    2  
ATOM 2466  C CA   . GLY A 1 50  ? 10.629  6.859   -0.428  1.00 0.00 ? 50  GLY A CA   2  
ATOM 2467  C C    . GLY A 1 50  ? 9.828   5.657   -0.935  1.00 0.00 ? 50  GLY A C    2  
ATOM 2468  O O    . GLY A 1 50  ? 10.348  4.832   -1.684  1.00 0.00 ? 50  GLY A O    2  
ATOM 2469  H H    . GLY A 1 50  ? 12.254  6.014   -1.421  1.00 0.00 ? 50  GLY A H    2  
ATOM 2470  H HA2  . GLY A 1 50  ? 10.698  6.822   0.659   1.00 0.00 ? 50  GLY A HA2  2  
ATOM 2471  H HA3  . GLY A 1 50  ? 10.108  7.781   -0.683  1.00 0.00 ? 50  GLY A HA3  2  
ATOM 2472  N N    . TYR A 1 51  ? 8.576   5.598   -0.505  1.00 0.00 ? 51  TYR A N    2  
ATOM 2473  C CA   . TYR A 1 51  ? 7.698   4.511   -0.906  1.00 0.00 ? 51  TYR A CA   2  
ATOM 2474  C C    . TYR A 1 51  ? 6.343   5.046   -1.373  1.00 0.00 ? 51  TYR A C    2  
ATOM 2475  O O    . TYR A 1 51  ? 5.752   5.904   -0.721  1.00 0.00 ? 51  TYR A O    2  
ATOM 2476  C CB   . TYR A 1 51  ? 7.492   3.654   0.344   1.00 0.00 ? 51  TYR A CB   2  
ATOM 2477  C CG   . TYR A 1 51  ? 8.767   2.982   0.856   1.00 0.00 ? 51  TYR A CG   2  
ATOM 2478  C CD1  . TYR A 1 51  ? 9.304   1.909   0.173   1.00 0.00 ? 51  TYR A CD1  2  
ATOM 2479  C CD2  . TYR A 1 51  ? 9.381   3.448   2.000   1.00 0.00 ? 51  TYR A CD2  2  
ATOM 2480  C CE1  . TYR A 1 51  ? 10.504  1.276   0.655   1.00 0.00 ? 51  TYR A CE1  2  
ATOM 2481  C CE2  . TYR A 1 51  ? 10.582  2.816   2.482   1.00 0.00 ? 51  TYR A CE2  2  
ATOM 2482  C CZ   . TYR A 1 51  ? 11.084  1.761   1.786   1.00 0.00 ? 51  TYR A CZ   2  
ATOM 2483  O OH   . TYR A 1 51  ? 12.218  1.164   2.241   1.00 0.00 ? 51  TYR A OH   2  
ATOM 2484  H H    . TYR A 1 51  ? 8.161   6.273   0.105   1.00 0.00 ? 51  TYR A H    2  
ATOM 2485  H HA   . TYR A 1 51  ? 8.175   3.980   -1.729  1.00 0.00 ? 51  TYR A HA   2  
ATOM 2486  H HB2  . TYR A 1 51  ? 7.079   4.278   1.137   1.00 0.00 ? 51  TYR A HB2  2  
ATOM 2487  H HB3  . TYR A 1 51  ? 6.751   2.885   0.126   1.00 0.00 ? 51  TYR A HB3  2  
ATOM 2488  H HD1  . TYR A 1 51  ? 8.818   1.540   -0.731  1.00 0.00 ? 51  TYR A HD1  2  
ATOM 2489  H HD2  . TYR A 1 51  ? 8.958   4.296   2.539   1.00 0.00 ? 51  TYR A HD2  2  
ATOM 2490  H HE1  . TYR A 1 51  ? 10.939  0.428   0.126   1.00 0.00 ? 51  TYR A HE1  2  
ATOM 2491  H HE2  . TYR A 1 51  ? 11.077  3.174   3.384   1.00 0.00 ? 51  TYR A HE2  2  
ATOM 2492  H HH   . TYR A 1 51  ? 12.224  0.198   1.981   1.00 0.00 ? 51  TYR A HH   2  
ATOM 2493  N N    . ARG A 1 52  ? 5.891   4.515   -2.500  1.00 0.00 ? 52  ARG A N    2  
ATOM 2494  C CA   . ARG A 1 52  ? 4.616   4.928   -3.062  1.00 0.00 ? 52  ARG A CA   2  
ATOM 2495  C C    . ARG A 1 52  ? 3.543   3.877   -2.772  1.00 0.00 ? 52  ARG A C    2  
ATOM 2496  O O    . ARG A 1 52  ? 3.585   2.774   -3.315  1.00 0.00 ? 52  ARG A O    2  
ATOM 2497  C CB   . ARG A 1 52  ? 4.722   5.134   -4.575  1.00 0.00 ? 52  ARG A CB   2  
ATOM 2498  C CG   . ARG A 1 52  ? 3.797   6.260   -5.041  1.00 0.00 ? 52  ARG A CG   2  
ATOM 2499  C CD   . ARG A 1 52  ? 3.318   6.018   -6.474  1.00 0.00 ? 52  ARG A CD   2  
ATOM 2500  N NE   . ARG A 1 52  ? 4.414   6.297   -7.428  1.00 0.00 ? 52  ARG A NE   2  
ATOM 2501  C CZ   . ARG A 1 52  ? 4.259   6.341   -8.758  1.00 0.00 ? 52  ARG A CZ   2  
ATOM 2502  N NH1  . ARG A 1 52  ? 3.052   6.126   -9.300  1.00 0.00 ? 52  ARG A NH1  2  
ATOM 2503  N NH2  . ARG A 1 52  ? 5.310   6.602   -9.547  1.00 0.00 ? 52  ARG A NH2  2  
ATOM 2504  H H    . ARG A 1 52  ? 6.378   3.817   -3.025  1.00 0.00 ? 52  ARG A H    2  
ATOM 2505  H HA   . ARG A 1 52  ? 4.385   5.871   -2.568  1.00 0.00 ? 52  ARG A HA   2  
ATOM 2506  H HB2  . ARG A 1 52  ? 5.752   5.371   -4.842  1.00 0.00 ? 52  ARG A HB2  2  
ATOM 2507  H HB3  . ARG A 1 52  ? 4.464   4.209   -5.090  1.00 0.00 ? 52  ARG A HB3  2  
ATOM 2508  H HG2  . ARG A 1 52  ? 2.938   6.330   -4.373  1.00 0.00 ? 52  ARG A HG2  2  
ATOM 2509  H HG3  . ARG A 1 52  ? 4.322   7.213   -4.986  1.00 0.00 ? 52  ARG A HG3  2  
ATOM 2510  H HD2  . ARG A 1 52  ? 2.982   4.987   -6.584  1.00 0.00 ? 52  ARG A HD2  2  
ATOM 2511  H HD3  . ARG A 1 52  ? 2.463   6.657   -6.693  1.00 0.00 ? 52  ARG A HD3  2  
ATOM 2512  H HE   . ARG A 1 52  ? 5.328   6.462   -7.057  1.00 0.00 ? 52  ARG A HE   2  
ATOM 2513  H HH11 . ARG A 1 52  ? 2.267   5.932   -8.711  1.00 0.00 ? 52  ARG A HH11 2  
ATOM 2514  H HH12 . ARG A 1 52  ? 2.936   6.160   -10.292 1.00 0.00 ? 52  ARG A HH12 2  
ATOM 2515  H HH21 . ARG A 1 52  ? 6.211   6.762   -9.143  1.00 0.00 ? 52  ARG A HH21 2  
ATOM 2516  H HH22 . ARG A 1 52  ? 5.194   6.635   -10.540 1.00 0.00 ? 52  ARG A HH22 2  
ATOM 2517  N N    . ILE A 1 53  ? 2.605   4.256   -1.916  1.00 0.00 ? 53  ILE A N    2  
ATOM 2518  C CA   . ILE A 1 53  ? 1.522   3.360   -1.547  1.00 0.00 ? 53  ILE A CA   2  
ATOM 2519  C C    . ILE A 1 53  ? 0.253   3.762   -2.302  1.00 0.00 ? 53  ILE A C    2  
ATOM 2520  O O    . ILE A 1 53  ? 0.048   4.939   -2.594  1.00 0.00 ? 53  ILE A O    2  
ATOM 2521  C CB   . ILE A 1 53  ? 1.349   3.327   -0.027  1.00 0.00 ? 53  ILE A CB   2  
ATOM 2522  C CG1  . ILE A 1 53  ? 0.282   2.309   0.381   1.00 0.00 ? 53  ILE A CG1  2  
ATOM 2523  C CG2  . ILE A 1 53  ? 1.049   4.723   0.522   1.00 0.00 ? 53  ILE A CG2  2  
ATOM 2524  C CD1  . ILE A 1 53  ? -0.070  2.448   1.863   1.00 0.00 ? 53  ILE A CD1  2  
ATOM 2525  H H    . ILE A 1 53  ? 2.577   5.155   -1.479  1.00 0.00 ? 53  ILE A H    2  
ATOM 2526  H HA   . ILE A 1 53  ? 1.807   2.356   -1.861  1.00 0.00 ? 53  ILE A HA   2  
ATOM 2527  H HB   . ILE A 1 53  ? 2.290   3.002   0.417   1.00 0.00 ? 53  ILE A HB   2  
ATOM 2528  H HG12 . ILE A 1 53  ? -0.613  2.453   -0.224  1.00 0.00 ? 53  ILE A HG12 2  
ATOM 2529  H HG13 . ILE A 1 53  ? 0.642   1.300   0.182   1.00 0.00 ? 53  ILE A HG13 2  
ATOM 2530  H HG21 . ILE A 1 53  ? 1.810   4.998   1.252   1.00 0.00 ? 53  ILE A HG21 2  
ATOM 2531  H HG22 . ILE A 1 53  ? 1.053   5.443   -0.296  1.00 0.00 ? 53  ILE A HG22 2  
ATOM 2532  H HG23 . ILE A 1 53  ? 0.070   4.723   1.000   1.00 0.00 ? 53  ILE A HG23 2  
ATOM 2533  H HD11 . ILE A 1 53  ? -1.039  2.937   1.962   1.00 0.00 ? 53  ILE A HD11 2  
ATOM 2534  H HD12 . ILE A 1 53  ? -0.113  1.460   2.321   1.00 0.00 ? 53  ILE A HD12 2  
ATOM 2535  H HD13 . ILE A 1 53  ? 0.691   3.047   2.363   1.00 0.00 ? 53  ILE A HD13 2  
ATOM 2536  N N    . SER A 1 54  ? -0.564  2.762   -2.595  1.00 0.00 ? 54  SER A N    2  
ATOM 2537  C CA   . SER A 1 54  ? -1.807  2.997   -3.310  1.00 0.00 ? 54  SER A CA   2  
ATOM 2538  C C    . SER A 1 54  ? -2.837  1.929   -2.934  1.00 0.00 ? 54  SER A C    2  
ATOM 2539  O O    . SER A 1 54  ? -2.645  0.749   -3.220  1.00 0.00 ? 54  SER A O    2  
ATOM 2540  C CB   . SER A 1 54  ? -1.580  3.005   -4.823  1.00 0.00 ? 54  SER A CB   2  
ATOM 2541  O OG   . SER A 1 54  ? -0.288  2.514   -5.171  1.00 0.00 ? 54  SER A OG   2  
ATOM 2542  H H    . SER A 1 54  ? -0.390  1.808   -2.353  1.00 0.00 ? 54  SER A H    2  
ATOM 2543  H HA   . SER A 1 54  ? -2.144  3.983   -2.988  1.00 0.00 ? 54  SER A HA   2  
ATOM 2544  H HB2  . SER A 1 54  ? -2.342  2.396   -5.307  1.00 0.00 ? 54  SER A HB2  2  
ATOM 2545  H HB3  . SER A 1 54  ? -1.695  4.021   -5.201  1.00 0.00 ? 54  SER A HB3  2  
ATOM 2546  H HG   . SER A 1 54  ? -0.221  2.401   -6.162  1.00 0.00 ? 54  SER A HG   2  
ATOM 2547  N N    . TRP A 1 55  ? -3.907  2.383   -2.298  1.00 0.00 ? 55  TRP A N    2  
ATOM 2548  C CA   . TRP A 1 55  ? -4.967  1.482   -1.880  1.00 0.00 ? 55  TRP A CA   2  
ATOM 2549  C C    . TRP A 1 55  ? -6.129  1.630   -2.865  1.00 0.00 ? 55  TRP A C    2  
ATOM 2550  O O    . TRP A 1 55  ? -6.395  2.725   -3.357  1.00 0.00 ? 55  TRP A O    2  
ATOM 2551  C CB   . TRP A 1 55  ? -5.375  1.749   -0.430  1.00 0.00 ? 55  TRP A CB   2  
ATOM 2552  C CG   . TRP A 1 55  ? -6.034  3.113   -0.210  1.00 0.00 ? 55  TRP A CG   2  
ATOM 2553  C CD1  . TRP A 1 55  ? -7.252  3.512   -0.598  1.00 0.00 ? 55  TRP A CD1  2  
ATOM 2554  C CD2  . TRP A 1 55  ? -5.455  4.247   0.469   1.00 0.00 ? 55  TRP A CD2  2  
ATOM 2555  N NE1  . TRP A 1 55  ? -7.501  4.816   -0.219  1.00 0.00 ? 55  TRP A NE1  2  
ATOM 2556  C CE2  . TRP A 1 55  ? -6.374  5.277   0.450   1.00 0.00 ? 55  TRP A CE2  2  
ATOM 2557  C CE3  . TRP A 1 55  ? -4.198  4.398   1.080   1.00 0.00 ? 55  TRP A CE3  2  
ATOM 2558  C CZ2  . TRP A 1 55  ? -6.133  6.530   1.026   1.00 0.00 ? 55  TRP A CZ2  2  
ATOM 2559  C CZ3  . TRP A 1 55  ? -3.973  5.657   1.651   1.00 0.00 ? 55  TRP A CZ3  2  
ATOM 2560  C CH2  . TRP A 1 55  ? -4.887  6.704   1.640   1.00 0.00 ? 55  TRP A CH2  2  
ATOM 2561  H H    . TRP A 1 55  ? -4.056  3.345   -2.069  1.00 0.00 ? 55  TRP A H    2  
ATOM 2562  H HA   . TRP A 1 55  ? -4.575  0.466   -1.917  1.00 0.00 ? 55  TRP A HA   2  
ATOM 2563  H HB2  . TRP A 1 55  ? -6.063  0.968   -0.107  1.00 0.00 ? 55  TRP A HB2  2  
ATOM 2564  H HB3  . TRP A 1 55  ? -4.491  1.678   0.204   1.00 0.00 ? 55  TRP A HB3  2  
ATOM 2565  H HD1  . TRP A 1 55  ? -7.958  2.886   -1.143  1.00 0.00 ? 55  TRP A HD1  2  
ATOM 2566  H HE1  . TRP A 1 55  ? -8.414  5.380   -0.411  1.00 0.00 ? 55  TRP A HE1  2  
ATOM 2567  H HE3  . TRP A 1 55  ? -3.456  3.600   1.109   1.00 0.00 ? 55  TRP A HE3  2  
ATOM 2568  H HZ2  . TRP A 1 55  ? -6.875  7.328   0.997   1.00 0.00 ? 55  TRP A HZ2  2  
ATOM 2569  H HZ3  . TRP A 1 55  ? -3.012  5.827   2.138   1.00 0.00 ? 55  TRP A HZ3  2  
ATOM 2570  H HH2  . TRP A 1 55  ? -4.635  7.655   2.107   1.00 0.00 ? 55  TRP A HH2  2  
ATOM 2571  N N    . GLU A 1 56  ? -6.791  0.511   -3.122  1.00 0.00 ? 56  GLU A N    2  
ATOM 2572  C CA   . GLU A 1 56  ? -7.919  0.502   -4.039  1.00 0.00 ? 56  GLU A CA   2  
ATOM 2573  C C    . GLU A 1 56  ? -8.744  -0.772  -3.853  1.00 0.00 ? 56  GLU A C    2  
ATOM 2574  O O    . GLU A 1 56  ? -8.197  -1.831  -3.548  1.00 0.00 ? 56  GLU A O    2  
ATOM 2575  C CB   . GLU A 1 56  ? -7.448  0.645   -5.488  1.00 0.00 ? 56  GLU A CB   2  
ATOM 2576  C CG   . GLU A 1 56  ? -6.696  -0.606  -5.945  1.00 0.00 ? 56  GLU A CG   2  
ATOM 2577  C CD   . GLU A 1 56  ? -7.025  -0.941  -7.402  1.00 0.00 ? 56  GLU A CD   2  
ATOM 2578  O OE1  . GLU A 1 56  ? -6.417  -0.296  -8.283  1.00 0.00 ? 56  GLU A OE1  2  
ATOM 2579  O OE2  . GLU A 1 56  ? -7.876  -1.835  -7.601  1.00 0.00 ? 56  GLU A OE2  2  
ATOM 2580  H H    . GLU A 1 56  ? -6.569  -0.376  -2.717  1.00 0.00 ? 56  GLU A H    2  
ATOM 2581  H HA   . GLU A 1 56  ? -8.517  1.373   -3.770  1.00 0.00 ? 56  GLU A HA   2  
ATOM 2582  H HB2  . GLU A 1 56  ? -8.307  0.816   -6.137  1.00 0.00 ? 56  GLU A HB2  2  
ATOM 2583  H HB3  . GLU A 1 56  ? -6.801  1.517   -5.580  1.00 0.00 ? 56  GLU A HB3  2  
ATOM 2584  H HG2  . GLU A 1 56  ? -5.623  -0.449  -5.838  1.00 0.00 ? 56  GLU A HG2  2  
ATOM 2585  H HG3  . GLU A 1 56  ? -6.961  -1.448  -5.306  1.00 0.00 ? 56  GLU A HG3  2  
ATOM 2586  N N    . GLU A 1 57  ? -10.047 -0.629  -4.045  1.00 0.00 ? 57  GLU A N    2  
ATOM 2587  C CA   . GLU A 1 57  ? -10.953 -1.755  -3.902  1.00 0.00 ? 57  GLU A CA   2  
ATOM 2588  C C    . GLU A 1 57  ? -10.417 -2.968  -4.666  1.00 0.00 ? 57  GLU A C    2  
ATOM 2589  O O    . GLU A 1 57  ? -9.413  -2.868  -5.370  1.00 0.00 ? 57  GLU A O    2  
ATOM 2590  C CB   . GLU A 1 57  ? -12.362 -1.389  -4.374  1.00 0.00 ? 57  GLU A CB   2  
ATOM 2591  C CG   . GLU A 1 57  ? -13.279 -1.094  -3.185  1.00 0.00 ? 57  GLU A CG   2  
ATOM 2592  C CD   . GLU A 1 57  ? -14.204 -2.279  -2.899  1.00 0.00 ? 57  GLU A CD   2  
ATOM 2593  O OE1  . GLU A 1 57  ? -13.669 -3.403  -2.792  1.00 0.00 ? 57  GLU A OE1  2  
ATOM 2594  O OE2  . GLU A 1 57  ? -15.425 -2.033  -2.794  1.00 0.00 ? 57  GLU A OE2  2  
ATOM 2595  H H    . GLU A 1 57  ? -10.484 0.236   -4.293  1.00 0.00 ? 57  GLU A H    2  
ATOM 2596  H HA   . GLU A 1 57  ? -10.979 -1.973  -2.835  1.00 0.00 ? 57  GLU A HA   2  
ATOM 2597  H HB2  . GLU A 1 57  ? -12.315 -0.518  -5.027  1.00 0.00 ? 57  GLU A HB2  2  
ATOM 2598  H HB3  . GLU A 1 57  ? -12.776 -2.208  -4.963  1.00 0.00 ? 57  GLU A HB3  2  
ATOM 2599  H HG2  . GLU A 1 57  ? -12.677 -0.876  -2.303  1.00 0.00 ? 57  GLU A HG2  2  
ATOM 2600  H HG3  . GLU A 1 57  ? -13.874 -0.205  -3.393  1.00 0.00 ? 57  GLU A HG3  2  
ATOM 2601  N N    . TYR A 1 58  ? -11.110 -4.085  -4.502  1.00 0.00 ? 58  TYR A N    2  
ATOM 2602  C CA   . TYR A 1 58  ? -10.716 -5.315  -5.167  1.00 0.00 ? 58  TYR A CA   2  
ATOM 2603  C C    . TYR A 1 58  ? -10.525 -5.090  -6.668  1.00 0.00 ? 58  TYR A C    2  
ATOM 2604  O O    . TYR A 1 58  ? -9.428  -5.273  -7.193  1.00 0.00 ? 58  TYR A O    2  
ATOM 2605  C CB   . TYR A 1 58  ? -11.869 -6.298  -4.953  1.00 0.00 ? 58  TYR A CB   2  
ATOM 2606  C CG   . TYR A 1 58  ? -11.845 -7.500  -5.899  1.00 0.00 ? 58  TYR A CG   2  
ATOM 2607  C CD1  . TYR A 1 58  ? -10.773 -8.370  -5.884  1.00 0.00 ? 58  TYR A CD1  2  
ATOM 2608  C CD2  . TYR A 1 58  ? -12.895 -7.715  -6.768  1.00 0.00 ? 58  TYR A CD2  2  
ATOM 2609  C CE1  . TYR A 1 58  ? -10.751 -9.501  -6.774  1.00 0.00 ? 58  TYR A CE1  2  
ATOM 2610  C CE2  . TYR A 1 58  ? -12.873 -8.847  -7.659  1.00 0.00 ? 58  TYR A CE2  2  
ATOM 2611  C CZ   . TYR A 1 58  ? -11.802 -9.684  -7.618  1.00 0.00 ? 58  TYR A CZ   2  
ATOM 2612  O OH   . TYR A 1 58  ? -11.780 -10.752 -8.459  1.00 0.00 ? 58  TYR A OH   2  
ATOM 2613  H H    . TYR A 1 58  ? -11.925 -4.158  -3.927  1.00 0.00 ? 58  TYR A H    2  
ATOM 2614  H HA   . TYR A 1 58  ? -9.772  -5.644  -4.734  1.00 0.00 ? 58  TYR A HA   2  
ATOM 2615  H HB2  . TYR A 1 58  ? -11.840 -6.657  -3.925  1.00 0.00 ? 58  TYR A HB2  2  
ATOM 2616  H HB3  . TYR A 1 58  ? -12.813 -5.768  -5.080  1.00 0.00 ? 58  TYR A HB3  2  
ATOM 2617  H HD1  . TYR A 1 58  ? -9.944  -8.200  -5.197  1.00 0.00 ? 58  TYR A HD1  2  
ATOM 2618  H HD2  . TYR A 1 58  ? -13.742 -7.029  -6.781  1.00 0.00 ? 58  TYR A HD2  2  
ATOM 2619  H HE1  . TYR A 1 58  ? -9.910  -10.195 -6.772  1.00 0.00 ? 58  TYR A HE1  2  
ATOM 2620  H HE2  . TYR A 1 58  ? -13.696 -9.028  -8.350  1.00 0.00 ? 58  TYR A HE2  2  
ATOM 2621  H HH   . TYR A 1 58  ? -10.923 -11.255 -8.351  1.00 0.00 ? 58  TYR A HH   2  
ATOM 2622  N N    . ASN A 1 59  ? -11.611 -4.696  -7.318  1.00 0.00 ? 59  ASN A N    2  
ATOM 2623  C CA   . ASN A 1 59  ? -11.577 -4.443  -8.748  1.00 0.00 ? 59  ASN A CA   2  
ATOM 2624  C C    . ASN A 1 59  ? -12.321 -3.141  -9.050  1.00 0.00 ? 59  ASN A C    2  
ATOM 2625  O O    . ASN A 1 59  ? -13.272 -3.131  -9.829  1.00 0.00 ? 59  ASN A O    2  
ATOM 2626  C CB   . ASN A 1 59  ? -12.264 -5.570  -9.523  1.00 0.00 ? 59  ASN A CB   2  
ATOM 2627  C CG   . ASN A 1 59  ? -11.505 -5.891  -10.812 1.00 0.00 ? 59  ASN A CG   2  
ATOM 2628  O OD1  . ASN A 1 59  ? -11.511 -5.135  -11.770 1.00 0.00 ? 59  ASN A OD1  2  
ATOM 2629  N ND2  . ASN A 1 59  ? -10.855 -7.050  -10.783 1.00 0.00 ? 59  ASN A ND2  2  
ATOM 2630  H H    . ASN A 1 59  ? -12.500 -4.549  -6.884  1.00 0.00 ? 59  ASN A H    2  
ATOM 2631  H HA   . ASN A 1 59  ? -10.519 -4.388  -9.004  1.00 0.00 ? 59  ASN A HA   2  
ATOM 2632  H HB2  . ASN A 1 59  ? -12.322 -6.462  -8.899  1.00 0.00 ? 59  ASN A HB2  2  
ATOM 2633  H HB3  . ASN A 1 59  ? -13.288 -5.281  -9.761  1.00 0.00 ? 59  ASN A HB3  2  
ATOM 2634  H HD21 . ASN A 1 59  ? -10.891 -7.623  -9.964  1.00 0.00 ? 59  ASN A HD21 2  
ATOM 2635  H HD22 . ASN A 1 59  ? -10.329 -7.349  -11.579 1.00 0.00 ? 59  ASN A HD22 2  
ATOM 2636  N N    . ARG A 1 60  ? -11.858 -2.072  -8.416  1.00 0.00 ? 60  ARG A N    2  
ATOM 2637  C CA   . ARG A 1 60  ? -12.468 -0.767  -8.607  1.00 0.00 ? 60  ARG A CA   2  
ATOM 2638  C C    . ARG A 1 60  ? -11.440 0.339   -8.363  1.00 0.00 ? 60  ARG A C    2  
ATOM 2639  O O    . ARG A 1 60  ? -11.354 0.879   -7.261  1.00 0.00 ? 60  ARG A O    2  
ATOM 2640  C CB   . ARG A 1 60  ? -13.654 -0.570  -7.661  1.00 0.00 ? 60  ARG A CB   2  
ATOM 2641  C CG   . ARG A 1 60  ? -14.458 -1.863  -7.513  1.00 0.00 ? 60  ARG A CG   2  
ATOM 2642  C CD   . ARG A 1 60  ? -15.635 -1.670  -6.555  1.00 0.00 ? 60  ARG A CD   2  
ATOM 2643  N NE   . ARG A 1 60  ? -16.815 -2.416  -7.046  1.00 0.00 ? 60  ARG A NE   2  
ATOM 2644  C CZ   . ARG A 1 60  ? -17.669 -1.949  -7.968  1.00 0.00 ? 60  ARG A CZ   2  
ATOM 2645  N NH1  . ARG A 1 60  ? -17.479 -0.736  -8.503  1.00 0.00 ? 60  ARG A NH1  2  
ATOM 2646  N NH2  . ARG A 1 60  ? -18.713 -2.696  -8.354  1.00 0.00 ? 60  ARG A NH2  2  
ATOM 2647  H H    . ARG A 1 60  ? -11.084 -2.089  -7.784  1.00 0.00 ? 60  ARG A H    2  
ATOM 2648  H HA   . ARG A 1 60  ? -12.806 -0.766  -9.643  1.00 0.00 ? 60  ARG A HA   2  
ATOM 2649  H HB2  . ARG A 1 60  ? -13.295 -0.246  -6.685  1.00 0.00 ? 60  ARG A HB2  2  
ATOM 2650  H HB3  . ARG A 1 60  ? -14.300 0.222   -8.042  1.00 0.00 ? 60  ARG A HB3  2  
ATOM 2651  H HG2  . ARG A 1 60  ? -14.826 -2.181  -8.488  1.00 0.00 ? 60  ARG A HG2  2  
ATOM 2652  H HG3  . ARG A 1 60  ? -13.810 -2.658  -7.142  1.00 0.00 ? 60  ARG A HG3  2  
ATOM 2653  H HD2  . ARG A 1 60  ? -15.365 -2.018  -5.558  1.00 0.00 ? 60  ARG A HD2  2  
ATOM 2654  H HD3  . ARG A 1 60  ? -15.875 -0.610  -6.469  1.00 0.00 ? 60  ARG A HD3  2  
ATOM 2655  H HE   . ARG A 1 60  ? -16.986 -3.326  -6.667  1.00 0.00 ? 60  ARG A HE   2  
ATOM 2656  H HH11 . ARG A 1 60  ? -16.700 -0.179  -8.215  1.00 0.00 ? 60  ARG A HH11 2  
ATOM 2657  H HH12 . ARG A 1 60  ? -18.116 -0.387  -9.191  1.00 0.00 ? 60  ARG A HH12 2  
ATOM 2658  H HH21 . ARG A 1 60  ? -18.854 -3.602  -7.954  1.00 0.00 ? 60  ARG A HH21 2  
ATOM 2659  H HH22 . ARG A 1 60  ? -19.350 -2.348  -9.041  1.00 0.00 ? 60  ARG A HH22 2  
ATOM 2660  N N    . THR A 1 61  ? -10.686 0.644   -9.408  1.00 0.00 ? 61  THR A N    2  
ATOM 2661  C CA   . THR A 1 61  ? -9.668  1.677   -9.321  1.00 0.00 ? 61  THR A CA   2  
ATOM 2662  C C    . THR A 1 61  ? -10.299 3.018   -8.943  1.00 0.00 ? 61  THR A C    2  
ATOM 2663  O O    . THR A 1 61  ? -9.624  3.899   -8.412  1.00 0.00 ? 61  THR A O    2  
ATOM 2664  C CB   . THR A 1 61  ? -8.916  1.714   -10.653 1.00 0.00 ? 61  THR A CB   2  
ATOM 2665  O OG1  . THR A 1 61  ? -8.155  0.509   -10.656 1.00 0.00 ? 61  THR A OG1  2  
ATOM 2666  C CG2  . THR A 1 61  ? -7.861  2.820   -10.700 1.00 0.00 ? 61  THR A CG2  2  
ATOM 2667  H H    . THR A 1 61  ? -10.762 0.201   -10.301 1.00 0.00 ? 61  THR A H    2  
ATOM 2668  H HA   . THR A 1 61  ? -8.977  1.412   -8.521  1.00 0.00 ? 61  THR A HA   2  
ATOM 2669  H HB   . THR A 1 61  ? -9.610  1.801   -11.489 1.00 0.00 ? 61  THR A HB   2  
ATOM 2670  H HG1  . THR A 1 61  ? -7.651  0.421   -9.796  1.00 0.00 ? 61  THR A HG1  2  
ATOM 2671  H HG21 . THR A 1 61  ? -7.200  2.657   -11.551 1.00 0.00 ? 61  THR A HG21 2  
ATOM 2672  H HG22 . THR A 1 61  ? -8.353  3.788   -10.803 1.00 0.00 ? 61  THR A HG22 2  
ATOM 2673  H HG23 . THR A 1 61  ? -7.277  2.806   -9.779  1.00 0.00 ? 61  THR A HG23 2  
ATOM 2674  N N    . ASN A 1 62  ? -11.587 3.132   -9.231  1.00 0.00 ? 62  ASN A N    2  
ATOM 2675  C CA   . ASN A 1 62  ? -12.317 4.351   -8.927  1.00 0.00 ? 62  ASN A CA   2  
ATOM 2676  C C    . ASN A 1 62  ? -12.052 4.751   -7.474  1.00 0.00 ? 62  ASN A C    2  
ATOM 2677  O O    . ASN A 1 62  ? -12.181 5.920   -7.115  1.00 0.00 ? 62  ASN A O    2  
ATOM 2678  C CB   . ASN A 1 62  ? -13.824 4.146   -9.094  1.00 0.00 ? 62  ASN A CB   2  
ATOM 2679  C CG   . ASN A 1 62  ? -14.267 4.471   -10.522 1.00 0.00 ? 62  ASN A CG   2  
ATOM 2680  O OD1  . ASN A 1 62  ? -13.528 4.313   -11.480 1.00 0.00 ? 62  ASN A OD1  2  
ATOM 2681  N ND2  . ASN A 1 62  ? -15.511 4.933   -10.611 1.00 0.00 ? 62  ASN A ND2  2  
ATOM 2682  H H    . ASN A 1 62  ? -12.129 2.411   -9.663  1.00 0.00 ? 62  ASN A H    2  
ATOM 2683  H HA   . ASN A 1 62  ? -11.947 5.090   -9.637  1.00 0.00 ? 62  ASN A HA   2  
ATOM 2684  H HB2  . ASN A 1 62  ? -14.084 3.115   -8.855  1.00 0.00 ? 62  ASN A HB2  2  
ATOM 2685  H HB3  . ASN A 1 62  ? -14.361 4.781   -8.390  1.00 0.00 ? 62  ASN A HB3  2  
ATOM 2686  H HD21 . ASN A 1 62  ? -16.065 5.039   -9.786  1.00 0.00 ? 62  ASN A HD21 2  
ATOM 2687  H HD22 . ASN A 1 62  ? -15.892 5.174   -11.504 1.00 0.00 ? 62  ASN A HD22 2  
ATOM 2688  N N    . THR A 1 63  ? -11.688 3.757   -6.678  1.00 0.00 ? 63  THR A N    2  
ATOM 2689  C CA   . THR A 1 63  ? -11.404 3.990   -5.272  1.00 0.00 ? 63  THR A CA   2  
ATOM 2690  C C    . THR A 1 63  ? -9.904  3.854   -5.001  1.00 0.00 ? 63  THR A C    2  
ATOM 2691  O O    . THR A 1 63  ? -9.502  3.380   -3.940  1.00 0.00 ? 63  THR A O    2  
ATOM 2692  C CB   . THR A 1 63  ? -12.260 3.024   -4.450  1.00 0.00 ? 63  THR A CB   2  
ATOM 2693  O OG1  . THR A 1 63  ? -11.554 1.788   -4.521  1.00 0.00 ? 63  THR A OG1  2  
ATOM 2694  C CG2  . THR A 1 63  ? -13.605 2.723   -5.114  1.00 0.00 ? 63  THR A CG2  2  
ATOM 2695  H H    . THR A 1 63  ? -11.586 2.808   -6.978  1.00 0.00 ? 63  THR A H    2  
ATOM 2696  H HA   . THR A 1 63  ? -11.681 5.016   -5.031  1.00 0.00 ? 63  THR A HA   2  
ATOM 2697  H HB   . THR A 1 63  ? -12.401 3.396   -3.435  1.00 0.00 ? 63  THR A HB   2  
ATOM 2698  H HG1  . THR A 1 63  ? -11.537 1.458   -5.465  1.00 0.00 ? 63  THR A HG1  2  
ATOM 2699  H HG21 . THR A 1 63  ? -14.162 2.014   -4.502  1.00 0.00 ? 63  THR A HG21 2  
ATOM 2700  H HG22 . THR A 1 63  ? -14.177 3.646   -5.211  1.00 0.00 ? 63  THR A HG22 2  
ATOM 2701  H HG23 . THR A 1 63  ? -13.435 2.296   -6.102  1.00 0.00 ? 63  THR A HG23 2  
ATOM 2702  N N    . ARG A 1 64  ? -9.118  4.279   -5.979  1.00 0.00 ? 64  ARG A N    2  
ATOM 2703  C CA   . ARG A 1 64  ? -7.672  4.211   -5.860  1.00 0.00 ? 64  ARG A CA   2  
ATOM 2704  C C    . ARG A 1 64  ? -7.115  5.554   -5.383  1.00 0.00 ? 64  ARG A C    2  
ATOM 2705  O O    . ARG A 1 64  ? -7.753  6.591   -5.555  1.00 0.00 ? 64  ARG A O    2  
ATOM 2706  C CB   . ARG A 1 64  ? -7.025  3.844   -7.197  1.00 0.00 ? 64  ARG A CB   2  
ATOM 2707  C CG   . ARG A 1 64  ? -5.643  3.223   -6.986  1.00 0.00 ? 64  ARG A CG   2  
ATOM 2708  C CD   . ARG A 1 64  ? -4.556  4.064   -7.659  1.00 0.00 ? 64  ARG A CD   2  
ATOM 2709  N NE   . ARG A 1 64  ? -3.601  3.182   -8.369  1.00 0.00 ? 64  ARG A NE   2  
ATOM 2710  C CZ   . ARG A 1 64  ? -2.771  3.598   -9.334  1.00 0.00 ? 64  ARG A CZ   2  
ATOM 2711  N NH1  . ARG A 1 64  ? -2.772  4.883   -9.712  1.00 0.00 ? 64  ARG A NH1  2  
ATOM 2712  N NH2  . ARG A 1 64  ? -1.939  2.727   -9.923  1.00 0.00 ? 64  ARG A NH2  2  
ATOM 2713  H H    . ARG A 1 64  ? -9.453  4.663   -6.840  1.00 0.00 ? 64  ARG A H    2  
ATOM 2714  H HA   . ARG A 1 64  ? -7.489  3.427   -5.125  1.00 0.00 ? 64  ARG A HA   2  
ATOM 2715  H HB2  . ARG A 1 64  ? -7.664  3.144   -7.734  1.00 0.00 ? 64  ARG A HB2  2  
ATOM 2716  H HB3  . ARG A 1 64  ? -6.936  4.735   -7.819  1.00 0.00 ? 64  ARG A HB3  2  
ATOM 2717  H HG2  . ARG A 1 64  ? -5.436  3.142   -5.919  1.00 0.00 ? 64  ARG A HG2  2  
ATOM 2718  H HG3  . ARG A 1 64  ? -5.629  2.212   -7.392  1.00 0.00 ? 64  ARG A HG3  2  
ATOM 2719  H HD2  . ARG A 1 64  ? -5.008  4.764   -8.361  1.00 0.00 ? 64  ARG A HD2  2  
ATOM 2720  H HD3  . ARG A 1 64  ? -4.029  4.657   -6.912  1.00 0.00 ? 64  ARG A HD3  2  
ATOM 2721  H HE   . ARG A 1 64  ? -3.575  2.216   -8.111  1.00 0.00 ? 64  ARG A HE   2  
ATOM 2722  H HH11 . ARG A 1 64  ? -3.393  5.533   -9.273  1.00 0.00 ? 64  ARG A HH11 2  
ATOM 2723  H HH12 . ARG A 1 64  ? -2.152  5.193   -10.433 1.00 0.00 ? 64  ARG A HH12 2  
ATOM 2724  H HH21 . ARG A 1 64  ? -1.938  1.768   -9.641  1.00 0.00 ? 64  ARG A HH21 2  
ATOM 2725  H HH22 . ARG A 1 64  ? -1.319  3.037   -10.644 1.00 0.00 ? 64  ARG A HH22 2  
ATOM 2726  N N    . VAL A 1 65  ? -5.930  5.491   -4.793  1.00 0.00 ? 65  VAL A N    2  
ATOM 2727  C CA   . VAL A 1 65  ? -5.280  6.689   -4.290  1.00 0.00 ? 65  VAL A CA   2  
ATOM 2728  C C    . VAL A 1 65  ? -3.769  6.572   -4.503  1.00 0.00 ? 65  VAL A C    2  
ATOM 2729  O O    . VAL A 1 65  ? -3.247  5.472   -4.678  1.00 0.00 ? 65  VAL A O    2  
ATOM 2730  C CB   . VAL A 1 65  ? -5.662  6.916   -2.826  1.00 0.00 ? 65  VAL A CB   2  
ATOM 2731  C CG1  . VAL A 1 65  ? -4.962  5.906   -1.914  1.00 0.00 ? 65  VAL A CG1  2  
ATOM 2732  C CG2  . VAL A 1 65  ? -5.351  8.351   -2.394  1.00 0.00 ? 65  VAL A CG2  2  
ATOM 2733  H H    . VAL A 1 65  ? -5.418  4.643   -4.656  1.00 0.00 ? 65  VAL A H    2  
ATOM 2734  H HA   . VAL A 1 65  ? -5.652  7.533   -4.870  1.00 0.00 ? 65  VAL A HA   2  
ATOM 2735  H HB   . VAL A 1 65  ? -6.737  6.763   -2.732  1.00 0.00 ? 65  VAL A HB   2  
ATOM 2736  H HG11 . VAL A 1 65  ? -5.596  5.028   -1.791  1.00 0.00 ? 65  VAL A HG11 2  
ATOM 2737  H HG12 . VAL A 1 65  ? -4.013  5.609   -2.361  1.00 0.00 ? 65  VAL A HG12 2  
ATOM 2738  H HG13 . VAL A 1 65  ? -4.779  6.361   -0.941  1.00 0.00 ? 65  VAL A HG13 2  
ATOM 2739  H HG21 . VAL A 1 65  ? -5.978  8.618   -1.543  1.00 0.00 ? 65  VAL A HG21 2  
ATOM 2740  H HG22 . VAL A 1 65  ? -4.302  8.426   -2.110  1.00 0.00 ? 65  VAL A HG22 2  
ATOM 2741  H HG23 . VAL A 1 65  ? -5.553  9.031   -3.222  1.00 0.00 ? 65  VAL A HG23 2  
ATOM 2742  N N    . THR A 1 66  ? -3.110  7.721   -4.481  1.00 0.00 ? 66  THR A N    2  
ATOM 2743  C CA   . THR A 1 66  ? -1.670  7.762   -4.670  1.00 0.00 ? 66  THR A CA   2  
ATOM 2744  C C    . THR A 1 66  ? -1.012  8.602   -3.573  1.00 0.00 ? 66  THR A C    2  
ATOM 2745  O O    . THR A 1 66  ? -1.093  9.829   -3.594  1.00 0.00 ? 66  THR A O    2  
ATOM 2746  C CB   . THR A 1 66  ? -1.392  8.280   -6.082  1.00 0.00 ? 66  THR A CB   2  
ATOM 2747  O OG1  . THR A 1 66  ? -2.002  7.313   -6.933  1.00 0.00 ? 66  THR A OG1  2  
ATOM 2748  C CG2  . THR A 1 66  ? 0.092   8.216   -6.448  1.00 0.00 ? 66  THR A CG2  2  
ATOM 2749  H H    . THR A 1 66  ? -3.543  8.611   -4.338  1.00 0.00 ? 66  THR A H    2  
ATOM 2750  H HA   . THR A 1 66  ? -1.282  6.748   -4.571  1.00 0.00 ? 66  THR A HA   2  
ATOM 2751  H HB   . THR A 1 66  ? -1.781  9.290   -6.209  1.00 0.00 ? 66  THR A HB   2  
ATOM 2752  H HG1  . THR A 1 66  ? -1.697  6.395   -6.681  1.00 0.00 ? 66  THR A HG1  2  
ATOM 2753  H HG21 . THR A 1 66  ? 0.655   7.800   -5.612  1.00 0.00 ? 66  THR A HG21 2  
ATOM 2754  H HG22 . THR A 1 66  ? 0.222   7.582   -7.325  1.00 0.00 ? 66  THR A HG22 2  
ATOM 2755  H HG23 . THR A 1 66  ? 0.456   9.219   -6.668  1.00 0.00 ? 66  THR A HG23 2  
ATOM 2756  N N    . HIS A 1 67  ? -0.375  7.908   -2.642  1.00 0.00 ? 67  HIS A N    2  
ATOM 2757  C CA   . HIS A 1 67  ? 0.296   8.575   -1.539  1.00 0.00 ? 67  HIS A CA   2  
ATOM 2758  C C    . HIS A 1 67  ? 1.806   8.356   -1.650  1.00 0.00 ? 67  HIS A C    2  
ATOM 2759  O O    . HIS A 1 67  ? 2.257   7.463   -2.367  1.00 0.00 ? 67  HIS A O    2  
ATOM 2760  C CB   . HIS A 1 67  ? -0.273  8.112   -0.197  1.00 0.00 ? 67  HIS A CB   2  
ATOM 2761  C CG   . HIS A 1 67  ? -1.389  8.983   0.330   1.00 0.00 ? 67  HIS A CG   2  
ATOM 2762  N ND1  . HIS A 1 67  ? -1.445  10.347  0.107   1.00 0.00 ? 67  HIS A ND1  2  
ATOM 2763  C CD2  . HIS A 1 67  ? -2.491  8.668   1.070   1.00 0.00 ? 67  HIS A CD2  2  
ATOM 2764  C CE1  . HIS A 1 67  ? -2.534  10.823  0.691   1.00 0.00 ? 67  HIS A CE1  2  
ATOM 2765  N NE2  . HIS A 1 67  ? -3.181  9.781   1.288   1.00 0.00 ? 67  HIS A NE2  2  
ATOM 2766  H H    . HIS A 1 67  ? -0.315  6.910   -2.632  1.00 0.00 ? 67  HIS A H    2  
ATOM 2767  H HA   . HIS A 1 67  ? 0.084   9.639   -1.641  1.00 0.00 ? 67  HIS A HA   2  
ATOM 2768  H HB2  . HIS A 1 67  ? -0.641  7.092   -0.302  1.00 0.00 ? 67  HIS A HB2  2  
ATOM 2769  H HB3  . HIS A 1 67  ? 0.532   8.087   0.538   1.00 0.00 ? 67  HIS A HB3  2  
ATOM 2770  H HD1  . HIS A 1 67  ? -0.776  10.883  -0.408  1.00 0.00 ? 67  HIS A HD1  2  
ATOM 2771  H HD2  . HIS A 1 67  ? -2.759  7.672   1.423   1.00 0.00 ? 67  HIS A HD2  2  
ATOM 2772  H HE1  . HIS A 1 67  ? -2.857  11.864  0.695   1.00 0.00 ? 67  HIS A HE1  2  
ATOM 2773  N N    . TYR A 1 68  ? 2.547   9.185   -0.930  1.00 0.00 ? 68  TYR A N    2  
ATOM 2774  C CA   . TYR A 1 68  ? 3.997   9.093   -0.938  1.00 0.00 ? 68  TYR A CA   2  
ATOM 2775  C C    . TYR A 1 68  ? 4.556   9.117   0.486   1.00 0.00 ? 68  TYR A C    2  
ATOM 2776  O O    . TYR A 1 68  ? 4.076   9.870   1.332   1.00 0.00 ? 68  TYR A O    2  
ATOM 2777  C CB   . TYR A 1 68  ? 4.493   10.330  -1.689  1.00 0.00 ? 68  TYR A CB   2  
ATOM 2778  C CG   . TYR A 1 68  ? 4.165   10.324  -3.184  1.00 0.00 ? 68  TYR A CG   2  
ATOM 2779  C CD1  . TYR A 1 68  ? 4.868   9.502   -4.041  1.00 0.00 ? 68  TYR A CD1  2  
ATOM 2780  C CD2  . TYR A 1 68  ? 3.167   11.141  -3.674  1.00 0.00 ? 68  TYR A CD2  2  
ATOM 2781  C CE1  . TYR A 1 68  ? 4.559   9.497   -5.448  1.00 0.00 ? 68  TYR A CE1  2  
ATOM 2782  C CE2  . TYR A 1 68  ? 2.858   11.135  -5.081  1.00 0.00 ? 68  TYR A CE2  2  
ATOM 2783  C CZ   . TYR A 1 68  ? 3.569   10.313  -5.898  1.00 0.00 ? 68  TYR A CZ   2  
ATOM 2784  O OH   . TYR A 1 68  ? 3.278   10.308  -7.227  1.00 0.00 ? 68  TYR A OH   2  
ATOM 2785  H H    . TYR A 1 68  ? 2.172   9.909   -0.350  1.00 0.00 ? 68  TYR A H    2  
ATOM 2786  H HA   . TYR A 1 68  ? 4.271   8.151   -1.413  1.00 0.00 ? 68  TYR A HA   2  
ATOM 2787  H HB2  . TYR A 1 68  ? 4.055   11.219  -1.235  1.00 0.00 ? 68  TYR A HB2  2  
ATOM 2788  H HB3  . TYR A 1 68  ? 5.573   10.409  -1.565  1.00 0.00 ? 68  TYR A HB3  2  
ATOM 2789  H HD1  . TYR A 1 68  ? 5.656   8.857   -3.654  1.00 0.00 ? 68  TYR A HD1  2  
ATOM 2790  H HD2  . TYR A 1 68  ? 2.612   11.790  -2.997  1.00 0.00 ? 68  TYR A HD2  2  
ATOM 2791  H HE1  . TYR A 1 68  ? 5.106   8.852   -6.136  1.00 0.00 ? 68  TYR A HE1  2  
ATOM 2792  H HE2  . TYR A 1 68  ? 2.072   11.776  -5.481  1.00 0.00 ? 68  TYR A HE2  2  
ATOM 2793  H HH   . TYR A 1 68  ? 3.587   11.160  -7.648  1.00 0.00 ? 68  TYR A HH   2  
ATOM 2794  N N    . LEU A 1 69  ? 5.563   8.285   0.706   1.00 0.00 ? 69  LEU A N    2  
ATOM 2795  C CA   . LEU A 1 69  ? 6.193   8.202   2.012   1.00 0.00 ? 69  LEU A CA   2  
ATOM 2796  C C    . LEU A 1 69  ? 7.713   8.228   1.844   1.00 0.00 ? 69  LEU A C    2  
ATOM 2797  O O    . LEU A 1 69  ? 8.227   7.941   0.764   1.00 0.00 ? 69  LEU A O    2  
ATOM 2798  C CB   . LEU A 1 69  ? 5.680   6.979   2.777   1.00 0.00 ? 69  LEU A CB   2  
ATOM 2799  C CG   . LEU A 1 69  ? 4.172   6.730   2.710   1.00 0.00 ? 69  LEU A CG   2  
ATOM 2800  C CD1  . LEU A 1 69  ? 3.839   5.283   3.080   1.00 0.00 ? 69  LEU A CD1  2  
ATOM 2801  C CD2  . LEU A 1 69  ? 3.411   7.734   3.578   1.00 0.00 ? 69  LEU A CD2  2  
ATOM 2802  H H    . LEU A 1 69  ? 5.948   7.677   0.012   1.00 0.00 ? 69  LEU A H    2  
ATOM 2803  H HA   . LEU A 1 69  ? 5.892   9.084   2.577   1.00 0.00 ? 69  LEU A HA   2  
ATOM 2804  H HB2  . LEU A 1 69  ? 6.192   6.096   2.395   1.00 0.00 ? 69  LEU A HB2  2  
ATOM 2805  H HB3  . LEU A 1 69  ? 5.965   7.085   3.824   1.00 0.00 ? 69  LEU A HB3  2  
ATOM 2806  H HG   . LEU A 1 69  ? 3.846   6.882   1.681   1.00 0.00 ? 69  LEU A HG   2  
ATOM 2807  H HD11 . LEU A 1 69  ? 2.860   5.247   3.558   1.00 0.00 ? 69  LEU A HD11 2  
ATOM 2808  H HD12 . LEU A 1 69  ? 3.825   4.671   2.178   1.00 0.00 ? 69  LEU A HD12 2  
ATOM 2809  H HD13 . LEU A 1 69  ? 4.594   4.901   3.767   1.00 0.00 ? 69  LEU A HD13 2  
ATOM 2810  H HD21 . LEU A 1 69  ? 2.353   7.472   3.594   1.00 0.00 ? 69  LEU A HD21 2  
ATOM 2811  H HD22 . LEU A 1 69  ? 3.807   7.709   4.593   1.00 0.00 ? 69  LEU A HD22 2  
ATOM 2812  H HD23 . LEU A 1 69  ? 3.531   8.735   3.165   1.00 0.00 ? 69  LEU A HD23 2  
ATOM 2813  N N    . PRO A 1 70  ? 8.409   8.586   2.957   1.00 0.00 ? 70  PRO A N    2  
ATOM 2814  C CA   . PRO A 1 70  ? 9.860   8.654   2.942   1.00 0.00 ? 70  PRO A CA   2  
ATOM 2815  C C    . PRO A 1 70  ? 10.475  7.253   2.966   1.00 0.00 ? 70  PRO A C    2  
ATOM 2816  O O    . PRO A 1 70  ? 9.757   6.257   3.030   1.00 0.00 ? 70  PRO A O    2  
ATOM 2817  C CB   . PRO A 1 70  ? 10.227  9.484   4.162   1.00 0.00 ? 70  PRO A CB   2  
ATOM 2818  C CG   . PRO A 1 70  ? 9.006   9.458   5.067   1.00 0.00 ? 70  PRO A CG   2  
ATOM 2819  C CD   . PRO A 1 70  ? 7.834   8.933   4.253   1.00 0.00 ? 70  PRO A CD   2  
ATOM 2820  H HA   . PRO A 1 70  ? 10.179  9.079   2.095   1.00 0.00 ? 70  PRO A HA   2  
ATOM 2821  H HB2  . PRO A 1 70  ? 11.098  9.069   4.669   1.00 0.00 ? 70  PRO A HB2  2  
ATOM 2822  H HB3  . PRO A 1 70  ? 10.480  10.505  3.877   1.00 0.00 ? 70  PRO A HB3  2  
ATOM 2823  H HG2  . PRO A 1 70  ? 9.186   8.820   5.932   1.00 0.00 ? 70  PRO A HG2  2  
ATOM 2824  H HG3  . PRO A 1 70  ? 8.790   10.456  5.446   1.00 0.00 ? 70  PRO A HG3  2  
ATOM 2825  H HD2  . PRO A 1 70  ? 7.378   8.065   4.729   1.00 0.00 ? 70  PRO A HD2  2  
ATOM 2826  H HD3  . PRO A 1 70  ? 7.054   9.687   4.151   1.00 0.00 ? 70  PRO A HD3  2  
ATOM 2827  N N    . ASN A 1 71  ? 11.799  7.222   2.911   1.00 0.00 ? 71  ASN A N    2  
ATOM 2828  C CA   . ASN A 1 71  ? 12.518  5.960   2.925   1.00 0.00 ? 71  ASN A CA   2  
ATOM 2829  C C    . ASN A 1 71  ? 12.779  5.542   4.374   1.00 0.00 ? 71  ASN A C    2  
ATOM 2830  O O    . ASN A 1 71  ? 13.713  4.791   4.648   1.00 0.00 ? 71  ASN A O    2  
ATOM 2831  C CB   . ASN A 1 71  ? 13.870  6.088   2.220   1.00 0.00 ? 71  ASN A CB   2  
ATOM 2832  C CG   . ASN A 1 71  ? 14.729  7.172   2.874   1.00 0.00 ? 71  ASN A CG   2  
ATOM 2833  O OD1  . ASN A 1 71  ? 14.250  8.217   3.283   1.00 0.00 ? 71  ASN A OD1  2  
ATOM 2834  N ND2  . ASN A 1 71  ? 16.021  6.867   2.948   1.00 0.00 ? 71  ASN A ND2  2  
ATOM 2835  H H    . ASN A 1 71  ? 12.376  8.037   2.859   1.00 0.00 ? 71  ASN A H    2  
ATOM 2836  H HA   . ASN A 1 71  ? 11.874  5.256   2.398   1.00 0.00 ? 71  ASN A HA   2  
ATOM 2837  H HB2  . ASN A 1 71  ? 14.394  5.134   2.254   1.00 0.00 ? 71  ASN A HB2  2  
ATOM 2838  H HB3  . ASN A 1 71  ? 13.713  6.329   1.168   1.00 0.00 ? 71  ASN A HB3  2  
ATOM 2839  H HD21 . ASN A 1 71  ? 16.349  5.992   2.593   1.00 0.00 ? 71  ASN A HD21 2  
ATOM 2840  H HD22 . ASN A 1 71  ? 16.664  7.512   3.360   1.00 0.00 ? 71  ASN A HD22 2  
ATOM 2841  N N    . VAL A 1 72  ? 11.937  6.048   5.263   1.00 0.00 ? 72  VAL A N    2  
ATOM 2842  C CA   . VAL A 1 72  ? 12.065  5.737   6.676   1.00 0.00 ? 72  VAL A CA   2  
ATOM 2843  C C    . VAL A 1 72  ? 10.801  5.019   7.152   1.00 0.00 ? 72  VAL A C    2  
ATOM 2844  O O    . VAL A 1 72  ? 10.856  4.196   8.065   1.00 0.00 ? 72  VAL A O    2  
ATOM 2845  C CB   . VAL A 1 72  ? 12.362  7.013   7.468   1.00 0.00 ? 72  VAL A CB   2  
ATOM 2846  C CG1  . VAL A 1 72  ? 13.661  7.664   6.990   1.00 0.00 ? 72  VAL A CG1  2  
ATOM 2847  C CG2  . VAL A 1 72  ? 11.192  7.995   7.383   1.00 0.00 ? 72  VAL A CG2  2  
ATOM 2848  H H    . VAL A 1 72  ? 11.180  6.659   5.031   1.00 0.00 ? 72  VAL A H    2  
ATOM 2849  H HA   . VAL A 1 72  ? 12.915  5.064   6.789   1.00 0.00 ? 72  VAL A HA   2  
ATOM 2850  H HB   . VAL A 1 72  ? 12.491  6.735   8.514   1.00 0.00 ? 72  VAL A HB   2  
ATOM 2851  H HG11 . VAL A 1 72  ? 13.807  8.610   7.512   1.00 0.00 ? 72  VAL A HG11 2  
ATOM 2852  H HG12 . VAL A 1 72  ? 14.500  7.000   7.201   1.00 0.00 ? 72  VAL A HG12 2  
ATOM 2853  H HG13 . VAL A 1 72  ? 13.603  7.846   5.917   1.00 0.00 ? 72  VAL A HG13 2  
ATOM 2854  H HG21 . VAL A 1 72  ? 10.882  8.278   8.389   1.00 0.00 ? 72  VAL A HG21 2  
ATOM 2855  H HG22 . VAL A 1 72  ? 11.504  8.885   6.836   1.00 0.00 ? 72  VAL A HG22 2  
ATOM 2856  H HG23 . VAL A 1 72  ? 10.358  7.523   6.865   1.00 0.00 ? 72  VAL A HG23 2  
ATOM 2857  N N    . THR A 1 73  ? 9.690   5.357   6.513   1.00 0.00 ? 73  THR A N    2  
ATOM 2858  C CA   . THR A 1 73  ? 8.414   4.755   6.860   1.00 0.00 ? 73  THR A CA   2  
ATOM 2859  C C    . THR A 1 73  ? 8.117   3.569   5.940   1.00 0.00 ? 73  THR A C    2  
ATOM 2860  O O    . THR A 1 73  ? 8.466   3.590   4.761   1.00 0.00 ? 73  THR A O    2  
ATOM 2861  C CB   . THR A 1 73  ? 7.345   5.848   6.807   1.00 0.00 ? 73  THR A CB   2  
ATOM 2862  O OG1  . THR A 1 73  ? 7.530   6.573   8.020   1.00 0.00 ? 73  THR A OG1  2  
ATOM 2863  C CG2  . THR A 1 73  ? 5.927   5.286   6.921   1.00 0.00 ? 73  THR A CG2  2  
ATOM 2864  H H    . THR A 1 73  ? 9.654   6.027   5.772   1.00 0.00 ? 73  THR A H    2  
ATOM 2865  H HA   . THR A 1 73  ? 8.484   4.362   7.875   1.00 0.00 ? 73  THR A HA   2  
ATOM 2866  H HB   . THR A 1 73  ? 7.453   6.454   5.908   1.00 0.00 ? 73  THR A HB   2  
ATOM 2867  H HG1  . THR A 1 73  ? 7.242   6.016   8.799   1.00 0.00 ? 73  THR A HG1  2  
ATOM 2868  H HG21 . THR A 1 73  ? 5.746   4.587   6.105   1.00 0.00 ? 73  THR A HG21 2  
ATOM 2869  H HG22 . THR A 1 73  ? 5.817   4.769   7.874   1.00 0.00 ? 73  THR A HG22 2  
ATOM 2870  H HG23 . THR A 1 73  ? 5.207   6.103   6.866   1.00 0.00 ? 73  THR A HG23 2  
ATOM 2871  N N    . LEU A 1 74  ? 7.474   2.563   6.514   1.00 0.00 ? 74  LEU A N    2  
ATOM 2872  C CA   . LEU A 1 74  ? 7.125   1.370   5.760   1.00 0.00 ? 74  LEU A CA   2  
ATOM 2873  C C    . LEU A 1 74  ? 5.697   0.949   6.112   1.00 0.00 ? 74  LEU A C    2  
ATOM 2874  O O    . LEU A 1 74  ? 5.268   -0.151  5.769   1.00 0.00 ? 74  LEU A O    2  
ATOM 2875  C CB   . LEU A 1 74  ? 8.164   0.270   5.987   1.00 0.00 ? 74  LEU A CB   2  
ATOM 2876  C CG   . LEU A 1 74  ? 9.608   0.739   6.172   1.00 0.00 ? 74  LEU A CG   2  
ATOM 2877  C CD1  . LEU A 1 74  ? 10.313  -0.072  7.261   1.00 0.00 ? 74  LEU A CD1  2  
ATOM 2878  C CD2  . LEU A 1 74  ? 10.371  0.704   4.846   1.00 0.00 ? 74  LEU A CD2  2  
ATOM 2879  H H    . LEU A 1 74  ? 7.193   2.553   7.474   1.00 0.00 ? 74  LEU A H    2  
ATOM 2880  H HA   . LEU A 1 74  ? 7.158   1.631   4.703   1.00 0.00 ? 74  LEU A HA   2  
ATOM 2881  H HB2  . LEU A 1 74  ? 7.873   -0.301  6.869   1.00 0.00 ? 74  LEU A HB2  2  
ATOM 2882  H HB3  . LEU A 1 74  ? 8.131   -0.414  5.139   1.00 0.00 ? 74  LEU A HB3  2  
ATOM 2883  H HG   . LEU A 1 74  ? 9.591   1.777   6.505   1.00 0.00 ? 74  LEU A HG   2  
ATOM 2884  H HD11 . LEU A 1 74  ? 10.546  -1.067  6.880   1.00 0.00 ? 74  LEU A HD11 2  
ATOM 2885  H HD12 . LEU A 1 74  ? 11.236  0.431   7.549   1.00 0.00 ? 74  LEU A HD12 2  
ATOM 2886  H HD13 . LEU A 1 74  ? 9.661   -0.160  8.129   1.00 0.00 ? 74  LEU A HD13 2  
ATOM 2887  H HD21 . LEU A 1 74  ? 10.820  1.679   4.659   1.00 0.00 ? 74  LEU A HD21 2  
ATOM 2888  H HD22 . LEU A 1 74  ? 11.153  -0.053  4.898   1.00 0.00 ? 74  LEU A HD22 2  
ATOM 2889  H HD23 . LEU A 1 74  ? 9.682   0.459   4.038   1.00 0.00 ? 74  LEU A HD23 2  
ATOM 2890  N N    . GLU A 1 75  ? 5.000   1.848   6.792   1.00 0.00 ? 75  GLU A N    2  
ATOM 2891  C CA   . GLU A 1 75  ? 3.629   1.583   7.194   1.00 0.00 ? 75  GLU A CA   2  
ATOM 2892  C C    . GLU A 1 75  ? 2.802   2.870   7.141   1.00 0.00 ? 75  GLU A C    2  
ATOM 2893  O O    . GLU A 1 75  ? 3.323   3.957   7.390   1.00 0.00 ? 75  GLU A O    2  
ATOM 2894  C CB   . GLU A 1 75  ? 3.577   0.956   8.589   1.00 0.00 ? 75  GLU A CB   2  
ATOM 2895  C CG   . GLU A 1 75  ? 4.038   1.952   9.655   1.00 0.00 ? 75  GLU A CG   2  
ATOM 2896  C CD   . GLU A 1 75  ? 5.434   1.596   10.171  1.00 0.00 ? 75  GLU A CD   2  
ATOM 2897  O OE1  . GLU A 1 75  ? 5.543   0.538   10.828  1.00 0.00 ? 75  GLU A OE1  2  
ATOM 2898  O OE2  . GLU A 1 75  ? 6.359   2.391   9.897   1.00 0.00 ? 75  GLU A OE2  2  
ATOM 2899  H H    . GLU A 1 75  ? 5.356   2.741   7.067   1.00 0.00 ? 75  GLU A H    2  
ATOM 2900  H HA   . GLU A 1 75  ? 3.246   0.868   6.466   1.00 0.00 ? 75  GLU A HA   2  
ATOM 2901  H HB2  . GLU A 1 75  ? 2.561   0.628   8.807   1.00 0.00 ? 75  GLU A HB2  2  
ATOM 2902  H HB3  . GLU A 1 75  ? 4.211   0.069   8.616   1.00 0.00 ? 75  GLU A HB3  2  
ATOM 2903  H HG2  . GLU A 1 75  ? 4.045   2.959   9.238   1.00 0.00 ? 75  GLU A HG2  2  
ATOM 2904  H HG3  . GLU A 1 75  ? 3.330   1.955   10.484  1.00 0.00 ? 75  GLU A HG3  2  
ATOM 2905  N N    . TYR A 1 76  ? 1.529   2.705   6.815   1.00 0.00 ? 76  TYR A N    2  
ATOM 2906  C CA   . TYR A 1 76  ? 0.626   3.839   6.727   1.00 0.00 ? 76  TYR A CA   2  
ATOM 2907  C C    . TYR A 1 76  ? -0.823  3.406   6.959   1.00 0.00 ? 76  TYR A C    2  
ATOM 2908  O O    . TYR A 1 76  ? -1.206  2.292   6.605   1.00 0.00 ? 76  TYR A O    2  
ATOM 2909  C CB   . TYR A 1 76  ? 0.763   4.377   5.301   1.00 0.00 ? 76  TYR A CB   2  
ATOM 2910  C CG   . TYR A 1 76  ? -0.141  5.573   4.997   1.00 0.00 ? 76  TYR A CG   2  
ATOM 2911  C CD1  . TYR A 1 76  ? -1.453  5.368   4.619   1.00 0.00 ? 76  TYR A CD1  2  
ATOM 2912  C CD2  . TYR A 1 76  ? 0.354   6.857   5.102   1.00 0.00 ? 76  TYR A CD2  2  
ATOM 2913  C CE1  . TYR A 1 76  ? -2.304  6.494   4.333   1.00 0.00 ? 76  TYR A CE1  2  
ATOM 2914  C CE2  . TYR A 1 76  ? -0.497  7.983   4.816   1.00 0.00 ? 76  TYR A CE2  2  
ATOM 2915  C CZ   . TYR A 1 76  ? -1.784  7.746   4.445   1.00 0.00 ? 76  TYR A CZ   2  
ATOM 2916  O OH   . TYR A 1 76  ? -2.587  8.809   4.175   1.00 0.00 ? 76  TYR A OH   2  
ATOM 2917  H H    . TYR A 1 76  ? 1.114   1.817   6.615   1.00 0.00 ? 76  TYR A H    2  
ATOM 2918  H HA   . TYR A 1 76  ? 0.910   4.557   7.496   1.00 0.00 ? 76  TYR A HA   2  
ATOM 2919  H HB2  . TYR A 1 76  ? 1.800   4.666   5.130   1.00 0.00 ? 76  TYR A HB2  2  
ATOM 2920  H HB3  . TYR A 1 76  ? 0.536   3.575   4.598   1.00 0.00 ? 76  TYR A HB3  2  
ATOM 2921  H HD1  . TYR A 1 76  ? -1.844  4.355   4.536   1.00 0.00 ? 76  TYR A HD1  2  
ATOM 2922  H HD2  . TYR A 1 76  ? 1.390   7.018   5.401   1.00 0.00 ? 76  TYR A HD2  2  
ATOM 2923  H HE1  . TYR A 1 76  ? -3.341  6.347   4.033   1.00 0.00 ? 76  TYR A HE1  2  
ATOM 2924  H HE2  . TYR A 1 76  ? -0.118  9.002   4.894   1.00 0.00 ? 76  TYR A HE2  2  
ATOM 2925  H HH   . TYR A 1 76  ? -2.054  9.542   3.752   1.00 0.00 ? 76  TYR A HH   2  
ATOM 2926  N N    . ARG A 1 77  ? -1.590  4.310   7.552   1.00 0.00 ? 77  ARG A N    2  
ATOM 2927  C CA   . ARG A 1 77  ? -2.988  4.035   7.835   1.00 0.00 ? 77  ARG A CA   2  
ATOM 2928  C C    . ARG A 1 77  ? -3.863  4.460   6.654   1.00 0.00 ? 77  ARG A C    2  
ATOM 2929  O O    . ARG A 1 77  ? -3.780  5.598   6.193   1.00 0.00 ? 77  ARG A O    2  
ATOM 2930  C CB   . ARG A 1 77  ? -3.450  4.772   9.094   1.00 0.00 ? 77  ARG A CB   2  
ATOM 2931  C CG   . ARG A 1 77  ? -4.971  4.702   9.243   1.00 0.00 ? 77  ARG A CG   2  
ATOM 2932  C CD   . ARG A 1 77  ? -5.387  4.872   10.705  1.00 0.00 ? 77  ARG A CD   2  
ATOM 2933  N NE   . ARG A 1 77  ? -5.953  6.223   10.917  1.00 0.00 ? 77  ARG A NE   2  
ATOM 2934  C CZ   . ARG A 1 77  ? -6.283  6.720   12.117  1.00 0.00 ? 77  ARG A CZ   2  
ATOM 2935  N NH1  . ARG A 1 77  ? -6.106  5.980   13.220  1.00 0.00 ? 77  ARG A NH1  2  
ATOM 2936  N NH2  . ARG A 1 77  ? -6.790  7.956   12.214  1.00 0.00 ? 77  ARG A NH2  2  
ATOM 2937  H H    . ARG A 1 77  ? -1.270  5.214   7.836   1.00 0.00 ? 77  ARG A H    2  
ATOM 2938  H HA   . ARG A 1 77  ? -3.035  2.957   7.990   1.00 0.00 ? 77  ARG A HA   2  
ATOM 2939  H HB2  . ARG A 1 77  ? -2.974  4.334   9.971   1.00 0.00 ? 77  ARG A HB2  2  
ATOM 2940  H HB3  . ARG A 1 77  ? -3.133  5.814   9.046   1.00 0.00 ? 77  ARG A HB3  2  
ATOM 2941  H HG2  . ARG A 1 77  ? -5.436  5.480   8.636   1.00 0.00 ? 77  ARG A HG2  2  
ATOM 2942  H HG3  . ARG A 1 77  ? -5.333  3.746   8.867   1.00 0.00 ? 77  ARG A HG3  2  
ATOM 2943  H HD2  . ARG A 1 77  ? -6.123  4.115   10.973  1.00 0.00 ? 77  ARG A HD2  2  
ATOM 2944  H HD3  . ARG A 1 77  ? -4.526  4.724   11.357  1.00 0.00 ? 77  ARG A HD3  2  
ATOM 2945  H HE   . ARG A 1 77  ? -6.098  6.802   10.114  1.00 0.00 ? 77  ARG A HE   2  
ATOM 2946  H HH11 . ARG A 1 77  ? -5.727  5.057   13.148  1.00 0.00 ? 77  ARG A HH11 2  
ATOM 2947  H HH12 . ARG A 1 77  ? -6.353  6.351   14.116  1.00 0.00 ? 77  ARG A HH12 2  
ATOM 2948  H HH21 . ARG A 1 77  ? -6.922  8.509   11.391  1.00 0.00 ? 77  ARG A HH21 2  
ATOM 2949  H HH22 . ARG A 1 77  ? -7.037  8.327   13.109  1.00 0.00 ? 77  ARG A HH22 2  
ATOM 2950  N N    . VAL A 1 78  ? -4.680  3.523   6.196   1.00 0.00 ? 78  VAL A N    2  
ATOM 2951  C CA   . VAL A 1 78  ? -5.569  3.786   5.077   1.00 0.00 ? 78  VAL A CA   2  
ATOM 2952  C C    . VAL A 1 78  ? -6.956  4.153   5.609   1.00 0.00 ? 78  VAL A C    2  
ATOM 2953  O O    . VAL A 1 78  ? -7.385  3.640   6.641   1.00 0.00 ? 78  VAL A O    2  
ATOM 2954  C CB   . VAL A 1 78  ? -5.589  2.584   4.132   1.00 0.00 ? 78  VAL A CB   2  
ATOM 2955  C CG1  . VAL A 1 78  ? -6.576  2.806   2.984   1.00 0.00 ? 78  VAL A CG1  2  
ATOM 2956  C CG2  . VAL A 1 78  ? -4.188  2.281   3.599   1.00 0.00 ? 78  VAL A CG2  2  
ATOM 2957  H H    . VAL A 1 78  ? -4.741  2.600   6.576   1.00 0.00 ? 78  VAL A H    2  
ATOM 2958  H HA   . VAL A 1 78  ? -5.166  4.639   4.531   1.00 0.00 ? 78  VAL A HA   2  
ATOM 2959  H HB   . VAL A 1 78  ? -5.926  1.716   4.700   1.00 0.00 ? 78  VAL A HB   2  
ATOM 2960  H HG11 . VAL A 1 78  ? -6.351  2.114   2.172   1.00 0.00 ? 78  VAL A HG11 2  
ATOM 2961  H HG12 . VAL A 1 78  ? -7.592  2.632   3.339   1.00 0.00 ? 78  VAL A HG12 2  
ATOM 2962  H HG13 . VAL A 1 78  ? -6.488  3.831   2.622   1.00 0.00 ? 78  VAL A HG13 2  
ATOM 2963  H HG21 . VAL A 1 78  ? -3.511  2.105   4.435   1.00 0.00 ? 78  VAL A HG21 2  
ATOM 2964  H HG22 . VAL A 1 78  ? -4.223  1.393   2.967   1.00 0.00 ? 78  VAL A HG22 2  
ATOM 2965  H HG23 . VAL A 1 78  ? -3.830  3.129   3.014   1.00 0.00 ? 78  VAL A HG23 2  
ATOM 2966  N N    . THR A 1 79  ? -7.619  5.038   4.879   1.00 0.00 ? 79  THR A N    2  
ATOM 2967  C CA   . THR A 1 79  ? -8.949  5.479   5.264   1.00 0.00 ? 79  THR A CA   2  
ATOM 2968  C C    . THR A 1 79  ? -9.799  5.755   4.022   1.00 0.00 ? 79  THR A C    2  
ATOM 2969  O O    . THR A 1 79  ? -9.270  6.107   2.969   1.00 0.00 ? 79  THR A O    2  
ATOM 2970  C CB   . THR A 1 79  ? -8.797  6.695   6.179   1.00 0.00 ? 79  THR A CB   2  
ATOM 2971  O OG1  . THR A 1 79  ? -8.094  7.644   5.382   1.00 0.00 ? 79  THR A OG1  2  
ATOM 2972  C CG2  . THR A 1 79  ? -7.857  6.428   7.357   1.00 0.00 ? 79  THR A CG2  2  
ATOM 2973  H H    . THR A 1 79  ? -7.263  5.450   4.040   1.00 0.00 ? 79  THR A H    2  
ATOM 2974  H HA   . THR A 1 79  ? -9.434  4.670   5.810   1.00 0.00 ? 79  THR A HA   2  
ATOM 2975  H HB   . THR A 1 79  ? -9.769  7.044   6.529   1.00 0.00 ? 79  THR A HB   2  
ATOM 2976  H HG1  . THR A 1 79  ? -8.570  7.781   4.514   1.00 0.00 ? 79  THR A HG1  2  
ATOM 2977  H HG21 . THR A 1 79  ? -8.243  5.598   7.949   1.00 0.00 ? 79  THR A HG21 2  
ATOM 2978  H HG22 . THR A 1 79  ? -6.865  6.176   6.980   1.00 0.00 ? 79  THR A HG22 2  
ATOM 2979  H HG23 . THR A 1 79  ? -7.793  7.320   7.980   1.00 0.00 ? 79  THR A HG23 2  
ATOM 2980  N N    . GLY A 1 80  ? -11.103 5.586   4.187   1.00 0.00 ? 80  GLY A N    2  
ATOM 2981  C CA   . GLY A 1 80  ? -12.032 5.813   3.093   1.00 0.00 ? 80  GLY A CA   2  
ATOM 2982  C C    . GLY A 1 80  ? -12.366 4.502   2.378   1.00 0.00 ? 80  GLY A C    2  
ATOM 2983  O O    . GLY A 1 80  ? -12.684 4.504   1.189   1.00 0.00 ? 80  GLY A O    2  
ATOM 2984  H H    . GLY A 1 80  ? -11.525 5.299   5.048   1.00 0.00 ? 80  GLY A H    2  
ATOM 2985  H HA2  . GLY A 1 80  ? -12.946 6.266   3.476   1.00 0.00 ? 80  GLY A HA2  2  
ATOM 2986  H HA3  . GLY A 1 80  ? -11.598 6.518   2.384   1.00 0.00 ? 80  GLY A HA3  2  
ATOM 2987  N N    . LEU A 1 81  ? -12.284 3.416   3.131   1.00 0.00 ? 81  LEU A N    2  
ATOM 2988  C CA   . LEU A 1 81  ? -12.574 2.102   2.584   1.00 0.00 ? 81  LEU A CA   2  
ATOM 2989  C C    . LEU A 1 81  ? -14.046 1.765   2.829   1.00 0.00 ? 81  LEU A C    2  
ATOM 2990  O O    . LEU A 1 81  ? -14.896 2.655   2.843   1.00 0.00 ? 81  LEU A O    2  
ATOM 2991  C CB   . LEU A 1 81  ? -11.604 1.061   3.146   1.00 0.00 ? 81  LEU A CB   2  
ATOM 2992  C CG   . LEU A 1 81  ? -10.136 1.486   3.226   1.00 0.00 ? 81  LEU A CG   2  
ATOM 2993  C CD1  . LEU A 1 81  ? -9.379  0.653   4.262   1.00 0.00 ? 81  LEU A CD1  2  
ATOM 2994  C CD2  . LEU A 1 81  ? -9.473  1.428   1.848   1.00 0.00 ? 81  LEU A CD2  2  
ATOM 2995  H H    . LEU A 1 81  ? -12.025 3.423   4.097   1.00 0.00 ? 81  LEU A H    2  
ATOM 2996  H HA   . LEU A 1 81  ? -12.406 2.151   1.508   1.00 0.00 ? 81  LEU A HA   2  
ATOM 2997  H HB2  . LEU A 1 81  ? -11.936 0.786   4.147   1.00 0.00 ? 81  LEU A HB2  2  
ATOM 2998  H HB3  . LEU A 1 81  ? -11.668 0.163   2.531   1.00 0.00 ? 81  LEU A HB3  2  
ATOM 2999  H HG   . LEU A 1 81  ? -10.099 2.524   3.557   1.00 0.00 ? 81  LEU A HG   2  
ATOM 3000  H HD11 . LEU A 1 81  ? -8.542  0.147   3.780   1.00 0.00 ? 81  LEU A HD11 2  
ATOM 3001  H HD12 . LEU A 1 81  ? -9.005  1.306   5.050   1.00 0.00 ? 81  LEU A HD12 2  
ATOM 3002  H HD13 . LEU A 1 81  ? -10.052 -0.089  4.693   1.00 0.00 ? 81  LEU A HD13 2  
ATOM 3003  H HD21 . LEU A 1 81  ? -8.872  0.522   1.772   1.00 0.00 ? 81  LEU A HD21 2  
ATOM 3004  H HD22 . LEU A 1 81  ? -10.241 1.421   1.075   1.00 0.00 ? 81  LEU A HD22 2  
ATOM 3005  H HD23 . LEU A 1 81  ? -8.833  2.301   1.716   1.00 0.00 ? 81  LEU A HD23 2  
ATOM 3006  N N    . THR A 1 82  ? -14.303 0.479   3.017   1.00 0.00 ? 82  THR A N    2  
ATOM 3007  C CA   . THR A 1 82  ? -15.658 0.014   3.261   1.00 0.00 ? 82  THR A CA   2  
ATOM 3008  C C    . THR A 1 82  ? -15.641 -1.248  4.124   1.00 0.00 ? 82  THR A C    2  
ATOM 3009  O O    . THR A 1 82  ? -14.706 -2.044  4.049   1.00 0.00 ? 82  THR A O    2  
ATOM 3010  C CB   . THR A 1 82  ? -16.341 -0.185  1.906   1.00 0.00 ? 82  THR A CB   2  
ATOM 3011  O OG1  . THR A 1 82  ? -16.298 1.105   1.303   1.00 0.00 ? 82  THR A OG1  2  
ATOM 3012  C CG2  . THR A 1 82  ? -17.835 -0.483  2.042   1.00 0.00 ? 82  THR A CG2  2  
ATOM 3013  H H    . THR A 1 82  ? -13.606 -0.238  3.004   1.00 0.00 ? 82  THR A H    2  
ATOM 3014  H HA   . THR A 1 82  ? -16.188 0.781   3.826   1.00 0.00 ? 82  THR A HA   2  
ATOM 3015  H HB   . THR A 1 82  ? -15.840 -0.961  1.328   1.00 0.00 ? 82  THR A HB   2  
ATOM 3016  H HG1  . THR A 1 82  ? -16.839 1.108   0.462   1.00 0.00 ? 82  THR A HG1  2  
ATOM 3017  H HG21 . THR A 1 82  ? -18.335 0.368   2.505   1.00 0.00 ? 82  THR A HG21 2  
ATOM 3018  H HG22 . THR A 1 82  ? -18.262 -0.661  1.055   1.00 0.00 ? 82  THR A HG22 2  
ATOM 3019  H HG23 . THR A 1 82  ? -17.975 -1.368  2.663   1.00 0.00 ? 82  THR A HG23 2  
ATOM 3020  N N    . ALA A 1 83  ? -16.687 -1.393  4.925   1.00 0.00 ? 83  ALA A N    2  
ATOM 3021  C CA   . ALA A 1 83  ? -16.804 -2.546  5.802   1.00 0.00 ? 83  ALA A CA   2  
ATOM 3022  C C    . ALA A 1 83  ? -16.830 -3.822  4.958   1.00 0.00 ? 83  ALA A C    2  
ATOM 3023  O O    . ALA A 1 83  ? -17.490 -3.873  3.922   1.00 0.00 ? 83  ALA A O    2  
ATOM 3024  C CB   . ALA A 1 83  ? -18.052 -2.399  6.674   1.00 0.00 ? 83  ALA A CB   2  
ATOM 3025  H H    . ALA A 1 83  ? -17.444 -0.742  4.980   1.00 0.00 ? 83  ALA A H    2  
ATOM 3026  H HA   . ALA A 1 83  ? -15.925 -2.564  6.446   1.00 0.00 ? 83  ALA A HA   2  
ATOM 3027  H HB1  . ALA A 1 83  ? -17.878 -2.874  7.640   1.00 0.00 ? 83  ALA A HB1  2  
ATOM 3028  H HB2  . ALA A 1 83  ? -18.269 -1.341  6.823   1.00 0.00 ? 83  ALA A HB2  2  
ATOM 3029  H HB3  . ALA A 1 83  ? -18.899 -2.877  6.182   1.00 0.00 ? 83  ALA A HB3  2  
ATOM 3030  N N    . LEU A 1 84  ? -16.103 -4.823  5.434   1.00 0.00 ? 84  LEU A N    2  
ATOM 3031  C CA   . LEU A 1 84  ? -16.034 -6.096  4.737   1.00 0.00 ? 84  LEU A CA   2  
ATOM 3032  C C    . LEU A 1 84  ? -16.005 -5.845  3.228   1.00 0.00 ? 84  LEU A C    2  
ATOM 3033  O O    . LEU A 1 84  ? -16.892 -6.293  2.504   1.00 0.00 ? 84  LEU A O    2  
ATOM 3034  C CB   . LEU A 1 84  ? -17.171 -7.015  5.186   1.00 0.00 ? 84  LEU A CB   2  
ATOM 3035  C CG   . LEU A 1 84  ? -17.266 -7.280  6.690   1.00 0.00 ? 84  LEU A CG   2  
ATOM 3036  C CD1  . LEU A 1 84  ? -18.485 -8.144  7.019   1.00 0.00 ? 84  LEU A CD1  2  
ATOM 3037  C CD2  . LEU A 1 84  ? -15.969 -7.893  7.222   1.00 0.00 ? 84  LEU A CD2  2  
ATOM 3038  H H    . LEU A 1 84  ? -15.569 -4.773  6.279   1.00 0.00 ? 84  LEU A H    2  
ATOM 3039  H HA   . LEU A 1 84  ? -15.099 -6.576  5.026   1.00 0.00 ? 84  LEU A HA   2  
ATOM 3040  H HB2  . LEU A 1 84  ? -18.115 -6.581  4.854   1.00 0.00 ? 84  LEU A HB2  2  
ATOM 3041  H HB3  . LEU A 1 84  ? -17.062 -7.971  4.675   1.00 0.00 ? 84  LEU A HB3  2  
ATOM 3042  H HG   . LEU A 1 84  ? -17.402 -6.325  7.197   1.00 0.00 ? 84  LEU A HG   2  
ATOM 3043  H HD11 . LEU A 1 84  ? -18.967 -7.764  7.920   1.00 0.00 ? 84  LEU A HD11 2  
ATOM 3044  H HD12 . LEU A 1 84  ? -19.190 -8.110  6.188   1.00 0.00 ? 84  LEU A HD12 2  
ATOM 3045  H HD13 . LEU A 1 84  ? -18.167 -9.173  7.184   1.00 0.00 ? 84  LEU A HD13 2  
ATOM 3046  H HD21 . LEU A 1 84  ? -15.120 -7.300  6.879   1.00 0.00 ? 84  LEU A HD21 2  
ATOM 3047  H HD22 . LEU A 1 84  ? -15.991 -7.901  8.311   1.00 0.00 ? 84  LEU A HD22 2  
ATOM 3048  H HD23 . LEU A 1 84  ? -15.872 -8.914  6.853   1.00 0.00 ? 84  LEU A HD23 2  
ATOM 3049  N N    . THR A 1 85  ? -14.975 -5.129  2.799   1.00 0.00 ? 85  THR A N    2  
ATOM 3050  C CA   . THR A 1 85  ? -14.819 -4.813  1.390   1.00 0.00 ? 85  THR A CA   2  
ATOM 3051  C C    . THR A 1 85  ? -13.413 -5.183  0.913   1.00 0.00 ? 85  THR A C    2  
ATOM 3052  O O    . THR A 1 85  ? -12.425 -4.635  1.398   1.00 0.00 ? 85  THR A O    2  
ATOM 3053  C CB   . THR A 1 85  ? -15.156 -3.334  1.197   1.00 0.00 ? 85  THR A CB   2  
ATOM 3054  O OG1  . THR A 1 85  ? -16.580 -3.296  1.221   1.00 0.00 ? 85  THR A OG1  2  
ATOM 3055  C CG2  . THR A 1 85  ? -14.794 -2.828  -0.202  1.00 0.00 ? 85  THR A CG2  2  
ATOM 3056  H H    . THR A 1 85  ? -14.258 -4.768  3.395   1.00 0.00 ? 85  THR A H    2  
ATOM 3057  H HA   . THR A 1 85  ? -15.521 -5.424  0.821   1.00 0.00 ? 85  THR A HA   2  
ATOM 3058  H HB   . THR A 1 85  ? -14.683 -2.723  1.966   1.00 0.00 ? 85  THR A HB   2  
ATOM 3059  H HG1  . THR A 1 85  ? -16.951 -3.900  0.516   1.00 0.00 ? 85  THR A HG1  2  
ATOM 3060  H HG21 . THR A 1 85  ? -13.838 -3.254  -0.506  1.00 0.00 ? 85  THR A HG21 2  
ATOM 3061  H HG22 . THR A 1 85  ? -15.567 -3.130  -0.908  1.00 0.00 ? 85  THR A HG22 2  
ATOM 3062  H HG23 . THR A 1 85  ? -14.720 -1.741  -0.187  1.00 0.00 ? 85  THR A HG23 2  
ATOM 3063  N N    . THR A 1 86  ? -13.368 -6.111  -0.032  1.00 0.00 ? 86  THR A N    2  
ATOM 3064  C CA   . THR A 1 86  ? -12.100 -6.561  -0.579  1.00 0.00 ? 86  THR A CA   2  
ATOM 3065  C C    . THR A 1 86  ? -11.339 -5.386  -1.196  1.00 0.00 ? 86  THR A C    2  
ATOM 3066  O O    . THR A 1 86  ? -11.807 -4.773  -2.154  1.00 0.00 ? 86  THR A O    2  
ATOM 3067  C CB   . THR A 1 86  ? -12.387 -7.688  -1.573  1.00 0.00 ? 86  THR A CB   2  
ATOM 3068  O OG1  . THR A 1 86  ? -13.059 -8.675  -0.795  1.00 0.00 ? 86  THR A OG1  2  
ATOM 3069  C CG2  . THR A 1 86  ? -11.113 -8.390  -2.047  1.00 0.00 ? 86  THR A CG2  2  
ATOM 3070  H H    . THR A 1 86  ? -14.177 -6.553  -0.421  1.00 0.00 ? 86  THR A H    2  
ATOM 3071  H HA   . THR A 1 86  ? -11.489 -6.944  0.238   1.00 0.00 ? 86  THR A HA   2  
ATOM 3072  H HB   . THR A 1 86  ? -12.968 -7.322  -2.420  1.00 0.00 ? 86  THR A HB   2  
ATOM 3073  H HG1  . THR A 1 86  ? -13.229 -9.490  -1.349  1.00 0.00 ? 86  THR A HG1  2  
ATOM 3074  H HG21 . THR A 1 86  ? -10.481 -7.678  -2.577  1.00 0.00 ? 86  THR A HG21 2  
ATOM 3075  H HG22 . THR A 1 86  ? -10.574 -8.784  -1.186  1.00 0.00 ? 86  THR A HG22 2  
ATOM 3076  H HG23 . THR A 1 86  ? -11.377 -9.210  -2.716  1.00 0.00 ? 86  THR A HG23 2  
ATOM 3077  N N    . TYR A 1 87  ? -10.178 -5.108  -0.622  1.00 0.00 ? 87  TYR A N    2  
ATOM 3078  C CA   . TYR A 1 87  ? -9.347  -4.017  -1.103  1.00 0.00 ? 87  TYR A CA   2  
ATOM 3079  C C    . TYR A 1 87  ? -7.936  -4.507  -1.433  1.00 0.00 ? 87  TYR A C    2  
ATOM 3080  O O    . TYR A 1 87  ? -7.509  -5.554  -0.947  1.00 0.00 ? 87  TYR A O    2  
ATOM 3081  C CB   . TYR A 1 87  ? -9.269  -3.008  0.044   1.00 0.00 ? 87  TYR A CB   2  
ATOM 3082  C CG   . TYR A 1 87  ? -10.238 -1.832  -0.094  1.00 0.00 ? 87  TYR A CG   2  
ATOM 3083  C CD1  . TYR A 1 87  ? -9.931  -0.781  -0.934  1.00 0.00 ? 87  TYR A CD1  2  
ATOM 3084  C CD2  . TYR A 1 87  ? -11.418 -1.822  0.621   1.00 0.00 ? 87  TYR A CD2  2  
ATOM 3085  C CE1  . TYR A 1 87  ? -10.843 0.326   -1.065  1.00 0.00 ? 87  TYR A CE1  2  
ATOM 3086  C CE2  . TYR A 1 87  ? -12.330 -0.715  0.491   1.00 0.00 ? 87  TYR A CE2  2  
ATOM 3087  C CZ   . TYR A 1 87  ? -11.997 0.304   -0.346  1.00 0.00 ? 87  TYR A CZ   2  
ATOM 3088  O OH   . TYR A 1 87  ? -12.858 1.350   -0.469  1.00 0.00 ? 87  TYR A OH   2  
ATOM 3089  H H    . TYR A 1 87  ? -9.804  -5.612  0.157   1.00 0.00 ? 87  TYR A H    2  
ATOM 3090  H HA   . TYR A 1 87  ? -9.806  -3.619  -2.008  1.00 0.00 ? 87  TYR A HA   2  
ATOM 3091  H HB2  . TYR A 1 87  ? -9.472  -3.524  0.983   1.00 0.00 ? 87  TYR A HB2  2  
ATOM 3092  H HB3  . TYR A 1 87  ? -8.252  -2.622  0.107   1.00 0.00 ? 87  TYR A HB3  2  
ATOM 3093  H HD1  . TYR A 1 87  ? -8.999  -0.789  -1.500  1.00 0.00 ? 87  TYR A HD1  2  
ATOM 3094  H HD2  . TYR A 1 87  ? -11.660 -2.653  1.285   1.00 0.00 ? 87  TYR A HD2  2  
ATOM 3095  H HE1  . TYR A 1 87  ? -10.614 1.162   -1.725  1.00 0.00 ? 87  TYR A HE1  2  
ATOM 3096  H HE2  . TYR A 1 87  ? -13.265 -0.695  1.050   1.00 0.00 ? 87  TYR A HE2  2  
ATOM 3097  H HH   . TYR A 1 87  ? -13.216 1.390   -1.402  1.00 0.00 ? 87  TYR A HH   2  
ATOM 3098  N N    . THR A 1 88  ? -7.250  -3.727  -2.256  1.00 0.00 ? 88  THR A N    2  
ATOM 3099  C CA   . THR A 1 88  ? -5.896  -4.069  -2.656  1.00 0.00 ? 88  THR A CA   2  
ATOM 3100  C C    . THR A 1 88  ? -4.947  -2.901  -2.378  1.00 0.00 ? 88  THR A C    2  
ATOM 3101  O O    . THR A 1 88  ? -5.087  -1.829  -2.965  1.00 0.00 ? 88  THR A O    2  
ATOM 3102  C CB   . THR A 1 88  ? -5.928  -4.488  -4.126  1.00 0.00 ? 88  THR A CB   2  
ATOM 3103  O OG1  . THR A 1 88  ? -6.076  -5.905  -4.080  1.00 0.00 ? 88  THR A OG1  2  
ATOM 3104  C CG2  . THR A 1 88  ? -4.584  -4.276  -4.826  1.00 0.00 ? 88  THR A CG2  2  
ATOM 3105  H H    . THR A 1 88  ? -7.604  -2.878  -2.646  1.00 0.00 ? 88  THR A H    2  
ATOM 3106  H HA   . THR A 1 88  ? -5.558  -4.907  -2.046  1.00 0.00 ? 88  THR A HA   2  
ATOM 3107  H HB   . THR A 1 88  ? -6.730  -3.977  -4.659  1.00 0.00 ? 88  THR A HB   2  
ATOM 3108  H HG1  . THR A 1 88  ? -5.246  -6.323  -3.712  1.00 0.00 ? 88  THR A HG1  2  
ATOM 3109  H HG21 . THR A 1 88  ? -3.848  -4.969  -4.417  1.00 0.00 ? 88  THR A HG21 2  
ATOM 3110  H HG22 . THR A 1 88  ? -4.698  -4.457  -5.895  1.00 0.00 ? 88  THR A HG22 2  
ATOM 3111  H HG23 . THR A 1 88  ? -4.248  -3.252  -4.665  1.00 0.00 ? 88  THR A HG23 2  
ATOM 3112  N N    . ILE A 1 89  ? -4.002  -3.148  -1.482  1.00 0.00 ? 89  ILE A N    2  
ATOM 3113  C CA   . ILE A 1 89  ? -3.031  -2.130  -1.119  1.00 0.00 ? 89  ILE A CA   2  
ATOM 3114  C C    . ILE A 1 89  ? -1.710  -2.412  -1.838  1.00 0.00 ? 89  ILE A C    2  
ATOM 3115  O O    . ILE A 1 89  ? -1.081  -3.443  -1.604  1.00 0.00 ? 89  ILE A O    2  
ATOM 3116  C CB   . ILE A 1 89  ? -2.896  -2.036  0.402   1.00 0.00 ? 89  ILE A CB   2  
ATOM 3117  C CG1  . ILE A 1 89  ? -4.263  -2.142  1.081   1.00 0.00 ? 89  ILE A CG1  2  
ATOM 3118  C CG2  . ILE A 1 89  ? -2.151  -0.763  0.809   1.00 0.00 ? 89  ILE A CG2  2  
ATOM 3119  C CD1  . ILE A 1 89  ? -5.293  -1.253  0.382   1.00 0.00 ? 89  ILE A CD1  2  
ATOM 3120  H H    . ILE A 1 89  ? -3.895  -4.022  -1.009  1.00 0.00 ? 89  ILE A H    2  
ATOM 3121  H HA   . ILE A 1 89  ? -3.416  -1.172  -1.468  1.00 0.00 ? 89  ILE A HA   2  
ATOM 3122  H HB   . ILE A 1 89  ? -2.300  -2.881  0.745   1.00 0.00 ? 89  ILE A HB   2  
ATOM 3123  H HG12 . ILE A 1 89  ? -4.601  -3.178  1.065   1.00 0.00 ? 89  ILE A HG12 2  
ATOM 3124  H HG13 . ILE A 1 89  ? -4.176  -1.851  2.128   1.00 0.00 ? 89  ILE A HG13 2  
ATOM 3125  H HG21 . ILE A 1 89  ? -2.281  -0.004  0.038   1.00 0.00 ? 89  ILE A HG21 2  
ATOM 3126  H HG22 . ILE A 1 89  ? -2.551  -0.394  1.753   1.00 0.00 ? 89  ILE A HG22 2  
ATOM 3127  H HG23 . ILE A 1 89  ? -1.090  -0.984  0.925   1.00 0.00 ? 89  ILE A HG23 2  
ATOM 3128  H HD11 . ILE A 1 89  ? -4.778  -0.521  -0.240  1.00 0.00 ? 89  ILE A HD11 2  
ATOM 3129  H HD12 . ILE A 1 89  ? -5.941  -1.868  -0.241  1.00 0.00 ? 89  ILE A HD12 2  
ATOM 3130  H HD13 . ILE A 1 89  ? -5.894  -0.735  1.131   1.00 0.00 ? 89  ILE A HD13 2  
ATOM 3131  N N    . GLU A 1 90  ? -1.329  -1.479  -2.697  1.00 0.00 ? 90  GLU A N    2  
ATOM 3132  C CA   . GLU A 1 90  ? -0.094  -1.615  -3.451  1.00 0.00 ? 90  GLU A CA   2  
ATOM 3133  C C    . GLU A 1 90  ? 0.999   -0.734  -2.843  1.00 0.00 ? 90  GLU A C    2  
ATOM 3134  O O    . GLU A 1 90  ? 0.858   0.487   -2.787  1.00 0.00 ? 90  GLU A O    2  
ATOM 3135  C CB   . GLU A 1 90  ? -0.313  -1.277  -4.927  1.00 0.00 ? 90  GLU A CB   2  
ATOM 3136  C CG   . GLU A 1 90  ? -1.553  -1.987  -5.474  1.00 0.00 ? 90  GLU A CG   2  
ATOM 3137  C CD   . GLU A 1 90  ? -2.535  -0.984  -6.084  1.00 0.00 ? 90  GLU A CD   2  
ATOM 3138  O OE1  . GLU A 1 90  ? -3.237  -0.323  -5.289  1.00 0.00 ? 90  GLU A OE1  2  
ATOM 3139  O OE2  . GLU A 1 90  ? -2.560  -0.901  -7.331  1.00 0.00 ? 90  GLU A OE2  2  
ATOM 3140  H H    . GLU A 1 90  ? -1.847  -0.643  -2.881  1.00 0.00 ? 90  GLU A H    2  
ATOM 3141  H HA   . GLU A 1 90  ? 0.185   -2.665  -3.363  1.00 0.00 ? 90  GLU A HA   2  
ATOM 3142  H HB2  . GLU A 1 90  ? -0.425  -0.199  -5.044  1.00 0.00 ? 90  GLU A HB2  2  
ATOM 3143  H HB3  . GLU A 1 90  ? 0.563   -1.570  -5.505  1.00 0.00 ? 90  GLU A HB3  2  
ATOM 3144  H HG2  . GLU A 1 90  ? -1.256  -2.715  -6.229  1.00 0.00 ? 90  GLU A HG2  2  
ATOM 3145  H HG3  . GLU A 1 90  ? -2.043  -2.539  -4.673  1.00 0.00 ? 90  GLU A HG3  2  
ATOM 3146  N N    . VAL A 1 91  ? 2.064   -1.387  -2.402  1.00 0.00 ? 91  VAL A N    2  
ATOM 3147  C CA   . VAL A 1 91  ? 3.180   -0.678  -1.800  1.00 0.00 ? 91  VAL A CA   2  
ATOM 3148  C C    . VAL A 1 91  ? 4.390   -0.753  -2.735  1.00 0.00 ? 91  VAL A C    2  
ATOM 3149  O O    . VAL A 1 91  ? 4.911   -1.836  -2.995  1.00 0.00 ? 91  VAL A O    2  
ATOM 3150  C CB   . VAL A 1 91  ? 3.466   -1.239  -0.406  1.00 0.00 ? 91  VAL A CB   2  
ATOM 3151  C CG1  . VAL A 1 91  ? 4.736   -0.622  0.184   1.00 0.00 ? 91  VAL A CG1  2  
ATOM 3152  C CG2  . VAL A 1 91  ? 2.271   -1.030  0.525   1.00 0.00 ? 91  VAL A CG2  2  
ATOM 3153  H H    . VAL A 1 91  ? 2.171   -2.380  -2.451  1.00 0.00 ? 91  VAL A H    2  
ATOM 3154  H HA   . VAL A 1 91  ? 2.886   0.366   -1.690  1.00 0.00 ? 91  VAL A HA   2  
ATOM 3155  H HB   . VAL A 1 91  ? 3.631   -2.313  -0.504  1.00 0.00 ? 91  VAL A HB   2  
ATOM 3156  H HG11 . VAL A 1 91  ? 4.464   0.172   0.880   1.00 0.00 ? 91  VAL A HG11 2  
ATOM 3157  H HG12 . VAL A 1 91  ? 5.302   -1.389  0.711   1.00 0.00 ? 91  VAL A HG12 2  
ATOM 3158  H HG13 . VAL A 1 91  ? 5.345   -0.207  -0.619  1.00 0.00 ? 91  VAL A HG13 2  
ATOM 3159  H HG21 . VAL A 1 91  ? 2.136   0.035   0.709   1.00 0.00 ? 91  VAL A HG21 2  
ATOM 3160  H HG22 . VAL A 1 91  ? 1.372   -1.435  0.059   1.00 0.00 ? 91  VAL A HG22 2  
ATOM 3161  H HG23 . VAL A 1 91  ? 2.452   -1.542  1.470   1.00 0.00 ? 91  VAL A HG23 2  
ATOM 3162  N N    . ALA A 1 92  ? 4.801   0.413   -3.213  1.00 0.00 ? 92  ALA A N    2  
ATOM 3163  C CA   . ALA A 1 92  ? 5.939   0.493   -4.112  1.00 0.00 ? 92  ALA A CA   2  
ATOM 3164  C C    . ALA A 1 92  ? 7.090   1.214   -3.408  1.00 0.00 ? 92  ALA A C    2  
ATOM 3165  O O    . ALA A 1 92  ? 6.889   1.849   -2.374  1.00 0.00 ? 92  ALA A O    2  
ATOM 3166  C CB   . ALA A 1 92  ? 5.518   1.191   -5.407  1.00 0.00 ? 92  ALA A CB   2  
ATOM 3167  H H    . ALA A 1 92  ? 4.371   1.289   -2.996  1.00 0.00 ? 92  ALA A H    2  
ATOM 3168  H HA   . ALA A 1 92  ? 6.248   -0.525  -4.348  1.00 0.00 ? 92  ALA A HA   2  
ATOM 3169  H HB1  . ALA A 1 92  ? 4.522   1.616   -5.284  1.00 0.00 ? 92  ALA A HB1  2  
ATOM 3170  H HB2  . ALA A 1 92  ? 6.226   1.988   -5.637  1.00 0.00 ? 92  ALA A HB2  2  
ATOM 3171  H HB3  . ALA A 1 92  ? 5.507   0.468   -6.223  1.00 0.00 ? 92  ALA A HB3  2  
ATOM 3172  N N    . ALA A 1 93  ? 8.271   1.091   -3.997  1.00 0.00 ? 93  ALA A N    2  
ATOM 3173  C CA   . ALA A 1 93  ? 9.454   1.723   -3.439  1.00 0.00 ? 93  ALA A CA   2  
ATOM 3174  C C    . ALA A 1 93  ? 10.044  2.690   -4.468  1.00 0.00 ? 93  ALA A C    2  
ATOM 3175  O O    . ALA A 1 93  ? 10.153  2.357   -5.647  1.00 0.00 ? 93  ALA A O    2  
ATOM 3176  C CB   . ALA A 1 93  ? 10.454  0.647   -3.010  1.00 0.00 ? 93  ALA A CB   2  
ATOM 3177  H H    . ALA A 1 93  ? 8.426   0.573   -4.838  1.00 0.00 ? 93  ALA A H    2  
ATOM 3178  H HA   . ALA A 1 93  ? 9.146   2.287   -2.558  1.00 0.00 ? 93  ALA A HA   2  
ATOM 3179  H HB1  . ALA A 1 93  ? 9.948   -0.091  -2.388  1.00 0.00 ? 93  ALA A HB1  2  
ATOM 3180  H HB2  . ALA A 1 93  ? 10.863  0.159   -3.894  1.00 0.00 ? 93  ALA A HB2  2  
ATOM 3181  H HB3  . ALA A 1 93  ? 11.262  1.108   -2.442  1.00 0.00 ? 93  ALA A HB3  2  
ATOM 3182  N N    . MET A 1 94  ? 10.408  3.869   -3.984  1.00 0.00 ? 94  MET A N    2  
ATOM 3183  C CA   . MET A 1 94  ? 10.984  4.886   -4.847  1.00 0.00 ? 94  MET A CA   2  
ATOM 3184  C C    . MET A 1 94  ? 12.462  5.110   -4.521  1.00 0.00 ? 94  MET A C    2  
ATOM 3185  O O    . MET A 1 94  ? 12.845  5.141   -3.352  1.00 0.00 ? 94  MET A O    2  
ATOM 3186  C CB   . MET A 1 94  ? 10.218  6.198   -4.671  1.00 0.00 ? 94  MET A CB   2  
ATOM 3187  C CG   . MET A 1 94  ? 8.724   6.001   -4.939  1.00 0.00 ? 94  MET A CG   2  
ATOM 3188  S SD   . MET A 1 94  ? 7.850   7.537   -4.683  1.00 0.00 ? 94  MET A SD   2  
ATOM 3189  C CE   . MET A 1 94  ? 8.084   7.736   -2.925  1.00 0.00 ? 94  MET A CE   2  
ATOM 3190  H H    . MET A 1 94  ? 10.316  4.132   -3.024  1.00 0.00 ? 94  MET A H    2  
ATOM 3191  H HA   . MET A 1 94  ? 10.883  4.500   -5.862  1.00 0.00 ? 94  MET A HA   2  
ATOM 3192  H HB2  . MET A 1 94  ? 10.362  6.575   -3.659  1.00 0.00 ? 94  MET A HB2  2  
ATOM 3193  H HB3  . MET A 1 94  ? 10.617  6.951   -5.351  1.00 0.00 ? 94  MET A HB3  2  
ATOM 3194  H HG2  . MET A 1 94  ? 8.573   5.653   -5.961  1.00 0.00 ? 94  MET A HG2  2  
ATOM 3195  H HG3  . MET A 1 94  ? 8.326   5.232   -4.278  1.00 0.00 ? 94  MET A HG3  2  
ATOM 3196  H HE1  . MET A 1 94  ? 7.374   8.471   -2.545  1.00 0.00 ? 94  MET A HE1  2  
ATOM 3197  H HE2  . MET A 1 94  ? 7.921   6.781   -2.425  1.00 0.00 ? 94  MET A HE2  2  
ATOM 3198  H HE3  . MET A 1 94  ? 9.100   8.079   -2.730  1.00 0.00 ? 94  MET A HE3  2  
ATOM 3199  N N    . THR A 1 95  ? 13.251  5.260   -5.574  1.00 0.00 ? 95  THR A N    2  
ATOM 3200  C CA   . THR A 1 95  ? 14.679  5.480   -5.414  1.00 0.00 ? 95  THR A CA   2  
ATOM 3201  C C    . THR A 1 95  ? 15.086  6.814   -6.042  1.00 0.00 ? 95  THR A C    2  
ATOM 3202  O O    . THR A 1 95  ? 14.232  7.632   -6.380  1.00 0.00 ? 95  THR A O    2  
ATOM 3203  C CB   . THR A 1 95  ? 15.412  4.278   -6.011  1.00 0.00 ? 95  THR A CB   2  
ATOM 3204  O OG1  . THR A 1 95  ? 14.684  3.982   -7.200  1.00 0.00 ? 95  THR A OG1  2  
ATOM 3205  C CG2  . THR A 1 95  ? 15.262  3.017   -5.158  1.00 0.00 ? 95  THR A CG2  2  
ATOM 3206  H H    . THR A 1 95  ? 12.932  5.234   -6.521  1.00 0.00 ? 95  THR A H    2  
ATOM 3207  H HA   . THR A 1 95  ? 14.899  5.548   -4.348  1.00 0.00 ? 95  THR A HA   2  
ATOM 3208  H HB   . THR A 1 95  ? 16.464  4.509   -6.182  1.00 0.00 ? 95  THR A HB   2  
ATOM 3209  H HG1  . THR A 1 95  ? 15.300  3.614   -7.896  1.00 0.00 ? 95  THR A HG1  2  
ATOM 3210  H HG21 . THR A 1 95  ? 15.162  2.148   -5.808  1.00 0.00 ? 95  THR A HG21 2  
ATOM 3211  H HG22 . THR A 1 95  ? 16.143  2.898   -4.527  1.00 0.00 ? 95  THR A HG22 2  
ATOM 3212  H HG23 . THR A 1 95  ? 14.375  3.106   -4.531  1.00 0.00 ? 95  THR A HG23 2  
ATOM 3213  N N    . SER A 1 96  ? 16.392  6.993   -6.179  1.00 0.00 ? 96  SER A N    2  
ATOM 3214  C CA   . SER A 1 96  ? 16.924  8.214   -6.761  1.00 0.00 ? 96  SER A CA   2  
ATOM 3215  C C    . SER A 1 96  ? 16.725  8.200   -8.278  1.00 0.00 ? 96  SER A C    2  
ATOM 3216  O O    . SER A 1 96  ? 17.072  9.162   -8.961  1.00 0.00 ? 96  SER A O    2  
ATOM 3217  C CB   . SER A 1 96  ? 18.405  8.386   -6.421  1.00 0.00 ? 96  SER A CB   2  
ATOM 3218  O OG   . SER A 1 96  ? 18.624  8.471   -5.015  1.00 0.00 ? 96  SER A OG   2  
ATOM 3219  H H    . SER A 1 96  ? 17.080  6.323   -5.902  1.00 0.00 ? 96  SER A H    2  
ATOM 3220  H HA   . SER A 1 96  ? 16.351  9.023   -6.307  1.00 0.00 ? 96  SER A HA   2  
ATOM 3221  H HB2  . SER A 1 96  ? 18.970  7.547   -6.826  1.00 0.00 ? 96  SER A HB2  2  
ATOM 3222  H HB3  . SER A 1 96  ? 18.785  9.288   -6.902  1.00 0.00 ? 96  SER A HB3  2  
ATOM 3223  H HG   . SER A 1 96  ? 18.036  9.177   -4.620  1.00 0.00 ? 96  SER A HG   2  
ATOM 3224  N N    . LYS A 1 97  ? 16.168  7.099   -8.760  1.00 0.00 ? 97  LYS A N    2  
ATOM 3225  C CA   . LYS A 1 97  ? 15.919  6.948   -10.183 1.00 0.00 ? 97  LYS A CA   2  
ATOM 3226  C C    . LYS A 1 97  ? 14.415  7.043   -10.447 1.00 0.00 ? 97  LYS A C    2  
ATOM 3227  O O    . LYS A 1 97  ? 13.990  7.670   -11.416 1.00 0.00 ? 97  LYS A O    2  
ATOM 3228  C CB   . LYS A 1 97  ? 16.554  5.657   -10.704 1.00 0.00 ? 97  LYS A CB   2  
ATOM 3229  C CG   . LYS A 1 97  ? 15.512  4.772   -11.391 1.00 0.00 ? 97  LYS A CG   2  
ATOM 3230  C CD   . LYS A 1 97  ? 15.186  5.295   -12.791 1.00 0.00 ? 97  LYS A CD   2  
ATOM 3231  C CE   . LYS A 1 97  ? 13.681  5.239   -13.060 1.00 0.00 ? 97  LYS A CE   2  
ATOM 3232  N NZ   . LYS A 1 97  ? 13.321  6.133   -14.184 1.00 0.00 ? 97  LYS A NZ   2  
ATOM 3233  H H    . LYS A 1 97  ? 15.889  6.321   -8.197  1.00 0.00 ? 97  LYS A H    2  
ATOM 3234  H HA   . LYS A 1 97  ? 16.412  7.777   -10.691 1.00 0.00 ? 97  LYS A HA   2  
ATOM 3235  H HB2  . LYS A 1 97  ? 17.353  5.897   -11.406 1.00 0.00 ? 97  LYS A HB2  2  
ATOM 3236  H HB3  . LYS A 1 97  ? 17.010  5.113   -9.877  1.00 0.00 ? 97  LYS A HB3  2  
ATOM 3237  H HG2  . LYS A 1 97  ? 15.886  3.750   -11.459 1.00 0.00 ? 97  LYS A HG2  2  
ATOM 3238  H HG3  . LYS A 1 97  ? 14.604  4.739   -10.790 1.00 0.00 ? 97  LYS A HG3  2  
ATOM 3239  H HD2  . LYS A 1 97  ? 15.538  6.322   -12.891 1.00 0.00 ? 97  LYS A HD2  2  
ATOM 3240  H HD3  . LYS A 1 97  ? 15.715  4.703   -13.538 1.00 0.00 ? 97  LYS A HD3  2  
ATOM 3241  H HE2  . LYS A 1 97  ? 13.385  4.215   -13.293 1.00 0.00 ? 97  LYS A HE2  2  
ATOM 3242  H HE3  . LYS A 1 97  ? 13.134  5.532   -12.165 1.00 0.00 ? 97  LYS A HE3  2  
ATOM 3243  H HZ1  . LYS A 1 97  ? 13.405  5.634   -15.046 1.00 0.00 ? 97  LYS A HZ1  2  
ATOM 3244  H HZ2  . LYS A 1 97  ? 12.378  6.447   -14.071 1.00 0.00 ? 97  LYS A HZ2  2  
ATOM 3245  H HZ3  . LYS A 1 97  ? 13.937  6.921   -14.193 1.00 0.00 ? 97  LYS A HZ3  2  
ATOM 3246  N N    . GLY A 1 98  ? 13.651  6.412   -9.567  1.00 0.00 ? 98  GLY A N    2  
ATOM 3247  C CA   . GLY A 1 98  ? 12.204  6.418   -9.693  1.00 0.00 ? 98  GLY A CA   2  
ATOM 3248  C C    . GLY A 1 98  ? 11.575  5.318   -8.836  1.00 0.00 ? 98  GLY A C    2  
ATOM 3249  O O    . GLY A 1 98  ? 12.106  4.965   -7.784  1.00 0.00 ? 98  GLY A O    2  
ATOM 3250  H H    . GLY A 1 98  ? 14.005  5.905   -8.782  1.00 0.00 ? 98  GLY A H    2  
ATOM 3251  H HA2  . GLY A 1 98  ? 11.813  7.389   -9.389  1.00 0.00 ? 98  GLY A HA2  2  
ATOM 3252  H HA3  . GLY A 1 98  ? 11.925  6.275   -10.737 1.00 0.00 ? 98  GLY A HA3  2  
ATOM 3253  N N    . GLN A 1 99  ? 10.451  4.806   -9.317  1.00 0.00 ? 99  GLN A N    2  
ATOM 3254  C CA   . GLN A 1 99  ? 9.744   3.753   -8.608  1.00 0.00 ? 99  GLN A CA   2  
ATOM 3255  C C    . GLN A 1 99  ? 9.961   2.407   -9.303  1.00 0.00 ? 99  GLN A C    2  
ATOM 3256  O O    . GLN A 1 99  ? 10.170  2.356   -10.514 1.00 0.00 ? 99  GLN A O    2  
ATOM 3257  C CB   . GLN A 1 99  ? 8.253   4.076   -8.492  1.00 0.00 ? 99  GLN A CB   2  
ATOM 3258  C CG   . GLN A 1 99  ? 7.519   2.996   -7.695  1.00 0.00 ? 99  GLN A CG   2  
ATOM 3259  C CD   . GLN A 1 99  ? 6.005   3.216   -7.740  1.00 0.00 ? 99  GLN A CD   2  
ATOM 3260  O OE1  . GLN A 1 99  ? 5.453   4.054   -7.046  1.00 0.00 ? 99  GLN A OE1  2  
ATOM 3261  N NE2  . GLN A 1 99  ? 5.368   2.418   -8.592  1.00 0.00 ? 99  GLN A NE2  2  
ATOM 3262  H H    . GLN A 1 99  ? 10.026  5.099   -10.174 1.00 0.00 ? 99  GLN A H    2  
ATOM 3263  H HA   . GLN A 1 99  ? 10.183  3.730   -7.611  1.00 0.00 ? 99  GLN A HA   2  
ATOM 3264  H HB2  . GLN A 1 99  ? 8.124   5.043   -8.006  1.00 0.00 ? 99  GLN A HB2  2  
ATOM 3265  H HB3  . GLN A 1 99  ? 7.817   4.159   -9.488  1.00 0.00 ? 99  GLN A HB3  2  
ATOM 3266  H HG2  . GLN A 1 99  ? 7.759   2.014   -8.100  1.00 0.00 ? 99  GLN A HG2  2  
ATOM 3267  H HG3  . GLN A 1 99  ? 7.861   3.008   -6.660  1.00 0.00 ? 99  GLN A HG3  2  
ATOM 3268  H HE21 . GLN A 1 99  ? 5.881   1.751   -9.132  1.00 0.00 ? 99  GLN A HE21 2  
ATOM 3269  H HE22 . GLN A 1 99  ? 4.375   2.486   -8.693  1.00 0.00 ? 99  GLN A HE22 2  
ATOM 3270  N N    . GLY A 1 100 ? 9.904   1.350   -8.506  1.00 0.00 ? 100 GLY A N    2  
ATOM 3271  C CA   . GLY A 1 100 ? 10.092  0.008   -9.030  1.00 0.00 ? 100 GLY A CA   2  
ATOM 3272  C C    . GLY A 1 100 ? 8.825   -0.831  -8.854  1.00 0.00 ? 100 GLY A C    2  
ATOM 3273  O O    . GLY A 1 100 ? 7.717   -0.296  -8.857  1.00 0.00 ? 100 GLY A O    2  
ATOM 3274  H H    . GLY A 1 100 ? 9.734   1.400   -7.522  1.00 0.00 ? 100 GLY A H    2  
ATOM 3275  H HA2  . GLY A 1 100 ? 10.356  0.059   -10.086 1.00 0.00 ? 100 GLY A HA2  2  
ATOM 3276  H HA3  . GLY A 1 100 ? 10.925  -0.473  -8.516  1.00 0.00 ? 100 GLY A HA3  2  
ATOM 3277  N N    . GLN A 1 101 ? 9.030   -2.132  -8.706  1.00 0.00 ? 101 GLN A N    2  
ATOM 3278  C CA   . GLN A 1 101 ? 7.918   -3.050  -8.530  1.00 0.00 ? 101 GLN A CA   2  
ATOM 3279  C C    . GLN A 1 101 ? 6.970   -2.534  -7.445  1.00 0.00 ? 101 GLN A C    2  
ATOM 3280  O O    . GLN A 1 101 ? 7.240   -1.512  -6.815  1.00 0.00 ? 101 GLN A O    2  
ATOM 3281  C CB   . GLN A 1 101 ? 8.416   -4.458  -8.199  1.00 0.00 ? 101 GLN A CB   2  
ATOM 3282  C CG   . GLN A 1 101 ? 7.699   -5.507  -9.051  1.00 0.00 ? 101 GLN A CG   2  
ATOM 3283  C CD   . GLN A 1 101 ? 8.695   -6.508  -9.641  1.00 0.00 ? 101 GLN A CD   2  
ATOM 3284  O OE1  . GLN A 1 101 ? 9.768   -6.156  -10.103 1.00 0.00 ? 101 GLN A OE1  2  
ATOM 3285  N NE2  . GLN A 1 101 ? 8.280   -7.771  -9.601  1.00 0.00 ? 101 GLN A NE2  2  
ATOM 3286  H H    . GLN A 1 101 ? 9.934   -2.558  -8.705  1.00 0.00 ? 101 GLN A H    2  
ATOM 3287  H HA   . GLN A 1 101 ? 7.403   -3.069  -9.491  1.00 0.00 ? 101 GLN A HA   2  
ATOM 3288  H HB2  . GLN A 1 101 ? 9.490   -4.517  -8.371  1.00 0.00 ? 101 GLN A HB2  2  
ATOM 3289  H HB3  . GLN A 1 101 ? 8.250   -4.667  -7.142  1.00 0.00 ? 101 GLN A HB3  2  
ATOM 3290  H HG2  . GLN A 1 101 ? 6.965   -6.035  -8.442  1.00 0.00 ? 101 GLN A HG2  2  
ATOM 3291  H HG3  . GLN A 1 101 ? 7.151   -5.016  -9.855  1.00 0.00 ? 101 GLN A HG3  2  
ATOM 3292  H HE21 . GLN A 1 101 ? 7.388   -7.992  -9.208  1.00 0.00 ? 101 GLN A HE21 2  
ATOM 3293  H HE22 . GLN A 1 101 ? 8.862   -8.500  -9.963  1.00 0.00 ? 101 GLN A HE22 2  
ATOM 3294  N N    . VAL A 1 102 ? 5.881   -3.264  -7.259  1.00 0.00 ? 102 VAL A N    2  
ATOM 3295  C CA   . VAL A 1 102 ? 4.892   -2.894  -6.261  1.00 0.00 ? 102 VAL A CA   2  
ATOM 3296  C C    . VAL A 1 102 ? 4.273   -4.160  -5.668  1.00 0.00 ? 102 VAL A C    2  
ATOM 3297  O O    . VAL A 1 102 ? 3.978   -5.110  -6.392  1.00 0.00 ? 102 VAL A O    2  
ATOM 3298  C CB   . VAL A 1 102 ? 3.855   -1.952  -6.876  1.00 0.00 ? 102 VAL A CB   2  
ATOM 3299  C CG1  . VAL A 1 102 ? 2.654   -2.735  -7.411  1.00 0.00 ? 102 VAL A CG1  2  
ATOM 3300  C CG2  . VAL A 1 102 ? 3.412   -0.890  -5.868  1.00 0.00 ? 102 VAL A CG2  2  
ATOM 3301  H H    . VAL A 1 102 ? 5.669   -4.094  -7.775  1.00 0.00 ? 102 VAL A H    2  
ATOM 3302  H HA   . VAL A 1 102 ? 5.411   -2.353  -5.469  1.00 0.00 ? 102 VAL A HA   2  
ATOM 3303  H HB   . VAL A 1 102 ? 4.323   -1.441  -7.717  1.00 0.00 ? 102 VAL A HB   2  
ATOM 3304  H HG11 . VAL A 1 102 ? 2.147   -2.145  -8.175  1.00 0.00 ? 102 VAL A HG11 2  
ATOM 3305  H HG12 . VAL A 1 102 ? 2.997   -3.674  -7.846  1.00 0.00 ? 102 VAL A HG12 2  
ATOM 3306  H HG13 . VAL A 1 102 ? 1.963   -2.943  -6.595  1.00 0.00 ? 102 VAL A HG13 2  
ATOM 3307  H HG21 . VAL A 1 102 ? 3.250   0.056   -6.384  1.00 0.00 ? 102 VAL A HG21 2  
ATOM 3308  H HG22 . VAL A 1 102 ? 2.485   -1.207  -5.390  1.00 0.00 ? 102 VAL A HG22 2  
ATOM 3309  H HG23 . VAL A 1 102 ? 4.186   -0.763  -5.111  1.00 0.00 ? 102 VAL A HG23 2  
ATOM 3310  N N    . SER A 1 103 ? 4.094   -4.135  -4.355  1.00 0.00 ? 103 SER A N    2  
ATOM 3311  C CA   . SER A 1 103 ? 3.515   -5.269  -3.656  1.00 0.00 ? 103 SER A CA   2  
ATOM 3312  C C    . SER A 1 103 ? 2.042   -4.996  -3.345  1.00 0.00 ? 103 SER A C    2  
ATOM 3313  O O    . SER A 1 103 ? 1.727   -4.251  -2.418  1.00 0.00 ? 103 SER A O    2  
ATOM 3314  C CB   . SER A 1 103 ? 4.282   -5.573  -2.368  1.00 0.00 ? 103 SER A CB   2  
ATOM 3315  O OG   . SER A 1 103 ? 5.374   -6.460  -2.593  1.00 0.00 ? 103 SER A OG   2  
ATOM 3316  H H    . SER A 1 103 ? 4.336   -3.359  -3.773  1.00 0.00 ? 103 SER A H    2  
ATOM 3317  H HA   . SER A 1 103 ? 3.611   -6.111  -4.343  1.00 0.00 ? 103 SER A HA   2  
ATOM 3318  H HB2  . SER A 1 103 ? 4.654   -4.642  -1.940  1.00 0.00 ? 103 SER A HB2  2  
ATOM 3319  H HB3  . SER A 1 103 ? 3.603   -6.011  -1.636  1.00 0.00 ? 103 SER A HB3  2  
ATOM 3320  H HG   . SER A 1 103 ? 5.076   -7.235  -3.151  1.00 0.00 ? 103 SER A HG   2  
ATOM 3321  N N    . ALA A 1 104 ? 1.178   -5.613  -4.138  1.00 0.00 ? 104 ALA A N    2  
ATOM 3322  C CA   . ALA A 1 104 ? -0.254  -5.446  -3.959  1.00 0.00 ? 104 ALA A CA   2  
ATOM 3323  C C    . ALA A 1 104 ? -0.821  -6.675  -3.244  1.00 0.00 ? 104 ALA A C    2  
ATOM 3324  O O    . ALA A 1 104 ? -0.756  -7.786  -3.767  1.00 0.00 ? 104 ALA A O    2  
ATOM 3325  C CB   . ALA A 1 104 ? -0.914  -5.205  -5.318  1.00 0.00 ? 104 ALA A CB   2  
ATOM 3326  H H    . ALA A 1 104 ? 1.442   -6.218  -4.890  1.00 0.00 ? 104 ALA A H    2  
ATOM 3327  H HA   . ALA A 1 104 ? -0.410  -4.568  -3.332  1.00 0.00 ? 104 ALA A HA   2  
ATOM 3328  H HB1  . ALA A 1 104 ? -1.631  -4.388  -5.234  1.00 0.00 ? 104 ALA A HB1  2  
ATOM 3329  H HB2  . ALA A 1 104 ? -0.151  -4.945  -6.051  1.00 0.00 ? 104 ALA A HB2  2  
ATOM 3330  H HB3  . ALA A 1 104 ? -1.431  -6.111  -5.636  1.00 0.00 ? 104 ALA A HB3  2  
ATOM 3331  N N    . SER A 1 105 ? -1.365  -6.433  -2.061  1.00 0.00 ? 105 SER A N    2  
ATOM 3332  C CA   . SER A 1 105 ? -1.944  -7.506  -1.270  1.00 0.00 ? 105 SER A CA   2  
ATOM 3333  C C    . SER A 1 105 ? -3.444  -7.268  -1.082  1.00 0.00 ? 105 SER A C    2  
ATOM 3334  O O    . SER A 1 105 ? -3.860  -6.171  -0.714  1.00 0.00 ? 105 SER A O    2  
ATOM 3335  C CB   . SER A 1 105 ? -1.251  -7.623  0.089   1.00 0.00 ? 105 SER A CB   2  
ATOM 3336  O OG   . SER A 1 105 ? -0.427  -8.782  0.170   1.00 0.00 ? 105 SER A OG   2  
ATOM 3337  H H    . SER A 1 105 ? -1.415  -5.526  -1.643  1.00 0.00 ? 105 SER A H    2  
ATOM 3338  H HA   . SER A 1 105 ? -1.770  -8.415  -1.845  1.00 0.00 ? 105 SER A HA   2  
ATOM 3339  H HB2  . SER A 1 105 ? -0.645  -6.734  0.265   1.00 0.00 ? 105 SER A HB2  2  
ATOM 3340  H HB3  . SER A 1 105 ? -2.003  -7.657  0.878   1.00 0.00 ? 105 SER A HB3  2  
ATOM 3341  H HG   . SER A 1 105 ? -0.995  -9.604  0.206   1.00 0.00 ? 105 SER A HG   2  
ATOM 3342  N N    . THR A 1 106 ? -4.213  -8.314  -1.345  1.00 0.00 ? 106 THR A N    2  
ATOM 3343  C CA   . THR A 1 106 ? -5.658  -8.232  -1.210  1.00 0.00 ? 106 THR A CA   2  
ATOM 3344  C C    . THR A 1 106 ? -6.060  -8.303  0.264   1.00 0.00 ? 106 THR A C    2  
ATOM 3345  O O    . THR A 1 106 ? -5.641  -9.208  0.984   1.00 0.00 ? 106 THR A O    2  
ATOM 3346  C CB   . THR A 1 106 ? -6.276  -9.343  -2.062  1.00 0.00 ? 106 THR A CB   2  
ATOM 3347  O OG1  . THR A 1 106 ? -5.314  -9.568  -3.089  1.00 0.00 ? 106 THR A OG1  2  
ATOM 3348  C CG2  . THR A 1 106 ? -7.523  -8.877  -2.816  1.00 0.00 ? 106 THR A CG2  2  
ATOM 3349  H H    . THR A 1 106 ? -3.866  -9.202  -1.644  1.00 0.00 ? 106 THR A H    2  
ATOM 3350  H HA   . THR A 1 106 ? -5.984  -7.262  -1.584  1.00 0.00 ? 106 THR A HA   2  
ATOM 3351  H HB   . THR A 1 106 ? -6.493  -10.223 -1.457  1.00 0.00 ? 106 THR A HB   2  
ATOM 3352  H HG1  . THR A 1 106 ? -5.154  -8.724  -3.599  1.00 0.00 ? 106 THR A HG1  2  
ATOM 3353  H HG21 . THR A 1 106 ? -7.448  -7.808  -3.017  1.00 0.00 ? 106 THR A HG21 2  
ATOM 3354  H HG22 . THR A 1 106 ? -7.602  -9.419  -3.758  1.00 0.00 ? 106 THR A HG22 2  
ATOM 3355  H HG23 . THR A 1 106 ? -8.408  -9.071  -2.210  1.00 0.00 ? 106 THR A HG23 2  
ATOM 3356  N N    . ILE A 1 107 ? -6.869  -7.335  0.671   1.00 0.00 ? 107 ILE A N    2  
ATOM 3357  C CA   . ILE A 1 107 ? -7.333  -7.276  2.046   1.00 0.00 ? 107 ILE A CA   2  
ATOM 3358  C C    . ILE A 1 107 ? -8.736  -6.667  2.081   1.00 0.00 ? 107 ILE A C    2  
ATOM 3359  O O    . ILE A 1 107 ? -8.967  -5.597  1.520   1.00 0.00 ? 107 ILE A O    2  
ATOM 3360  C CB   . ILE A 1 107 ? -6.320  -6.536  2.922   1.00 0.00 ? 107 ILE A CB   2  
ATOM 3361  C CG1  . ILE A 1 107 ? -6.768  -6.521  4.385   1.00 0.00 ? 107 ILE A CG1  2  
ATOM 3362  C CG2  . ILE A 1 107 ? -6.059  -5.126  2.388   1.00 0.00 ? 107 ILE A CG2  2  
ATOM 3363  C CD1  . ILE A 1 107 ? -6.714  -7.925  4.990   1.00 0.00 ? 107 ILE A CD1  2  
ATOM 3364  H H    . ILE A 1 107 ? -7.206  -6.602  0.079   1.00 0.00 ? 107 ILE A H    2  
ATOM 3365  H HA   . ILE A 1 107 ? -7.391  -8.300  2.416   1.00 0.00 ? 107 ILE A HA   2  
ATOM 3366  H HB   . ILE A 1 107 ? -5.374  -7.076  2.881   1.00 0.00 ? 107 ILE A HB   2  
ATOM 3367  H HG12 . ILE A 1 107 ? -6.128  -5.849  4.958   1.00 0.00 ? 107 ILE A HG12 2  
ATOM 3368  H HG13 . ILE A 1 107 ? -7.783  -6.130  4.454   1.00 0.00 ? 107 ILE A HG13 2  
ATOM 3369  H HG21 . ILE A 1 107 ? -4.991  -4.915  2.427   1.00 0.00 ? 107 ILE A HG21 2  
ATOM 3370  H HG22 . ILE A 1 107 ? -6.405  -5.059  1.356   1.00 0.00 ? 107 ILE A HG22 2  
ATOM 3371  H HG23 . ILE A 1 107 ? -6.596  -4.401  2.999   1.00 0.00 ? 107 ILE A HG23 2  
ATOM 3372  H HD11 . ILE A 1 107 ? -5.817  -8.436  4.641   1.00 0.00 ? 107 ILE A HD11 2  
ATOM 3373  H HD12 . ILE A 1 107 ? -6.690  -7.851  6.077   1.00 0.00 ? 107 ILE A HD12 2  
ATOM 3374  H HD13 . ILE A 1 107 ? -7.596  -8.487  4.683   1.00 0.00 ? 107 ILE A HD13 2  
ATOM 3375  N N    . SER A 1 108 ? -9.638  -7.375  2.746   1.00 0.00 ? 108 SER A N    2  
ATOM 3376  C CA   . SER A 1 108 ? -11.012 -6.918  2.862   1.00 0.00 ? 108 SER A CA   2  
ATOM 3377  C C    . SER A 1 108 ? -11.217 -6.211  4.203   1.00 0.00 ? 108 SER A C    2  
ATOM 3378  O O    . SER A 1 108 ? -11.540 -6.850  5.203   1.00 0.00 ? 108 SER A O    2  
ATOM 3379  C CB   . SER A 1 108 ? -11.994 -8.083  2.720   1.00 0.00 ? 108 SER A CB   2  
ATOM 3380  O OG   . SER A 1 108 ? -13.298 -7.740  3.179   1.00 0.00 ? 108 SER A OG   2  
ATOM 3381  H H    . SER A 1 108 ? -9.442  -8.244  3.200   1.00 0.00 ? 108 SER A H    2  
ATOM 3382  H HA   . SER A 1 108 ? -11.155 -6.221  2.036   1.00 0.00 ? 108 SER A HA   2  
ATOM 3383  H HB2  . SER A 1 108 ? -12.046 -8.388  1.675   1.00 0.00 ? 108 SER A HB2  2  
ATOM 3384  H HB3  . SER A 1 108 ? -11.624 -8.939  3.284   1.00 0.00 ? 108 SER A HB3  2  
ATOM 3385  H HG   . SER A 1 108 ? -13.847 -8.568  3.299   1.00 0.00 ? 108 SER A HG   2  
ATOM 3386  N N    . SER A 1 109 ? -11.022 -4.900  4.180   1.00 0.00 ? 109 SER A N    2  
ATOM 3387  C CA   . SER A 1 109 ? -11.182 -4.099  5.382   1.00 0.00 ? 109 SER A CA   2  
ATOM 3388  C C    . SER A 1 109 ? -11.089 -4.991  6.621   1.00 0.00 ? 109 SER A C    2  
ATOM 3389  O O    . SER A 1 109 ? -10.168 -5.797  6.743   1.00 0.00 ? 109 SER A O    2  
ATOM 3390  C CB   . SER A 1 109 ? -12.514 -3.346  5.369   1.00 0.00 ? 109 SER A CB   2  
ATOM 3391  O OG   . SER A 1 109 ? -13.629 -4.231  5.440   1.00 0.00 ? 109 SER A OG   2  
ATOM 3392  H H    . SER A 1 109 ? -10.761 -4.388  3.362   1.00 0.00 ? 109 SER A H    2  
ATOM 3393  H HA   . SER A 1 109 ? -10.361 -3.383  5.363   1.00 0.00 ? 109 SER A HA   2  
ATOM 3394  H HB2  . SER A 1 109 ? -12.547 -2.653  6.209   1.00 0.00 ? 109 SER A HB2  2  
ATOM 3395  H HB3  . SER A 1 109 ? -12.584 -2.748  4.460   1.00 0.00 ? 109 SER A HB3  2  
ATOM 3396  H HG   . SER A 1 109 ? -14.442 -3.788  5.062   1.00 0.00 ? 109 SER A HG   2  
ATOM 3397  N N    . GLY A 1 110 ? -12.056 -4.817  7.511   1.00 0.00 ? 110 GLY A N    2  
ATOM 3398  C CA   . GLY A 1 110 ? -12.095 -5.596  8.737   1.00 0.00 ? 110 GLY A CA   2  
ATOM 3399  C C    . GLY A 1 110 ? -13.536 -5.919  9.136   1.00 0.00 ? 110 GLY A C    2  
ATOM 3400  O O    . GLY A 1 110 ? -14.063 -6.970  8.776   1.00 0.00 ? 110 GLY A O    2  
ATOM 3401  H H    . GLY A 1 110 ? -12.802 -4.159  7.404   1.00 0.00 ? 110 GLY A H    2  
ATOM 3402  H HA2  . GLY A 1 110 ? -11.535 -6.521  8.601   1.00 0.00 ? 110 GLY A HA2  2  
ATOM 3403  H HA3  . GLY A 1 110 ? -11.606 -5.043  9.539   1.00 0.00 ? 110 GLY A HA3  2  
ATOM 3404  N N    . VAL A 1 111 ? -14.132 -4.995  9.875   1.00 0.00 ? 111 VAL A N    2  
ATOM 3405  C CA   . VAL A 1 111 ? -15.502 -5.168  10.327  1.00 0.00 ? 111 VAL A CA   2  
ATOM 3406  C C    . VAL A 1 111 ? -15.926 -3.941  11.138  1.00 0.00 ? 111 VAL A C    2  
ATOM 3407  O O    . VAL A 1 111 ? -15.136 -3.401  11.911  1.00 0.00 ? 111 VAL A O    2  
ATOM 3408  C CB   . VAL A 1 111 ? -15.634 -6.476  11.109  1.00 0.00 ? 111 VAL A CB   2  
ATOM 3409  C CG1  . VAL A 1 111 ? -14.768 -6.451  12.370  1.00 0.00 ? 111 VAL A CG1  2  
ATOM 3410  C CG2  . VAL A 1 111 ? -17.097 -6.764  11.454  1.00 0.00 ? 111 VAL A CG2  2  
ATOM 3411  H H    . VAL A 1 111 ? -13.697 -4.142  10.163  1.00 0.00 ? 111 VAL A H    2  
ATOM 3412  H HA   . VAL A 1 111 ? -16.134 -5.238  9.442   1.00 0.00 ? 111 VAL A HA   2  
ATOM 3413  H HB   . VAL A 1 111 ? -15.275 -7.285  10.472  1.00 0.00 ? 111 VAL A HB   2  
ATOM 3414  H HG11 . VAL A 1 111 ? -14.938 -7.360  12.946  1.00 0.00 ? 111 VAL A HG11 2  
ATOM 3415  H HG12 . VAL A 1 111 ? -13.717 -6.390  12.088  1.00 0.00 ? 111 VAL A HG12 2  
ATOM 3416  H HG13 . VAL A 1 111 ? -15.032 -5.583  12.975  1.00 0.00 ? 111 VAL A HG13 2  
ATOM 3417  H HG21 . VAL A 1 111 ? -17.658 -6.943  10.537  1.00 0.00 ? 111 VAL A HG21 2  
ATOM 3418  H HG22 . VAL A 1 111 ? -17.152 -7.645  12.092  1.00 0.00 ? 111 VAL A HG22 2  
ATOM 3419  H HG23 . VAL A 1 111 ? -17.521 -5.908  11.978  1.00 0.00 ? 111 VAL A HG23 2  
ATOM 3420  N N    . PRO A 1 112 ? -17.204 -3.527  10.929  1.00 0.00 ? 112 PRO A N    2  
ATOM 3421  C CA   . PRO A 1 112 ? -17.742 -2.375  11.631  1.00 0.00 ? 112 PRO A CA   2  
ATOM 3422  C C    . PRO A 1 112 ? -18.055 -2.718  13.089  1.00 0.00 ? 112 PRO A C    2  
ATOM 3423  O O    . PRO A 1 112 ? -18.748 -3.696  13.365  1.00 0.00 ? 112 PRO A O    2  
ATOM 3424  C CB   . PRO A 1 112 ? -18.974 -1.971  10.838  1.00 0.00 ? 112 PRO A CB   2  
ATOM 3425  C CG   . PRO A 1 112 ? -19.345 -3.182  9.998   1.00 0.00 ? 112 PRO A CG   2  
ATOM 3426  C CD   . PRO A 1 112 ? -18.168 -4.143  10.021  1.00 0.00 ? 112 PRO A CD   2  
ATOM 3427  H HA   . PRO A 1 112 ? -17.064 -1.640  11.663  1.00 0.00 ? 112 PRO A HA   2  
ATOM 3428  H HB2  . PRO A 1 112 ? -19.792 -1.691  11.502  1.00 0.00 ? 112 PRO A HB2  2  
ATOM 3429  H HB3  . PRO A 1 112 ? -18.767 -1.106  10.207  1.00 0.00 ? 112 PRO A HB3  2  
ATOM 3430  H HG2  . PRO A 1 112 ? -20.239 -3.663  10.395  1.00 0.00 ? 112 PRO A HG2  2  
ATOM 3431  H HG3  . PRO A 1 112 ? -19.573 -2.881  8.975   1.00 0.00 ? 112 PRO A HG3  2  
ATOM 3432  H HD2  . PRO A 1 112 ? -18.469 -5.130  10.373  1.00 0.00 ? 112 PRO A HD2  2  
ATOM 3433  H HD3  . PRO A 1 112 ? -17.745 -4.276  9.025   1.00 0.00 ? 112 PRO A HD3  2  
ATOM 3434  N N    . PRO A 1 113 ? -17.516 -1.873  14.007  1.00 0.00 ? 113 PRO A N    2  
ATOM 3435  C CA   . PRO A 1 113 ? -17.731 -2.077  15.430  1.00 0.00 ? 113 PRO A CA   2  
ATOM 3436  C C    . PRO A 1 113 ? -19.149 -1.668  15.834  1.00 0.00 ? 113 PRO A C    2  
ATOM 3437  O O    . PRO A 1 113 ? -19.637 -2.070  16.889  1.00 0.00 ? 113 PRO A O    2  
ATOM 3438  C CB   . PRO A 1 113 ? -16.655 -1.248  16.113  1.00 0.00 ? 113 PRO A CB   2  
ATOM 3439  C CG   . PRO A 1 113 ? -16.175 -0.249  15.073  1.00 0.00 ? 113 PRO A CG   2  
ATOM 3440  C CD   . PRO A 1 113 ? -16.690 -0.704  13.717  1.00 0.00 ? 113 PRO A CD   2  
ATOM 3441  H HA   . PRO A 1 113 ? -17.651 -3.047  15.657  1.00 0.00 ? 113 PRO A HA   2  
ATOM 3442  H HB2  . PRO A 1 113 ? -17.054 -0.738  16.990  1.00 0.00 ? 113 PRO A HB2  2  
ATOM 3443  H HB3  . PRO A 1 113 ? -15.836 -1.879  16.456  1.00 0.00 ? 113 PRO A HB3  2  
ATOM 3444  H HG2  . PRO A 1 113 ? -16.543 0.750   15.305  1.00 0.00 ? 113 PRO A HG2  2  
ATOM 3445  H HG3  . PRO A 1 113 ? -15.087 -0.195  15.069  1.00 0.00 ? 113 PRO A HG3  2  
ATOM 3446  H HD2  . PRO A 1 113 ? -17.271 0.080   13.230  1.00 0.00 ? 113 PRO A HD2  2  
ATOM 3447  H HD3  . PRO A 1 113 ? -15.870 -0.956  13.046  1.00 0.00 ? 113 PRO A HD3  2  
ATOM 3448  N N    . SER A 1 114 ? -19.769 -0.873  14.975  1.00 0.00 ? 114 SER A N    2  
ATOM 3449  C CA   . SER A 1 114 ? -21.121 -0.405  15.229  1.00 0.00 ? 114 SER A CA   2  
ATOM 3450  C C    . SER A 1 114 ? -22.134 -1.448  14.755  1.00 0.00 ? 114 SER A C    2  
ATOM 3451  O O    . SER A 1 114 ? -22.615 -1.383  13.624  1.00 0.00 ? 114 SER A O    2  
ATOM 3452  C CB   . SER A 1 114 ? -21.378 0.937   14.540  1.00 0.00 ? 114 SER A CB   2  
ATOM 3453  O OG   . SER A 1 114 ? -21.126 2.039   15.407  1.00 0.00 ? 114 SER A OG   2  
ATOM 3454  H H    . SER A 1 114 ? -19.364 -0.551  14.119  1.00 0.00 ? 114 SER A H    2  
ATOM 3455  H HA   . SER A 1 114 ? -21.182 -0.276  16.310  1.00 0.00 ? 114 SER A HA   2  
ATOM 3456  H HB2  . SER A 1 114 ? -20.744 1.018   13.657  1.00 0.00 ? 114 SER A HB2  2  
ATOM 3457  H HB3  . SER A 1 114 ? -22.411 0.975   14.196  1.00 0.00 ? 114 SER A HB3  2  
ATOM 3458  H HG   . SER A 1 114 ? -21.134 1.734   16.360  1.00 0.00 ? 114 SER A HG   2  
ATOM 3459  N N    . GLY A 1 115 ? -22.429 -2.387  15.642  1.00 0.00 ? 115 GLY A N    2  
ATOM 3460  C CA   . GLY A 1 115 ? -23.376 -3.443  15.328  1.00 0.00 ? 115 GLY A CA   2  
ATOM 3461  C C    . GLY A 1 115 ? -24.367 -3.650  16.475  1.00 0.00 ? 115 GLY A C    2  
ATOM 3462  O O    . GLY A 1 115 ? -24.632 -2.728  17.245  1.00 0.00 ? 115 GLY A O    2  
ATOM 3463  H H    . GLY A 1 115 ? -22.033 -2.433  16.559  1.00 0.00 ? 115 GLY A H    2  
ATOM 3464  H HA2  . GLY A 1 115 ? -23.917 -3.191  14.416  1.00 0.00 ? 115 GLY A HA2  2  
ATOM 3465  H HA3  . GLY A 1 115 ? -22.840 -4.372  15.134  1.00 0.00 ? 115 GLY A HA3  2  
ATOM 3466  N N    . PRO A 1 116 ? -24.902 -4.898  16.555  1.00 0.00 ? 116 PRO A N    2  
ATOM 3467  C CA   . PRO A 1 116 ? -25.857 -5.237  17.595  1.00 0.00 ? 116 PRO A CA   2  
ATOM 3468  C C    . PRO A 1 116 ? -25.159 -5.412  18.945  1.00 0.00 ? 116 PRO A C    2  
ATOM 3469  O O    . PRO A 1 116 ? -23.932 -5.381  19.022  1.00 0.00 ? 116 PRO A O    2  
ATOM 3470  C CB   . PRO A 1 116 ? -26.535 -6.508  17.108  1.00 0.00 ? 116 PRO A CB   2  
ATOM 3471  C CG   . PRO A 1 116 ? -25.616 -7.088  16.044  1.00 0.00 ? 116 PRO A CG   2  
ATOM 3472  C CD   . PRO A 1 116 ? -24.611 -6.014  15.660  1.00 0.00 ? 116 PRO A CD   2  
ATOM 3473  H HA   . PRO A 1 116 ? -26.513 -4.492  17.721  1.00 0.00 ? 116 PRO A HA   2  
ATOM 3474  H HB2  . PRO A 1 116 ? -26.679 -7.212  17.927  1.00 0.00 ? 116 PRO A HB2  2  
ATOM 3475  H HB3  . PRO A 1 116 ? -27.521 -6.291  16.697  1.00 0.00 ? 116 PRO A HB3  2  
ATOM 3476  H HG2  . PRO A 1 116 ? -25.104 -7.972  16.424  1.00 0.00 ? 116 PRO A HG2  2  
ATOM 3477  H HG3  . PRO A 1 116 ? -26.191 -7.401  15.173  1.00 0.00 ? 116 PRO A HG3  2  
ATOM 3478  H HD2  . PRO A 1 116 ? -23.587 -6.367  15.787  1.00 0.00 ? 116 PRO A HD2  2  
ATOM 3479  H HD3  . PRO A 1 116 ? -24.722 -5.724  14.616  1.00 0.00 ? 116 PRO A HD3  2  
ATOM 3480  N N    . SER A 1 117 ? -25.972 -5.592  19.977  1.00 0.00 ? 117 SER A N    2  
ATOM 3481  C CA   . SER A 1 117 ? -25.448 -5.772  21.320  1.00 0.00 ? 117 SER A CA   2  
ATOM 3482  C C    . SER A 1 117 ? -26.290 -6.801  22.077  1.00 0.00 ? 117 SER A C    2  
ATOM 3483  O O    . SER A 1 117 ? -27.517 -6.786  21.994  1.00 0.00 ? 117 SER A O    2  
ATOM 3484  C CB   . SER A 1 117 ? -25.418 -4.446  22.082  1.00 0.00 ? 117 SER A CB   2  
ATOM 3485  O OG   . SER A 1 117 ? -26.713 -3.858  22.180  1.00 0.00 ? 117 SER A OG   2  
ATOM 3486  H H    . SER A 1 117 ? -26.969 -5.616  19.905  1.00 0.00 ? 117 SER A H    2  
ATOM 3487  H HA   . SER A 1 117 ? -24.429 -6.136  21.186  1.00 0.00 ? 117 SER A HA   2  
ATOM 3488  H HB2  . SER A 1 117 ? -25.019 -4.612  23.082  1.00 0.00 ? 117 SER A HB2  2  
ATOM 3489  H HB3  . SER A 1 117 ? -24.743 -3.754  21.580  1.00 0.00 ? 117 SER A HB3  2  
ATOM 3490  H HG   . SER A 1 117 ? -27.107 -4.046  23.079  1.00 0.00 ? 117 SER A HG   2  
ATOM 3491  N N    . SER A 1 118 ? -25.597 -7.671  22.797  1.00 0.00 ? 118 SER A N    2  
ATOM 3492  C CA   . SER A 1 118 ? -26.266 -8.705  23.568  1.00 0.00 ? 118 SER A CA   2  
ATOM 3493  C C    . SER A 1 118 ? -27.018 -9.653  22.631  1.00 0.00 ? 118 SER A C    2  
ATOM 3494  O O    . SER A 1 118 ? -27.641 -9.212  21.667  1.00 0.00 ? 118 SER A O    2  
ATOM 3495  C CB   . SER A 1 118 ? -27.228 -8.095  24.590  1.00 0.00 ? 118 SER A CB   2  
ATOM 3496  O OG   . SER A 1 118 ? -26.579 -7.151  25.436  1.00 0.00 ? 118 SER A OG   2  
ATOM 3497  H H    . SER A 1 118 ? -24.599 -7.677  22.859  1.00 0.00 ? 118 SER A H    2  
ATOM 3498  H HA   . SER A 1 118 ? -25.470 -9.236  24.091  1.00 0.00 ? 118 SER A HA   2  
ATOM 3499  H HB2  . SER A 1 118 ? -28.051 -7.608  24.067  1.00 0.00 ? 118 SER A HB2  2  
ATOM 3500  H HB3  . SER A 1 118 ? -27.662 -8.889  25.198  1.00 0.00 ? 118 SER A HB3  2  
ATOM 3501  H HG   . SER A 1 118 ? -26.320 -7.585  26.299  1.00 0.00 ? 118 SER A HG   2  
ATOM 3502  N N    . GLY A 1 119 ? -26.934 -10.937 22.948  1.00 0.00 ? 119 GLY A N    2  
ATOM 3503  C CA   . GLY A 1 119 ? -27.599 -11.950 22.146  1.00 0.00 ? 119 GLY A CA   2  
ATOM 3504  C C    . GLY A 1 119 ? -26.985 -12.032 20.747  1.00 0.00 ? 119 GLY A C    2  
ATOM 3505  O O    . GLY A 1 119 ? -26.274 -11.123 20.323  1.00 0.00 ? 119 GLY A O    2  
ATOM 3506  H H    . GLY A 1 119 ? -26.425 -11.286 23.734  1.00 0.00 ? 119 GLY A H    2  
ATOM 3507  H HA2  . GLY A 1 119 ? -27.519 -12.919 22.640  1.00 0.00 ? 119 GLY A HA2  2  
ATOM 3508  H HA3  . GLY A 1 119 ? -28.661 -11.718 22.068  1.00 0.00 ? 119 GLY A HA3  2  
ATOM 3509  N N    . GLY A 1 1   ? -5.315  -14.513 4.010   1.00 0.00 ? 1   GLY A N    3  
ATOM 3510  C CA   . GLY A 1 1   ? -3.980  -14.039 3.686   1.00 0.00 ? 1   GLY A CA   3  
ATOM 3511  C C    . GLY A 1 1   ? -3.910  -13.544 2.239   1.00 0.00 ? 1   GLY A C    3  
ATOM 3512  O O    . GLY A 1 1   ? -4.905  -13.069 1.694   1.00 0.00 ? 1   GLY A O    3  
ATOM 3513  H H1   . GLY A 1 1   ? -5.927  -14.620 3.227   1.00 0.00 ? 1   GLY A H1   3  
ATOM 3514  H HA2  . GLY A 1 1   ? -3.702  -13.233 4.364   1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3515  H HA3  . GLY A 1 1   ? -3.259  -14.843 3.834   1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3516  N N    . SER A 1 2   ? -2.726  -13.673 1.660   1.00 0.00 ? 2   SER A N    3  
ATOM 3517  C CA   . SER A 1 2   ? -2.513  -13.245 0.288   1.00 0.00 ? 2   SER A CA   3  
ATOM 3518  C C    . SER A 1 2   ? -1.369  -14.044 -0.338  1.00 0.00 ? 2   SER A C    3  
ATOM 3519  O O    . SER A 1 2   ? -0.303  -14.182 0.261   1.00 0.00 ? 2   SER A O    3  
ATOM 3520  C CB   . SER A 1 2   ? -2.215  -11.746 0.219   1.00 0.00 ? 2   SER A CB   3  
ATOM 3521  O OG   . SER A 1 2   ? -3.037  -11.081 -0.736  1.00 0.00 ? 2   SER A OG   3  
ATOM 3522  H H    . SER A 1 2   ? -1.922  -14.061 2.111   1.00 0.00 ? 2   SER A H    3  
ATOM 3523  H HA   . SER A 1 2   ? -3.451  -13.452 -0.227  1.00 0.00 ? 2   SER A HA   3  
ATOM 3524  H HB2  . SER A 1 2   ? -2.367  -11.300 1.202   1.00 0.00 ? 2   SER A HB2  3  
ATOM 3525  H HB3  . SER A 1 2   ? -1.166  -11.597 -0.039  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3526  H HG   . SER A 1 2   ? -3.084  -11.616 -1.579  1.00 0.00 ? 2   SER A HG   3  
ATOM 3527  N N    . SER A 1 3   ? -1.628  -14.549 -1.535  1.00 0.00 ? 3   SER A N    3  
ATOM 3528  C CA   . SER A 1 3   ? -0.632  -15.331 -2.249  1.00 0.00 ? 3   SER A CA   3  
ATOM 3529  C C    . SER A 1 3   ? -1.032  -15.470 -3.719  1.00 0.00 ? 3   SER A C    3  
ATOM 3530  O O    . SER A 1 3   ? -2.216  -15.433 -4.051  1.00 0.00 ? 3   SER A O    3  
ATOM 3531  C CB   . SER A 1 3   ? -0.457  -16.711 -1.614  1.00 0.00 ? 3   SER A CB   3  
ATOM 3532  O OG   . SER A 1 3   ? 0.113   -16.631 -0.310  1.00 0.00 ? 3   SER A OG   3  
ATOM 3533  H H    . SER A 1 3   ? -2.497  -14.432 -2.015  1.00 0.00 ? 3   SER A H    3  
ATOM 3534  H HA   . SER A 1 3   ? 0.297   -14.768 -2.157  1.00 0.00 ? 3   SER A HA   3  
ATOM 3535  H HB2  . SER A 1 3   ? -1.424  -17.210 -1.557  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3536  H HB3  . SER A 1 3   ? 0.181   -17.325 -2.250  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3537  H HG   . SER A 1 3   ? -0.593  -16.783 0.382   1.00 0.00 ? 3   SER A HG   3  
ATOM 3538  N N    . GLY A 1 4   ? -0.021  -15.626 -4.562  1.00 0.00 ? 4   GLY A N    3  
ATOM 3539  C CA   . GLY A 1 4   ? -0.253  -15.771 -5.989  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3540  C C    . GLY A 1 4   ? 0.854   -16.602 -6.642  1.00 0.00 ? 4   GLY A C    3  
ATOM 3541  O O    . GLY A 1 4   ? 1.969   -16.670 -6.128  1.00 0.00 ? 4   GLY A O    3  
ATOM 3542  H H    . GLY A 1 4   ? 0.939   -15.655 -4.284  1.00 0.00 ? 4   GLY A H    3  
ATOM 3543  H HA2  . GLY A 1 4   ? -1.218  -16.247 -6.158  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3544  H HA3  . GLY A 1 4   ? -0.296  -14.787 -6.456  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3545  N N    . SER A 1 5   ? 0.506   -17.213 -7.765  1.00 0.00 ? 5   SER A N    3  
ATOM 3546  C CA   . SER A 1 5   ? 1.455   -18.037 -8.494  1.00 0.00 ? 5   SER A CA   3  
ATOM 3547  C C    . SER A 1 5   ? 1.100   -18.053 -9.982  1.00 0.00 ? 5   SER A C    3  
ATOM 3548  O O    . SER A 1 5   ? 0.091   -18.636 -10.376 1.00 0.00 ? 5   SER A O    3  
ATOM 3549  C CB   . SER A 1 5   ? 1.486   -19.463 -7.940  1.00 0.00 ? 5   SER A CB   3  
ATOM 3550  O OG   . SER A 1 5   ? 2.459   -19.614 -6.909  1.00 0.00 ? 5   SER A OG   3  
ATOM 3551  H H    . SER A 1 5   ? -0.404  -17.152 -8.176  1.00 0.00 ? 5   SER A H    3  
ATOM 3552  H HA   . SER A 1 5   ? 2.426   -17.566 -8.337  1.00 0.00 ? 5   SER A HA   3  
ATOM 3553  H HB2  . SER A 1 5   ? 0.502   -19.722 -7.550  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3554  H HB3  . SER A 1 5   ? 1.703   -20.161 -8.748  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3555  H HG   . SER A 1 5   ? 3.361   -19.771 -7.311  1.00 0.00 ? 5   SER A HG   3  
ATOM 3556  N N    . SER A 1 6   ? 1.949   -17.407 -10.768 1.00 0.00 ? 6   SER A N    3  
ATOM 3557  C CA   . SER A 1 6   ? 1.737   -17.340 -12.204 1.00 0.00 ? 6   SER A CA   3  
ATOM 3558  C C    . SER A 1 6   ? 3.066   -17.525 -12.938 1.00 0.00 ? 6   SER A C    3  
ATOM 3559  O O    . SER A 1 6   ? 4.133   -17.421 -12.334 1.00 0.00 ? 6   SER A O    3  
ATOM 3560  C CB   . SER A 1 6   ? 1.090   -16.013 -12.603 1.00 0.00 ? 6   SER A CB   3  
ATOM 3561  O OG   . SER A 1 6   ? 1.792   -14.894 -12.069 1.00 0.00 ? 6   SER A OG   3  
ATOM 3562  H H    . SER A 1 6   ? 2.767   -16.936 -10.439 1.00 0.00 ? 6   SER A H    3  
ATOM 3563  H HA   . SER A 1 6   ? 1.056   -18.159 -12.433 1.00 0.00 ? 6   SER A HA   3  
ATOM 3564  H HB2  . SER A 1 6   ? 1.061   -15.937 -13.690 1.00 0.00 ? 6   SER A HB2  3  
ATOM 3565  H HB3  . SER A 1 6   ? 0.057   -15.993 -12.255 1.00 0.00 ? 6   SER A HB3  3  
ATOM 3566  H HG   . SER A 1 6   ? 1.311   -14.047 -12.296 1.00 0.00 ? 6   SER A HG   3  
ATOM 3567  N N    . GLY A 1 7   ? 2.959   -17.796 -14.230 1.00 0.00 ? 7   GLY A N    3  
ATOM 3568  C CA   . GLY A 1 7   ? 4.140   -17.996 -15.053 1.00 0.00 ? 7   GLY A CA   3  
ATOM 3569  C C    . GLY A 1 7   ? 3.902   -17.502 -16.482 1.00 0.00 ? 7   GLY A C    3  
ATOM 3570  O O    . GLY A 1 7   ? 3.413   -18.249 -17.328 1.00 0.00 ? 7   GLY A O    3  
ATOM 3571  H H    . GLY A 1 7   ? 2.088   -17.879 -14.714 1.00 0.00 ? 7   GLY A H    3  
ATOM 3572  H HA2  . GLY A 1 7   ? 4.986   -17.466 -14.617 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3573  H HA3  . GLY A 1 7   ? 4.401   -19.054 -15.069 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3574  N N    . PRO A 1 8   ? 4.270   -16.214 -16.713 1.00 0.00 ? 8   PRO A N    3  
ATOM 3575  C CA   . PRO A 1 8   ? 4.102   -15.611 -18.024 1.00 0.00 ? 8   PRO A CA   3  
ATOM 3576  C C    . PRO A 1 8   ? 5.160   -16.125 -19.003 1.00 0.00 ? 8   PRO A C    3  
ATOM 3577  O O    . PRO A 1 8   ? 5.985   -16.965 -18.647 1.00 0.00 ? 8   PRO A O    3  
ATOM 3578  C CB   . PRO A 1 8   ? 4.193   -14.113 -17.784 1.00 0.00 ? 8   PRO A CB   3  
ATOM 3579  C CG   . PRO A 1 8   ? 4.869   -13.948 -16.432 1.00 0.00 ? 8   PRO A CG   3  
ATOM 3580  C CD   . PRO A 1 8   ? 4.853   -15.299 -15.735 1.00 0.00 ? 8   PRO A CD   3  
ATOM 3581  H HA   . PRO A 1 8   ? 3.219   -15.871 -18.415 1.00 0.00 ? 8   PRO A HA   3  
ATOM 3582  H HB2  . PRO A 1 8   ? 4.769   -13.625 -18.570 1.00 0.00 ? 8   PRO A HB2  3  
ATOM 3583  H HB3  . PRO A 1 8   ? 3.203   -13.657 -17.784 1.00 0.00 ? 8   PRO A HB3  3  
ATOM 3584  H HG2  . PRO A 1 8   ? 5.892   -13.595 -16.557 1.00 0.00 ? 8   PRO A HG2  3  
ATOM 3585  H HG3  . PRO A 1 8   ? 4.345   -13.203 -15.832 1.00 0.00 ? 8   PRO A HG3  3  
ATOM 3586  H HD2  . PRO A 1 8   ? 5.858   -15.610 -15.452 1.00 0.00 ? 8   PRO A HD2  3  
ATOM 3587  H HD3  . PRO A 1 8   ? 4.260   -15.266 -14.821 1.00 0.00 ? 8   PRO A HD3  3  
ATOM 3588  N N    . GLN A 1 9   ? 5.103   -15.597 -20.217 1.00 0.00 ? 9   GLN A N    3  
ATOM 3589  C CA   . GLN A 1 9   ? 6.046   -15.992 -21.250 1.00 0.00 ? 9   GLN A CA   3  
ATOM 3590  C C    . GLN A 1 9   ? 7.458   -15.530 -20.884 1.00 0.00 ? 9   GLN A C    3  
ATOM 3591  O O    . GLN A 1 9   ? 7.651   -14.394 -20.454 1.00 0.00 ? 9   GLN A O    3  
ATOM 3592  C CB   . GLN A 1 9   ? 5.626   -15.443 -22.615 1.00 0.00 ? 9   GLN A CB   3  
ATOM 3593  C CG   . GLN A 1 9   ? 5.146   -16.567 -23.535 1.00 0.00 ? 9   GLN A CG   3  
ATOM 3594  C CD   . GLN A 1 9   ? 5.640   -16.353 -24.967 1.00 0.00 ? 9   GLN A CD   3  
ATOM 3595  O OE1  . GLN A 1 9   ? 6.721   -15.840 -25.208 1.00 0.00 ? 9   GLN A OE1  3  
ATOM 3596  N NE2  . GLN A 1 9   ? 4.792   -16.773 -25.901 1.00 0.00 ? 9   GLN A NE2  3  
ATOM 3597  H H    . GLN A 1 9   ? 4.429   -14.914 -20.499 1.00 0.00 ? 9   GLN A H    3  
ATOM 3598  H HA   . GLN A 1 9   ? 6.007   -17.081 -21.276 1.00 0.00 ? 9   GLN A HA   3  
ATOM 3599  H HB2  . GLN A 1 9   ? 4.830   -14.709 -22.486 1.00 0.00 ? 9   GLN A HB2  3  
ATOM 3600  H HB3  . GLN A 1 9   ? 6.466   -14.924 -23.076 1.00 0.00 ? 9   GLN A HB3  3  
ATOM 3601  H HG2  . GLN A 1 9   ? 5.506   -17.526 -23.161 1.00 0.00 ? 9   GLN A HG2  3  
ATOM 3602  H HG3  . GLN A 1 9   ? 4.057   -16.610 -23.525 1.00 0.00 ? 9   GLN A HG3  3  
ATOM 3603  H HE21 . GLN A 1 9   ? 3.921   -17.186 -25.635 1.00 0.00 ? 9   GLN A HE21 3  
ATOM 3604  H HE22 . GLN A 1 9   ? 5.025   -16.676 -26.868 1.00 0.00 ? 9   GLN A HE22 3  
ATOM 3605  N N    . LEU A 1 10  ? 8.408   -16.435 -21.067 1.00 0.00 ? 10  LEU A N    3  
ATOM 3606  C CA   . LEU A 1 10  ? 9.796   -16.135 -20.762 1.00 0.00 ? 10  LEU A CA   3  
ATOM 3607  C C    . LEU A 1 10  ? 10.189  -14.820 -21.436 1.00 0.00 ? 10  LEU A C    3  
ATOM 3608  O O    . LEU A 1 10  ? 9.873   -14.598 -22.604 1.00 0.00 ? 10  LEU A O    3  
ATOM 3609  C CB   . LEU A 1 10  ? 10.695  -17.314 -21.141 1.00 0.00 ? 10  LEU A CB   3  
ATOM 3610  C CG   . LEU A 1 10  ? 11.379  -18.038 -19.979 1.00 0.00 ? 10  LEU A CG   3  
ATOM 3611  C CD1  . LEU A 1 10  ? 10.867  -19.474 -19.851 1.00 0.00 ? 10  LEU A CD1  3  
ATOM 3612  C CD2  . LEU A 1 10  ? 12.901  -17.981 -20.118 1.00 0.00 ? 10  LEU A CD2  3  
ATOM 3613  H H    . LEU A 1 10  ? 8.242   -17.357 -21.417 1.00 0.00 ? 10  LEU A H    3  
ATOM 3614  H HA   . LEU A 1 10  ? 9.872   -16.006 -19.682 1.00 0.00 ? 10  LEU A HA   3  
ATOM 3615  H HB2  . LEU A 1 10  ? 10.097  -18.039 -21.693 1.00 0.00 ? 10  LEU A HB2  3  
ATOM 3616  H HB3  . LEU A 1 10  ? 11.466  -16.952 -21.822 1.00 0.00 ? 10  LEU A HB3  3  
ATOM 3617  H HG   . LEU A 1 10  ? 11.120  -17.520 -19.055 1.00 0.00 ? 10  LEU A HG   3  
ATOM 3618  H HD11 . LEU A 1 10  ? 10.028  -19.500 -19.156 1.00 0.00 ? 10  LEU A HD11 3  
ATOM 3619  H HD12 . LEU A 1 10  ? 10.541  -19.832 -20.828 1.00 0.00 ? 10  LEU A HD12 3  
ATOM 3620  H HD13 . LEU A 1 10  ? 11.668  -20.113 -19.479 1.00 0.00 ? 10  LEU A HD13 3  
ATOM 3621  H HD21 . LEU A 1 10  ? 13.291  -17.160 -19.517 1.00 0.00 ? 10  LEU A HD21 3  
ATOM 3622  H HD22 . LEU A 1 10  ? 13.332  -18.921 -19.772 1.00 0.00 ? 10  LEU A HD22 3  
ATOM 3623  H HD23 . LEU A 1 10  ? 13.165  -17.824 -21.163 1.00 0.00 ? 10  LEU A HD23 3  
ATOM 3624  N N    . VAL A 1 11  ? 10.874  -13.981 -20.672 1.00 0.00 ? 11  VAL A N    3  
ATOM 3625  C CA   . VAL A 1 11  ? 11.314  -12.693 -21.181 1.00 0.00 ? 11  VAL A CA   3  
ATOM 3626  C C    . VAL A 1 11  ? 12.461  -12.172 -20.314 1.00 0.00 ? 11  VAL A C    3  
ATOM 3627  O O    . VAL A 1 11  ? 12.434  -12.312 -19.092 1.00 0.00 ? 11  VAL A O    3  
ATOM 3628  C CB   . VAL A 1 11  ? 10.130  -11.726 -21.251 1.00 0.00 ? 11  VAL A CB   3  
ATOM 3629  C CG1  . VAL A 1 11  ? 9.544   -11.476 -19.860 1.00 0.00 ? 11  VAL A CG1  3  
ATOM 3630  C CG2  . VAL A 1 11  ? 10.535  -10.412 -21.920 1.00 0.00 ? 11  VAL A CG2  3  
ATOM 3631  H H    . VAL A 1 11  ? 11.127  -14.169 -19.723 1.00 0.00 ? 11  VAL A H    3  
ATOM 3632  H HA   . VAL A 1 11  ? 11.683  -12.849 -22.195 1.00 0.00 ? 11  VAL A HA   3  
ATOM 3633  H HB   . VAL A 1 11  ? 9.355   -12.189 -21.863 1.00 0.00 ? 11  VAL A HB   3  
ATOM 3634  H HG11 . VAL A 1 11  ? 8.460   -11.584 -19.898 1.00 0.00 ? 11  VAL A HG11 3  
ATOM 3635  H HG12 . VAL A 1 11  ? 9.956   -12.199 -19.156 1.00 0.00 ? 11  VAL A HG12 3  
ATOM 3636  H HG13 . VAL A 1 11  ? 9.797   -10.467 -19.535 1.00 0.00 ? 11  VAL A HG13 3  
ATOM 3637  H HG21 . VAL A 1 11  ? 11.064  -10.625 -22.849 1.00 0.00 ? 11  VAL A HG21 3  
ATOM 3638  H HG22 . VAL A 1 11  ? 9.643   -9.824  -22.136 1.00 0.00 ? 11  VAL A HG22 3  
ATOM 3639  H HG23 . VAL A 1 11  ? 11.187  -9.849  -21.252 1.00 0.00 ? 11  VAL A HG23 3  
ATOM 3640  N N    . ARG A 1 12  ? 13.442  -11.581 -20.980 1.00 0.00 ? 12  ARG A N    3  
ATOM 3641  C CA   . ARG A 1 12  ? 14.597  -11.038 -20.285 1.00 0.00 ? 12  ARG A CA   3  
ATOM 3642  C C    . ARG A 1 12  ? 14.683  -9.525  -20.499 1.00 0.00 ? 12  ARG A C    3  
ATOM 3643  O O    . ARG A 1 12  ? 15.022  -9.067  -21.589 1.00 0.00 ? 12  ARG A O    3  
ATOM 3644  C CB   . ARG A 1 12  ? 15.892  -11.689 -20.776 1.00 0.00 ? 12  ARG A CB   3  
ATOM 3645  C CG   . ARG A 1 12  ? 16.247  -12.911 -19.926 1.00 0.00 ? 12  ARG A CG   3  
ATOM 3646  C CD   . ARG A 1 12  ? 17.145  -13.877 -20.702 1.00 0.00 ? 12  ARG A CD   3  
ATOM 3647  N NE   . ARG A 1 12  ? 16.874  -15.269 -20.280 1.00 0.00 ? 12  ARG A NE   3  
ATOM 3648  C CZ   . ARG A 1 12  ? 17.703  -16.297 -20.505 1.00 0.00 ? 12  ARG A CZ   3  
ATOM 3649  N NH1  . ARG A 1 12  ? 18.861  -16.095 -21.148 1.00 0.00 ? 12  ARG A NH1  3  
ATOM 3650  N NH2  . ARG A 1 12  ? 17.375  -17.527 -20.086 1.00 0.00 ? 12  ARG A NH2  3  
ATOM 3651  H H    . ARG A 1 12  ? 13.457  -11.471 -21.974 1.00 0.00 ? 12  ARG A H    3  
ATOM 3652  H HA   . ARG A 1 12  ? 14.428  -11.276 -19.235 1.00 0.00 ? 12  ARG A HA   3  
ATOM 3653  H HB2  . ARG A 1 12  ? 15.781  -11.987 -21.818 1.00 0.00 ? 12  ARG A HB2  3  
ATOM 3654  H HB3  . ARG A 1 12  ? 16.705  -10.965 -20.736 1.00 0.00 ? 12  ARG A HB3  3  
ATOM 3655  H HG2  . ARG A 1 12  ? 16.754  -12.590 -19.016 1.00 0.00 ? 12  ARG A HG2  3  
ATOM 3656  H HG3  . ARG A 1 12  ? 15.335  -13.423 -19.619 1.00 0.00 ? 12  ARG A HG3  3  
ATOM 3657  H HD2  . ARG A 1 12  ? 16.966  -13.771 -21.772 1.00 0.00 ? 12  ARG A HD2  3  
ATOM 3658  H HD3  . ARG A 1 12  ? 18.192  -13.633 -20.528 1.00 0.00 ? 12  ARG A HD3  3  
ATOM 3659  H HE   . ARG A 1 12  ? 16.018  -15.454 -19.797 1.00 0.00 ? 12  ARG A HE   3  
ATOM 3660  H HH11 . ARG A 1 12  ? 19.106  -15.178 -21.461 1.00 0.00 ? 12  ARG A HH11 3  
ATOM 3661  H HH12 . ARG A 1 12  ? 19.480  -16.863 -21.316 1.00 0.00 ? 12  ARG A HH12 3  
ATOM 3662  H HH21 . ARG A 1 12  ? 16.511  -17.678 -19.606 1.00 0.00 ? 12  ARG A HH21 3  
ATOM 3663  H HH22 . ARG A 1 12  ? 17.994  -18.294 -20.254 1.00 0.00 ? 12  ARG A HH22 3  
ATOM 3664  N N    . THR A 1 13  ? 14.368  -8.792  -19.442 1.00 0.00 ? 13  THR A N    3  
ATOM 3665  C CA   . THR A 1 13  ? 14.405  -7.340  -19.500 1.00 0.00 ? 13  THR A CA   3  
ATOM 3666  C C    . THR A 1 13  ? 15.145  -6.776  -18.286 1.00 0.00 ? 13  THR A C    3  
ATOM 3667  O O    . THR A 1 13  ? 15.018  -7.298  -17.179 1.00 0.00 ? 13  THR A O    3  
ATOM 3668  C CB   . THR A 1 13  ? 12.966  -6.835  -19.624 1.00 0.00 ? 13  THR A CB   3  
ATOM 3669  O OG1  . THR A 1 13  ? 12.290  -7.443  -18.527 1.00 0.00 ? 13  THR A OG1  3  
ATOM 3670  C CG2  . THR A 1 13  ? 12.253  -7.394  -20.857 1.00 0.00 ? 13  THR A CG2  3  
ATOM 3671  H H    . THR A 1 13  ? 14.093  -9.172  -18.559 1.00 0.00 ? 13  THR A H    3  
ATOM 3672  H HA   . THR A 1 13  ? 14.971  -7.046  -20.384 1.00 0.00 ? 13  THR A HA   3  
ATOM 3673  H HB   . THR A 1 13  ? 12.934  -5.746  -19.615 1.00 0.00 ? 13  THR A HB   3  
ATOM 3674  H HG1  . THR A 1 13  ? 12.756  -7.220  -17.671 1.00 0.00 ? 13  THR A HG1  3  
ATOM 3675  H HG21 . THR A 1 13  ? 12.019  -6.578  -21.541 1.00 0.00 ? 13  THR A HG21 3  
ATOM 3676  H HG22 . THR A 1 13  ? 12.902  -8.113  -21.357 1.00 0.00 ? 13  THR A HG22 3  
ATOM 3677  H HG23 . THR A 1 13  ? 11.331  -7.888  -20.551 1.00 0.00 ? 13  THR A HG23 3  
ATOM 3678  N N    . HIS A 1 14  ? 15.902  -5.717  -18.533 1.00 0.00 ? 14  HIS A N    3  
ATOM 3679  C CA   . HIS A 1 14  ? 16.662  -5.076  -17.474 1.00 0.00 ? 14  HIS A CA   3  
ATOM 3680  C C    . HIS A 1 14  ? 15.748  -4.142  -16.679 1.00 0.00 ? 14  HIS A C    3  
ATOM 3681  O O    . HIS A 1 14  ? 14.572  -3.990  -17.007 1.00 0.00 ? 14  HIS A O    3  
ATOM 3682  C CB   . HIS A 1 14  ? 17.890  -4.362  -18.042 1.00 0.00 ? 14  HIS A CB   3  
ATOM 3683  C CG   . HIS A 1 14  ? 19.202  -5.025  -17.694 1.00 0.00 ? 14  HIS A CG   3  
ATOM 3684  N ND1  . HIS A 1 14  ? 19.435  -6.374  -17.892 1.00 0.00 ? 14  HIS A ND1  3  
ATOM 3685  C CD2  . HIS A 1 14  ? 20.346  -4.510  -17.160 1.00 0.00 ? 14  HIS A CD2  3  
ATOM 3686  C CE1  . HIS A 1 14  ? 20.668  -6.649  -17.491 1.00 0.00 ? 14  HIS A CE1  3  
ATOM 3687  N NE2  . HIS A 1 14  ? 21.231  -5.492  -17.037 1.00 0.00 ? 14  HIS A NE2  3  
ATOM 3688  H H    . HIS A 1 14  ? 15.999  -5.298  -19.436 1.00 0.00 ? 14  HIS A H    3  
ATOM 3689  H HA   . HIS A 1 14  ? 17.014  -5.871  -16.817 1.00 0.00 ? 14  HIS A HA   3  
ATOM 3690  H HB2  . HIS A 1 14  ? 17.798  -4.310  -19.127 1.00 0.00 ? 14  HIS A HB2  3  
ATOM 3691  H HB3  . HIS A 1 14  ? 17.904  -3.336  -17.673 1.00 0.00 ? 14  HIS A HB3  3  
ATOM 3692  H HD1  . HIS A 1 14  ? 18.784  -7.031  -18.273 1.00 0.00 ? 14  HIS A HD1  3  
ATOM 3693  H HD2  . HIS A 1 14  ? 20.507  -3.469  -16.882 1.00 0.00 ? 14  HIS A HD2  3  
ATOM 3694  H HE1  . HIS A 1 14  ? 21.148  -7.627  -17.519 1.00 0.00 ? 14  HIS A HE1  3  
ATOM 3695  N N    . GLU A 1 15  ? 16.323  -3.539  -15.648 1.00 0.00 ? 15  GLU A N    3  
ATOM 3696  C CA   . GLU A 1 15  ? 15.574  -2.624  -14.804 1.00 0.00 ? 15  GLU A CA   3  
ATOM 3697  C C    . GLU A 1 15  ? 16.507  -1.949  -13.796 1.00 0.00 ? 15  GLU A C    3  
ATOM 3698  O O    . GLU A 1 15  ? 17.501  -2.537  -13.374 1.00 0.00 ? 15  GLU A O    3  
ATOM 3699  C CB   . GLU A 1 15  ? 14.428  -3.346  -14.093 1.00 0.00 ? 15  GLU A CB   3  
ATOM 3700  C CG   . GLU A 1 15  ? 13.148  -3.301  -14.930 1.00 0.00 ? 15  GLU A CG   3  
ATOM 3701  C CD   . GLU A 1 15  ? 11.949  -2.888  -14.075 1.00 0.00 ? 15  GLU A CD   3  
ATOM 3702  O OE1  . GLU A 1 15  ? 11.704  -1.665  -13.994 1.00 0.00 ? 15  GLU A OE1  3  
ATOM 3703  O OE2  . GLU A 1 15  ? 11.303  -3.804  -13.522 1.00 0.00 ? 15  GLU A OE2  3  
ATOM 3704  H H    . GLU A 1 15  ? 17.279  -3.668  -15.388 1.00 0.00 ? 15  GLU A H    3  
ATOM 3705  H HA   . GLU A 1 15  ? 15.160  -1.878  -15.482 1.00 0.00 ? 15  GLU A HA   3  
ATOM 3706  H HB2  . GLU A 1 15  ? 14.708  -4.383  -13.905 1.00 0.00 ? 15  GLU A HB2  3  
ATOM 3707  H HB3  . GLU A 1 15  ? 14.249  -2.884  -13.122 1.00 0.00 ? 15  GLU A HB3  3  
ATOM 3708  H HG2  . GLU A 1 15  ? 13.273  -2.598  -15.753 1.00 0.00 ? 15  GLU A HG2  3  
ATOM 3709  H HG3  . GLU A 1 15  ? 12.964  -4.281  -15.372 1.00 0.00 ? 15  GLU A HG3  3  
ATOM 3710  N N    . ASP A 1 16  ? 16.152  -0.723  -13.439 1.00 0.00 ? 16  ASP A N    3  
ATOM 3711  C CA   . ASP A 1 16  ? 16.945  0.038   -12.489 1.00 0.00 ? 16  ASP A CA   3  
ATOM 3712  C C    . ASP A 1 16  ? 16.198  0.117   -11.156 1.00 0.00 ? 16  ASP A C    3  
ATOM 3713  O O    . ASP A 1 16  ? 16.725  -0.285  -10.120 1.00 0.00 ? 16  ASP A O    3  
ATOM 3714  C CB   . ASP A 1 16  ? 17.178  1.467   -12.985 1.00 0.00 ? 16  ASP A CB   3  
ATOM 3715  C CG   . ASP A 1 16  ? 18.359  2.192   -12.337 1.00 0.00 ? 16  ASP A CG   3  
ATOM 3716  O OD1  . ASP A 1 16  ? 18.434  2.152   -11.090 1.00 0.00 ? 16  ASP A OD1  3  
ATOM 3717  O OD2  . ASP A 1 16  ? 19.161  2.768   -13.103 1.00 0.00 ? 16  ASP A OD2  3  
ATOM 3718  H H    . ASP A 1 16  ? 15.342  -0.251  -13.787 1.00 0.00 ? 16  ASP A H    3  
ATOM 3719  H HA   . ASP A 1 16  ? 17.889  -0.500  -12.407 1.00 0.00 ? 16  ASP A HA   3  
ATOM 3720  H HB2  . ASP A 1 16  ? 17.335  1.439   -14.063 1.00 0.00 ? 16  ASP A HB2  3  
ATOM 3721  H HB3  . ASP A 1 16  ? 16.273  2.048   -12.809 1.00 0.00 ? 16  ASP A HB3  3  
ATOM 3722  N N    . VAL A 1 17  ? 14.982  0.637   -11.225 1.00 0.00 ? 17  VAL A N    3  
ATOM 3723  C CA   . VAL A 1 17  ? 14.157  0.774   -10.037 1.00 0.00 ? 17  VAL A CA   3  
ATOM 3724  C C    . VAL A 1 17  ? 14.257  -0.505  -9.202  1.00 0.00 ? 17  VAL A C    3  
ATOM 3725  O O    . VAL A 1 17  ? 14.729  -1.532  -9.688  1.00 0.00 ? 17  VAL A O    3  
ATOM 3726  C CB   . VAL A 1 17  ? 12.720  1.118   -10.434 1.00 0.00 ? 17  VAL A CB   3  
ATOM 3727  C CG1  . VAL A 1 17  ? 12.561  2.621   -10.670 1.00 0.00 ? 17  VAL A CG1  3  
ATOM 3728  C CG2  . VAL A 1 17  ? 12.286  0.321   -11.666 1.00 0.00 ? 17  VAL A CG2  3  
ATOM 3729  H H    . VAL A 1 17  ? 14.560  0.962   -12.072 1.00 0.00 ? 17  VAL A H    3  
ATOM 3730  H HA   . VAL A 1 17  ? 14.554  1.605   -9.455  1.00 0.00 ? 17  VAL A HA   3  
ATOM 3731  H HB   . VAL A 1 17  ? 12.067  0.837   -9.607  1.00 0.00 ? 17  VAL A HB   3  
ATOM 3732  H HG11 . VAL A 1 17  ? 11.656  2.804   -11.249 1.00 0.00 ? 17  VAL A HG11 3  
ATOM 3733  H HG12 . VAL A 1 17  ? 12.487  3.133   -9.710  1.00 0.00 ? 17  VAL A HG12 3  
ATOM 3734  H HG13 . VAL A 1 17  ? 13.425  2.996   -11.217 1.00 0.00 ? 17  VAL A HG13 3  
ATOM 3735  H HG21 . VAL A 1 17  ? 12.693  0.787   -12.563 1.00 0.00 ? 17  VAL A HG21 3  
ATOM 3736  H HG22 . VAL A 1 17  ? 12.658  -0.701  -11.587 1.00 0.00 ? 17  VAL A HG22 3  
ATOM 3737  H HG23 . VAL A 1 17  ? 11.197  0.307   -11.725 1.00 0.00 ? 17  VAL A HG23 3  
ATOM 3738  N N    . PRO A 1 18  ? 13.793  -0.397  -7.928  1.00 0.00 ? 18  PRO A N    3  
ATOM 3739  C CA   . PRO A 1 18  ? 13.826  -1.532  -7.022  1.00 0.00 ? 18  PRO A CA   3  
ATOM 3740  C C    . PRO A 1 18  ? 12.733  -2.544  -7.371  1.00 0.00 ? 18  PRO A C    3  
ATOM 3741  O O    . PRO A 1 18  ? 11.977  -2.344  -8.320  1.00 0.00 ? 18  PRO A O    3  
ATOM 3742  C CB   . PRO A 1 18  ? 13.659  -0.933  -5.635  1.00 0.00 ? 18  PRO A CB   3  
ATOM 3743  C CG   . PRO A 1 18  ? 13.077  0.455   -5.848  1.00 0.00 ? 18  PRO A CG   3  
ATOM 3744  C CD   . PRO A 1 18  ? 13.228  0.803   -7.319  1.00 0.00 ? 18  PRO A CD   3  
ATOM 3745  H HA   . PRO A 1 18  ? 14.692  -2.023  -7.112  1.00 0.00 ? 18  PRO A HA   3  
ATOM 3746  H HB2  . PRO A 1 18  ? 12.998  -1.545  -5.022  1.00 0.00 ? 18  PRO A HB2  3  
ATOM 3747  H HB3  . PRO A 1 18  ? 14.616  -0.879  -5.115  1.00 0.00 ? 18  PRO A HB3  3  
ATOM 3748  H HG2  . PRO A 1 18  ? 12.026  0.476   -5.556  1.00 0.00 ? 18  PRO A HG2  3  
ATOM 3749  H HG3  . PRO A 1 18  ? 13.595  1.186   -5.227  1.00 0.00 ? 18  PRO A HG3  3  
ATOM 3750  H HD2  . PRO A 1 18  ? 12.267  1.059   -7.767  1.00 0.00 ? 18  PRO A HD2  3  
ATOM 3751  H HD3  . PRO A 1 18  ? 13.883  1.663   -7.457  1.00 0.00 ? 18  PRO A HD3  3  
ATOM 3752  N N    . GLY A 1 19  ? 12.684  -3.609  -6.584  1.00 0.00 ? 19  GLY A N    3  
ATOM 3753  C CA   . GLY A 1 19  ? 11.696  -4.653  -6.798  1.00 0.00 ? 19  GLY A CA   3  
ATOM 3754  C C    . GLY A 1 19  ? 10.555  -4.543  -5.786  1.00 0.00 ? 19  GLY A C    3  
ATOM 3755  O O    . GLY A 1 19  ? 10.245  -3.452  -5.309  1.00 0.00 ? 19  GLY A O    3  
ATOM 3756  H H    . GLY A 1 19  ? 13.303  -3.764  -5.814  1.00 0.00 ? 19  GLY A H    3  
ATOM 3757  H HA2  . GLY A 1 19  ? 11.298  -4.580  -7.810  1.00 0.00 ? 19  GLY A HA2  3  
ATOM 3758  H HA3  . GLY A 1 19  ? 12.171  -5.631  -6.712  1.00 0.00 ? 19  GLY A HA3  3  
ATOM 3759  N N    . PRO A 1 20  ? 9.943   -5.719  -5.479  1.00 0.00 ? 20  PRO A N    3  
ATOM 3760  C CA   . PRO A 1 20  ? 8.842   -5.765  -4.532  1.00 0.00 ? 20  PRO A CA   3  
ATOM 3761  C C    . PRO A 1 20  ? 9.348   -5.613  -3.096  1.00 0.00 ? 20  PRO A C    3  
ATOM 3762  O O    . PRO A 1 20  ? 10.284  -6.299  -2.688  1.00 0.00 ? 20  PRO A O    3  
ATOM 3763  C CB   . PRO A 1 20  ? 8.162   -7.101  -4.785  1.00 0.00 ? 20  PRO A CB   3  
ATOM 3764  C CG   . PRO A 1 20  ? 9.176   -7.950  -5.534  1.00 0.00 ? 20  PRO A CG   3  
ATOM 3765  C CD   . PRO A 1 20  ? 10.283  -7.030  -6.024  1.00 0.00 ? 20  PRO A CD   3  
ATOM 3766  H HA   . PRO A 1 20  ? 8.220   -4.997  -4.685  1.00 0.00 ? 20  PRO A HA   3  
ATOM 3767  H HB2  . PRO A 1 20  ? 7.873   -7.575  -3.847  1.00 0.00 ? 20  PRO A HB2  3  
ATOM 3768  H HB3  . PRO A 1 20  ? 7.252   -6.971  -5.370  1.00 0.00 ? 20  PRO A HB3  3  
ATOM 3769  H HG2  . PRO A 1 20  ? 9.582   -8.723  -4.883  1.00 0.00 ? 20  PRO A HG2  3  
ATOM 3770  H HG3  . PRO A 1 20  ? 8.702   -8.458  -6.374  1.00 0.00 ? 20  PRO A HG3  3  
ATOM 3771  H HD2  . PRO A 1 20  ? 11.259  -7.364  -5.673  1.00 0.00 ? 20  PRO A HD2  3  
ATOM 3772  H HD3  . PRO A 1 20  ? 10.326  -7.008  -7.113  1.00 0.00 ? 20  PRO A HD3  3  
ATOM 3773  N N    . VAL A 1 21  ? 8.705   -4.712  -2.369  1.00 0.00 ? 21  VAL A N    3  
ATOM 3774  C CA   . VAL A 1 21  ? 9.078   -4.461  -0.987  1.00 0.00 ? 21  VAL A CA   3  
ATOM 3775  C C    . VAL A 1 21  ? 9.013   -5.772  -0.200  1.00 0.00 ? 21  VAL A C    3  
ATOM 3776  O O    . VAL A 1 21  ? 8.806   -6.838  -0.779  1.00 0.00 ? 21  VAL A O    3  
ATOM 3777  C CB   . VAL A 1 21  ? 8.189   -3.365  -0.395  1.00 0.00 ? 21  VAL A CB   3  
ATOM 3778  C CG1  . VAL A 1 21  ? 8.685   -1.977  -0.804  1.00 0.00 ? 21  VAL A CG1  3  
ATOM 3779  C CG2  . VAL A 1 21  ? 6.727   -3.566  -0.800  1.00 0.00 ? 21  VAL A CG2  3  
ATOM 3780  H H    . VAL A 1 21  ? 7.944   -4.158  -2.708  1.00 0.00 ? 21  VAL A H    3  
ATOM 3781  H HA   . VAL A 1 21  ? 10.106  -4.100  -0.983  1.00 0.00 ? 21  VAL A HA   3  
ATOM 3782  H HB   . VAL A 1 21  ? 8.248   -3.435  0.691   1.00 0.00 ? 21  VAL A HB   3  
ATOM 3783  H HG11 . VAL A 1 21  ? 8.089   -1.215  -0.302  1.00 0.00 ? 21  VAL A HG11 3  
ATOM 3784  H HG12 . VAL A 1 21  ? 9.731   -1.866  -0.518  1.00 0.00 ? 21  VAL A HG12 3  
ATOM 3785  H HG13 . VAL A 1 21  ? 8.589   -1.860  -1.884  1.00 0.00 ? 21  VAL A HG13 3  
ATOM 3786  H HG21 . VAL A 1 21  ? 6.423   -2.764  -1.472  1.00 0.00 ? 21  VAL A HG21 3  
ATOM 3787  H HG22 . VAL A 1 21  ? 6.620   -4.525  -1.308  1.00 0.00 ? 21  VAL A HG22 3  
ATOM 3788  H HG23 . VAL A 1 21  ? 6.098   -3.554  0.090   1.00 0.00 ? 21  VAL A HG23 3  
ATOM 3789  N N    . GLY A 1 22  ? 9.195   -5.651  1.107   1.00 0.00 ? 22  GLY A N    3  
ATOM 3790  C CA   . GLY A 1 22  ? 9.160   -6.813  1.978   1.00 0.00 ? 22  GLY A CA   3  
ATOM 3791  C C    . GLY A 1 22  ? 7.802   -7.513  1.904   1.00 0.00 ? 22  GLY A C    3  
ATOM 3792  O O    . GLY A 1 22  ? 7.207   -7.610  0.832   1.00 0.00 ? 22  GLY A O    3  
ATOM 3793  H H    . GLY A 1 22  ? 9.363   -4.780  1.569   1.00 0.00 ? 22  GLY A H    3  
ATOM 3794  H HA2  . GLY A 1 22  ? 9.949   -7.509  1.693   1.00 0.00 ? 22  GLY A HA2  3  
ATOM 3795  H HA3  . GLY A 1 22  ? 9.360   -6.507  3.005   1.00 0.00 ? 22  GLY A HA3  3  
ATOM 3796  N N    . HIS A 1 23  ? 7.351   -7.983  3.058   1.00 0.00 ? 23  HIS A N    3  
ATOM 3797  C CA   . HIS A 1 23  ? 6.074   -8.672  3.137   1.00 0.00 ? 23  HIS A CA   3  
ATOM 3798  C C    . HIS A 1 23  ? 5.019   -7.731  3.723   1.00 0.00 ? 23  HIS A C    3  
ATOM 3799  O O    . HIS A 1 23  ? 5.031   -7.446  4.919   1.00 0.00 ? 23  HIS A O    3  
ATOM 3800  C CB   . HIS A 1 23  ? 6.208   -9.976  3.926   1.00 0.00 ? 23  HIS A CB   3  
ATOM 3801  C CG   . HIS A 1 23  ? 7.618   -10.512 3.990   1.00 0.00 ? 23  HIS A CG   3  
ATOM 3802  N ND1  . HIS A 1 23  ? 7.999   -11.694 3.379   1.00 0.00 ? 23  HIS A ND1  3  
ATOM 3803  C CD2  . HIS A 1 23  ? 8.733   -10.016 4.598   1.00 0.00 ? 23  HIS A CD2  3  
ATOM 3804  C CE1  . HIS A 1 23  ? 9.288   -11.891 3.616   1.00 0.00 ? 23  HIS A CE1  3  
ATOM 3805  N NE2  . HIS A 1 23  ? 9.741   -10.850 4.372   1.00 0.00 ? 23  HIS A NE2  3  
ATOM 3806  H H    . HIS A 1 23  ? 7.841   -7.900  3.926   1.00 0.00 ? 23  HIS A H    3  
ATOM 3807  H HA   . HIS A 1 23  ? 5.792   -8.928  2.116   1.00 0.00 ? 23  HIS A HA   3  
ATOM 3808  H HB2  . HIS A 1 23  ? 5.845   -9.814  4.941   1.00 0.00 ? 23  HIS A HB2  3  
ATOM 3809  H HB3  . HIS A 1 23  ? 5.563   -10.730 3.474   1.00 0.00 ? 23  HIS A HB3  3  
ATOM 3810  H HD1  . HIS A 1 23  ? 7.403   -12.298 2.849   1.00 0.00 ? 23  HIS A HD1  3  
ATOM 3811  H HD2  . HIS A 1 23  ? 8.788   -9.091  5.172   1.00 0.00 ? 23  HIS A HD2  3  
ATOM 3812  H HE1  . HIS A 1 23  ? 9.881   -12.736 3.268   1.00 0.00 ? 23  HIS A HE1  3  
ATOM 3813  N N    . LEU A 1 24  ? 4.131   -7.274  2.852   1.00 0.00 ? 24  LEU A N    3  
ATOM 3814  C CA   . LEU A 1 24  ? 3.071   -6.371  3.268   1.00 0.00 ? 24  LEU A CA   3  
ATOM 3815  C C    . LEU A 1 24  ? 2.339   -6.971  4.470   1.00 0.00 ? 24  LEU A C    3  
ATOM 3816  O O    . LEU A 1 24  ? 2.245   -8.190  4.599   1.00 0.00 ? 24  LEU A O    3  
ATOM 3817  C CB   . LEU A 1 24  ? 2.152   -6.045  2.089   1.00 0.00 ? 24  LEU A CB   3  
ATOM 3818  C CG   . LEU A 1 24  ? 2.195   -4.600  1.585   1.00 0.00 ? 24  LEU A CG   3  
ATOM 3819  C CD1  . LEU A 1 24  ? 3.291   -4.419  0.534   1.00 0.00 ? 24  LEU A CD1  3  
ATOM 3820  C CD2  . LEU A 1 24  ? 0.825   -4.160  1.067   1.00 0.00 ? 24  LEU A CD2  3  
ATOM 3821  H H    . LEU A 1 24  ? 4.127   -7.511  1.880   1.00 0.00 ? 24  LEU A H    3  
ATOM 3822  H HA   . LEU A 1 24  ? 3.540   -5.438  3.579   1.00 0.00 ? 24  LEU A HA   3  
ATOM 3823  H HB2  . LEU A 1 24  ? 2.408   -6.705  1.260   1.00 0.00 ? 24  LEU A HB2  3  
ATOM 3824  H HB3  . LEU A 1 24  ? 1.127   -6.278  2.377   1.00 0.00 ? 24  LEU A HB3  3  
ATOM 3825  H HG   . LEU A 1 24  ? 2.445   -3.953  2.425   1.00 0.00 ? 24  LEU A HG   3  
ATOM 3826  H HD11 . LEU A 1 24  ? 3.841   -5.353  0.417   1.00 0.00 ? 24  LEU A HD11 3  
ATOM 3827  H HD12 . LEU A 1 24  ? 2.839   -4.142  -0.419  1.00 0.00 ? 24  LEU A HD12 3  
ATOM 3828  H HD13 . LEU A 1 24  ? 3.975   -3.632  0.853   1.00 0.00 ? 24  LEU A HD13 3  
ATOM 3829  H HD21 . LEU A 1 24  ? 0.784   -3.071  1.028   1.00 0.00 ? 24  LEU A HD21 3  
ATOM 3830  H HD22 . LEU A 1 24  ? 0.667   -4.565  0.067   1.00 0.00 ? 24  LEU A HD22 3  
ATOM 3831  H HD23 . LEU A 1 24  ? 0.047   -4.529  1.735   1.00 0.00 ? 24  LEU A HD23 3  
ATOM 3832  N N    . SER A 1 25  ? 1.838   -6.085  5.319   1.00 0.00 ? 25  SER A N    3  
ATOM 3833  C CA   . SER A 1 25  ? 1.117   -6.511  6.507   1.00 0.00 ? 25  SER A CA   3  
ATOM 3834  C C    . SER A 1 25  ? -0.039  -5.550  6.790   1.00 0.00 ? 25  SER A C    3  
ATOM 3835  O O    . SER A 1 25  ? 0.019   -4.378  6.421   1.00 0.00 ? 25  SER A O    3  
ATOM 3836  C CB   . SER A 1 25  ? 2.049   -6.592  7.718   1.00 0.00 ? 25  SER A CB   3  
ATOM 3837  O OG   . SER A 1 25  ? 1.589   -7.533  8.684   1.00 0.00 ? 25  SER A OG   3  
ATOM 3838  H H    . SER A 1 25  ? 1.919   -5.095  5.207   1.00 0.00 ? 25  SER A H    3  
ATOM 3839  H HA   . SER A 1 25  ? 0.739   -7.507  6.273   1.00 0.00 ? 25  SER A HA   3  
ATOM 3840  H HB2  . SER A 1 25  ? 3.050   -6.872  7.387   1.00 0.00 ? 25  SER A HB2  3  
ATOM 3841  H HB3  . SER A 1 25  ? 2.130   -5.608  8.179   1.00 0.00 ? 25  SER A HB3  3  
ATOM 3842  H HG   . SER A 1 25  ? 2.211   -8.314  8.724   1.00 0.00 ? 25  SER A HG   3  
ATOM 3843  N N    . PHE A 1 26  ? -1.062  -6.083  7.442   1.00 0.00 ? 26  PHE A N    3  
ATOM 3844  C CA   . PHE A 1 26  ? -2.230  -5.287  7.779   1.00 0.00 ? 26  PHE A CA   3  
ATOM 3845  C C    . PHE A 1 26  ? -2.652  -5.520  9.231   1.00 0.00 ? 26  PHE A C    3  
ATOM 3846  O O    . PHE A 1 26  ? -2.881  -6.657  9.640   1.00 0.00 ? 26  PHE A O    3  
ATOM 3847  C CB   . PHE A 1 26  ? -3.361  -5.738  6.853   1.00 0.00 ? 26  PHE A CB   3  
ATOM 3848  C CG   . PHE A 1 26  ? -3.079  -5.506  5.367   1.00 0.00 ? 26  PHE A CG   3  
ATOM 3849  C CD1  . PHE A 1 26  ? -2.354  -4.425  4.973   1.00 0.00 ? 26  PHE A CD1  3  
ATOM 3850  C CD2  . PHE A 1 26  ? -3.554  -6.380  4.440   1.00 0.00 ? 26  PHE A CD2  3  
ATOM 3851  C CE1  . PHE A 1 26  ? -2.092  -4.209  3.594   1.00 0.00 ? 26  PHE A CE1  3  
ATOM 3852  C CE2  . PHE A 1 26  ? -3.293  -6.165  3.061   1.00 0.00 ? 26  PHE A CE2  3  
ATOM 3853  C CZ   . PHE A 1 26  ? -2.567  -5.084  2.667   1.00 0.00 ? 26  PHE A CZ   3  
ATOM 3854  H H    . PHE A 1 26  ? -1.101  -7.037  7.738   1.00 0.00 ? 26  PHE A H    3  
ATOM 3855  H HA   . PHE A 1 26  ? -1.958  -4.240  7.645   1.00 0.00 ? 26  PHE A HA   3  
ATOM 3856  H HB2  . PHE A 1 26  ? -3.548  -6.800  7.015   1.00 0.00 ? 26  PHE A HB2  3  
ATOM 3857  H HB3  . PHE A 1 26  ? -4.274  -5.209  7.126   1.00 0.00 ? 26  PHE A HB3  3  
ATOM 3858  H HD1  . PHE A 1 26  ? -1.973  -3.724  5.716   1.00 0.00 ? 26  PHE A HD1  3  
ATOM 3859  H HD2  . PHE A 1 26  ? -4.136  -7.247  4.755   1.00 0.00 ? 26  PHE A HD2  3  
ATOM 3860  H HE1  . PHE A 1 26  ? -1.511  -3.343  3.279   1.00 0.00 ? 26  PHE A HE1  3  
ATOM 3861  H HE2  . PHE A 1 26  ? -3.673  -6.866  2.318   1.00 0.00 ? 26  PHE A HE2  3  
ATOM 3862  H HZ   . PHE A 1 26  ? -2.367  -4.918  1.609   1.00 0.00 ? 26  PHE A HZ   3  
ATOM 3863  N N    . SER A 1 27  ? -2.743  -4.424  9.970   1.00 0.00 ? 27  SER A N    3  
ATOM 3864  C CA   . SER A 1 27  ? -3.133  -4.495  11.368  1.00 0.00 ? 27  SER A CA   3  
ATOM 3865  C C    . SER A 1 27  ? -4.190  -3.430  11.671  1.00 0.00 ? 27  SER A C    3  
ATOM 3866  O O    . SER A 1 27  ? -4.521  -2.616  10.810  1.00 0.00 ? 27  SER A O    3  
ATOM 3867  C CB   . SER A 1 27  ? -1.923  -4.318  12.288  1.00 0.00 ? 27  SER A CB   3  
ATOM 3868  O OG   . SER A 1 27  ? -1.490  -2.961  12.344  1.00 0.00 ? 27  SER A OG   3  
ATOM 3869  H H    . SER A 1 27  ? -2.555  -3.503  9.630   1.00 0.00 ? 27  SER A H    3  
ATOM 3870  H HA   . SER A 1 27  ? -3.548  -5.494  11.502  1.00 0.00 ? 27  SER A HA   3  
ATOM 3871  H HB2  . SER A 1 27  ? -2.178  -4.659  13.291  1.00 0.00 ? 27  SER A HB2  3  
ATOM 3872  H HB3  . SER A 1 27  ? -1.105  -4.946  11.935  1.00 0.00 ? 27  SER A HB3  3  
ATOM 3873  H HG   . SER A 1 27  ? -1.340  -2.690  13.295  1.00 0.00 ? 27  SER A HG   3  
ATOM 3874  N N    . GLU A 1 28  ? -4.691  -3.471  12.897  1.00 0.00 ? 28  GLU A N    3  
ATOM 3875  C CA   . GLU A 1 28  ? -5.703  -2.520  13.323  1.00 0.00 ? 28  GLU A CA   3  
ATOM 3876  C C    . GLU A 1 28  ? -6.705  -2.270  12.195  1.00 0.00 ? 28  GLU A C    3  
ATOM 3877  O O    . GLU A 1 28  ? -6.913  -1.128  11.786  1.00 0.00 ? 28  GLU A O    3  
ATOM 3878  C CB   . GLU A 1 28  ? -5.064  -1.210  13.789  1.00 0.00 ? 28  GLU A CB   3  
ATOM 3879  C CG   . GLU A 1 28  ? -4.271  -1.417  15.082  1.00 0.00 ? 28  GLU A CG   3  
ATOM 3880  C CD   . GLU A 1 28  ? -4.843  -0.565  16.217  1.00 0.00 ? 28  GLU A CD   3  
ATOM 3881  O OE1  . GLU A 1 28  ? -5.956  -0.905  16.675  1.00 0.00 ? 28  GLU A OE1  3  
ATOM 3882  O OE2  . GLU A 1 28  ? -4.155  0.405   16.602  1.00 0.00 ? 28  GLU A OE2  3  
ATOM 3883  H H    . GLU A 1 28  ? -4.416  -4.136  13.591  1.00 0.00 ? 28  GLU A H    3  
ATOM 3884  H HA   . GLU A 1 28  ? -6.206  -2.992  14.167  1.00 0.00 ? 28  GLU A HA   3  
ATOM 3885  H HB2  . GLU A 1 28  ? -4.404  -0.827  13.011  1.00 0.00 ? 28  GLU A HB2  3  
ATOM 3886  H HB3  . GLU A 1 28  ? -5.838  -0.460  13.949  1.00 0.00 ? 28  GLU A HB3  3  
ATOM 3887  H HG2  . GLU A 1 28  ? -4.296  -2.469  15.364  1.00 0.00 ? 28  GLU A HG2  3  
ATOM 3888  H HG3  . GLU A 1 28  ? -3.226  -1.155  14.917  1.00 0.00 ? 28  GLU A HG3  3  
ATOM 3889  N N    . ILE A 1 29  ? -7.301  -3.355  11.723  1.00 0.00 ? 29  ILE A N    3  
ATOM 3890  C CA   . ILE A 1 29  ? -8.276  -3.268  10.650  1.00 0.00 ? 29  ILE A CA   3  
ATOM 3891  C C    . ILE A 1 29  ? -9.671  -3.077  11.249  1.00 0.00 ? 29  ILE A C    3  
ATOM 3892  O O    . ILE A 1 29  ? -10.042 -3.765  12.199  1.00 0.00 ? 29  ILE A O    3  
ATOM 3893  C CB   . ILE A 1 29  ? -8.165  -4.481  9.725   1.00 0.00 ? 29  ILE A CB   3  
ATOM 3894  C CG1  . ILE A 1 29  ? -6.705  -4.764  9.365   1.00 0.00 ? 29  ILE A CG1  3  
ATOM 3895  C CG2  . ILE A 1 29  ? -9.038  -4.304  8.481   1.00 0.00 ? 29  ILE A CG2  3  
ATOM 3896  C CD1  . ILE A 1 29  ? -6.605  -5.541  8.051   1.00 0.00 ? 29  ILE A CD1  3  
ATOM 3897  H H    . ILE A 1 29  ? -7.126  -4.280  12.062  1.00 0.00 ? 29  ILE A H    3  
ATOM 3898  H HA   . ILE A 1 29  ? -8.031  -2.387  10.057  1.00 0.00 ? 29  ILE A HA   3  
ATOM 3899  H HB   . ILE A 1 29  ? -8.540  -5.354  10.259  1.00 0.00 ? 29  ILE A HB   3  
ATOM 3900  H HG12 . ILE A 1 29  ? -6.159  -3.825  9.280   1.00 0.00 ? 29  ILE A HG12 3  
ATOM 3901  H HG13 . ILE A 1 29  ? -6.234  -5.335  10.165  1.00 0.00 ? 29  ILE A HG13 3  
ATOM 3902  H HG21 . ILE A 1 29  ? -8.464  -3.799  7.704   1.00 0.00 ? 29  ILE A HG21 3  
ATOM 3903  H HG22 . ILE A 1 29  ? -9.358  -5.281  8.119   1.00 0.00 ? 29  ILE A HG22 3  
ATOM 3904  H HG23 . ILE A 1 29  ? -9.913  -3.705  8.733   1.00 0.00 ? 29  ILE A HG23 3  
ATOM 3905  H HD11 . ILE A 1 29  ? -6.456  -4.843  7.227   1.00 0.00 ? 29  ILE A HD11 3  
ATOM 3906  H HD12 . ILE A 1 29  ? -5.762  -6.231  8.099   1.00 0.00 ? 29  ILE A HD12 3  
ATOM 3907  H HD13 . ILE A 1 29  ? -7.525  -6.102  7.889   1.00 0.00 ? 29  ILE A HD13 3  
ATOM 3908  N N    . LEU A 1 30  ? -10.406 -2.140  10.669  1.00 0.00 ? 30  LEU A N    3  
ATOM 3909  C CA   . LEU A 1 30  ? -11.752 -1.850  11.134  1.00 0.00 ? 30  LEU A CA   3  
ATOM 3910  C C    . LEU A 1 30  ? -12.755 -2.209  10.035  1.00 0.00 ? 30  LEU A C    3  
ATOM 3911  O O    . LEU A 1 30  ? -12.807 -3.353  9.588   1.00 0.00 ? 30  LEU A O    3  
ATOM 3912  C CB   . LEU A 1 30  ? -11.854 -0.399  11.609  1.00 0.00 ? 30  LEU A CB   3  
ATOM 3913  C CG   . LEU A 1 30  ? -11.046 -0.044  12.859  1.00 0.00 ? 30  LEU A CG   3  
ATOM 3914  C CD1  . LEU A 1 30  ? -11.390 -0.982  14.018  1.00 0.00 ? 30  LEU A CD1  3  
ATOM 3915  C CD2  . LEU A 1 30  ? -9.547  -0.031  12.558  1.00 0.00 ? 30  LEU A CD2  3  
ATOM 3916  H H    . LEU A 1 30  ? -10.097 -1.585  9.897   1.00 0.00 ? 30  LEU A H    3  
ATOM 3917  H HA   . LEU A 1 30  ? -11.943 -2.486  11.998  1.00 0.00 ? 30  LEU A HA   3  
ATOM 3918  H HB2  . LEU A 1 30  ? -11.532 0.252   10.796  1.00 0.00 ? 30  LEU A HB2  3  
ATOM 3919  H HB3  . LEU A 1 30  ? -12.903 -0.173  11.802  1.00 0.00 ? 30  LEU A HB3  3  
ATOM 3920  H HG   . LEU A 1 30  ? -11.322 0.964   13.169  1.00 0.00 ? 30  LEU A HG   3  
ATOM 3921  H HD11 . LEU A 1 30  ? -12.434 -1.287  13.941  1.00 0.00 ? 30  LEU A HD11 3  
ATOM 3922  H HD12 . LEU A 1 30  ? -10.750 -1.863  13.974  1.00 0.00 ? 30  LEU A HD12 3  
ATOM 3923  H HD13 . LEU A 1 30  ? -11.231 -0.464  14.964  1.00 0.00 ? 30  LEU A HD13 3  
ATOM 3924  H HD21 . LEU A 1 30  ? -9.118  -1.003  12.801  1.00 0.00 ? 30  LEU A HD21 3  
ATOM 3925  H HD22 . LEU A 1 30  ? -9.390  0.181   11.500  1.00 0.00 ? 30  LEU A HD22 3  
ATOM 3926  H HD23 . LEU A 1 30  ? -9.062  0.740   13.158  1.00 0.00 ? 30  LEU A HD23 3  
ATOM 3927  N N    . ASP A 1 31  ? -13.526 -1.210  9.632   1.00 0.00 ? 31  ASP A N    3  
ATOM 3928  C CA   . ASP A 1 31  ? -14.524 -1.406  8.595   1.00 0.00 ? 31  ASP A CA   3  
ATOM 3929  C C    . ASP A 1 31  ? -14.109 -0.633  7.341   1.00 0.00 ? 31  ASP A C    3  
ATOM 3930  O O    . ASP A 1 31  ? -14.418 -1.043  6.224   1.00 0.00 ? 31  ASP A O    3  
ATOM 3931  C CB   . ASP A 1 31  ? -15.892 -0.885  9.041   1.00 0.00 ? 31  ASP A CB   3  
ATOM 3932  C CG   . ASP A 1 31  ? -15.958 0.622   9.294   1.00 0.00 ? 31  ASP A CG   3  
ATOM 3933  O OD1  . ASP A 1 31  ? -14.950 1.157   9.804   1.00 0.00 ? 31  ASP A OD1  3  
ATOM 3934  O OD2  . ASP A 1 31  ? -17.016 1.206   8.973   1.00 0.00 ? 31  ASP A OD2  3  
ATOM 3935  H H    . ASP A 1 31  ? -13.477 -0.282  10.002  1.00 0.00 ? 31  ASP A H    3  
ATOM 3936  H HA   . ASP A 1 31  ? -14.557 -2.483  8.429   1.00 0.00 ? 31  ASP A HA   3  
ATOM 3937  H HB2  . ASP A 1 31  ? -16.628 -1.143  8.279   1.00 0.00 ? 31  ASP A HB2  3  
ATOM 3938  H HB3  . ASP A 1 31  ? -16.182 -1.405  9.954   1.00 0.00 ? 31  ASP A HB3  3  
ATOM 3939  N N    . THR A 1 32  ? -13.416 0.473   7.570   1.00 0.00 ? 32  THR A N    3  
ATOM 3940  C CA   . THR A 1 32  ? -12.956 1.307   6.473   1.00 0.00 ? 32  THR A CA   3  
ATOM 3941  C C    . THR A 1 32  ? -11.601 1.934   6.811   1.00 0.00 ? 32  THR A C    3  
ATOM 3942  O O    . THR A 1 32  ? -11.189 2.907   6.181   1.00 0.00 ? 32  THR A O    3  
ATOM 3943  C CB   . THR A 1 32  ? -14.045 2.340   6.174   1.00 0.00 ? 32  THR A CB   3  
ATOM 3944  O OG1  . THR A 1 32  ? -14.153 3.089   7.382   1.00 0.00 ? 32  THR A OG1  3  
ATOM 3945  C CG2  . THR A 1 32  ? -15.426 1.702   6.007   1.00 0.00 ? 32  THR A CG2  3  
ATOM 3946  H H    . THR A 1 32  ? -13.169 0.800   8.482   1.00 0.00 ? 32  THR A H    3  
ATOM 3947  H HA   . THR A 1 32  ? -12.806 0.674   5.598   1.00 0.00 ? 32  THR A HA   3  
ATOM 3948  H HB   . THR A 1 32  ? -13.784 2.939   5.302   1.00 0.00 ? 32  THR A HB   3  
ATOM 3949  H HG1  . THR A 1 32  ? -14.656 3.937   7.214   1.00 0.00 ? 32  THR A HG1  3  
ATOM 3950  H HG21 . THR A 1 32  ? -16.115 2.434   5.584   1.00 0.00 ? 32  THR A HG21 3  
ATOM 3951  H HG22 . THR A 1 32  ? -15.351 0.844   5.339   1.00 0.00 ? 32  THR A HG22 3  
ATOM 3952  H HG23 . THR A 1 32  ? -15.795 1.375   6.979   1.00 0.00 ? 32  THR A HG23 3  
ATOM 3953  N N    . SER A 1 33  ? -10.947 1.350   7.804   1.00 0.00 ? 33  SER A N    3  
ATOM 3954  C CA   . SER A 1 33  ? -9.647  1.838   8.233   1.00 0.00 ? 33  SER A CA   3  
ATOM 3955  C C    . SER A 1 33  ? -8.749  0.663   8.623   1.00 0.00 ? 33  SER A C    3  
ATOM 3956  O O    . SER A 1 33  ? -9.168  -0.225  9.363   1.00 0.00 ? 33  SER A O    3  
ATOM 3957  C CB   . SER A 1 33  ? -9.785  2.812   9.405   1.00 0.00 ? 33  SER A CB   3  
ATOM 3958  O OG   . SER A 1 33  ? -10.753 2.373   10.353  1.00 0.00 ? 33  SER A OG   3  
ATOM 3959  H H    . SER A 1 33  ? -11.289 0.559   8.310   1.00 0.00 ? 33  SER A H    3  
ATOM 3960  H HA   . SER A 1 33  ? -9.237  2.364   7.371   1.00 0.00 ? 33  SER A HA   3  
ATOM 3961  H HB2  . SER A 1 33  ? -8.819  2.924   9.898   1.00 0.00 ? 33  SER A HB2  3  
ATOM 3962  H HB3  . SER A 1 33  ? -10.066 3.795   9.028   1.00 0.00 ? 33  SER A HB3  3  
ATOM 3963  H HG   . SER A 1 33  ? -10.483 2.656   11.274  1.00 0.00 ? 33  SER A HG   3  
ATOM 3964  N N    . LEU A 1 34  ? -7.529  0.695   8.106   1.00 0.00 ? 34  LEU A N    3  
ATOM 3965  C CA   . LEU A 1 34  ? -6.568  -0.357  8.390   1.00 0.00 ? 34  LEU A CA   3  
ATOM 3966  C C    . LEU A 1 34  ? -5.151  0.194   8.220   1.00 0.00 ? 34  LEU A C    3  
ATOM 3967  O O    . LEU A 1 34  ? -4.925  1.098   7.418   1.00 0.00 ? 34  LEU A O    3  
ATOM 3968  C CB   . LEU A 1 34  ? -6.855  -1.592  7.534   1.00 0.00 ? 34  LEU A CB   3  
ATOM 3969  C CG   . LEU A 1 34  ? -6.638  -1.428  6.028   1.00 0.00 ? 34  LEU A CG   3  
ATOM 3970  C CD1  . LEU A 1 34  ? -5.147  -1.444  5.684   1.00 0.00 ? 34  LEU A CD1  3  
ATOM 3971  C CD2  . LEU A 1 34  ? -7.418  -2.485  5.244   1.00 0.00 ? 34  LEU A CD2  3  
ATOM 3972  H H    . LEU A 1 34  ? -7.196  1.421   7.504   1.00 0.00 ? 34  LEU A H    3  
ATOM 3973  H HA   . LEU A 1 34  ? -6.702  -0.649  9.432   1.00 0.00 ? 34  LEU A HA   3  
ATOM 3974  H HB2  . LEU A 1 34  ? -6.225  -2.408  7.885   1.00 0.00 ? 34  LEU A HB2  3  
ATOM 3975  H HB3  . LEU A 1 34  ? -7.889  -1.893  7.701   1.00 0.00 ? 34  LEU A HB3  3  
ATOM 3976  H HG   . LEU A 1 34  ? -7.027  -0.455  5.730   1.00 0.00 ? 34  LEU A HG   3  
ATOM 3977  H HD11 . LEU A 1 34  ? -4.954  -2.218  4.941   1.00 0.00 ? 34  LEU A HD11 3  
ATOM 3978  H HD12 . LEU A 1 34  ? -4.857  -0.473  5.282   1.00 0.00 ? 34  LEU A HD12 3  
ATOM 3979  H HD13 . LEU A 1 34  ? -4.569  -1.652  6.585   1.00 0.00 ? 34  LEU A HD13 3  
ATOM 3980  H HD21 . LEU A 1 34  ? -8.091  -3.015  5.918   1.00 0.00 ? 34  LEU A HD21 3  
ATOM 3981  H HD22 . LEU A 1 34  ? -7.998  -2.000  4.458   1.00 0.00 ? 34  LEU A HD22 3  
ATOM 3982  H HD23 . LEU A 1 34  ? -6.721  -3.194  4.796   1.00 0.00 ? 34  LEU A HD23 3  
ATOM 3983  N N    . LYS A 1 35  ? -4.233  -0.376  8.987   1.00 0.00 ? 35  LYS A N    3  
ATOM 3984  C CA   . LYS A 1 35  ? -2.844  0.047   8.931   1.00 0.00 ? 35  LYS A CA   3  
ATOM 3985  C C    . LYS A 1 35  ? -2.075  -0.868  7.976   1.00 0.00 ? 35  LYS A C    3  
ATOM 3986  O O    . LYS A 1 35  ? -2.206  -2.089  8.040   1.00 0.00 ? 35  LYS A O    3  
ATOM 3987  C CB   . LYS A 1 35  ? -2.245  0.108   10.338  1.00 0.00 ? 35  LYS A CB   3  
ATOM 3988  C CG   . LYS A 1 35  ? -0.989  0.982   10.362  1.00 0.00 ? 35  LYS A CG   3  
ATOM 3989  C CD   . LYS A 1 35  ? 0.151   0.281   11.103  1.00 0.00 ? 35  LYS A CD   3  
ATOM 3990  C CE   . LYS A 1 35  ? 0.749   -0.842  10.254  1.00 0.00 ? 35  LYS A CE   3  
ATOM 3991  N NZ   . LYS A 1 35  ? 0.602   -2.145  10.940  1.00 0.00 ? 35  LYS A NZ   3  
ATOM 3992  H H    . LYS A 1 35  ? -4.425  -1.111  9.637   1.00 0.00 ? 35  LYS A H    3  
ATOM 3993  H HA   . LYS A 1 35  ? -2.826  1.060   8.529   1.00 0.00 ? 35  LYS A HA   3  
ATOM 3994  H HB2  . LYS A 1 35  ? -2.983  0.507   11.035  1.00 0.00 ? 35  LYS A HB2  3  
ATOM 3995  H HB3  . LYS A 1 35  ? -1.999  -0.898  10.677  1.00 0.00 ? 35  LYS A HB3  3  
ATOM 3996  H HG2  . LYS A 1 35  ? -0.680  1.208   9.342   1.00 0.00 ? 35  LYS A HG2  3  
ATOM 3997  H HG3  . LYS A 1 35  ? -1.212  1.933   10.845  1.00 0.00 ? 35  LYS A HG3  3  
ATOM 3998  H HD2  . LYS A 1 35  ? 0.927   1.006   11.352  1.00 0.00 ? 35  LYS A HD2  3  
ATOM 3999  H HD3  . LYS A 1 35  ? -0.218  -0.126  12.044  1.00 0.00 ? 35  LYS A HD3  3  
ATOM 4000  H HE2  . LYS A 1 35  ? 0.253   -0.876  9.284   1.00 0.00 ? 35  LYS A HE2  3  
ATOM 4001  H HE3  . LYS A 1 35  ? 1.804   -0.641  10.065  1.00 0.00 ? 35  LYS A HE3  3  
ATOM 4002  H HZ1  . LYS A 1 35  ? 1.152   -2.834  10.469  1.00 0.00 ? 35  LYS A HZ1  3  
ATOM 4003  H HZ2  . LYS A 1 35  ? 0.913   -2.060  11.887  1.00 0.00 ? 35  LYS A HZ2  3  
ATOM 4004  H HZ3  . LYS A 1 35  ? -0.359  -2.421  10.929  1.00 0.00 ? 35  LYS A HZ3  3  
ATOM 4005  N N    . VAL A 1 36  ? -1.291  -0.242  7.111   1.00 0.00 ? 36  VAL A N    3  
ATOM 4006  C CA   . VAL A 1 36  ? -0.501  -0.984  6.143   1.00 0.00 ? 36  VAL A CA   3  
ATOM 4007  C C    . VAL A 1 36  ? 0.973   -0.936  6.550   1.00 0.00 ? 36  VAL A C    3  
ATOM 4008  O O    . VAL A 1 36  ? 1.436   0.060   7.104   1.00 0.00 ? 36  VAL A O    3  
ATOM 4009  C CB   . VAL A 1 36  ? -0.751  -0.439  4.735   1.00 0.00 ? 36  VAL A CB   3  
ATOM 4010  C CG1  . VAL A 1 36  ? 0.229   -1.047  3.730   1.00 0.00 ? 36  VAL A CG1  3  
ATOM 4011  C CG2  . VAL A 1 36  ? -2.199  -0.678  4.304   1.00 0.00 ? 36  VAL A CG2  3  
ATOM 4012  H H    . VAL A 1 36  ? -1.190  0.752   7.065   1.00 0.00 ? 36  VAL A H    3  
ATOM 4013  H HA   . VAL A 1 36  ? -0.839  -2.020  6.168   1.00 0.00 ? 36  VAL A HA   3  
ATOM 4014  H HB   . VAL A 1 36  ? -0.582  0.638   4.758   1.00 0.00 ? 36  VAL A HB   3  
ATOM 4015  H HG11 . VAL A 1 36  ? -0.007  -2.101  3.585   1.00 0.00 ? 36  VAL A HG11 3  
ATOM 4016  H HG12 . VAL A 1 36  ? 0.146   -0.522  2.778   1.00 0.00 ? 36  VAL A HG12 3  
ATOM 4017  H HG13 . VAL A 1 36  ? 1.246   -0.951  4.110   1.00 0.00 ? 36  VAL A HG13 3  
ATOM 4018  H HG21 . VAL A 1 36  ? -2.813  -0.873  5.183   1.00 0.00 ? 36  VAL A HG21 3  
ATOM 4019  H HG22 . VAL A 1 36  ? -2.575  0.205   3.786   1.00 0.00 ? 36  VAL A HG22 3  
ATOM 4020  H HG23 . VAL A 1 36  ? -2.241  -1.537  3.634   1.00 0.00 ? 36  VAL A HG23 3  
ATOM 4021  N N    . SER A 1 37  ? 1.670   -2.025  6.259   1.00 0.00 ? 37  SER A N    3  
ATOM 4022  C CA   . SER A 1 37  ? 3.082   -2.119  6.587   1.00 0.00 ? 37  SER A CA   3  
ATOM 4023  C C    . SER A 1 37  ? 3.829   -2.861  5.477   1.00 0.00 ? 37  SER A C    3  
ATOM 4024  O O    . SER A 1 37  ? 3.209   -3.443  4.588   1.00 0.00 ? 37  SER A O    3  
ATOM 4025  C CB   . SER A 1 37  ? 3.289   -2.824  7.929   1.00 0.00 ? 37  SER A CB   3  
ATOM 4026  O OG   . SER A 1 37  ? 3.728   -4.170  7.763   1.00 0.00 ? 37  SER A OG   3  
ATOM 4027  H H    . SER A 1 37  ? 1.286   -2.831  5.808   1.00 0.00 ? 37  SER A H    3  
ATOM 4028  H HA   . SER A 1 37  ? 3.431   -1.089  6.661   1.00 0.00 ? 37  SER A HA   3  
ATOM 4029  H HB2  . SER A 1 37  ? 4.023   -2.274  8.518   1.00 0.00 ? 37  SER A HB2  3  
ATOM 4030  H HB3  . SER A 1 37  ? 2.356   -2.813  8.492   1.00 0.00 ? 37  SER A HB3  3  
ATOM 4031  H HG   . SER A 1 37  ? 4.633   -4.287  8.170   1.00 0.00 ? 37  SER A HG   3  
ATOM 4032  N N    . TRP A 1 38  ? 5.150   -2.817  5.564   1.00 0.00 ? 38  TRP A N    3  
ATOM 4033  C CA   . TRP A 1 38  ? 5.988   -3.478  4.578   1.00 0.00 ? 38  TRP A CA   3  
ATOM 4034  C C    . TRP A 1 38  ? 7.448   -3.297  5.001   1.00 0.00 ? 38  TRP A C    3  
ATOM 4035  O O    . TRP A 1 38  ? 7.754   -2.451  5.840   1.00 0.00 ? 38  TRP A O    3  
ATOM 4036  C CB   . TRP A 1 38  ? 5.703   -2.947  3.172   1.00 0.00 ? 38  TRP A CB   3  
ATOM 4037  C CG   . TRP A 1 38  ? 5.973   -1.450  3.005   1.00 0.00 ? 38  TRP A CG   3  
ATOM 4038  C CD1  . TRP A 1 38  ? 7.141   -0.847  2.745   1.00 0.00 ? 38  TRP A CD1  3  
ATOM 4039  C CD2  . TRP A 1 38  ? 5.003   -0.386  3.096   1.00 0.00 ? 38  TRP A CD2  3  
ATOM 4040  N NE1  . TRP A 1 38  ? 6.996   0.523   2.663   1.00 0.00 ? 38  TRP A NE1  3  
ATOM 4041  C CE2  . TRP A 1 38  ? 5.654   0.812   2.883   1.00 0.00 ? 38  TRP A CE2  3  
ATOM 4042  C CE3  . TRP A 1 38  ? 3.621   -0.433  3.350   1.00 0.00 ? 38  TRP A CE3  3  
ATOM 4043  C CZ2  . TRP A 1 38  ? 5.004   2.052   2.903   1.00 0.00 ? 38  TRP A CZ2  3  
ATOM 4044  C CZ3  . TRP A 1 38  ? 2.986   0.814   3.366   1.00 0.00 ? 38  TRP A CZ3  3  
ATOM 4045  C CH2  . TRP A 1 38  ? 3.627   2.029   3.154   1.00 0.00 ? 38  TRP A CH2  3  
ATOM 4046  H H    . TRP A 1 38  ? 5.647   -2.341  6.290   1.00 0.00 ? 38  TRP A H    3  
ATOM 4047  H HA   . TRP A 1 38  ? 5.729   -4.536  4.577   1.00 0.00 ? 38  TRP A HA   3  
ATOM 4048  H HB2  . TRP A 1 38  ? 6.312   -3.498  2.456   1.00 0.00 ? 38  TRP A HB2  3  
ATOM 4049  H HB3  . TRP A 1 38  ? 4.660   -3.147  2.924   1.00 0.00 ? 38  TRP A HB3  3  
ATOM 4050  H HD1  . TRP A 1 38  ? 8.087   -1.372  2.616   1.00 0.00 ? 38  TRP A HD1  3  
ATOM 4051  H HE1  . TRP A 1 38  ? 7.787   1.245   2.463   1.00 0.00 ? 38  TRP A HE1  3  
ATOM 4052  H HE3  . TRP A 1 38  ? 3.084   -1.366  3.521   1.00 0.00 ? 38  TRP A HE3  3  
ATOM 4053  H HZ2  . TRP A 1 38  ? 5.541   2.985   2.732   1.00 0.00 ? 38  TRP A HZ2  3  
ATOM 4054  H HZ3  . TRP A 1 38  ? 1.913   0.834   3.559   1.00 0.00 ? 38  TRP A HZ3  3  
ATOM 4055  H HH2  . TRP A 1 38  ? 3.060   2.960   3.183   1.00 0.00 ? 38  TRP A HH2  3  
ATOM 4056  N N    . GLN A 1 39  ? 8.309   -4.105  4.400   1.00 0.00 ? 39  GLN A N    3  
ATOM 4057  C CA   . GLN A 1 39  ? 9.728   -4.044  4.703   1.00 0.00 ? 39  GLN A CA   3  
ATOM 4058  C C    . GLN A 1 39  ? 10.510  -3.538  3.489   1.00 0.00 ? 39  GLN A C    3  
ATOM 4059  O O    . GLN A 1 39  ? 9.926   -3.265  2.441   1.00 0.00 ? 39  GLN A O    3  
ATOM 4060  C CB   . GLN A 1 39  ? 10.250  -5.408  5.161   1.00 0.00 ? 39  GLN A CB   3  
ATOM 4061  C CG   . GLN A 1 39  ? 10.586  -5.393  6.653   1.00 0.00 ? 39  GLN A CG   3  
ATOM 4062  C CD   . GLN A 1 39  ? 11.565  -6.515  7.006   1.00 0.00 ? 39  GLN A CD   3  
ATOM 4063  O OE1  . GLN A 1 39  ? 11.514  -7.610  6.469   1.00 0.00 ? 39  GLN A OE1  3  
ATOM 4064  N NE2  . GLN A 1 39  ? 12.457  -6.183  7.935   1.00 0.00 ? 39  GLN A NE2  3  
ATOM 4065  H H    . GLN A 1 39  ? 8.051   -4.790  3.718   1.00 0.00 ? 39  GLN A H    3  
ATOM 4066  H HA   . GLN A 1 39  ? 9.819   -3.333  5.524   1.00 0.00 ? 39  GLN A HA   3  
ATOM 4067  H HB2  . GLN A 1 39  ? 9.500   -6.174  4.961   1.00 0.00 ? 39  GLN A HB2  3  
ATOM 4068  H HB3  . GLN A 1 39  ? 11.138  -5.673  4.587   1.00 0.00 ? 39  GLN A HB3  3  
ATOM 4069  H HG2  . GLN A 1 39  ? 11.019  -4.430  6.923   1.00 0.00 ? 39  GLN A HG2  3  
ATOM 4070  H HG3  . GLN A 1 39  ? 9.672   -5.507  7.237   1.00 0.00 ? 39  GLN A HG3  3  
ATOM 4071  H HE21 . GLN A 1 39  ? 12.444  -5.267  8.335   1.00 0.00 ? 39  GLN A HE21 3  
ATOM 4072  H HE22 . GLN A 1 39  ? 13.140  -6.850  8.233   1.00 0.00 ? 39  GLN A HE22 3  
ATOM 4073  N N    . GLU A 1 40  ? 11.817  -3.428  3.670   1.00 0.00 ? 40  GLU A N    3  
ATOM 4074  C CA   . GLU A 1 40  ? 12.684  -2.959  2.602   1.00 0.00 ? 40  GLU A CA   3  
ATOM 4075  C C    . GLU A 1 40  ? 13.000  -4.102  1.635   1.00 0.00 ? 40  GLU A C    3  
ATOM 4076  O O    . GLU A 1 40  ? 13.289  -5.219  2.062   1.00 0.00 ? 40  GLU A O    3  
ATOM 4077  C CB   . GLU A 1 40  ? 13.968  -2.348  3.167   1.00 0.00 ? 40  GLU A CB   3  
ATOM 4078  C CG   . GLU A 1 40  ? 13.945  -0.823  3.052   1.00 0.00 ? 40  GLU A CG   3  
ATOM 4079  C CD   . GLU A 1 40  ? 15.074  -0.194  3.872   1.00 0.00 ? 40  GLU A CD   3  
ATOM 4080  O OE1  . GLU A 1 40  ? 15.698  -0.948  4.650   1.00 0.00 ? 40  GLU A OE1  3  
ATOM 4081  O OE2  . GLU A 1 40  ? 15.288  1.026   3.702   1.00 0.00 ? 40  GLU A OE2  3  
ATOM 4082  H H    . GLU A 1 40  ? 12.284  -3.652  4.526   1.00 0.00 ? 40  GLU A H    3  
ATOM 4083  H HA   . GLU A 1 40  ? 12.116  -2.185  2.087   1.00 0.00 ? 40  GLU A HA   3  
ATOM 4084  H HB2  . GLU A 1 40  ? 14.084  -2.636  4.212   1.00 0.00 ? 40  GLU A HB2  3  
ATOM 4085  H HB3  . GLU A 1 40  ? 14.830  -2.744  2.630   1.00 0.00 ? 40  GLU A HB3  3  
ATOM 4086  H HG2  . GLU A 1 40  ? 14.045  -0.531  2.007   1.00 0.00 ? 40  GLU A HG2  3  
ATOM 4087  H HG3  . GLU A 1 40  ? 12.984  -0.443  3.399   1.00 0.00 ? 40  GLU A HG3  3  
ATOM 4088  N N    . PRO A 1 41  ? 12.934  -3.775  0.317   1.00 0.00 ? 41  PRO A N    3  
ATOM 4089  C CA   . PRO A 1 41  ? 13.209  -4.761  -0.714  1.00 0.00 ? 41  PRO A CA   3  
ATOM 4090  C C    . PRO A 1 41  ? 14.711  -5.035  -0.823  1.00 0.00 ? 41  PRO A C    3  
ATOM 4091  O O    . PRO A 1 41  ? 15.527  -4.159  -0.541  1.00 0.00 ? 41  PRO A O    3  
ATOM 4092  C CB   . PRO A 1 41  ? 12.619  -4.175  -1.986  1.00 0.00 ? 41  PRO A CB   3  
ATOM 4093  C CG   . PRO A 1 41  ? 12.448  -2.688  -1.721  1.00 0.00 ? 41  PRO A CG   3  
ATOM 4094  C CD   . PRO A 1 41  ? 12.595  -2.462  -0.225  1.00 0.00 ? 41  PRO A CD   3  
ATOM 4095  H HA   . PRO A 1 41  ? 12.788  -5.636  -0.478  1.00 0.00 ? 41  PRO A HA   3  
ATOM 4096  H HB2  . PRO A 1 41  ? 13.277  -4.347  -2.838  1.00 0.00 ? 41  PRO A HB2  3  
ATOM 4097  H HB3  . PRO A 1 41  ? 11.663  -4.642  -2.224  1.00 0.00 ? 41  PRO A HB3  3  
ATOM 4098  H HG2  . PRO A 1 41  ? 13.195  -2.114  -2.269  1.00 0.00 ? 41  PRO A HG2  3  
ATOM 4099  H HG3  . PRO A 1 41  ? 11.471  -2.349  -2.064  1.00 0.00 ? 41  PRO A HG3  3  
ATOM 4100  H HD2  . PRO A 1 41  ? 13.375  -1.731  -0.009  1.00 0.00 ? 41  PRO A HD2  3  
ATOM 4101  H HD3  . PRO A 1 41  ? 11.671  -2.080  0.210   1.00 0.00 ? 41  PRO A HD3  3  
ATOM 4102  N N    . GLY A 1 42  ? 15.029  -6.254  -1.232  1.00 0.00 ? 42  GLY A N    3  
ATOM 4103  C CA   . GLY A 1 42  ? 16.417  -6.655  -1.382  1.00 0.00 ? 42  GLY A CA   3  
ATOM 4104  C C    . GLY A 1 42  ? 16.986  -6.173  -2.718  1.00 0.00 ? 42  GLY A C    3  
ATOM 4105  O O    . GLY A 1 42  ? 18.182  -6.306  -2.971  1.00 0.00 ? 42  GLY A O    3  
ATOM 4106  H H    . GLY A 1 42  ? 14.358  -6.961  -1.459  1.00 0.00 ? 42  GLY A H    3  
ATOM 4107  H HA2  . GLY A 1 42  ? 17.008  -6.246  -0.562  1.00 0.00 ? 42  GLY A HA2  3  
ATOM 4108  H HA3  . GLY A 1 42  ? 16.495  -7.740  -1.319  1.00 0.00 ? 42  GLY A HA3  3  
ATOM 4109  N N    . GLU A 1 43  ? 16.102  -5.624  -3.537  1.00 0.00 ? 43  GLU A N    3  
ATOM 4110  C CA   . GLU A 1 43  ? 16.501  -5.122  -4.841  1.00 0.00 ? 43  GLU A CA   3  
ATOM 4111  C C    . GLU A 1 43  ? 16.526  -3.592  -4.836  1.00 0.00 ? 43  GLU A C    3  
ATOM 4112  O O    . GLU A 1 43  ? 16.192  -2.959  -5.836  1.00 0.00 ? 43  GLU A O    3  
ATOM 4113  C CB   . GLU A 1 43  ? 15.576  -5.651  -5.939  1.00 0.00 ? 43  GLU A CB   3  
ATOM 4114  C CG   . GLU A 1 43  ? 16.085  -6.985  -6.489  1.00 0.00 ? 43  GLU A CG   3  
ATOM 4115  C CD   . GLU A 1 43  ? 17.510  -6.847  -7.030  1.00 0.00 ? 43  GLU A CD   3  
ATOM 4116  O OE1  . GLU A 1 43  ? 17.632  -6.487  -8.221  1.00 0.00 ? 43  GLU A OE1  3  
ATOM 4117  O OE2  . GLU A 1 43  ? 18.444  -7.105  -6.241  1.00 0.00 ? 43  GLU A OE2  3  
ATOM 4118  H H    . GLU A 1 43  ? 15.131  -5.520  -3.323  1.00 0.00 ? 43  GLU A H    3  
ATOM 4119  H HA   . GLU A 1 43  ? 17.507  -5.507  -5.005  1.00 0.00 ? 43  GLU A HA   3  
ATOM 4120  H HB2  . GLU A 1 43  ? 14.569  -5.778  -5.542  1.00 0.00 ? 43  GLU A HB2  3  
ATOM 4121  H HB3  . GLU A 1 43  ? 15.510  -4.922  -6.747  1.00 0.00 ? 43  GLU A HB3  3  
ATOM 4122  H HG2  . GLU A 1 43  ? 16.063  -7.739  -5.702  1.00 0.00 ? 43  GLU A HG2  3  
ATOM 4123  H HG3  . GLU A 1 43  ? 15.423  -7.332  -7.282  1.00 0.00 ? 43  GLU A HG3  3  
ATOM 4124  N N    . LYS A 1 44  ? 16.924  -3.042  -3.698  1.00 0.00 ? 44  LYS A N    3  
ATOM 4125  C CA   . LYS A 1 44  ? 16.997  -1.599  -3.549  1.00 0.00 ? 44  LYS A CA   3  
ATOM 4126  C C    . LYS A 1 44  ? 17.545  -0.984  -4.839  1.00 0.00 ? 44  LYS A C    3  
ATOM 4127  O O    . LYS A 1 44  ? 17.144  0.111   -5.228  1.00 0.00 ? 44  LYS A O    3  
ATOM 4128  C CB   . LYS A 1 44  ? 17.801  -1.228  -2.301  1.00 0.00 ? 44  LYS A CB   3  
ATOM 4129  C CG   . LYS A 1 44  ? 17.079  -1.680  -1.030  1.00 0.00 ? 44  LYS A CG   3  
ATOM 4130  C CD   . LYS A 1 44  ? 17.652  -0.980  0.204   1.00 0.00 ? 44  LYS A CD   3  
ATOM 4131  C CE   . LYS A 1 44  ? 16.693  -1.088  1.391   1.00 0.00 ? 44  LYS A CE   3  
ATOM 4132  N NZ   . LYS A 1 44  ? 17.402  -0.804  2.658   1.00 0.00 ? 44  LYS A NZ   3  
ATOM 4133  H H    . LYS A 1 44  ? 17.194  -3.564  -2.889  1.00 0.00 ? 44  LYS A H    3  
ATOM 4134  H HA   . LYS A 1 44  ? 15.981  -1.234  -3.398  1.00 0.00 ? 44  LYS A HA   3  
ATOM 4135  H HB2  . LYS A 1 44  ? 18.787  -1.691  -2.348  1.00 0.00 ? 44  LYS A HB2  3  
ATOM 4136  H HB3  . LYS A 1 44  ? 17.957  -0.150  -2.272  1.00 0.00 ? 44  LYS A HB3  3  
ATOM 4137  H HG2  . LYS A 1 44  ? 16.015  -1.462  -1.115  1.00 0.00 ? 44  LYS A HG2  3  
ATOM 4138  H HG3  . LYS A 1 44  ? 17.176  -2.760  -0.917  1.00 0.00 ? 44  LYS A HG3  3  
ATOM 4139  H HD2  . LYS A 1 44  ? 18.612  -1.424  0.466   1.00 0.00 ? 44  LYS A HD2  3  
ATOM 4140  H HD3  . LYS A 1 44  ? 17.838  0.070   -0.023  1.00 0.00 ? 44  LYS A HD3  3  
ATOM 4141  H HE2  . LYS A 1 44  ? 15.867  -0.389  1.264   1.00 0.00 ? 44  LYS A HE2  3  
ATOM 4142  H HE3  . LYS A 1 44  ? 16.260  -2.088  1.426   1.00 0.00 ? 44  LYS A HE3  3  
ATOM 4143  H HZ1  . LYS A 1 44  ? 18.383  -0.949  2.531   1.00 0.00 ? 44  LYS A HZ1  3  
ATOM 4144  H HZ2  . LYS A 1 44  ? 17.238  0.146   2.926   1.00 0.00 ? 44  LYS A HZ2  3  
ATOM 4145  H HZ3  . LYS A 1 44  ? 17.064  -1.415  3.374   1.00 0.00 ? 44  LYS A HZ3  3  
ATOM 4146  N N    . ASN A 1 45  ? 18.454  -1.717  -5.466  1.00 0.00 ? 45  ASN A N    3  
ATOM 4147  C CA   . ASN A 1 45  ? 19.061  -1.258  -6.703  1.00 0.00 ? 45  ASN A CA   3  
ATOM 4148  C C    . ASN A 1 45  ? 19.328  0.246   -6.608  1.00 0.00 ? 45  ASN A C    3  
ATOM 4149  O O    . ASN A 1 45  ? 19.072  0.986   -7.557  1.00 0.00 ? 45  ASN A O    3  
ATOM 4150  C CB   . ASN A 1 45  ? 18.133  -1.499  -7.895  1.00 0.00 ? 45  ASN A CB   3  
ATOM 4151  C CG   . ASN A 1 45  ? 18.453  -2.831  -8.578  1.00 0.00 ? 45  ASN A CG   3  
ATOM 4152  O OD1  . ASN A 1 45  ? 19.372  -2.945  -9.372  1.00 0.00 ? 45  ASN A OD1  3  
ATOM 4153  N ND2  . ASN A 1 45  ? 17.645  -3.827  -8.227  1.00 0.00 ? 45  ASN A ND2  3  
ATOM 4154  H H    . ASN A 1 45  ? 18.775  -2.607  -5.142  1.00 0.00 ? 45  ASN A H    3  
ATOM 4155  H HA   . ASN A 1 45  ? 19.978  -1.838  -6.805  1.00 0.00 ? 45  ASN A HA   3  
ATOM 4156  H HB2  . ASN A 1 45  ? 17.096  -1.499  -7.559  1.00 0.00 ? 45  ASN A HB2  3  
ATOM 4157  H HB3  . ASN A 1 45  ? 18.236  -0.685  -8.612  1.00 0.00 ? 45  ASN A HB3  3  
ATOM 4158  H HD21 . ASN A 1 45  ? 16.909  -3.665  -7.569  1.00 0.00 ? 45  ASN A HD21 3  
ATOM 4159  H HD22 . ASN A 1 45  ? 17.773  -4.737  -8.620  1.00 0.00 ? 45  ASN A HD22 3  
ATOM 4160  N N    . GLY A 1 46  ? 19.838  0.652   -5.455  1.00 0.00 ? 46  GLY A N    3  
ATOM 4161  C CA   . GLY A 1 46  ? 20.142  2.054   -5.224  1.00 0.00 ? 46  GLY A CA   3  
ATOM 4162  C C    . GLY A 1 46  ? 19.715  2.484   -3.819  1.00 0.00 ? 46  GLY A C    3  
ATOM 4163  O O    . GLY A 1 46  ? 19.510  1.643   -2.945  1.00 0.00 ? 46  GLY A O    3  
ATOM 4164  H H    . GLY A 1 46  ? 20.043  0.044   -4.689  1.00 0.00 ? 46  GLY A H    3  
ATOM 4165  H HA2  . GLY A 1 46  ? 21.211  2.224   -5.351  1.00 0.00 ? 46  GLY A HA2  3  
ATOM 4166  H HA3  . GLY A 1 46  ? 19.631  2.668   -5.967  1.00 0.00 ? 46  GLY A HA3  3  
ATOM 4167  N N    . ILE A 1 47  ? 19.594  3.792   -3.646  1.00 0.00 ? 47  ILE A N    3  
ATOM 4168  C CA   . ILE A 1 47  ? 19.195  4.343   -2.362  1.00 0.00 ? 47  ILE A CA   3  
ATOM 4169  C C    . ILE A 1 47  ? 17.725  4.763   -2.427  1.00 0.00 ? 47  ILE A C    3  
ATOM 4170  O O    . ILE A 1 47  ? 17.375  5.703   -3.139  1.00 0.00 ? 47  ILE A O    3  
ATOM 4171  C CB   . ILE A 1 47  ? 20.140  5.472   -1.947  1.00 0.00 ? 47  ILE A CB   3  
ATOM 4172  C CG1  . ILE A 1 47  ? 21.493  4.917   -1.497  1.00 0.00 ? 47  ILE A CG1  3  
ATOM 4173  C CG2  . ILE A 1 47  ? 19.499  6.358   -0.877  1.00 0.00 ? 47  ILE A CG2  3  
ATOM 4174  C CD1  . ILE A 1 47  ? 21.317  3.864   -0.402  1.00 0.00 ? 47  ILE A CD1  3  
ATOM 4175  H H    . ILE A 1 47  ? 19.762  4.469   -4.362  1.00 0.00 ? 47  ILE A H    3  
ATOM 4176  H HA   . ILE A 1 47  ? 19.295  3.550   -1.621  1.00 0.00 ? 47  ILE A HA   3  
ATOM 4177  H HB   . ILE A 1 47  ? 20.324  6.101   -2.818  1.00 0.00 ? 47  ILE A HB   3  
ATOM 4178  H HG12 . ILE A 1 47  ? 22.012  4.478   -2.349  1.00 0.00 ? 47  ILE A HG12 3  
ATOM 4179  H HG13 . ILE A 1 47  ? 22.118  5.730   -1.127  1.00 0.00 ? 47  ILE A HG13 3  
ATOM 4180  H HG21 . ILE A 1 47  ? 19.224  7.317   -1.316  1.00 0.00 ? 47  ILE A HG21 3  
ATOM 4181  H HG22 . ILE A 1 47  ? 18.607  5.868   -0.487  1.00 0.00 ? 47  ILE A HG22 3  
ATOM 4182  H HG23 . ILE A 1 47  ? 20.209  6.520   -0.066  1.00 0.00 ? 47  ILE A HG23 3  
ATOM 4183  H HD11 . ILE A 1 47  ? 21.320  2.870   -0.850  1.00 0.00 ? 47  ILE A HD11 3  
ATOM 4184  H HD12 . ILE A 1 47  ? 22.135  3.943   0.314   1.00 0.00 ? 47  ILE A HD12 3  
ATOM 4185  H HD13 . ILE A 1 47  ? 20.369  4.028   0.111   1.00 0.00 ? 47  ILE A HD13 3  
ATOM 4186  N N    . LEU A 1 48  ? 16.904  4.046   -1.673  1.00 0.00 ? 48  LEU A N    3  
ATOM 4187  C CA   . LEU A 1 48  ? 15.480  4.333   -1.636  1.00 0.00 ? 48  LEU A CA   3  
ATOM 4188  C C    . LEU A 1 48  ? 15.266  5.763   -1.136  1.00 0.00 ? 48  LEU A C    3  
ATOM 4189  O O    . LEU A 1 48  ? 15.969  6.223   -0.239  1.00 0.00 ? 48  LEU A O    3  
ATOM 4190  C CB   . LEU A 1 48  ? 14.742  3.276   -0.812  1.00 0.00 ? 48  LEU A CB   3  
ATOM 4191  C CG   . LEU A 1 48  ? 15.059  1.818   -1.151  1.00 0.00 ? 48  LEU A CG   3  
ATOM 4192  C CD1  . LEU A 1 48  ? 14.362  0.865   -0.179  1.00 0.00 ? 48  LEU A CD1  3  
ATOM 4193  C CD2  . LEU A 1 48  ? 14.711  1.507   -2.608  1.00 0.00 ? 48  LEU A CD2  3  
ATOM 4194  H H    . LEU A 1 48  ? 17.197  3.283   -1.097  1.00 0.00 ? 48  LEU A H    3  
ATOM 4195  H HA   . LEU A 1 48  ? 15.106  4.264   -2.657  1.00 0.00 ? 48  LEU A HA   3  
ATOM 4196  H HB2  . LEU A 1 48  ? 14.971  3.441   0.242   1.00 0.00 ? 48  LEU A HB2  3  
ATOM 4197  H HB3  . LEU A 1 48  ? 13.670  3.432   -0.934  1.00 0.00 ? 48  LEU A HB3  3  
ATOM 4198  H HG   . LEU A 1 48  ? 16.133  1.667   -1.037  1.00 0.00 ? 48  LEU A HG   3  
ATOM 4199  H HD11 . LEU A 1 48  ? 14.594  1.157   0.845   1.00 0.00 ? 48  LEU A HD11 3  
ATOM 4200  H HD12 . LEU A 1 48  ? 13.284  0.911   -0.335  1.00 0.00 ? 48  LEU A HD12 3  
ATOM 4201  H HD13 . LEU A 1 48  ? 14.712  -0.153  -0.355  1.00 0.00 ? 48  LEU A HD13 3  
ATOM 4202  H HD21 . LEU A 1 48  ? 15.414  2.018   -3.267  1.00 0.00 ? 48  LEU A HD21 3  
ATOM 4203  H HD22 . LEU A 1 48  ? 14.773  0.432   -2.775  1.00 0.00 ? 48  LEU A HD22 3  
ATOM 4204  H HD23 . LEU A 1 48  ? 13.699  1.850   -2.821  1.00 0.00 ? 48  LEU A HD23 3  
ATOM 4205  N N    . THR A 1 49  ? 14.290  6.426   -1.740  1.00 0.00 ? 49  THR A N    3  
ATOM 4206  C CA   . THR A 1 49  ? 13.974  7.795   -1.367  1.00 0.00 ? 49  THR A CA   3  
ATOM 4207  C C    . THR A 1 49  ? 12.596  7.862   -0.705  1.00 0.00 ? 49  THR A C    3  
ATOM 4208  O O    . THR A 1 49  ? 12.274  8.840   -0.032  1.00 0.00 ? 49  THR A O    3  
ATOM 4209  C CB   . THR A 1 49  ? 14.088  8.664   -2.621  1.00 0.00 ? 49  THR A CB   3  
ATOM 4210  O OG1  . THR A 1 49  ? 13.295  7.984   -3.589  1.00 0.00 ? 49  THR A OG1  3  
ATOM 4211  C CG2  . THR A 1 49  ? 15.498  8.650   -3.216  1.00 0.00 ? 49  THR A CG2  3  
ATOM 4212  H H    . THR A 1 49  ? 13.722  6.045   -2.469  1.00 0.00 ? 49  THR A H    3  
ATOM 4213  H HA   . THR A 1 49  ? 14.701  8.126   -0.626  1.00 0.00 ? 49  THR A HA   3  
ATOM 4214  H HB   . THR A 1 49  ? 13.762  9.684   -2.418  1.00 0.00 ? 49  THR A HB   3  
ATOM 4215  H HG1  . THR A 1 49  ? 12.337  8.256   -3.500  1.00 0.00 ? 49  THR A HG1  3  
ATOM 4216  H HG21 . THR A 1 49  ? 16.153  8.052   -2.584  1.00 0.00 ? 49  THR A HG21 3  
ATOM 4217  H HG22 . THR A 1 49  ? 15.465  8.218   -4.217  1.00 0.00 ? 49  THR A HG22 3  
ATOM 4218  H HG23 . THR A 1 49  ? 15.879  9.670   -3.273  1.00 0.00 ? 49  THR A HG23 3  
ATOM 4219  N N    . GLY A 1 50  ? 11.820  6.810   -0.919  1.00 0.00 ? 50  GLY A N    3  
ATOM 4220  C CA   . GLY A 1 50  ? 10.484  6.738   -0.351  1.00 0.00 ? 50  GLY A CA   3  
ATOM 4221  C C    . GLY A 1 50  ? 9.729   5.516   -0.879  1.00 0.00 ? 50  GLY A C    3  
ATOM 4222  O O    . GLY A 1 50  ? 10.323  4.636   -1.501  1.00 0.00 ? 50  GLY A O    3  
ATOM 4223  H H    . GLY A 1 50  ? 12.089  6.019   -1.468  1.00 0.00 ? 50  GLY A H    3  
ATOM 4224  H HA2  . GLY A 1 50  ? 10.550  6.687   0.736   1.00 0.00 ? 50  GLY A HA2  3  
ATOM 4225  H HA3  . GLY A 1 50  ? 9.932   7.645   -0.595  1.00 0.00 ? 50  GLY A HA3  3  
ATOM 4226  N N    . TYR A 1 51  ? 8.431   5.502   -0.613  1.00 0.00 ? 51  TYR A N    3  
ATOM 4227  C CA   . TYR A 1 51  ? 7.589   4.403   -1.053  1.00 0.00 ? 51  TYR A CA   3  
ATOM 4228  C C    . TYR A 1 51  ? 6.210   4.907   -1.482  1.00 0.00 ? 51  TYR A C    3  
ATOM 4229  O O    . TYR A 1 51  ? 5.620   5.754   -0.814  1.00 0.00 ? 51  TYR A O    3  
ATOM 4230  C CB   . TYR A 1 51  ? 7.429   3.482   0.158   1.00 0.00 ? 51  TYR A CB   3  
ATOM 4231  C CG   . TYR A 1 51  ? 8.694   2.699   0.516   1.00 0.00 ? 51  TYR A CG   3  
ATOM 4232  C CD1  . TYR A 1 51  ? 9.044   1.582   -0.214  1.00 0.00 ? 51  TYR A CD1  3  
ATOM 4233  C CD2  . TYR A 1 51  ? 9.485   3.111   1.570   1.00 0.00 ? 51  TYR A CD2  3  
ATOM 4234  C CE1  . TYR A 1 51  ? 10.234  0.845   0.123   1.00 0.00 ? 51  TYR A CE1  3  
ATOM 4235  C CE2  . TYR A 1 51  ? 10.675  2.374   1.907   1.00 0.00 ? 51  TYR A CE2  3  
ATOM 4236  C CZ   . TYR A 1 51  ? 10.991  1.278   1.168   1.00 0.00 ? 51  TYR A CZ   3  
ATOM 4237  O OH   . TYR A 1 51  ? 12.115  0.582   1.486   1.00 0.00 ? 51  TYR A OH   3  
ATOM 4238  H H    . TYR A 1 51  ? 7.957   6.222   -0.107  1.00 0.00 ? 51  TYR A H    3  
ATOM 4239  H HA   . TYR A 1 51  ? 8.075   3.927   -1.905  1.00 0.00 ? 51  TYR A HA   3  
ATOM 4240  H HB2  . TYR A 1 51  ? 7.128   4.080   1.019   1.00 0.00 ? 51  TYR A HB2  3  
ATOM 4241  H HB3  . TYR A 1 51  ? 6.621   2.777   -0.038  1.00 0.00 ? 51  TYR A HB3  3  
ATOM 4242  H HD1  . TYR A 1 51  ? 8.419   1.257   -1.046  1.00 0.00 ? 51  TYR A HD1  3  
ATOM 4243  H HD2  . TYR A 1 51  ? 9.208   3.993   2.147   1.00 0.00 ? 51  TYR A HD2  3  
ATOM 4244  H HE1  . TYR A 1 51  ? 10.522  -0.039  -0.445  1.00 0.00 ? 51  TYR A HE1  3  
ATOM 4245  H HE2  . TYR A 1 51  ? 11.308  2.688   2.737   1.00 0.00 ? 51  TYR A HE2  3  
ATOM 4246  H HH   . TYR A 1 51  ? 12.719  1.147   2.048   1.00 0.00 ? 51  TYR A HH   3  
ATOM 4247  N N    . ARG A 1 52  ? 5.736   4.364   -2.594  1.00 0.00 ? 52  ARG A N    3  
ATOM 4248  C CA   . ARG A 1 52  ? 4.437   4.749   -3.119  1.00 0.00 ? 52  ARG A CA   3  
ATOM 4249  C C    . ARG A 1 52  ? 3.385   3.698   -2.756  1.00 0.00 ? 52  ARG A C    3  
ATOM 4250  O O    . ARG A 1 52  ? 3.453   2.561   -3.219  1.00 0.00 ? 52  ARG A O    3  
ATOM 4251  C CB   . ARG A 1 52  ? 4.483   4.909   -4.640  1.00 0.00 ? 52  ARG A CB   3  
ATOM 4252  C CG   . ARG A 1 52  ? 3.580   6.056   -5.099  1.00 0.00 ? 52  ARG A CG   3  
ATOM 4253  C CD   . ARG A 1 52  ? 3.125   5.850   -6.545  1.00 0.00 ? 52  ARG A CD   3  
ATOM 4254  N NE   . ARG A 1 52  ? 4.143   6.384   -7.477  1.00 0.00 ? 52  ARG A NE   3  
ATOM 4255  C CZ   . ARG A 1 52  ? 4.028   6.357   -8.811  1.00 0.00 ? 52  ARG A CZ   3  
ATOM 4256  N NH1  . ARG A 1 52  ? 2.938   5.821   -9.379  1.00 0.00 ? 52  ARG A NH1  3  
ATOM 4257  N NH2  . ARG A 1 52  ? 5.002   6.865   -9.579  1.00 0.00 ? 52  ARG A NH2  3  
ATOM 4258  H H    . ARG A 1 52  ? 6.222   3.676   -3.131  1.00 0.00 ? 52  ARG A H    3  
ATOM 4259  H HA   . ARG A 1 52  ? 4.216   5.705   -2.645  1.00 0.00 ? 52  ARG A HA   3  
ATOM 4260  H HB2  . ARG A 1 52  ? 5.508   5.099   -4.958  1.00 0.00 ? 52  ARG A HB2  3  
ATOM 4261  H HB3  . ARG A 1 52  ? 4.169   3.981   -5.117  1.00 0.00 ? 52  ARG A HB3  3  
ATOM 4262  H HG2  . ARG A 1 52  ? 2.710   6.122   -4.445  1.00 0.00 ? 52  ARG A HG2  3  
ATOM 4263  H HG3  . ARG A 1 52  ? 4.116   7.001   -5.013  1.00 0.00 ? 52  ARG A HG3  3  
ATOM 4264  H HD2  . ARG A 1 52  ? 2.965   4.790   -6.737  1.00 0.00 ? 52  ARG A HD2  3  
ATOM 4265  H HD3  . ARG A 1 52  ? 2.171   6.352   -6.709  1.00 0.00 ? 52  ARG A HD3  3  
ATOM 4266  H HE   . ARG A 1 52  ? 4.969   6.791   -7.086  1.00 0.00 ? 52  ARG A HE   3  
ATOM 4267  H HH11 . ARG A 1 52  ? 2.211   5.442   -8.806  1.00 0.00 ? 52  ARG A HH11 3  
ATOM 4268  H HH12 . ARG A 1 52  ? 2.852   5.801   -10.375 1.00 0.00 ? 52  ARG A HH12 3  
ATOM 4269  H HH21 . ARG A 1 52  ? 5.815   7.265   -9.155  1.00 0.00 ? 52  ARG A HH21 3  
ATOM 4270  H HH22 . ARG A 1 52  ? 4.916   6.844   -10.575 1.00 0.00 ? 52  ARG A HH22 3  
ATOM 4271  N N    . ILE A 1 53  ? 2.438   4.117   -1.930  1.00 0.00 ? 53  ILE A N    3  
ATOM 4272  C CA   . ILE A 1 53  ? 1.374   3.226   -1.499  1.00 0.00 ? 53  ILE A CA   3  
ATOM 4273  C C    . ILE A 1 53  ? 0.073   3.613   -2.205  1.00 0.00 ? 53  ILE A C    3  
ATOM 4274  O O    . ILE A 1 53  ? -0.143  4.783   -2.518  1.00 0.00 ? 53  ILE A O    3  
ATOM 4275  C CB   . ILE A 1 53  ? 1.266   3.219   0.027   1.00 0.00 ? 53  ILE A CB   3  
ATOM 4276  C CG1  . ILE A 1 53  ? 0.235   2.192   0.499   1.00 0.00 ? 53  ILE A CG1  3  
ATOM 4277  C CG2  . ILE A 1 53  ? 0.966   4.621   0.562   1.00 0.00 ? 53  ILE A CG2  3  
ATOM 4278  C CD1  . ILE A 1 53  ? -0.075  2.370   1.987   1.00 0.00 ? 53  ILE A CD1  3  
ATOM 4279  H H    . ILE A 1 53  ? 2.390   5.044   -1.557  1.00 0.00 ? 53  ILE A H    3  
ATOM 4280  H HA   . ILE A 1 53  ? 1.647   2.217   -1.807  1.00 0.00 ? 53  ILE A HA   3  
ATOM 4281  H HB   . ILE A 1 53  ? 2.231   2.918   0.436   1.00 0.00 ? 53  ILE A HB   3  
ATOM 4282  H HG12 . ILE A 1 53  ? -0.681  2.298   -0.082  1.00 0.00 ? 53  ILE A HG12 3  
ATOM 4283  H HG13 . ILE A 1 53  ? 0.611   1.185   0.321   1.00 0.00 ? 53  ILE A HG13 3  
ATOM 4284  H HG21 . ILE A 1 53  ? 0.949   5.330   -0.265  1.00 0.00 ? 53  ILE A HG21 3  
ATOM 4285  H HG22 . ILE A 1 53  ? -0.004  4.620   1.059   1.00 0.00 ? 53  ILE A HG22 3  
ATOM 4286  H HG23 . ILE A 1 53  ? 1.738   4.911   1.274   1.00 0.00 ? 53  ILE A HG23 3  
ATOM 4287  H HD11 . ILE A 1 53  ? 0.537   3.177   2.392   1.00 0.00 ? 53  ILE A HD11 3  
ATOM 4288  H HD12 . ILE A 1 53  ? -1.130  2.617   2.112   1.00 0.00 ? 53  ILE A HD12 3  
ATOM 4289  H HD13 . ILE A 1 53  ? 0.147   1.444   2.518   1.00 0.00 ? 53  ILE A HD13 3  
ATOM 4290  N N    . SER A 1 54  ? -0.759  2.609   -2.436  1.00 0.00 ? 54  SER A N    3  
ATOM 4291  C CA   . SER A 1 54  ? -2.033  2.830   -3.100  1.00 0.00 ? 54  SER A CA   3  
ATOM 4292  C C    . SER A 1 54  ? -3.028  1.738   -2.700  1.00 0.00 ? 54  SER A C    3  
ATOM 4293  O O    . SER A 1 54  ? -2.789  0.556   -2.943  1.00 0.00 ? 54  SER A O    3  
ATOM 4294  C CB   . SER A 1 54  ? -1.863  2.862   -4.620  1.00 0.00 ? 54  SER A CB   3  
ATOM 4295  O OG   . SER A 1 54  ? -0.784  2.039   -5.055  1.00 0.00 ? 54  SER A OG   3  
ATOM 4296  H H    . SER A 1 54  ? -0.576  1.660   -2.179  1.00 0.00 ? 54  SER A H    3  
ATOM 4297  H HA   . SER A 1 54  ? -2.374  3.805   -2.753  1.00 0.00 ? 54  SER A HA   3  
ATOM 4298  H HB2  . SER A 1 54  ? -2.787  2.530   -5.095  1.00 0.00 ? 54  SER A HB2  3  
ATOM 4299  H HB3  . SER A 1 54  ? -1.690  3.888   -4.944  1.00 0.00 ? 54  SER A HB3  3  
ATOM 4300  H HG   . SER A 1 54  ? -1.016  1.603   -5.925  1.00 0.00 ? 54  SER A HG   3  
ATOM 4301  N N    . TRP A 1 55  ? -4.122  2.173   -2.094  1.00 0.00 ? 55  TRP A N    3  
ATOM 4302  C CA   . TRP A 1 55  ? -5.154  1.248   -1.658  1.00 0.00 ? 55  TRP A CA   3  
ATOM 4303  C C    . TRP A 1 55  ? -6.356  1.407   -2.591  1.00 0.00 ? 55  TRP A C    3  
ATOM 4304  O O    . TRP A 1 55  ? -6.888  2.506   -2.743  1.00 0.00 ? 55  TRP A O    3  
ATOM 4305  C CB   . TRP A 1 55  ? -5.506  1.473   -0.186  1.00 0.00 ? 55  TRP A CB   3  
ATOM 4306  C CG   . TRP A 1 55  ? -6.076  2.861   0.113   1.00 0.00 ? 55  TRP A CG   3  
ATOM 4307  C CD1  . TRP A 1 55  ? -7.254  3.370   -0.273  1.00 0.00 ? 55  TRP A CD1  3  
ATOM 4308  C CD2  . TRP A 1 55  ? -5.441  3.904   0.881   1.00 0.00 ? 55  TRP A CD2  3  
ATOM 4309  N NE1  . TRP A 1 55  ? -7.424  4.659   0.188   1.00 0.00 ? 55  TRP A NE1  3  
ATOM 4310  C CE2  . TRP A 1 55  ? -6.286  4.995   0.913   1.00 0.00 ? 55  TRP A CE2  3  
ATOM 4311  C CE3  . TRP A 1 55  ? -4.193  3.926   1.529   1.00 0.00 ? 55  TRP A CE3  3  
ATOM 4312  C CZ2  . TRP A 1 55  ? -5.976  6.187   1.578   1.00 0.00 ? 55  TRP A CZ2  3  
ATOM 4313  C CZ3  . TRP A 1 55  ? -3.898  5.125   2.190   1.00 0.00 ? 55  TRP A CZ3  3  
ATOM 4314  C CH2  . TRP A 1 55  ? -4.738  6.231   2.230   1.00 0.00 ? 55  TRP A CH2  3  
ATOM 4315  H H    . TRP A 1 55  ? -4.309  3.137   -1.900  1.00 0.00 ? 55  TRP A H    3  
ATOM 4316  H HA   . TRP A 1 55  ? -4.752  0.238   -1.737  1.00 0.00 ? 55  TRP A HA   3  
ATOM 4317  H HB2  . TRP A 1 55  ? -6.231  0.720   0.123   1.00 0.00 ? 55  TRP A HB2  3  
ATOM 4318  H HB3  . TRP A 1 55  ? -4.612  1.321   0.418   1.00 0.00 ? 55  TRP A HB3  3  
ATOM 4319  H HD1  . TRP A 1 55  ? -7.986  2.833   -0.876  1.00 0.00 ? 55  TRP A HD1  3  
ATOM 4320  H HE1  . TRP A 1 55  ? -8.291  5.297   0.016   1.00 0.00 ? 55  TRP A HE1  3  
ATOM 4321  H HE3  . TRP A 1 55  ? -3.508  3.079   1.519   1.00 0.00 ? 55  TRP A HE3  3  
ATOM 4322  H HZ2  . TRP A 1 55  ? -6.661  7.034   1.588   1.00 0.00 ? 55  TRP A HZ2  3  
ATOM 4323  H HZ3  . TRP A 1 55  ? -2.942  5.195   2.708   1.00 0.00 ? 55  TRP A HZ3  3  
ATOM 4324  H HH2  . TRP A 1 55  ? -4.434  7.130   2.768   1.00 0.00 ? 55  TRP A HH2  3  
ATOM 4325  N N    . GLU A 1 56  ? -6.750  0.293   -3.191  1.00 0.00 ? 56  GLU A N    3  
ATOM 4326  C CA   . GLU A 1 56  ? -7.880  0.295   -4.105  1.00 0.00 ? 56  GLU A CA   3  
ATOM 4327  C C    . GLU A 1 56  ? -8.642  -1.028  -4.009  1.00 0.00 ? 56  GLU A C    3  
ATOM 4328  O O    . GLU A 1 56  ? -8.036  -2.088  -3.861  1.00 0.00 ? 56  GLU A O    3  
ATOM 4329  C CB   . GLU A 1 56  ? -7.423  0.562   -5.541  1.00 0.00 ? 56  GLU A CB   3  
ATOM 4330  C CG   . GLU A 1 56  ? -6.830  -0.700  -6.171  1.00 0.00 ? 56  GLU A CG   3  
ATOM 4331  C CD   . GLU A 1 56  ? -6.267  -0.405  -7.563  1.00 0.00 ? 56  GLU A CD   3  
ATOM 4332  O OE1  . GLU A 1 56  ? -5.121  0.090   -7.618  1.00 0.00 ? 56  GLU A OE1  3  
ATOM 4333  O OE2  . GLU A 1 56  ? -6.996  -0.682  -8.540  1.00 0.00 ? 56  GLU A OE2  3  
ATOM 4334  H H    . GLU A 1 56  ? -6.312  -0.596  -3.062  1.00 0.00 ? 56  GLU A H    3  
ATOM 4335  H HA   . GLU A 1 56  ? -8.518  1.115   -3.775  1.00 0.00 ? 56  GLU A HA   3  
ATOM 4336  H HB2  . GLU A 1 56  ? -8.268  0.908   -6.137  1.00 0.00 ? 56  GLU A HB2  3  
ATOM 4337  H HB3  . GLU A 1 56  ? -6.680  1.360   -5.548  1.00 0.00 ? 56  GLU A HB3  3  
ATOM 4338  H HG2  . GLU A 1 56  ? -6.040  -1.093  -5.531  1.00 0.00 ? 56  GLU A HG2  3  
ATOM 4339  H HG3  . GLU A 1 56  ? -7.597  -1.471  -6.241  1.00 0.00 ? 56  GLU A HG3  3  
ATOM 4340  N N    . GLU A 1 57  ? -9.960  -0.922  -4.098  1.00 0.00 ? 57  GLU A N    3  
ATOM 4341  C CA   . GLU A 1 57  ? -10.811 -2.097  -4.023  1.00 0.00 ? 57  GLU A CA   3  
ATOM 4342  C C    . GLU A 1 57  ? -10.263 -3.209  -4.920  1.00 0.00 ? 57  GLU A C    3  
ATOM 4343  O O    . GLU A 1 57  ? -9.305  -2.996  -5.662  1.00 0.00 ? 57  GLU A O    3  
ATOM 4344  C CB   . GLU A 1 57  ? -12.255 -1.753  -4.397  1.00 0.00 ? 57  GLU A CB   3  
ATOM 4345  C CG   . GLU A 1 57  ? -13.049 -1.309  -3.167  1.00 0.00 ? 57  GLU A CG   3  
ATOM 4346  C CD   . GLU A 1 57  ? -14.352 -2.100  -3.041  1.00 0.00 ? 57  GLU A CD   3  
ATOM 4347  O OE1  . GLU A 1 57  ? -14.299 -3.325  -3.285  1.00 0.00 ? 57  GLU A OE1  3  
ATOM 4348  O OE2  . GLU A 1 57  ? -15.373 -1.462  -2.704  1.00 0.00 ? 57  GLU A OE2  3  
ATOM 4349  H H    . GLU A 1 57  ? -10.445 -0.056  -4.219  1.00 0.00 ? 57  GLU A H    3  
ATOM 4350  H HA   . GLU A 1 57  ? -10.778 -2.413  -2.980  1.00 0.00 ? 57  GLU A HA   3  
ATOM 4351  H HB2  . GLU A 1 57  ? -12.261 -0.960  -5.144  1.00 0.00 ? 57  GLU A HB2  3  
ATOM 4352  H HB3  . GLU A 1 57  ? -12.734 -2.622  -4.849  1.00 0.00 ? 57  GLU A HB3  3  
ATOM 4353  H HG2  . GLU A 1 57  ? -12.446 -1.450  -2.270  1.00 0.00 ? 57  GLU A HG2  3  
ATOM 4354  H HG3  . GLU A 1 57  ? -13.271 -0.244  -3.238  1.00 0.00 ? 57  GLU A HG3  3  
ATOM 4355  N N    . TYR A 1 58  ? -10.893 -4.370  -4.822  1.00 0.00 ? 58  TYR A N    3  
ATOM 4356  C CA   . TYR A 1 58  ? -10.479 -5.515  -5.615  1.00 0.00 ? 58  TYR A CA   3  
ATOM 4357  C C    . TYR A 1 58  ? -10.334 -5.136  -7.090  1.00 0.00 ? 58  TYR A C    3  
ATOM 4358  O O    . TYR A 1 58  ? -9.245  -5.231  -7.655  1.00 0.00 ? 58  TYR A O    3  
ATOM 4359  C CB   . TYR A 1 58  ? -11.597 -6.551  -5.475  1.00 0.00 ? 58  TYR A CB   3  
ATOM 4360  C CG   . TYR A 1 58  ? -11.406 -7.794  -6.345  1.00 0.00 ? 58  TYR A CG   3  
ATOM 4361  C CD1  . TYR A 1 58  ? -10.371 -8.668  -6.083  1.00 0.00 ? 58  TYR A CD1  3  
ATOM 4362  C CD2  . TYR A 1 58  ? -12.269 -8.042  -7.393  1.00 0.00 ? 58  TYR A CD2  3  
ATOM 4363  C CE1  . TYR A 1 58  ? -10.191 -9.839  -6.902  1.00 0.00 ? 58  TYR A CE1  3  
ATOM 4364  C CE2  . TYR A 1 58  ? -12.089 -9.212  -8.213  1.00 0.00 ? 58  TYR A CE2  3  
ATOM 4365  C CZ   . TYR A 1 58  ? -11.059 -10.053 -7.927  1.00 0.00 ? 58  TYR A CZ   3  
ATOM 4366  O OH   . TYR A 1 58  ? -10.889 -11.158 -8.701  1.00 0.00 ? 58  TYR A OH   3  
ATOM 4367  H H    . TYR A 1 58  ? -11.671 -4.535  -4.215  1.00 0.00 ? 58  TYR A H    3  
ATOM 4368  H HA   . TYR A 1 58  ? -9.515  -5.855  -5.238  1.00 0.00 ? 58  TYR A HA   3  
ATOM 4369  H HB2  . TYR A 1 58  ? -11.665 -6.858  -4.431  1.00 0.00 ? 58  TYR A HB2  3  
ATOM 4370  H HB3  . TYR A 1 58  ? -12.547 -6.082  -5.732  1.00 0.00 ? 58  TYR A HB3  3  
ATOM 4371  H HD1  . TYR A 1 58  ? -9.689  -8.472  -5.255  1.00 0.00 ? 58  TYR A HD1  3  
ATOM 4372  H HD2  . TYR A 1 58  ? -13.087 -7.352  -7.601  1.00 0.00 ? 58  TYR A HD2  3  
ATOM 4373  H HE1  . TYR A 1 58  ? -9.377  -10.537 -6.706  1.00 0.00 ? 58  TYR A HE1  3  
ATOM 4374  H HE2  . TYR A 1 58  ? -12.763 -9.420  -9.044  1.00 0.00 ? 58  TYR A HE2  3  
ATOM 4375  H HH   . TYR A 1 58  ? -11.258 -10.995 -9.616  1.00 0.00 ? 58  TYR A HH   3  
ATOM 4376  N N    . ASN A 1 59  ? -11.447 -4.716  -7.673  1.00 0.00 ? 59  ASN A N    3  
ATOM 4377  C CA   . ASN A 1 59  ? -11.457 -4.323  -9.072  1.00 0.00 ? 59  ASN A CA   3  
ATOM 4378  C C    . ASN A 1 59  ? -12.019 -2.905  -9.194  1.00 0.00 ? 59  ASN A C    3  
ATOM 4379  O O    . ASN A 1 59  ? -13.126 -2.713  -9.697  1.00 0.00 ? 59  ASN A O    3  
ATOM 4380  C CB   . ASN A 1 59  ? -12.343 -5.256  -9.900  1.00 0.00 ? 59  ASN A CB   3  
ATOM 4381  C CG   . ASN A 1 59  ? -12.331 -4.856  -11.376 1.00 0.00 ? 59  ASN A CG   3  
ATOM 4382  O OD1  . ASN A 1 59  ? -11.623 -3.955  -11.797 1.00 0.00 ? 59  ASN A OD1  3  
ATOM 4383  N ND2  . ASN A 1 59  ? -13.152 -5.573  -12.138 1.00 0.00 ? 59  ASN A ND2  3  
ATOM 4384  H H    . ASN A 1 59  ? -12.329 -4.642  -7.207  1.00 0.00 ? 59  ASN A H    3  
ATOM 4385  H HA   . ASN A 1 59  ? -10.419 -4.389  -9.395  1.00 0.00 ? 59  ASN A HA   3  
ATOM 4386  H HB2  . ASN A 1 59  ? -11.994 -6.283  -9.795  1.00 0.00 ? 59  ASN A HB2  3  
ATOM 4387  H HB3  . ASN A 1 59  ? -13.364 -5.226  -9.520  1.00 0.00 ? 59  ASN A HB3  3  
ATOM 4388  H HD21 . ASN A 1 59  ? -13.706 -6.299  -11.730 1.00 0.00 ? 59  ASN A HD21 3  
ATOM 4389  H HD22 . ASN A 1 59  ? -13.215 -5.387  -13.119 1.00 0.00 ? 59  ASN A HD22 3  
ATOM 4390  N N    . ARG A 1 60  ? -11.232 -1.948  -8.726  1.00 0.00 ? 60  ARG A N    3  
ATOM 4391  C CA   . ARG A 1 60  ? -11.637 -0.553  -8.777  1.00 0.00 ? 60  ARG A CA   3  
ATOM 4392  C C    . ARG A 1 60  ? -10.407 0.356   -8.803  1.00 0.00 ? 60  ARG A C    3  
ATOM 4393  O O    . ARG A 1 60  ? -9.753  0.551   -7.780  1.00 0.00 ? 60  ARG A O    3  
ATOM 4394  C CB   . ARG A 1 60  ? -12.507 -0.188  -7.572  1.00 0.00 ? 60  ARG A CB   3  
ATOM 4395  C CG   . ARG A 1 60  ? -13.472 -1.325  -7.228  1.00 0.00 ? 60  ARG A CG   3  
ATOM 4396  C CD   . ARG A 1 60  ? -14.433 -0.909  -6.113  1.00 0.00 ? 60  ARG A CD   3  
ATOM 4397  N NE   . ARG A 1 60  ? -15.759 -0.582  -6.683  1.00 0.00 ? 60  ARG A NE   3  
ATOM 4398  C CZ   . ARG A 1 60  ? -16.648 -1.497  -7.091  1.00 0.00 ? 60  ARG A CZ   3  
ATOM 4399  N NH1  . ARG A 1 60  ? -16.359 -2.802  -6.995  1.00 0.00 ? 60  ARG A NH1  3  
ATOM 4400  N NH2  . ARG A 1 60  ? -17.827 -1.108  -7.596  1.00 0.00 ? 60  ARG A NH2  3  
ATOM 4401  H H    . ARG A 1 60  ? -10.334 -2.112  -8.318  1.00 0.00 ? 60  ARG A H    3  
ATOM 4402  H HA   . ARG A 1 60  ? -12.211 -0.464  -9.699  1.00 0.00 ? 60  ARG A HA   3  
ATOM 4403  H HB2  . ARG A 1 60  ? -11.872 0.027   -6.713  1.00 0.00 ? 60  ARG A HB2  3  
ATOM 4404  H HB3  . ARG A 1 60  ? -13.071 0.719   -7.788  1.00 0.00 ? 60  ARG A HB3  3  
ATOM 4405  H HG2  . ARG A 1 60  ? -14.039 -1.607  -8.116  1.00 0.00 ? 60  ARG A HG2  3  
ATOM 4406  H HG3  . ARG A 1 60  ? -12.908 -2.205  -6.918  1.00 0.00 ? 60  ARG A HG3  3  
ATOM 4407  H HD2  . ARG A 1 60  ? -14.530 -1.716  -5.386  1.00 0.00 ? 60  ARG A HD2  3  
ATOM 4408  H HD3  . ARG A 1 60  ? -14.034 -0.046  -5.580  1.00 0.00 ? 60  ARG A HD3  3  
ATOM 4409  H HE   . ARG A 1 60  ? -16.007 0.383   -6.770  1.00 0.00 ? 60  ARG A HE   3  
ATOM 4410  H HH11 . ARG A 1 60  ? -15.480 -3.093  -6.618  1.00 0.00 ? 60  ARG A HH11 3  
ATOM 4411  H HH12 . ARG A 1 60  ? -17.023 -3.485  -7.299  1.00 0.00 ? 60  ARG A HH12 3  
ATOM 4412  H HH21 . ARG A 1 60  ? -18.043 -0.134  -7.668  1.00 0.00 ? 60  ARG A HH21 3  
ATOM 4413  H HH22 . ARG A 1 60  ? -18.491 -1.791  -7.901  1.00 0.00 ? 60  ARG A HH22 3  
ATOM 4414  N N    . THR A 1 61  ? -10.130 0.889   -9.984  1.00 0.00 ? 61  THR A N    3  
ATOM 4415  C CA   . THR A 1 61  ? -8.990  1.773   -10.157 1.00 0.00 ? 61  THR A CA   3  
ATOM 4416  C C    . THR A 1 61  ? -9.384  3.218   -9.845  1.00 0.00 ? 61  THR A C    3  
ATOM 4417  O O    . THR A 1 61  ? -8.548  4.119   -9.900  1.00 0.00 ? 61  THR A O    3  
ATOM 4418  C CB   . THR A 1 61  ? -8.455  1.582   -11.578 1.00 0.00 ? 61  THR A CB   3  
ATOM 4419  O OG1  . THR A 1 61  ? -8.081  0.208   -11.626 1.00 0.00 ? 61  THR A OG1  3  
ATOM 4420  C CG2  . THR A 1 61  ? -7.144  2.334   -11.815 1.00 0.00 ? 61  THR A CG2  3  
ATOM 4421  H H    . THR A 1 61  ? -10.668 0.726   -10.811 1.00 0.00 ? 61  THR A H    3  
ATOM 4422  H HA   . THR A 1 61  ? -8.222  1.489   -9.438  1.00 0.00 ? 61  THR A HA   3  
ATOM 4423  H HB   . THR A 1 61  ? -9.205  1.864   -12.317 1.00 0.00 ? 61  THR A HB   3  
ATOM 4424  H HG1  . THR A 1 61  ? -7.879  -0.058  -12.569 1.00 0.00 ? 61  THR A HG1  3  
ATOM 4425  H HG21 . THR A 1 61  ? -6.389  1.979   -11.114 1.00 0.00 ? 61  THR A HG21 3  
ATOM 4426  H HG22 . THR A 1 61  ? -6.803  2.157   -12.836 1.00 0.00 ? 61  THR A HG22 3  
ATOM 4427  H HG23 . THR A 1 61  ? -7.304  3.402   -11.666 1.00 0.00 ? 61  THR A HG23 3  
ATOM 4428  N N    . ASN A 1 62  ? -10.658 3.395   -9.526  1.00 0.00 ? 62  ASN A N    3  
ATOM 4429  C CA   . ASN A 1 62  ? -11.173 4.715   -9.205  1.00 0.00 ? 62  ASN A CA   3  
ATOM 4430  C C    . ASN A 1 62  ? -10.939 5.003   -7.721  1.00 0.00 ? 62  ASN A C    3  
ATOM 4431  O O    . ASN A 1 62  ? -10.737 6.152   -7.332  1.00 0.00 ? 62  ASN A O    3  
ATOM 4432  C CB   . ASN A 1 62  ? -12.677 4.799   -9.471  1.00 0.00 ? 62  ASN A CB   3  
ATOM 4433  C CG   . ASN A 1 62  ? -13.107 6.243   -9.740  1.00 0.00 ? 62  ASN A CG   3  
ATOM 4434  O OD1  . ASN A 1 62  ? -12.443 6.997   -10.431 1.00 0.00 ? 62  ASN A OD1  3  
ATOM 4435  N ND2  . ASN A 1 62  ? -14.252 6.584   -9.156  1.00 0.00 ? 62  ASN A ND2  3  
ATOM 4436  H H    . ASN A 1 62  ? -11.331 2.657   -9.484  1.00 0.00 ? 62  ASN A H    3  
ATOM 4437  H HA   . ASN A 1 62  ? -10.628 5.401   -9.854  1.00 0.00 ? 62  ASN A HA   3  
ATOM 4438  H HB2  . ASN A 1 62  ? -12.934 4.174   -10.327 1.00 0.00 ? 62  ASN A HB2  3  
ATOM 4439  H HB3  . ASN A 1 62  ? -13.225 4.406   -8.614  1.00 0.00 ? 62  ASN A HB3  3  
ATOM 4440  H HD21 . ASN A 1 62  ? -14.749 5.916   -8.601  1.00 0.00 ? 62  ASN A HD21 3  
ATOM 4441  H HD22 . ASN A 1 62  ? -14.617 7.507   -9.272  1.00 0.00 ? 62  ASN A HD22 3  
ATOM 4442  N N    . THR A 1 63  ? -10.974 3.939   -6.932  1.00 0.00 ? 63  THR A N    3  
ATOM 4443  C CA   . THR A 1 63  ? -10.768 4.062   -5.499  1.00 0.00 ? 63  THR A CA   3  
ATOM 4444  C C    . THR A 1 63  ? -9.285  3.904   -5.158  1.00 0.00 ? 63  THR A C    3  
ATOM 4445  O O    . THR A 1 63  ? -8.940  3.482   -4.055  1.00 0.00 ? 63  THR A O    3  
ATOM 4446  C CB   . THR A 1 63  ? -11.665 3.037   -4.802  1.00 0.00 ? 63  THR A CB   3  
ATOM 4447  O OG1  . THR A 1 63  ? -11.345 1.805   -5.442  1.00 0.00 ? 63  THR A OG1  3  
ATOM 4448  C CG2  . THR A 1 63  ? -13.147 3.247   -5.117  1.00 0.00 ? 63  THR A CG2  3  
ATOM 4449  H H    . THR A 1 63  ? -11.138 3.007   -7.256  1.00 0.00 ? 63  THR A H    3  
ATOM 4450  H HA   . THR A 1 63  ? -11.060 5.068   -5.195  1.00 0.00 ? 63  THR A HA   3  
ATOM 4451  H HB   . THR A 1 63  ? -11.491 3.036   -3.726  1.00 0.00 ? 63  THR A HB   3  
ATOM 4452  H HG1  . THR A 1 63  ? -11.843 1.054   -5.007  1.00 0.00 ? 63  THR A HG1  3  
ATOM 4453  H HG21 . THR A 1 63  ? -13.651 2.281   -5.153  1.00 0.00 ? 63  THR A HG21 3  
ATOM 4454  H HG22 . THR A 1 63  ? -13.600 3.863   -4.340  1.00 0.00 ? 63  THR A HG22 3  
ATOM 4455  H HG23 . THR A 1 63  ? -13.247 3.746   -6.081  1.00 0.00 ? 63  THR A HG23 3  
ATOM 4456  N N    . ARG A 1 64  ? -8.448  4.250   -6.124  1.00 0.00 ? 64  ARG A N    3  
ATOM 4457  C CA   . ARG A 1 64  ? -7.010  4.152   -5.940  1.00 0.00 ? 64  ARG A CA   3  
ATOM 4458  C C    . ARG A 1 64  ? -6.450  5.474   -5.411  1.00 0.00 ? 64  ARG A C    3  
ATOM 4459  O O    . ARG A 1 64  ? -6.733  6.536   -5.962  1.00 0.00 ? 64  ARG A O    3  
ATOM 4460  C CB   . ARG A 1 64  ? -6.309  3.799   -7.253  1.00 0.00 ? 64  ARG A CB   3  
ATOM 4461  C CG   . ARG A 1 64  ? -4.846  3.423   -7.011  1.00 0.00 ? 64  ARG A CG   3  
ATOM 4462  C CD   . ARG A 1 64  ? -3.956  3.920   -8.152  1.00 0.00 ? 64  ARG A CD   3  
ATOM 4463  N NE   . ARG A 1 64  ? -2.624  4.296   -7.627  1.00 0.00 ? 64  ARG A NE   3  
ATOM 4464  C CZ   . ARG A 1 64  ? -1.579  4.628   -8.399  1.00 0.00 ? 64  ARG A CZ   3  
ATOM 4465  N NH1  . ARG A 1 64  ? -1.706  4.632   -9.733  1.00 0.00 ? 64  ARG A NH1  3  
ATOM 4466  N NH2  . ARG A 1 64  ? -0.408  4.955   -7.836  1.00 0.00 ? 64  ARG A NH2  3  
ATOM 4467  H H    . ARG A 1 64  ? -8.737  4.593   -7.018  1.00 0.00 ? 64  ARG A H    3  
ATOM 4468  H HA   . ARG A 1 64  ? -6.876  3.350   -5.213  1.00 0.00 ? 64  ARG A HA   3  
ATOM 4469  H HB2  . ARG A 1 64  ? -6.826  2.968   -7.734  1.00 0.00 ? 64  ARG A HB2  3  
ATOM 4470  H HB3  . ARG A 1 64  ? -6.362  4.646   -7.937  1.00 0.00 ? 64  ARG A HB3  3  
ATOM 4471  H HG2  . ARG A 1 64  ? -4.508  3.853   -6.068  1.00 0.00 ? 64  ARG A HG2  3  
ATOM 4472  H HG3  . ARG A 1 64  ? -4.755  2.341   -6.919  1.00 0.00 ? 64  ARG A HG3  3  
ATOM 4473  H HD2  . ARG A 1 64  ? -3.852  3.142   -8.908  1.00 0.00 ? 64  ARG A HD2  3  
ATOM 4474  H HD3  . ARG A 1 64  ? -4.419  4.778   -8.639  1.00 0.00 ? 64  ARG A HD3  3  
ATOM 4475  H HE   . ARG A 1 64  ? -2.495  4.303   -6.636  1.00 0.00 ? 64  ARG A HE   3  
ATOM 4476  H HH11 . ARG A 1 64  ? -2.580  4.387   -10.153 1.00 0.00 ? 64  ARG A HH11 3  
ATOM 4477  H HH12 . ARG A 1 64  ? -0.926  4.879   -10.308 1.00 0.00 ? 64  ARG A HH12 3  
ATOM 4478  H HH21 . ARG A 1 64  ? -0.313  4.952   -6.840  1.00 0.00 ? 64  ARG A HH21 3  
ATOM 4479  H HH22 . ARG A 1 64  ? 0.372   5.203   -8.411  1.00 0.00 ? 64  ARG A HH22 3  
ATOM 4480  N N    . VAL A 1 65  ? -5.667  5.365   -4.348  1.00 0.00 ? 65  VAL A N    3  
ATOM 4481  C CA   . VAL A 1 65  ? -5.065  6.539   -3.738  1.00 0.00 ? 65  VAL A CA   3  
ATOM 4482  C C    . VAL A 1 65  ? -3.565  6.551   -4.037  1.00 0.00 ? 65  VAL A C    3  
ATOM 4483  O O    . VAL A 1 65  ? -2.987  5.519   -4.373  1.00 0.00 ? 65  VAL A O    3  
ATOM 4484  C CB   . VAL A 1 65  ? -5.377  6.568   -2.241  1.00 0.00 ? 65  VAL A CB   3  
ATOM 4485  C CG1  . VAL A 1 65  ? -4.896  7.875   -1.606  1.00 0.00 ? 65  VAL A CG1  3  
ATOM 4486  C CG2  . VAL A 1 65  ? -6.870  6.352   -1.987  1.00 0.00 ? 65  VAL A CG2  3  
ATOM 4487  H H    . VAL A 1 65  ? -5.442  4.497   -3.906  1.00 0.00 ? 65  VAL A H    3  
ATOM 4488  H HA   . VAL A 1 65  ? -5.521  7.417   -4.195  1.00 0.00 ? 65  VAL A HA   3  
ATOM 4489  H HB   . VAL A 1 65  ? -4.835  5.748   -1.770  1.00 0.00 ? 65  VAL A HB   3  
ATOM 4490  H HG11 . VAL A 1 65  ? -5.172  7.890   -0.552  1.00 0.00 ? 65  VAL A HG11 3  
ATOM 4491  H HG12 . VAL A 1 65  ? -3.813  7.947   -1.699  1.00 0.00 ? 65  VAL A HG12 3  
ATOM 4492  H HG13 . VAL A 1 65  ? -5.362  8.719   -2.116  1.00 0.00 ? 65  VAL A HG13 3  
ATOM 4493  H HG21 . VAL A 1 65  ? -7.120  5.305   -2.161  1.00 0.00 ? 65  VAL A HG21 3  
ATOM 4494  H HG22 . VAL A 1 65  ? -7.105  6.615   -0.955  1.00 0.00 ? 65  VAL A HG22 3  
ATOM 4495  H HG23 . VAL A 1 65  ? -7.448  6.981   -2.663  1.00 0.00 ? 65  VAL A HG23 3  
ATOM 4496  N N    . THR A 1 66  ? -2.977  7.731   -3.905  1.00 0.00 ? 66  THR A N    3  
ATOM 4497  C CA   . THR A 1 66  ? -1.555  7.892   -4.156  1.00 0.00 ? 66  THR A CA   3  
ATOM 4498  C C    . THR A 1 66  ? -0.884  8.611   -2.985  1.00 0.00 ? 66  THR A C    3  
ATOM 4499  O O    . THR A 1 66  ? -1.202  9.764   -2.695  1.00 0.00 ? 66  THR A O    3  
ATOM 4500  C CB   . THR A 1 66  ? -1.391  8.621   -5.491  1.00 0.00 ? 66  THR A CB   3  
ATOM 4501  O OG1  . THR A 1 66  ? -2.132  7.827   -6.414  1.00 0.00 ? 66  THR A OG1  3  
ATOM 4502  C CG2  . THR A 1 66  ? 0.045   8.562   -6.018  1.00 0.00 ? 66  THR A CG2  3  
ATOM 4503  H H    . THR A 1 66  ? -3.455  8.566   -3.631  1.00 0.00 ? 66  THR A H    3  
ATOM 4504  H HA   . THR A 1 66  ? -1.104  6.902   -4.224  1.00 0.00 ? 66  THR A HA   3  
ATOM 4505  H HB   . THR A 1 66  ? -1.736  9.652   -5.417  1.00 0.00 ? 66  THR A HB   3  
ATOM 4506  H HG1  . THR A 1 66  ? -2.544  8.410   -7.114  1.00 0.00 ? 66  THR A HG1  3  
ATOM 4507  H HG21 . THR A 1 66  ? 0.406   9.573   -6.202  1.00 0.00 ? 66  THR A HG21 3  
ATOM 4508  H HG22 . THR A 1 66  ? 0.683   8.077   -5.279  1.00 0.00 ? 66  THR A HG22 3  
ATOM 4509  H HG23 . THR A 1 66  ? 0.068   7.993   -6.947  1.00 0.00 ? 66  THR A HG23 3  
ATOM 4510  N N    . HIS A 1 67  ? 0.032   7.901   -2.342  1.00 0.00 ? 67  HIS A N    3  
ATOM 4511  C CA   . HIS A 1 67  ? 0.751   8.457   -1.209  1.00 0.00 ? 67  HIS A CA   3  
ATOM 4512  C C    . HIS A 1 67  ? 2.252   8.221   -1.387  1.00 0.00 ? 67  HIS A C    3  
ATOM 4513  O O    . HIS A 1 67  ? 2.665   7.171   -1.876  1.00 0.00 ? 67  HIS A O    3  
ATOM 4514  C CB   . HIS A 1 67  ? 0.213   7.890   0.107   1.00 0.00 ? 67  HIS A CB   3  
ATOM 4515  C CG   . HIS A 1 67  ? -1.130  7.212   -0.020  1.00 0.00 ? 67  HIS A CG   3  
ATOM 4516  N ND1  . HIS A 1 67  ? -1.349  6.133   -0.857  1.00 0.00 ? 67  HIS A ND1  3  
ATOM 4517  C CD2  . HIS A 1 67  ? -2.321  7.472   0.593   1.00 0.00 ? 67  HIS A CD2  3  
ATOM 4518  C CE1  . HIS A 1 67  ? -2.618  5.767   -0.746  1.00 0.00 ? 67  HIS A CE1  3  
ATOM 4519  N NE2  . HIS A 1 67  ? -3.218  6.599   0.153   1.00 0.00 ? 67  HIS A NE2  3  
ATOM 4520  H H    . HIS A 1 67  ? 0.284   6.964   -2.584  1.00 0.00 ? 67  HIS A H    3  
ATOM 4521  H HA   . HIS A 1 67  ? 0.557   9.530   -1.212  1.00 0.00 ? 67  HIS A HA   3  
ATOM 4522  H HB2  . HIS A 1 67  ? 0.934   7.175   0.503   1.00 0.00 ? 67  HIS A HB2  3  
ATOM 4523  H HB3  . HIS A 1 67  ? 0.134   8.698   0.834   1.00 0.00 ? 67  HIS A HB3  3  
ATOM 4524  H HD1  . HIS A 1 67  ? -0.666  5.701   -1.447  1.00 0.00 ? 67  HIS A HD1  3  
ATOM 4525  H HD2  . HIS A 1 67  ? -2.503  8.262   1.321   1.00 0.00 ? 67  HIS A HD2  3  
ATOM 4526  H HE1  . HIS A 1 67  ? -3.097  4.946   -1.279  1.00 0.00 ? 67  HIS A HE1  3  
ATOM 4527  N N    . TYR A 1 68  ? 3.027   9.216   -0.980  1.00 0.00 ? 68  TYR A N    3  
ATOM 4528  C CA   . TYR A 1 68  ? 4.473   9.130   -1.089  1.00 0.00 ? 68  TYR A CA   3  
ATOM 4529  C C    . TYR A 1 68  ? 5.136   9.283   0.282   1.00 0.00 ? 68  TYR A C    3  
ATOM 4530  O O    . TYR A 1 68  ? 5.225   10.389  0.812   1.00 0.00 ? 68  TYR A O    3  
ATOM 4531  C CB   . TYR A 1 68  ? 4.900   10.297  -1.981  1.00 0.00 ? 68  TYR A CB   3  
ATOM 4532  C CG   . TYR A 1 68  ? 4.207   10.323  -3.345  1.00 0.00 ? 68  TYR A CG   3  
ATOM 4533  C CD1  . TYR A 1 68  ? 4.462   9.328   -4.267  1.00 0.00 ? 68  TYR A CD1  3  
ATOM 4534  C CD2  . TYR A 1 68  ? 3.328   11.341  -3.654  1.00 0.00 ? 68  TYR A CD2  3  
ATOM 4535  C CE1  . TYR A 1 68  ? 3.810   9.352   -5.551  1.00 0.00 ? 68  TYR A CE1  3  
ATOM 4536  C CE2  . TYR A 1 68  ? 2.676   11.365  -4.937  1.00 0.00 ? 68  TYR A CE2  3  
ATOM 4537  C CZ   . TYR A 1 68  ? 2.949   10.369  -5.823  1.00 0.00 ? 68  TYR A CZ   3  
ATOM 4538  O OH   . TYR A 1 68  ? 2.334   10.392  -7.035  1.00 0.00 ? 68  TYR A OH   3  
ATOM 4539  H H    . TYR A 1 68  ? 2.683   10.067  -0.584  1.00 0.00 ? 68  TYR A H    3  
ATOM 4540  H HA   . TYR A 1 68  ? 4.722   8.150   -1.497  1.00 0.00 ? 68  TYR A HA   3  
ATOM 4541  H HB2  . TYR A 1 68  ? 4.692   11.233  -1.462  1.00 0.00 ? 68  TYR A HB2  3  
ATOM 4542  H HB3  . TYR A 1 68  ? 5.978   10.250  -2.133  1.00 0.00 ? 68  TYR A HB3  3  
ATOM 4543  H HD1  . TYR A 1 68  ? 5.156   8.524   -4.023  1.00 0.00 ? 68  TYR A HD1  3  
ATOM 4544  H HD2  . TYR A 1 68  ? 3.127   12.127  -2.925  1.00 0.00 ? 68  TYR A HD2  3  
ATOM 4545  H HE1  . TYR A 1 68  ? 4.002   8.573   -6.288  1.00 0.00 ? 68  TYR A HE1  3  
ATOM 4546  H HE2  . TYR A 1 68  ? 1.979   12.163  -5.194  1.00 0.00 ? 68  TYR A HE2  3  
ATOM 4547  H HH   . TYR A 1 68  ? 2.377   9.487   -7.458  1.00 0.00 ? 68  TYR A HH   3  
ATOM 4548  N N    . LEU A 1 69  ? 5.584   8.156   0.816   1.00 0.00 ? 69  LEU A N    3  
ATOM 4549  C CA   . LEU A 1 69  ? 6.236   8.151   2.115   1.00 0.00 ? 69  LEU A CA   3  
ATOM 4550  C C    . LEU A 1 69  ? 7.753   8.151   1.918   1.00 0.00 ? 69  LEU A C    3  
ATOM 4551  O O    . LEU A 1 69  ? 8.243   7.823   0.839   1.00 0.00 ? 69  LEU A O    3  
ATOM 4552  C CB   . LEU A 1 69  ? 5.726   6.986   2.965   1.00 0.00 ? 69  LEU A CB   3  
ATOM 4553  C CG   . LEU A 1 69  ? 4.252   6.618   2.784   1.00 0.00 ? 69  LEU A CG   3  
ATOM 4554  C CD1  . LEU A 1 69  ? 4.036   5.114   2.960   1.00 0.00 ? 69  LEU A CD1  3  
ATOM 4555  C CD2  . LEU A 1 69  ? 3.363   7.438   3.722   1.00 0.00 ? 69  LEU A CD2  3  
ATOM 4556  H H    . LEU A 1 69  ? 5.508   7.260   0.378   1.00 0.00 ? 69  LEU A H    3  
ATOM 4557  H HA   . LEU A 1 69  ? 5.954   9.071   2.626   1.00 0.00 ? 69  LEU A HA   3  
ATOM 4558  H HB2  . LEU A 1 69  ? 6.329   6.106   2.741   1.00 0.00 ? 69  LEU A HB2  3  
ATOM 4559  H HB3  . LEU A 1 69  ? 5.893   7.228   4.015   1.00 0.00 ? 69  LEU A HB3  3  
ATOM 4560  H HG   . LEU A 1 69  ? 3.960   6.868   1.764   1.00 0.00 ? 69  LEU A HG   3  
ATOM 4561  H HD11 . LEU A 1 69  ? 4.869   4.691   3.522   1.00 0.00 ? 69  LEU A HD11 3  
ATOM 4562  H HD12 . LEU A 1 69  ? 3.107   4.941   3.503   1.00 0.00 ? 69  LEU A HD12 3  
ATOM 4563  H HD13 . LEU A 1 69  ? 3.980   4.638   1.981   1.00 0.00 ? 69  LEU A HD13 3  
ATOM 4564  H HD21 . LEU A 1 69  ? 2.316   7.277   3.462   1.00 0.00 ? 69  LEU A HD21 3  
ATOM 4565  H HD22 . LEU A 1 69  ? 3.534   7.124   4.751   1.00 0.00 ? 69  LEU A HD22 3  
ATOM 4566  H HD23 . LEU A 1 69  ? 3.605   8.496   3.619   1.00 0.00 ? 69  LEU A HD23 3  
ATOM 4567  N N    . PRO A 1 70  ? 8.474   8.532   3.007   1.00 0.00 ? 70  PRO A N    3  
ATOM 4568  C CA   . PRO A 1 70  ? 9.925   8.579   2.966   1.00 0.00 ? 70  PRO A CA   3  
ATOM 4569  C C    . PRO A 1 70  ? 10.521  7.171   3.021   1.00 0.00 ? 70  PRO A C    3  
ATOM 4570  O O    . PRO A 1 70  ? 9.793   6.190   3.165   1.00 0.00 ? 70  PRO A O    3  
ATOM 4571  C CB   . PRO A 1 70  ? 10.325  9.440   4.152   1.00 0.00 ? 70  PRO A CB   3  
ATOM 4572  C CG   . PRO A 1 70  ? 9.120   9.459   5.079   1.00 0.00 ? 70  PRO A CG   3  
ATOM 4573  C CD   . PRO A 1 70  ? 7.927   8.927   4.302   1.00 0.00 ? 70  PRO A CD   3  
ATOM 4574  H HA   . PRO A 1 70  ? 10.235  8.973   2.100   1.00 0.00 ? 70  PRO A HA   3  
ATOM 4575  H HB2  . PRO A 1 70  ? 11.199  9.029   4.657   1.00 0.00 ? 70  PRO A HB2  3  
ATOM 4576  H HB3  . PRO A 1 70  ? 10.588  10.449  3.832   1.00 0.00 ? 70  PRO A HB3  3  
ATOM 4577  H HG2  . PRO A 1 70  ? 9.307   8.846   5.960   1.00 0.00 ? 70  PRO A HG2  3  
ATOM 4578  H HG3  . PRO A 1 70  ? 8.926   10.472  5.431   1.00 0.00 ? 70  PRO A HG3  3  
ATOM 4579  H HD2  . PRO A 1 70  ? 7.468   8.080   4.813   1.00 0.00 ? 70  PRO A HD2  3  
ATOM 4580  H HD3  . PRO A 1 70  ? 7.155   9.688   4.191   1.00 0.00 ? 70  PRO A HD3  3  
ATOM 4581  N N    . ASN A 1 71  ? 11.840  7.116   2.905   1.00 0.00 ? 71  ASN A N    3  
ATOM 4582  C CA   . ASN A 1 71  ? 12.542  5.844   2.940   1.00 0.00 ? 71  ASN A CA   3  
ATOM 4583  C C    . ASN A 1 71  ? 12.777  5.436   4.396   1.00 0.00 ? 71  ASN A C    3  
ATOM 4584  O O    . ASN A 1 71  ? 13.602  4.568   4.676   1.00 0.00 ? 71  ASN A O    3  
ATOM 4585  C CB   . ASN A 1 71  ? 13.905  5.948   2.253   1.00 0.00 ? 71  ASN A CB   3  
ATOM 4586  C CG   . ASN A 1 71  ? 14.864  6.820   3.065   1.00 0.00 ? 71  ASN A CG   3  
ATOM 4587  O OD1  . ASN A 1 71  ? 14.467  7.734   3.770   1.00 0.00 ? 71  ASN A OD1  3  
ATOM 4588  N ND2  . ASN A 1 71  ? 16.144  6.489   2.928   1.00 0.00 ? 71  ASN A ND2  3  
ATOM 4589  H H    . ASN A 1 71  ? 12.425  7.918   2.788   1.00 0.00 ? 71  ASN A H    3  
ATOM 4590  H HA   . ASN A 1 71  ? 11.895  5.145   2.410   1.00 0.00 ? 71  ASN A HA   3  
ATOM 4591  H HB2  . ASN A 1 71  ? 14.330  4.952   2.128   1.00 0.00 ? 71  ASN A HB2  3  
ATOM 4592  H HB3  . ASN A 1 71  ? 13.782  6.369   1.255   1.00 0.00 ? 71  ASN A HB3  3  
ATOM 4593  H HD21 . ASN A 1 71  ? 16.403  5.728   2.333   1.00 0.00 ? 71  ASN A HD21 3  
ATOM 4594  H HD22 . ASN A 1 71  ? 16.849  7.001   3.420   1.00 0.00 ? 71  ASN A HD22 3  
ATOM 4595  N N    . VAL A 1 72  ? 12.035  6.081   5.284   1.00 0.00 ? 72  VAL A N    3  
ATOM 4596  C CA   . VAL A 1 72  ? 12.152  5.796   6.704   1.00 0.00 ? 72  VAL A CA   3  
ATOM 4597  C C    . VAL A 1 72  ? 10.865  5.130   7.194   1.00 0.00 ? 72  VAL A C    3  
ATOM 4598  O O    . VAL A 1 72  ? 10.853  4.493   8.246   1.00 0.00 ? 72  VAL A O    3  
ATOM 4599  C CB   . VAL A 1 72  ? 12.491  7.078   7.469   1.00 0.00 ? 72  VAL A CB   3  
ATOM 4600  C CG1  . VAL A 1 72  ? 13.755  7.732   6.909   1.00 0.00 ? 72  VAL A CG1  3  
ATOM 4601  C CG2  . VAL A 1 72  ? 11.314  8.054   7.451   1.00 0.00 ? 72  VAL A CG2  3  
ATOM 4602  H H    . VAL A 1 72  ? 11.366  6.786   5.049   1.00 0.00 ? 72  VAL A H    3  
ATOM 4603  H HA   . VAL A 1 72  ? 12.979  5.098   6.833   1.00 0.00 ? 72  VAL A HA   3  
ATOM 4604  H HB   . VAL A 1 72  ? 12.686  6.807   8.507   1.00 0.00 ? 72  VAL A HB   3  
ATOM 4605  H HG11 . VAL A 1 72  ? 13.650  7.863   5.832   1.00 0.00 ? 72  VAL A HG11 3  
ATOM 4606  H HG12 . VAL A 1 72  ? 13.901  8.704   7.380   1.00 0.00 ? 72  VAL A HG12 3  
ATOM 4607  H HG13 . VAL A 1 72  ? 14.616  7.096   7.115   1.00 0.00 ? 72  VAL A HG13 3  
ATOM 4608  H HG21 . VAL A 1 72  ? 11.167  8.465   8.450   1.00 0.00 ? 72  VAL A HG21 3  
ATOM 4609  H HG22 . VAL A 1 72  ? 11.524  8.864   6.752   1.00 0.00 ? 72  VAL A HG22 3  
ATOM 4610  H HG23 . VAL A 1 72  ? 10.411  7.530   7.138   1.00 0.00 ? 72  VAL A HG23 3  
ATOM 4611  N N    . THR A 1 73  ? 9.812   5.301   6.409   1.00 0.00 ? 73  THR A N    3  
ATOM 4612  C CA   . THR A 1 73  ? 8.522   4.725   6.749   1.00 0.00 ? 73  THR A CA   3  
ATOM 4613  C C    . THR A 1 73  ? 8.197   3.557   5.816   1.00 0.00 ? 73  THR A C    3  
ATOM 4614  O O    . THR A 1 73  ? 8.525   3.594   4.631   1.00 0.00 ? 73  THR A O    3  
ATOM 4615  C CB   . THR A 1 73  ? 7.479   5.844   6.710   1.00 0.00 ? 73  THR A CB   3  
ATOM 4616  O OG1  . THR A 1 73  ? 7.783   6.643   7.850   1.00 0.00 ? 73  THR A OG1  3  
ATOM 4617  C CG2  . THR A 1 73  ? 6.062   5.333   6.980   1.00 0.00 ? 73  THR A CG2  3  
ATOM 4618  H H    . THR A 1 73  ? 9.830   5.822   5.555   1.00 0.00 ? 73  THR A H    3  
ATOM 4619  H HA   . THR A 1 73  ? 8.583   4.320   7.759   1.00 0.00 ? 73  THR A HA   3  
ATOM 4620  H HB   . THR A 1 73  ? 7.525   6.385   5.765   1.00 0.00 ? 73  THR A HB   3  
ATOM 4621  H HG1  . THR A 1 73  ? 8.007   7.575   7.565   1.00 0.00 ? 73  THR A HG1  3  
ATOM 4622  H HG21 . THR A 1 73  ? 6.031   4.848   7.955   1.00 0.00 ? 73  THR A HG21 3  
ATOM 4623  H HG22 . THR A 1 73  ? 5.366   6.171   6.968   1.00 0.00 ? 73  THR A HG22 3  
ATOM 4624  H HG23 . THR A 1 73  ? 5.781   4.616   6.208   1.00 0.00 ? 73  THR A HG23 3  
ATOM 4625  N N    . LEU A 1 74  ? 7.555   2.548   6.386   1.00 0.00 ? 74  LEU A N    3  
ATOM 4626  C CA   . LEU A 1 74  ? 7.181   1.371   5.620   1.00 0.00 ? 74  LEU A CA   3  
ATOM 4627  C C    . LEU A 1 74  ? 5.759   0.952   5.997   1.00 0.00 ? 74  LEU A C    3  
ATOM 4628  O O    . LEU A 1 74  ? 5.307   -0.130  5.625   1.00 0.00 ? 74  LEU A O    3  
ATOM 4629  C CB   . LEU A 1 74  ? 8.218   0.261   5.803   1.00 0.00 ? 74  LEU A CB   3  
ATOM 4630  C CG   . LEU A 1 74  ? 9.671   0.717   5.946   1.00 0.00 ? 74  LEU A CG   3  
ATOM 4631  C CD1  . LEU A 1 74  ? 10.417  -0.140  6.970   1.00 0.00 ? 74  LEU A CD1  3  
ATOM 4632  C CD2  . LEU A 1 74  ? 10.377  0.732   4.588   1.00 0.00 ? 74  LEU A CD2  3  
ATOM 4633  H H    . LEU A 1 74  ? 7.291   2.525   7.350   1.00 0.00 ? 74  LEU A H    3  
ATOM 4634  H HA   . LEU A 1 74  ? 7.192   1.650   4.566   1.00 0.00 ? 74  LEU A HA   3  
ATOM 4635  H HB2  . LEU A 1 74  ? 7.951   -0.316  6.688   1.00 0.00 ? 74  LEU A HB2  3  
ATOM 4636  H HB3  . LEU A 1 74  ? 8.152   -0.415  4.950   1.00 0.00 ? 74  LEU A HB3  3  
ATOM 4637  H HG   . LEU A 1 74  ? 9.673   1.741   6.320   1.00 0.00 ? 74  LEU A HG   3  
ATOM 4638  H HD11 . LEU A 1 74  ? 9.884   -0.116  7.921   1.00 0.00 ? 74  LEU A HD11 3  
ATOM 4639  H HD12 . LEU A 1 74  ? 10.474  -1.168  6.612   1.00 0.00 ? 74  LEU A HD12 3  
ATOM 4640  H HD13 . LEU A 1 74  ? 11.424  0.253   7.109   1.00 0.00 ? 74  LEU A HD13 3  
ATOM 4641  H HD21 . LEU A 1 74  ? 10.834  1.708   4.427   1.00 0.00 ? 74  LEU A HD21 3  
ATOM 4642  H HD22 . LEU A 1 74  ? 11.149  -0.038  4.572   1.00 0.00 ? 74  LEU A HD22 3  
ATOM 4643  H HD23 . LEU A 1 74  ? 9.652   0.535   3.799   1.00 0.00 ? 74  LEU A HD23 3  
ATOM 4644  N N    . GLU A 1 75  ? 5.092   1.832   6.730   1.00 0.00 ? 75  GLU A N    3  
ATOM 4645  C CA   . GLU A 1 75  ? 3.730   1.567   7.162   1.00 0.00 ? 75  GLU A CA   3  
ATOM 4646  C C    . GLU A 1 75  ? 2.916   2.863   7.174   1.00 0.00 ? 75  GLU A C    3  
ATOM 4647  O O    . GLU A 1 75  ? 3.429   3.919   7.539   1.00 0.00 ? 75  GLU A O    3  
ATOM 4648  C CB   . GLU A 1 75  ? 3.712   0.895   8.536   1.00 0.00 ? 75  GLU A CB   3  
ATOM 4649  C CG   . GLU A 1 75  ? 4.300   1.817   9.605   1.00 0.00 ? 75  GLU A CG   3  
ATOM 4650  C CD   . GLU A 1 75  ? 5.729   1.401   9.962   1.00 0.00 ? 75  GLU A CD   3  
ATOM 4651  O OE1  . GLU A 1 75  ? 5.883   0.258   10.443  1.00 0.00 ? 75  GLU A OE1  3  
ATOM 4652  O OE2  . GLU A 1 75  ? 6.634   2.236   9.746   1.00 0.00 ? 75  GLU A OE2  3  
ATOM 4653  H H    . GLU A 1 75  ? 5.467   2.710   7.028   1.00 0.00 ? 75  GLU A H    3  
ATOM 4654  H HA   . GLU A 1 75  ? 3.321   0.880   6.422   1.00 0.00 ? 75  GLU A HA   3  
ATOM 4655  H HB2  . GLU A 1 75  ? 2.688   0.631   8.802   1.00 0.00 ? 75  GLU A HB2  3  
ATOM 4656  H HB3  . GLU A 1 75  ? 4.281   -0.034  8.498   1.00 0.00 ? 75  GLU A HB3  3  
ATOM 4657  H HG2  . GLU A 1 75  ? 4.297   2.846   9.246   1.00 0.00 ? 75  GLU A HG2  3  
ATOM 4658  H HG3  . GLU A 1 75  ? 3.676   1.789   10.498  1.00 0.00 ? 75  GLU A HG3  3  
ATOM 4659  N N    . TYR A 1 76  ? 1.661   2.739   6.769   1.00 0.00 ? 76  TYR A N    3  
ATOM 4660  C CA   . TYR A 1 76  ? 0.771   3.886   6.729   1.00 0.00 ? 76  TYR A CA   3  
ATOM 4661  C C    . TYR A 1 76  ? -0.675  3.469   7.003   1.00 0.00 ? 76  TYR A C    3  
ATOM 4662  O O    . TYR A 1 76  ? -1.105  2.395   6.584   1.00 0.00 ? 76  TYR A O    3  
ATOM 4663  C CB   . TYR A 1 76  ? 0.867   4.445   5.307   1.00 0.00 ? 76  TYR A CB   3  
ATOM 4664  C CG   . TYR A 1 76  ? -0.045  5.646   5.048   1.00 0.00 ? 76  TYR A CG   3  
ATOM 4665  C CD1  . TYR A 1 76  ? -1.372  5.448   4.724   1.00 0.00 ? 76  TYR A CD1  3  
ATOM 4666  C CD2  . TYR A 1 76  ? 0.460   6.927   5.137   1.00 0.00 ? 76  TYR A CD2  3  
ATOM 4667  C CE1  . TYR A 1 76  ? -2.230  6.578   4.480   1.00 0.00 ? 76  TYR A CE1  3  
ATOM 4668  C CE2  . TYR A 1 76  ? -0.398  8.057   4.892   1.00 0.00 ? 76  TYR A CE2  3  
ATOM 4669  C CZ   . TYR A 1 76  ? -1.701  7.827   4.576   1.00 0.00 ? 76  TYR A CZ   3  
ATOM 4670  O OH   . TYR A 1 76  ? -2.511  8.895   4.345   1.00 0.00 ? 76  TYR A OH   3  
ATOM 4671  H H    . TYR A 1 76  ? 1.251   1.876   6.473   1.00 0.00 ? 76  TYR A H    3  
ATOM 4672  H HA   . TYR A 1 76  ? 1.091   4.588   7.499   1.00 0.00 ? 76  TYR A HA   3  
ATOM 4673  H HB2  . TYR A 1 76  ? 1.899   4.736   5.111   1.00 0.00 ? 76  TYR A HB2  3  
ATOM 4674  H HB3  . TYR A 1 76  ? 0.619   3.654   4.600   1.00 0.00 ? 76  TYR A HB3  3  
ATOM 4675  H HD1  . TYR A 1 76  ? -1.770  4.435   4.654   1.00 0.00 ? 76  TYR A HD1  3  
ATOM 4676  H HD2  . TYR A 1 76  ? 1.508   7.084   5.392   1.00 0.00 ? 76  TYR A HD2  3  
ATOM 4677  H HE1  . TYR A 1 76  ? -3.280  6.435   4.224   1.00 0.00 ? 76  TYR A HE1  3  
ATOM 4678  H HE2  . TYR A 1 76  ? -0.013  9.075   4.959   1.00 0.00 ? 76  TYR A HE2  3  
ATOM 4679  H HH   . TYR A 1 76  ? -2.343  9.260   3.430   1.00 0.00 ? 76  TYR A HH   3  
ATOM 4680  N N    . ARG A 1 77  ? -1.386  4.339   7.705   1.00 0.00 ? 77  ARG A N    3  
ATOM 4681  C CA   . ARG A 1 77  ? -2.775  4.074   8.041   1.00 0.00 ? 77  ARG A CA   3  
ATOM 4682  C C    . ARG A 1 77  ? -3.684  4.444   6.867   1.00 0.00 ? 77  ARG A C    3  
ATOM 4683  O O    . ARG A 1 77  ? -3.604  5.553   6.341   1.00 0.00 ? 77  ARG A O    3  
ATOM 4684  C CB   . ARG A 1 77  ? -3.203  4.865   9.278   1.00 0.00 ? 77  ARG A CB   3  
ATOM 4685  C CG   . ARG A 1 77  ? -4.628  4.499   9.697   1.00 0.00 ? 77  ARG A CG   3  
ATOM 4686  C CD   . ARG A 1 77  ? -4.694  4.172   11.190  1.00 0.00 ? 77  ARG A CD   3  
ATOM 4687  N NE   . ARG A 1 77  ? -4.075  5.264   11.975  1.00 0.00 ? 77  ARG A NE   3  
ATOM 4688  C CZ   . ARG A 1 77  ? -2.827  5.226   12.461  1.00 0.00 ? 77  ARG A CZ   3  
ATOM 4689  N NH1  . ARG A 1 77  ? -2.057  4.151   12.245  1.00 0.00 ? 77  ARG A NH1  3  
ATOM 4690  N NH2  . ARG A 1 77  ? -2.349  6.263   13.162  1.00 0.00 ? 77  ARG A NH2  3  
ATOM 4691  H H    . ARG A 1 77  ? -1.029  5.210   8.042   1.00 0.00 ? 77  ARG A H    3  
ATOM 4692  H HA   . ARG A 1 77  ? -2.813  3.004   8.244   1.00 0.00 ? 77  ARG A HA   3  
ATOM 4693  H HB2  . ARG A 1 77  ? -2.516  4.663   10.099  1.00 0.00 ? 77  ARG A HB2  3  
ATOM 4694  H HB3  . ARG A 1 77  ? -3.145  5.934   9.069   1.00 0.00 ? 77  ARG A HB3  3  
ATOM 4695  H HG2  . ARG A 1 77  ? -5.301  5.326   9.472   1.00 0.00 ? 77  ARG A HG2  3  
ATOM 4696  H HG3  . ARG A 1 77  ? -4.972  3.642   9.118   1.00 0.00 ? 77  ARG A HG3  3  
ATOM 4697  H HD2  . ARG A 1 77  ? -5.731  4.036   11.496  1.00 0.00 ? 77  ARG A HD2  3  
ATOM 4698  H HD3  . ARG A 1 77  ? -4.178  3.233   11.388  1.00 0.00 ? 77  ARG A HD3  3  
ATOM 4699  H HE   . ARG A 1 77  ? -4.623  6.081   12.154  1.00 0.00 ? 77  ARG A HE   3  
ATOM 4700  H HH11 . ARG A 1 77  ? -2.414  3.377   11.722  1.00 0.00 ? 77  ARG A HH11 3  
ATOM 4701  H HH12 . ARG A 1 77  ? -1.125  4.122   12.608  1.00 0.00 ? 77  ARG A HH12 3  
ATOM 4702  H HH21 . ARG A 1 77  ? -2.924  7.065   13.323  1.00 0.00 ? 77  ARG A HH21 3  
ATOM 4703  H HH22 . ARG A 1 77  ? -1.418  6.234   13.524  1.00 0.00 ? 77  ARG A HH22 3  
ATOM 4704  N N    . VAL A 1 78  ? -4.528  3.495   6.491   1.00 0.00 ? 78  VAL A N    3  
ATOM 4705  C CA   . VAL A 1 78  ? -5.451  3.707   5.390   1.00 0.00 ? 78  VAL A CA   3  
ATOM 4706  C C    . VAL A 1 78  ? -6.846  3.999   5.948   1.00 0.00 ? 78  VAL A C    3  
ATOM 4707  O O    . VAL A 1 78  ? -7.224  3.468   6.991   1.00 0.00 ? 78  VAL A O    3  
ATOM 4708  C CB   . VAL A 1 78  ? -5.425  2.503   4.445   1.00 0.00 ? 78  VAL A CB   3  
ATOM 4709  C CG1  . VAL A 1 78  ? -6.398  2.698   3.281   1.00 0.00 ? 78  VAL A CG1  3  
ATOM 4710  C CG2  . VAL A 1 78  ? -4.007  2.236   3.936   1.00 0.00 ? 78  VAL A CG2  3  
ATOM 4711  H H    . VAL A 1 78  ? -4.586  2.595   6.924   1.00 0.00 ? 78  VAL A H    3  
ATOM 4712  H HA   . VAL A 1 78  ? -5.106  4.579   4.834   1.00 0.00 ? 78  VAL A HA   3  
ATOM 4713  H HB   . VAL A 1 78  ? -5.748  1.628   5.009   1.00 0.00 ? 78  VAL A HB   3  
ATOM 4714  H HG11 . VAL A 1 78  ? -6.038  2.151   2.410   1.00 0.00 ? 78  VAL A HG11 3  
ATOM 4715  H HG12 . VAL A 1 78  ? -7.382  2.324   3.564   1.00 0.00 ? 78  VAL A HG12 3  
ATOM 4716  H HG13 . VAL A 1 78  ? -6.468  3.759   3.040   1.00 0.00 ? 78  VAL A HG13 3  
ATOM 4717  H HG21 . VAL A 1 78  ? -3.537  3.180   3.659   1.00 0.00 ? 78  VAL A HG21 3  
ATOM 4718  H HG22 . VAL A 1 78  ? -3.423  1.757   4.722   1.00 0.00 ? 78  VAL A HG22 3  
ATOM 4719  H HG23 . VAL A 1 78  ? -4.051  1.582   3.065   1.00 0.00 ? 78  VAL A HG23 3  
ATOM 4720  N N    . THR A 1 79  ? -7.572  4.841   5.228   1.00 0.00 ? 79  THR A N    3  
ATOM 4721  C CA   . THR A 1 79  ? -8.916  5.210   5.638   1.00 0.00 ? 79  THR A CA   3  
ATOM 4722  C C    . THR A 1 79  ? -9.728  5.689   4.434   1.00 0.00 ? 79  THR A C    3  
ATOM 4723  O O    . THR A 1 79  ? -9.182  6.294   3.512   1.00 0.00 ? 79  THR A O    3  
ATOM 4724  C CB   . THR A 1 79  ? -8.801  6.256   6.749   1.00 0.00 ? 79  THR A CB   3  
ATOM 4725  O OG1  . THR A 1 79  ? -7.916  7.236   6.213   1.00 0.00 ? 79  THR A OG1  3  
ATOM 4726  C CG2  . THR A 1 79  ? -8.066  5.723   7.981   1.00 0.00 ? 79  THR A CG2  3  
ATOM 4727  H H    . THR A 1 79  ? -7.257  5.268   4.380   1.00 0.00 ? 79  THR A H    3  
ATOM 4728  H HA   . THR A 1 79  ? -9.413  4.321   6.025   1.00 0.00 ? 79  THR A HA   3  
ATOM 4729  H HB   . THR A 1 79  ? -9.782  6.646   7.019   1.00 0.00 ? 79  THR A HB   3  
ATOM 4730  H HG1  . THR A 1 79  ? -8.426  7.887   5.652   1.00 0.00 ? 79  THR A HG1  3  
ATOM 4731  H HG21 . THR A 1 79  ? -8.190  6.422   8.808   1.00 0.00 ? 79  THR A HG21 3  
ATOM 4732  H HG22 . THR A 1 79  ? -8.479  4.753   8.259   1.00 0.00 ? 79  THR A HG22 3  
ATOM 4733  H HG23 . THR A 1 79  ? -7.006  5.615   7.753   1.00 0.00 ? 79  THR A HG23 3  
ATOM 4734  N N    . GLY A 1 80  ? -11.021 5.402   4.480   1.00 0.00 ? 80  GLY A N    3  
ATOM 4735  C CA   . GLY A 1 80  ? -11.914 5.796   3.404   1.00 0.00 ? 80  GLY A CA   3  
ATOM 4736  C C    . GLY A 1 80  ? -12.283 4.596   2.529   1.00 0.00 ? 80  GLY A C    3  
ATOM 4737  O O    . GLY A 1 80  ? -12.705 4.763   1.386   1.00 0.00 ? 80  GLY A O    3  
ATOM 4738  H H    . GLY A 1 80  ? -11.458 4.910   5.233   1.00 0.00 ? 80  GLY A H    3  
ATOM 4739  H HA2  . GLY A 1 80  ? -12.819 6.238   3.821   1.00 0.00 ? 80  GLY A HA2  3  
ATOM 4740  H HA3  . GLY A 1 80  ? -11.438 6.563   2.793   1.00 0.00 ? 80  GLY A HA3  3  
ATOM 4741  N N    . LEU A 1 81  ? -12.109 3.413   3.100   1.00 0.00 ? 81  LEU A N    3  
ATOM 4742  C CA   . LEU A 1 81  ? -12.418 2.186   2.387   1.00 0.00 ? 81  LEU A CA   3  
ATOM 4743  C C    . LEU A 1 81  ? -13.919 1.907   2.487   1.00 0.00 ? 81  LEU A C    3  
ATOM 4744  O O    . LEU A 1 81  ? -14.731 2.827   2.407   1.00 0.00 ? 81  LEU A O    3  
ATOM 4745  C CB   . LEU A 1 81  ? -11.544 1.037   2.894   1.00 0.00 ? 81  LEU A CB   3  
ATOM 4746  C CG   . LEU A 1 81  ? -10.094 1.393   3.227   1.00 0.00 ? 81  LEU A CG   3  
ATOM 4747  C CD1  . LEU A 1 81  ? -9.514  0.425   4.260   1.00 0.00 ? 81  LEU A CD1  3  
ATOM 4748  C CD2  . LEU A 1 81  ? -9.240  1.458   1.959   1.00 0.00 ? 81  LEU A CD2  3  
ATOM 4749  H H    . LEU A 1 81  ? -11.765 3.286   4.030   1.00 0.00 ? 81  LEU A H    3  
ATOM 4750  H HA   . LEU A 1 81  ? -12.165 2.344   1.339   1.00 0.00 ? 81  LEU A HA   3  
ATOM 4751  H HB2  . LEU A 1 81  ? -12.009 0.620   3.788   1.00 0.00 ? 81  LEU A HB2  3  
ATOM 4752  H HB3  . LEU A 1 81  ? -11.540 0.249   2.141   1.00 0.00 ? 81  LEU A HB3  3  
ATOM 4753  H HG   . LEU A 1 81  ? -10.081 2.387   3.675   1.00 0.00 ? 81  LEU A HG   3  
ATOM 4754  H HD11 . LEU A 1 81  ? -10.251 -0.345  4.490   1.00 0.00 ? 81  LEU A HD11 3  
ATOM 4755  H HD12 . LEU A 1 81  ? -8.616  -0.042  3.856   1.00 0.00 ? 81  LEU A HD12 3  
ATOM 4756  H HD13 . LEU A 1 81  ? -9.263  0.971   5.169   1.00 0.00 ? 81  LEU A HD13 3  
ATOM 4757  H HD21 . LEU A 1 81  ? -9.887  1.403   1.083   1.00 0.00 ? 81  LEU A HD21 3  
ATOM 4758  H HD22 . LEU A 1 81  ? -8.684  2.395   1.942   1.00 0.00 ? 81  LEU A HD22 3  
ATOM 4759  H HD23 . LEU A 1 81  ? -8.542  0.620   1.948   1.00 0.00 ? 81  LEU A HD23 3  
ATOM 4760  N N    . THR A 1 82  ? -14.242 0.634   2.659   1.00 0.00 ? 82  THR A N    3  
ATOM 4761  C CA   . THR A 1 82  ? -15.631 0.222   2.770   1.00 0.00 ? 82  THR A CA   3  
ATOM 4762  C C    . THR A 1 82  ? -15.767 -0.934  3.763   1.00 0.00 ? 82  THR A C    3  
ATOM 4763  O O    . THR A 1 82  ? -14.857 -1.750  3.900   1.00 0.00 ? 82  THR A O    3  
ATOM 4764  C CB   . THR A 1 82  ? -16.137 -0.119  1.368   1.00 0.00 ? 82  THR A CB   3  
ATOM 4765  O OG1  . THR A 1 82  ? -15.984 1.096   0.638   1.00 0.00 ? 82  THR A OG1  3  
ATOM 4766  C CG2  . THR A 1 82  ? -17.643 -0.385  1.337   1.00 0.00 ? 82  THR A CG2  3  
ATOM 4767  H H    . THR A 1 82  ? -13.575 -0.109  2.723   1.00 0.00 ? 82  THR A H    3  
ATOM 4768  H HA   . THR A 1 82  ? -16.205 1.057   3.172   1.00 0.00 ? 82  THR A HA   3  
ATOM 4769  H HB   . THR A 1 82  ? -15.584 -0.960  0.948   1.00 0.00 ? 82  THR A HB   3  
ATOM 4770  H HG1  . THR A 1 82  ? -16.587 1.799   1.015   1.00 0.00 ? 82  THR A HG1  3  
ATOM 4771  H HG21 . THR A 1 82  ? -18.034 -0.151  0.346   1.00 0.00 ? 82  THR A HG21 3  
ATOM 4772  H HG22 . THR A 1 82  ? -17.832 -1.434  1.563   1.00 0.00 ? 82  THR A HG22 3  
ATOM 4773  H HG23 . THR A 1 82  ? -18.138 0.241   2.079   1.00 0.00 ? 82  THR A HG23 3  
ATOM 4774  N N    . ALA A 1 83  ? -16.911 -0.967  4.431   1.00 0.00 ? 83  ALA A N    3  
ATOM 4775  C CA   . ALA A 1 83  ? -17.178 -2.010  5.407   1.00 0.00 ? 83  ALA A CA   3  
ATOM 4776  C C    . ALA A 1 83  ? -17.340 -3.349  4.685   1.00 0.00 ? 83  ALA A C    3  
ATOM 4777  O O    . ALA A 1 83  ? -17.955 -3.414  3.622   1.00 0.00 ? 83  ALA A O    3  
ATOM 4778  C CB   . ALA A 1 83  ? -18.413 -1.636  6.229   1.00 0.00 ? 83  ALA A CB   3  
ATOM 4779  H H    . ALA A 1 83  ? -17.646 -0.299  4.314   1.00 0.00 ? 83  ALA A H    3  
ATOM 4780  H HA   . ALA A 1 83  ? -16.317 -2.068  6.074   1.00 0.00 ? 83  ALA A HA   3  
ATOM 4781  H HB1  . ALA A 1 83  ? -18.127 -0.947  7.023   1.00 0.00 ? 83  ALA A HB1  3  
ATOM 4782  H HB2  . ALA A 1 83  ? -19.149 -1.159  5.581   1.00 0.00 ? 83  ALA A HB2  3  
ATOM 4783  H HB3  . ALA A 1 83  ? -18.844 -2.537  6.667   1.00 0.00 ? 83  ALA A HB3  3  
ATOM 4784  N N    . LEU A 1 84  ? -16.779 -4.384  5.292   1.00 0.00 ? 84  LEU A N    3  
ATOM 4785  C CA   . LEU A 1 84  ? -16.854 -5.718  4.721   1.00 0.00 ? 84  LEU A CA   3  
ATOM 4786  C C    . LEU A 1 84  ? -16.646 -5.632  3.207   1.00 0.00 ? 84  LEU A C    3  
ATOM 4787  O O    . LEU A 1 84  ? -17.519 -6.022  2.434   1.00 0.00 ? 84  LEU A O    3  
ATOM 4788  C CB   . LEU A 1 84  ? -18.163 -6.400  5.123   1.00 0.00 ? 84  LEU A CB   3  
ATOM 4789  C CG   . LEU A 1 84  ? -18.461 -6.447  6.623   1.00 0.00 ? 84  LEU A CG   3  
ATOM 4790  C CD1  . LEU A 1 84  ? -19.658 -7.353  6.917   1.00 0.00 ? 84  LEU A CD1  3  
ATOM 4791  C CD2  . LEU A 1 84  ? -17.220 -6.861  7.417   1.00 0.00 ? 84  LEU A CD2  3  
ATOM 4792  H H    . LEU A 1 84  ? -16.281 -4.322  6.157   1.00 0.00 ? 84  LEU A H    3  
ATOM 4793  H HA   . LEU A 1 84  ? -16.040 -6.303  5.149   1.00 0.00 ? 84  LEU A HA   3  
ATOM 4794  H HB2  . LEU A 1 84  ? -18.985 -5.888  4.625   1.00 0.00 ? 84  LEU A HB2  3  
ATOM 4795  H HB3  . LEU A 1 84  ? -18.148 -7.422  4.744   1.00 0.00 ? 84  LEU A HB3  3  
ATOM 4796  H HG   . LEU A 1 84  ? -18.731 -5.442  6.949   1.00 0.00 ? 84  LEU A HG   3  
ATOM 4797  H HD11 . LEU A 1 84  ? -20.580 -6.782  6.815   1.00 0.00 ? 84  LEU A HD11 3  
ATOM 4798  H HD12 . LEU A 1 84  ? -19.666 -8.184  6.211   1.00 0.00 ? 84  LEU A HD12 3  
ATOM 4799  H HD13 . LEU A 1 84  ? -19.580 -7.741  7.933   1.00 0.00 ? 84  LEU A HD13 3  
ATOM 4800  H HD21 . LEU A 1 84  ? -16.529 -6.020  7.476   1.00 0.00 ? 84  LEU A HD21 3  
ATOM 4801  H HD22 . LEU A 1 84  ? -17.515 -7.160  8.422   1.00 0.00 ? 84  LEU A HD22 3  
ATOM 4802  H HD23 . LEU A 1 84  ? -16.732 -7.697  6.917   1.00 0.00 ? 84  LEU A HD23 3  
ATOM 4803  N N    . THR A 1 85  ? -15.484 -5.118  2.830   1.00 0.00 ? 85  THR A N    3  
ATOM 4804  C CA   . THR A 1 85  ? -15.150 -4.976  1.423   1.00 0.00 ? 85  THR A CA   3  
ATOM 4805  C C    . THR A 1 85  ? -13.701 -5.399  1.174   1.00 0.00 ? 85  THR A C    3  
ATOM 4806  O O    . THR A 1 85  ? -12.843 -5.231  2.040   1.00 0.00 ? 85  THR A O    3  
ATOM 4807  C CB   . THR A 1 85  ? -15.440 -3.532  1.012   1.00 0.00 ? 85  THR A CB   3  
ATOM 4808  O OG1  . THR A 1 85  ? -16.859 -3.486  0.883   1.00 0.00 ? 85  THR A OG1  3  
ATOM 4809  C CG2  . THR A 1 85  ? -14.927 -3.208  -0.393  1.00 0.00 ? 85  THR A CG2  3  
ATOM 4810  H H    . THR A 1 85  ? -14.779 -4.804  3.466   1.00 0.00 ? 85  THR A H    3  
ATOM 4811  H HA   . THR A 1 85  ? -15.783 -5.653  0.850   1.00 0.00 ? 85  THR A HA   3  
ATOM 4812  H HB   . THR A 1 85  ? -15.039 -2.830  1.744   1.00 0.00 ? 85  THR A HB   3  
ATOM 4813  H HG1  . THR A 1 85  ? -17.287 -3.571  1.782   1.00 0.00 ? 85  THR A HG1  3  
ATOM 4814  H HG21 . THR A 1 85  ? -14.000 -3.752  -0.575  1.00 0.00 ? 85  THR A HG21 3  
ATOM 4815  H HG22 . THR A 1 85  ? -15.673 -3.506  -1.129  1.00 0.00 ? 85  THR A HG22 3  
ATOM 4816  H HG23 . THR A 1 85  ? -14.743 -2.137  -0.474  1.00 0.00 ? 85  THR A HG23 3  
ATOM 4817  N N    . THR A 1 86  ? -13.472 -5.940  -0.014  1.00 0.00 ? 86  THR A N    3  
ATOM 4818  C CA   . THR A 1 86  ? -12.142 -6.389  -0.388  1.00 0.00 ? 86  THR A CA   3  
ATOM 4819  C C    . THR A 1 86  ? -11.338 -5.233  -0.986  1.00 0.00 ? 86  THR A C    3  
ATOM 4820  O O    . THR A 1 86  ? -11.812 -4.543  -1.888  1.00 0.00 ? 86  THR A O    3  
ATOM 4821  C CB   . THR A 1 86  ? -12.294 -7.578  -1.338  1.00 0.00 ? 86  THR A CB   3  
ATOM 4822  O OG1  . THR A 1 86  ? -13.046 -8.528  -0.588  1.00 0.00 ? 86  THR A OG1  3  
ATOM 4823  C CG2  . THR A 1 86  ? -10.964 -8.286  -1.609  1.00 0.00 ? 86  THR A CG2  3  
ATOM 4824  H H    . THR A 1 86  ? -14.175 -6.073  -0.712  1.00 0.00 ? 86  THR A H    3  
ATOM 4825  H HA   . THR A 1 86  ? -11.620 -6.708  0.514   1.00 0.00 ? 86  THR A HA   3  
ATOM 4826  H HB   . THR A 1 86  ? -12.769 -7.274  -2.271  1.00 0.00 ? 86  THR A HB   3  
ATOM 4827  H HG1  . THR A 1 86  ? -13.739 -8.952  -1.170  1.00 0.00 ? 86  THR A HG1  3  
ATOM 4828  H HG21 . THR A 1 86  ? -11.058 -8.909  -2.498  1.00 0.00 ? 86  THR A HG21 3  
ATOM 4829  H HG22 . THR A 1 86  ? -10.183 -7.542  -1.767  1.00 0.00 ? 86  THR A HG22 3  
ATOM 4830  H HG23 . THR A 1 86  ? -10.704 -8.909  -0.753  1.00 0.00 ? 86  THR A HG23 3  
ATOM 4831  N N    . TYR A 1 87  ? -10.134 -5.056  -0.460  1.00 0.00 ? 87  TYR A N    3  
ATOM 4832  C CA   . TYR A 1 87  ? -9.260  -3.996  -0.931  1.00 0.00 ? 87  TYR A CA   3  
ATOM 4833  C C    . TYR A 1 87  ? -7.837  -4.514  -1.147  1.00 0.00 ? 87  TYR A C    3  
ATOM 4834  O O    . TYR A 1 87  ? -7.404  -5.449  -0.476  1.00 0.00 ? 87  TYR A O    3  
ATOM 4835  C CB   . TYR A 1 87  ? -9.243  -2.941  0.177   1.00 0.00 ? 87  TYR A CB   3  
ATOM 4836  C CG   . TYR A 1 87  ? -10.404 -1.947  0.108   1.00 0.00 ? 87  TYR A CG   3  
ATOM 4837  C CD1  . TYR A 1 87  ? -11.607 -2.249  0.713   1.00 0.00 ? 87  TYR A CD1  3  
ATOM 4838  C CD2  . TYR A 1 87  ? -10.248 -0.749  -0.559  1.00 0.00 ? 87  TYR A CD2  3  
ATOM 4839  C CE1  . TYR A 1 87  ? -12.700 -1.313  0.649   1.00 0.00 ? 87  TYR A CE1  3  
ATOM 4840  C CE2  . TYR A 1 87  ? -11.341 0.186   -0.624  1.00 0.00 ? 87  TYR A CE2  3  
ATOM 4841  C CZ   . TYR A 1 87  ? -12.513 -0.142  -0.017  1.00 0.00 ? 87  TYR A CZ   3  
ATOM 4842  O OH   . TYR A 1 87  ? -13.545 0.742   -0.078  1.00 0.00 ? 87  TYR A OH   3  
ATOM 4843  H H    . TYR A 1 87  ? -9.756  -5.622  0.272   1.00 0.00 ? 87  TYR A H    3  
ATOM 4844  H HA   . TYR A 1 87  ? -9.654  -3.631  -1.879  1.00 0.00 ? 87  TYR A HA   3  
ATOM 4845  H HB2  . TYR A 1 87  ? -9.265  -3.444  1.144   1.00 0.00 ? 87  TYR A HB2  3  
ATOM 4846  H HB3  . TYR A 1 87  ? -8.303  -2.390  0.126   1.00 0.00 ? 87  TYR A HB3  3  
ATOM 4847  H HD1  . TYR A 1 87  ? -11.730 -3.195  1.240   1.00 0.00 ? 87  TYR A HD1  3  
ATOM 4848  H HD2  . TYR A 1 87  ? -9.298  -0.511  -1.037  1.00 0.00 ? 87  TYR A HD2  3  
ATOM 4849  H HE1  . TYR A 1 87  ? -13.656 -1.539  1.122   1.00 0.00 ? 87  TYR A HE1  3  
ATOM 4850  H HE2  . TYR A 1 87  ? -11.232 1.136   -1.147  1.00 0.00 ? 87  TYR A HE2  3  
ATOM 4851  H HH   . TYR A 1 87  ? -13.208 1.643   -0.347  1.00 0.00 ? 87  TYR A HH   3  
ATOM 4852  N N    . THR A 1 88  ? -7.148  -3.884  -2.088  1.00 0.00 ? 88  THR A N    3  
ATOM 4853  C CA   . THR A 1 88  ? -5.783  -4.269  -2.401  1.00 0.00 ? 88  THR A CA   3  
ATOM 4854  C C    . THR A 1 88  ? -4.840  -3.075  -2.236  1.00 0.00 ? 88  THR A C    3  
ATOM 4855  O O    . THR A 1 88  ? -4.924  -2.105  -2.988  1.00 0.00 ? 88  THR A O    3  
ATOM 4856  C CB   . THR A 1 88  ? -5.771  -4.862  -3.812  1.00 0.00 ? 88  THR A CB   3  
ATOM 4857  O OG1  . THR A 1 88  ? -5.763  -6.271  -3.596  1.00 0.00 ? 88  THR A OG1  3  
ATOM 4858  C CG2  . THR A 1 88  ? -4.459  -4.591  -4.550  1.00 0.00 ? 88  THR A CG2  3  
ATOM 4859  H H    . THR A 1 88  ? -7.508  -3.124  -2.630  1.00 0.00 ? 88  THR A H    3  
ATOM 4860  H HA   . THR A 1 88  ? -5.467  -5.027  -1.685  1.00 0.00 ? 88  THR A HA   3  
ATOM 4861  H HB   . THR A 1 88  ? -6.624  -4.508  -4.390  1.00 0.00 ? 88  THR A HB   3  
ATOM 4862  H HG1  . THR A 1 88  ? -5.599  -6.748  -4.459  1.00 0.00 ? 88  THR A HG1  3  
ATOM 4863  H HG21 . THR A 1 88  ? -4.260  -3.519  -4.556  1.00 0.00 ? 88  THR A HG21 3  
ATOM 4864  H HG22 . THR A 1 88  ? -3.644  -5.109  -4.045  1.00 0.00 ? 88  THR A HG22 3  
ATOM 4865  H HG23 . THR A 1 88  ? -4.538  -4.950  -5.576  1.00 0.00 ? 88  THR A HG23 3  
ATOM 4866  N N    . ILE A 1 89  ? -3.965  -3.186  -1.248  1.00 0.00 ? 89  ILE A N    3  
ATOM 4867  C CA   . ILE A 1 89  ? -3.008  -2.127  -0.975  1.00 0.00 ? 89  ILE A CA   3  
ATOM 4868  C C    . ILE A 1 89  ? -1.714  -2.406  -1.742  1.00 0.00 ? 89  ILE A C    3  
ATOM 4869  O O    . ILE A 1 89  ? -1.057  -3.420  -1.512  1.00 0.00 ? 89  ILE A O    3  
ATOM 4870  C CB   . ILE A 1 89  ? -2.806  -1.964  0.533   1.00 0.00 ? 89  ILE A CB   3  
ATOM 4871  C CG1  . ILE A 1 89  ? -4.115  -2.194  1.290   1.00 0.00 ? 89  ILE A CG1  3  
ATOM 4872  C CG2  . ILE A 1 89  ? -2.186  -0.604  0.859   1.00 0.00 ? 89  ILE A CG2  3  
ATOM 4873  C CD1  . ILE A 1 89  ? -5.214  -1.259  0.781   1.00 0.00 ? 89  ILE A CD1  3  
ATOM 4874  H H    . ILE A 1 89  ? -3.904  -3.978  -0.641  1.00 0.00 ? 89  ILE A H    3  
ATOM 4875  H HA   . ILE A 1 89  ? -3.436  -1.196  -1.345  1.00 0.00 ? 89  ILE A HA   3  
ATOM 4876  H HB   . ILE A 1 89  ? -2.102  -2.726  0.868   1.00 0.00 ? 89  ILE A HB   3  
ATOM 4877  H HG12 . ILE A 1 89  ? -4.431  -3.230  1.171   1.00 0.00 ? 89  ILE A HG12 3  
ATOM 4878  H HG13 . ILE A 1 89  ? -3.957  -2.029  2.356   1.00 0.00 ? 89  ILE A HG13 3  
ATOM 4879  H HG21 . ILE A 1 89  ? -1.196  -0.538  0.408   1.00 0.00 ? 89  ILE A HG21 3  
ATOM 4880  H HG22 . ILE A 1 89  ? -2.820  0.189   0.460   1.00 0.00 ? 89  ILE A HG22 3  
ATOM 4881  H HG23 . ILE A 1 89  ? -2.102  -0.492  1.940   1.00 0.00 ? 89  ILE A HG23 3  
ATOM 4882  H HD11 . ILE A 1 89  ? -6.183  -1.746  0.886   1.00 0.00 ? 89  ILE A HD11 3  
ATOM 4883  H HD12 . ILE A 1 89  ? -5.205  -0.337  1.362   1.00 0.00 ? 89  ILE A HD12 3  
ATOM 4884  H HD13 . ILE A 1 89  ? -5.036  -1.028  -0.270  1.00 0.00 ? 89  ILE A HD13 3  
ATOM 4885  N N    . GLU A 1 90  ? -1.386  -1.487  -2.639  1.00 0.00 ? 90  GLU A N    3  
ATOM 4886  C CA   . GLU A 1 90  ? -0.182  -1.621  -3.441  1.00 0.00 ? 90  GLU A CA   3  
ATOM 4887  C C    . GLU A 1 90  ? 0.937   -0.748  -2.869  1.00 0.00 ? 90  GLU A C    3  
ATOM 4888  O O    . GLU A 1 90  ? 0.813   0.475   -2.821  1.00 0.00 ? 90  GLU A O    3  
ATOM 4889  C CB   . GLU A 1 90  ? -0.457  -1.269  -4.905  1.00 0.00 ? 90  GLU A CB   3  
ATOM 4890  C CG   . GLU A 1 90  ? -1.759  -1.911  -5.387  1.00 0.00 ? 90  GLU A CG   3  
ATOM 4891  C CD   . GLU A 1 90  ? -2.795  -0.844  -5.749  1.00 0.00 ? 90  GLU A CD   3  
ATOM 4892  O OE1  . GLU A 1 90  ? -2.497  -0.054  -6.671  1.00 0.00 ? 90  GLU A OE1  3  
ATOM 4893  O OE2  . GLU A 1 90  ? -3.861  -0.843  -5.097  1.00 0.00 ? 90  GLU A OE2  3  
ATOM 4894  H H    . GLU A 1 90  ? -1.925  -0.665  -2.820  1.00 0.00 ? 90  GLU A H    3  
ATOM 4895  H HA   . GLU A 1 90  ? 0.097   -2.672  -3.373  1.00 0.00 ? 90  GLU A HA   3  
ATOM 4896  H HB2  . GLU A 1 90  ? -0.517  -0.187  -5.018  1.00 0.00 ? 90  GLU A HB2  3  
ATOM 4897  H HB3  . GLU A 1 90  ? 0.372   -1.609  -5.526  1.00 0.00 ? 90  GLU A HB3  3  
ATOM 4898  H HG2  . GLU A 1 90  ? -1.560  -2.539  -6.256  1.00 0.00 ? 90  GLU A HG2  3  
ATOM 4899  H HG3  . GLU A 1 90  ? -2.159  -2.561  -4.609  1.00 0.00 ? 90  GLU A HG3  3  
ATOM 4900  N N    . VAL A 1 91  ? 2.005   -1.411  -2.449  1.00 0.00 ? 91  VAL A N    3  
ATOM 4901  C CA   . VAL A 1 91  ? 3.145   -0.711  -1.882  1.00 0.00 ? 91  VAL A CA   3  
ATOM 4902  C C    . VAL A 1 91  ? 4.330   -0.812  -2.845  1.00 0.00 ? 91  VAL A C    3  
ATOM 4903  O O    . VAL A 1 91  ? 4.795   -1.909  -3.150  1.00 0.00 ? 91  VAL A O    3  
ATOM 4904  C CB   . VAL A 1 91  ? 3.458   -1.263  -0.490  1.00 0.00 ? 91  VAL A CB   3  
ATOM 4905  C CG1  . VAL A 1 91  ? 4.723   -0.620  0.083   1.00 0.00 ? 91  VAL A CG1  3  
ATOM 4906  C CG2  . VAL A 1 91  ? 2.270   -1.073  0.455   1.00 0.00 ? 91  VAL A CG2  3  
ATOM 4907  H H    . VAL A 1 91  ? 2.098   -2.406  -2.492  1.00 0.00 ? 91  VAL A H    3  
ATOM 4908  H HA   . VAL A 1 91  ? 2.868   0.337   -1.775  1.00 0.00 ? 91  VAL A HA   3  
ATOM 4909  H HB   . VAL A 1 91  ? 3.640   -2.333  -0.587  1.00 0.00 ? 91  VAL A HB   3  
ATOM 4910  H HG11 . VAL A 1 91  ? 4.446   0.213   0.729   1.00 0.00 ? 91  VAL A HG11 3  
ATOM 4911  H HG12 . VAL A 1 91  ? 5.276   -1.360  0.661   1.00 0.00 ? 91  VAL A HG12 3  
ATOM 4912  H HG13 . VAL A 1 91  ? 5.346   -0.256  -0.733  1.00 0.00 ? 91  VAL A HG13 3  
ATOM 4913  H HG21 . VAL A 1 91  ? 2.173   -0.017  0.708   1.00 0.00 ? 91  VAL A HG21 3  
ATOM 4914  H HG22 . VAL A 1 91  ? 1.358   -1.414  -0.035  1.00 0.00 ? 91  VAL A HG22 3  
ATOM 4915  H HG23 . VAL A 1 91  ? 2.432   -1.651  1.365   1.00 0.00 ? 91  VAL A HG23 3  
ATOM 4916  N N    . ALA A 1 92  ? 4.784   0.348   -3.296  1.00 0.00 ? 92  ALA A N    3  
ATOM 4917  C CA   . ALA A 1 92  ? 5.906   0.405   -4.218  1.00 0.00 ? 92  ALA A CA   3  
ATOM 4918  C C    . ALA A 1 92  ? 7.041   1.213   -3.585  1.00 0.00 ? 92  ALA A C    3  
ATOM 4919  O O    . ALA A 1 92  ? 6.817   1.969   -2.641  1.00 0.00 ? 92  ALA A O    3  
ATOM 4920  C CB   . ALA A 1 92  ? 5.442   0.997   -5.551  1.00 0.00 ? 92  ALA A CB   3  
ATOM 4921  H H    . ALA A 1 92  ? 4.400   1.236   -3.043  1.00 0.00 ? 92  ALA A H    3  
ATOM 4922  H HA   . ALA A 1 92  ? 6.248   -0.616  -4.388  1.00 0.00 ? 92  ALA A HA   3  
ATOM 4923  H HB1  . ALA A 1 92  ? 5.467   0.224   -6.320  1.00 0.00 ? 92  ALA A HB1  3  
ATOM 4924  H HB2  . ALA A 1 92  ? 4.424   1.373   -5.447  1.00 0.00 ? 92  ALA A HB2  3  
ATOM 4925  H HB3  . ALA A 1 92  ? 6.104   1.814   -5.835  1.00 0.00 ? 92  ALA A HB3  3  
ATOM 4926  N N    . ALA A 1 93  ? 8.233   1.025   -4.130  1.00 0.00 ? 93  ALA A N    3  
ATOM 4927  C CA   . ALA A 1 93  ? 9.404   1.726   -3.630  1.00 0.00 ? 93  ALA A CA   3  
ATOM 4928  C C    . ALA A 1 93  ? 9.760   2.863   -4.591  1.00 0.00 ? 93  ALA A C    3  
ATOM 4929  O O    . ALA A 1 93  ? 9.345   2.855   -5.749  1.00 0.00 ? 93  ALA A O    3  
ATOM 4930  C CB   . ALA A 1 93  ? 10.554  0.735   -3.448  1.00 0.00 ? 93  ALA A CB   3  
ATOM 4931  H H    . ALA A 1 93  ? 8.407   0.408   -4.898  1.00 0.00 ? 93  ALA A H    3  
ATOM 4932  H HA   . ALA A 1 93  ? 9.147   2.149   -2.659  1.00 0.00 ? 93  ALA A HA   3  
ATOM 4933  H HB1  . ALA A 1 93  ? 11.500  1.276   -3.422  1.00 0.00 ? 93  ALA A HB1  3  
ATOM 4934  H HB2  . ALA A 1 93  ? 10.421  0.192   -2.512  1.00 0.00 ? 93  ALA A HB2  3  
ATOM 4935  H HB3  . ALA A 1 93  ? 10.562  0.029   -4.279  1.00 0.00 ? 93  ALA A HB3  3  
ATOM 4936  N N    . MET A 1 94  ? 10.526  3.813   -4.074  1.00 0.00 ? 94  MET A N    3  
ATOM 4937  C CA   . MET A 1 94  ? 10.943  4.953   -4.872  1.00 0.00 ? 94  MET A CA   3  
ATOM 4938  C C    . MET A 1 94  ? 12.400  5.321   -4.582  1.00 0.00 ? 94  MET A C    3  
ATOM 4939  O O    . MET A 1 94  ? 12.792  5.452   -3.423  1.00 0.00 ? 94  MET A O    3  
ATOM 4940  C CB   . MET A 1 94  ? 10.043  6.150   -4.561  1.00 0.00 ? 94  MET A CB   3  
ATOM 4941  C CG   . MET A 1 94  ? 8.565   5.769   -4.677  1.00 0.00 ? 94  MET A CG   3  
ATOM 4942  S SD   . MET A 1 94  ? 7.554   6.988   -3.852  1.00 0.00 ? 94  MET A SD   3  
ATOM 4943  C CE   . MET A 1 94  ? 7.498   8.249   -5.114  1.00 0.00 ? 94  MET A CE   3  
ATOM 4944  H H    . MET A 1 94  ? 10.860  3.811   -3.132  1.00 0.00 ? 94  MET A H    3  
ATOM 4945  H HA   . MET A 1 94  ? 10.841  4.638   -5.910  1.00 0.00 ? 94  MET A HA   3  
ATOM 4946  H HB2  . MET A 1 94  ? 10.250  6.515   -3.555  1.00 0.00 ? 94  MET A HB2  3  
ATOM 4947  H HB3  . MET A 1 94  ? 10.266  6.966   -5.248  1.00 0.00 ? 94  MET A HB3  3  
ATOM 4948  H HG2  . MET A 1 94  ? 8.280   5.699   -5.726  1.00 0.00 ? 94  MET A HG2  3  
ATOM 4949  H HG3  . MET A 1 94  ? 8.399   4.787   -4.234  1.00 0.00 ? 94  MET A HG3  3  
ATOM 4950  H HE1  . MET A 1 94  ? 8.166   7.976   -5.931  1.00 0.00 ? 94  MET A HE1  3  
ATOM 4951  H HE2  . MET A 1 94  ? 6.480   8.340   -5.492  1.00 0.00 ? 94  MET A HE2  3  
ATOM 4952  H HE3  . MET A 1 94  ? 7.814   9.202   -4.690  1.00 0.00 ? 94  MET A HE3  3  
ATOM 4953  N N    . THR A 1 95  ? 13.162  5.479   -5.654  1.00 0.00 ? 95  THR A N    3  
ATOM 4954  C CA   . THR A 1 95  ? 14.566  5.829   -5.530  1.00 0.00 ? 95  THR A CA   3  
ATOM 4955  C C    . THR A 1 95  ? 14.853  7.148   -6.251  1.00 0.00 ? 95  THR A C    3  
ATOM 4956  O O    . THR A 1 95  ? 13.933  7.906   -6.554  1.00 0.00 ? 95  THR A O    3  
ATOM 4957  C CB   . THR A 1 95  ? 15.395  4.656   -6.057  1.00 0.00 ? 95  THR A CB   3  
ATOM 4958  O OG1  . THR A 1 95  ? 14.844  4.392   -7.344  1.00 0.00 ? 95  THR A OG1  3  
ATOM 4959  C CG2  . THR A 1 95  ? 15.146  3.365   -5.274  1.00 0.00 ? 95  THR A CG2  3  
ATOM 4960  H H    . THR A 1 95  ? 12.835  5.371   -6.593  1.00 0.00 ? 95  THR A H    3  
ATOM 4961  H HA   . THR A 1 95  ? 14.789  5.987   -4.475  1.00 0.00 ? 95  THR A HA   3  
ATOM 4962  H HB   . THR A 1 95  ? 16.456  4.904   -6.071  1.00 0.00 ? 95  THR A HB   3  
ATOM 4963  H HG1  . THR A 1 95  ? 15.573  4.152   -7.986  1.00 0.00 ? 95  THR A HG1  3  
ATOM 4964  H HG21 . THR A 1 95  ? 14.468  3.568   -4.445  1.00 0.00 ? 95  THR A HG21 3  
ATOM 4965  H HG22 . THR A 1 95  ? 14.702  2.620   -5.934  1.00 0.00 ? 95  THR A HG22 3  
ATOM 4966  H HG23 . THR A 1 95  ? 16.092  2.988   -4.885  1.00 0.00 ? 95  THR A HG23 3  
ATOM 4967  N N    . SER A 1 96  ? 16.132  7.380   -6.505  1.00 0.00 ? 96  SER A N    3  
ATOM 4968  C CA   . SER A 1 96  ? 16.552  8.594   -7.185  1.00 0.00 ? 96  SER A CA   3  
ATOM 4969  C C    . SER A 1 96  ? 16.331  8.452   -8.692  1.00 0.00 ? 96  SER A C    3  
ATOM 4970  O O    . SER A 1 96  ? 16.685  9.344   -9.462  1.00 0.00 ? 96  SER A O    3  
ATOM 4971  C CB   . SER A 1 96  ? 18.019  8.911   -6.891  1.00 0.00 ? 96  SER A CB   3  
ATOM 4972  O OG   . SER A 1 96  ? 18.582  9.785   -7.866  1.00 0.00 ? 96  SER A OG   3  
ATOM 4973  H H    . SER A 1 96  ? 16.874  6.758   -6.256  1.00 0.00 ? 96  SER A H    3  
ATOM 4974  H HA   . SER A 1 96  ? 15.921  9.385   -6.779  1.00 0.00 ? 96  SER A HA   3  
ATOM 4975  H HB2  . SER A 1 96  ? 18.101  9.367   -5.905  1.00 0.00 ? 96  SER A HB2  3  
ATOM 4976  H HB3  . SER A 1 96  ? 18.592  7.984   -6.862  1.00 0.00 ? 96  SER A HB3  3  
ATOM 4977  H HG   . SER A 1 96  ? 19.349  9.337   -8.325  1.00 0.00 ? 96  SER A HG   3  
ATOM 4978  N N    . LYS A 1 97  ? 15.746  7.325   -9.069  1.00 0.00 ? 97  LYS A N    3  
ATOM 4979  C CA   . LYS A 1 97  ? 15.473  7.055   -10.471 1.00 0.00 ? 97  LYS A CA   3  
ATOM 4980  C C    . LYS A 1 97  ? 13.963  7.097   -10.709 1.00 0.00 ? 97  LYS A C    3  
ATOM 4981  O O    . LYS A 1 97  ? 13.503  7.649   -11.708 1.00 0.00 ? 97  LYS A O    3  
ATOM 4982  C CB   . LYS A 1 97  ? 16.128  5.741   -10.901 1.00 0.00 ? 97  LYS A CB   3  
ATOM 4983  C CG   . LYS A 1 97  ? 15.081  4.748   -11.411 1.00 0.00 ? 97  LYS A CG   3  
ATOM 4984  C CD   . LYS A 1 97  ? 14.593  5.136   -12.808 1.00 0.00 ? 97  LYS A CD   3  
ATOM 4985  C CE   . LYS A 1 97  ? 13.065  5.116   -12.881 1.00 0.00 ? 97  LYS A CE   3  
ATOM 4986  N NZ   . LYS A 1 97  ? 12.602  4.018   -13.759 1.00 0.00 ? 97  LYS A NZ   3  
ATOM 4987  H H    . LYS A 1 97  ? 15.460  6.604   -8.437  1.00 0.00 ? 97  LYS A H    3  
ATOM 4988  H HA   . LYS A 1 97  ? 15.937  7.851   -11.053 1.00 0.00 ? 97  LYS A HA   3  
ATOM 4989  H HB2  . LYS A 1 97  ? 16.862  5.934   -11.682 1.00 0.00 ? 97  LYS A HB2  3  
ATOM 4990  H HB3  . LYS A 1 97  ? 16.666  5.306   -10.058 1.00 0.00 ? 97  LYS A HB3  3  
ATOM 4991  H HG2  . LYS A 1 97  ? 15.507  3.746   -11.436 1.00 0.00 ? 97  LYS A HG2  3  
ATOM 4992  H HG3  . LYS A 1 97  ? 14.237  4.718   -10.722 1.00 0.00 ? 97  LYS A HG3  3  
ATOM 4993  H HD2  . LYS A 1 97  ? 14.959  6.131   -13.062 1.00 0.00 ? 97  LYS A HD2  3  
ATOM 4994  H HD3  . LYS A 1 97  ? 15.005  4.447   -13.546 1.00 0.00 ? 97  LYS A HD3  3  
ATOM 4995  H HE2  . LYS A 1 97  ? 12.649  4.989   -11.881 1.00 0.00 ? 97  LYS A HE2  3  
ATOM 4996  H HE3  . LYS A 1 97  ? 12.700  6.071   -13.259 1.00 0.00 ? 97  LYS A HE3  3  
ATOM 4997  H HZ1  . LYS A 1 97  ? 12.662  4.308   -14.715 1.00 0.00 ? 97  LYS A HZ1  3  
ATOM 4998  H HZ2  . LYS A 1 97  ? 13.179  3.213   -13.619 1.00 0.00 ? 97  LYS A HZ2  3  
ATOM 4999  H HZ3  . LYS A 1 97  ? 11.653  3.792   -13.539 1.00 0.00 ? 97  LYS A HZ3  3  
ATOM 5000  N N    . GLY A 1 98  ? 13.232  6.506   -9.776  1.00 0.00 ? 98  GLY A N    3  
ATOM 5001  C CA   . GLY A 1 98  ? 11.782  6.468   -9.872  1.00 0.00 ? 98  GLY A CA   3  
ATOM 5002  C C    . GLY A 1 98  ? 11.201  5.380   -8.968  1.00 0.00 ? 98  GLY A C    3  
ATOM 5003  O O    . GLY A 1 98  ? 11.791  5.036   -7.945  1.00 0.00 ? 98  GLY A O    3  
ATOM 5004  H H    . GLY A 1 98  ? 13.613  6.059   -8.967  1.00 0.00 ? 98  GLY A H    3  
ATOM 5005  H HA2  . GLY A 1 98  ? 11.371  7.438   -9.591  1.00 0.00 ? 98  GLY A HA2  3  
ATOM 5006  H HA3  . GLY A 1 98  ? 11.488  6.284   -10.905 1.00 0.00 ? 98  GLY A HA3  3  
ATOM 5007  N N    . GLN A 1 99  ? 10.049  4.868   -9.378  1.00 0.00 ? 99  GLN A N    3  
ATOM 5008  C CA   . GLN A 1 99  ? 9.381   3.825   -8.617  1.00 0.00 ? 99  GLN A CA   3  
ATOM 5009  C C    . GLN A 1 99  ? 9.603   2.462   -9.277  1.00 0.00 ? 99  GLN A C    3  
ATOM 5010  O O    . GLN A 1 99  ? 9.666   2.364   -10.501 1.00 0.00 ? 99  GLN A O    3  
ATOM 5011  C CB   . GLN A 1 99  ? 7.889   4.126   -8.469  1.00 0.00 ? 99  GLN A CB   3  
ATOM 5012  C CG   . GLN A 1 99  ? 7.221   3.131   -7.518  1.00 0.00 ? 99  GLN A CG   3  
ATOM 5013  C CD   . GLN A 1 99  ? 5.827   2.746   -8.017  1.00 0.00 ? 99  GLN A CD   3  
ATOM 5014  O OE1  . GLN A 1 99  ? 5.651   1.827   -8.800  1.00 0.00 ? 99  GLN A OE1  3  
ATOM 5015  N NE2  . GLN A 1 99  ? 4.848   3.499   -7.522  1.00 0.00 ? 99  GLN A NE2  3  
ATOM 5016  H H    . GLN A 1 99  ? 9.576   5.153   -10.211 1.00 0.00 ? 99  GLN A H    3  
ATOM 5017  H HA   . GLN A 1 99  ? 9.848   3.840   -7.633  1.00 0.00 ? 99  GLN A HA   3  
ATOM 5018  H HB2  . GLN A 1 99  ? 7.754   5.140   -8.093  1.00 0.00 ? 99  GLN A HB2  3  
ATOM 5019  H HB3  . GLN A 1 99  ? 7.406   4.081   -9.445  1.00 0.00 ? 99  GLN A HB3  3  
ATOM 5020  H HG2  . GLN A 1 99  ? 7.838   2.237   -7.428  1.00 0.00 ? 99  GLN A HG2  3  
ATOM 5021  H HG3  . GLN A 1 99  ? 7.146   3.568   -6.522  1.00 0.00 ? 99  GLN A HG3  3  
ATOM 5022  H HE21 . GLN A 1 99  ? 5.060   4.238   -6.883  1.00 0.00 ? 99  GLN A HE21 3  
ATOM 5023  H HE22 . GLN A 1 99  ? 3.900   3.325   -7.789  1.00 0.00 ? 99  GLN A HE22 3  
ATOM 5024  N N    . GLY A 1 100 ? 9.715   1.445   -8.436  1.00 0.00 ? 100 GLY A N    3  
ATOM 5025  C CA   . GLY A 1 100 ? 9.929   0.092   -8.921  1.00 0.00 ? 100 GLY A CA   3  
ATOM 5026  C C    . GLY A 1 100 ? 8.664   -0.754  -8.761  1.00 0.00 ? 100 GLY A C    3  
ATOM 5027  O O    . GLY A 1 100 ? 7.554   -0.223  -8.758  1.00 0.00 ? 100 GLY A O    3  
ATOM 5028  H H    . GLY A 1 100 ? 9.663   1.533   -7.441  1.00 0.00 ? 100 GLY A H    3  
ATOM 5029  H HA2  . GLY A 1 100 ? 10.221  0.121   -9.971  1.00 0.00 ? 100 GLY A HA2  3  
ATOM 5030  H HA3  . GLY A 1 100 ? 10.751  -0.369  -8.374  1.00 0.00 ? 100 GLY A HA3  3  
ATOM 5031  N N    . GLN A 1 101 ? 8.874   -2.056  -8.632  1.00 0.00 ? 101 GLN A N    3  
ATOM 5032  C CA   . GLN A 1 101 ? 7.764   -2.980  -8.472  1.00 0.00 ? 101 GLN A CA   3  
ATOM 5033  C C    . GLN A 1 101 ? 6.804   -2.475  -7.394  1.00 0.00 ? 101 GLN A C    3  
ATOM 5034  O O    . GLN A 1 101 ? 7.058   -1.451  -6.761  1.00 0.00 ? 101 GLN A O    3  
ATOM 5035  C CB   . GLN A 1 101 ? 8.266   -4.387  -8.143  1.00 0.00 ? 101 GLN A CB   3  
ATOM 5036  C CG   . GLN A 1 101 ? 7.544   -5.439  -8.988  1.00 0.00 ? 101 GLN A CG   3  
ATOM 5037  C CD   . GLN A 1 101 ? 8.530   -6.467  -9.545  1.00 0.00 ? 101 GLN A CD   3  
ATOM 5038  O OE1  . GLN A 1 101 ? 9.584   -6.137  -10.064 1.00 0.00 ? 101 GLN A OE1  3  
ATOM 5039  N NE2  . GLN A 1 101 ? 8.131   -7.729  -9.409  1.00 0.00 ? 101 GLN A NE2  3  
ATOM 5040  H H    . GLN A 1 101 ? 9.779   -2.479  -8.636  1.00 0.00 ? 101 GLN A H    3  
ATOM 5041  H HA   . GLN A 1 101 ? 7.260   -2.997  -9.438  1.00 0.00 ? 101 GLN A HA   3  
ATOM 5042  H HB2  . GLN A 1 101 ? 9.340   -4.446  -8.324  1.00 0.00 ? 101 GLN A HB2  3  
ATOM 5043  H HB3  . GLN A 1 101 ? 8.109   -4.596  -7.085  1.00 0.00 ? 101 GLN A HB3  3  
ATOM 5044  H HG2  . GLN A 1 101 ? 6.791   -5.943  -8.382  1.00 0.00 ? 101 GLN A HG2  3  
ATOM 5045  H HG3  . GLN A 1 101 ? 7.018   -4.952  -9.810  1.00 0.00 ? 101 GLN A HG3  3  
ATOM 5046  H HE21 . GLN A 1 101 ? 7.254   -7.931  -8.973  1.00 0.00 ? 101 GLN A HE21 3  
ATOM 5047  H HE22 . GLN A 1 101 ? 8.708   -8.474  -9.742  1.00 0.00 ? 101 GLN A HE22 3  
ATOM 5048  N N    . VAL A 1 102 ? 5.720   -3.216  -7.217  1.00 0.00 ? 102 VAL A N    3  
ATOM 5049  C CA   . VAL A 1 102 ? 4.720   -2.856  -6.226  1.00 0.00 ? 102 VAL A CA   3  
ATOM 5050  C C    . VAL A 1 102 ? 4.144   -4.129  -5.603  1.00 0.00 ? 102 VAL A C    3  
ATOM 5051  O O    . VAL A 1 102 ? 3.915   -5.117  -6.299  1.00 0.00 ? 102 VAL A O    3  
ATOM 5052  C CB   . VAL A 1 102 ? 3.650   -1.965  -6.862  1.00 0.00 ? 102 VAL A CB   3  
ATOM 5053  C CG1  . VAL A 1 102 ? 2.514   -2.806  -7.447  1.00 0.00 ? 102 VAL A CG1  3  
ATOM 5054  C CG2  . VAL A 1 102 ? 3.116   -0.946  -5.854  1.00 0.00 ? 102 VAL A CG2  3  
ATOM 5055  H H    . VAL A 1 102 ? 5.520   -4.047  -7.736  1.00 0.00 ? 102 VAL A H    3  
ATOM 5056  H HA   . VAL A 1 102 ? 5.221   -2.280  -5.448  1.00 0.00 ? 102 VAL A HA   3  
ATOM 5057  H HB   . VAL A 1 102 ? 4.115   -1.415  -7.680  1.00 0.00 ? 102 VAL A HB   3  
ATOM 5058  H HG11 . VAL A 1 102 ? 1.731   -2.929  -6.698  1.00 0.00 ? 102 VAL A HG11 3  
ATOM 5059  H HG12 . VAL A 1 102 ? 2.103   -2.303  -8.322  1.00 0.00 ? 102 VAL A HG12 3  
ATOM 5060  H HG13 . VAL A 1 102 ? 2.897   -3.784  -7.736  1.00 0.00 ? 102 VAL A HG13 3  
ATOM 5061  H HG21 . VAL A 1 102 ? 2.785   -0.052  -6.382  1.00 0.00 ? 102 VAL A HG21 3  
ATOM 5062  H HG22 . VAL A 1 102 ? 2.276   -1.379  -5.310  1.00 0.00 ? 102 VAL A HG22 3  
ATOM 5063  H HG23 . VAL A 1 102 ? 3.906   -0.681  -5.151  1.00 0.00 ? 102 VAL A HG23 3  
ATOM 5064  N N    . SER A 1 103 ? 3.928   -4.065  -4.297  1.00 0.00 ? 103 SER A N    3  
ATOM 5065  C CA   . SER A 1 103 ? 3.383   -5.200  -3.572  1.00 0.00 ? 103 SER A CA   3  
ATOM 5066  C C    . SER A 1 103 ? 1.906   -4.959  -3.254  1.00 0.00 ? 103 SER A C    3  
ATOM 5067  O O    . SER A 1 103 ? 1.581   -4.215  -2.329  1.00 0.00 ? 103 SER A O    3  
ATOM 5068  C CB   . SER A 1 103 ? 4.168   -5.459  -2.285  1.00 0.00 ? 103 SER A CB   3  
ATOM 5069  O OG   . SER A 1 103 ? 5.149   -6.480  -2.454  1.00 0.00 ? 103 SER A OG   3  
ATOM 5070  H H    . SER A 1 103 ? 4.117   -3.258  -3.738  1.00 0.00 ? 103 SER A H    3  
ATOM 5071  H HA   . SER A 1 103 ? 3.496   -6.052  -4.243  1.00 0.00 ? 103 SER A HA   3  
ATOM 5072  H HB2  . SER A 1 103 ? 4.655   -4.538  -1.966  1.00 0.00 ? 103 SER A HB2  3  
ATOM 5073  H HB3  . SER A 1 103 ? 3.479   -5.747  -1.491  1.00 0.00 ? 103 SER A HB3  3  
ATOM 5074  H HG   . SER A 1 103 ? 4.996   -6.962  -3.316  1.00 0.00 ? 103 SER A HG   3  
ATOM 5075  N N    . ALA A 1 104 ? 1.052   -5.601  -4.037  1.00 0.00 ? 104 ALA A N    3  
ATOM 5076  C CA   . ALA A 1 104 ? -0.382  -5.465  -3.850  1.00 0.00 ? 104 ALA A CA   3  
ATOM 5077  C C    . ALA A 1 104 ? -0.909  -6.676  -3.079  1.00 0.00 ? 104 ALA A C    3  
ATOM 5078  O O    . ALA A 1 104 ? -0.808  -7.808  -3.550  1.00 0.00 ? 104 ALA A O    3  
ATOM 5079  C CB   . ALA A 1 104 ? -1.061  -5.300  -5.211  1.00 0.00 ? 104 ALA A CB   3  
ATOM 5080  H H    . ALA A 1 104 ? 1.326   -6.203  -4.787  1.00 0.00 ? 104 ALA A H    3  
ATOM 5081  H HA   . ALA A 1 104 ? -0.556  -4.565  -3.260  1.00 0.00 ? 104 ALA A HA   3  
ATOM 5082  H HB1  . ALA A 1 104 ? -0.337  -5.487  -6.004  1.00 0.00 ? 104 ALA A HB1  3  
ATOM 5083  H HB2  . ALA A 1 104 ? -1.883  -6.011  -5.295  1.00 0.00 ? 104 ALA A HB2  3  
ATOM 5084  H HB3  . ALA A 1 104 ? -1.447  -4.285  -5.304  1.00 0.00 ? 104 ALA A HB3  3  
ATOM 5085  N N    . SER A 1 105 ? -1.459  -6.398  -1.906  1.00 0.00 ? 105 SER A N    3  
ATOM 5086  C CA   . SER A 1 105 ? -2.002  -7.451  -1.065  1.00 0.00 ? 105 SER A CA   3  
ATOM 5087  C C    . SER A 1 105 ? -3.498  -7.223  -0.841  1.00 0.00 ? 105 SER A C    3  
ATOM 5088  O O    . SER A 1 105 ? -3.909  -6.140  -0.428  1.00 0.00 ? 105 SER A O    3  
ATOM 5089  C CB   . SER A 1 105 ? -1.268  -7.518  0.276   1.00 0.00 ? 105 SER A CB   3  
ATOM 5090  O OG   . SER A 1 105 ? -0.640  -8.781  0.478   1.00 0.00 ? 105 SER A OG   3  
ATOM 5091  H H    . SER A 1 105 ? -1.537  -5.474  -1.530  1.00 0.00 ? 105 SER A H    3  
ATOM 5092  H HA   . SER A 1 105 ? -1.834  -8.376  -1.617  1.00 0.00 ? 105 SER A HA   3  
ATOM 5093  H HB2  . SER A 1 105 ? -0.517  -6.729  0.318   1.00 0.00 ? 105 SER A HB2  3  
ATOM 5094  H HB3  . SER A 1 105 ? -1.973  -7.330  1.085   1.00 0.00 ? 105 SER A HB3  3  
ATOM 5095  H HG   . SER A 1 105 ? -0.068  -8.751  1.298   1.00 0.00 ? 105 SER A HG   3  
ATOM 5096  N N    . THR A 1 106 ? -4.271  -8.262  -1.122  1.00 0.00 ? 106 THR A N    3  
ATOM 5097  C CA   . THR A 1 106 ? -5.712  -8.188  -0.956  1.00 0.00 ? 106 THR A CA   3  
ATOM 5098  C C    . THR A 1 106 ? -6.086  -8.319  0.522   1.00 0.00 ? 106 THR A C    3  
ATOM 5099  O O    . THR A 1 106 ? -5.578  -9.195  1.219   1.00 0.00 ? 106 THR A O    3  
ATOM 5100  C CB   . THR A 1 106 ? -6.346  -9.264  -1.841  1.00 0.00 ? 106 THR A CB   3  
ATOM 5101  O OG1  . THR A 1 106 ? -5.443  -9.388  -2.936  1.00 0.00 ? 106 THR A OG1  3  
ATOM 5102  C CG2  . THR A 1 106 ? -7.652  -8.797  -2.485  1.00 0.00 ? 106 THR A CG2  3  
ATOM 5103  H H    . THR A 1 106 ? -3.928  -9.139  -1.457  1.00 0.00 ? 106 THR A H    3  
ATOM 5104  H HA   . THR A 1 106 ? -6.046  -7.204  -1.284  1.00 0.00 ? 106 THR A HA   3  
ATOM 5105  H HB   . THR A 1 106 ? -6.495  -10.188 -1.283  1.00 0.00 ? 106 THR A HB   3  
ATOM 5106  H HG1  . THR A 1 106 ? -5.236  -10.352 -3.101  1.00 0.00 ? 106 THR A HG1  3  
ATOM 5107  H HG21 . THR A 1 106 ? -7.751  -9.246  -3.474  1.00 0.00 ? 106 THR A HG21 3  
ATOM 5108  H HG22 . THR A 1 106 ? -8.494  -9.101  -1.863  1.00 0.00 ? 106 THR A HG22 3  
ATOM 5109  H HG23 . THR A 1 106 ? -7.644  -7.711  -2.579  1.00 0.00 ? 106 THR A HG23 3  
ATOM 5110  N N    . ILE A 1 107 ? -6.973  -7.435  0.956   1.00 0.00 ? 107 ILE A N    3  
ATOM 5111  C CA   . ILE A 1 107 ? -7.421  -7.441  2.338   1.00 0.00 ? 107 ILE A CA   3  
ATOM 5112  C C    . ILE A 1 107 ? -8.880  -6.985  2.398   1.00 0.00 ? 107 ILE A C    3  
ATOM 5113  O O    . ILE A 1 107 ? -9.249  -5.989  1.778   1.00 0.00 ? 107 ILE A O    3  
ATOM 5114  C CB   . ILE A 1 107 ? -6.479  -6.607  3.210   1.00 0.00 ? 107 ILE A CB   3  
ATOM 5115  C CG1  . ILE A 1 107 ? -7.025  -6.473  4.633   1.00 0.00 ? 107 ILE A CG1  3  
ATOM 5116  C CG2  . ILE A 1 107 ? -6.203  -5.244  2.571   1.00 0.00 ? 107 ILE A CG2  3  
ATOM 5117  C CD1  . ILE A 1 107 ? -6.899  -7.794  5.395   1.00 0.00 ? 107 ILE A CD1  3  
ATOM 5118  H H    . ILE A 1 107 ? -7.382  -6.725  0.382   1.00 0.00 ? 107 ILE A H    3  
ATOM 5119  H HA   . ILE A 1 107 ? -7.365  -8.469  2.695   1.00 0.00 ? 107 ILE A HA   3  
ATOM 5120  H HB   . ILE A 1 107 ? -5.525  -7.129  3.279   1.00 0.00 ? 107 ILE A HB   3  
ATOM 5121  H HG12 . ILE A 1 107 ? -6.482  -5.690  5.162   1.00 0.00 ? 107 ILE A HG12 3  
ATOM 5122  H HG13 . ILE A 1 107 ? -8.071  -6.167  4.598   1.00 0.00 ? 107 ILE A HG13 3  
ATOM 5123  H HG21 . ILE A 1 107 ? -6.210  -4.474  3.342   1.00 0.00 ? 107 ILE A HG21 3  
ATOM 5124  H HG22 . ILE A 1 107 ? -5.229  -5.263  2.083   1.00 0.00 ? 107 ILE A HG22 3  
ATOM 5125  H HG23 . ILE A 1 107 ? -6.975  -5.026  1.833   1.00 0.00 ? 107 ILE A HG23 3  
ATOM 5126  H HD11 . ILE A 1 107 ? -7.757  -8.426  5.170   1.00 0.00 ? 107 ILE A HD11 3  
ATOM 5127  H HD12 . ILE A 1 107 ? -5.984  -8.302  5.092   1.00 0.00 ? 107 ILE A HD12 3  
ATOM 5128  H HD13 . ILE A 1 107 ? -6.866  -7.593  6.466   1.00 0.00 ? 107 ILE A HD13 3  
ATOM 5129  N N    . SER A 1 108 ? -9.670  -7.736  3.152   1.00 0.00 ? 108 SER A N    3  
ATOM 5130  C CA   . SER A 1 108 ? -11.081 -7.421  3.302   1.00 0.00 ? 108 SER A CA   3  
ATOM 5131  C C    . SER A 1 108 ? -11.320 -6.710  4.635   1.00 0.00 ? 108 SER A C    3  
ATOM 5132  O O    . SER A 1 108 ? -11.044 -7.265  5.697   1.00 0.00 ? 108 SER A O    3  
ATOM 5133  C CB   . SER A 1 108 ? -11.939 -8.685  3.213   1.00 0.00 ? 108 SER A CB   3  
ATOM 5134  O OG   . SER A 1 108 ? -13.199 -8.521  3.858   1.00 0.00 ? 108 SER A OG   3  
ATOM 5135  H H    . SER A 1 108 ? -9.362  -8.544  3.654   1.00 0.00 ? 108 SER A H    3  
ATOM 5136  H HA   . SER A 1 108 ? -11.320 -6.762  2.468   1.00 0.00 ? 108 SER A HA   3  
ATOM 5137  H HB2  . SER A 1 108 ? -12.099 -8.942  2.166   1.00 0.00 ? 108 SER A HB2  3  
ATOM 5138  H HB3  . SER A 1 108 ? -11.404 -9.519  3.667   1.00 0.00 ? 108 SER A HB3  3  
ATOM 5139  H HG   . SER A 1 108 ? -13.663 -7.710  3.503   1.00 0.00 ? 108 SER A HG   3  
ATOM 5140  N N    . SER A 1 109 ? -11.831 -5.491  4.536   1.00 0.00 ? 109 SER A N    3  
ATOM 5141  C CA   . SER A 1 109 ? -12.110 -4.698  5.721   1.00 0.00 ? 109 SER A CA   3  
ATOM 5142  C C    . SER A 1 109 ? -12.661 -5.594  6.832   1.00 0.00 ? 109 SER A C    3  
ATOM 5143  O O    . SER A 1 109 ? -13.369 -6.562  6.560   1.00 0.00 ? 109 SER A O    3  
ATOM 5144  C CB   . SER A 1 109 ? -13.097 -3.571  5.409   1.00 0.00 ? 109 SER A CB   3  
ATOM 5145  O OG   . SER A 1 109 ? -14.288 -4.058  4.798   1.00 0.00 ? 109 SER A OG   3  
ATOM 5146  H H    . SER A 1 109 ? -12.052 -5.047  3.668   1.00 0.00 ? 109 SER A H    3  
ATOM 5147  H HA   . SER A 1 109 ? -11.151 -4.270  6.014   1.00 0.00 ? 109 SER A HA   3  
ATOM 5148  H HB2  . SER A 1 109 ? -13.350 -3.046  6.330   1.00 0.00 ? 109 SER A HB2  3  
ATOM 5149  H HB3  . SER A 1 109 ? -12.621 -2.845  4.749   1.00 0.00 ? 109 SER A HB3  3  
ATOM 5150  H HG   . SER A 1 109 ? -14.956 -3.319  4.714   1.00 0.00 ? 109 SER A HG   3  
ATOM 5151  N N    . GLY A 1 110 ? -12.315 -5.239  8.060   1.00 0.00 ? 110 GLY A N    3  
ATOM 5152  C CA   . GLY A 1 110 ? -12.766 -5.999  9.214   1.00 0.00 ? 110 GLY A CA   3  
ATOM 5153  C C    . GLY A 1 110 ? -14.294 -6.014  9.297   1.00 0.00 ? 110 GLY A C    3  
ATOM 5154  O O    . GLY A 1 110 ? -14.943 -6.874  8.704   1.00 0.00 ? 110 GLY A O    3  
ATOM 5155  H H    . GLY A 1 110 ? -11.738 -4.450  8.273   1.00 0.00 ? 110 GLY A H    3  
ATOM 5156  H HA2  . GLY A 1 110 ? -12.392 -7.020  9.150   1.00 0.00 ? 110 GLY A HA2  3  
ATOM 5157  H HA3  . GLY A 1 110 ? -12.353 -5.564  10.124  1.00 0.00 ? 110 GLY A HA3  3  
ATOM 5158  N N    . VAL A 1 111 ? -14.824 -5.052  10.038  1.00 0.00 ? 111 VAL A N    3  
ATOM 5159  C CA   . VAL A 1 111 ? -16.263 -4.944  10.207  1.00 0.00 ? 111 VAL A CA   3  
ATOM 5160  C C    . VAL A 1 111 ? -16.583 -3.697  11.034  1.00 0.00 ? 111 VAL A C    3  
ATOM 5161  O O    . VAL A 1 111 ? -15.863 -3.371  11.976  1.00 0.00 ? 111 VAL A O    3  
ATOM 5162  C CB   . VAL A 1 111 ? -16.816 -6.230  10.825  1.00 0.00 ? 111 VAL A CB   3  
ATOM 5163  C CG1  . VAL A 1 111 ? -16.166 -6.509  12.182  1.00 0.00 ? 111 VAL A CG1  3  
ATOM 5164  C CG2  . VAL A 1 111 ? -18.339 -6.168  10.949  1.00 0.00 ? 111 VAL A CG2  3  
ATOM 5165  H H    . VAL A 1 111 ? -14.289 -4.356  10.518  1.00 0.00 ? 111 VAL A H    3  
ATOM 5166  H HA   . VAL A 1 111 ? -16.702 -4.830  9.216   1.00 0.00 ? 111 VAL A HA   3  
ATOM 5167  H HB   . VAL A 1 111 ? -16.567 -7.056  10.158  1.00 0.00 ? 111 VAL A HB   3  
ATOM 5168  H HG11 . VAL A 1 111 ? -15.090 -6.627  12.052  1.00 0.00 ? 111 VAL A HG11 3  
ATOM 5169  H HG12 . VAL A 1 111 ? -16.361 -5.676  12.856  1.00 0.00 ? 111 VAL A HG12 3  
ATOM 5170  H HG13 . VAL A 1 111 ? -16.583 -7.424  12.603  1.00 0.00 ? 111 VAL A HG13 3  
ATOM 5171  H HG21 . VAL A 1 111 ? -18.687 -6.996  11.566  1.00 0.00 ? 111 VAL A HG21 3  
ATOM 5172  H HG22 . VAL A 1 111 ? -18.628 -5.224  11.412  1.00 0.00 ? 111 VAL A HG22 3  
ATOM 5173  H HG23 . VAL A 1 111 ? -18.788 -6.239  9.958   1.00 0.00 ? 111 VAL A HG23 3  
ATOM 5174  N N    . PRO A 1 112 ? -17.694 -3.017  10.642  1.00 0.00 ? 112 PRO A N    3  
ATOM 5175  C CA   . PRO A 1 112 ? -18.118 -1.814  11.337  1.00 0.00 ? 112 PRO A CA   3  
ATOM 5176  C C    . PRO A 1 112 ? -18.761 -2.155  12.683  1.00 0.00 ? 112 PRO A C    3  
ATOM 5177  O O    . PRO A 1 112 ? -19.683 -2.967  12.746  1.00 0.00 ? 112 PRO A O    3  
ATOM 5178  C CB   . PRO A 1 112 ? -19.076 -1.124  10.379  1.00 0.00 ? 112 PRO A CB   3  
ATOM 5179  C CG   . PRO A 1 112 ? -19.512 -2.189  9.386   1.00 0.00 ? 112 PRO A CG   3  
ATOM 5180  C CD   . PRO A 1 112 ? -18.571 -3.374  9.531   1.00 0.00 ? 112 PRO A CD   3  
ATOM 5181  H HA   . PRO A 1 112 ? -17.328 -1.238  11.549  1.00 0.00 ? 112 PRO A HA   3  
ATOM 5182  H HB2  . PRO A 1 112 ? -19.933 -0.713  10.913  1.00 0.00 ? 112 PRO A HB2  3  
ATOM 5183  H HB3  . PRO A 1 112 ? -18.589 -0.292  9.871   1.00 0.00 ? 112 PRO A HB3  3  
ATOM 5184  H HG2  . PRO A 1 112 ? -20.541 -2.493  9.579   1.00 0.00 ? 112 PRO A HG2  3  
ATOM 5185  H HG3  . PRO A 1 112 ? -19.480 -1.798  8.369   1.00 0.00 ? 112 PRO A HG3  3  
ATOM 5186  H HD2  . PRO A 1 112 ? -19.120 -4.292  9.739   1.00 0.00 ? 112 PRO A HD2  3  
ATOM 5187  H HD3  . PRO A 1 112 ? -18.003 -3.543  8.616   1.00 0.00 ? 112 PRO A HD3  3  
ATOM 5188  N N    . PRO A 1 113 ? -18.234 -1.502  13.753  1.00 0.00 ? 113 PRO A N    3  
ATOM 5189  C CA   . PRO A 1 113 ? -18.746 -1.728  15.094  1.00 0.00 ? 113 PRO A CA   3  
ATOM 5190  C C    . PRO A 1 113 ? -20.096 -1.034  15.290  1.00 0.00 ? 113 PRO A C    3  
ATOM 5191  O O    . PRO A 1 113 ? -20.884 -1.432  16.145  1.00 0.00 ? 113 PRO A O    3  
ATOM 5192  C CB   . PRO A 1 113 ? -17.666 -1.198  16.022  1.00 0.00 ? 113 PRO A CB   3  
ATOM 5193  C CG   . PRO A 1 113 ? -16.802 -0.278  15.174  1.00 0.00 ? 113 PRO A CG   3  
ATOM 5194  C CD   . PRO A 1 113 ? -17.142 -0.534  13.715  1.00 0.00 ? 113 PRO A CD   3  
ATOM 5195  H HA   . PRO A 1 113 ? -18.916 -2.702  15.241  1.00 0.00 ? 113 PRO A HA   3  
ATOM 5196  H HB2  . PRO A 1 113 ? -18.103 -0.659  16.863  1.00 0.00 ? 113 PRO A HB2  3  
ATOM 5197  H HB3  . PRO A 1 113 ? -17.075 -2.014  16.439  1.00 0.00 ? 113 PRO A HB3  3  
ATOM 5198  H HG2  . PRO A 1 113 ? -16.987 0.764   15.433  1.00 0.00 ? 113 PRO A HG2  3  
ATOM 5199  H HG3  . PRO A 1 113 ? -15.745 -0.470  15.359  1.00 0.00 ? 113 PRO A HG3  3  
ATOM 5200  H HD2  . PRO A 1 113 ? -17.444 0.385   13.212  1.00 0.00 ? 113 PRO A HD2  3  
ATOM 5201  H HD3  . PRO A 1 113 ? -16.283 -0.927  13.171  1.00 0.00 ? 113 PRO A HD3  3  
ATOM 5202  N N    . SER A 1 114 ? -20.320 -0.007  14.482  1.00 0.00 ? 114 SER A N    3  
ATOM 5203  C CA   . SER A 1 114 ? -21.560 0.746   14.556  1.00 0.00 ? 114 SER A CA   3  
ATOM 5204  C C    . SER A 1 114 ? -21.979 0.922   16.017  1.00 0.00 ? 114 SER A C    3  
ATOM 5205  O O    . SER A 1 114 ? -22.908 0.264   16.484  1.00 0.00 ? 114 SER A O    3  
ATOM 5206  C CB   . SER A 1 114 ? -22.672 0.055   13.764  1.00 0.00 ? 114 SER A CB   3  
ATOM 5207  O OG   . SER A 1 114 ? -23.455 0.985   13.021  1.00 0.00 ? 114 SER A OG   3  
ATOM 5208  H H    . SER A 1 114 ? -19.673 0.310   13.789  1.00 0.00 ? 114 SER A H    3  
ATOM 5209  H HA   . SER A 1 114 ? -21.338 1.712   14.103  1.00 0.00 ? 114 SER A HA   3  
ATOM 5210  H HB2  . SER A 1 114 ? -22.233 -0.674  13.084  1.00 0.00 ? 114 SER A HB2  3  
ATOM 5211  H HB3  . SER A 1 114 ? -23.317 -0.496  14.449  1.00 0.00 ? 114 SER A HB3  3  
ATOM 5212  H HG   . SER A 1 114 ? -23.786 1.712   13.623  1.00 0.00 ? 114 SER A HG   3  
ATOM 5213  N N    . GLY A 1 115 ? -21.275 1.813   16.698  1.00 0.00 ? 115 GLY A N    3  
ATOM 5214  C CA   . GLY A 1 115 ? -21.562 2.084   18.097  1.00 0.00 ? 115 GLY A CA   3  
ATOM 5215  C C    . GLY A 1 115 ? -21.144 0.907   18.980  1.00 0.00 ? 115 GLY A C    3  
ATOM 5216  O O    . GLY A 1 115 ? -21.929 -0.012  19.208  1.00 0.00 ? 115 GLY A O    3  
ATOM 5217  H H    . GLY A 1 115 ? -20.521 2.345   16.311  1.00 0.00 ? 115 GLY A H    3  
ATOM 5218  H HA2  . GLY A 1 115 ? -21.036 2.985   18.412  1.00 0.00 ? 115 GLY A HA2  3  
ATOM 5219  H HA3  . GLY A 1 115 ? -22.628 2.277   18.222  1.00 0.00 ? 115 GLY A HA3  3  
ATOM 5220  N N    . PRO A 1 116 ? -19.876 0.975   19.466  1.00 0.00 ? 116 PRO A N    3  
ATOM 5221  C CA   . PRO A 1 116 ? -19.344 -0.073  20.320  1.00 0.00 ? 116 PRO A CA   3  
ATOM 5222  C C    . PRO A 1 116 ? -19.927 0.020   21.731  1.00 0.00 ? 116 PRO A C    3  
ATOM 5223  O O    . PRO A 1 116 ? -19.883 1.079   22.356  1.00 0.00 ? 116 PRO A O    3  
ATOM 5224  C CB   . PRO A 1 116 ? -17.837 0.119   20.286  1.00 0.00 ? 116 PRO A CB   3  
ATOM 5225  C CG   . PRO A 1 116 ? -17.608 1.539   19.795  1.00 0.00 ? 116 PRO A CG   3  
ATOM 5226  C CD   . PRO A 1 116 ? -18.918 2.049   19.217  1.00 0.00 ? 116 PRO A CD   3  
ATOM 5227  H HA   . PRO A 1 116 ? -19.611 -0.972  19.973  1.00 0.00 ? 116 PRO A HA   3  
ATOM 5228  H HB2  . PRO A 1 116 ? -17.402 -0.028  21.275  1.00 0.00 ? 116 PRO A HB2  3  
ATOM 5229  H HB3  . PRO A 1 116 ? -17.366 -0.605  19.621  1.00 0.00 ? 116 PRO A HB3  3  
ATOM 5230  H HG2  . PRO A 1 116 ? -17.278 2.177   20.615  1.00 0.00 ? 116 PRO A HG2  3  
ATOM 5231  H HG3  . PRO A 1 116 ? -16.823 1.560   19.039  1.00 0.00 ? 116 PRO A HG3  3  
ATOM 5232  H HD2  . PRO A 1 116 ? -19.229 2.976   19.698  1.00 0.00 ? 116 PRO A HD2  3  
ATOM 5233  H HD3  . PRO A 1 116 ? -18.826 2.258   18.151  1.00 0.00 ? 116 PRO A HD3  3  
ATOM 5234  N N    . SER A 1 117 ? -20.460 -1.102  22.193  1.00 0.00 ? 117 SER A N    3  
ATOM 5235  C CA   . SER A 1 117 ? -21.051 -1.160  23.519  1.00 0.00 ? 117 SER A CA   3  
ATOM 5236  C C    . SER A 1 117 ? -20.274 -2.144  24.395  1.00 0.00 ? 117 SER A C    3  
ATOM 5237  O O    . SER A 1 117 ? -19.899 -1.817  25.520  1.00 0.00 ? 117 SER A O    3  
ATOM 5238  C CB   . SER A 1 117 ? -22.525 -1.562  23.448  1.00 0.00 ? 117 SER A CB   3  
ATOM 5239  O OG   . SER A 1 117 ? -23.237 -0.811  22.468  1.00 0.00 ? 117 SER A OG   3  
ATOM 5240  H H    . SER A 1 117 ? -20.492 -1.959  21.678  1.00 0.00 ? 117 SER A H    3  
ATOM 5241  H HA   . SER A 1 117 ? -20.970 -0.148  23.915  1.00 0.00 ? 117 SER A HA   3  
ATOM 5242  H HB2  . SER A 1 117 ? -22.600 -2.625  23.215  1.00 0.00 ? 117 SER A HB2  3  
ATOM 5243  H HB3  . SER A 1 117 ? -22.988 -1.416  24.423  1.00 0.00 ? 117 SER A HB3  3  
ATOM 5244  H HG   . SER A 1 117 ? -22.756 0.045   22.277  1.00 0.00 ? 117 SER A HG   3  
ATOM 5245  N N    . SER A 1 118 ? -20.055 -3.330  23.847  1.00 0.00 ? 118 SER A N    3  
ATOM 5246  C CA   . SER A 1 118 ? -19.329 -4.364  24.565  1.00 0.00 ? 118 SER A CA   3  
ATOM 5247  C C    . SER A 1 118 ? -17.916 -3.879  24.895  1.00 0.00 ? 118 SER A C    3  
ATOM 5248  O O    . SER A 1 118 ? -17.533 -3.819  26.062  1.00 0.00 ? 118 SER A O    3  
ATOM 5249  C CB   . SER A 1 118 ? -19.269 -5.660  23.753  1.00 0.00 ? 118 SER A CB   3  
ATOM 5250  O OG   . SER A 1 118 ? -20.526 -6.330  23.725  1.00 0.00 ? 118 SER A OG   3  
ATOM 5251  H H    . SER A 1 118 ? -20.363 -3.589  22.931  1.00 0.00 ? 118 SER A H    3  
ATOM 5252  H HA   . SER A 1 118 ? -19.898 -4.535  25.479  1.00 0.00 ? 118 SER A HA   3  
ATOM 5253  H HB2  . SER A 1 118 ? -18.955 -5.435  22.734  1.00 0.00 ? 118 SER A HB2  3  
ATOM 5254  H HB3  . SER A 1 118 ? -18.515 -6.321  24.180  1.00 0.00 ? 118 SER A HB3  3  
ATOM 5255  H HG   . SER A 1 118 ? -21.259 -5.676  23.542  1.00 0.00 ? 118 SER A HG   3  
ATOM 5256  N N    . GLY A 1 119 ? -17.179 -3.545  23.845  1.00 0.00 ? 119 GLY A N    3  
ATOM 5257  C CA   . GLY A 1 119 ? -15.817 -3.067  24.009  1.00 0.00 ? 119 GLY A CA   3  
ATOM 5258  C C    . GLY A 1 119 ? -14.896 -3.660  22.941  1.00 0.00 ? 119 GLY A C    3  
ATOM 5259  O O    . GLY A 1 119 ? -13.680 -3.480  22.996  1.00 0.00 ? 119 GLY A O    3  
ATOM 5260  H H    . GLY A 1 119 ? -17.498 -3.597  22.899  1.00 0.00 ? 119 GLY A H    3  
ATOM 5261  H HA2  . GLY A 1 119 ? -15.800 -1.979  23.946  1.00 0.00 ? 119 GLY A HA2  3  
ATOM 5262  H HA3  . GLY A 1 119 ? -15.451 -3.334  25.000  1.00 0.00 ? 119 GLY A HA3  3  
ATOM 5263  N N    . GLY A 1 1   ? -2.669  -16.674 8.066   1.00 0.00 ? 1   GLY A N    4  
ATOM 5264  C CA   . GLY A 1 1   ? -1.573  -17.196 7.267   1.00 0.00 ? 1   GLY A CA   4  
ATOM 5265  C C    . GLY A 1 1   ? -0.353  -16.275 7.342   1.00 0.00 ? 1   GLY A C    4  
ATOM 5266  O O    . GLY A 1 1   ? -0.194  -15.381 6.512   1.00 0.00 ? 1   GLY A O    4  
ATOM 5267  H H1   . GLY A 1 1   ? -2.603  -16.859 9.046   1.00 0.00 ? 1   GLY A H1   4  
ATOM 5268  H HA2  . GLY A 1 1   ? -1.303  -18.191 7.620   1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5269  H HA3  . GLY A 1 1   ? -1.891  -17.300 6.230   1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5270  N N    . SER A 1 2   ? 0.476   -16.524 8.344   1.00 0.00 ? 2   SER A N    4  
ATOM 5271  C CA   . SER A 1 2   ? 1.677   -15.729 8.538   1.00 0.00 ? 2   SER A CA   4  
ATOM 5272  C C    . SER A 1 2   ? 2.903   -16.504 8.051   1.00 0.00 ? 2   SER A C    4  
ATOM 5273  O O    . SER A 1 2   ? 3.628   -16.037 7.174   1.00 0.00 ? 2   SER A O    4  
ATOM 5274  C CB   . SER A 1 2   ? 1.846   -15.337 10.007  1.00 0.00 ? 2   SER A CB   4  
ATOM 5275  O OG   . SER A 1 2   ? 3.136   -14.791 10.269  1.00 0.00 ? 2   SER A OG   4  
ATOM 5276  H H    . SER A 1 2   ? 0.340   -17.254 9.015   1.00 0.00 ? 2   SER A H    4  
ATOM 5277  H HA   . SER A 1 2   ? 1.528   -14.831 7.938   1.00 0.00 ? 2   SER A HA   4  
ATOM 5278  H HB2  . SER A 1 2   ? 1.082   -14.608 10.278  1.00 0.00 ? 2   SER A HB2  4  
ATOM 5279  H HB3  . SER A 1 2   ? 1.688   -16.212 10.637  1.00 0.00 ? 2   SER A HB3  4  
ATOM 5280  H HG   . SER A 1 2   ? 3.110   -14.235 11.100  1.00 0.00 ? 2   SER A HG   4  
ATOM 5281  N N    . SER A 1 3   ? 3.096   -17.674 8.641   1.00 0.00 ? 3   SER A N    4  
ATOM 5282  C CA   . SER A 1 3   ? 4.221   -18.518 8.278   1.00 0.00 ? 3   SER A CA   4  
ATOM 5283  C C    . SER A 1 3   ? 4.354   -18.588 6.755   1.00 0.00 ? 3   SER A C    4  
ATOM 5284  O O    . SER A 1 3   ? 5.387   -18.217 6.201   1.00 0.00 ? 3   SER A O    4  
ATOM 5285  C CB   . SER A 1 3   ? 4.067   -19.924 8.862   1.00 0.00 ? 3   SER A CB   4  
ATOM 5286  O OG   . SER A 1 3   ? 5.158   -20.770 8.513   1.00 0.00 ? 3   SER A OG   4  
ATOM 5287  H H    . SER A 1 3   ? 2.501   -18.047 9.353   1.00 0.00 ? 3   SER A H    4  
ATOM 5288  H HA   . SER A 1 3   ? 5.096   -18.038 8.717   1.00 0.00 ? 3   SER A HA   4  
ATOM 5289  H HB2  . SER A 1 3   ? 3.991   -19.859 9.948   1.00 0.00 ? 3   SER A HB2  4  
ATOM 5290  H HB3  . SER A 1 3   ? 3.137   -20.365 8.504   1.00 0.00 ? 3   SER A HB3  4  
ATOM 5291  H HG   . SER A 1 3   ? 4.871   -21.728 8.539   1.00 0.00 ? 3   SER A HG   4  
ATOM 5292  N N    . GLY A 1 4   ? 3.293   -19.066 6.122   1.00 0.00 ? 4   GLY A N    4  
ATOM 5293  C CA   . GLY A 1 4   ? 3.277   -19.189 4.675   1.00 0.00 ? 4   GLY A CA   4  
ATOM 5294  C C    . GLY A 1 4   ? 3.598   -17.850 4.007   1.00 0.00 ? 4   GLY A C    4  
ATOM 5295  O O    . GLY A 1 4   ? 2.952   -16.841 4.288   1.00 0.00 ? 4   GLY A O    4  
ATOM 5296  H H    . GLY A 1 4   ? 2.456   -19.365 6.581   1.00 0.00 ? 4   GLY A H    4  
ATOM 5297  H HA2  . GLY A 1 4   ? 4.004   -19.938 4.362   1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5298  H HA3  . GLY A 1 4   ? 2.298   -19.537 4.346   1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5299  N N    . SER A 1 5   ? 4.596   -17.883 3.136   1.00 0.00 ? 5   SER A N    4  
ATOM 5300  C CA   . SER A 1 5   ? 5.011   -16.685 2.427   1.00 0.00 ? 5   SER A CA   4  
ATOM 5301  C C    . SER A 1 5   ? 6.149   -17.017 1.460   1.00 0.00 ? 5   SER A C    4  
ATOM 5302  O O    . SER A 1 5   ? 6.826   -18.031 1.618   1.00 0.00 ? 5   SER A O    4  
ATOM 5303  C CB   . SER A 1 5   ? 5.446   -15.590 3.403   1.00 0.00 ? 5   SER A CB   4  
ATOM 5304  O OG   . SER A 1 5   ? 6.496   -16.026 4.261   1.00 0.00 ? 5   SER A OG   4  
ATOM 5305  H H    . SER A 1 5   ? 5.117   -18.708 2.914   1.00 0.00 ? 5   SER A H    4  
ATOM 5306  H HA   . SER A 1 5   ? 4.129   -16.354 1.880   1.00 0.00 ? 5   SER A HA   4  
ATOM 5307  H HB2  . SER A 1 5   ? 5.776   -14.715 2.842   1.00 0.00 ? 5   SER A HB2  4  
ATOM 5308  H HB3  . SER A 1 5   ? 4.591   -15.279 4.004   1.00 0.00 ? 5   SER A HB3  4  
ATOM 5309  H HG   . SER A 1 5   ? 6.151   -16.138 5.193   1.00 0.00 ? 5   SER A HG   4  
ATOM 5310  N N    . SER A 1 6   ? 6.325   -16.142 0.480   1.00 0.00 ? 6   SER A N    4  
ATOM 5311  C CA   . SER A 1 6   ? 7.369   -16.329 -0.512  1.00 0.00 ? 6   SER A CA   4  
ATOM 5312  C C    . SER A 1 6   ? 7.059   -17.555 -1.374  1.00 0.00 ? 6   SER A C    4  
ATOM 5313  O O    . SER A 1 6   ? 6.354   -18.463 -0.937  1.00 0.00 ? 6   SER A O    4  
ATOM 5314  C CB   . SER A 1 6   ? 8.739   -16.481 0.152   1.00 0.00 ? 6   SER A CB   4  
ATOM 5315  O OG   . SER A 1 6   ? 9.755   -15.772 -0.551  1.00 0.00 ? 6   SER A OG   4  
ATOM 5316  H H    . SER A 1 6   ? 5.770   -15.319 0.359   1.00 0.00 ? 6   SER A H    4  
ATOM 5317  H HA   . SER A 1 6   ? 7.358   -15.423 -1.118  1.00 0.00 ? 6   SER A HA   4  
ATOM 5318  H HB2  . SER A 1 6   ? 8.687   -16.117 1.178   1.00 0.00 ? 6   SER A HB2  4  
ATOM 5319  H HB3  . SER A 1 6   ? 9.003   -17.538 0.202   1.00 0.00 ? 6   SER A HB3  4  
ATOM 5320  H HG   . SER A 1 6   ? 9.340   -15.136 -1.203  1.00 0.00 ? 6   SER A HG   4  
ATOM 5321  N N    . GLY A 1 7   ? 7.600   -17.541 -2.583  1.00 0.00 ? 7   GLY A N    4  
ATOM 5322  C CA   . GLY A 1 7   ? 7.389   -18.640 -3.510  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5323  C C    . GLY A 1 7   ? 8.657   -18.926 -4.318  1.00 0.00 ? 7   GLY A C    4  
ATOM 5324  O O    . GLY A 1 7   ? 9.544   -18.079 -4.409  1.00 0.00 ? 7   GLY A O    4  
ATOM 5325  H H    . GLY A 1 7   ? 8.172   -16.798 -2.931  1.00 0.00 ? 7   GLY A H    4  
ATOM 5326  H HA2  . GLY A 1 7   ? 7.096   -19.533 -2.959  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5327  H HA3  . GLY A 1 7   ? 6.569   -18.398 -4.186  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5328  N N    . PRO A 1 8   ? 8.702   -20.154 -4.900  1.00 0.00 ? 8   PRO A N    4  
ATOM 5329  C CA   . PRO A 1 8   ? 9.846   -20.563 -5.698  1.00 0.00 ? 8   PRO A CA   4  
ATOM 5330  C C    . PRO A 1 8   ? 9.833   -19.877 -7.066  1.00 0.00 ? 8   PRO A C    4  
ATOM 5331  O O    . PRO A 1 8   ? 8.771   -19.535 -7.583  1.00 0.00 ? 8   PRO A O    4  
ATOM 5332  C CB   . PRO A 1 8   ? 9.740   -22.076 -5.791  1.00 0.00 ? 8   PRO A CB   4  
ATOM 5333  C CG   . PRO A 1 8   ? 8.301   -22.416 -5.441  1.00 0.00 ? 8   PRO A CG   4  
ATOM 5334  C CD   . PRO A 1 8   ? 7.670   -21.183 -4.814  1.00 0.00 ? 8   PRO A CD   4  
ATOM 5335  H HA   . PRO A 1 8   ? 10.696  -20.277 -5.257  1.00 0.00 ? 8   PRO A HA   4  
ATOM 5336  H HB2  . PRO A 1 8   ? 9.991   -22.424 -6.793  1.00 0.00 ? 8   PRO A HB2  4  
ATOM 5337  H HB3  . PRO A 1 8   ? 10.434  -22.559 -5.103  1.00 0.00 ? 8   PRO A HB3  4  
ATOM 5338  H HG2  . PRO A 1 8   ? 7.751   -22.714 -6.334  1.00 0.00 ? 8   PRO A HG2  4  
ATOM 5339  H HG3  . PRO A 1 8   ? 8.264   -23.257 -4.749  1.00 0.00 ? 8   PRO A HG3  4  
ATOM 5340  H HD2  . PRO A 1 8   ? 6.768   -20.885 -5.348  1.00 0.00 ? 8   PRO A HD2  4  
ATOM 5341  H HD3  . PRO A 1 8   ? 7.381   -21.369 -3.780  1.00 0.00 ? 8   PRO A HD3  4  
ATOM 5342  N N    . GLN A 1 9   ? 11.026  -19.697 -7.613  1.00 0.00 ? 9   GLN A N    4  
ATOM 5343  C CA   . GLN A 1 9   ? 11.166  -19.059 -8.911  1.00 0.00 ? 9   GLN A CA   4  
ATOM 5344  C C    . GLN A 1 9   ? 12.643  -18.962 -9.299  1.00 0.00 ? 9   GLN A C    4  
ATOM 5345  O O    . GLN A 1 9   ? 13.521  -19.242 -8.485  1.00 0.00 ? 9   GLN A O    4  
ATOM 5346  C CB   . GLN A 1 9   ? 10.505  -17.679 -8.917  1.00 0.00 ? 9   GLN A CB   4  
ATOM 5347  C CG   . GLN A 1 9   ? 9.321   -17.642 -9.885  1.00 0.00 ? 9   GLN A CG   4  
ATOM 5348  C CD   . GLN A 1 9   ? 9.012   -16.208 -10.319 1.00 0.00 ? 9   GLN A CD   4  
ATOM 5349  O OE1  . GLN A 1 9   ? 8.871   -15.304 -9.512  1.00 0.00 ? 9   GLN A OE1  4  
ATOM 5350  N NE2  . GLN A 1 9   ? 8.914   -16.051 -11.636 1.00 0.00 ? 9   GLN A NE2  4  
ATOM 5351  H H    . GLN A 1 9   ? 11.885  -19.979 -7.186  1.00 0.00 ? 9   GLN A H    4  
ATOM 5352  H HA   . GLN A 1 9   ? 10.641  -19.709 -9.611  1.00 0.00 ? 9   GLN A HA   4  
ATOM 5353  H HB2  . GLN A 1 9   ? 10.166  -17.430 -7.912  1.00 0.00 ? 9   GLN A HB2  4  
ATOM 5354  H HB3  . GLN A 1 9   ? 11.236  -16.923 -9.203  1.00 0.00 ? 9   GLN A HB3  4  
ATOM 5355  H HG2  . GLN A 1 9   ? 9.543   -18.252 -10.761 1.00 0.00 ? 9   GLN A HG2  4  
ATOM 5356  H HG3  . GLN A 1 9   ? 8.443   -18.079 -9.408  1.00 0.00 ? 9   GLN A HG3  4  
ATOM 5357  H HE21 . GLN A 1 9   ? 9.041   -16.835 -12.244 1.00 0.00 ? 9   GLN A HE21 4  
ATOM 5358  H HE22 . GLN A 1 9   ? 8.714   -15.149 -12.019 1.00 0.00 ? 9   GLN A HE22 4  
ATOM 5359  N N    . LEU A 1 10  ? 12.870  -18.563 -10.541 1.00 0.00 ? 10  LEU A N    4  
ATOM 5360  C CA   . LEU A 1 10  ? 14.225  -18.425 -11.047 1.00 0.00 ? 10  LEU A CA   4  
ATOM 5361  C C    . LEU A 1 10  ? 14.185  -17.774 -12.431 1.00 0.00 ? 10  LEU A C    4  
ATOM 5362  O O    . LEU A 1 10  ? 13.653  -18.352 -13.377 1.00 0.00 ? 10  LEU A O    4  
ATOM 5363  C CB   . LEU A 1 10  ? 14.946  -19.774 -11.022 1.00 0.00 ? 10  LEU A CB   4  
ATOM 5364  C CG   . LEU A 1 10  ? 16.163  -19.902 -11.942 1.00 0.00 ? 10  LEU A CG   4  
ATOM 5365  C CD1  . LEU A 1 10  ? 17.444  -20.104 -11.131 1.00 0.00 ? 10  LEU A CD1  4  
ATOM 5366  C CD2  . LEU A 1 10  ? 15.956  -21.013 -12.973 1.00 0.00 ? 10  LEU A CD2  4  
ATOM 5367  H H    . LEU A 1 10  ? 12.150  -18.337 -11.197 1.00 0.00 ? 10  LEU A H    4  
ATOM 5368  H HA   . LEU A 1 10  ? 14.761  -17.761 -10.368 1.00 0.00 ? 10  LEU A HA   4  
ATOM 5369  H HB2  . LEU A 1 10  ? 15.266  -19.975 -10.000 1.00 0.00 ? 10  LEU A HB2  4  
ATOM 5370  H HB3  . LEU A 1 10  ? 14.230  -20.551 -11.290 1.00 0.00 ? 10  LEU A HB3  4  
ATOM 5371  H HG   . LEU A 1 10  ? 16.274  -18.968 -12.493 1.00 0.00 ? 10  LEU A HG   4  
ATOM 5372  H HD11 . LEU A 1 10  ? 17.867  -19.133 -10.871 1.00 0.00 ? 10  LEU A HD11 4  
ATOM 5373  H HD12 . LEU A 1 10  ? 17.214  -20.655 -10.219 1.00 0.00 ? 10  LEU A HD12 4  
ATOM 5374  H HD13 . LEU A 1 10  ? 18.165  -20.667 -11.724 1.00 0.00 ? 10  LEU A HD13 4  
ATOM 5375  H HD21 . LEU A 1 10  ? 15.754  -21.953 -12.459 1.00 0.00 ? 10  LEU A HD21 4  
ATOM 5376  H HD22 . LEU A 1 10  ? 15.112  -20.761 -13.615 1.00 0.00 ? 10  LEU A HD22 4  
ATOM 5377  H HD23 . LEU A 1 10  ? 16.856  -21.117 -13.580 1.00 0.00 ? 10  LEU A HD23 4  
ATOM 5378  N N    . VAL A 1 11  ? 14.755  -16.581 -12.505 1.00 0.00 ? 11  VAL A N    4  
ATOM 5379  C CA   . VAL A 1 11  ? 14.791  -15.845 -13.758 1.00 0.00 ? 11  VAL A CA   4  
ATOM 5380  C C    . VAL A 1 11  ? 15.639  -14.584 -13.580 1.00 0.00 ? 11  VAL A C    4  
ATOM 5381  O O    . VAL A 1 11  ? 15.800  -14.093 -12.463 1.00 0.00 ? 11  VAL A O    4  
ATOM 5382  C CB   . VAL A 1 11  ? 13.367  -15.546 -14.230 1.00 0.00 ? 11  VAL A CB   4  
ATOM 5383  C CG1  . VAL A 1 11  ? 12.685  -14.532 -13.310 1.00 0.00 ? 11  VAL A CG1  4  
ATOM 5384  C CG2  . VAL A 1 11  ? 13.361  -15.061 -15.681 1.00 0.00 ? 11  VAL A CG2  4  
ATOM 5385  H H    . VAL A 1 11  ? 15.186  -16.118 -11.731 1.00 0.00 ? 11  VAL A H    4  
ATOM 5386  H HA   . VAL A 1 11  ? 15.267  -16.485 -14.501 1.00 0.00 ? 11  VAL A HA   4  
ATOM 5387  H HB   . VAL A 1 11  ? 12.798  -16.475 -14.186 1.00 0.00 ? 11  VAL A HB   4  
ATOM 5388  H HG11 . VAL A 1 11  ? 12.689  -14.910 -12.287 1.00 0.00 ? 11  VAL A HG11 4  
ATOM 5389  H HG12 . VAL A 1 11  ? 13.224  -13.586 -13.349 1.00 0.00 ? 11  VAL A HG12 4  
ATOM 5390  H HG13 . VAL A 1 11  ? 11.657  -14.379 -13.636 1.00 0.00 ? 11  VAL A HG13 4  
ATOM 5391  H HG21 . VAL A 1 11  ? 12.336  -14.870 -15.996 1.00 0.00 ? 11  VAL A HG21 4  
ATOM 5392  H HG22 . VAL A 1 11  ? 13.942  -14.141 -15.758 1.00 0.00 ? 11  VAL A HG22 4  
ATOM 5393  H HG23 . VAL A 1 11  ? 13.803  -15.824 -16.322 1.00 0.00 ? 11  VAL A HG23 4  
ATOM 5394  N N    . ARG A 1 12  ? 16.158  -14.096 -14.696 1.00 0.00 ? 12  ARG A N    4  
ATOM 5395  C CA   . ARG A 1 12  ? 16.985  -12.901 -14.678 1.00 0.00 ? 12  ARG A CA   4  
ATOM 5396  C C    . ARG A 1 12  ? 16.235  -11.726 -15.307 1.00 0.00 ? 12  ARG A C    4  
ATOM 5397  O O    . ARG A 1 12  ? 15.833  -11.792 -16.468 1.00 0.00 ? 12  ARG A O    4  
ATOM 5398  C CB   . ARG A 1 12  ? 18.295  -13.126 -15.436 1.00 0.00 ? 12  ARG A CB   4  
ATOM 5399  C CG   . ARG A 1 12  ? 19.365  -13.722 -14.518 1.00 0.00 ? 12  ARG A CG   4  
ATOM 5400  C CD   . ARG A 1 12  ? 20.753  -13.618 -15.153 1.00 0.00 ? 12  ARG A CD   4  
ATOM 5401  N NE   . ARG A 1 12  ? 21.796  -13.860 -14.132 1.00 0.00 ? 12  ARG A NE   4  
ATOM 5402  C CZ   . ARG A 1 12  ? 23.111  -13.873 -14.390 1.00 0.00 ? 12  ARG A CZ   4  
ATOM 5403  N NH1  . ARG A 1 12  ? 23.551  -13.657 -15.637 1.00 0.00 ? 12  ARG A NH1  4  
ATOM 5404  N NH2  . ARG A 1 12  ? 23.986  -14.101 -13.401 1.00 0.00 ? 12  ARG A NH2  4  
ATOM 5405  H H    . ARG A 1 12  ? 16.022  -14.502 -15.600 1.00 0.00 ? 12  ARG A H    4  
ATOM 5406  H HA   . ARG A 1 12  ? 17.186  -12.718 -13.622 1.00 0.00 ? 12  ARG A HA   4  
ATOM 5407  H HB2  . ARG A 1 12  ? 18.121  -13.794 -16.279 1.00 0.00 ? 12  ARG A HB2  4  
ATOM 5408  H HB3  . ARG A 1 12  ? 18.649  -12.181 -15.846 1.00 0.00 ? 12  ARG A HB3  4  
ATOM 5409  H HG2  . ARG A 1 12  ? 19.359  -13.201 -13.561 1.00 0.00 ? 12  ARG A HG2  4  
ATOM 5410  H HG3  . ARG A 1 12  ? 19.132  -14.768 -14.314 1.00 0.00 ? 12  ARG A HG3  4  
ATOM 5411  H HD2  . ARG A 1 12  ? 20.847  -14.343 -15.961 1.00 0.00 ? 12  ARG A HD2  4  
ATOM 5412  H HD3  . ARG A 1 12  ? 20.886  -12.630 -15.594 1.00 0.00 ? 12  ARG A HD3  4  
ATOM 5413  H HE   . ARG A 1 12  ? 21.502  -14.025 -13.191 1.00 0.00 ? 12  ARG A HE   4  
ATOM 5414  H HH11 . ARG A 1 12  ? 22.898  -13.487 -16.375 1.00 0.00 ? 12  ARG A HH11 4  
ATOM 5415  H HH12 . ARG A 1 12  ? 24.532  -13.667 -15.830 1.00 0.00 ? 12  ARG A HH12 4  
ATOM 5416  H HH21 . ARG A 1 12  ? 23.657  -14.262 -12.470 1.00 0.00 ? 12  ARG A HH21 4  
ATOM 5417  H HH22 . ARG A 1 12  ? 24.967  -14.111 -13.593 1.00 0.00 ? 12  ARG A HH22 4  
ATOM 5418  N N    . THR A 1 13  ? 16.069  -10.678 -14.514 1.00 0.00 ? 13  THR A N    4  
ATOM 5419  C CA   . THR A 1 13  ? 15.374  -9.490  -14.979 1.00 0.00 ? 13  THR A CA   4  
ATOM 5420  C C    . THR A 1 13  ? 16.104  -8.229  -14.514 1.00 0.00 ? 13  THR A C    4  
ATOM 5421  O O    . THR A 1 13  ? 16.197  -7.967  -13.316 1.00 0.00 ? 13  THR A O    4  
ATOM 5422  C CB   . THR A 1 13  ? 13.925  -9.569  -14.492 1.00 0.00 ? 13  THR A CB   4  
ATOM 5423  O OG1  . THR A 1 13  ? 14.042  -9.792  -13.090 1.00 0.00 ? 13  THR A OG1  4  
ATOM 5424  C CG2  . THR A 1 13  ? 13.200  -10.813 -15.009 1.00 0.00 ? 13  THR A CG2  4  
ATOM 5425  H H    . THR A 1 13  ? 16.399  -10.633 -13.571 1.00 0.00 ? 13  THR A H    4  
ATOM 5426  H HA   . THR A 1 13  ? 15.391  -9.486  -16.069 1.00 0.00 ? 13  THR A HA   4  
ATOM 5427  H HB   . THR A 1 13  ? 13.378  -8.663  -14.752 1.00 0.00 ? 13  THR A HB   4  
ATOM 5428  H HG1  . THR A 1 13  ? 13.449  -9.160  -12.592 1.00 0.00 ? 13  THR A HG1  4  
ATOM 5429  H HG21 . THR A 1 13  ? 13.641  -11.703 -14.559 1.00 0.00 ? 13  THR A HG21 4  
ATOM 5430  H HG22 . THR A 1 13  ? 12.145  -10.755 -14.742 1.00 0.00 ? 13  THR A HG22 4  
ATOM 5431  H HG23 . THR A 1 13  ? 13.298  -10.867 -16.093 1.00 0.00 ? 13  THR A HG23 4  
ATOM 5432  N N    . HIS A 1 14  ? 16.603  -7.480  -15.487 1.00 0.00 ? 14  HIS A N    4  
ATOM 5433  C CA   . HIS A 1 14  ? 17.322  -6.252  -15.192 1.00 0.00 ? 14  HIS A CA   4  
ATOM 5434  C C    . HIS A 1 14  ? 16.325  -5.110  -14.988 1.00 0.00 ? 14  HIS A C    4  
ATOM 5435  O O    . HIS A 1 14  ? 15.217  -5.145  -15.523 1.00 0.00 ? 14  HIS A O    4  
ATOM 5436  C CB   . HIS A 1 14  ? 18.353  -5.952  -16.282 1.00 0.00 ? 14  HIS A CB   4  
ATOM 5437  C CG   . HIS A 1 14  ? 19.476  -6.959  -16.359 1.00 0.00 ? 14  HIS A CG   4  
ATOM 5438  N ND1  . HIS A 1 14  ? 20.608  -6.882  -15.568 1.00 0.00 ? 14  HIS A ND1  4  
ATOM 5439  C CD2  . HIS A 1 14  ? 19.627  -8.066  -17.141 1.00 0.00 ? 14  HIS A CD2  4  
ATOM 5440  C CE1  . HIS A 1 14  ? 21.399  -7.901  -15.869 1.00 0.00 ? 14  HIS A CE1  4  
ATOM 5441  N NE2  . HIS A 1 14  ? 20.789  -8.634  -16.845 1.00 0.00 ? 14  HIS A NE2  4  
ATOM 5442  H H    . HIS A 1 14  ? 16.523  -7.700  -16.459 1.00 0.00 ? 14  HIS A H    4  
ATOM 5443  H HA   . HIS A 1 14  ? 17.862  -6.422  -14.261 1.00 0.00 ? 14  HIS A HA   4  
ATOM 5444  H HB2  . HIS A 1 14  ? 17.847  -5.912  -17.246 1.00 0.00 ? 14  HIS A HB2  4  
ATOM 5445  H HB3  . HIS A 1 14  ? 18.777  -4.964  -16.104 1.00 0.00 ? 14  HIS A HB3  4  
ATOM 5446  H HD1  . HIS A 1 14  ? 20.798  -6.176  -14.885 1.00 0.00 ? 14  HIS A HD1  4  
ATOM 5447  H HD2  . HIS A 1 14  ? 18.914  -8.424  -17.884 1.00 0.00 ? 14  HIS A HD2  4  
ATOM 5448  H HE1  . HIS A 1 14  ? 22.367  -8.117  -15.417 1.00 0.00 ? 14  HIS A HE1  4  
ATOM 5449  N N    . GLU A 1 15  ? 16.754  -4.124  -14.214 1.00 0.00 ? 15  GLU A N    4  
ATOM 5450  C CA   . GLU A 1 15  ? 15.912  -2.973  -13.933 1.00 0.00 ? 15  GLU A CA   4  
ATOM 5451  C C    . GLU A 1 15  ? 16.615  -2.027  -12.957 1.00 0.00 ? 15  GLU A C    4  
ATOM 5452  O O    . GLU A 1 15  ? 17.146  -2.464  -11.937 1.00 0.00 ? 15  GLU A O    4  
ATOM 5453  C CB   . GLU A 1 15  ? 14.550  -3.409  -13.389 1.00 0.00 ? 15  GLU A CB   4  
ATOM 5454  C CG   . GLU A 1 15  ? 13.504  -3.457  -14.505 1.00 0.00 ? 15  GLU A CG   4  
ATOM 5455  C CD   . GLU A 1 15  ? 12.239  -2.696  -14.102 1.00 0.00 ? 15  GLU A CD   4  
ATOM 5456  O OE1  . GLU A 1 15  ? 11.559  -3.179  -13.170 1.00 0.00 ? 15  GLU A OE1  4  
ATOM 5457  O OE2  . GLU A 1 15  ? 11.980  -1.650  -14.735 1.00 0.00 ? 15  GLU A OE2  4  
ATOM 5458  H H    . GLU A 1 15  ? 17.656  -4.103  -13.784 1.00 0.00 ? 15  GLU A H    4  
ATOM 5459  H HA   . GLU A 1 15  ? 15.771  -2.476  -14.893 1.00 0.00 ? 15  GLU A HA   4  
ATOM 5460  H HB2  . GLU A 1 15  ? 14.638  -4.392  -12.926 1.00 0.00 ? 15  GLU A HB2  4  
ATOM 5461  H HB3  . GLU A 1 15  ? 14.227  -2.718  -12.611 1.00 0.00 ? 15  GLU A HB3  4  
ATOM 5462  H HG2  . GLU A 1 15  ? 13.918  -3.024  -15.415 1.00 0.00 ? 15  GLU A HG2  4  
ATOM 5463  H HG3  . GLU A 1 15  ? 13.254  -4.493  -14.730 1.00 0.00 ? 15  GLU A HG3  4  
ATOM 5464  N N    . ASP A 1 16  ? 16.596  -0.749  -13.305 1.00 0.00 ? 16  ASP A N    4  
ATOM 5465  C CA   . ASP A 1 16  ? 17.225  0.262   -12.472 1.00 0.00 ? 16  ASP A CA   4  
ATOM 5466  C C    . ASP A 1 16  ? 16.470  0.365   -11.145 1.00 0.00 ? 16  ASP A C    4  
ATOM 5467  O O    . ASP A 1 16  ? 17.021  0.060   -10.088 1.00 0.00 ? 16  ASP A O    4  
ATOM 5468  C CB   . ASP A 1 16  ? 17.184  1.635   -13.147 1.00 0.00 ? 16  ASP A CB   4  
ATOM 5469  C CG   . ASP A 1 16  ? 18.171  2.661   -12.586 1.00 0.00 ? 16  ASP A CG   4  
ATOM 5470  O OD1  . ASP A 1 16  ? 19.371  2.318   -12.523 1.00 0.00 ? 16  ASP A OD1  4  
ATOM 5471  O OD2  . ASP A 1 16  ? 17.702  3.764   -12.232 1.00 0.00 ? 16  ASP A OD2  4  
ATOM 5472  H H    . ASP A 1 16  ? 16.162  -0.402  -14.136 1.00 0.00 ? 16  ASP A H    4  
ATOM 5473  H HA   . ASP A 1 16  ? 18.254  -0.073  -12.342 1.00 0.00 ? 16  ASP A HA   4  
ATOM 5474  H HB2  . ASP A 1 16  ? 17.383  1.506   -14.211 1.00 0.00 ? 16  ASP A HB2  4  
ATOM 5475  H HB3  . ASP A 1 16  ? 16.175  2.037   -13.058 1.00 0.00 ? 16  ASP A HB3  4  
ATOM 5476  N N    . VAL A 1 17  ? 15.221  0.797   -11.243 1.00 0.00 ? 17  VAL A N    4  
ATOM 5477  C CA   . VAL A 1 17  ? 14.386  0.944   -10.063 1.00 0.00 ? 17  VAL A CA   4  
ATOM 5478  C C    . VAL A 1 17  ? 14.495  -0.318  -9.206  1.00 0.00 ? 17  VAL A C    4  
ATOM 5479  O O    . VAL A 1 17  ? 14.968  -1.353  -9.674  1.00 0.00 ? 17  VAL A O    4  
ATOM 5480  C CB   . VAL A 1 17  ? 12.948  1.263   -10.477 1.00 0.00 ? 17  VAL A CB   4  
ATOM 5481  C CG1  . VAL A 1 17  ? 12.780  2.755   -10.770 1.00 0.00 ? 17  VAL A CG1  4  
ATOM 5482  C CG2  . VAL A 1 17  ? 12.523  0.417   -11.679 1.00 0.00 ? 17  VAL A CG2  4  
ATOM 5483  H H    . VAL A 1 17  ? 14.781  1.043   -12.106 1.00 0.00 ? 17  VAL A H    4  
ATOM 5484  H HA   . VAL A 1 17  ? 14.768  1.790   -9.493  1.00 0.00 ? 17  VAL A HA   4  
ATOM 5485  H HB   . VAL A 1 17  ? 12.295  1.009   -9.642  1.00 0.00 ? 17  VAL A HB   4  
ATOM 5486  H HG11 . VAL A 1 17  ? 13.562  3.081   -11.455 1.00 0.00 ? 17  VAL A HG11 4  
ATOM 5487  H HG12 . VAL A 1 17  ? 11.803  2.929   -11.223 1.00 0.00 ? 17  VAL A HG12 4  
ATOM 5488  H HG13 . VAL A 1 17  ? 12.854  3.318   -9.839  1.00 0.00 ? 17  VAL A HG13 4  
ATOM 5489  H HG21 . VAL A 1 17  ? 12.923  -0.591  -11.574 1.00 0.00 ? 17  VAL A HG21 4  
ATOM 5490  H HG22 . VAL A 1 17  ? 11.435  0.373   -11.726 1.00 0.00 ? 17  VAL A HG22 4  
ATOM 5491  H HG23 . VAL A 1 17  ? 12.908  0.867   -12.594 1.00 0.00 ? 17  VAL A HG23 4  
ATOM 5492  N N    . PRO A 1 18  ? 14.038  -0.189  -7.931  1.00 0.00 ? 18  PRO A N    4  
ATOM 5493  C CA   . PRO A 1 18  ? 14.079  -1.306  -7.004  1.00 0.00 ? 18  PRO A CA   4  
ATOM 5494  C C    . PRO A 1 18  ? 12.989  -2.329  -7.328  1.00 0.00 ? 18  PRO A C    4  
ATOM 5495  O O    . PRO A 1 18  ? 12.214  -2.140  -8.264  1.00 0.00 ? 18  PRO A O    4  
ATOM 5496  C CB   . PRO A 1 18  ? 13.918  -0.682  -5.628  1.00 0.00 ? 18  PRO A CB   4  
ATOM 5497  C CG   . PRO A 1 18  ? 13.328  0.699   -5.863  1.00 0.00 ? 18  PRO A CG   4  
ATOM 5498  C CD   . PRO A 1 18  ? 13.471  1.021   -7.342  1.00 0.00 ? 18  PRO A CD   4  
ATOM 5499  H HA   . PRO A 1 18  ? 14.947  -1.796  -7.089  1.00 0.00 ? 18  PRO A HA   4  
ATOM 5500  H HB2  . PRO A 1 18  ? 13.262  -1.284  -5.000  1.00 0.00 ? 18  PRO A HB2  4  
ATOM 5501  H HB3  . PRO A 1 18  ? 14.877  -0.615  -5.114  1.00 0.00 ? 18  PRO A HB3  4  
ATOM 5502  H HG2  . PRO A 1 18  ? 12.280  0.723   -5.567  1.00 0.00 ? 18  PRO A HG2  4  
ATOM 5503  H HG3  . PRO A 1 18  ? 13.847  1.444   -5.259  1.00 0.00 ? 18  PRO A HG3  4  
ATOM 5504  H HD2  . PRO A 1 18  ? 12.507  1.265   -7.789  1.00 0.00 ? 18  PRO A HD2  4  
ATOM 5505  H HD3  . PRO A 1 18  ? 14.122  1.881   -7.499  1.00 0.00 ? 18  PRO A HD3  4  
ATOM 5506  N N    . GLY A 1 19  ? 12.963  -3.391  -6.536  1.00 0.00 ? 19  GLY A N    4  
ATOM 5507  C CA   . GLY A 1 19  ? 11.980  -4.443  -6.727  1.00 0.00 ? 19  GLY A CA   4  
ATOM 5508  C C    . GLY A 1 19  ? 10.803  -4.277  -5.763  1.00 0.00 ? 19  GLY A C    4  
ATOM 5509  O O    . GLY A 1 19  ? 10.533  -3.172  -5.293  1.00 0.00 ? 19  GLY A O    4  
ATOM 5510  H H    . GLY A 1 19  ? 13.597  -3.537  -5.776  1.00 0.00 ? 19  GLY A H    4  
ATOM 5511  H HA2  . GLY A 1 19  ? 11.618  -4.426  -7.754  1.00 0.00 ? 19  GLY A HA2  4  
ATOM 5512  H HA3  . GLY A 1 19  ? 12.448  -5.415  -6.570  1.00 0.00 ? 19  GLY A HA3  4  
ATOM 5513  N N    . PRO A 1 20  ? 10.118  -5.419  -5.489  1.00 0.00 ? 20  PRO A N    4  
ATOM 5514  C CA   . PRO A 1 20  ? 8.977   -5.410  -4.590  1.00 0.00 ? 20  PRO A CA   4  
ATOM 5515  C C    . PRO A 1 20  ? 9.428   -5.291  -3.133  1.00 0.00 ? 20  PRO A C    4  
ATOM 5516  O O    . PRO A 1 20  ? 10.321  -6.014  -2.695  1.00 0.00 ? 20  PRO A O    4  
ATOM 5517  C CB   . PRO A 1 20  ? 8.238   -6.706  -4.879  1.00 0.00 ? 20  PRO A CB   4  
ATOM 5518  C CG   . PRO A 1 20  ? 9.236   -7.605  -5.591  1.00 0.00 ? 20  PRO A CG   4  
ATOM 5519  C CD   . PRO A 1 20  ? 10.410  -6.744  -6.027  1.00 0.00 ? 20  PRO A CD   4  
ATOM 5520  H HA   . PRO A 1 20  ? 8.403   -4.609  -4.765  1.00 0.00 ? 20  PRO A HA   4  
ATOM 5521  H HB2  . PRO A 1 20  ? 7.884   -7.168  -3.957  1.00 0.00 ? 20  PRO A HB2  4  
ATOM 5522  H HB3  . PRO A 1 20  ? 7.361   -6.526  -5.502  1.00 0.00 ? 20  PRO A HB3  4  
ATOM 5523  H HG2  . PRO A 1 20  ? 9.572   -8.402  -4.927  1.00 0.00 ? 20  PRO A HG2  4  
ATOM 5524  H HG3  . PRO A 1 20  ? 8.771   -8.084  -6.453  1.00 0.00 ? 20  PRO A HG3  4  
ATOM 5525  H HD2  . PRO A 1 20  ? 11.351  -7.131  -5.637  1.00 0.00 ? 20  PRO A HD2  4  
ATOM 5526  H HD3  . PRO A 1 20  ? 10.500  -6.720  -7.113  1.00 0.00 ? 20  PRO A HD3  4  
ATOM 5527  N N    . VAL A 1 21  ? 8.790   -4.372  -2.422  1.00 0.00 ? 21  VAL A N    4  
ATOM 5528  C CA   . VAL A 1 21  ? 9.114   -4.150  -1.024  1.00 0.00 ? 21  VAL A CA   4  
ATOM 5529  C C    . VAL A 1 21  ? 8.982   -5.467  -0.258  1.00 0.00 ? 21  VAL A C    4  
ATOM 5530  O O    . VAL A 1 21  ? 8.815   -6.526  -0.861  1.00 0.00 ? 21  VAL A O    4  
ATOM 5531  C CB   . VAL A 1 21  ? 8.233   -3.036  -0.453  1.00 0.00 ? 21  VAL A CB   4  
ATOM 5532  C CG1  . VAL A 1 21  ? 8.642   -1.672  -1.014  1.00 0.00 ? 21  VAL A CG1  4  
ATOM 5533  C CG2  . VAL A 1 21  ? 6.753   -3.317  -0.719  1.00 0.00 ? 21  VAL A CG2  4  
ATOM 5534  H H    . VAL A 1 21  ? 8.064   -3.788  -2.786  1.00 0.00 ? 21  VAL A H    4  
ATOM 5535  H HA   . VAL A 1 21  ? 10.151  -3.818  -0.976  1.00 0.00 ? 21  VAL A HA   4  
ATOM 5536  H HB   . VAL A 1 21  ? 8.381   -3.012  0.627   1.00 0.00 ? 21  VAL A HB   4  
ATOM 5537  H HG11 . VAL A 1 21  ? 8.195   -0.882  -0.410  1.00 0.00 ? 21  VAL A HG11 4  
ATOM 5538  H HG12 . VAL A 1 21  ? 9.728   -1.579  -0.987  1.00 0.00 ? 21  VAL A HG12 4  
ATOM 5539  H HG13 . VAL A 1 21  ? 8.295   -1.584  -2.043  1.00 0.00 ? 21  VAL A HG13 4  
ATOM 5540  H HG21 . VAL A 1 21  ? 6.239   -3.481  0.227   1.00 0.00 ? 21  VAL A HG21 4  
ATOM 5541  H HG22 . VAL A 1 21  ? 6.308   -2.464  -1.232  1.00 0.00 ? 21  VAL A HG22 4  
ATOM 5542  H HG23 . VAL A 1 21  ? 6.658   -4.206  -1.343  1.00 0.00 ? 21  VAL A HG23 4  
ATOM 5543  N N    . GLY A 1 22  ? 9.062   -5.359  1.060   1.00 0.00 ? 22  GLY A N    4  
ATOM 5544  C CA   . GLY A 1 22  ? 8.954   -6.530  1.915   1.00 0.00 ? 22  GLY A CA   4  
ATOM 5545  C C    . GLY A 1 22  ? 7.615   -7.239  1.706   1.00 0.00 ? 22  GLY A C    4  
ATOM 5546  O O    . GLY A 1 22  ? 7.086   -7.260  0.596   1.00 0.00 ? 22  GLY A O    4  
ATOM 5547  H H    . GLY A 1 22  ? 9.198   -4.494  1.543   1.00 0.00 ? 22  GLY A H    4  
ATOM 5548  H HA2  . GLY A 1 22  ? 9.772   -7.218  1.701   1.00 0.00 ? 22  GLY A HA2  4  
ATOM 5549  H HA3  . GLY A 1 22  ? 9.053   -6.232  2.959   1.00 0.00 ? 22  GLY A HA3  4  
ATOM 5550  N N    . HIS A 1 23  ? 7.105   -7.803  2.791   1.00 0.00 ? 23  HIS A N    4  
ATOM 5551  C CA   . HIS A 1 23  ? 5.838   -8.512  2.740   1.00 0.00 ? 23  HIS A CA   4  
ATOM 5552  C C    . HIS A 1 23  ? 4.719   -7.601  3.251   1.00 0.00 ? 23  HIS A C    4  
ATOM 5553  O O    . HIS A 1 23  ? 4.816   -7.046  4.344   1.00 0.00 ? 23  HIS A O    4  
ATOM 5554  C CB   . HIS A 1 23  ? 5.923   -9.833  3.508   1.00 0.00 ? 23  HIS A CB   4  
ATOM 5555  C CG   . HIS A 1 23  ? 5.519   -9.728  4.959   1.00 0.00 ? 23  HIS A CG   4  
ATOM 5556  N ND1  . HIS A 1 23  ? 4.440   -10.414 5.489   1.00 0.00 ? 23  HIS A ND1  4  
ATOM 5557  C CD2  . HIS A 1 23  ? 6.061   -9.011  5.985   1.00 0.00 ? 23  HIS A CD2  4  
ATOM 5558  C CE1  . HIS A 1 23  ? 4.346   -10.115 6.776   1.00 0.00 ? 23  HIS A CE1  4  
ATOM 5559  N NE2  . HIS A 1 23  ? 5.351   -9.245  7.081   1.00 0.00 ? 23  HIS A NE2  4  
ATOM 5560  H H    . HIS A 1 23  ? 7.541   -7.782  3.690   1.00 0.00 ? 23  HIS A H    4  
ATOM 5561  H HA   . HIS A 1 23  ? 5.653   -8.748  1.692   1.00 0.00 ? 23  HIS A HA   4  
ATOM 5562  H HB2  . HIS A 1 23  ? 5.286   -10.569 3.016   1.00 0.00 ? 23  HIS A HB2  4  
ATOM 5563  H HB3  . HIS A 1 23  ? 6.945   -10.209 3.452   1.00 0.00 ? 23  HIS A HB3  4  
ATOM 5564  H HD1  . HIS A 1 23  ? 3.835   -11.030 4.985   1.00 0.00 ? 23  HIS A HD1  4  
ATOM 5565  H HD2  . HIS A 1 23  ? 6.930   -8.356  5.916   1.00 0.00 ? 23  HIS A HD2  4  
ATOM 5566  H HE1  . HIS A 1 23  ? 3.597   -10.497 7.469   1.00 0.00 ? 23  HIS A HE1  4  
ATOM 5567  N N    . LEU A 1 24  ? 3.683   -7.476  2.434   1.00 0.00 ? 24  LEU A N    4  
ATOM 5568  C CA   . LEU A 1 24  ? 2.548   -6.642  2.789   1.00 0.00 ? 24  LEU A CA   4  
ATOM 5569  C C    . LEU A 1 24  ? 1.929   -7.157  4.090   1.00 0.00 ? 24  LEU A C    4  
ATOM 5570  O O    . LEU A 1 24  ? 1.772   -8.364  4.272   1.00 0.00 ? 24  LEU A O    4  
ATOM 5571  C CB   . LEU A 1 24  ? 1.557   -6.562  1.626   1.00 0.00 ? 24  LEU A CB   4  
ATOM 5572  C CG   . LEU A 1 24  ? 1.570   -5.260  0.822   1.00 0.00 ? 24  LEU A CG   4  
ATOM 5573  C CD1  . LEU A 1 24  ? 0.762   -4.170  1.531   1.00 0.00 ? 24  LEU A CD1  4  
ATOM 5574  C CD2  . LEU A 1 24  ? 3.003   -4.811  0.528   1.00 0.00 ? 24  LEU A CD2  4  
ATOM 5575  H H    . LEU A 1 24  ? 3.612   -7.930  1.547   1.00 0.00 ? 24  LEU A H    4  
ATOM 5576  H HA   . LEU A 1 24  ? 2.924   -5.633  2.962   1.00 0.00 ? 24  LEU A HA   4  
ATOM 5577  H HB2  . LEU A 1 24  ? 1.760   -7.388  0.945   1.00 0.00 ? 24  LEU A HB2  4  
ATOM 5578  H HB3  . LEU A 1 24  ? 0.552   -6.712  2.020   1.00 0.00 ? 24  LEU A HB3  4  
ATOM 5579  H HG   . LEU A 1 24  ? 1.087   -5.446  -0.137  1.00 0.00 ? 24  LEU A HG   4  
ATOM 5580  H HD11 . LEU A 1 24  ? 0.455   -4.527  2.514   1.00 0.00 ? 24  LEU A HD11 4  
ATOM 5581  H HD12 . LEU A 1 24  ? 1.377   -3.278  1.644   1.00 0.00 ? 24  LEU A HD12 4  
ATOM 5582  H HD13 . LEU A 1 24  ? -0.121  -3.930  0.939   1.00 0.00 ? 24  LEU A HD13 4  
ATOM 5583  H HD21 . LEU A 1 24  ? 3.345   -4.146  1.321   1.00 0.00 ? 24  LEU A HD21 4  
ATOM 5584  H HD22 . LEU A 1 24  ? 3.654   -5.684  0.480   1.00 0.00 ? 24  LEU A HD22 4  
ATOM 5585  H HD23 . LEU A 1 24  ? 3.030   -4.284  -0.426  1.00 0.00 ? 24  LEU A HD23 4  
ATOM 5586  N N    . SER A 1 25  ? 1.593   -6.217  4.961   1.00 0.00 ? 25  SER A N    4  
ATOM 5587  C CA   . SER A 1 25  ? 0.994   -6.561  6.240   1.00 0.00 ? 25  SER A CA   4  
ATOM 5588  C C    . SER A 1 25  ? -0.171  -5.617  6.544   1.00 0.00 ? 25  SER A C    4  
ATOM 5589  O O    . SER A 1 25  ? -0.188  -4.478  6.079   1.00 0.00 ? 25  SER A O    4  
ATOM 5590  C CB   . SER A 1 25  ? 2.029   -6.507  7.365   1.00 0.00 ? 25  SER A CB   4  
ATOM 5591  O OG   . SER A 1 25  ? 1.671   -7.343  8.462   1.00 0.00 ? 25  SER A OG   4  
ATOM 5592  H H    . SER A 1 25  ? 1.723   -5.238  4.806   1.00 0.00 ? 25  SER A H    4  
ATOM 5593  H HA   . SER A 1 25  ? 0.637   -7.585  6.125   1.00 0.00 ? 25  SER A HA   4  
ATOM 5594  H HB2  . SER A 1 25  ? 3.001   -6.813  6.979   1.00 0.00 ? 25  SER A HB2  4  
ATOM 5595  H HB3  . SER A 1 25  ? 2.134   -5.479  7.712   1.00 0.00 ? 25  SER A HB3  4  
ATOM 5596  H HG   . SER A 1 25  ? 2.490   -7.620  8.963   1.00 0.00 ? 25  SER A HG   4  
ATOM 5597  N N    . PHE A 1 26  ? -1.115  -6.125  7.322   1.00 0.00 ? 26  PHE A N    4  
ATOM 5598  C CA   . PHE A 1 26  ? -2.281  -5.341  7.693   1.00 0.00 ? 26  PHE A CA   4  
ATOM 5599  C C    . PHE A 1 26  ? -2.676  -5.601  9.148   1.00 0.00 ? 26  PHE A C    4  
ATOM 5600  O O    . PHE A 1 26  ? -2.847  -6.749  9.553   1.00 0.00 ? 26  PHE A O    4  
ATOM 5601  C CB   . PHE A 1 26  ? -3.426  -5.782  6.780   1.00 0.00 ? 26  PHE A CB   4  
ATOM 5602  C CG   . PHE A 1 26  ? -3.161  -5.547  5.291   1.00 0.00 ? 26  PHE A CG   4  
ATOM 5603  C CD1  . PHE A 1 26  ? -2.676  -4.349  4.868   1.00 0.00 ? 26  PHE A CD1  4  
ATOM 5604  C CD2  . PHE A 1 26  ? -3.411  -6.535  4.391   1.00 0.00 ? 26  PHE A CD2  4  
ATOM 5605  C CE1  . PHE A 1 26  ? -2.430  -4.130  3.487   1.00 0.00 ? 26  PHE A CE1  4  
ATOM 5606  C CE2  . PHE A 1 26  ? -3.165  -6.317  3.010   1.00 0.00 ? 26  PHE A CE2  4  
ATOM 5607  C CZ   . PHE A 1 26  ? -2.680  -5.119  2.587   1.00 0.00 ? 26  PHE A CZ   4  
ATOM 5608  H H    . PHE A 1 26  ? -1.093  -7.052  7.696   1.00 0.00 ? 26  PHE A H    4  
ATOM 5609  H HA   . PHE A 1 26  ? -2.016  -4.290  7.572   1.00 0.00 ? 26  PHE A HA   4  
ATOM 5610  H HB2  . PHE A 1 26  ? -3.618  -6.843  6.941   1.00 0.00 ? 26  PHE A HB2  4  
ATOM 5611  H HB3  . PHE A 1 26  ? -4.332  -5.248  7.066   1.00 0.00 ? 26  PHE A HB3  4  
ATOM 5612  H HD1  . PHE A 1 26  ? -2.476  -3.556  5.589   1.00 0.00 ? 26  PHE A HD1  4  
ATOM 5613  H HD2  . PHE A 1 26  ? -3.800  -7.495  4.730   1.00 0.00 ? 26  PHE A HD2  4  
ATOM 5614  H HE1  . PHE A 1 26  ? -2.041  -3.170  3.148   1.00 0.00 ? 26  PHE A HE1  4  
ATOM 5615  H HE2  . PHE A 1 26  ? -3.365  -7.109  2.289   1.00 0.00 ? 26  PHE A HE2  4  
ATOM 5616  H HZ   . PHE A 1 26  ? -2.491  -4.951  1.526   1.00 0.00 ? 26  PHE A HZ   4  
ATOM 5617  N N    . SER A 1 27  ? -2.808  -4.514  9.895   1.00 0.00 ? 27  SER A N    4  
ATOM 5618  C CA   . SER A 1 27  ? -3.180  -4.610  11.296  1.00 0.00 ? 27  SER A CA   4  
ATOM 5619  C C    . SER A 1 27  ? -4.178  -3.506  11.650  1.00 0.00 ? 27  SER A C    4  
ATOM 5620  O O    . SER A 1 27  ? -4.378  -2.573  10.874  1.00 0.00 ? 27  SER A O    4  
ATOM 5621  C CB   . SER A 1 27  ? -1.948  -4.521  12.200  1.00 0.00 ? 27  SER A CB   4  
ATOM 5622  O OG   . SER A 1 27  ? -1.275  -5.772  12.310  1.00 0.00 ? 27  SER A OG   4  
ATOM 5623  H H    . SER A 1 27  ? -2.667  -3.583  9.558   1.00 0.00 ? 27  SER A H    4  
ATOM 5624  H HA   . SER A 1 27  ? -3.640  -5.592  11.406  1.00 0.00 ? 27  SER A HA   4  
ATOM 5625  H HB2  . SER A 1 27  ? -1.261  -3.773  11.803  1.00 0.00 ? 27  SER A HB2  4  
ATOM 5626  H HB3  . SER A 1 27  ? -2.250  -4.183  13.191  1.00 0.00 ? 27  SER A HB3  4  
ATOM 5627  H HG   . SER A 1 27  ? -0.745  -5.949  11.481  1.00 0.00 ? 27  SER A HG   4  
ATOM 5628  N N    . GLU A 1 28  ? -4.780  -3.649  12.821  1.00 0.00 ? 28  GLU A N    4  
ATOM 5629  C CA   . GLU A 1 28  ? -5.753  -2.676  13.287  1.00 0.00 ? 28  GLU A CA   4  
ATOM 5630  C C    . GLU A 1 28  ? -6.769  -2.372  12.184  1.00 0.00 ? 28  GLU A C    4  
ATOM 5631  O O    . GLU A 1 28  ? -7.031  -1.209  11.879  1.00 0.00 ? 28  GLU A O    4  
ATOM 5632  C CB   . GLU A 1 28  ? -5.063  -1.397  13.765  1.00 0.00 ? 28  GLU A CB   4  
ATOM 5633  C CG   . GLU A 1 28  ? -4.226  -1.660  15.018  1.00 0.00 ? 28  GLU A CG   4  
ATOM 5634  C CD   . GLU A 1 28  ? -4.651  -0.741  16.165  1.00 0.00 ? 28  GLU A CD   4  
ATOM 5635  O OE1  . GLU A 1 28  ? -4.849  0.461   15.885  1.00 0.00 ? 28  GLU A OE1  4  
ATOM 5636  O OE2  . GLU A 1 28  ? -4.769  -1.261  17.295  1.00 0.00 ? 28  GLU A OE2  4  
ATOM 5637  H H    . GLU A 1 28  ? -4.612  -4.412  13.447  1.00 0.00 ? 28  GLU A H    4  
ATOM 5638  H HA   . GLU A 1 28  ? -6.254  -3.149  14.132  1.00 0.00 ? 28  GLU A HA   4  
ATOM 5639  H HB2  . GLU A 1 28  ? -4.425  -1.006  12.973  1.00 0.00 ? 28  GLU A HB2  4  
ATOM 5640  H HB3  . GLU A 1 28  ? -5.812  -0.633  13.977  1.00 0.00 ? 28  GLU A HB3  4  
ATOM 5641  H HG2  . GLU A 1 28  ? -4.337  -2.701  15.322  1.00 0.00 ? 28  GLU A HG2  4  
ATOM 5642  H HG3  . GLU A 1 28  ? -3.171  -1.504  14.794  1.00 0.00 ? 28  GLU A HG3  4  
ATOM 5643  N N    . ILE A 1 29  ? -7.315  -3.437  11.616  1.00 0.00 ? 29  ILE A N    4  
ATOM 5644  C CA   . ILE A 1 29  ? -8.296  -3.299  10.554  1.00 0.00 ? 29  ILE A CA   4  
ATOM 5645  C C    . ILE A 1 29  ? -9.682  -3.091  11.170  1.00 0.00 ? 29  ILE A C    4  
ATOM 5646  O O    . ILE A 1 29  ? -10.053 -3.781  12.118  1.00 0.00 ? 29  ILE A O    4  
ATOM 5647  C CB   . ILE A 1 29  ? -8.222  -4.490  9.597   1.00 0.00 ? 29  ILE A CB   4  
ATOM 5648  C CG1  . ILE A 1 29  ? -6.769  -4.827  9.253   1.00 0.00 ? 29  ILE A CG1  4  
ATOM 5649  C CG2  . ILE A 1 29  ? -9.064  -4.241  8.345   1.00 0.00 ? 29  ILE A CG2  4  
ATOM 5650  C CD1  . ILE A 1 29  ? -6.677  -5.548  7.907   1.00 0.00 ? 29  ILE A CD1  4  
ATOM 5651  H H    . ILE A 1 29  ? -7.097  -4.380  11.870  1.00 0.00 ? 29  ILE A H    4  
ATOM 5652  H HA   . ILE A 1 29  ? -8.035  -2.409  9.982   1.00 0.00 ? 29  ILE A HA   4  
ATOM 5653  H HB   . ILE A 1 29  ? -8.643  -5.360  10.101  1.00 0.00 ? 29  ILE A HB   4  
ATOM 5654  H HG12 . ILE A 1 29  ? -6.178  -3.912  9.221   1.00 0.00 ? 29  ILE A HG12 4  
ATOM 5655  H HG13 . ILE A 1 29  ? -6.343  -5.455  10.036  1.00 0.00 ? 29  ILE A HG13 4  
ATOM 5656  H HG21 . ILE A 1 29  ? -8.415  -3.927  7.527   1.00 0.00 ? 29  ILE A HG21 4  
ATOM 5657  H HG22 . ILE A 1 29  ? -9.581  -5.160  8.065   1.00 0.00 ? 29  ILE A HG22 4  
ATOM 5658  H HG23 . ILE A 1 29  ? -9.796  -3.460  8.549   1.00 0.00 ? 29  ILE A HG23 4  
ATOM 5659  H HD11 . ILE A 1 29  ? -7.601  -6.097  7.725   1.00 0.00 ? 29  ILE A HD11 4  
ATOM 5660  H HD12 . ILE A 1 29  ? -6.527  -4.816  7.113   1.00 0.00 ? 29  ILE A HD12 4  
ATOM 5661  H HD13 . ILE A 1 29  ? -5.838  -6.243  7.923   1.00 0.00 ? 29  ILE A HD13 4  
ATOM 5662  N N    . LEU A 1 30  ? -10.408 -2.137  10.605  1.00 0.00 ? 30  LEU A N    4  
ATOM 5663  C CA   . LEU A 1 30  ? -11.744 -1.830  11.087  1.00 0.00 ? 30  LEU A CA   4  
ATOM 5664  C C    . LEU A 1 30  ? -12.765 -2.186  10.005  1.00 0.00 ? 30  LEU A C    4  
ATOM 5665  O O    . LEU A 1 30  ? -12.822 -3.328  9.552   1.00 0.00 ? 30  LEU A O    4  
ATOM 5666  C CB   . LEU A 1 30  ? -11.823 -0.375  11.553  1.00 0.00 ? 30  LEU A CB   4  
ATOM 5667  C CG   . LEU A 1 30  ? -10.999 -0.021  12.792  1.00 0.00 ? 30  LEU A CG   4  
ATOM 5668  C CD1  . LEU A 1 30  ? -11.342 -0.947  13.961  1.00 0.00 ? 30  LEU A CD1  4  
ATOM 5669  C CD2  . LEU A 1 30  ? -9.502  -0.028  12.475  1.00 0.00 ? 30  LEU A CD2  4  
ATOM 5670  H H    . LEU A 1 30  ? -10.098 -1.581  9.835   1.00 0.00 ? 30  LEU A H    4  
ATOM 5671  H HA   . LEU A 1 30  ? -11.929 -2.458  11.958  1.00 0.00 ? 30  LEU A HA   4  
ATOM 5672  H HB2  . LEU A 1 30  ? -11.503 0.267   10.732  1.00 0.00 ? 30  LEU A HB2  4  
ATOM 5673  H HB3  . LEU A 1 30  ? -12.867 -0.135  11.755  1.00 0.00 ? 30  LEU A HB3  4  
ATOM 5674  H HG   . LEU A 1 30  ? -11.258 0.993   13.098  1.00 0.00 ? 30  LEU A HG   4  
ATOM 5675  H HD11 . LEU A 1 30  ? -11.132 -0.437  14.902  1.00 0.00 ? 30  LEU A HD11 4  
ATOM 5676  H HD12 . LEU A 1 30  ? -12.398 -1.211  13.918  1.00 0.00 ? 30  LEU A HD12 4  
ATOM 5677  H HD13 . LEU A 1 30  ? -10.738 -1.852  13.897  1.00 0.00 ? 30  LEU A HD13 4  
ATOM 5678  H HD21 . LEU A 1 30  ? -9.346  0.311   11.451  1.00 0.00 ? 30  LEU A HD21 4  
ATOM 5679  H HD22 . LEU A 1 30  ? -8.982  0.640   13.162  1.00 0.00 ? 30  LEU A HD22 4  
ATOM 5680  H HD23 . LEU A 1 30  ? -9.112  -1.040  12.587  1.00 0.00 ? 30  LEU A HD23 4  
ATOM 5681  N N    . ASP A 1 31  ? -13.548 -1.187  9.623   1.00 0.00 ? 31  ASP A N    4  
ATOM 5682  C CA   . ASP A 1 31  ? -14.564 -1.381  8.603   1.00 0.00 ? 31  ASP A CA   4  
ATOM 5683  C C    . ASP A 1 31  ? -14.166 -0.615  7.340   1.00 0.00 ? 31  ASP A C    4  
ATOM 5684  O O    . ASP A 1 31  ? -14.471 -1.043  6.228   1.00 0.00 ? 31  ASP A O    4  
ATOM 5685  C CB   . ASP A 1 31  ? -15.921 -0.850  9.070   1.00 0.00 ? 31  ASP A CB   4  
ATOM 5686  C CG   . ASP A 1 31  ? -15.890 0.550   9.688   1.00 0.00 ? 31  ASP A CG   4  
ATOM 5687  O OD1  . ASP A 1 31  ? -14.769 1.008   9.999   1.00 0.00 ? 31  ASP A OD1  4  
ATOM 5688  O OD2  . ASP A 1 31  ? -16.987 1.130   9.835   1.00 0.00 ? 31  ASP A OD2  4  
ATOM 5689  H H    . ASP A 1 31  ? -13.495 -0.261  9.997   1.00 0.00 ? 31  ASP A H    4  
ATOM 5690  H HA   . ASP A 1 31  ? -14.607 -2.458  8.442   1.00 0.00 ? 31  ASP A HA   4  
ATOM 5691  H HB2  . ASP A 1 31  ? -16.603 -0.840  8.220   1.00 0.00 ? 31  ASP A HB2  4  
ATOM 5692  H HB3  . ASP A 1 31  ? -16.334 -1.544  9.802   1.00 0.00 ? 31  ASP A HB3  4  
ATOM 5693  N N    . THR A 1 32  ? -13.491 0.505   7.554   1.00 0.00 ? 32  THR A N    4  
ATOM 5694  C CA   . THR A 1 32  ? -13.047 1.334   6.446   1.00 0.00 ? 32  THR A CA   4  
ATOM 5695  C C    . THR A 1 32  ? -11.684 1.955   6.757   1.00 0.00 ? 32  THR A C    4  
ATOM 5696  O O    . THR A 1 32  ? -11.287 2.936   6.130   1.00 0.00 ? 32  THR A O    4  
ATOM 5697  C CB   . THR A 1 32  ? -14.137 2.371   6.166   1.00 0.00 ? 32  THR A CB   4  
ATOM 5698  O OG1  . THR A 1 32  ? -14.116 3.216   7.314   1.00 0.00 ? 32  THR A OG1  4  
ATOM 5699  C CG2  . THR A 1 32  ? -15.541 1.763   6.178   1.00 0.00 ? 32  THR A CG2  4  
ATOM 5700  H H    . THR A 1 32  ? -13.247 0.846   8.462   1.00 0.00 ? 32  THR A H    4  
ATOM 5701  H HA   . THR A 1 32  ? -12.917 0.698   5.571   1.00 0.00 ? 32  THR A HA   4  
ATOM 5702  H HB   . THR A 1 32  ? -13.946 2.893   5.229   1.00 0.00 ? 32  THR A HB   4  
ATOM 5703  H HG1  . THR A 1 32  ? -13.301 3.795   7.298   1.00 0.00 ? 32  THR A HG1  4  
ATOM 5704  H HG21 . THR A 1 32  ? -16.268 2.522   5.890   1.00 0.00 ? 32  THR A HG21 4  
ATOM 5705  H HG22 . THR A 1 32  ? -15.583 0.934   5.471   1.00 0.00 ? 32  THR A HG22 4  
ATOM 5706  H HG23 . THR A 1 32  ? -15.772 1.399   7.179   1.00 0.00 ? 32  THR A HG23 4  
ATOM 5707  N N    . SER A 1 33  ? -11.004 1.357   7.724   1.00 0.00 ? 33  SER A N    4  
ATOM 5708  C CA   . SER A 1 33  ? -9.693  1.838   8.126   1.00 0.00 ? 33  SER A CA   4  
ATOM 5709  C C    . SER A 1 33  ? -8.807  0.661   8.537   1.00 0.00 ? 33  SER A C    4  
ATOM 5710  O O    . SER A 1 33  ? -9.220  -0.185  9.329   1.00 0.00 ? 33  SER A O    4  
ATOM 5711  C CB   . SER A 1 33  ? -9.804  2.846   9.272   1.00 0.00 ? 33  SER A CB   4  
ATOM 5712  O OG   . SER A 1 33  ? -10.773 2.450   10.239  1.00 0.00 ? 33  SER A OG   4  
ATOM 5713  H H    . SER A 1 33  ? -11.334 0.559   8.229   1.00 0.00 ? 33  SER A H    4  
ATOM 5714  H HA   . SER A 1 33  ? -9.286  2.334   7.245   1.00 0.00 ? 33  SER A HA   4  
ATOM 5715  H HB2  . SER A 1 33  ? -8.832  2.953   9.755   1.00 0.00 ? 33  SER A HB2  4  
ATOM 5716  H HB3  . SER A 1 33  ? -10.070 3.823   8.871   1.00 0.00 ? 33  SER A HB3  4  
ATOM 5717  H HG   . SER A 1 33  ? -10.317 2.089   11.052  1.00 0.00 ? 33  SER A HG   4  
ATOM 5718  N N    . LEU A 1 34  ? -7.604  0.645   7.982   1.00 0.00 ? 34  LEU A N    4  
ATOM 5719  C CA   . LEU A 1 34  ? -6.656  -0.415  8.281   1.00 0.00 ? 34  LEU A CA   4  
ATOM 5720  C C    . LEU A 1 34  ? -5.232  0.118   8.110   1.00 0.00 ? 34  LEU A C    4  
ATOM 5721  O O    . LEU A 1 34  ? -4.989  0.997   7.284   1.00 0.00 ? 34  LEU A O    4  
ATOM 5722  C CB   . LEU A 1 34  ? -6.954  -1.656  7.437   1.00 0.00 ? 34  LEU A CB   4  
ATOM 5723  C CG   . LEU A 1 34  ? -6.765  -1.501  5.927   1.00 0.00 ? 34  LEU A CG   4  
ATOM 5724  C CD1  . LEU A 1 34  ? -5.287  -1.609  5.546   1.00 0.00 ? 34  LEU A CD1  4  
ATOM 5725  C CD2  . LEU A 1 34  ? -7.629  -2.503  5.160   1.00 0.00 ? 34  LEU A CD2  4  
ATOM 5726  H H    . LEU A 1 34  ? -7.275  1.336   7.339   1.00 0.00 ? 34  LEU A H    4  
ATOM 5727  H HA   . LEU A 1 34  ? -6.797  -0.694  9.326   1.00 0.00 ? 34  LEU A HA   4  
ATOM 5728  H HB2  . LEU A 1 34  ? -6.315  -2.468  7.783   1.00 0.00 ? 34  LEU A HB2  4  
ATOM 5729  H HB3  . LEU A 1 34  ? -7.984  -1.959  7.625   1.00 0.00 ? 34  LEU A HB3  4  
ATOM 5730  H HG   . LEU A 1 34  ? -7.098  -0.503  5.641   1.00 0.00 ? 34  LEU A HG   4  
ATOM 5731  H HD11 . LEU A 1 34  ? -5.034  -0.816  4.843   1.00 0.00 ? 34  LEU A HD11 4  
ATOM 5732  H HD12 . LEU A 1 34  ? -4.673  -1.511  6.441   1.00 0.00 ? 34  LEU A HD12 4  
ATOM 5733  H HD13 . LEU A 1 34  ? -5.101  -2.579  5.083   1.00 0.00 ? 34  LEU A HD13 4  
ATOM 5734  H HD21 . LEU A 1 34  ? -7.003  -3.314  4.789   1.00 0.00 ? 34  LEU A HD21 4  
ATOM 5735  H HD22 . LEU A 1 34  ? -8.392  -2.909  5.826   1.00 0.00 ? 34  LEU A HD22 4  
ATOM 5736  H HD23 . LEU A 1 34  ? -8.110  -2.001  4.321   1.00 0.00 ? 34  LEU A HD23 4  
ATOM 5737  N N    . LYS A 1 35  ? -4.327  -0.437  8.903   1.00 0.00 ? 35  LYS A N    4  
ATOM 5738  C CA   . LYS A 1 35  ? -2.934  -0.029  8.849   1.00 0.00 ? 35  LYS A CA   4  
ATOM 5739  C C    . LYS A 1 35  ? -2.176  -0.943  7.883   1.00 0.00 ? 35  LYS A C    4  
ATOM 5740  O O    . LYS A 1 35  ? -2.378  -2.156  7.884   1.00 0.00 ? 35  LYS A O    4  
ATOM 5741  C CB   . LYS A 1 35  ? -2.333  0.012   10.256  1.00 0.00 ? 35  LYS A CB   4  
ATOM 5742  C CG   . LYS A 1 35  ? -1.093  0.909   10.296  1.00 0.00 ? 35  LYS A CG   4  
ATOM 5743  C CD   . LYS A 1 35  ? 0.167   0.119   9.936   1.00 0.00 ? 35  LYS A CD   4  
ATOM 5744  C CE   . LYS A 1 35  ? 0.868   -0.397  11.194  1.00 0.00 ? 35  LYS A CE   4  
ATOM 5745  N NZ   . LYS A 1 35  ? 1.093   -1.857  11.100  1.00 0.00 ? 35  LYS A NZ   4  
ATOM 5746  H H    . LYS A 1 35  ? -4.533  -1.152  9.572   1.00 0.00 ? 35  LYS A H    4  
ATOM 5747  H HA   . LYS A 1 35  ? -2.906  0.987   8.457   1.00 0.00 ? 35  LYS A HA   4  
ATOM 5748  H HB2  . LYS A 1 35  ? -3.076  0.381   10.962  1.00 0.00 ? 35  LYS A HB2  4  
ATOM 5749  H HB3  . LYS A 1 35  ? -2.067  -0.997  10.571  1.00 0.00 ? 35  LYS A HB3  4  
ATOM 5750  H HG2  . LYS A 1 35  ? -1.218  1.739   9.601   1.00 0.00 ? 35  LYS A HG2  4  
ATOM 5751  H HG3  . LYS A 1 35  ? -0.985  1.340   11.291  1.00 0.00 ? 35  LYS A HG3  4  
ATOM 5752  H HD2  . LYS A 1 35  ? -0.097  -0.720  9.292   1.00 0.00 ? 35  LYS A HD2  4  
ATOM 5753  H HD3  . LYS A 1 35  ? 0.848   0.754   9.370   1.00 0.00 ? 35  LYS A HD3  4  
ATOM 5754  H HE2  . LYS A 1 35  ? 1.821   0.116   11.323  1.00 0.00 ? 35  LYS A HE2  4  
ATOM 5755  H HE3  . LYS A 1 35  ? 0.263   -0.173  12.073  1.00 0.00 ? 35  LYS A HE3  4  
ATOM 5756  H HZ1  . LYS A 1 35  ? 0.287   -2.341  11.440  1.00 0.00 ? 35  LYS A HZ1  4  
ATOM 5757  H HZ2  . LYS A 1 35  ? 1.255   -2.108  10.146  1.00 0.00 ? 35  LYS A HZ2  4  
ATOM 5758  H HZ3  . LYS A 1 35  ? 1.890   -2.108  11.650  1.00 0.00 ? 35  LYS A HZ3  4  
ATOM 5759  N N    . VAL A 1 36  ? -1.320  -0.324  7.083   1.00 0.00 ? 36  VAL A N    4  
ATOM 5760  C CA   . VAL A 1 36  ? -0.531  -1.067  6.114   1.00 0.00 ? 36  VAL A CA   4  
ATOM 5761  C C    . VAL A 1 36  ? 0.948   -0.977  6.492   1.00 0.00 ? 36  VAL A C    4  
ATOM 5762  O O    . VAL A 1 36  ? 1.462   0.111   6.751   1.00 0.00 ? 36  VAL A O    4  
ATOM 5763  C CB   . VAL A 1 36  ? -0.821  -0.555  4.702   1.00 0.00 ? 36  VAL A CB   4  
ATOM 5764  C CG1  . VAL A 1 36  ? 0.141   -1.175  3.686   1.00 0.00 ? 36  VAL A CG1  4  
ATOM 5765  C CG2  . VAL A 1 36  ? -2.276  -0.818  4.310   1.00 0.00 ? 36  VAL A CG2  4  
ATOM 5766  H H    . VAL A 1 36  ? -1.162  0.663   7.089   1.00 0.00 ? 36  VAL A H    4  
ATOM 5767  H HA   . VAL A 1 36  ? -0.844  -2.110  6.166   1.00 0.00 ? 36  VAL A HA   4  
ATOM 5768  H HB   . VAL A 1 36  ? -0.663  0.524   4.697   1.00 0.00 ? 36  VAL A HB   4  
ATOM 5769  H HG11 . VAL A 1 36  ? -0.338  -2.028  3.207   1.00 0.00 ? 36  VAL A HG11 4  
ATOM 5770  H HG12 . VAL A 1 36  ? 0.401   -0.432  2.932   1.00 0.00 ? 36  VAL A HG12 4  
ATOM 5771  H HG13 . VAL A 1 36  ? 1.046   -1.505  4.197   1.00 0.00 ? 36  VAL A HG13 4  
ATOM 5772  H HG21 . VAL A 1 36  ? -2.626  -1.725  4.802   1.00 0.00 ? 36  VAL A HG21 4  
ATOM 5773  H HG22 . VAL A 1 36  ? -2.894  0.025   4.620   1.00 0.00 ? 36  VAL A HG22 4  
ATOM 5774  H HG23 . VAL A 1 36  ? -2.345  -0.941  3.229   1.00 0.00 ? 36  VAL A HG23 4  
ATOM 5775  N N    . SER A 1 37  ? 1.593   -2.134  6.510   1.00 0.00 ? 37  SER A N    4  
ATOM 5776  C CA   . SER A 1 37  ? 3.004   -2.200  6.851   1.00 0.00 ? 37  SER A CA   4  
ATOM 5777  C C    . SER A 1 37  ? 3.750   -3.062  5.831   1.00 0.00 ? 37  SER A C    4  
ATOM 5778  O O    . SER A 1 37  ? 3.196   -4.025  5.303   1.00 0.00 ? 37  SER A O    4  
ATOM 5779  C CB   . SER A 1 37  ? 3.204   -2.755  8.263   1.00 0.00 ? 37  SER A CB   4  
ATOM 5780  O OG   . SER A 1 37  ? 2.082   -3.516  8.701   1.00 0.00 ? 37  SER A OG   4  
ATOM 5781  H H    . SER A 1 37  ? 1.168   -3.014  6.298   1.00 0.00 ? 37  SER A H    4  
ATOM 5782  H HA   . SER A 1 37  ? 3.358   -1.169  6.814   1.00 0.00 ? 37  SER A HA   4  
ATOM 5783  H HB2  . SER A 1 37  ? 4.096   -3.381  8.283   1.00 0.00 ? 37  SER A HB2  4  
ATOM 5784  H HB3  . SER A 1 37  ? 3.377   -1.932  8.956   1.00 0.00 ? 37  SER A HB3  4  
ATOM 5785  H HG   . SER A 1 37  ? 1.233   -3.056  8.439   1.00 0.00 ? 37  SER A HG   4  
ATOM 5786  N N    . TRP A 1 38  ? 4.996   -2.684  5.583   1.00 0.00 ? 38  TRP A N    4  
ATOM 5787  C CA   . TRP A 1 38  ? 5.823   -3.411  4.635   1.00 0.00 ? 38  TRP A CA   4  
ATOM 5788  C C    . TRP A 1 38  ? 7.275   -3.319  5.108   1.00 0.00 ? 38  TRP A C    4  
ATOM 5789  O O    . TRP A 1 38  ? 7.554   -2.746  6.160   1.00 0.00 ? 38  TRP A O    4  
ATOM 5790  C CB   . TRP A 1 38  ? 5.622   -2.882  3.214   1.00 0.00 ? 38  TRP A CB   4  
ATOM 5791  C CG   . TRP A 1 38  ? 5.939   -1.394  3.053   1.00 0.00 ? 38  TRP A CG   4  
ATOM 5792  C CD1  . TRP A 1 38  ? 7.119   -0.828  2.767   1.00 0.00 ? 38  TRP A CD1  4  
ATOM 5793  C CD2  . TRP A 1 38  ? 5.008   -0.298  3.182   1.00 0.00 ? 38  TRP A CD2  4  
ATOM 5794  N NE1  . TRP A 1 38  ? 7.018   0.547   2.702   1.00 0.00 ? 38  TRP A NE1  4  
ATOM 5795  C CE2  . TRP A 1 38  ? 5.694   0.880   2.962   1.00 0.00 ? 38  TRP A CE2  4  
ATOM 5796  C CE3  . TRP A 1 38  ? 3.633   -0.302  3.474   1.00 0.00 ? 38  TRP A CE3  4  
ATOM 5797  C CZ2  . TRP A 1 38  ? 5.087   2.140   3.012   1.00 0.00 ? 38  TRP A CZ2  4  
ATOM 5798  C CZ3  . TRP A 1 38  ? 3.042   0.967   3.519   1.00 0.00 ? 38  TRP A CZ3  4  
ATOM 5799  C CH2  . TRP A 1 38  ? 3.718   2.161   3.301   1.00 0.00 ? 38  TRP A CH2  4  
ATOM 5800  H H    . TRP A 1 38  ? 5.439   -1.900  6.016   1.00 0.00 ? 38  TRP A H    4  
ATOM 5801  H HA   . TRP A 1 38  ? 5.496   -4.451  4.636   1.00 0.00 ? 38  TRP A HA   4  
ATOM 5802  H HB2  . TRP A 1 38  ? 6.253   -3.453  2.532   1.00 0.00 ? 38  TRP A HB2  4  
ATOM 5803  H HB3  . TRP A 1 38  ? 4.589   -3.057  2.914   1.00 0.00 ? 38  TRP A HB3  4  
ATOM 5804  H HD1  . TRP A 1 38  ? 8.043   -1.383  2.606   1.00 0.00 ? 38  TRP A HD1  4  
ATOM 5805  H HE1  . TRP A 1 38  ? 7.828   1.244   2.486   1.00 0.00 ? 38  TRP A HE1  4  
ATOM 5806  H HE3  . TRP A 1 38  ? 3.069   -1.217  3.651   1.00 0.00 ? 38  TRP A HE3  4  
ATOM 5807  H HZ2  . TRP A 1 38  ? 5.651   3.056   2.834   1.00 0.00 ? 38  TRP A HZ2  4  
ATOM 5808  H HZ3  . TRP A 1 38  ? 1.976   1.021   3.742   1.00 0.00 ? 38  TRP A HZ3  4  
ATOM 5809  H HH2  . TRP A 1 38  ? 3.184   3.110   3.355   1.00 0.00 ? 38  TRP A HH2  4  
ATOM 5810  N N    . GLN A 1 39  ? 8.162   -3.892  4.307   1.00 0.00 ? 39  GLN A N    4  
ATOM 5811  C CA   . GLN A 1 39  ? 9.578   -3.882  4.630   1.00 0.00 ? 39  GLN A CA   4  
ATOM 5812  C C    . GLN A 1 39  ? 10.397  -3.439  3.415   1.00 0.00 ? 39  GLN A C    4  
ATOM 5813  O O    . GLN A 1 39  ? 9.838   -3.147  2.359   1.00 0.00 ? 39  GLN A O    4  
ATOM 5814  C CB   . GLN A 1 39  ? 10.037  -5.253  5.129   1.00 0.00 ? 39  GLN A CB   4  
ATOM 5815  C CG   . GLN A 1 39  ? 10.320  -5.223  6.632   1.00 0.00 ? 39  GLN A CG   4  
ATOM 5816  C CD   . GLN A 1 39  ? 11.789  -4.892  6.907   1.00 0.00 ? 39  GLN A CD   4  
ATOM 5817  O OE1  . GLN A 1 39  ? 12.641  -5.761  7.000   1.00 0.00 ? 39  GLN A OE1  4  
ATOM 5818  N NE2  . GLN A 1 39  ? 12.037  -3.592  7.031   1.00 0.00 ? 39  GLN A NE2  4  
ATOM 5819  H H    . GLN A 1 39  ? 7.927   -4.356  3.453   1.00 0.00 ? 39  GLN A H    4  
ATOM 5820  H HA   . GLN A 1 39  ? 9.687   -3.154  5.434   1.00 0.00 ? 39  GLN A HA   4  
ATOM 5821  H HB2  . GLN A 1 39  ? 9.270   -5.997  4.915   1.00 0.00 ? 39  GLN A HB2  4  
ATOM 5822  H HB3  . GLN A 1 39  ? 10.935  -5.558  4.592   1.00 0.00 ? 39  GLN A HB3  4  
ATOM 5823  H HG2  . GLN A 1 39  ? 9.681   -4.481  7.112   1.00 0.00 ? 39  GLN A HG2  4  
ATOM 5824  H HG3  . GLN A 1 39  ? 10.073  -6.189  7.072   1.00 0.00 ? 39  GLN A HG3  4  
ATOM 5825  H HE21 . GLN A 1 39  ? 11.292  -2.930  6.944   1.00 0.00 ? 39  GLN A HE21 4  
ATOM 5826  H HE22 . GLN A 1 39  ? 12.968  -3.275  7.212   1.00 0.00 ? 39  GLN A HE22 4  
ATOM 5827  N N    . GLU A 1 40  ? 11.707  -3.403  3.606   1.00 0.00 ? 40  GLU A N    4  
ATOM 5828  C CA   . GLU A 1 40  ? 12.608  -3.000  2.539   1.00 0.00 ? 40  GLU A CA   4  
ATOM 5829  C C    . GLU A 1 40  ? 12.827  -4.159  1.564   1.00 0.00 ? 40  GLU A C    4  
ATOM 5830  O O    . GLU A 1 40  ? 12.898  -5.316  1.975   1.00 0.00 ? 40  GLU A O    4  
ATOM 5831  C CB   . GLU A 1 40  ? 13.939  -2.500  3.104   1.00 0.00 ? 40  GLU A CB   4  
ATOM 5832  C CG   . GLU A 1 40  ? 14.127  -1.008  2.825   1.00 0.00 ? 40  GLU A CG   4  
ATOM 5833  C CD   . GLU A 1 40  ? 15.355  -0.464  3.558   1.00 0.00 ? 40  GLU A CD   4  
ATOM 5834  O OE1  . GLU A 1 40  ? 15.728  -1.083  4.577   1.00 0.00 ? 40  GLU A OE1  4  
ATOM 5835  O OE2  . GLU A 1 40  ? 15.892  0.560   3.083   1.00 0.00 ? 40  GLU A OE2  4  
ATOM 5836  H H    . GLU A 1 40  ? 12.154  -3.642  4.468   1.00 0.00 ? 40  GLU A H    4  
ATOM 5837  H HA   . GLU A 1 40  ? 12.105  -2.178  2.030   1.00 0.00 ? 40  GLU A HA   4  
ATOM 5838  H HB2  . GLU A 1 40  ? 13.972  -2.680  4.179   1.00 0.00 ? 40  GLU A HB2  4  
ATOM 5839  H HB3  . GLU A 1 40  ? 14.761  -3.063  2.662   1.00 0.00 ? 40  GLU A HB3  4  
ATOM 5840  H HG2  . GLU A 1 40  ? 14.238  -0.846  1.753   1.00 0.00 ? 40  GLU A HG2  4  
ATOM 5841  H HG3  . GLU A 1 40  ? 13.239  -0.460  3.140   1.00 0.00 ? 40  GLU A HG3  4  
ATOM 5842  N N    . PRO A 1 41  ? 12.932  -3.798  0.257   1.00 0.00 ? 41  PRO A N    4  
ATOM 5843  C CA   . PRO A 1 41  ? 13.141  -4.795  -0.780  1.00 0.00 ? 41  PRO A CA   4  
ATOM 5844  C C    . PRO A 1 41  ? 14.585  -5.302  -0.769  1.00 0.00 ? 41  PRO A C    4  
ATOM 5845  O O    . PRO A 1 41  ? 15.480  -4.627  -0.263  1.00 0.00 ? 41  PRO A O    4  
ATOM 5846  C CB   . PRO A 1 41  ? 12.767  -4.097  -2.077  1.00 0.00 ? 41  PRO A CB   4  
ATOM 5847  C CG   . PRO A 1 41  ? 12.808  -2.607  -1.777  1.00 0.00 ? 41  PRO A CG   4  
ATOM 5848  C CD   . PRO A 1 41  ? 12.853  -2.438  -0.267  1.00 0.00 ? 41  PRO A CD   4  
ATOM 5849  H HA   . PRO A 1 41  ? 12.568  -5.597  -0.612  1.00 0.00 ? 41  PRO A HA   4  
ATOM 5850  H HB2  . PRO A 1 41  ? 13.465  -4.354  -2.874  1.00 0.00 ? 41  PRO A HB2  4  
ATOM 5851  H HB3  . PRO A 1 41  ? 11.775  -4.400  -2.412  1.00 0.00 ? 41  PRO A HB3  4  
ATOM 5852  H HG2  . PRO A 1 41  ? 13.682  -2.149  -2.238  1.00 0.00 ? 41  PRO A HG2  4  
ATOM 5853  H HG3  . PRO A 1 41  ? 11.931  -2.110  -2.191  1.00 0.00 ? 41  PRO A HG3  4  
ATOM 5854  H HD2  . PRO A 1 41  ? 13.715  -1.845  0.040   1.00 0.00 ? 41  PRO A HD2  4  
ATOM 5855  H HD3  . PRO A 1 41  ? 11.965  -1.923  0.100   1.00 0.00 ? 41  PRO A HD3  4  
ATOM 5856  N N    . GLY A 1 42  ? 14.766  -6.487  -1.332  1.00 0.00 ? 42  GLY A N    4  
ATOM 5857  C CA   . GLY A 1 42  ? 16.085  -7.093  -1.393  1.00 0.00 ? 42  GLY A CA   4  
ATOM 5858  C C    . GLY A 1 42  ? 16.837  -6.644  -2.648  1.00 0.00 ? 42  GLY A C    4  
ATOM 5859  O O    . GLY A 1 42  ? 18.038  -6.879  -2.774  1.00 0.00 ? 42  GLY A O    4  
ATOM 5860  H H    . GLY A 1 42  ? 14.032  -7.030  -1.741  1.00 0.00 ? 42  GLY A H    4  
ATOM 5861  H HA2  . GLY A 1 42  ? 16.656  -6.821  -0.506  1.00 0.00 ? 42  GLY A HA2  4  
ATOM 5862  H HA3  . GLY A 1 42  ? 15.991  -8.179  -1.391  1.00 0.00 ? 42  GLY A HA3  4  
ATOM 5863  N N    . GLU A 1 43  ? 16.099  -6.006  -3.545  1.00 0.00 ? 43  GLU A N    4  
ATOM 5864  C CA   . GLU A 1 43  ? 16.681  -5.522  -4.785  1.00 0.00 ? 43  GLU A CA   4  
ATOM 5865  C C    . GLU A 1 43  ? 16.685  -3.993  -4.808  1.00 0.00 ? 43  GLU A C    4  
ATOM 5866  O O    . GLU A 1 43  ? 16.419  -3.383  -5.842  1.00 0.00 ? 43  GLU A O    4  
ATOM 5867  C CB   . GLU A 1 43  ? 15.936  -6.086  -5.997  1.00 0.00 ? 43  GLU A CB   4  
ATOM 5868  C CG   . GLU A 1 43  ? 14.546  -6.589  -5.601  1.00 0.00 ? 43  GLU A CG   4  
ATOM 5869  C CD   . GLU A 1 43  ? 13.874  -7.316  -6.767  1.00 0.00 ? 43  GLU A CD   4  
ATOM 5870  O OE1  . GLU A 1 43  ? 13.732  -6.674  -7.830  1.00 0.00 ? 43  GLU A OE1  4  
ATOM 5871  O OE2  . GLU A 1 43  ? 13.516  -8.497  -6.569  1.00 0.00 ? 43  GLU A OE2  4  
ATOM 5872  H H    . GLU A 1 43  ? 15.123  -5.820  -3.435  1.00 0.00 ? 43  GLU A H    4  
ATOM 5873  H HA   . GLU A 1 43  ? 17.705  -5.896  -4.789  1.00 0.00 ? 43  GLU A HA   4  
ATOM 5874  H HB2  . GLU A 1 43  ? 15.844  -5.316  -6.762  1.00 0.00 ? 43  GLU A HB2  4  
ATOM 5875  H HB3  . GLU A 1 43  ? 16.511  -6.903  -6.434  1.00 0.00 ? 43  GLU A HB3  4  
ATOM 5876  H HG2  . GLU A 1 43  ? 14.628  -7.262  -4.747  1.00 0.00 ? 43  GLU A HG2  4  
ATOM 5877  H HG3  . GLU A 1 43  ? 13.928  -5.748  -5.287  1.00 0.00 ? 43  GLU A HG3  4  
ATOM 5878  N N    . LYS A 1 44  ? 16.990  -3.416  -3.654  1.00 0.00 ? 44  LYS A N    4  
ATOM 5879  C CA   . LYS A 1 44  ? 17.033  -1.969  -3.528  1.00 0.00 ? 44  LYS A CA   4  
ATOM 5880  C C    . LYS A 1 44  ? 17.675  -1.372  -4.782  1.00 0.00 ? 44  LYS A C    4  
ATOM 5881  O O    . LYS A 1 44  ? 17.357  -0.249  -5.172  1.00 0.00 ? 44  LYS A O    4  
ATOM 5882  C CB   . LYS A 1 44  ? 17.730  -1.565  -2.228  1.00 0.00 ? 44  LYS A CB   4  
ATOM 5883  C CG   . LYS A 1 44  ? 16.889  -1.957  -1.011  1.00 0.00 ? 44  LYS A CG   4  
ATOM 5884  C CD   . LYS A 1 44  ? 17.767  -2.125  0.231   1.00 0.00 ? 44  LYS A CD   4  
ATOM 5885  C CE   . LYS A 1 44  ? 16.916  -2.186  1.500   1.00 0.00 ? 44  LYS A CE   4  
ATOM 5886  N NZ   . LYS A 1 44  ? 17.284  -3.366  2.315   1.00 0.00 ? 44  LYS A NZ   4  
ATOM 5887  H H    . LYS A 1 44  ? 17.205  -3.920  -2.817  1.00 0.00 ? 44  LYS A H    4  
ATOM 5888  H HA   . LYS A 1 44  ? 16.003  -1.616  -3.466  1.00 0.00 ? 44  LYS A HA   4  
ATOM 5889  H HB2  . LYS A 1 44  ? 18.707  -2.044  -2.169  1.00 0.00 ? 44  LYS A HB2  4  
ATOM 5890  H HB3  . LYS A 1 44  ? 17.903  -0.489  -2.223  1.00 0.00 ? 44  LYS A HB3  4  
ATOM 5891  H HG2  . LYS A 1 44  ? 16.133  -1.194  -0.825  1.00 0.00 ? 44  LYS A HG2  4  
ATOM 5892  H HG3  . LYS A 1 44  ? 16.360  -2.888  -1.214  1.00 0.00 ? 44  LYS A HG3  4  
ATOM 5893  H HD2  . LYS A 1 44  ? 18.360  -3.035  0.141   1.00 0.00 ? 44  LYS A HD2  4  
ATOM 5894  H HD3  . LYS A 1 44  ? 18.469  -1.294  0.299   1.00 0.00 ? 44  LYS A HD3  4  
ATOM 5895  H HE2  . LYS A 1 44  ? 17.056  -1.276  2.084   1.00 0.00 ? 44  LYS A HE2  4  
ATOM 5896  H HE3  . LYS A 1 44  ? 15.860  -2.236  1.235   1.00 0.00 ? 44  LYS A HE3  4  
ATOM 5897  H HZ1  . LYS A 1 44  ? 17.288  -4.182  1.737   1.00 0.00 ? 44  LYS A HZ1  4  
ATOM 5898  H HZ2  . LYS A 1 44  ? 18.195  -3.230  2.706   1.00 0.00 ? 44  LYS A HZ2  4  
ATOM 5899  H HZ3  . LYS A 1 44  ? 16.619  -3.482  3.053   1.00 0.00 ? 44  LYS A HZ3  4  
ATOM 5900  N N    . ASN A 1 45  ? 18.568  -2.148  -5.378  1.00 0.00 ? 45  ASN A N    4  
ATOM 5901  C CA   . ASN A 1 45  ? 19.258  -1.710  -6.579  1.00 0.00 ? 45  ASN A CA   4  
ATOM 5902  C C    . ASN A 1 45  ? 19.797  -0.294  -6.364  1.00 0.00 ? 45  ASN A C    4  
ATOM 5903  O O    . ASN A 1 45  ? 20.017  0.443   -7.325  1.00 0.00 ? 45  ASN A O    4  
ATOM 5904  C CB   . ASN A 1 45  ? 18.309  -1.677  -7.779  1.00 0.00 ? 45  ASN A CB   4  
ATOM 5905  C CG   . ASN A 1 45  ? 18.275  -3.033  -8.487  1.00 0.00 ? 45  ASN A CG   4  
ATOM 5906  O OD1  . ASN A 1 45  ? 19.140  -3.371  -9.278  1.00 0.00 ? 45  ASN A OD1  4  
ATOM 5907  N ND2  . ASN A 1 45  ? 17.229  -3.788  -8.161  1.00 0.00 ? 45  ASN A ND2  4  
ATOM 5908  H H    . ASN A 1 45  ? 18.821  -3.060  -5.054  1.00 0.00 ? 45  ASN A H    4  
ATOM 5909  H HA   . ASN A 1 45  ? 20.053  -2.439  -6.735  1.00 0.00 ? 45  ASN A HA   4  
ATOM 5910  H HB2  . ASN A 1 45  ? 17.306  -1.411  -7.446  1.00 0.00 ? 45  ASN A HB2  4  
ATOM 5911  H HB3  . ASN A 1 45  ? 18.628  -0.905  -8.479  1.00 0.00 ? 45  ASN A HB3  4  
ATOM 5912  H HD21 . ASN A 1 45  ? 16.555  -3.450  -7.504  1.00 0.00 ? 45  ASN A HD21 4  
ATOM 5913  H HD22 . ASN A 1 45  ? 17.118  -4.693  -8.572  1.00 0.00 ? 45  ASN A HD22 4  
ATOM 5914  N N    . GLY A 1 46  ? 19.994  0.044   -5.099  1.00 0.00 ? 46  GLY A N    4  
ATOM 5915  C CA   . GLY A 1 46  ? 20.503  1.359   -4.746  1.00 0.00 ? 46  GLY A CA   4  
ATOM 5916  C C    . GLY A 1 46  ? 19.981  1.799   -3.376  1.00 0.00 ? 46  GLY A C    4  
ATOM 5917  O O    . GLY A 1 46  ? 20.081  1.055   -2.401  1.00 0.00 ? 46  GLY A O    4  
ATOM 5918  H H    . GLY A 1 46  ? 19.812  -0.561  -4.323  1.00 0.00 ? 46  GLY A H    4  
ATOM 5919  H HA2  . GLY A 1 46  ? 21.592  1.340   -4.735  1.00 0.00 ? 46  GLY A HA2  4  
ATOM 5920  H HA3  . GLY A 1 46  ? 20.204  2.084   -5.503  1.00 0.00 ? 46  GLY A HA3  4  
ATOM 5921  N N    . ILE A 1 47  ? 19.436  3.006   -3.346  1.00 0.00 ? 47  ILE A N    4  
ATOM 5922  C CA   . ILE A 1 47  ? 18.898  3.554   -2.113  1.00 0.00 ? 47  ILE A CA   4  
ATOM 5923  C C    . ILE A 1 47  ? 17.498  4.111   -2.375  1.00 0.00 ? 47  ILE A C    4  
ATOM 5924  O O    . ILE A 1 47  ? 17.288  4.847   -3.337  1.00 0.00 ? 47  ILE A O    4  
ATOM 5925  C CB   . ILE A 1 47  ? 19.865  4.579   -1.516  1.00 0.00 ? 47  ILE A CB   4  
ATOM 5926  C CG1  . ILE A 1 47  ? 21.086  3.888   -0.903  1.00 0.00 ? 47  ILE A CG1  4  
ATOM 5927  C CG2  . ILE A 1 47  ? 19.153  5.483   -0.508  1.00 0.00 ? 47  ILE A CG2  4  
ATOM 5928  C CD1  . ILE A 1 47  ? 20.662  2.786   0.069   1.00 0.00 ? 47  ILE A CD1  4  
ATOM 5929  H H    . ILE A 1 47  ? 19.358  3.605   -4.144  1.00 0.00 ? 47  ILE A H    4  
ATOM 5930  H HA   . ILE A 1 47  ? 18.817  2.734   -1.399  1.00 0.00 ? 47  ILE A HA   4  
ATOM 5931  H HB   . ILE A 1 47  ? 20.227  5.217   -2.322  1.00 0.00 ? 47  ILE A HB   4  
ATOM 5932  H HG12 . ILE A 1 47  ? 21.702  3.463   -1.695  1.00 0.00 ? 47  ILE A HG12 4  
ATOM 5933  H HG13 . ILE A 1 47  ? 21.700  4.623   -0.382  1.00 0.00 ? 47  ILE A HG13 4  
ATOM 5934  H HG21 . ILE A 1 47  ? 18.414  4.901   0.043   1.00 0.00 ? 47  ILE A HG21 4  
ATOM 5935  H HG22 . ILE A 1 47  ? 19.882  5.897   0.188   1.00 0.00 ? 47  ILE A HG22 4  
ATOM 5936  H HG23 . ILE A 1 47  ? 18.655  6.295   -1.037  1.00 0.00 ? 47  ILE A HG23 4  
ATOM 5937  H HD11 . ILE A 1 47  ? 21.337  2.778   0.925   1.00 0.00 ? 47  ILE A HD11 4  
ATOM 5938  H HD12 . ILE A 1 47  ? 19.644  2.974   0.410   1.00 0.00 ? 47  ILE A HD12 4  
ATOM 5939  H HD13 . ILE A 1 47  ? 20.704  1.821   -0.435  1.00 0.00 ? 47  ILE A HD13 4  
ATOM 5940  N N    . LEU A 1 48  ? 16.574  3.738   -1.501  1.00 0.00 ? 48  LEU A N    4  
ATOM 5941  C CA   . LEU A 1 48  ? 15.199  4.190   -1.626  1.00 0.00 ? 48  LEU A CA   4  
ATOM 5942  C C    . LEU A 1 48  ? 15.083  5.613   -1.075  1.00 0.00 ? 48  LEU A C    4  
ATOM 5943  O O    . LEU A 1 48  ? 15.605  5.911   -0.001  1.00 0.00 ? 48  LEU A O    4  
ATOM 5944  C CB   . LEU A 1 48  ? 14.245  3.195   -0.963  1.00 0.00 ? 48  LEU A CB   4  
ATOM 5945  C CG   . LEU A 1 48  ? 14.614  1.716   -1.104  1.00 0.00 ? 48  LEU A CG   4  
ATOM 5946  C CD1  . LEU A 1 48  ? 15.206  1.429   -2.485  1.00 0.00 ? 48  LEU A CD1  4  
ATOM 5947  C CD2  . LEU A 1 48  ? 15.549  1.275   0.024   1.00 0.00 ? 48  LEU A CD2  4  
ATOM 5948  H H    . LEU A 1 48  ? 16.753  3.138   -0.721  1.00 0.00 ? 48  LEU A H    4  
ATOM 5949  H HA   . LEU A 1 48  ? 14.957  4.211   -2.688  1.00 0.00 ? 48  LEU A HA   4  
ATOM 5950  H HB2  . LEU A 1 48  ? 14.182  3.433   0.099   1.00 0.00 ? 48  LEU A HB2  4  
ATOM 5951  H HB3  . LEU A 1 48  ? 13.250  3.342   -1.382  1.00 0.00 ? 48  LEU A HB3  4  
ATOM 5952  H HG   . LEU A 1 48  ? 13.702  1.127   -1.016  1.00 0.00 ? 48  LEU A HG   4  
ATOM 5953  H HD11 . LEU A 1 48  ? 14.731  0.543   -2.907  1.00 0.00 ? 48  LEU A HD11 4  
ATOM 5954  H HD12 . LEU A 1 48  ? 15.031  2.282   -3.141  1.00 0.00 ? 48  LEU A HD12 4  
ATOM 5955  H HD13 . LEU A 1 48  ? 16.279  1.256   -2.392  1.00 0.00 ? 48  LEU A HD13 4  
ATOM 5956  H HD21 . LEU A 1 48  ? 15.585  2.049   0.790   1.00 0.00 ? 48  LEU A HD21 4  
ATOM 5957  H HD22 . LEU A 1 48  ? 15.178  0.348   0.461   1.00 0.00 ? 48  LEU A HD22 4  
ATOM 5958  H HD23 . LEU A 1 48  ? 16.550  1.113   -0.377  1.00 0.00 ? 48  LEU A HD23 4  
ATOM 5959  N N    . THR A 1 49  ? 14.396  6.453   -1.834  1.00 0.00 ? 49  THR A N    4  
ATOM 5960  C CA   . THR A 1 49  ? 14.205  7.837   -1.435  1.00 0.00 ? 49  THR A CA   4  
ATOM 5961  C C    . THR A 1 49  ? 12.768  8.062   -0.961  1.00 0.00 ? 49  THR A C    4  
ATOM 5962  O O    . THR A 1 49  ? 12.381  9.188   -0.651  1.00 0.00 ? 49  THR A O    4  
ATOM 5963  C CB   . THR A 1 49  ? 14.602  8.728   -2.614  1.00 0.00 ? 49  THR A CB   4  
ATOM 5964  O OG1  . THR A 1 49  ? 13.758  8.294   -3.677  1.00 0.00 ? 49  THR A OG1  4  
ATOM 5965  C CG2  . THR A 1 49  ? 16.016  8.436   -3.118  1.00 0.00 ? 49  THR A CG2  4  
ATOM 5966  H H    . THR A 1 49  ? 13.974  6.203   -2.705  1.00 0.00 ? 49  THR A H    4  
ATOM 5967  H HA   . THR A 1 49  ? 14.857  8.044   -0.587  1.00 0.00 ? 49  THR A HA   4  
ATOM 5968  H HB   . THR A 1 49  ? 14.489  9.782   -2.360  1.00 0.00 ? 49  THR A HB   4  
ATOM 5969  H HG1  . THR A 1 49  ? 12.808  8.539   -3.481  1.00 0.00 ? 49  THR A HG1  4  
ATOM 5970  H HG21 . THR A 1 49  ? 16.498  7.719   -2.453  1.00 0.00 ? 49  THR A HG21 4  
ATOM 5971  H HG22 . THR A 1 49  ? 15.965  8.021   -4.125  1.00 0.00 ? 49  THR A HG22 4  
ATOM 5972  H HG23 . THR A 1 49  ? 16.594  9.360   -3.135  1.00 0.00 ? 49  THR A HG23 4  
ATOM 5973  N N    . GLY A 1 50  ? 12.015  6.972   -0.918  1.00 0.00 ? 50  GLY A N    4  
ATOM 5974  C CA   . GLY A 1 50  ? 10.629  7.036   -0.486  1.00 0.00 ? 50  GLY A CA   4  
ATOM 5975  C C    . GLY A 1 50  ? 9.861   5.786   -0.921  1.00 0.00 ? 50  GLY A C    4  
ATOM 5976  O O    . GLY A 1 50  ? 10.430  4.888   -1.540  1.00 0.00 ? 50  GLY A O    4  
ATOM 5977  H H    . GLY A 1 50  ? 12.337  6.060   -1.171  1.00 0.00 ? 50  GLY A H    4  
ATOM 5978  H HA2  . GLY A 1 50  ? 10.586  7.135   0.598   1.00 0.00 ? 50  GLY A HA2  4  
ATOM 5979  H HA3  . GLY A 1 50  ? 10.154  7.923   -0.906  1.00 0.00 ? 50  GLY A HA3  4  
ATOM 5980  N N    . TYR A 1 51  ? 8.582   5.768   -0.579  1.00 0.00 ? 51  TYR A N    4  
ATOM 5981  C CA   . TYR A 1 51  ? 7.730   4.643   -0.925  1.00 0.00 ? 51  TYR A CA   4  
ATOM 5982  C C    . TYR A 1 51  ? 6.340   5.118   -1.353  1.00 0.00 ? 51  TYR A C    4  
ATOM 5983  O O    . TYR A 1 51  ? 5.719   5.928   -0.666  1.00 0.00 ? 51  TYR A O    4  
ATOM 5984  C CB   . TYR A 1 51  ? 7.600   3.804   0.348   1.00 0.00 ? 51  TYR A CB   4  
ATOM 5985  C CG   . TYR A 1 51  ? 8.843   2.975   0.676   1.00 0.00 ? 51  TYR A CG   4  
ATOM 5986  C CD1  . TYR A 1 51  ? 9.113   1.824   -0.035  1.00 0.00 ? 51  TYR A CD1  4  
ATOM 5987  C CD2  . TYR A 1 51  ? 9.695   3.379   1.685   1.00 0.00 ? 51  TYR A CD2  4  
ATOM 5988  C CE1  . TYR A 1 51  ? 10.283  1.043   0.274   1.00 0.00 ? 51  TYR A CE1  4  
ATOM 5989  C CE2  . TYR A 1 51  ? 10.865  2.598   1.994   1.00 0.00 ? 51  TYR A CE2  4  
ATOM 5990  C CZ   . TYR A 1 51  ? 11.101  1.469   1.274   1.00 0.00 ? 51  TYR A CZ   4  
ATOM 5991  O OH   . TYR A 1 51  ? 12.206  0.732   1.566   1.00 0.00 ? 51  TYR A OH   4  
ATOM 5992  H H    . TYR A 1 51  ? 8.127   6.502   -0.075  1.00 0.00 ? 51  TYR A H    4  
ATOM 5993  H HA   . TYR A 1 51  ? 8.196   4.112   -1.756  1.00 0.00 ? 51  TYR A HA   4  
ATOM 5994  H HB2  . TYR A 1 51  ? 7.385   4.466   1.186   1.00 0.00 ? 51  TYR A HB2  4  
ATOM 5995  H HB3  . TYR A 1 51  ? 6.746   3.134   0.244   1.00 0.00 ? 51  TYR A HB3  4  
ATOM 5996  H HD1  . TYR A 1 51  ? 8.440   1.505   -0.831  1.00 0.00 ? 51  TYR A HD1  4  
ATOM 5997  H HD2  . TYR A 1 51  ? 9.482   4.288   2.247   1.00 0.00 ? 51  TYR A HD2  4  
ATOM 5998  H HE1  . TYR A 1 51  ? 10.507  0.132   -0.280  1.00 0.00 ? 51  TYR A HE1  4  
ATOM 5999  H HE2  . TYR A 1 51  ? 11.546  2.905   2.788   1.00 0.00 ? 51  TYR A HE2  4  
ATOM 6000  H HH   . TYR A 1 51  ? 12.933  1.327   1.908   1.00 0.00 ? 51  TYR A HH   4  
ATOM 6001  N N    . ARG A 1 52  ? 5.893   4.595   -2.485  1.00 0.00 ? 52  ARG A N    4  
ATOM 6002  C CA   . ARG A 1 52  ? 4.588   4.956   -3.012  1.00 0.00 ? 52  ARG A CA   4  
ATOM 6003  C C    . ARG A 1 52  ? 3.554   3.889   -2.646  1.00 0.00 ? 52  ARG A C    4  
ATOM 6004  O O    . ARG A 1 52  ? 3.713   2.720   -2.994  1.00 0.00 ? 52  ARG A O    4  
ATOM 6005  C CB   . ARG A 1 52  ? 4.633   5.112   -4.534  1.00 0.00 ? 52  ARG A CB   4  
ATOM 6006  C CG   . ARG A 1 52  ? 3.482   5.991   -5.028  1.00 0.00 ? 52  ARG A CG   4  
ATOM 6007  C CD   . ARG A 1 52  ? 3.216   5.759   -6.517  1.00 0.00 ? 52  ARG A CD   4  
ATOM 6008  N NE   . ARG A 1 52  ? 4.389   6.185   -7.313  1.00 0.00 ? 52  ARG A NE   4  
ATOM 6009  C CZ   . ARG A 1 52  ? 4.363   6.389   -8.637  1.00 0.00 ? 52  ARG A CZ   4  
ATOM 6010  N NH1  . ARG A 1 52  ? 3.226   6.209   -9.322  1.00 0.00 ? 52  ARG A NH1  4  
ATOM 6011  N NH2  . ARG A 1 52  ? 5.476   6.775   -9.277  1.00 0.00 ? 52  ARG A NH2  4  
ATOM 6012  H H    . ARG A 1 52  ? 6.405   3.937   -3.038  1.00 0.00 ? 52  ARG A H    4  
ATOM 6013  H HA   . ARG A 1 52  ? 4.351   5.910   -2.541  1.00 0.00 ? 52  ARG A HA   4  
ATOM 6014  H HB2  . ARG A 1 52  ? 5.585   5.552   -4.830  1.00 0.00 ? 52  ARG A HB2  4  
ATOM 6015  H HB3  . ARG A 1 52  ? 4.575   4.131   -5.006  1.00 0.00 ? 52  ARG A HB3  4  
ATOM 6016  H HG2  . ARG A 1 52  ? 2.581   5.773   -4.456  1.00 0.00 ? 52  ARG A HG2  4  
ATOM 6017  H HG3  . ARG A 1 52  ? 3.722   7.040   -4.857  1.00 0.00 ? 52  ARG A HG3  4  
ATOM 6018  H HD2  . ARG A 1 52  ? 3.007   4.704   -6.698  1.00 0.00 ? 52  ARG A HD2  4  
ATOM 6019  H HD3  . ARG A 1 52  ? 2.333   6.317   -6.828  1.00 0.00 ? 52  ARG A HD3  4  
ATOM 6020  H HE   . ARG A 1 52  ? 5.254   6.328   -6.833  1.00 0.00 ? 52  ARG A HE   4  
ATOM 6021  H HH11 . ARG A 1 52  ? 2.395   5.921   -8.844  1.00 0.00 ? 52  ARG A HH11 4  
ATOM 6022  H HH12 . ARG A 1 52  ? 3.207   6.362   -10.310 1.00 0.00 ? 52  ARG A HH12 4  
ATOM 6023  H HH21 . ARG A 1 52  ? 6.325   6.910   -8.766  1.00 0.00 ? 52  ARG A HH21 4  
ATOM 6024  H HH22 . ARG A 1 52  ? 5.457   6.928   -10.265 1.00 0.00 ? 52  ARG A HH22 4  
ATOM 6025  N N    . ILE A 1 53  ? 2.518   4.330   -1.949  1.00 0.00 ? 53  ILE A N    4  
ATOM 6026  C CA   . ILE A 1 53  ? 1.458   3.427   -1.532  1.00 0.00 ? 53  ILE A CA   4  
ATOM 6027  C C    . ILE A 1 53  ? 0.153   3.824   -2.226  1.00 0.00 ? 53  ILE A C    4  
ATOM 6028  O O    . ILE A 1 53  ? -0.123  5.009   -2.405  1.00 0.00 ? 53  ILE A O    4  
ATOM 6029  C CB   . ILE A 1 53  ? 1.355   3.391   -0.006  1.00 0.00 ? 53  ILE A CB   4  
ATOM 6030  C CG1  . ILE A 1 53  ? 0.356   2.326   0.451   1.00 0.00 ? 53  ILE A CG1  4  
ATOM 6031  C CG2  . ILE A 1 53  ? 1.016   4.773   0.555   1.00 0.00 ? 53  ILE A CG2  4  
ATOM 6032  C CD1  . ILE A 1 53  ? 0.088   2.433   1.954   1.00 0.00 ? 53  ILE A CD1  4  
ATOM 6033  H H    . ILE A 1 53  ? 2.396   5.282   -1.670  1.00 0.00 ? 53  ILE A H    4  
ATOM 6034  H HA   . ILE A 1 53  ? 1.734   2.425   -1.860  1.00 0.00 ? 53  ILE A HA   4  
ATOM 6035  H HB   . ILE A 1 53  ? 2.329   3.111   0.395   1.00 0.00 ? 53  ILE A HB   4  
ATOM 6036  H HG12 . ILE A 1 53  ? -0.579  2.441   -0.097  1.00 0.00 ? 53  ILE A HG12 4  
ATOM 6037  H HG13 . ILE A 1 53  ? 0.743   1.334   0.217   1.00 0.00 ? 53  ILE A HG13 4  
ATOM 6038  H HG21 . ILE A 1 53  ? 1.720   5.026   1.348   1.00 0.00 ? 53  ILE A HG21 4  
ATOM 6039  H HG22 . ILE A 1 53  ? 1.084   5.515   -0.241  1.00 0.00 ? 53  ILE A HG22 4  
ATOM 6040  H HG23 . ILE A 1 53  ? 0.003   4.764   0.957   1.00 0.00 ? 53  ILE A HG23 4  
ATOM 6041  H HD11 . ILE A 1 53  ? 0.674   3.253   2.369   1.00 0.00 ? 53  ILE A HD11 4  
ATOM 6042  H HD12 . ILE A 1 53  ? -0.972  2.623   2.121   1.00 0.00 ? 53  ILE A HD12 4  
ATOM 6043  H HD13 . ILE A 1 53  ? 0.372   1.501   2.441   1.00 0.00 ? 53  ILE A HD13 4  
ATOM 6044  N N    . SER A 1 54  ? -0.613  2.810   -2.599  1.00 0.00 ? 54  SER A N    4  
ATOM 6045  C CA   . SER A 1 54  ? -1.882  3.037   -3.270  1.00 0.00 ? 54  SER A CA   4  
ATOM 6046  C C    . SER A 1 54  ? -2.894  1.968   -2.853  1.00 0.00 ? 54  SER A C    4  
ATOM 6047  O O    . SER A 1 54  ? -2.720  0.790   -3.161  1.00 0.00 ? 54  SER A O    4  
ATOM 6048  C CB   . SER A 1 54  ? -1.708  3.040   -4.790  1.00 0.00 ? 54  SER A CB   4  
ATOM 6049  O OG   . SER A 1 54  ? -0.348  2.853   -5.172  1.00 0.00 ? 54  SER A OG   4  
ATOM 6050  H H    . SER A 1 54  ? -0.381  1.849   -2.449  1.00 0.00 ? 54  SER A H    4  
ATOM 6051  H HA   . SER A 1 54  ? -2.209  4.023   -2.940  1.00 0.00 ? 54  SER A HA   4  
ATOM 6052  H HB2  . SER A 1 54  ? -2.319  2.249   -5.226  1.00 0.00 ? 54  SER A HB2  4  
ATOM 6053  H HB3  . SER A 1 54  ? -2.073  3.984   -5.195  1.00 0.00 ? 54  SER A HB3  4  
ATOM 6054  H HG   . SER A 1 54  ? -0.209  3.176   -6.108  1.00 0.00 ? 54  SER A HG   4  
ATOM 6055  N N    . TRP A 1 55  ? -3.929  2.417   -2.158  1.00 0.00 ? 55  TRP A N    4  
ATOM 6056  C CA   . TRP A 1 55  ? -4.969  1.514   -1.696  1.00 0.00 ? 55  TRP A CA   4  
ATOM 6057  C C    . TRP A 1 55  ? -6.183  1.682   -2.612  1.00 0.00 ? 55  TRP A C    4  
ATOM 6058  O O    . TRP A 1 55  ? -6.448  2.779   -3.102  1.00 0.00 ? 55  TRP A O    4  
ATOM 6059  C CB   . TRP A 1 55  ? -5.294  1.761   -0.222  1.00 0.00 ? 55  TRP A CB   4  
ATOM 6060  C CG   . TRP A 1 55  ? -5.959  3.111   0.052   1.00 0.00 ? 55  TRP A CG   4  
ATOM 6061  C CD1  . TRP A 1 55  ? -7.197  3.503   -0.280  1.00 0.00 ? 55  TRP A CD1  4  
ATOM 6062  C CD2  . TRP A 1 55  ? -5.368  4.239   0.731   1.00 0.00 ? 55  TRP A CD2  4  
ATOM 6063  N NE1  . TRP A 1 55  ? -7.446  4.796   0.134   1.00 0.00 ? 55  TRP A NE1  4  
ATOM 6064  C CE2  . TRP A 1 55  ? -6.299  5.257   0.768   1.00 0.00 ? 55  TRP A CE2  4  
ATOM 6065  C CE3  . TRP A 1 55  ? -4.090  4.394   1.295   1.00 0.00 ? 55  TRP A CE3  4  
ATOM 6066  C CZ2  . TRP A 1 55  ? -6.050  6.502   1.359   1.00 0.00 ? 55  TRP A CZ2  4  
ATOM 6067  C CZ3  . TRP A 1 55  ? -3.857  5.643   1.882   1.00 0.00 ? 55  TRP A CZ3  4  
ATOM 6068  C CH2  . TRP A 1 55  ? -4.783  6.679   1.928   1.00 0.00 ? 55  TRP A CH2  4  
ATOM 6069  H H    . TRP A 1 55  ? -4.063  3.377   -1.912  1.00 0.00 ? 55  TRP A H    4  
ATOM 6070  H HA   . TRP A 1 55  ? -4.584  0.497   -1.770  1.00 0.00 ? 55  TRP A HA   4  
ATOM 6071  H HB2  . TRP A 1 55  ? -5.950  0.966   0.133   1.00 0.00 ? 55  TRP A HB2  4  
ATOM 6072  H HB3  . TRP A 1 55  ? -4.373  1.697   0.358   1.00 0.00 ? 55  TRP A HB3  4  
ATOM 6073  H HD1  . TRP A 1 55  ? -7.917  2.879   -0.810  1.00 0.00 ? 55  TRP A HD1  4  
ATOM 6074  H HE1  . TRP A 1 55  ? -8.373  5.352   -0.010  1.00 0.00 ? 55  TRP A HE1  4  
ATOM 6075  H HE3  . TRP A 1 55  ? -3.338  3.605   1.279   1.00 0.00 ? 55  TRP A HE3  4  
ATOM 6076  H HZ2  . TRP A 1 55  ? -6.802  7.291   1.376   1.00 0.00 ? 55  TRP A HZ2  4  
ATOM 6077  H HZ3  . TRP A 1 55  ? -2.880  5.816   2.334   1.00 0.00 ? 55  TRP A HZ3  4  
ATOM 6078  H HH2  . TRP A 1 55  ? -4.524  7.624   2.404   1.00 0.00 ? 55  TRP A HH2  4  
ATOM 6079  N N    . GLU A 1 56  ? -6.888  0.579   -2.815  1.00 0.00 ? 56  GLU A N    4  
ATOM 6080  C CA   . GLU A 1 56  ? -8.067  0.590   -3.664  1.00 0.00 ? 56  GLU A CA   4  
ATOM 6081  C C    . GLU A 1 56  ? -8.856  -0.710  -3.494  1.00 0.00 ? 56  GLU A C    4  
ATOM 6082  O O    . GLU A 1 56  ? -8.326  -1.701  -2.994  1.00 0.00 ? 56  GLU A O    4  
ATOM 6083  C CB   . GLU A 1 56  ? -7.687  0.813   -5.129  1.00 0.00 ? 56  GLU A CB   4  
ATOM 6084  C CG   . GLU A 1 56  ? -7.154  -0.475  -5.759  1.00 0.00 ? 56  GLU A CG   4  
ATOM 6085  C CD   . GLU A 1 56  ? -6.878  -0.282  -7.252  1.00 0.00 ? 56  GLU A CD   4  
ATOM 6086  O OE1  . GLU A 1 56  ? -5.842  0.345   -7.561  1.00 0.00 ? 56  GLU A OE1  4  
ATOM 6087  O OE2  . GLU A 1 56  ? -7.710  -0.765  -8.049  1.00 0.00 ? 56  GLU A OE2  4  
ATOM 6088  H H    . GLU A 1 56  ? -6.665  -0.309  -2.413  1.00 0.00 ? 56  GLU A H    4  
ATOM 6089  H HA   . GLU A 1 56  ? -8.665  1.434   -3.318  1.00 0.00 ? 56  GLU A HA   4  
ATOM 6090  H HB2  . GLU A 1 56  ? -8.557  1.162   -5.685  1.00 0.00 ? 56  GLU A HB2  4  
ATOM 6091  H HB3  . GLU A 1 56  ? -6.931  1.596   -5.197  1.00 0.00 ? 56  GLU A HB3  4  
ATOM 6092  H HG2  . GLU A 1 56  ? -6.238  -0.779  -5.253  1.00 0.00 ? 56  GLU A HG2  4  
ATOM 6093  H HG3  . GLU A 1 56  ? -7.877  -1.278  -5.620  1.00 0.00 ? 56  GLU A HG3  4  
ATOM 6094  N N    . GLU A 1 57  ? -10.110 -0.663  -3.919  1.00 0.00 ? 57  GLU A N    4  
ATOM 6095  C CA   . GLU A 1 57  ? -10.977 -1.825  -3.821  1.00 0.00 ? 57  GLU A CA   4  
ATOM 6096  C C    . GLU A 1 57  ? -10.353 -3.017  -4.550  1.00 0.00 ? 57  GLU A C    4  
ATOM 6097  O O    . GLU A 1 57  ? -9.307  -2.883  -5.183  1.00 0.00 ? 57  GLU A O    4  
ATOM 6098  C CB   . GLU A 1 57  ? -12.372 -1.516  -4.368  1.00 0.00 ? 57  GLU A CB   4  
ATOM 6099  C CG   . GLU A 1 57  ? -13.336 -1.152  -3.238  1.00 0.00 ? 57  GLU A CG   4  
ATOM 6100  C CD   . GLU A 1 57  ? -14.310 -2.298  -2.957  1.00 0.00 ? 57  GLU A CD   4  
ATOM 6101  O OE1  . GLU A 1 57  ? -13.824 -3.445  -2.861  1.00 0.00 ? 57  GLU A OE1  4  
ATOM 6102  O OE2  . GLU A 1 57  ? -15.519 -2.001  -2.845  1.00 0.00 ? 57  GLU A OE2  4  
ATOM 6103  H H    . GLU A 1 57  ? -10.534 0.147   -4.325  1.00 0.00 ? 57  GLU A H    4  
ATOM 6104  H HA   . GLU A 1 57  ? -11.052 -2.041  -2.755  1.00 0.00 ? 57  GLU A HA   4  
ATOM 6105  H HB2  . GLU A 1 57  ? -12.313 -0.693  -5.080  1.00 0.00 ? 57  GLU A HB2  4  
ATOM 6106  H HB3  . GLU A 1 57  ? -12.753 -2.381  -4.911  1.00 0.00 ? 57  GLU A HB3  4  
ATOM 6107  H HG2  . GLU A 1 57  ? -12.772 -0.919  -2.335  1.00 0.00 ? 57  GLU A HG2  4  
ATOM 6108  H HG3  . GLU A 1 57  ? -13.893 -0.254  -3.506  1.00 0.00 ? 57  GLU A HG3  4  
ATOM 6109  N N    . TYR A 1 58  ? -11.021 -4.155  -4.436  1.00 0.00 ? 58  TYR A N    4  
ATOM 6110  C CA   . TYR A 1 58  ? -10.545 -5.369  -5.077  1.00 0.00 ? 58  TYR A CA   4  
ATOM 6111  C C    . TYR A 1 58  ? -10.317 -5.146  -6.573  1.00 0.00 ? 58  TYR A C    4  
ATOM 6112  O O    . TYR A 1 58  ? -9.196  -5.282  -7.061  1.00 0.00 ? 58  TYR A O    4  
ATOM 6113  C CB   . TYR A 1 58  ? -11.655 -6.407  -4.892  1.00 0.00 ? 58  TYR A CB   4  
ATOM 6114  C CG   . TYR A 1 58  ? -11.546 -7.608  -5.832  1.00 0.00 ? 58  TYR A CG   4  
ATOM 6115  C CD1  . TYR A 1 58  ? -10.416 -8.400  -5.812  1.00 0.00 ? 58  TYR A CD1  4  
ATOM 6116  C CD2  . TYR A 1 58  ? -12.579 -7.901  -6.700  1.00 0.00 ? 58  TYR A CD2  4  
ATOM 6117  C CE1  . TYR A 1 58  ? -10.314 -9.532  -6.697  1.00 0.00 ? 58  TYR A CE1  4  
ATOM 6118  C CE2  . TYR A 1 58  ? -12.476 -9.032  -7.585  1.00 0.00 ? 58  TYR A CE2  4  
ATOM 6119  C CZ   . TYR A 1 58  ? -11.349 -9.792  -7.540  1.00 0.00 ? 58  TYR A CZ   4  
ATOM 6120  O OH   . TYR A 1 58  ? -11.253 -10.860 -8.376  1.00 0.00 ? 58  TYR A OH   4  
ATOM 6121  H H    . TYR A 1 58  ? -11.872 -4.255  -3.920  1.00 0.00 ? 58  TYR A H    4  
ATOM 6122  H HA   . TYR A 1 58  ? -9.601  -5.648  -4.610  1.00 0.00 ? 58  TYR A HA   4  
ATOM 6123  H HB2  . TYR A 1 58  ? -11.638 -6.762  -3.861  1.00 0.00 ? 58  TYR A HB2  4  
ATOM 6124  H HB3  . TYR A 1 58  ? -12.620 -5.923  -5.046  1.00 0.00 ? 58  TYR A HB3  4  
ATOM 6125  H HD1  . TYR A 1 58  ? -9.601  -8.169  -5.127  1.00 0.00 ? 58  TYR A HD1  4  
ATOM 6126  H HD2  . TYR A 1 58  ? -13.471 -7.276  -6.716  1.00 0.00 ? 58  TYR A HD2  4  
ATOM 6127  H HE1  . TYR A 1 58  ? -9.427  -10.165 -6.692  1.00 0.00 ? 58  TYR A HE1  4  
ATOM 6128  H HE2  . TYR A 1 58  ? -13.284 -9.274  -8.276  1.00 0.00 ? 58  TYR A HE2  4  
ATOM 6129  H HH   . TYR A 1 58  ? -11.897 -11.572 -8.097  1.00 0.00 ? 58  TYR A HH   4  
ATOM 6130  N N    . ASN A 1 59  ? -11.398 -4.808  -7.261  1.00 0.00 ? 59  ASN A N    4  
ATOM 6131  C CA   . ASN A 1 59  ? -11.329 -4.565  -8.692  1.00 0.00 ? 59  ASN A CA   4  
ATOM 6132  C C    . ASN A 1 59  ? -12.003 -3.229  -9.010  1.00 0.00 ? 59  ASN A C    4  
ATOM 6133  O O    . ASN A 1 59  ? -12.982 -3.185  -9.754  1.00 0.00 ? 59  ASN A O    4  
ATOM 6134  C CB   . ASN A 1 59  ? -12.059 -5.661  -9.472  1.00 0.00 ? 59  ASN A CB   4  
ATOM 6135  C CG   . ASN A 1 59  ? -13.516 -5.780  -9.018  1.00 0.00 ? 59  ASN A CG   4  
ATOM 6136  O OD1  . ASN A 1 59  ? -13.955 -5.136  -8.079  1.00 0.00 ? 59  ASN A OD1  4  
ATOM 6137  N ND2  . ASN A 1 59  ? -14.237 -6.636  -9.735  1.00 0.00 ? 59  ASN A ND2  4  
ATOM 6138  H H    . ASN A 1 59  ? -12.306 -4.700  -6.857  1.00 0.00 ? 59  ASN A H    4  
ATOM 6139  H HA   . ASN A 1 59  ? -10.266 -4.564  -8.931  1.00 0.00 ? 59  ASN A HA   4  
ATOM 6140  H HB2  . ASN A 1 59  ? -12.024 -5.438  -10.538 1.00 0.00 ? 59  ASN A HB2  4  
ATOM 6141  H HB3  . ASN A 1 59  ? -11.551 -6.614  -9.329  1.00 0.00 ? 59  ASN A HB3  4  
ATOM 6142  H HD21 . ASN A 1 59  ? -13.816 -7.133  -10.493 1.00 0.00 ? 59  ASN A HD21 4  
ATOM 6143  H HD22 . ASN A 1 59  ? -15.202 -6.784  -9.515  1.00 0.00 ? 59  ASN A HD22 4  
ATOM 6144  N N    . ARG A 1 60  ? -11.452 -2.172  -8.432  1.00 0.00 ? 60  ARG A N    4  
ATOM 6145  C CA   . ARG A 1 60  ? -11.987 -0.838  -8.645  1.00 0.00 ? 60  ARG A CA   4  
ATOM 6146  C C    . ARG A 1 60  ? -10.907 0.214   -8.387  1.00 0.00 ? 60  ARG A C    4  
ATOM 6147  O O    . ARG A 1 60  ? -10.686 0.616   -7.246  1.00 0.00 ? 60  ARG A O    4  
ATOM 6148  C CB   . ARG A 1 60  ? -13.180 -0.570  -7.726  1.00 0.00 ? 60  ARG A CB   4  
ATOM 6149  C CG   . ARG A 1 60  ? -13.858 -1.878  -7.311  1.00 0.00 ? 60  ARG A CG   4  
ATOM 6150  C CD   . ARG A 1 60  ? -14.946 -1.624  -6.266  1.00 0.00 ? 60  ARG A CD   4  
ATOM 6151  N NE   . ARG A 1 60  ? -16.247 -2.130  -6.756  1.00 0.00 ? 60  ARG A NE   4  
ATOM 6152  C CZ   . ARG A 1 60  ? -17.430 -1.805  -6.218  1.00 0.00 ? 60  ARG A CZ   4  
ATOM 6153  N NH1  . ARG A 1 60  ? -17.484 -0.973  -5.169  1.00 0.00 ? 60  ARG A NH1  4  
ATOM 6154  N NH2  . ARG A 1 60  ? -18.561 -2.311  -6.729  1.00 0.00 ? 60  ARG A NH2  4  
ATOM 6155  H H    . ARG A 1 60  ? -10.656 -2.217  -7.828  1.00 0.00 ? 60  ARG A H    4  
ATOM 6156  H HA   . ARG A 1 60  ? -12.303 -0.828  -9.688  1.00 0.00 ? 60  ARG A HA   4  
ATOM 6157  H HB2  . ARG A 1 60  ? -12.847 -0.032  -6.838  1.00 0.00 ? 60  ARG A HB2  4  
ATOM 6158  H HB3  . ARG A 1 60  ? -13.900 0.071   -8.235  1.00 0.00 ? 60  ARG A HB3  4  
ATOM 6159  H HG2  . ARG A 1 60  ? -14.295 -2.358  -8.187  1.00 0.00 ? 60  ARG A HG2  4  
ATOM 6160  H HG3  . ARG A 1 60  ? -13.114 -2.565  -6.908  1.00 0.00 ? 60  ARG A HG3  4  
ATOM 6161  H HD2  . ARG A 1 60  ? -14.684 -2.118  -5.330  1.00 0.00 ? 60  ARG A HD2  4  
ATOM 6162  H HD3  . ARG A 1 60  ? -15.017 -0.557  -6.054  1.00 0.00 ? 60  ARG A HD3  4  
ATOM 6163  H HE   . ARG A 1 60  ? -16.243 -2.753  -7.539  1.00 0.00 ? 60  ARG A HE   4  
ATOM 6164  H HH11 . ARG A 1 60  ? -16.640 -0.595  -4.787  1.00 0.00 ? 60  ARG A HH11 4  
ATOM 6165  H HH12 . ARG A 1 60  ? -18.367 -0.731  -4.767  1.00 0.00 ? 60  ARG A HH12 4  
ATOM 6166  H HH21 . ARG A 1 60  ? -18.521 -2.932  -7.512  1.00 0.00 ? 60  ARG A HH21 4  
ATOM 6167  H HH22 . ARG A 1 60  ? -19.444 -2.069  -6.328  1.00 0.00 ? 60  ARG A HH22 4  
ATOM 6168  N N    . THR A 1 61  ? -10.262 0.631   -9.467  1.00 0.00 ? 61  THR A N    4  
ATOM 6169  C CA   . THR A 1 61  ? -9.210  1.629   -9.373  1.00 0.00 ? 61  THR A CA   4  
ATOM 6170  C C    . THR A 1 61  ? -9.801  2.994   -9.013  1.00 0.00 ? 61  THR A C    4  
ATOM 6171  O O    . THR A 1 61  ? -9.111  3.846   -8.456  1.00 0.00 ? 61  THR A O    4  
ATOM 6172  C CB   . THR A 1 61  ? -8.439  1.629   -10.694 1.00 0.00 ? 61  THR A CB   4  
ATOM 6173  O OG1  . THR A 1 61  ? -7.809  0.352   -10.728 1.00 0.00 ? 61  THR A OG1  4  
ATOM 6174  C CG2  . THR A 1 61  ? -7.272  2.620   -10.690 1.00 0.00 ? 61  THR A CG2  4  
ATOM 6175  H H    . THR A 1 61  ? -10.447 0.299   -10.392 1.00 0.00 ? 61  THR A H    4  
ATOM 6176  H HA   . THR A 1 61  ? -8.541  1.347   -8.560  1.00 0.00 ? 61  THR A HA   4  
ATOM 6177  H HB   . THR A 1 61  ? -9.106  1.817   -11.534 1.00 0.00 ? 61  THR A HB   4  
ATOM 6178  H HG1  . THR A 1 61  ? -8.482  -0.356  -10.943 1.00 0.00 ? 61  THR A HG1  4  
ATOM 6179  H HG21 . THR A 1 61  ? -6.453  2.219   -11.287 1.00 0.00 ? 61  THR A HG21 4  
ATOM 6180  H HG22 . THR A 1 61  ? -7.600  3.569   -11.115 1.00 0.00 ? 61  THR A HG22 4  
ATOM 6181  H HG23 . THR A 1 61  ? -6.933  2.778   -9.666  1.00 0.00 ? 61  THR A HG23 4  
ATOM 6182  N N    . ASN A 1 62  ? -11.073 3.159   -9.347  1.00 0.00 ? 62  ASN A N    4  
ATOM 6183  C CA   . ASN A 1 62  ? -11.764 4.405   -9.067  1.00 0.00 ? 62  ASN A CA   4  
ATOM 6184  C C    . ASN A 1 62  ? -11.505 4.813   -7.616  1.00 0.00 ? 62  ASN A C    4  
ATOM 6185  O O    . ASN A 1 62  ? -11.342 5.995   -7.318  1.00 0.00 ? 62  ASN A O    4  
ATOM 6186  C CB   . ASN A 1 62  ? -13.275 4.251   -9.252  1.00 0.00 ? 62  ASN A CB   4  
ATOM 6187  C CG   . ASN A 1 62  ? -14.027 5.429   -8.630  1.00 0.00 ? 62  ASN A CG   4  
ATOM 6188  O OD1  . ASN A 1 62  ? -14.462 5.389   -7.490  1.00 0.00 ? 62  ASN A OD1  4  
ATOM 6189  N ND2  . ASN A 1 62  ? -14.155 6.477   -9.439  1.00 0.00 ? 62  ASN A ND2  4  
ATOM 6190  H H    . ASN A 1 62  ? -11.627 2.461   -9.800  1.00 0.00 ? 62  ASN A H    4  
ATOM 6191  H HA   . ASN A 1 62  ? -11.360 5.124   -9.781  1.00 0.00 ? 62  ASN A HA   4  
ATOM 6192  H HB2  . ASN A 1 62  ? -13.511 4.185   -10.314 1.00 0.00 ? 62  ASN A HB2  4  
ATOM 6193  H HB3  . ASN A 1 62  ? -13.608 3.320   -8.793  1.00 0.00 ? 62  ASN A HB3  4  
ATOM 6194  H HD21 . ASN A 1 62  ? -13.775 6.444   -10.363 1.00 0.00 ? 62  ASN A HD21 4  
ATOM 6195  H HD22 . ASN A 1 62  ? -14.632 7.297   -9.123  1.00 0.00 ? 62  ASN A HD22 4  
ATOM 6196  N N    . THR A 1 63  ? -11.474 3.810   -6.750  1.00 0.00 ? 63  THR A N    4  
ATOM 6197  C CA   . THR A 1 63  ? -11.237 4.049   -5.336  1.00 0.00 ? 63  THR A CA   4  
ATOM 6198  C C    . THR A 1 63  ? -9.749  3.900   -5.012  1.00 0.00 ? 63  THR A C    4  
ATOM 6199  O O    . THR A 1 63  ? -9.389  3.401   -3.948  1.00 0.00 ? 63  THR A O    4  
ATOM 6200  C CB   . THR A 1 63  ? -12.131 3.097   -4.539  1.00 0.00 ? 63  THR A CB   4  
ATOM 6201  O OG1  . THR A 1 63  ? -11.431 1.856   -4.570  1.00 0.00 ? 63  THR A OG1  4  
ATOM 6202  C CG2  . THR A 1 63  ? -13.451 2.798   -5.253  1.00 0.00 ? 63  THR A CG2  4  
ATOM 6203  H H    . THR A 1 63  ? -11.607 2.851   -7.000  1.00 0.00 ? 63  THR A H    4  
ATOM 6204  H HA   . THR A 1 63  ? -11.511 5.080   -5.111  1.00 0.00 ? 63  THR A HA   4  
ATOM 6205  H HB   . THR A 1 63  ? -12.309 3.480   -3.534  1.00 0.00 ? 63  THR A HB   4  
ATOM 6206  H HG1  . THR A 1 63  ? -11.368 1.522   -5.511  1.00 0.00 ? 63  THR A HG1  4  
ATOM 6207  H HG21 . THR A 1 63  ? -14.092 2.207   -4.598  1.00 0.00 ? 63  THR A HG21 4  
ATOM 6208  H HG22 . THR A 1 63  ? -13.950 3.735   -5.501  1.00 0.00 ? 63  THR A HG22 4  
ATOM 6209  H HG23 . THR A 1 63  ? -13.251 2.239   -6.167  1.00 0.00 ? 63  THR A HG23 4  
ATOM 6210  N N    . ARG A 1 64  ? -8.925  4.342   -5.951  1.00 0.00 ? 64  ARG A N    4  
ATOM 6211  C CA   . ARG A 1 64  ? -7.484  4.264   -5.779  1.00 0.00 ? 64  ARG A CA   4  
ATOM 6212  C C    . ARG A 1 64  ? -6.921  5.632   -5.388  1.00 0.00 ? 64  ARG A C    4  
ATOM 6213  O O    . ARG A 1 64  ? -7.357  6.658   -5.908  1.00 0.00 ? 64  ARG A O    4  
ATOM 6214  C CB   . ARG A 1 64  ? -6.801  3.787   -7.062  1.00 0.00 ? 64  ARG A CB   4  
ATOM 6215  C CG   . ARG A 1 64  ? -5.328  3.458   -6.810  1.00 0.00 ? 64  ARG A CG   4  
ATOM 6216  C CD   . ARG A 1 64  ? -4.421  4.242   -7.760  1.00 0.00 ? 64  ARG A CD   4  
ATOM 6217  N NE   . ARG A 1 64  ? -3.076  3.626   -7.799  1.00 0.00 ? 64  ARG A NE   4  
ATOM 6218  C CZ   . ARG A 1 64  ? -2.759  2.561   -8.547  1.00 0.00 ? 64  ARG A CZ   4  
ATOM 6219  N NH1  . ARG A 1 64  ? -3.688  1.987   -9.323  1.00 0.00 ? 64  ARG A NH1  4  
ATOM 6220  N NH2  . ARG A 1 64  ? -1.512  2.070   -8.520  1.00 0.00 ? 64  ARG A NH2  4  
ATOM 6221  H H    . ARG A 1 64  ? -9.226  4.747   -6.814  1.00 0.00 ? 64  ARG A H    4  
ATOM 6222  H HA   . ARG A 1 64  ? -7.338  3.537   -4.980  1.00 0.00 ? 64  ARG A HA   4  
ATOM 6223  H HB2  . ARG A 1 64  ? -7.314  2.904   -7.445  1.00 0.00 ? 64  ARG A HB2  4  
ATOM 6224  H HB3  . ARG A 1 64  ? -6.879  4.558   -7.828  1.00 0.00 ? 64  ARG A HB3  4  
ATOM 6225  H HG2  . ARG A 1 64  ? -5.071  3.695   -5.777  1.00 0.00 ? 64  ARG A HG2  4  
ATOM 6226  H HG3  . ARG A 1 64  ? -5.163  2.389   -6.943  1.00 0.00 ? 64  ARG A HG3  4  
ATOM 6227  H HD2  . ARG A 1 64  ? -4.853  4.255   -8.761  1.00 0.00 ? 64  ARG A HD2  4  
ATOM 6228  H HD3  . ARG A 1 64  ? -4.346  5.279   -7.432  1.00 0.00 ? 64  ARG A HD3  4  
ATOM 6229  H HE   . ARG A 1 64  ? -2.359  4.030   -7.231  1.00 0.00 ? 64  ARG A HE   4  
ATOM 6230  H HH11 . ARG A 1 64  ? -4.618  2.353   -9.344  1.00 0.00 ? 64  ARG A HH11 4  
ATOM 6231  H HH12 . ARG A 1 64  ? -3.452  1.192   -9.882  1.00 0.00 ? 64  ARG A HH12 4  
ATOM 6232  H HH21 . ARG A 1 64  ? -0.819  2.498   -7.940  1.00 0.00 ? 64  ARG A HH21 4  
ATOM 6233  H HH22 . ARG A 1 64  ? -1.276  1.274   -9.078  1.00 0.00 ? 64  ARG A HH22 4  
ATOM 6234  N N    . VAL A 1 65  ? -5.962  5.603   -4.475  1.00 0.00 ? 65  VAL A N    4  
ATOM 6235  C CA   . VAL A 1 65  ? -5.335  6.828   -4.008  1.00 0.00 ? 65  VAL A CA   4  
ATOM 6236  C C    . VAL A 1 65  ? -3.825  6.745   -4.246  1.00 0.00 ? 65  VAL A C    4  
ATOM 6237  O O    . VAL A 1 65  ? -3.277  5.656   -4.407  1.00 0.00 ? 65  VAL A O    4  
ATOM 6238  C CB   . VAL A 1 65  ? -5.697  7.076   -2.543  1.00 0.00 ? 65  VAL A CB   4  
ATOM 6239  C CG1  . VAL A 1 65  ? -4.999  6.067   -1.627  1.00 0.00 ? 65  VAL A CG1  4  
ATOM 6240  C CG2  . VAL A 1 65  ? -5.365  8.511   -2.131  1.00 0.00 ? 65  VAL A CG2  4  
ATOM 6241  H H    . VAL A 1 65  ? -5.613  4.764   -4.057  1.00 0.00 ? 65  VAL A H    4  
ATOM 6242  H HA   . VAL A 1 65  ? -5.739  7.649   -4.600  1.00 0.00 ? 65  VAL A HA   4  
ATOM 6243  H HB   . VAL A 1 65  ? -6.773  6.937   -2.435  1.00 0.00 ? 65  VAL A HB   4  
ATOM 6244  H HG11 . VAL A 1 65  ? -4.841  6.516   -0.647  1.00 0.00 ? 65  VAL A HG11 4  
ATOM 6245  H HG12 . VAL A 1 65  ? -5.622  5.178   -1.525  1.00 0.00 ? 65  VAL A HG12 4  
ATOM 6246  H HG13 . VAL A 1 65  ? -4.038  5.789   -2.059  1.00 0.00 ? 65  VAL A HG13 4  
ATOM 6247  H HG21 . VAL A 1 65  ? -4.315  8.573   -1.844  1.00 0.00 ? 65  VAL A HG21 4  
ATOM 6248  H HG22 . VAL A 1 65  ? -5.552  9.182   -2.970  1.00 0.00 ? 65  VAL A HG22 4  
ATOM 6249  H HG23 . VAL A 1 65  ? -5.990  8.801   -1.287  1.00 0.00 ? 65  VAL A HG23 4  
ATOM 6250  N N    . THR A 1 66  ? -3.197  7.911   -4.260  1.00 0.00 ? 66  THR A N    4  
ATOM 6251  C CA   . THR A 1 66  ? -1.761  7.985   -4.474  1.00 0.00 ? 66  THR A CA   4  
ATOM 6252  C C    . THR A 1 66  ? -1.095  8.785   -3.354  1.00 0.00 ? 66  THR A C    4  
ATOM 6253  O O    . THR A 1 66  ? -1.236  10.005  -3.288  1.00 0.00 ? 66  THR A O    4  
ATOM 6254  C CB   . THR A 1 66  ? -1.521  8.573   -5.866  1.00 0.00 ? 66  THR A CB   4  
ATOM 6255  O OG1  . THR A 1 66  ? -2.128  7.633   -6.749  1.00 0.00 ? 66  THR A OG1  4  
ATOM 6256  C CG2  . THR A 1 66  ? -0.043  8.556   -6.262  1.00 0.00 ? 66  THR A CG2  4  
ATOM 6257  H H    . THR A 1 66  ? -3.650  8.793   -4.128  1.00 0.00 ? 66  THR A H    4  
ATOM 6258  H HA   . THR A 1 66  ? -1.355  6.975   -4.431  1.00 0.00 ? 66  THR A HA   4  
ATOM 6259  H HB   . THR A 1 66  ? -1.932  9.580   -5.940  1.00 0.00 ? 66  THR A HB   4  
ATOM 6260  H HG1  . THR A 1 66  ? -2.569  8.113   -7.509  1.00 0.00 ? 66  THR A HG1  4  
ATOM 6261  H HG21 . THR A 1 66  ? 0.077   9.028   -7.237  1.00 0.00 ? 66  THR A HG21 4  
ATOM 6262  H HG22 . THR A 1 66  ? 0.538   9.102   -5.520  1.00 0.00 ? 66  THR A HG22 4  
ATOM 6263  H HG23 . THR A 1 66  ? 0.308   7.525   -6.312  1.00 0.00 ? 66  THR A HG23 4  
ATOM 6264  N N    . HIS A 1 67  ? -0.382  8.066   -2.499  1.00 0.00 ? 67  HIS A N    4  
ATOM 6265  C CA   . HIS A 1 67  ? 0.307   8.693   -1.385  1.00 0.00 ? 67  HIS A CA   4  
ATOM 6266  C C    . HIS A 1 67  ? 1.817   8.503   -1.542  1.00 0.00 ? 67  HIS A C    4  
ATOM 6267  O O    . HIS A 1 67  ? 2.262   7.599   -2.247  1.00 0.00 ? 67  HIS A O    4  
ATOM 6268  C CB   . HIS A 1 67  ? -0.222  8.162   -0.051  1.00 0.00 ? 67  HIS A CB   4  
ATOM 6269  C CG   . HIS A 1 67  ? -1.307  9.014   0.563   1.00 0.00 ? 67  HIS A CG   4  
ATOM 6270  N ND1  . HIS A 1 67  ? -1.345  10.391  0.429   1.00 0.00 ? 67  HIS A ND1  4  
ATOM 6271  C CD2  . HIS A 1 67  ? -2.392  8.670   1.314   1.00 0.00 ? 67  HIS A CD2  4  
ATOM 6272  C CE1  . HIS A 1 67  ? -2.410  10.844  1.075   1.00 0.00 ? 67  HIS A CE1  4  
ATOM 6273  N NE2  . HIS A 1 67  ? -3.057  9.776   1.623   1.00 0.00 ? 67  HIS A NE2  4  
ATOM 6274  H H    . HIS A 1 67  ? -0.272  7.074   -2.560  1.00 0.00 ? 67  HIS A H    4  
ATOM 6275  H HA   . HIS A 1 67  ? 0.076   9.757   -1.433  1.00 0.00 ? 67  HIS A HA   4  
ATOM 6276  H HB2  . HIS A 1 67  ? -0.606  7.153   -0.200  1.00 0.00 ? 67  HIS A HB2  4  
ATOM 6277  H HB3  . HIS A 1 67  ? 0.608   8.086   0.652   1.00 0.00 ? 67  HIS A HB3  4  
ATOM 6278  H HD1  . HIS A 1 67  ? -0.683  10.948  -0.071  1.00 0.00 ? 67  HIS A HD1  4  
ATOM 6279  H HD2  . HIS A 1 67  ? -2.667  7.657   1.610   1.00 0.00 ? 67  HIS A HD2  4  
ATOM 6280  H HE1  . HIS A 1 67  ? -2.714  11.888  1.153   1.00 0.00 ? 67  HIS A HE1  4  
ATOM 6281  N N    . TYR A 1 68  ? 2.563   9.371   -0.874  1.00 0.00 ? 68  TYR A N    4  
ATOM 6282  C CA   . TYR A 1 68  ? 4.013   9.310   -0.930  1.00 0.00 ? 68  TYR A CA   4  
ATOM 6283  C C    . TYR A 1 68  ? 4.620   9.378   0.472   1.00 0.00 ? 68  TYR A C    4  
ATOM 6284  O O    . TYR A 1 68  ? 4.292   10.271  1.252   1.00 0.00 ? 68  TYR A O    4  
ATOM 6285  C CB   . TYR A 1 68  ? 4.456   10.540  -1.725  1.00 0.00 ? 68  TYR A CB   4  
ATOM 6286  C CG   . TYR A 1 68  ? 4.168   10.449  -3.225  1.00 0.00 ? 68  TYR A CG   4  
ATOM 6287  C CD1  . TYR A 1 68  ? 4.812   9.502   -3.995  1.00 0.00 ? 68  TYR A CD1  4  
ATOM 6288  C CD2  . TYR A 1 68  ? 3.264   11.314  -3.808  1.00 0.00 ? 68  TYR A CD2  4  
ATOM 6289  C CE1  . TYR A 1 68  ? 4.541   9.416   -5.407  1.00 0.00 ? 68  TYR A CE1  4  
ATOM 6290  C CE2  . TYR A 1 68  ? 2.993   11.228  -5.219  1.00 0.00 ? 68  TYR A CE2  4  
ATOM 6291  C CZ   . TYR A 1 68  ? 3.645   10.283  -5.949  1.00 0.00 ? 68  TYR A CZ   4  
ATOM 6292  O OH   . TYR A 1 68  ? 3.389   10.202  -7.282  1.00 0.00 ? 68  TYR A OH   4  
ATOM 6293  H H    . TYR A 1 68  ? 2.192   10.103  -0.302  1.00 0.00 ? 68  TYR A H    4  
ATOM 6294  H HA   . TYR A 1 68  ? 4.293   8.364   -1.394  1.00 0.00 ? 68  TYR A HA   4  
ATOM 6295  H HB2  . TYR A 1 68  ? 3.955   11.420  -1.322  1.00 0.00 ? 68  TYR A HB2  4  
ATOM 6296  H HB3  . TYR A 1 68  ? 5.526   10.689  -1.579  1.00 0.00 ? 68  TYR A HB3  4  
ATOM 6297  H HD1  . TYR A 1 68  ? 5.527   8.819   -3.534  1.00 0.00 ? 68  TYR A HD1  4  
ATOM 6298  H HD2  . TYR A 1 68  ? 2.755   12.062  -3.199  1.00 0.00 ? 68  TYR A HD2  4  
ATOM 6299  H HE1  . TYR A 1 68  ? 5.043   8.673   -6.026  1.00 0.00 ? 68  TYR A HE1  4  
ATOM 6300  H HE2  . TYR A 1 68  ? 2.281   11.904  -5.692  1.00 0.00 ? 68  TYR A HE2  4  
ATOM 6301  H HH   . TYR A 1 68  ? 3.680   11.043  -7.738  1.00 0.00 ? 68  TYR A HH   4  
ATOM 6302  N N    . LEU A 1 69  ? 5.496   8.423   0.751   1.00 0.00 ? 69  LEU A N    4  
ATOM 6303  C CA   . LEU A 1 69  ? 6.151   8.364   2.046   1.00 0.00 ? 69  LEU A CA   4  
ATOM 6304  C C    . LEU A 1 69  ? 7.668   8.378   1.846   1.00 0.00 ? 69  LEU A C    4  
ATOM 6305  O O    . LEU A 1 69  ? 8.157   8.086   0.756   1.00 0.00 ? 69  LEU A O    4  
ATOM 6306  C CB   . LEU A 1 69  ? 5.648   7.161   2.847   1.00 0.00 ? 69  LEU A CB   4  
ATOM 6307  C CG   . LEU A 1 69  ? 4.153   6.858   2.733   1.00 0.00 ? 69  LEU A CG   4  
ATOM 6308  C CD1  . LEU A 1 69  ? 3.868   5.385   3.033   1.00 0.00 ? 69  LEU A CD1  4  
ATOM 6309  C CD2  . LEU A 1 69  ? 3.334   7.793   3.625   1.00 0.00 ? 69  LEU A CD2  4  
ATOM 6310  H H    . LEU A 1 69  ? 5.758   7.701   0.111   1.00 0.00 ? 69  LEU A H    4  
ATOM 6311  H HA   . LEU A 1 69  ? 5.867   9.260   2.598   1.00 0.00 ? 69  LEU A HA   4  
ATOM 6312  H HB2  . LEU A 1 69  ? 6.203   6.279   2.526   1.00 0.00 ? 69  LEU A HB2  4  
ATOM 6313  H HB3  . LEU A 1 69  ? 5.887   7.323   3.898   1.00 0.00 ? 69  LEU A HB3  4  
ATOM 6314  H HG   . LEU A 1 69  ? 3.844   7.042   1.704   1.00 0.00 ? 69  LEU A HG   4  
ATOM 6315  H HD11 . LEU A 1 69  ? 3.670   4.856   2.101   1.00 0.00 ? 69  LEU A HD11 4  
ATOM 6316  H HD12 . LEU A 1 69  ? 4.732   4.941   3.527   1.00 0.00 ? 69  LEU A HD12 4  
ATOM 6317  H HD13 . LEU A 1 69  ? 2.998   5.309   3.686   1.00 0.00 ? 69  LEU A HD13 4  
ATOM 6318  H HD21 . LEU A 1 69  ? 3.846   7.926   4.578   1.00 0.00 ? 69  LEU A HD21 4  
ATOM 6319  H HD22 . LEU A 1 69  ? 3.225   8.760   3.134   1.00 0.00 ? 69  LEU A HD22 4  
ATOM 6320  H HD23 . LEU A 1 69  ? 2.349   7.361   3.798   1.00 0.00 ? 69  LEU A HD23 4  
ATOM 6321  N N    . PRO A 1 70  ? 8.389   8.730   2.944   1.00 0.00 ? 70  PRO A N    4  
ATOM 6322  C CA   . PRO A 1 70  ? 9.841   8.787   2.899   1.00 0.00 ? 70  PRO A CA   4  
ATOM 6323  C C    . PRO A 1 70  ? 10.445  7.381   2.911   1.00 0.00 ? 70  PRO A C    4  
ATOM 6324  O O    . PRO A 1 70  ? 9.722   6.392   3.018   1.00 0.00 ? 70  PRO A O    4  
ATOM 6325  C CB   . PRO A 1 70  ? 10.239  9.614   4.110   1.00 0.00 ? 70  PRO A CB   4  
ATOM 6326  C CG   . PRO A 1 70  ? 9.037   9.598   5.040   1.00 0.00 ? 70  PRO A CG   4  
ATOM 6327  C CD   . PRO A 1 70  ? 7.845   9.083   4.252   1.00 0.00 ? 70  PRO A CD   4  
ATOM 6328  H HA   . PRO A 1 70  ? 10.146  9.208   2.045   1.00 0.00 ? 70  PRO A HA   4  
ATOM 6329  H HB2  . PRO A 1 70  ? 11.117  9.193   4.600   1.00 0.00 ? 70  PRO A HB2  4  
ATOM 6330  H HB3  . PRO A 1 70  ? 10.495  10.633  3.820   1.00 0.00 ? 70  PRO A HB3  4  
ATOM 6331  H HG2  . PRO A 1 70  ? 9.230   8.960   5.902   1.00 0.00 ? 70  PRO A HG2  4  
ATOM 6332  H HG3  . PRO A 1 70  ? 8.838   10.599  5.424   1.00 0.00 ? 70  PRO A HG3  4  
ATOM 6333  H HD2  . PRO A 1 70  ? 7.392   8.219   4.738   1.00 0.00 ? 70  PRO A HD2  4  
ATOM 6334  H HD3  . PRO A 1 70  ? 7.068   9.843   4.165   1.00 0.00 ? 70  PRO A HD3  4  
ATOM 6335  N N    . ASN A 1 71  ? 11.764  7.338   2.799   1.00 0.00 ? 71  ASN A N    4  
ATOM 6336  C CA   . ASN A 1 71  ? 12.474  6.069   2.795   1.00 0.00 ? 71  ASN A CA   4  
ATOM 6337  C C    . ASN A 1 71  ? 12.749  5.640   4.238   1.00 0.00 ? 71  ASN A C    4  
ATOM 6338  O O    . ASN A 1 71  ? 13.621  4.808   4.486   1.00 0.00 ? 71  ASN A O    4  
ATOM 6339  C CB   . ASN A 1 71  ? 13.817  6.192   2.074   1.00 0.00 ? 71  ASN A CB   4  
ATOM 6340  C CG   . ASN A 1 71  ? 14.825  6.973   2.921   1.00 0.00 ? 71  ASN A CG   4  
ATOM 6341  O OD1  . ASN A 1 71  ? 14.509  7.973   3.543   1.00 0.00 ? 71  ASN A OD1  4  
ATOM 6342  N ND2  . ASN A 1 71  ? 16.052  6.461   2.909   1.00 0.00 ? 71  ASN A ND2  4  
ATOM 6343  H H    . ASN A 1 71  ? 12.345  8.147   2.713   1.00 0.00 ? 71  ASN A H    4  
ATOM 6344  H HA   . ASN A 1 71  ? 11.817  5.375   2.272   1.00 0.00 ? 71  ASN A HA   4  
ATOM 6345  H HB2  . ASN A 1 71  ? 14.210  5.199   1.858   1.00 0.00 ? 71  ASN A HB2  4  
ATOM 6346  H HB3  . ASN A 1 71  ? 13.676  6.694   1.117   1.00 0.00 ? 71  ASN A HB3  4  
ATOM 6347  H HD21 . ASN A 1 71  ? 16.245  5.636   2.377   1.00 0.00 ? 71  ASN A HD21 4  
ATOM 6348  H HD22 . ASN A 1 71  ? 16.782  6.900   3.433   1.00 0.00 ? 71  ASN A HD22 4  
ATOM 6349  N N    . VAL A 1 72  ? 11.989  6.226   5.151   1.00 0.00 ? 72  VAL A N    4  
ATOM 6350  C CA   . VAL A 1 72  ? 12.140  5.914   6.563   1.00 0.00 ? 72  VAL A CA   4  
ATOM 6351  C C    . VAL A 1 72  ? 10.873  5.221   7.066   1.00 0.00 ? 72  VAL A C    4  
ATOM 6352  O O    . VAL A 1 72  ? 10.907  4.508   8.068   1.00 0.00 ? 72  VAL A O    4  
ATOM 6353  C CB   . VAL A 1 72  ? 12.478  7.184   7.346   1.00 0.00 ? 72  VAL A CB   4  
ATOM 6354  C CG1  . VAL A 1 72  ? 13.664  7.918   6.716   1.00 0.00 ? 72  VAL A CG1  4  
ATOM 6355  C CG2  . VAL A 1 72  ? 11.259  8.103   7.453   1.00 0.00 ? 72  VAL A CG2  4  
ATOM 6356  H H    . VAL A 1 72  ? 11.282  6.901   4.941   1.00 0.00 ? 72  VAL A H    4  
ATOM 6357  H HA   . VAL A 1 72  ? 12.979  5.225   6.659   1.00 0.00 ? 72  VAL A HA   4  
ATOM 6358  H HB   . VAL A 1 72  ? 12.765  6.889   8.355   1.00 0.00 ? 72  VAL A HB   4  
ATOM 6359  H HG11 . VAL A 1 72  ? 13.753  8.911   7.156   1.00 0.00 ? 72  VAL A HG11 4  
ATOM 6360  H HG12 . VAL A 1 72  ? 14.579  7.355   6.901   1.00 0.00 ? 72  VAL A HG12 4  
ATOM 6361  H HG13 . VAL A 1 72  ? 13.505  8.009   5.641   1.00 0.00 ? 72  VAL A HG13 4  
ATOM 6362  H HG21 . VAL A 1 72  ? 11.458  9.033   6.921   1.00 0.00 ? 72  VAL A HG21 4  
ATOM 6363  H HG22 . VAL A 1 72  ? 10.393  7.609   7.013   1.00 0.00 ? 72  VAL A HG22 4  
ATOM 6364  H HG23 . VAL A 1 72  ? 11.060  8.320   8.503   1.00 0.00 ? 72  VAL A HG23 4  
ATOM 6365  N N    . THR A 1 73  ? 9.784   5.453   6.347   1.00 0.00 ? 73  THR A N    4  
ATOM 6366  C CA   . THR A 1 73  ? 8.508   4.860   6.708   1.00 0.00 ? 73  THR A CA   4  
ATOM 6367  C C    . THR A 1 73  ? 8.195   3.672   5.796   1.00 0.00 ? 73  THR A C    4  
ATOM 6368  O O    . THR A 1 73  ? 8.493   3.705   4.603   1.00 0.00 ? 73  THR A O    4  
ATOM 6369  C CB   . THR A 1 73  ? 7.445   5.959   6.660   1.00 0.00 ? 73  THR A CB   4  
ATOM 6370  O OG1  . THR A 1 73  ? 7.678   6.719   7.843   1.00 0.00 ? 73  THR A OG1  4  
ATOM 6371  C CG2  . THR A 1 73  ? 6.028   5.412   6.842   1.00 0.00 ? 73  THR A CG2  4  
ATOM 6372  H H    . THR A 1 73  ? 9.765   6.034   5.533   1.00 0.00 ? 73  THR A H    4  
ATOM 6373  H HA   . THR A 1 73  ? 8.585   4.472   7.724   1.00 0.00 ? 73  THR A HA   4  
ATOM 6374  H HB   . THR A 1 73  ? 7.524   6.537   5.739   1.00 0.00 ? 73  THR A HB   4  
ATOM 6375  H HG1  . THR A 1 73  ? 8.638   6.997   7.888   1.00 0.00 ? 73  THR A HG1  4  
ATOM 6376  H HG21 . THR A 1 73  ? 5.952   4.912   7.808   1.00 0.00 ? 73  THR A HG21 4  
ATOM 6377  H HG22 . THR A 1 73  ? 5.313   6.234   6.801   1.00 0.00 ? 73  THR A HG22 4  
ATOM 6378  H HG23 . THR A 1 73  ? 5.809   4.699   6.047   1.00 0.00 ? 73  THR A HG23 4  
ATOM 6379  N N    . LEU A 1 74  ? 7.598   2.650   6.393   1.00 0.00 ? 74  LEU A N    4  
ATOM 6380  C CA   . LEU A 1 74  ? 7.242   1.454   5.649   1.00 0.00 ? 74  LEU A CA   4  
ATOM 6381  C C    . LEU A 1 74  ? 5.830   1.015   6.045   1.00 0.00 ? 74  LEU A C    4  
ATOM 6382  O O    . LEU A 1 74  ? 5.395   -0.080  5.690   1.00 0.00 ? 74  LEU A O    4  
ATOM 6383  C CB   . LEU A 1 74  ? 8.301   0.367   5.843   1.00 0.00 ? 74  LEU A CB   4  
ATOM 6384  C CG   . LEU A 1 74  ? 9.751   0.849   5.912   1.00 0.00 ? 74  LEU A CG   4  
ATOM 6385  C CD1  . LEU A 1 74  ? 10.553  0.031   6.927   1.00 0.00 ? 74  LEU A CD1  4  
ATOM 6386  C CD2  . LEU A 1 74  ? 10.400  0.837   4.526   1.00 0.00 ? 74  LEU A CD2  4  
ATOM 6387  H H    . LEU A 1 74  ? 7.359   2.631   7.364   1.00 0.00 ? 74  LEU A H    4  
ATOM 6388  H HA   . LEU A 1 74  ? 7.238   1.716   4.591   1.00 0.00 ? 74  LEU A HA   4  
ATOM 6389  H HB2  . LEU A 1 74  ? 8.074   -0.174  6.762   1.00 0.00 ? 74  LEU A HB2  4  
ATOM 6390  H HB3  . LEU A 1 74  ? 8.215   -0.347  5.023   1.00 0.00 ? 74  LEU A HB3  4  
ATOM 6391  H HG   . LEU A 1 74  ? 9.752   1.882   6.259   1.00 0.00 ? 74  LEU A HG   4  
ATOM 6392  H HD11 . LEU A 1 74  ? 11.613  0.266   6.827   1.00 0.00 ? 74  LEU A HD11 4  
ATOM 6393  H HD12 . LEU A 1 74  ? 10.220  0.277   7.935   1.00 0.00 ? 74  LEU A HD12 4  
ATOM 6394  H HD13 . LEU A 1 74  ? 10.397  -1.031  6.742   1.00 0.00 ? 74  LEU A HD13 4  
ATOM 6395  H HD21 . LEU A 1 74  ? 10.863  1.805   4.333   1.00 0.00 ? 74  LEU A HD21 4  
ATOM 6396  H HD22 . LEU A 1 74  ? 11.160  0.057   4.487   1.00 0.00 ? 74  LEU A HD22 4  
ATOM 6397  H HD23 . LEU A 1 74  ? 9.639   0.641   3.771   1.00 0.00 ? 74  LEU A HD23 4  
ATOM 6398  N N    . GLU A 1 75  ? 5.155   1.891   6.773   1.00 0.00 ? 75  GLU A N    4  
ATOM 6399  C CA   . GLU A 1 75  ? 3.802   1.607   7.221   1.00 0.00 ? 75  GLU A CA   4  
ATOM 6400  C C    . GLU A 1 75  ? 2.949   2.877   7.171   1.00 0.00 ? 75  GLU A C    4  
ATOM 6401  O O    . GLU A 1 75  ? 3.463   3.981   7.343   1.00 0.00 ? 75  GLU A O    4  
ATOM 6402  C CB   . GLU A 1 75  ? 3.804   1.003   8.626   1.00 0.00 ? 75  GLU A CB   4  
ATOM 6403  C CG   . GLU A 1 75  ? 4.153   2.059   9.677   1.00 0.00 ? 75  GLU A CG   4  
ATOM 6404  C CD   . GLU A 1 75  ? 5.507   1.763   10.324  1.00 0.00 ? 75  GLU A CD   4  
ATOM 6405  O OE1  . GLU A 1 75  ? 6.523   1.922   9.612   1.00 0.00 ? 75  GLU A OE1  4  
ATOM 6406  O OE2  . GLU A 1 75  ? 5.497   1.385   11.515  1.00 0.00 ? 75  GLU A OE2  4  
ATOM 6407  H H    . GLU A 1 75  ? 5.516   2.779   7.057   1.00 0.00 ? 75  GLU A H    4  
ATOM 6408  H HA   . GLU A 1 75  ? 3.412   0.872   6.517   1.00 0.00 ? 75  GLU A HA   4  
ATOM 6409  H HB2  . GLU A 1 75  ? 2.825   0.577   8.845   1.00 0.00 ? 75  GLU A HB2  4  
ATOM 6410  H HB3  . GLU A 1 75  ? 4.525   0.186   8.674   1.00 0.00 ? 75  GLU A HB3  4  
ATOM 6411  H HG2  . GLU A 1 75  ? 4.175   3.045   9.212   1.00 0.00 ? 75  GLU A HG2  4  
ATOM 6412  H HG3  . GLU A 1 75  ? 3.378   2.085   10.443  1.00 0.00 ? 75  GLU A HG3  4  
ATOM 6413  N N    . TYR A 1 76  ? 1.661   2.677   6.936   1.00 0.00 ? 76  TYR A N    4  
ATOM 6414  C CA   . TYR A 1 76  ? 0.732   3.792   6.862   1.00 0.00 ? 76  TYR A CA   4  
ATOM 6415  C C    . TYR A 1 76  ? -0.701  3.332   7.140   1.00 0.00 ? 76  TYR A C    4  
ATOM 6416  O O    . TYR A 1 76  ? -1.038  2.170   6.916   1.00 0.00 ? 76  TYR A O    4  
ATOM 6417  C CB   . TYR A 1 76  ? 0.816   4.316   5.427   1.00 0.00 ? 76  TYR A CB   4  
ATOM 6418  C CG   . TYR A 1 76  ? -0.095  5.513   5.147   1.00 0.00 ? 76  TYR A CG   4  
ATOM 6419  C CD1  . TYR A 1 76  ? -1.408  5.308   4.776   1.00 0.00 ? 76  TYR A CD1  4  
ATOM 6420  C CD2  . TYR A 1 76  ? 0.397   6.797   5.266   1.00 0.00 ? 76  TYR A CD2  4  
ATOM 6421  C CE1  . TYR A 1 76  ? -2.266  6.435   4.513   1.00 0.00 ? 76  TYR A CE1  4  
ATOM 6422  C CE2  . TYR A 1 76  ? -0.461  7.924   5.002   1.00 0.00 ? 76  TYR A CE2  4  
ATOM 6423  C CZ   . TYR A 1 76  ? -1.750  7.687   4.639   1.00 0.00 ? 76  TYR A CZ   4  
ATOM 6424  O OH   . TYR A 1 76  ? -2.560  8.751   4.390   1.00 0.00 ? 76  TYR A OH   4  
ATOM 6425  H H    . TYR A 1 76  ? 1.251   1.775   6.797   1.00 0.00 ? 76  TYR A H    4  
ATOM 6426  H HA   . TYR A 1 76  ? 1.024   4.523   7.615   1.00 0.00 ? 76  TYR A HA   4  
ATOM 6427  H HB2  . TYR A 1 76  ? 1.847   4.600   5.215   1.00 0.00 ? 76  TYR A HB2  4  
ATOM 6428  H HB3  . TYR A 1 76  ? 0.561   3.510   4.740   1.00 0.00 ? 76  TYR A HB3  4  
ATOM 6429  H HD1  . TYR A 1 76  ? -1.796  4.294   4.683   1.00 0.00 ? 76  TYR A HD1  4  
ATOM 6430  H HD2  . TYR A 1 76  ? 1.434   6.959   5.559   1.00 0.00 ? 76  TYR A HD2  4  
ATOM 6431  H HE1  . TYR A 1 76  ? -3.305  6.287   4.219   1.00 0.00 ? 76  TYR A HE1  4  
ATOM 6432  H HE2  . TYR A 1 76  ? -0.086  8.943   5.092   1.00 0.00 ? 76  TYR A HE2  4  
ATOM 6433  H HH   . TYR A 1 76  ? -3.362  8.716   4.986   1.00 0.00 ? 76  TYR A HH   4  
ATOM 6434  N N    . ARG A 1 77  ? -1.505  4.266   7.625   1.00 0.00 ? 77  ARG A N    4  
ATOM 6435  C CA   . ARG A 1 77  ? -2.893  3.972   7.936   1.00 0.00 ? 77  ARG A CA   4  
ATOM 6436  C C    . ARG A 1 77  ? -3.797  4.387   6.775   1.00 0.00 ? 77  ARG A C    4  
ATOM 6437  O O    . ARG A 1 77  ? -3.757  5.534   6.331   1.00 0.00 ? 77  ARG A O    4  
ATOM 6438  C CB   . ARG A 1 77  ? -3.339  4.699   9.206   1.00 0.00 ? 77  ARG A CB   4  
ATOM 6439  C CG   . ARG A 1 77  ? -4.860  4.645   9.364   1.00 0.00 ? 77  ARG A CG   4  
ATOM 6440  C CD   . ARG A 1 77  ? -5.260  4.673   10.840  1.00 0.00 ? 77  ARG A CD   4  
ATOM 6441  N NE   . ARG A 1 77  ? -5.615  6.052   11.242  1.00 0.00 ? 77  ARG A NE   4  
ATOM 6442  C CZ   . ARG A 1 77  ? -5.576  6.500   12.504  1.00 0.00 ? 77  ARG A CZ   4  
ATOM 6443  N NH1  . ARG A 1 77  ? -5.197  5.681   13.495  1.00 0.00 ? 77  ARG A NH1  4  
ATOM 6444  N NH2  . ARG A 1 77  ? -5.916  7.768   12.776  1.00 0.00 ? 77  ARG A NH2  4  
ATOM 6445  H H    . ARG A 1 77  ? -1.222  5.209   7.805   1.00 0.00 ? 77  ARG A H    4  
ATOM 6446  H HA   . ARG A 1 77  ? -2.921  2.893   8.089   1.00 0.00 ? 77  ARG A HA   4  
ATOM 6447  H HB2  . ARG A 1 77  ? -2.864  4.245   10.076  1.00 0.00 ? 77  ARG A HB2  4  
ATOM 6448  H HB3  . ARG A 1 77  ? -3.010  5.737   9.170   1.00 0.00 ? 77  ARG A HB3  4  
ATOM 6449  H HG2  . ARG A 1 77  ? -5.313  5.489   8.844   1.00 0.00 ? 77  ARG A HG2  4  
ATOM 6450  H HG3  . ARG A 1 77  ? -5.246  3.739   8.896   1.00 0.00 ? 77  ARG A HG3  4  
ATOM 6451  H HD2  . ARG A 1 77  ? -6.106  4.007   11.009  1.00 0.00 ? 77  ARG A HD2  4  
ATOM 6452  H HD3  . ARG A 1 77  ? -4.438  4.306   11.455  1.00 0.00 ? 77  ARG A HD3  4  
ATOM 6453  H HE   . ARG A 1 77  ? -5.903  6.689   10.527  1.00 0.00 ? 77  ARG A HE   4  
ATOM 6454  H HH11 . ARG A 1 77  ? -4.944  4.735   13.292  1.00 0.00 ? 77  ARG A HH11 4  
ATOM 6455  H HH12 . ARG A 1 77  ? -5.168  6.016   14.437  1.00 0.00 ? 77  ARG A HH12 4  
ATOM 6456  H HH21 . ARG A 1 77  ? -6.199  8.379   12.037  1.00 0.00 ? 77  ARG A HH21 4  
ATOM 6457  H HH22 . ARG A 1 77  ? -5.887  8.102   13.718  1.00 0.00 ? 77  ARG A HH22 4  
ATOM 6458  N N    . VAL A 1 78  ? -4.593  3.432   6.315   1.00 0.00 ? 78  VAL A N    4  
ATOM 6459  C CA   . VAL A 1 78  ? -5.506  3.685   5.213   1.00 0.00 ? 78  VAL A CA   4  
ATOM 6460  C C    . VAL A 1 78  ? -6.890  4.022   5.771   1.00 0.00 ? 78  VAL A C    4  
ATOM 6461  O O    . VAL A 1 78  ? -7.281  3.513   6.820   1.00 0.00 ? 78  VAL A O    4  
ATOM 6462  C CB   . VAL A 1 78  ? -5.520  2.487   4.261   1.00 0.00 ? 78  VAL A CB   4  
ATOM 6463  C CG1  . VAL A 1 78  ? -6.473  2.731   3.088   1.00 0.00 ? 78  VAL A CG1  4  
ATOM 6464  C CG2  . VAL A 1 78  ? -4.110  2.165   3.763   1.00 0.00 ? 78  VAL A CG2  4  
ATOM 6465  H H    . VAL A 1 78  ? -4.620  2.502   6.681   1.00 0.00 ? 78  VAL A H    4  
ATOM 6466  H HA   . VAL A 1 78  ? -5.128  4.548   4.664   1.00 0.00 ? 78  VAL A HA   4  
ATOM 6467  H HB   . VAL A 1 78  ? -5.885  1.623   4.815   1.00 0.00 ? 78  VAL A HB   4  
ATOM 6468  H HG11 . VAL A 1 78  ? -6.153  2.139   2.231   1.00 0.00 ? 78  VAL A HG11 4  
ATOM 6469  H HG12 . VAL A 1 78  ? -7.483  2.439   3.374   1.00 0.00 ? 78  VAL A HG12 4  
ATOM 6470  H HG13 . VAL A 1 78  ? -6.461  3.789   2.825   1.00 0.00 ? 78  VAL A HG13 4  
ATOM 6471  H HG21 . VAL A 1 78  ? -4.149  1.311   3.088   1.00 0.00 ? 78  VAL A HG21 4  
ATOM 6472  H HG22 . VAL A 1 78  ? -3.705  3.028   3.234   1.00 0.00 ? 78  VAL A HG22 4  
ATOM 6473  H HG23 . VAL A 1 78  ? -3.470  1.927   4.613   1.00 0.00 ? 78  VAL A HG23 4  
ATOM 6474  N N    . THR A 1 79  ? -7.593  4.878   5.044   1.00 0.00 ? 79  THR A N    4  
ATOM 6475  C CA   . THR A 1 79  ? -8.925  5.289   5.452   1.00 0.00 ? 79  THR A CA   4  
ATOM 6476  C C    . THR A 1 79  ? -9.749  5.716   4.236   1.00 0.00 ? 79  THR A C    4  
ATOM 6477  O O    . THR A 1 79  ? -9.210  6.275   3.282   1.00 0.00 ? 79  THR A O    4  
ATOM 6478  C CB   . THR A 1 79  ? -8.778  6.391   6.503   1.00 0.00 ? 79  THR A CB   4  
ATOM 6479  O OG1  . THR A 1 79  ? -8.043  7.413   5.835   1.00 0.00 ? 79  THR A OG1  4  
ATOM 6480  C CG2  . THR A 1 79  ? -7.871  5.977   7.663   1.00 0.00 ? 79  THR A CG2  4  
ATOM 6481  H H    . THR A 1 79  ? -7.267  5.287   4.191   1.00 0.00 ? 79  THR A H    4  
ATOM 6482  H HA   . THR A 1 79  ? -9.430  4.430   5.894   1.00 0.00 ? 79  THR A HA   4  
ATOM 6483  H HB   . THR A 1 79  ? -9.754  6.714   6.868   1.00 0.00 ? 79  THR A HB   4  
ATOM 6484  H HG1  . THR A 1 79  ? -8.627  7.873   5.167   1.00 0.00 ? 79  THR A HG1  4  
ATOM 6485  H HG21 . THR A 1 79  ? -7.896  6.746   8.436   1.00 0.00 ? 79  THR A HG21 4  
ATOM 6486  H HG22 . THR A 1 79  ? -8.222  5.032   8.079   1.00 0.00 ? 79  THR A HG22 4  
ATOM 6487  H HG23 . THR A 1 79  ? -6.850  5.858   7.302   1.00 0.00 ? 79  THR A HG23 4  
ATOM 6488  N N    . GLY A 1 80  ? -11.042 5.436   4.308   1.00 0.00 ? 80  GLY A N    4  
ATOM 6489  C CA   . GLY A 1 80  ? -11.945 5.784   3.225   1.00 0.00 ? 80  GLY A CA   4  
ATOM 6490  C C    . GLY A 1 80  ? -12.310 4.549   2.397   1.00 0.00 ? 80  GLY A C    4  
ATOM 6491  O O    . GLY A 1 80  ? -12.677 4.667   1.229   1.00 0.00 ? 80  GLY A O    4  
ATOM 6492  H H    . GLY A 1 80  ? -11.472 4.981   5.088   1.00 0.00 ? 80  GLY A H    4  
ATOM 6493  H HA2  . GLY A 1 80  ? -12.850 6.234   3.631   1.00 0.00 ? 80  GLY A HA2  4  
ATOM 6494  H HA3  . GLY A 1 80  ? -11.478 6.531   2.583   1.00 0.00 ? 80  GLY A HA3  4  
ATOM 6495  N N    . LEU A 1 81  ? -12.195 3.394   3.035   1.00 0.00 ? 81  LEU A N    4  
ATOM 6496  C CA   . LEU A 1 81  ? -12.508 2.139   2.373   1.00 0.00 ? 81  LEU A CA   4  
ATOM 6497  C C    . LEU A 1 81  ? -14.003 1.848   2.522   1.00 0.00 ? 81  LEU A C    4  
ATOM 6498  O O    . LEU A 1 81  ? -14.826 2.759   2.455   1.00 0.00 ? 81  LEU A O    4  
ATOM 6499  C CB   . LEU A 1 81  ? -11.608 1.018   2.896   1.00 0.00 ? 81  LEU A CB   4  
ATOM 6500  C CG   . LEU A 1 81  ? -10.176 1.420   3.256   1.00 0.00 ? 81  LEU A CG   4  
ATOM 6501  C CD1  . LEU A 1 81  ? -9.482  0.317   4.058   1.00 0.00 ? 81  LEU A CD1  4  
ATOM 6502  C CD2  . LEU A 1 81  ? -9.384  1.803   2.004   1.00 0.00 ? 81  LEU A CD2  4  
ATOM 6503  H H    . LEU A 1 81  ? -11.895 3.307   3.985   1.00 0.00 ? 81  LEU A H    4  
ATOM 6504  H HA   . LEU A 1 81  ? -12.284 2.264   1.314   1.00 0.00 ? 81  LEU A HA   4  
ATOM 6505  H HB2  . LEU A 1 81  ? -12.076 0.586   3.781   1.00 0.00 ? 81  LEU A HB2  4  
ATOM 6506  H HB3  . LEU A 1 81  ? -11.565 0.232   2.143   1.00 0.00 ? 81  LEU A HB3  4  
ATOM 6507  H HG   . LEU A 1 81  ? -10.219 2.303   3.893   1.00 0.00 ? 81  LEU A HG   4  
ATOM 6508  H HD11 . LEU A 1 81  ? -8.909  0.765   4.870   1.00 0.00 ? 81  LEU A HD11 4  
ATOM 6509  H HD12 . LEU A 1 81  ? -10.231 -0.358  4.471   1.00 0.00 ? 81  LEU A HD12 4  
ATOM 6510  H HD13 . LEU A 1 81  ? -8.811  -0.240  3.404   1.00 0.00 ? 81  LEU A HD13 4  
ATOM 6511  H HD21 . LEU A 1 81  ? -9.170  2.872   2.022   1.00 0.00 ? 81  LEU A HD21 4  
ATOM 6512  H HD22 . LEU A 1 81  ? -8.447  1.246   1.982   1.00 0.00 ? 81  LEU A HD22 4  
ATOM 6513  H HD23 . LEU A 1 81  ? -9.969  1.565   1.116   1.00 0.00 ? 81  LEU A HD23 4  
ATOM 6514  N N    . THR A 1 82  ? -14.308 0.574   2.721   1.00 0.00 ? 82  THR A N    4  
ATOM 6515  C CA   . THR A 1 82  ? -15.689 0.151   2.880   1.00 0.00 ? 82  THR A CA   4  
ATOM 6516  C C    . THR A 1 82  ? -15.777 -1.027  3.852   1.00 0.00 ? 82  THR A C    4  
ATOM 6517  O O    . THR A 1 82  ? -14.829 -1.799  3.986   1.00 0.00 ? 82  THR A O    4  
ATOM 6518  C CB   . THR A 1 82  ? -16.250 -0.163  1.492   1.00 0.00 ? 82  THR A CB   4  
ATOM 6519  O OG1  . THR A 1 82  ? -15.789 0.913   0.680   1.00 0.00 ? 82  THR A OG1  4  
ATOM 6520  C CG2  . THR A 1 82  ? -17.774 -0.046  1.436   1.00 0.00 ? 82  THR A CG2  4  
ATOM 6521  H H    . THR A 1 82  ? -13.632 -0.161  2.774   1.00 0.00 ? 82  THR A H    4  
ATOM 6522  H HA   . THR A 1 82  ? -16.251 0.973   3.322   1.00 0.00 ? 82  THR A HA   4  
ATOM 6523  H HB   . THR A 1 82  ? -15.922 -1.146  1.153   1.00 0.00 ? 82  THR A HB   4  
ATOM 6524  H HG1  . THR A 1 82  ? -16.121 1.783   1.044   1.00 0.00 ? 82  THR A HG1  4  
ATOM 6525  H HG21 . THR A 1 82  ? -18.053 0.995   1.273   1.00 0.00 ? 82  THR A HG21 4  
ATOM 6526  H HG22 . THR A 1 82  ? -18.156 -0.658  0.618   1.00 0.00 ? 82  THR A HG22 4  
ATOM 6527  H HG23 . THR A 1 82  ? -18.200 -0.393  2.378   1.00 0.00 ? 82  THR A HG23 4  
ATOM 6528  N N    . ALA A 1 83  ? -16.925 -1.129  4.506   1.00 0.00 ? 83  ALA A N    4  
ATOM 6529  C CA   . ALA A 1 83  ? -17.150 -2.200  5.462   1.00 0.00 ? 83  ALA A CA   4  
ATOM 6530  C C    . ALA A 1 83  ? -17.240 -3.532  4.716   1.00 0.00 ? 83  ALA A C    4  
ATOM 6531  O O    . ALA A 1 83  ? -17.857 -3.614  3.655   1.00 0.00 ? 83  ALA A O    4  
ATOM 6532  C CB   . ALA A 1 83  ? -18.410 -1.901  6.277   1.00 0.00 ? 83  ALA A CB   4  
ATOM 6533  H H    . ALA A 1 83  ? -17.691 -0.496  4.392   1.00 0.00 ? 83  ALA A H    4  
ATOM 6534  H HA   . ALA A 1 83  ? -16.294 -2.228  6.137   1.00 0.00 ? 83  ALA A HA   4  
ATOM 6535  H HB1  . ALA A 1 83  ? -18.162 -1.224  7.094   1.00 0.00 ? 83  ALA A HB1  4  
ATOM 6536  H HB2  . ALA A 1 83  ? -19.157 -1.436  5.633   1.00 0.00 ? 83  ALA A HB2  4  
ATOM 6537  H HB3  . ALA A 1 83  ? -18.809 -2.831  6.683   1.00 0.00 ? 83  ALA A HB3  4  
ATOM 6538  N N    . LEU A 1 84  ? -16.615 -4.545  5.300   1.00 0.00 ? 84  LEU A N    4  
ATOM 6539  C CA   . LEU A 1 84  ? -16.617 -5.870  4.704   1.00 0.00 ? 84  LEU A CA   4  
ATOM 6540  C C    . LEU A 1 84  ? -16.424 -5.744  3.192   1.00 0.00 ? 84  LEU A C    4  
ATOM 6541  O O    . LEU A 1 84  ? -17.269 -6.186  2.415   1.00 0.00 ? 84  LEU A O    4  
ATOM 6542  C CB   . LEU A 1 84  ? -17.882 -6.634  5.101   1.00 0.00 ? 84  LEU A CB   4  
ATOM 6543  C CG   . LEU A 1 84  ? -18.103 -6.832  6.602   1.00 0.00 ? 84  LEU A CG   4  
ATOM 6544  C CD1  . LEU A 1 84  ? -19.250 -7.810  6.863   1.00 0.00 ? 84  LEU A CD1  4  
ATOM 6545  C CD2  . LEU A 1 84  ? -16.810 -7.269  7.293   1.00 0.00 ? 84  LEU A CD2  4  
ATOM 6546  H H    . LEU A 1 84  ? -16.116 -4.470  6.163   1.00 0.00 ? 84  LEU A H    4  
ATOM 6547  H HA   . LEU A 1 84  ? -15.769 -6.415  5.117   1.00 0.00 ? 84  LEU A HA   4  
ATOM 6548  H HB2  . LEU A 1 84  ? -18.744 -6.106  4.694   1.00 0.00 ? 84  LEU A HB2  4  
ATOM 6549  H HB3  . LEU A 1 84  ? -17.855 -7.614  4.625   1.00 0.00 ? 84  LEU A HB3  4  
ATOM 6550  H HG   . LEU A 1 84  ? -18.391 -5.874  7.034   1.00 0.00 ? 84  LEU A HG   4  
ATOM 6551  H HD11 . LEU A 1 84  ? -19.918 -7.824  6.002   1.00 0.00 ? 84  LEU A HD11 4  
ATOM 6552  H HD12 . LEU A 1 84  ? -18.847 -8.809  7.026   1.00 0.00 ? 84  LEU A HD12 4  
ATOM 6553  H HD13 . LEU A 1 84  ? -19.804 -7.492  7.747   1.00 0.00 ? 84  LEU A HD13 4  
ATOM 6554  H HD21 . LEU A 1 84  ? -16.466 -8.209  6.861   1.00 0.00 ? 84  LEU A HD21 4  
ATOM 6555  H HD22 . LEU A 1 84  ? -16.046 -6.504  7.153   1.00 0.00 ? 84  LEU A HD22 4  
ATOM 6556  H HD23 . LEU A 1 84  ? -16.996 -7.406  8.358   1.00 0.00 ? 84  LEU A HD23 4  
ATOM 6557  N N    . THR A 1 85  ? -15.306 -5.139  2.819   1.00 0.00 ? 85  THR A N    4  
ATOM 6558  C CA   . THR A 1 85  ? -14.990 -4.950  1.413   1.00 0.00 ? 85  THR A CA   4  
ATOM 6559  C C    . THR A 1 85  ? -13.546 -5.368  1.129   1.00 0.00 ? 85  THR A C    4  
ATOM 6560  O O    . THR A 1 85  ? -12.652 -5.110  1.934   1.00 0.00 ? 85  THR A O    4  
ATOM 6561  C CB   . THR A 1 85  ? -15.282 -3.492  1.055   1.00 0.00 ? 85  THR A CB   4  
ATOM 6562  O OG1  . THR A 1 85  ? -16.695 -3.456  0.869   1.00 0.00 ? 85  THR A OG1  4  
ATOM 6563  C CG2  . THR A 1 85  ? -14.717 -3.099  -0.311  1.00 0.00 ? 85  THR A CG2  4  
ATOM 6564  H H    . THR A 1 85  ? -14.623 -4.783  3.457   1.00 0.00 ? 85  THR A H    4  
ATOM 6565  H HA   . THR A 1 85  ? -15.634 -5.605  0.825   1.00 0.00 ? 85  THR A HA   4  
ATOM 6566  H HB   . THR A 1 85  ? -14.921 -2.820  1.834   1.00 0.00 ? 85  THR A HB   4  
ATOM 6567  H HG1  . THR A 1 85  ? -17.156 -3.793  1.690   1.00 0.00 ? 85  THR A HG1  4  
ATOM 6568  H HG21 . THR A 1 85  ? -14.962 -2.058  -0.521  1.00 0.00 ? 85  THR A HG21 4  
ATOM 6569  H HG22 . THR A 1 85  ? -13.634 -3.223  -0.306  1.00 0.00 ? 85  THR A HG22 4  
ATOM 6570  H HG23 . THR A 1 85  ? -15.152 -3.737  -1.081  1.00 0.00 ? 85  THR A HG23 4  
ATOM 6571  N N    . THR A 1 86  ? -13.362 -6.005  -0.018  1.00 0.00 ? 86  THR A N    4  
ATOM 6572  C CA   . THR A 1 86  ? -12.042 -6.461  -0.417  1.00 0.00 ? 86  THR A CA   4  
ATOM 6573  C C    . THR A 1 86  ? -11.253 -5.315  -1.055  1.00 0.00 ? 86  THR A C    4  
ATOM 6574  O O    . THR A 1 86  ? -11.682 -4.742  -2.055  1.00 0.00 ? 86  THR A O    4  
ATOM 6575  C CB   . THR A 1 86  ? -12.218 -7.666  -1.343  1.00 0.00 ? 86  THR A CB   4  
ATOM 6576  O OG1  . THR A 1 86  ? -12.956 -8.600  -0.560  1.00 0.00 ? 86  THR A OG1  4  
ATOM 6577  C CG2  . THR A 1 86  ? -10.896 -8.382  -1.630  1.00 0.00 ? 86  THR A CG2  4  
ATOM 6578  H H    . THR A 1 86  ? -14.095 -6.210  -0.667  1.00 0.00 ? 86  THR A H    4  
ATOM 6579  H HA   . THR A 1 86  ? -11.498 -6.765  0.477   1.00 0.00 ? 86  THR A HA   4  
ATOM 6580  H HB   . THR A 1 86  ? -12.713 -7.376  -2.270  1.00 0.00 ? 86  THR A HB   4  
ATOM 6581  H HG1  . THR A 1 86  ? -12.396 -8.925  0.203   1.00 0.00 ? 86  THR A HG1  4  
ATOM 6582  H HG21 . THR A 1 86  ? -10.332 -8.489  -0.703  1.00 0.00 ? 86  THR A HG21 4  
ATOM 6583  H HG22 . THR A 1 86  ? -11.100 -9.368  -2.047  1.00 0.00 ? 86  THR A HG22 4  
ATOM 6584  H HG23 . THR A 1 86  ? -10.314 -7.799  -2.344  1.00 0.00 ? 86  THR A HG23 4  
ATOM 6585  N N    . TYR A 1 87  ? -10.113 -5.016  -0.449  1.00 0.00 ? 87  TYR A N    4  
ATOM 6586  C CA   . TYR A 1 87  ? -9.260  -3.949  -0.945  1.00 0.00 ? 87  TYR A CA   4  
ATOM 6587  C C    . TYR A 1 87  ? -7.837  -4.455  -1.192  1.00 0.00 ? 87  TYR A C    4  
ATOM 6588  O O    . TYR A 1 87  ? -7.397  -5.414  -0.560  1.00 0.00 ? 87  TYR A O    4  
ATOM 6589  C CB   . TYR A 1 87  ? -9.227  -2.889  0.157   1.00 0.00 ? 87  TYR A CB   4  
ATOM 6590  C CG   . TYR A 1 87  ? -10.363 -1.867  0.072   1.00 0.00 ? 87  TYR A CG   4  
ATOM 6591  C CD1  . TYR A 1 87  ? -11.573 -2.129  0.682   1.00 0.00 ? 87  TYR A CD1  4  
ATOM 6592  C CD2  . TYR A 1 87  ? -10.178 -0.685  -0.615  1.00 0.00 ? 87  TYR A CD2  4  
ATOM 6593  C CE1  . TYR A 1 87  ? -12.643 -1.168  0.602   1.00 0.00 ? 87  TYR A CE1  4  
ATOM 6594  C CE2  . TYR A 1 87  ? -11.248 0.276   -0.695  1.00 0.00 ? 87  TYR A CE2  4  
ATOM 6595  C CZ   . TYR A 1 87  ? -12.427 -0.013  -0.083  1.00 0.00 ? 87  TYR A CZ   4  
ATOM 6596  O OH   . TYR A 1 87  ? -13.437 0.895   -0.158  1.00 0.00 ? 87  TYR A OH   4  
ATOM 6597  H H    . TYR A 1 87  ? -9.771  -5.487  0.364   1.00 0.00 ? 87  TYR A H    4  
ATOM 6598  H HA   . TYR A 1 87  ? -9.679  -3.593  -1.886  1.00 0.00 ? 87  TYR A HA   4  
ATOM 6599  H HB2  . TYR A 1 87  ? -9.271  -3.385  1.126   1.00 0.00 ? 87  TYR A HB2  4  
ATOM 6600  H HB3  . TYR A 1 87  ? -8.274  -2.361  0.111   1.00 0.00 ? 87  TYR A HB3  4  
ATOM 6601  H HD1  . TYR A 1 87  ? -11.719 -3.063  1.225   1.00 0.00 ? 87  TYR A HD1  4  
ATOM 6602  H HD2  . TYR A 1 87  ? -9.223  -0.478  -1.097  1.00 0.00 ? 87  TYR A HD2  4  
ATOM 6603  H HE1  . TYR A 1 87  ? -13.603 -1.362  1.080   1.00 0.00 ? 87  TYR A HE1  4  
ATOM 6604  H HE2  . TYR A 1 87  ? -11.115 1.214   -1.235  1.00 0.00 ? 87  TYR A HE2  4  
ATOM 6605  H HH   . TYR A 1 87  ? -14.262 0.459   -0.517  1.00 0.00 ? 87  TYR A HH   4  
ATOM 6606  N N    . THR A 1 88  ? -7.158  -3.787  -2.114  1.00 0.00 ? 88  THR A N    4  
ATOM 6607  C CA   . THR A 1 88  ? -5.794  -4.157  -2.452  1.00 0.00 ? 88  THR A CA   4  
ATOM 6608  C C    . THR A 1 88  ? -4.846  -2.981  -2.208  1.00 0.00 ? 88  THR A C    4  
ATOM 6609  O O    . THR A 1 88  ? -4.997  -1.922  -2.815  1.00 0.00 ? 88  THR A O    4  
ATOM 6610  C CB   . THR A 1 88  ? -5.784  -4.656  -3.899  1.00 0.00 ? 88  THR A CB   4  
ATOM 6611  O OG1  . THR A 1 88  ? -5.734  -6.074  -3.777  1.00 0.00 ? 88  THR A OG1  4  
ATOM 6612  C CG2  . THR A 1 88  ? -4.490  -4.299  -4.632  1.00 0.00 ? 88  THR A CG2  4  
ATOM 6613  H H    . THR A 1 88  ? -7.523  -3.009  -2.623  1.00 0.00 ? 88  THR A H    4  
ATOM 6614  H HA   . THR A 1 88  ? -5.481  -4.963  -1.788  1.00 0.00 ? 88  THR A HA   4  
ATOM 6615  H HB   . THR A 1 88  ? -6.654  -4.288  -4.443  1.00 0.00 ? 88  THR A HB   4  
ATOM 6616  H HG1  . THR A 1 88  ? -4.944  -6.343  -3.227  1.00 0.00 ? 88  THR A HG1  4  
ATOM 6617  H HG21 . THR A 1 88  ? -3.655  -4.828  -4.173  1.00 0.00 ? 88  THR A HG21 4  
ATOM 6618  H HG22 . THR A 1 88  ? -4.574  -4.591  -5.679  1.00 0.00 ? 88  THR A HG22 4  
ATOM 6619  H HG23 . THR A 1 88  ? -4.320  -3.224  -4.567  1.00 0.00 ? 88  THR A HG23 4  
ATOM 6620  N N    . ILE A 1 89  ? -3.890  -3.207  -1.319  1.00 0.00 ? 89  ILE A N    4  
ATOM 6621  C CA   . ILE A 1 89  ? -2.918  -2.179  -0.988  1.00 0.00 ? 89  ILE A CA   4  
ATOM 6622  C C    . ILE A 1 89  ? -1.609  -2.465  -1.726  1.00 0.00 ? 89  ILE A C    4  
ATOM 6623  O O    . ILE A 1 89  ? -0.985  -3.503  -1.512  1.00 0.00 ? 89  ILE A O    4  
ATOM 6624  C CB   . ILE A 1 89  ? -2.756  -2.064  0.529   1.00 0.00 ? 89  ILE A CB   4  
ATOM 6625  C CG1  . ILE A 1 89  ? -4.115  -2.114  1.231   1.00 0.00 ? 89  ILE A CG1  4  
ATOM 6626  C CG2  . ILE A 1 89  ? -1.965  -0.809  0.902   1.00 0.00 ? 89  ILE A CG2  4  
ATOM 6627  C CD1  . ILE A 1 89  ? -5.152  -1.277  0.479   1.00 0.00 ? 89  ILE A CD1  4  
ATOM 6628  H H    . ILE A 1 89  ? -3.774  -4.072  -0.831  1.00 0.00 ? 89  ILE A H    4  
ATOM 6629  H HA   . ILE A 1 89  ? -3.315  -1.228  -1.343  1.00 0.00 ? 89  ILE A HA   4  
ATOM 6630  H HB   . ILE A 1 89  ? -2.182  -2.922  0.877   1.00 0.00 ? 89  ILE A HB   4  
ATOM 6631  H HG12 . ILE A 1 89  ? -4.456  -3.147  1.297   1.00 0.00 ? 89  ILE A HG12 4  
ATOM 6632  H HG13 . ILE A 1 89  ? -4.015  -1.745  2.251   1.00 0.00 ? 89  ILE A HG13 4  
ATOM 6633  H HG21 . ILE A 1 89  ? -1.531  -0.372  0.003   1.00 0.00 ? 89  ILE A HG21 4  
ATOM 6634  H HG22 . ILE A 1 89  ? -2.631  -0.085  1.372   1.00 0.00 ? 89  ILE A HG22 4  
ATOM 6635  H HG23 . ILE A 1 89  ? -1.169  -1.075  1.597   1.00 0.00 ? 89  ILE A HG23 4  
ATOM 6636  H HD11 . ILE A 1 89  ? -5.714  -1.918  -0.200  1.00 0.00 ? 89  ILE A HD11 4  
ATOM 6637  H HD12 . ILE A 1 89  ? -5.834  -0.817  1.194   1.00 0.00 ? 89  ILE A HD12 4  
ATOM 6638  H HD13 . ILE A 1 89  ? -4.645  -0.499  -0.092  1.00 0.00 ? 89  ILE A HD13 4  
ATOM 6639  N N    . GLU A 1 90  ? -1.231  -1.525  -2.580  1.00 0.00 ? 90  GLU A N    4  
ATOM 6640  C CA   . GLU A 1 90  ? -0.007  -1.663  -3.351  1.00 0.00 ? 90  GLU A CA   4  
ATOM 6641  C C    . GLU A 1 90  ? 1.091   -0.770  -2.769  1.00 0.00 ? 90  GLU A C    4  
ATOM 6642  O O    . GLU A 1 90  ? 0.935   0.448   -2.702  1.00 0.00 ? 90  GLU A O    4  
ATOM 6643  C CB   . GLU A 1 90  ? -0.250  -1.341  -4.827  1.00 0.00 ? 90  GLU A CB   4  
ATOM 6644  C CG   . GLU A 1 90  ? -1.562  -1.957  -5.314  1.00 0.00 ? 90  GLU A CG   4  
ATOM 6645  C CD   . GLU A 1 90  ? -2.568  -0.871  -5.701  1.00 0.00 ? 90  GLU A CD   4  
ATOM 6646  O OE1  . GLU A 1 90  ? -2.104  0.191   -6.169  1.00 0.00 ? 90  GLU A OE1  4  
ATOM 6647  O OE2  . GLU A 1 90  ? -3.778  -1.127  -5.521  1.00 0.00 ? 90  GLU A OE2  4  
ATOM 6648  H H    . GLU A 1 90  ? -1.744  -0.684  -2.749  1.00 0.00 ? 90  GLU A H    4  
ATOM 6649  H HA   . GLU A 1 90  ? 0.279   -2.710  -3.257  1.00 0.00 ? 90  GLU A HA   4  
ATOM 6650  H HB2  . GLU A 1 90  ? -0.277  -0.260  -4.968  1.00 0.00 ? 90  GLU A HB2  4  
ATOM 6651  H HB3  . GLU A 1 90  ? 0.579   -1.719  -5.427  1.00 0.00 ? 90  GLU A HB3  4  
ATOM 6652  H HG2  . GLU A 1 90  ? -1.370  -2.601  -6.172  1.00 0.00 ? 90  GLU A HG2  4  
ATOM 6653  H HG3  . GLU A 1 90  ? -1.985  -2.587  -4.532  1.00 0.00 ? 90  GLU A HG3  4  
ATOM 6654  N N    . VAL A 1 91  ? 2.176   -1.411  -2.362  1.00 0.00 ? 91  VAL A N    4  
ATOM 6655  C CA   . VAL A 1 91  ? 3.300   -0.691  -1.787  1.00 0.00 ? 91  VAL A CA   4  
ATOM 6656  C C    . VAL A 1 91  ? 4.508   -0.813  -2.717  1.00 0.00 ? 91  VAL A C    4  
ATOM 6657  O O    . VAL A 1 91  ? 5.000   -1.913  -2.962  1.00 0.00 ? 91  VAL A O    4  
ATOM 6658  C CB   . VAL A 1 91  ? 3.580   -1.202  -0.372  1.00 0.00 ? 91  VAL A CB   4  
ATOM 6659  C CG1  . VAL A 1 91  ? 4.839   -0.552  0.206   1.00 0.00 ? 91  VAL A CG1  4  
ATOM 6660  C CG2  . VAL A 1 91  ? 2.376   -0.974  0.543   1.00 0.00 ? 91  VAL A CG2  4  
ATOM 6661  H H    . VAL A 1 91  ? 2.295   -2.403  -2.420  1.00 0.00 ? 91  VAL A H    4  
ATOM 6662  H HA   . VAL A 1 91  ? 3.015   0.359   -1.716  1.00 0.00 ? 91  VAL A HA   4  
ATOM 6663  H HB   . VAL A 1 91  ? 3.756   -2.276  -0.433  1.00 0.00 ? 91  VAL A HB   4  
ATOM 6664  H HG11 . VAL A 1 91  ? 5.425   -0.114  -0.602  1.00 0.00 ? 91  VAL A HG11 4  
ATOM 6665  H HG12 . VAL A 1 91  ? 4.553   0.228   0.912   1.00 0.00 ? 91  VAL A HG12 4  
ATOM 6666  H HG13 . VAL A 1 91  ? 5.435   -1.307  0.719   1.00 0.00 ? 91  VAL A HG13 4  
ATOM 6667  H HG21 . VAL A 1 91  ? 2.550   -1.462  1.501   1.00 0.00 ? 91  VAL A HG21 4  
ATOM 6668  H HG22 . VAL A 1 91  ? 2.236   0.096   0.700   1.00 0.00 ? 91  VAL A HG22 4  
ATOM 6669  H HG23 . VAL A 1 91  ? 1.482   -1.392  0.078   1.00 0.00 ? 91  VAL A HG23 4  
ATOM 6670  N N    . ALA A 1 92  ? 4.952   0.334   -3.211  1.00 0.00 ? 92  ALA A N    4  
ATOM 6671  C CA   . ALA A 1 92  ? 6.093   0.370   -4.109  1.00 0.00 ? 92  ALA A CA   4  
ATOM 6672  C C    . ALA A 1 92  ? 7.203   1.217   -3.484  1.00 0.00 ? 92  ALA A C    4  
ATOM 6673  O O    . ALA A 1 92  ? 6.941   2.041   -2.608  1.00 0.00 ? 92  ALA A O    4  
ATOM 6674  C CB   . ALA A 1 92  ? 5.653   0.902   -5.474  1.00 0.00 ? 92  ALA A CB   4  
ATOM 6675  H H    . ALA A 1 92  ? 4.546   1.225   -3.007  1.00 0.00 ? 92  ALA A H    4  
ATOM 6676  H HA   . ALA A 1 92  ? 6.453   -0.652  -4.231  1.00 0.00 ? 92  ALA A HA   4  
ATOM 6677  H HB1  . ALA A 1 92  ? 6.347   1.675   -5.805  1.00 0.00 ? 92  ALA A HB1  4  
ATOM 6678  H HB2  . ALA A 1 92  ? 5.646   0.087   -6.198  1.00 0.00 ? 92  ALA A HB2  4  
ATOM 6679  H HB3  . ALA A 1 92  ? 4.651   1.324   -5.394  1.00 0.00 ? 92  ALA A HB3  4  
ATOM 6680  N N    . ALA A 1 93  ? 8.419   0.986   -3.957  1.00 0.00 ? 93  ALA A N    4  
ATOM 6681  C CA   . ALA A 1 93  ? 9.569   1.718   -3.455  1.00 0.00 ? 93  ALA A CA   4  
ATOM 6682  C C    . ALA A 1 93  ? 9.907   2.854   -4.423  1.00 0.00 ? 93  ALA A C    4  
ATOM 6683  O O    . ALA A 1 93  ? 9.390   2.899   -5.538  1.00 0.00 ? 93  ALA A O    4  
ATOM 6684  C CB   . ALA A 1 93  ? 10.740  0.755   -3.255  1.00 0.00 ? 93  ALA A CB   4  
ATOM 6685  H H    . ALA A 1 93  ? 8.623   0.315   -4.669  1.00 0.00 ? 93  ALA A H    4  
ATOM 6686  H HA   . ALA A 1 93  ? 9.296   2.144   -2.489  1.00 0.00 ? 93  ALA A HA   4  
ATOM 6687  H HB1  . ALA A 1 93  ? 10.932  0.218   -4.184  1.00 0.00 ? 93  ALA A HB1  4  
ATOM 6688  H HB2  . ALA A 1 93  ? 11.629  1.317   -2.971  1.00 0.00 ? 93  ALA A HB2  4  
ATOM 6689  H HB3  . ALA A 1 93  ? 10.494  0.042   -2.468  1.00 0.00 ? 93  ALA A HB3  4  
ATOM 6690  N N    . MET A 1 94  ? 10.773  3.744   -3.960  1.00 0.00 ? 94  MET A N    4  
ATOM 6691  C CA   . MET A 1 94  ? 11.186  4.877   -4.771  1.00 0.00 ? 94  MET A CA   4  
ATOM 6692  C C    . MET A 1 94  ? 12.686  5.140   -4.622  1.00 0.00 ? 94  MET A C    4  
ATOM 6693  O O    . MET A 1 94  ? 13.210  5.154   -3.509  1.00 0.00 ? 94  MET A O    4  
ATOM 6694  C CB   . MET A 1 94  ? 10.405  6.122   -4.345  1.00 0.00 ? 94  MET A CB   4  
ATOM 6695  C CG   . MET A 1 94  ? 8.943   6.029   -4.785  1.00 0.00 ? 94  MET A CG   4  
ATOM 6696  S SD   . MET A 1 94  ? 8.160   7.627   -4.645  1.00 0.00 ? 94  MET A SD   4  
ATOM 6697  C CE   . MET A 1 94  ? 7.945   7.713   -2.875  1.00 0.00 ? 94  MET A CE   4  
ATOM 6698  H H    . MET A 1 94  ? 11.189  3.701   -3.052  1.00 0.00 ? 94  MET A H    4  
ATOM 6699  H HA   . MET A 1 94  ? 10.959  4.599   -5.800  1.00 0.00 ? 94  MET A HA   4  
ATOM 6700  H HB2  . MET A 1 94  ? 10.456  6.235   -3.262  1.00 0.00 ? 94  MET A HB2  4  
ATOM 6701  H HB3  . MET A 1 94  ? 10.864  7.010   -4.780  1.00 0.00 ? 94  MET A HB3  4  
ATOM 6702  H HG2  . MET A 1 94  ? 8.886   5.676   -5.815  1.00 0.00 ? 94  MET A HG2  4  
ATOM 6703  H HG3  . MET A 1 94  ? 8.415   5.301   -4.169  1.00 0.00 ? 94  MET A HG3  4  
ATOM 6704  H HE1  . MET A 1 94  ? 8.885   7.467   -2.382  1.00 0.00 ? 94  MET A HE1  4  
ATOM 6705  H HE2  . MET A 1 94  ? 7.640   8.721   -2.595  1.00 0.00 ? 94  MET A HE2  4  
ATOM 6706  H HE3  . MET A 1 94  ? 7.177   7.003   -2.568  1.00 0.00 ? 94  MET A HE3  4  
ATOM 6707  N N    . THR A 1 95  ? 13.335  5.340   -5.760  1.00 0.00 ? 95  THR A N    4  
ATOM 6708  C CA   . THR A 1 95  ? 14.765  5.601   -5.770  1.00 0.00 ? 95  THR A CA   4  
ATOM 6709  C C    . THR A 1 95  ? 15.053  6.966   -6.398  1.00 0.00 ? 95  THR A C    4  
ATOM 6710  O O    . THR A 1 95  ? 14.143  7.774   -6.582  1.00 0.00 ? 95  THR A O    4  
ATOM 6711  C CB   . THR A 1 95  ? 15.452  4.442   -6.494  1.00 0.00 ? 95  THR A CB   4  
ATOM 6712  O OG1  . THR A 1 95  ? 14.504  4.037   -7.478  1.00 0.00 ? 95  THR A OG1  4  
ATOM 6713  C CG2  . THR A 1 95  ? 15.614  3.209   -5.602  1.00 0.00 ? 95  THR A CG2  4  
ATOM 6714  H H    . THR A 1 95  ? 12.902  5.327   -6.661  1.00 0.00 ? 95  THR A H    4  
ATOM 6715  H HA   . THR A 1 95  ? 15.113  5.644   -4.738  1.00 0.00 ? 95  THR A HA   4  
ATOM 6716  H HB   . THR A 1 95  ? 16.412  4.754   -6.905  1.00 0.00 ? 95  THR A HB   4  
ATOM 6717  H HG1  . THR A 1 95  ? 14.926  4.051   -8.385  1.00 0.00 ? 95  THR A HG1  4  
ATOM 6718  H HG21 . THR A 1 95  ? 15.576  2.309   -6.217  1.00 0.00 ? 95  THR A HG21 4  
ATOM 6719  H HG22 . THR A 1 95  ? 16.573  3.257   -5.086  1.00 0.00 ? 95  THR A HG22 4  
ATOM 6720  H HG23 . THR A 1 95  ? 14.808  3.182   -4.869  1.00 0.00 ? 95  THR A HG23 4  
ATOM 6721  N N    . SER A 1 96  ? 16.322  7.182   -6.710  1.00 0.00 ? 96  SER A N    4  
ATOM 6722  C CA   . SER A 1 96  ? 16.742  8.435   -7.314  1.00 0.00 ? 96  SER A CA   4  
ATOM 6723  C C    . SER A 1 96  ? 16.483  8.402   -8.822  1.00 0.00 ? 96  SER A C    4  
ATOM 6724  O O    . SER A 1 96  ? 16.870  9.321   -9.542  1.00 0.00 ? 96  SER A O    4  
ATOM 6725  C CB   . SER A 1 96  ? 18.220  8.713   -7.035  1.00 0.00 ? 96  SER A CB   4  
ATOM 6726  O OG   . SER A 1 96  ? 18.669  9.906   -7.673  1.00 0.00 ? 96  SER A OG   4  
ATOM 6727  H H    . SER A 1 96  ? 17.056  6.520   -6.557  1.00 0.00 ? 96  SER A H    4  
ATOM 6728  H HA   . SER A 1 96  ? 16.132  9.203   -6.838  1.00 0.00 ? 96  SER A HA   4  
ATOM 6729  H HB2  . SER A 1 96  ? 18.377  8.796   -5.960  1.00 0.00 ? 96  SER A HB2  4  
ATOM 6730  H HB3  . SER A 1 96  ? 18.819  7.870   -7.380  1.00 0.00 ? 96  SER A HB3  4  
ATOM 6731  H HG   . SER A 1 96  ? 18.387  9.907   -8.633  1.00 0.00 ? 96  SER A HG   4  
ATOM 6732  N N    . LYS A 1 97  ? 15.831  7.333   -9.255  1.00 0.00 ? 97  LYS A N    4  
ATOM 6733  C CA   . LYS A 1 97  ? 15.516  7.168   -10.663 1.00 0.00 ? 97  LYS A CA   4  
ATOM 6734  C C    . LYS A 1 97  ? 13.998  7.201   -10.850 1.00 0.00 ? 97  LYS A C    4  
ATOM 6735  O O    . LYS A 1 97  ? 13.500  7.774   -11.817 1.00 0.00 ? 97  LYS A O    4  
ATOM 6736  C CB   . LYS A 1 97  ? 16.176  5.903   -11.216 1.00 0.00 ? 97  LYS A CB   4  
ATOM 6737  C CG   . LYS A 1 97  ? 15.127  4.924   -11.745 1.00 0.00 ? 97  LYS A CG   4  
ATOM 6738  C CD   . LYS A 1 97  ? 14.636  5.343   -13.132 1.00 0.00 ? 97  LYS A CD   4  
ATOM 6739  C CE   . LYS A 1 97  ? 13.132  5.102   -13.278 1.00 0.00 ? 97  LYS A CE   4  
ATOM 6740  N NZ   . LYS A 1 97  ? 12.651  5.604   -14.585 1.00 0.00 ? 97  LYS A NZ   4  
ATOM 6741  H H    . LYS A 1 97  ? 15.520  6.590   -8.662  1.00 0.00 ? 97  LYS A H    4  
ATOM 6742  H HA   . LYS A 1 97  ? 15.948  8.016   -11.196 1.00 0.00 ? 97  LYS A HA   4  
ATOM 6743  H HB2  . LYS A 1 97  ? 16.868  6.168   -12.015 1.00 0.00 ? 97  LYS A HB2  4  
ATOM 6744  H HB3  . LYS A 1 97  ? 16.764  5.424   -10.432 1.00 0.00 ? 97  LYS A HB3  4  
ATOM 6745  H HG2  . LYS A 1 97  ? 15.552  3.921   -11.794 1.00 0.00 ? 97  LYS A HG2  4  
ATOM 6746  H HG3  . LYS A 1 97  ? 14.284  4.879   -11.055 1.00 0.00 ? 97  LYS A HG3  4  
ATOM 6747  H HD2  . LYS A 1 97  ? 14.856  6.398   -13.296 1.00 0.00 ? 97  LYS A HD2  4  
ATOM 6748  H HD3  . LYS A 1 97  ? 15.174  4.783   -13.897 1.00 0.00 ? 97  LYS A HD3  4  
ATOM 6749  H HE2  . LYS A 1 97  ? 12.919  4.037   -13.189 1.00 0.00 ? 97  LYS A HE2  4  
ATOM 6750  H HE3  . LYS A 1 97  ? 12.598  5.603   -12.470 1.00 0.00 ? 97  LYS A HE3  4  
ATOM 6751  H HZ1  . LYS A 1 97  ? 11.774  5.176   -14.803 1.00 0.00 ? 97  LYS A HZ1  4  
ATOM 6752  H HZ2  . LYS A 1 97  ? 12.536  6.596   -14.539 1.00 0.00 ? 97  LYS A HZ2  4  
ATOM 6753  H HZ3  . LYS A 1 97  ? 13.318  5.377   -15.294 1.00 0.00 ? 97  LYS A HZ3  4  
ATOM 6754  N N    . GLY A 1 98  ? 13.305  6.579   -9.907  1.00 0.00 ? 98  GLY A N    4  
ATOM 6755  C CA   . GLY A 1 98  ? 11.853  6.530   -9.955  1.00 0.00 ? 98  GLY A CA   4  
ATOM 6756  C C    . GLY A 1 98  ? 11.312  5.429   -9.041  1.00 0.00 ? 98  GLY A C    4  
ATOM 6757  O O    . GLY A 1 98  ? 11.933  5.091   -8.035  1.00 0.00 ? 98  GLY A O    4  
ATOM 6758  H H    . GLY A 1 98  ? 13.718  6.115   -9.123  1.00 0.00 ? 98  GLY A H    4  
ATOM 6759  H HA2  . GLY A 1 98  ? 11.443  7.493   -9.653  1.00 0.00 ? 98  GLY A HA2  4  
ATOM 6760  H HA3  . GLY A 1 98  ? 11.526  6.351   -10.979 1.00 0.00 ? 98  GLY A HA3  4  
ATOM 6761  N N    . GLN A 1 99  ? 10.159  4.900   -9.424  1.00 0.00 ? 99  GLN A N    4  
ATOM 6762  C CA   . GLN A 1 99  ? 9.526   3.845   -8.651  1.00 0.00 ? 99  GLN A CA   4  
ATOM 6763  C C    . GLN A 1 99  ? 9.773   2.485   -9.308  1.00 0.00 ? 99  GLN A C    4  
ATOM 6764  O O    . GLN A 1 99  ? 9.813   2.382   -10.533 1.00 0.00 ? 99  GLN A O    4  
ATOM 6765  C CB   . GLN A 1 99  ? 8.029   4.110   -8.484  1.00 0.00 ? 99  GLN A CB   4  
ATOM 6766  C CG   . GLN A 1 99  ? 7.379   3.047   -7.596  1.00 0.00 ? 99  GLN A CG   4  
ATOM 6767  C CD   . GLN A 1 99  ? 5.892   2.895   -7.920  1.00 0.00 ? 99  GLN A CD   4  
ATOM 6768  O OE1  . GLN A 1 99  ? 5.059   3.692   -7.522  1.00 0.00 ? 99  GLN A OE1  4  
ATOM 6769  N NE2  . GLN A 1 99  ? 5.606   1.829   -8.663  1.00 0.00 ? 99  GLN A NE2  4  
ATOM 6770  H H    . GLN A 1 99  ? 9.660   5.181   -10.243 1.00 0.00 ? 99  GLN A H    4  
ATOM 6771  H HA   . GLN A 1 99  ? 10.005  3.876   -7.672  1.00 0.00 ? 99  GLN A HA   4  
ATOM 6772  H HB2  . GLN A 1 99  ? 7.876   5.096   -8.047  1.00 0.00 ? 99  GLN A HB2  4  
ATOM 6773  H HB3  . GLN A 1 99  ? 7.546   4.116   -9.462  1.00 0.00 ? 99  GLN A HB3  4  
ATOM 6774  H HG2  . GLN A 1 99  ? 7.885   2.091   -7.736  1.00 0.00 ? 99  GLN A HG2  4  
ATOM 6775  H HG3  . GLN A 1 99  ? 7.501   3.320   -6.548  1.00 0.00 ? 99  GLN A HG3  4  
ATOM 6776  H HE21 . GLN A 1 99  ? 6.337   1.214   -8.956  1.00 0.00 ? 99  GLN A HE21 4  
ATOM 6777  H HE22 . GLN A 1 99  ? 4.660   1.643   -8.927  1.00 0.00 ? 99  GLN A HE22 4  
ATOM 6778  N N    . GLY A 1 100 ? 9.932   1.476   -8.464  1.00 0.00 ? 100 GLY A N    4  
ATOM 6779  C CA   . GLY A 1 100 ? 10.174  0.128   -8.947  1.00 0.00 ? 100 GLY A CA   4  
ATOM 6780  C C    . GLY A 1 100 ? 8.923   -0.741  -8.797  1.00 0.00 ? 100 GLY A C    4  
ATOM 6781  O O    . GLY A 1 100 ? 7.802   -0.240  -8.873  1.00 0.00 ? 100 GLY A O    4  
ATOM 6782  H H    . GLY A 1 100 ? 9.898   1.569   -7.469  1.00 0.00 ? 100 GLY A H    4  
ATOM 6783  H HA2  . GLY A 1 100 ? 10.474  0.161   -9.994  1.00 0.00 ? 100 GLY A HA2  4  
ATOM 6784  H HA3  . GLY A 1 100 ? 10.999  -0.319  -8.392  1.00 0.00 ? 100 GLY A HA3  4  
ATOM 6785  N N    . GLN A 1 101 ? 9.157   -2.028  -8.586  1.00 0.00 ? 101 GLN A N    4  
ATOM 6786  C CA   . GLN A 1 101 ? 8.064   -2.971  -8.425  1.00 0.00 ? 101 GLN A CA   4  
ATOM 6787  C C    . GLN A 1 101 ? 7.071   -2.458  -7.380  1.00 0.00 ? 101 GLN A C    4  
ATOM 6788  O O    . GLN A 1 101 ? 7.278   -1.400  -6.788  1.00 0.00 ? 101 GLN A O    4  
ATOM 6789  C CB   . GLN A 1 101 ? 8.587   -4.359  -8.049  1.00 0.00 ? 101 GLN A CB   4  
ATOM 6790  C CG   . GLN A 1 101 ? 7.941   -5.441  -8.915  1.00 0.00 ? 101 GLN A CG   4  
ATOM 6791  C CD   . GLN A 1 101 ? 9.004   -6.281  -9.628  1.00 0.00 ? 101 GLN A CD   4  
ATOM 6792  O OE1  . GLN A 1 101 ? 9.549   -7.228  -9.086  1.00 0.00 ? 101 GLN A OE1  4  
ATOM 6793  N NE2  . GLN A 1 101 ? 9.266   -5.881  -10.869 1.00 0.00 ? 101 GLN A NE2  4  
ATOM 6794  H H    . GLN A 1 101 ? 10.072  -2.427  -8.525  1.00 0.00 ? 101 GLN A H    4  
ATOM 6795  H HA   . GLN A 1 101 ? 7.580   -3.024  -9.400  1.00 0.00 ? 101 GLN A HA   4  
ATOM 6796  H HB2  . GLN A 1 101 ? 9.670   -4.388  -8.171  1.00 0.00 ? 101 GLN A HB2  4  
ATOM 6797  H HB3  . GLN A 1 101 ? 8.380   -4.557  -6.997  1.00 0.00 ? 101 GLN A HB3  4  
ATOM 6798  H HG2  . GLN A 1 101 ? 7.319   -6.086  -8.294  1.00 0.00 ? 101 GLN A HG2  4  
ATOM 6799  H HG3  . GLN A 1 101 ? 7.284   -4.979  -9.652  1.00 0.00 ? 101 GLN A HG3  4  
ATOM 6800  H HE21 . GLN A 1 101 ? 8.782   -5.095  -11.254 1.00 0.00 ? 101 GLN A HE21 4  
ATOM 6801  H HE22 . GLN A 1 101 ? 9.947   -6.366  -11.417 1.00 0.00 ? 101 GLN A HE22 4  
ATOM 6802  N N    . VAL A 1 102 ? 6.013   -3.233  -7.185  1.00 0.00 ? 102 VAL A N    4  
ATOM 6803  C CA   . VAL A 1 102 ? 4.987   -2.870  -6.222  1.00 0.00 ? 102 VAL A CA   4  
ATOM 6804  C C    . VAL A 1 102 ? 4.407   -4.141  -5.598  1.00 0.00 ? 102 VAL A C    4  
ATOM 6805  O O    . VAL A 1 102 ? 4.249   -5.154  -6.278  1.00 0.00 ? 102 VAL A O    4  
ATOM 6806  C CB   . VAL A 1 102 ? 3.926   -1.995  -6.892  1.00 0.00 ? 102 VAL A CB   4  
ATOM 6807  C CG1  . VAL A 1 102 ? 2.742   -2.838  -7.370  1.00 0.00 ? 102 VAL A CG1  4  
ATOM 6808  C CG2  . VAL A 1 102 ? 3.462   -0.880  -5.953  1.00 0.00 ? 102 VAL A CG2  4  
ATOM 6809  H H    . VAL A 1 102 ? 5.852   -4.092  -7.670  1.00 0.00 ? 102 VAL A H    4  
ATOM 6810  H HA   . VAL A 1 102 ? 5.465   -2.281  -5.439  1.00 0.00 ? 102 VAL A HA   4  
ATOM 6811  H HB   . VAL A 1 102 ? 4.380   -1.529  -7.767  1.00 0.00 ? 102 VAL A HB   4  
ATOM 6812  H HG11 . VAL A 1 102 ? 2.312   -2.387  -8.264  1.00 0.00 ? 102 VAL A HG11 4  
ATOM 6813  H HG12 . VAL A 1 102 ? 3.084   -3.847  -7.601  1.00 0.00 ? 102 VAL A HG12 4  
ATOM 6814  H HG13 . VAL A 1 102 ? 1.987   -2.881  -6.585  1.00 0.00 ? 102 VAL A HG13 4  
ATOM 6815  H HG21 . VAL A 1 102 ? 3.524   0.078   -6.468  1.00 0.00 ? 102 VAL A HG21 4  
ATOM 6816  H HG22 . VAL A 1 102 ? 2.430   -1.065  -5.652  1.00 0.00 ? 102 VAL A HG22 4  
ATOM 6817  H HG23 . VAL A 1 102 ? 4.100   -0.860  -5.070  1.00 0.00 ? 102 VAL A HG23 4  
ATOM 6818  N N    . SER A 1 103 ? 4.106   -4.046  -4.311  1.00 0.00 ? 103 SER A N    4  
ATOM 6819  C CA   . SER A 1 103 ? 3.547   -5.176  -3.588  1.00 0.00 ? 103 SER A CA   4  
ATOM 6820  C C    . SER A 1 103 ? 2.065   -4.929  -3.298  1.00 0.00 ? 103 SER A C    4  
ATOM 6821  O O    . SER A 1 103 ? 1.724   -4.179  -2.384  1.00 0.00 ? 103 SER A O    4  
ATOM 6822  C CB   . SER A 1 103 ? 4.309   -5.427  -2.285  1.00 0.00 ? 103 SER A CB   4  
ATOM 6823  O OG   . SER A 1 103 ? 5.469   -6.228  -2.491  1.00 0.00 ? 103 SER A OG   4  
ATOM 6824  H H    . SER A 1 103 ? 4.238   -3.218  -3.766  1.00 0.00 ? 103 SER A H    4  
ATOM 6825  H HA   . SER A 1 103 ? 3.670   -6.032  -4.251  1.00 0.00 ? 103 SER A HA   4  
ATOM 6826  H HB2  . SER A 1 103 ? 4.600   -4.473  -1.846  1.00 0.00 ? 103 SER A HB2  4  
ATOM 6827  H HB3  . SER A 1 103 ? 3.650   -5.920  -1.570  1.00 0.00 ? 103 SER A HB3  4  
ATOM 6828  H HG   . SER A 1 103 ? 5.386   -7.087  -1.986  1.00 0.00 ? 103 SER A HG   4  
ATOM 6829  N N    . ALA A 1 104 ? 1.224   -5.575  -4.092  1.00 0.00 ? 104 ALA A N    4  
ATOM 6830  C CA   . ALA A 1 104 ? -0.213  -5.436  -3.932  1.00 0.00 ? 104 ALA A CA   4  
ATOM 6831  C C    . ALA A 1 104 ? -0.767  -6.678  -3.232  1.00 0.00 ? 104 ALA A C    4  
ATOM 6832  O O    . ALA A 1 104 ? -0.655  -7.789  -3.749  1.00 0.00 ? 104 ALA A O    4  
ATOM 6833  C CB   . ALA A 1 104 ? -0.859  -5.200  -5.298  1.00 0.00 ? 104 ALA A CB   4  
ATOM 6834  H H    . ALA A 1 104 ? 1.509   -6.183  -4.833  1.00 0.00 ? 104 ALA A H    4  
ATOM 6835  H HA   . ALA A 1 104 ? -0.394  -4.564  -3.303  1.00 0.00 ? 104 ALA A HA   4  
ATOM 6836  H HB1  . ALA A 1 104 ? -1.358  -6.112  -5.627  1.00 0.00 ? 104 ALA A HB1  4  
ATOM 6837  H HB2  . ALA A 1 104 ? -1.590  -4.394  -5.221  1.00 0.00 ? 104 ALA A HB2  4  
ATOM 6838  H HB3  . ALA A 1 104 ? -0.091  -4.926  -6.021  1.00 0.00 ? 104 ALA A HB3  4  
ATOM 6839  N N    . SER A 1 105 ? -1.353  -6.450  -2.065  1.00 0.00 ? 105 SER A N    4  
ATOM 6840  C CA   . SER A 1 105 ? -1.924  -7.537  -1.289  1.00 0.00 ? 105 SER A CA   4  
ATOM 6841  C C    . SER A 1 105 ? -3.407  -7.268  -1.024  1.00 0.00 ? 105 SER A C    4  
ATOM 6842  O O    . SER A 1 105 ? -3.779  -6.168  -0.619  1.00 0.00 ? 105 SER A O    4  
ATOM 6843  C CB   . SER A 1 105 ? -1.174  -7.724  0.031   1.00 0.00 ? 105 SER A CB   4  
ATOM 6844  O OG   . SER A 1 105 ? -0.405  -8.924  0.043   1.00 0.00 ? 105 SER A OG   4  
ATOM 6845  H H    . SER A 1 105 ? -1.440  -5.544  -1.651  1.00 0.00 ? 105 SER A H    4  
ATOM 6846  H HA   . SER A 1 105 ? -1.801  -8.427  -1.905  1.00 0.00 ? 105 SER A HA   4  
ATOM 6847  H HB2  . SER A 1 105 ? -0.517  -6.871  0.199   1.00 0.00 ? 105 SER A HB2  4  
ATOM 6848  H HB3  . SER A 1 105 ? -1.889  -7.744  0.854   1.00 0.00 ? 105 SER A HB3  4  
ATOM 6849  H HG   . SER A 1 105 ? -0.792  -9.584  -0.601  1.00 0.00 ? 105 SER A HG   4  
ATOM 6850  N N    . THR A 1 106 ? -4.213  -8.292  -1.263  1.00 0.00 ? 106 THR A N    4  
ATOM 6851  C CA   . THR A 1 106 ? -5.647  -8.180  -1.055  1.00 0.00 ? 106 THR A CA   4  
ATOM 6852  C C    . THR A 1 106 ? -5.978  -8.262  0.437   1.00 0.00 ? 106 THR A C    4  
ATOM 6853  O O    . THR A 1 106 ? -5.409  -9.080  1.158   1.00 0.00 ? 106 THR A O    4  
ATOM 6854  C CB   . THR A 1 106 ? -6.332  -9.263  -1.890  1.00 0.00 ? 106 THR A CB   4  
ATOM 6855  O OG1  . THR A 1 106 ? -5.520  -9.368  -3.056  1.00 0.00 ? 106 THR A OG1  4  
ATOM 6856  C CG2  . THR A 1 106 ? -7.695  -8.817  -2.423  1.00 0.00 ? 106 THR A CG2  4  
ATOM 6857  H H    . THR A 1 106 ? -3.902  -9.183  -1.592  1.00 0.00 ? 106 THR A H    4  
ATOM 6858  H HA   . THR A 1 106 ? -5.968  -7.197  -1.400  1.00 0.00 ? 106 THR A HA   4  
ATOM 6859  H HB   . THR A 1 106 ? -6.419  -10.192 -1.326  1.00 0.00 ? 106 THR A HB   4  
ATOM 6860  H HG1  . THR A 1 106 ? -5.639  -8.557  -3.630  1.00 0.00 ? 106 THR A HG1  4  
ATOM 6861  H HG21 . THR A 1 106 ? -8.477  -9.142  -1.737  1.00 0.00 ? 106 THR A HG21 4  
ATOM 6862  H HG22 . THR A 1 106 ? -7.714  -7.731  -2.508  1.00 0.00 ? 106 THR A HG22 4  
ATOM 6863  H HG23 . THR A 1 106 ? -7.865  -9.262  -3.404  1.00 0.00 ? 106 THR A HG23 4  
ATOM 6864  N N    . ILE A 1 107 ? -6.895  -7.403  0.855   1.00 0.00 ? 107 ILE A N    4  
ATOM 6865  C CA   . ILE A 1 107 ? -7.308  -7.368  2.248   1.00 0.00 ? 107 ILE A CA   4  
ATOM 6866  C C    . ILE A 1 107 ? -8.771  -6.927  2.330   1.00 0.00 ? 107 ILE A C    4  
ATOM 6867  O O    . ILE A 1 107 ? -9.166  -5.952  1.693   1.00 0.00 ? 107 ILE A O    4  
ATOM 6868  C CB   . ILE A 1 107 ? -6.356  -6.495  3.067   1.00 0.00 ? 107 ILE A CB   4  
ATOM 6869  C CG1  . ILE A 1 107 ? -6.871  -6.314  4.497   1.00 0.00 ? 107 ILE A CG1  4  
ATOM 6870  C CG2  . ILE A 1 107 ? -6.107  -5.154  2.374   1.00 0.00 ? 107 ILE A CG2  4  
ATOM 6871  C CD1  . ILE A 1 107 ? -6.699  -7.600  5.308   1.00 0.00 ? 107 ILE A CD1  4  
ATOM 6872  H H    . ILE A 1 107 ? -7.353  -6.740  0.262   1.00 0.00 ? 107 ILE A H    4  
ATOM 6873  H HA   . ILE A 1 107 ? -7.231  -8.383  2.637   1.00 0.00 ? 107 ILE A HA   4  
ATOM 6874  H HB   . ILE A 1 107 ? -5.395  -7.006  3.133   1.00 0.00 ? 107 ILE A HB   4  
ATOM 6875  H HG12 . ILE A 1 107 ? -6.332  -5.500  4.981   1.00 0.00 ? 107 ILE A HG12 4  
ATOM 6876  H HG13 . ILE A 1 107 ? -7.923  -6.032  4.475   1.00 0.00 ? 107 ILE A HG13 4  
ATOM 6877  H HG21 . ILE A 1 107 ? -5.221  -5.230  1.743   1.00 0.00 ? 107 ILE A HG21 4  
ATOM 6878  H HG22 . ILE A 1 107 ? -6.969  -4.897  1.759   1.00 0.00 ? 107 ILE A HG22 4  
ATOM 6879  H HG23 . ILE A 1 107 ? -5.953  -4.380  3.125   1.00 0.00 ? 107 ILE A HG23 4  
ATOM 6880  H HD11 . ILE A 1 107 ? -7.636  -8.157  5.309   1.00 0.00 ? 107 ILE A HD11 4  
ATOM 6881  H HD12 . ILE A 1 107 ? -5.914  -8.210  4.861   1.00 0.00 ? 107 ILE A HD12 4  
ATOM 6882  H HD13 . ILE A 1 107 ? -6.425  -7.349  6.333   1.00 0.00 ? 107 ILE A HD13 4  
ATOM 6883  N N    . SER A 1 108 ? -9.535  -7.667  3.121   1.00 0.00 ? 108 SER A N    4  
ATOM 6884  C CA   . SER A 1 108 ? -10.945 -7.364  3.295   1.00 0.00 ? 108 SER A CA   4  
ATOM 6885  C C    . SER A 1 108 ? -11.169 -6.664  4.637   1.00 0.00 ? 108 SER A C    4  
ATOM 6886  O O    . SER A 1 108 ? -10.845 -7.213  5.689   1.00 0.00 ? 108 SER A O    4  
ATOM 6887  C CB   . SER A 1 108 ? -11.795 -8.634  3.211   1.00 0.00 ? 108 SER A CB   4  
ATOM 6888  O OG   . SER A 1 108 ? -13.057 -8.475  3.854   1.00 0.00 ? 108 SER A OG   4  
ATOM 6889  H H    . SER A 1 108 ? -9.206  -8.458  3.636   1.00 0.00 ? 108 SER A H    4  
ATOM 6890  H HA   . SER A 1 108 ? -11.202 -6.700  2.470   1.00 0.00 ? 108 SER A HA   4  
ATOM 6891  H HB2  . SER A 1 108 ? -11.952 -8.897  2.165   1.00 0.00 ? 108 SER A HB2  4  
ATOM 6892  H HB3  . SER A 1 108 ? -11.256 -9.462  3.671   1.00 0.00 ? 108 SER A HB3  4  
ATOM 6893  H HG   . SER A 1 108 ? -13.749 -8.201  3.185   1.00 0.00 ? 108 SER A HG   4  
ATOM 6894  N N    . SER A 1 109 ? -11.720 -5.462  4.556   1.00 0.00 ? 109 SER A N    4  
ATOM 6895  C CA   . SER A 1 109 ? -11.990 -4.681  5.752   1.00 0.00 ? 109 SER A CA   4  
ATOM 6896  C C    . SER A 1 109 ? -12.495 -5.594  6.870   1.00 0.00 ? 109 SER A C    4  
ATOM 6897  O O    . SER A 1 109 ? -13.183 -6.580  6.609   1.00 0.00 ? 109 SER A O    4  
ATOM 6898  C CB   . SER A 1 109 ? -13.009 -3.575  5.468   1.00 0.00 ? 109 SER A CB   4  
ATOM 6899  O OG   . SER A 1 109 ? -14.186 -4.081  4.844   1.00 0.00 ? 109 SER A OG   4  
ATOM 6900  H H    . SER A 1 109 ? -11.980 -5.022  3.697   1.00 0.00 ? 109 SER A H    4  
ATOM 6901  H HA   . SER A 1 109 ? -11.035 -4.233  6.026   1.00 0.00 ? 109 SER A HA   4  
ATOM 6902  H HB2  . SER A 1 109 ? -13.277 -3.081  6.402   1.00 0.00 ? 109 SER A HB2  4  
ATOM 6903  H HB3  . SER A 1 109 ? -12.555 -2.819  4.828   1.00 0.00 ? 109 SER A HB3  4  
ATOM 6904  H HG   . SER A 1 109 ? -14.864 -3.351  4.751   1.00 0.00 ? 109 SER A HG   4  
ATOM 6905  N N    . GLY A 1 110 ? -12.135 -5.233  8.093   1.00 0.00 ? 110 GLY A N    4  
ATOM 6906  C CA   . GLY A 1 110 ? -12.543 -6.008  9.253   1.00 0.00 ? 110 GLY A CA   4  
ATOM 6907  C C    . GLY A 1 110 ? -14.068 -6.092  9.347   1.00 0.00 ? 110 GLY A C    4  
ATOM 6908  O O    . GLY A 1 110 ? -14.680 -6.989  8.769   1.00 0.00 ? 110 GLY A O    4  
ATOM 6909  H H    . GLY A 1 110 ? -11.575 -4.430  8.297   1.00 0.00 ? 110 GLY A H    4  
ATOM 6910  H HA2  . GLY A 1 110 ? -12.123 -7.012  9.190   1.00 0.00 ? 110 GLY A HA2  4  
ATOM 6911  H HA3  . GLY A 1 110 ? -12.144 -5.551  10.158  1.00 0.00 ? 110 GLY A HA3  4  
ATOM 6912  N N    . VAL A 1 111 ? -14.637 -5.146  10.079  1.00 0.00 ? 111 VAL A N    4  
ATOM 6913  C CA   . VAL A 1 111 ? -16.078 -5.102  10.256  1.00 0.00 ? 111 VAL A CA   4  
ATOM 6914  C C    . VAL A 1 111 ? -16.449 -3.862  11.072  1.00 0.00 ? 111 VAL A C    4  
ATOM 6915  O O    . VAL A 1 111 ? -15.737 -3.491  12.004  1.00 0.00 ? 111 VAL A O    4  
ATOM 6916  C CB   . VAL A 1 111 ? -16.567 -6.404  10.892  1.00 0.00 ? 111 VAL A CB   4  
ATOM 6917  C CG1  . VAL A 1 111 ? -15.877 -6.652  12.235  1.00 0.00 ? 111 VAL A CG1  4  
ATOM 6918  C CG2  . VAL A 1 111 ? -18.089 -6.399  11.051  1.00 0.00 ? 111 VAL A CG2  4  
ATOM 6919  H H    . VAL A 1 111 ? -14.131 -4.420  10.546  1.00 0.00 ? 111 VAL A H    4  
ATOM 6920  H HA   . VAL A 1 111 ? -16.528 -5.019  9.267   1.00 0.00 ? 111 VAL A HA   4  
ATOM 6921  H HB   . VAL A 1 111 ? -16.303 -7.224  10.224  1.00 0.00 ? 111 VAL A HB   4  
ATOM 6922  H HG11 . VAL A 1 111 ? -14.797 -6.680  12.088  1.00 0.00 ? 111 VAL A HG11 4  
ATOM 6923  H HG12 . VAL A 1 111 ? -16.128 -5.848  12.927  1.00 0.00 ? 111 VAL A HG12 4  
ATOM 6924  H HG13 . VAL A 1 111 ? -16.213 -7.604  12.646  1.00 0.00 ? 111 VAL A HG13 4  
ATOM 6925  H HG21 . VAL A 1 111 ? -18.389 -7.223  11.699  1.00 0.00 ? 111 VAL A HG21 4  
ATOM 6926  H HG22 . VAL A 1 111 ? -18.405 -5.455  11.493  1.00 0.00 ? 111 VAL A HG22 4  
ATOM 6927  H HG23 . VAL A 1 111 ? -18.557 -6.517  10.073  1.00 0.00 ? 111 VAL A HG23 4  
ATOM 6928  N N    . PRO A 1 112 ? -17.594 -3.239  10.682  1.00 0.00 ? 112 PRO A N    4  
ATOM 6929  C CA   . PRO A 1 112 ? -18.068 -2.048  11.367  1.00 0.00 ? 112 PRO A CA   4  
ATOM 6930  C C    . PRO A 1 112 ? -18.683 -2.404  12.722  1.00 0.00 ? 112 PRO A C    4  
ATOM 6931  O O    . PRO A 1 112 ? -19.573 -3.249  12.802  1.00 0.00 ? 112 PRO A O    4  
ATOM 6932  C CB   . PRO A 1 112 ? -19.066 -1.415  10.410  1.00 0.00 ? 112 PRO A CB   4  
ATOM 6933  C CG   . PRO A 1 112 ? -19.459 -2.512  9.433   1.00 0.00 ? 112 PRO A CG   4  
ATOM 6934  C CD   . PRO A 1 112 ? -18.463 -3.649  9.583   1.00 0.00 ? 112 PRO A CD   4  
ATOM 6935  H HA   . PRO A 1 112 ? -17.305 -1.434  11.565  1.00 0.00 ? 112 PRO A HA   4  
ATOM 6936  H HB2  . PRO A 1 112 ? -19.937 -1.039  10.946  1.00 0.00 ? 112 PRO A HB2  4  
ATOM 6937  H HB3  . PRO A 1 112 ? -18.622 -0.568  9.888   1.00 0.00 ? 112 PRO A HB3  4  
ATOM 6938  H HG2  . PRO A 1 112 ? -20.471 -2.861  9.638   1.00 0.00 ? 112 PRO A HG2  4  
ATOM 6939  H HG3  . PRO A 1 112 ? -19.454 -2.132  8.411   1.00 0.00 ? 112 PRO A HG3  4  
ATOM 6940  H HD2  . PRO A 1 112 ? -18.966 -4.590  9.807   1.00 0.00 ? 112 PRO A HD2  4  
ATOM 6941  H HD3  . PRO A 1 112 ? -17.895 -3.802  8.665   1.00 0.00 ? 112 PRO A HD3  4  
ATOM 6942  N N    . PRO A 1 113 ? -18.170 -1.723  13.782  1.00 0.00 ? 113 PRO A N    4  
ATOM 6943  C CA   . PRO A 1 113 ? -18.659 -1.958  15.130  1.00 0.00 ? 113 PRO A CA   4  
ATOM 6944  C C    . PRO A 1 113 ? -20.032 -1.314  15.335  1.00 0.00 ? 113 PRO A C    4  
ATOM 6945  O O    . PRO A 1 113 ? -20.794 -1.733  16.205  1.00 0.00 ? 113 PRO A O    4  
ATOM 6946  C CB   . PRO A 1 113 ? -17.589 -1.381  16.042  1.00 0.00 ? 113 PRO A CB   4  
ATOM 6947  C CG   . PRO A 1 113 ? -16.770 -0.435  15.179  1.00 0.00 ? 113 PRO A CG   4  
ATOM 6948  C CD   . PRO A 1 113 ? -17.116 -0.715  13.725  1.00 0.00 ? 113 PRO A CD   4  
ATOM 6949  H HA   . PRO A 1 113 ? -18.791 -2.937  15.285  1.00 0.00 ? 113 PRO A HA   4  
ATOM 6950  H HB2  . PRO A 1 113 ? -18.037 -0.852  16.884  1.00 0.00 ? 113 PRO A HB2  4  
ATOM 6951  H HB3  . PRO A 1 113 ? -16.964 -2.170  16.459  1.00 0.00 ? 113 PRO A HB3  4  
ATOM 6952  H HG2  . PRO A 1 113 ? -16.992 0.601   15.431  1.00 0.00 ? 113 PRO A HG2  4  
ATOM 6953  H HG3  . PRO A 1 113 ? -15.705 -0.585  15.353  1.00 0.00 ? 113 PRO A HG3  4  
ATOM 6954  H HD2  . PRO A 1 113 ? -17.458 0.188   13.219  1.00 0.00 ? 113 PRO A HD2  4  
ATOM 6955  H HD3  . PRO A 1 113 ? -16.249 -1.079  13.175  1.00 0.00 ? 113 PRO A HD3  4  
ATOM 6956  N N    . SER A 1 114 ? -20.304 -0.305  14.521  1.00 0.00 ? 114 SER A N    4  
ATOM 6957  C CA   . SER A 1 114 ? -21.572 0.401   14.603  1.00 0.00 ? 114 SER A CA   4  
ATOM 6958  C C    . SER A 1 114 ? -21.987 0.563   16.066  1.00 0.00 ? 114 SER A C    4  
ATOM 6959  O O    . SER A 1 114 ? -22.834 -0.180  16.560  1.00 0.00 ? 114 SER A O    4  
ATOM 6960  C CB   . SER A 1 114 ? -22.662 -0.332  13.819  1.00 0.00 ? 114 SER A CB   4  
ATOM 6961  O OG   . SER A 1 114 ? -23.550 0.573   13.167  1.00 0.00 ? 114 SER A OG   4  
ATOM 6962  H H    . SER A 1 114 ? -19.679 0.030   13.816  1.00 0.00 ? 114 SER A H    4  
ATOM 6963  H HA   . SER A 1 114 ? -21.389 1.375   14.147  1.00 0.00 ? 114 SER A HA   4  
ATOM 6964  H HB2  . SER A 1 114 ? -22.200 -0.983  13.078  1.00 0.00 ? 114 SER A HB2  4  
ATOM 6965  H HB3  . SER A 1 114 ? -23.228 -0.971  14.496  1.00 0.00 ? 114 SER A HB3  4  
ATOM 6966  H HG   . SER A 1 114 ? -23.227 0.760   12.239  1.00 0.00 ? 114 SER A HG   4  
ATOM 6967  N N    . GLY A 1 115 ? -21.372 1.538   16.719  1.00 0.00 ? 115 GLY A N    4  
ATOM 6968  C CA   . GLY A 1 115 ? -21.668 1.806   18.116  1.00 0.00 ? 115 GLY A CA   4  
ATOM 6969  C C    . GLY A 1 115 ? -21.521 0.539   18.960  1.00 0.00 ? 115 GLY A C    4  
ATOM 6970  O O    . GLY A 1 115 ? -22.437 -0.279  19.024  1.00 0.00 ? 115 GLY A O    4  
ATOM 6971  H H    . GLY A 1 115 ? -20.685 2.138   16.310  1.00 0.00 ? 115 GLY A H    4  
ATOM 6972  H HA2  . GLY A 1 115 ? -20.996 2.578   18.492  1.00 0.00 ? 115 GLY A HA2  4  
ATOM 6973  H HA3  . GLY A 1 115 ? -22.682 2.194   18.209  1.00 0.00 ? 115 GLY A HA3  4  
ATOM 6974  N N    . PRO A 1 116 ? -20.330 0.413   19.605  1.00 0.00 ? 116 PRO A N    4  
ATOM 6975  C CA   . PRO A 1 116 ? -20.051 -0.740  20.443  1.00 0.00 ? 116 PRO A CA   4  
ATOM 6976  C C    . PRO A 1 116 ? -20.800 -0.646  21.774  1.00 0.00 ? 116 PRO A C    4  
ATOM 6977  O O    . PRO A 1 116 ? -21.475 0.348   22.041  1.00 0.00 ? 116 PRO A O    4  
ATOM 6978  C CB   . PRO A 1 116 ? -18.540 -0.748  20.612  1.00 0.00 ? 116 PRO A CB   4  
ATOM 6979  C CG   . PRO A 1 116 ? -18.074 0.654   20.254  1.00 0.00 ? 116 PRO A CG   4  
ATOM 6980  C CD   . PRO A 1 116 ? -19.222 1.362   19.553  1.00 0.00 ? 116 PRO A CD   4  
ATOM 6981  H HA   . PRO A 1 116 ? -20.379 -1.576  20.004  1.00 0.00 ? 116 PRO A HA   4  
ATOM 6982  H HB2  . PRO A 1 116 ? -18.263 -1.003  21.635  1.00 0.00 ? 116 PRO A HB2  4  
ATOM 6983  H HB3  . PRO A 1 116 ? -18.079 -1.491  19.962  1.00 0.00 ? 116 PRO A HB3  4  
ATOM 6984  H HG2  . PRO A 1 116 ? -17.779 1.198   21.151  1.00 0.00 ? 116 PRO A HG2  4  
ATOM 6985  H HG3  . PRO A 1 116 ? -17.199 0.611   19.605  1.00 0.00 ? 116 PRO A HG3  4  
ATOM 6986  H HD2  . PRO A 1 116 ? -19.476 2.296   20.055  1.00 0.00 ? 116 PRO A HD2  4  
ATOM 6987  H HD3  . PRO A 1 116 ? -18.963 1.613   18.525  1.00 0.00 ? 116 PRO A HD3  4  
ATOM 6988  N N    . SER A 1 117 ? -20.657 -1.693  22.573  1.00 0.00 ? 117 SER A N    4  
ATOM 6989  C CA   . SER A 1 117 ? -21.312 -1.740  23.869  1.00 0.00 ? 117 SER A CA   4  
ATOM 6990  C C    . SER A 1 117 ? -20.291 -2.066  24.960  1.00 0.00 ? 117 SER A C    4  
ATOM 6991  O O    . SER A 1 117 ? -19.226 -2.612  24.675  1.00 0.00 ? 117 SER A O    4  
ATOM 6992  C CB   . SER A 1 117 ? -22.444 -2.769  23.877  1.00 0.00 ? 117 SER A CB   4  
ATOM 6993  O OG   . SER A 1 117 ? -21.957 -4.098  24.044  1.00 0.00 ? 117 SER A OG   4  
ATOM 6994  H H    . SER A 1 117 ? -20.107 -2.497  22.348  1.00 0.00 ? 117 SER A H    4  
ATOM 6995  H HA   . SER A 1 117 ? -21.727 -0.743  24.019  1.00 0.00 ? 117 SER A HA   4  
ATOM 6996  H HB2  . SER A 1 117 ? -23.142 -2.535  24.681  1.00 0.00 ? 117 SER A HB2  4  
ATOM 6997  H HB3  . SER A 1 117 ? -23.001 -2.703  22.942  1.00 0.00 ? 117 SER A HB3  4  
ATOM 6998  H HG   . SER A 1 117 ? -21.110 -4.219  23.526  1.00 0.00 ? 117 SER A HG   4  
ATOM 6999  N N    . SER A 1 118 ? -20.651 -1.718  26.187  1.00 0.00 ? 118 SER A N    4  
ATOM 7000  C CA   . SER A 1 118 ? -19.779 -1.967  27.322  1.00 0.00 ? 118 SER A CA   4  
ATOM 7001  C C    . SER A 1 118 ? -20.316 -3.138  28.147  1.00 0.00 ? 118 SER A C    4  
ATOM 7002  O O    . SER A 1 118 ? -21.487 -3.496  28.035  1.00 0.00 ? 118 SER A O    4  
ATOM 7003  C CB   . SER A 1 118 ? -19.643 -0.719  28.196  1.00 0.00 ? 118 SER A CB   4  
ATOM 7004  O OG   . SER A 1 118 ? -18.458 -0.747  28.986  1.00 0.00 ? 118 SER A OG   4  
ATOM 7005  H H    . SER A 1 118 ? -21.519 -1.275  26.410  1.00 0.00 ? 118 SER A H    4  
ATOM 7006  H HA   . SER A 1 118 ? -18.809 -2.216  26.891  1.00 0.00 ? 118 SER A HA   4  
ATOM 7007  H HB2  . SER A 1 118 ? -19.636 0.168   27.563  1.00 0.00 ? 118 SER A HB2  4  
ATOM 7008  H HB3  . SER A 1 118 ? -20.512 -0.638  28.849  1.00 0.00 ? 118 SER A HB3  4  
ATOM 7009  H HG   . SER A 1 118 ? -18.599 -1.317  29.796  1.00 0.00 ? 118 SER A HG   4  
ATOM 7010  N N    . GLY A 1 119 ? -19.434 -3.702  28.959  1.00 0.00 ? 119 GLY A N    4  
ATOM 7011  C CA   . GLY A 1 119 ? -19.804 -4.825  29.803  1.00 0.00 ? 119 GLY A CA   4  
ATOM 7012  C C    . GLY A 1 119 ? -20.404 -4.343  31.126  1.00 0.00 ? 119 GLY A C    4  
ATOM 7013  O O    . GLY A 1 119 ? -21.267 -3.467  31.137  1.00 0.00 ? 119 GLY A O    4  
ATOM 7014  H H    . GLY A 1 119 ? -18.483 -3.405  29.045  1.00 0.00 ? 119 GLY A H    4  
ATOM 7015  H HA2  . GLY A 1 119 ? -20.525 -5.455  29.281  1.00 0.00 ? 119 GLY A HA2  4  
ATOM 7016  H HA3  . GLY A 1 119 ? -18.927 -5.442  30.001  1.00 0.00 ? 119 GLY A HA3  4  
ATOM 7017  N N    . GLY A 1 1   ? -0.908  -10.524 -7.024  1.00 0.00 ? 1   GLY A N    5  
ATOM 7018  C CA   . GLY A 1 1   ? -0.247  -11.608 -7.729  1.00 0.00 ? 1   GLY A CA   5  
ATOM 7019  C C    . GLY A 1 1   ? -1.239  -12.381 -8.601  1.00 0.00 ? 1   GLY A C    5  
ATOM 7020  O O    . GLY A 1 1   ? -1.852  -13.344 -8.144  1.00 0.00 ? 1   GLY A O    5  
ATOM 7021  H H1   . GLY A 1 1   ? -1.533  -9.976  -7.580  1.00 0.00 ? 1   GLY A H1   5  
ATOM 7022  H HA2  . GLY A 1 1   ? 0.554   -11.208 -8.351  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7023  H HA3  . GLY A 1 1   ? 0.216   -12.285 -7.011  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7024  N N    . SER A 1 2   ? -1.365  -11.929 -9.840  1.00 0.00 ? 2   SER A N    5  
ATOM 7025  C CA   . SER A 1 2   ? -2.273  -12.566 -10.779 1.00 0.00 ? 2   SER A CA   5  
ATOM 7026  C C    . SER A 1 2   ? -2.072  -11.981 -12.179 1.00 0.00 ? 2   SER A C    5  
ATOM 7027  O O    . SER A 1 2   ? -2.601  -10.916 -12.492 1.00 0.00 ? 2   SER A O    5  
ATOM 7028  C CB   . SER A 1 2   ? -3.728  -12.400 -10.338 1.00 0.00 ? 2   SER A CB   5  
ATOM 7029  O OG   . SER A 1 2   ? -4.603  -13.277 -11.043 1.00 0.00 ? 2   SER A OG   5  
ATOM 7030  H H    . SER A 1 2   ? -0.863  -11.145 -10.203 1.00 0.00 ? 2   SER A H    5  
ATOM 7031  H HA   . SER A 1 2   ? -2.008  -13.623 -10.765 1.00 0.00 ? 2   SER A HA   5  
ATOM 7032  H HB2  . SER A 1 2   ? -3.807  -12.592 -9.268  1.00 0.00 ? 2   SER A HB2  5  
ATOM 7033  H HB3  . SER A 1 2   ? -4.041  -11.368 -10.501 1.00 0.00 ? 2   SER A HB3  5  
ATOM 7034  H HG   . SER A 1 2   ? -5.530  -12.902 -11.050 1.00 0.00 ? 2   SER A HG   5  
ATOM 7035  N N    . SER A 1 3   ? -1.306  -12.704 -12.983 1.00 0.00 ? 3   SER A N    5  
ATOM 7036  C CA   . SER A 1 3   ? -1.029  -12.270 -14.342 1.00 0.00 ? 3   SER A CA   5  
ATOM 7037  C C    . SER A 1 3   ? -1.497  -13.334 -15.337 1.00 0.00 ? 3   SER A C    5  
ATOM 7038  O O    . SER A 1 3   ? -1.683  -14.493 -14.969 1.00 0.00 ? 3   SER A O    5  
ATOM 7039  C CB   . SER A 1 3   ? 0.461   -11.981 -14.535 1.00 0.00 ? 3   SER A CB   5  
ATOM 7040  O OG   . SER A 1 3   ? 1.257   -13.152 -14.372 1.00 0.00 ? 3   SER A OG   5  
ATOM 7041  H H    . SER A 1 3   ? -0.880  -13.569 -12.721 1.00 0.00 ? 3   SER A H    5  
ATOM 7042  H HA   . SER A 1 3   ? -1.597  -11.349 -14.472 1.00 0.00 ? 3   SER A HA   5  
ATOM 7043  H HB2  . SER A 1 3   ? 0.624   -11.567 -15.530 1.00 0.00 ? 3   SER A HB2  5  
ATOM 7044  H HB3  . SER A 1 3   ? 0.779   -11.224 -13.818 1.00 0.00 ? 3   SER A HB3  5  
ATOM 7045  H HG   . SER A 1 3   ? 1.045   -13.591 -13.500 1.00 0.00 ? 3   SER A HG   5  
ATOM 7046  N N    . GLY A 1 4   ? -1.672  -12.903 -16.577 1.00 0.00 ? 4   GLY A N    5  
ATOM 7047  C CA   . GLY A 1 4   ? -2.114  -13.804 -17.627 1.00 0.00 ? 4   GLY A CA   5  
ATOM 7048  C C    . GLY A 1 4   ? -3.562  -13.513 -18.027 1.00 0.00 ? 4   GLY A C    5  
ATOM 7049  O O    . GLY A 1 4   ? -4.483  -14.193 -17.576 1.00 0.00 ? 4   GLY A O    5  
ATOM 7050  H H    . GLY A 1 4   ? -1.518  -11.959 -16.868 1.00 0.00 ? 4   GLY A H    5  
ATOM 7051  H HA2  . GLY A 1 4   ? -1.465  -13.701 -18.497 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7052  H HA3  . GLY A 1 4   ? -2.028  -14.836 -17.286 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7053  N N    . SER A 1 5   ? -3.718  -12.501 -18.868 1.00 0.00 ? 5   SER A N    5  
ATOM 7054  C CA   . SER A 1 5   ? -5.038  -12.111 -19.333 1.00 0.00 ? 5   SER A CA   5  
ATOM 7055  C C    . SER A 1 5   ? -5.008  -11.860 -20.842 1.00 0.00 ? 5   SER A C    5  
ATOM 7056  O O    . SER A 1 5   ? -5.737  -12.503 -21.596 1.00 0.00 ? 5   SER A O    5  
ATOM 7057  C CB   . SER A 1 5   ? -5.535  -10.865 -18.598 1.00 0.00 ? 5   SER A CB   5  
ATOM 7058  O OG   . SER A 1 5   ? -5.526  -11.040 -17.184 1.00 0.00 ? 5   SER A OG   5  
ATOM 7059  H H    . SER A 1 5   ? -2.964  -11.953 -19.229 1.00 0.00 ? 5   SER A H    5  
ATOM 7060  H HA   . SER A 1 5   ? -5.687  -12.954 -19.098 1.00 0.00 ? 5   SER A HA   5  
ATOM 7061  H HB2  . SER A 1 5   ? -4.908  -10.014 -18.861 1.00 0.00 ? 5   SER A HB2  5  
ATOM 7062  H HB3  . SER A 1 5   ? -6.547  -10.629 -18.927 1.00 0.00 ? 5   SER A HB3  5  
ATOM 7063  H HG   . SER A 1 5   ? -5.190  -11.954 -16.954 1.00 0.00 ? 5   SER A HG   5  
ATOM 7064  N N    . SER A 1 6   ? -4.158  -10.925 -21.237 1.00 0.00 ? 6   SER A N    5  
ATOM 7065  C CA   . SER A 1 6   ? -4.023  -10.581 -22.643 1.00 0.00 ? 6   SER A CA   5  
ATOM 7066  C C    . SER A 1 6   ? -3.030  -9.429  -22.807 1.00 0.00 ? 6   SER A C    5  
ATOM 7067  O O    . SER A 1 6   ? -3.135  -8.412  -22.125 1.00 0.00 ? 6   SER A O    5  
ATOM 7068  C CB   . SER A 1 6   ? -5.376  -10.206 -23.250 1.00 0.00 ? 6   SER A CB   5  
ATOM 7069  O OG   . SER A 1 6   ? -5.669  -10.971 -24.416 1.00 0.00 ? 6   SER A OG   5  
ATOM 7070  H H    . SER A 1 6   ? -3.568  -10.407 -20.618 1.00 0.00 ? 6   SER A H    5  
ATOM 7071  H HA   . SER A 1 6   ? -3.647  -11.483 -23.126 1.00 0.00 ? 6   SER A HA   5  
ATOM 7072  H HB2  . SER A 1 6   ? -6.161  -10.359 -22.509 1.00 0.00 ? 6   SER A HB2  5  
ATOM 7073  H HB3  . SER A 1 6   ? -5.379  -9.145  -23.502 1.00 0.00 ? 6   SER A HB3  5  
ATOM 7074  H HG   . SER A 1 6   ? -6.655  -10.977 -24.582 1.00 0.00 ? 6   SER A HG   5  
ATOM 7075  N N    . GLY A 1 7   ? -2.087  -9.628  -23.717 1.00 0.00 ? 7   GLY A N    5  
ATOM 7076  C CA   . GLY A 1 7   ? -1.076  -8.619  -23.980 1.00 0.00 ? 7   GLY A CA   5  
ATOM 7077  C C    . GLY A 1 7   ? 0.167   -9.242  -24.619 1.00 0.00 ? 7   GLY A C    5  
ATOM 7078  O O    . GLY A 1 7   ? 0.315   -10.463 -24.637 1.00 0.00 ? 7   GLY A O    5  
ATOM 7079  H H    . GLY A 1 7   ? -2.008  -10.459 -24.268 1.00 0.00 ? 7   GLY A H    5  
ATOM 7080  H HA2  . GLY A 1 7   ? -1.484  -7.853  -24.640 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7081  H HA3  . GLY A 1 7   ? -0.801  -8.123  -23.049 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7082  N N    . PRO A 1 8   ? 1.052   -8.351  -25.142 1.00 0.00 ? 8   PRO A N    5  
ATOM 7083  C CA   . PRO A 1 8   ? 2.278   -8.800  -25.780 1.00 0.00 ? 8   PRO A CA   5  
ATOM 7084  C C    . PRO A 1 8   ? 3.301   -9.260  -24.740 1.00 0.00 ? 8   PRO A C    5  
ATOM 7085  O O    . PRO A 1 8   ? 3.013   -9.273  -23.544 1.00 0.00 ? 8   PRO A O    5  
ATOM 7086  C CB   . PRO A 1 8   ? 2.754   -7.611  -26.597 1.00 0.00 ? 8   PRO A CB   5  
ATOM 7087  C CG   . PRO A 1 8   ? 2.039   -6.398  -26.025 1.00 0.00 ? 8   PRO A CG   5  
ATOM 7088  C CD   . PRO A 1 8   ? 0.910   -6.898  -25.139 1.00 0.00 ? 8   PRO A CD   5  
ATOM 7089  H HA   . PRO A 1 8   ? 2.097   -9.598  -26.356 1.00 0.00 ? 8   PRO A HA   5  
ATOM 7090  H HB2  . PRO A 1 8   ? 3.836   -7.497  -26.526 1.00 0.00 ? 8   PRO A HB2  5  
ATOM 7091  H HB3  . PRO A 1 8   ? 2.517   -7.742  -27.653 1.00 0.00 ? 8   PRO A HB3  5  
ATOM 7092  H HG2  . PRO A 1 8   ? 2.732   -5.783  -25.450 1.00 0.00 ? 8   PRO A HG2  5  
ATOM 7093  H HG3  . PRO A 1 8   ? 1.647   -5.772  -26.826 1.00 0.00 ? 8   PRO A HG3  5  
ATOM 7094  H HD2  . PRO A 1 8   ? 0.990   -6.494  -24.129 1.00 0.00 ? 8   PRO A HD2  5  
ATOM 7095  H HD3  . PRO A 1 8   ? -0.062  -6.594  -25.527 1.00 0.00 ? 8   PRO A HD3  5  
ATOM 7096  N N    . GLN A 1 9   ? 4.475   -9.625  -25.233 1.00 0.00 ? 9   GLN A N    5  
ATOM 7097  C CA   . GLN A 1 9   ? 5.543   -10.084 -24.361 1.00 0.00 ? 9   GLN A CA   5  
ATOM 7098  C C    . GLN A 1 9   ? 6.867   -9.423  -24.750 1.00 0.00 ? 9   GLN A C    5  
ATOM 7099  O O    . GLN A 1 9   ? 7.385   -9.658  -25.841 1.00 0.00 ? 9   GLN A O    5  
ATOM 7100  C CB   . GLN A 1 9   ? 5.661   -11.609 -24.394 1.00 0.00 ? 9   GLN A CB   5  
ATOM 7101  C CG   . GLN A 1 9   ? 6.422   -12.127 -23.171 1.00 0.00 ? 9   GLN A CG   5  
ATOM 7102  C CD   . GLN A 1 9   ? 5.716   -13.338 -22.558 1.00 0.00 ? 9   GLN A CD   5  
ATOM 7103  O OE1  . GLN A 1 9   ? 5.087   -13.260 -21.516 1.00 0.00 ? 9   GLN A OE1  5  
ATOM 7104  N NE2  . GLN A 1 9   ? 5.854   -14.458 -23.262 1.00 0.00 ? 9   GLN A NE2  5  
ATOM 7105  H H    . GLN A 1 9   ? 4.701   -9.612  -26.207 1.00 0.00 ? 9   GLN A H    5  
ATOM 7106  H HA   . GLN A 1 9   ? 5.254   -9.770  -23.358 1.00 0.00 ? 9   GLN A HA   5  
ATOM 7107  H HB2  . GLN A 1 9   ? 4.666   -12.054 -24.423 1.00 0.00 ? 9   GLN A HB2  5  
ATOM 7108  H HB3  . GLN A 1 9   ? 6.175   -11.918 -25.304 1.00 0.00 ? 9   GLN A HB3  5  
ATOM 7109  H HG2  . GLN A 1 9   ? 7.437   -12.401 -23.459 1.00 0.00 ? 9   GLN A HG2  5  
ATOM 7110  H HG3  . GLN A 1 9   ? 6.504   -11.334 -22.428 1.00 0.00 ? 9   GLN A HG3  5  
ATOM 7111  H HE21 . GLN A 1 9   ? 6.383   -14.454 -24.110 1.00 0.00 ? 9   GLN A HE21 5  
ATOM 7112  H HE22 . GLN A 1 9   ? 5.428   -15.304 -22.942 1.00 0.00 ? 9   GLN A HE22 5  
ATOM 7113  N N    . LEU A 1 10  ? 7.377   -8.610  -23.837 1.00 0.00 ? 10  LEU A N    5  
ATOM 7114  C CA   . LEU A 1 10  ? 8.631   -7.914  -24.071 1.00 0.00 ? 10  LEU A CA   5  
ATOM 7115  C C    . LEU A 1 10  ? 9.381   -7.764  -22.746 1.00 0.00 ? 10  LEU A C    5  
ATOM 7116  O O    . LEU A 1 10  ? 8.765   -7.592  -21.695 1.00 0.00 ? 10  LEU A O    5  
ATOM 7117  C CB   . LEU A 1 10  ? 8.380   -6.587  -24.789 1.00 0.00 ? 10  LEU A CB   5  
ATOM 7118  C CG   . LEU A 1 10  ? 8.016   -6.685  -26.272 1.00 0.00 ? 10  LEU A CG   5  
ATOM 7119  C CD1  . LEU A 1 10  ? 6.504   -6.561  -26.474 1.00 0.00 ? 10  LEU A CD1  5  
ATOM 7120  C CD2  . LEU A 1 10  ? 8.790   -5.654  -27.096 1.00 0.00 ? 10  LEU A CD2  5  
ATOM 7121  H H    . LEU A 1 10  ? 6.950   -8.425  -22.952 1.00 0.00 ? 10  LEU A H    5  
ATOM 7122  H HA   . LEU A 1 10  ? 9.229   -8.534  -24.739 1.00 0.00 ? 10  LEU A HA   5  
ATOM 7123  H HB2  . LEU A 1 10  ? 7.577   -6.062  -24.272 1.00 0.00 ? 10  LEU A HB2  5  
ATOM 7124  H HB3  . LEU A 1 10  ? 9.275   -5.971  -24.695 1.00 0.00 ? 10  LEU A HB3  5  
ATOM 7125  H HG   . LEU A 1 10  ? 8.309   -7.671  -26.631 1.00 0.00 ? 10  LEU A HG   5  
ATOM 7126  H HD11 . LEU A 1 10  ? 6.229   -5.508  -26.524 1.00 0.00 ? 10  LEU A HD11 5  
ATOM 7127  H HD12 . LEU A 1 10  ? 6.221   -7.055  -27.403 1.00 0.00 ? 10  LEU A HD12 5  
ATOM 7128  H HD13 . LEU A 1 10  ? 5.986   -7.033  -25.639 1.00 0.00 ? 10  LEU A HD13 5  
ATOM 7129  H HD21 . LEU A 1 10  ? 8.244   -4.711  -27.104 1.00 0.00 ? 10  LEU A HD21 5  
ATOM 7130  H HD22 . LEU A 1 10  ? 9.775   -5.501  -26.654 1.00 0.00 ? 10  LEU A HD22 5  
ATOM 7131  H HD23 . LEU A 1 10  ? 8.904   -6.017  -28.118 1.00 0.00 ? 10  LEU A HD23 5  
ATOM 7132  N N    . VAL A 1 11  ? 10.701  -7.835  -22.839 1.00 0.00 ? 11  VAL A N    5  
ATOM 7133  C CA   . VAL A 1 11  ? 11.542  -7.710  -21.660 1.00 0.00 ? 11  VAL A CA   5  
ATOM 7134  C C    . VAL A 1 11  ? 11.292  -8.900  -20.731 1.00 0.00 ? 11  VAL A C    5  
ATOM 7135  O O    . VAL A 1 11  ? 10.223  -9.507  -20.769 1.00 0.00 ? 11  VAL A O    5  
ATOM 7136  C CB   . VAL A 1 11  ? 11.296  -6.360  -20.983 1.00 0.00 ? 11  VAL A CB   5  
ATOM 7137  C CG1  . VAL A 1 11  ? 10.564  -6.541  -19.651 1.00 0.00 ? 11  VAL A CG1  5  
ATOM 7138  C CG2  . VAL A 1 11  ? 12.607  -5.597  -20.789 1.00 0.00 ? 11  VAL A CG2  5  
ATOM 7139  H H    . VAL A 1 11  ? 11.195  -7.976  -23.697 1.00 0.00 ? 11  VAL A H    5  
ATOM 7140  H HA   . VAL A 1 11  ? 12.580  -7.736  -21.993 1.00 0.00 ? 11  VAL A HA   5  
ATOM 7141  H HB   . VAL A 1 11  ? 10.657  -5.768  -21.639 1.00 0.00 ? 11  VAL A HB   5  
ATOM 7142  H HG11 . VAL A 1 11  ? 11.271  -6.870  -18.890 1.00 0.00 ? 11  VAL A HG11 5  
ATOM 7143  H HG12 . VAL A 1 11  ? 10.121  -5.592  -19.349 1.00 0.00 ? 11  VAL A HG12 5  
ATOM 7144  H HG13 . VAL A 1 11  ? 9.779   -7.288  -19.767 1.00 0.00 ? 11  VAL A HG13 5  
ATOM 7145  H HG21 . VAL A 1 11  ? 13.283  -6.186  -20.169 1.00 0.00 ? 11  VAL A HG21 5  
ATOM 7146  H HG22 . VAL A 1 11  ? 13.070  -5.416  -21.759 1.00 0.00 ? 11  VAL A HG22 5  
ATOM 7147  H HG23 . VAL A 1 11  ? 12.404  -4.644  -20.300 1.00 0.00 ? 11  VAL A HG23 5  
ATOM 7148  N N    . ARG A 1 12  ? 12.295  -9.197  -19.919 1.00 0.00 ? 12  ARG A N    5  
ATOM 7149  C CA   . ARG A 1 12  ? 12.197  -10.303 -18.982 1.00 0.00 ? 12  ARG A CA   5  
ATOM 7150  C C    . ARG A 1 12  ? 12.845  -9.927  -17.648 1.00 0.00 ? 12  ARG A C    5  
ATOM 7151  O O    . ARG A 1 12  ? 12.221  -10.048 -16.595 1.00 0.00 ? 12  ARG A O    5  
ATOM 7152  C CB   . ARG A 1 12  ? 12.878  -11.556 -19.536 1.00 0.00 ? 12  ARG A CB   5  
ATOM 7153  C CG   . ARG A 1 12  ? 12.031  -12.802 -19.270 1.00 0.00 ? 12  ARG A CG   5  
ATOM 7154  C CD   . ARG A 1 12  ? 12.917  -14.034 -19.067 1.00 0.00 ? 12  ARG A CD   5  
ATOM 7155  N NE   . ARG A 1 12  ? 12.398  -14.852 -17.948 1.00 0.00 ? 12  ARG A NE   5  
ATOM 7156  C CZ   . ARG A 1 12  ? 12.987  -15.968 -17.498 1.00 0.00 ? 12  ARG A CZ   5  
ATOM 7157  N NH1  . ARG A 1 12  ? 14.117  -16.407 -18.069 1.00 0.00 ? 12  ARG A NH1  5  
ATOM 7158  N NH2  . ARG A 1 12  ? 12.445  -16.646 -16.477 1.00 0.00 ? 12  ARG A NH2  5  
ATOM 7159  H H    . ARG A 1 12  ? 13.162  -8.697  -19.895 1.00 0.00 ? 12  ARG A H    5  
ATOM 7160  H HA   . ARG A 1 12  ? 11.128  -10.474 -18.864 1.00 0.00 ? 12  ARG A HA   5  
ATOM 7161  H HB2  . ARG A 1 12  ? 13.038  -11.443 -20.609 1.00 0.00 ? 12  ARG A HB2  5  
ATOM 7162  H HB3  . ARG A 1 12  ? 13.860  -11.674 -19.078 1.00 0.00 ? 12  ARG A HB3  5  
ATOM 7163  H HG2  . ARG A 1 12  ? 11.414  -12.645 -18.386 1.00 0.00 ? 12  ARG A HG2  5  
ATOM 7164  H HG3  . ARG A 1 12  ? 11.353  -12.972 -20.106 1.00 0.00 ? 12  ARG A HG3  5  
ATOM 7165  H HD2  . ARG A 1 12  ? 12.943  -14.627 -19.981 1.00 0.00 ? 12  ARG A HD2  5  
ATOM 7166  H HD3  . ARG A 1 12  ? 13.941  -13.725 -18.859 1.00 0.00 ? 12  ARG A HD3  5  
ATOM 7167  H HE   . ARG A 1 12  ? 11.556  -14.552 -17.500 1.00 0.00 ? 12  ARG A HE   5  
ATOM 7168  H HH11 . ARG A 1 12  ? 14.521  -15.900 -18.831 1.00 0.00 ? 12  ARG A HH11 5  
ATOM 7169  H HH12 . ARG A 1 12  ? 14.556  -17.240 -17.733 1.00 0.00 ? 12  ARG A HH12 5  
ATOM 7170  H HH21 . ARG A 1 12  ? 11.601  -16.319 -16.052 1.00 0.00 ? 12  ARG A HH21 5  
ATOM 7171  H HH22 . ARG A 1 12  ? 12.884  -17.480 -16.142 1.00 0.00 ? 12  ARG A HH22 5  
ATOM 7172  N N    . THR A 1 13  ? 14.089  -9.479  -17.736 1.00 0.00 ? 13  THR A N    5  
ATOM 7173  C CA   . THR A 1 13  ? 14.829  -9.085  -16.549 1.00 0.00 ? 13  THR A CA   5  
ATOM 7174  C C    . THR A 1 13  ? 15.733  -7.890  -16.856 1.00 0.00 ? 13  THR A C    5  
ATOM 7175  O O    . THR A 1 13  ? 16.750  -8.034  -17.532 1.00 0.00 ? 13  THR A O    5  
ATOM 7176  C CB   . THR A 1 13  ? 15.592  -10.309 -16.039 1.00 0.00 ? 13  THR A CB   5  
ATOM 7177  O OG1  . THR A 1 13  ? 16.579  -10.544 -17.040 1.00 0.00 ? 13  THR A OG1  5  
ATOM 7178  C CG2  . THR A 1 13  ? 14.738  -11.579 -16.052 1.00 0.00 ? 13  THR A CG2  5  
ATOM 7179  H H    . THR A 1 13  ? 14.590  -9.384  -18.596 1.00 0.00 ? 13  THR A H    5  
ATOM 7180  H HA   . THR A 1 13  ? 14.115  -8.760  -15.792 1.00 0.00 ? 13  THR A HA   5  
ATOM 7181  H HB   . THR A 1 13  ? 16.002  -10.126 -15.046 1.00 0.00 ? 13  THR A HB   5  
ATOM 7182  H HG1  . THR A 1 13  ? 16.138  -10.744 -17.914 1.00 0.00 ? 13  THR A HG1  5  
ATOM 7183  H HG21 . THR A 1 13  ? 13.769  -11.370 -15.600 1.00 0.00 ? 13  THR A HG21 5  
ATOM 7184  H HG22 . THR A 1 13  ? 14.595  -11.910 -17.081 1.00 0.00 ? 13  THR A HG22 5  
ATOM 7185  H HG23 . THR A 1 13  ? 15.242  -12.361 -15.485 1.00 0.00 ? 13  THR A HG23 5  
ATOM 7186  N N    . HIS A 1 14  ? 15.329  -6.736  -16.344 1.00 0.00 ? 14  HIS A N    5  
ATOM 7187  C CA   . HIS A 1 14  ? 16.090  -5.517  -16.556 1.00 0.00 ? 14  HIS A CA   5  
ATOM 7188  C C    . HIS A 1 14  ? 15.317  -4.324  -15.988 1.00 0.00 ? 14  HIS A C    5  
ATOM 7189  O O    . HIS A 1 14  ? 14.186  -4.063  -16.395 1.00 0.00 ? 14  HIS A O    5  
ATOM 7190  C CB   . HIS A 1 14  ? 16.442  -5.345  -18.034 1.00 0.00 ? 14  HIS A CB   5  
ATOM 7191  C CG   . HIS A 1 14  ? 17.918  -5.162  -18.297 1.00 0.00 ? 14  HIS A CG   5  
ATOM 7192  N ND1  . HIS A 1 14  ? 18.609  -5.905  -19.238 1.00 0.00 ? 14  HIS A ND1  5  
ATOM 7193  C CD2  . HIS A 1 14  ? 18.825  -4.314  -17.734 1.00 0.00 ? 14  HIS A CD2  5  
ATOM 7194  C CE1  . HIS A 1 14  ? 19.875  -5.513  -19.232 1.00 0.00 ? 14  HIS A CE1  5  
ATOM 7195  N NE2  . HIS A 1 14  ? 20.007  -4.528  -18.298 1.00 0.00 ? 14  HIS A NE2  5  
ATOM 7196  H H    . HIS A 1 14  ? 14.500  -6.627  -15.795 1.00 0.00 ? 14  HIS A H    5  
ATOM 7197  H HA   . HIS A 1 14  ? 17.023  -5.630  -16.003 1.00 0.00 ? 14  HIS A HA   5  
ATOM 7198  H HB2  . HIS A 1 14  ? 16.091  -6.218  -18.585 1.00 0.00 ? 14  HIS A HB2  5  
ATOM 7199  H HB3  . HIS A 1 14  ? 15.904  -4.483  -18.428 1.00 0.00 ? 14  HIS A HB3  5  
ATOM 7200  H HD1  . HIS A 1 14  ? 18.220  -6.616  -19.823 1.00 0.00 ? 14  HIS A HD1  5  
ATOM 7201  H HD2  . HIS A 1 14  ? 18.615  -3.584  -16.952 1.00 0.00 ? 14  HIS A HD2  5  
ATOM 7202  H HE1  . HIS A 1 14  ? 20.672  -5.909  -19.862 1.00 0.00 ? 14  HIS A HE1  5  
ATOM 7203  N N    . GLU A 1 15  ? 15.958  -3.633  -15.057 1.00 0.00 ? 15  GLU A N    5  
ATOM 7204  C CA   . GLU A 1 15  ? 15.345  -2.475  -14.430 1.00 0.00 ? 15  GLU A CA   5  
ATOM 7205  C C    . GLU A 1 15  ? 16.268  -1.905  -13.351 1.00 0.00 ? 15  GLU A C    5  
ATOM 7206  O O    . GLU A 1 15  ? 16.857  -2.654  -12.574 1.00 0.00 ? 15  GLU A O    5  
ATOM 7207  C CB   . GLU A 1 15  ? 13.974  -2.828  -13.848 1.00 0.00 ? 15  GLU A CB   5  
ATOM 7208  C CG   . GLU A 1 15  ? 12.854  -2.466  -14.826 1.00 0.00 ? 15  GLU A CG   5  
ATOM 7209  C CD   . GLU A 1 15  ? 11.755  -1.663  -14.127 1.00 0.00 ? 15  GLU A CD   5  
ATOM 7210  O OE1  . GLU A 1 15  ? 11.134  -2.234  -13.205 1.00 0.00 ? 15  GLU A OE1  5  
ATOM 7211  O OE2  . GLU A 1 15  ? 11.561  -0.496  -14.530 1.00 0.00 ? 15  GLU A OE2  5  
ATOM 7212  H H    . GLU A 1 15  ? 16.878  -3.853  -14.732 1.00 0.00 ? 15  GLU A H    5  
ATOM 7213  H HA   . GLU A 1 15  ? 15.216  -1.746  -15.230 1.00 0.00 ? 15  GLU A HA   5  
ATOM 7214  H HB2  . GLU A 1 15  ? 13.934  -3.894  -13.622 1.00 0.00 ? 15  GLU A HB2  5  
ATOM 7215  H HB3  . GLU A 1 15  ? 13.827  -2.297  -12.907 1.00 0.00 ? 15  GLU A HB3  5  
ATOM 7216  H HG2  . GLU A 1 15  ? 13.263  -1.886  -15.653 1.00 0.00 ? 15  GLU A HG2  5  
ATOM 7217  H HG3  . GLU A 1 15  ? 12.430  -3.375  -15.252 1.00 0.00 ? 15  GLU A HG3  5  
ATOM 7218  N N    . ASP A 1 16  ? 16.364  -0.584  -13.337 1.00 0.00 ? 16  ASP A N    5  
ATOM 7219  C CA   . ASP A 1 16  ? 17.205  0.096   -12.367 1.00 0.00 ? 16  ASP A CA   5  
ATOM 7220  C C    . ASP A 1 16  ? 16.463  0.190   -11.032 1.00 0.00 ? 16  ASP A C    5  
ATOM 7221  O O    . ASP A 1 16  ? 16.957  -0.280  -10.008 1.00 0.00 ? 16  ASP A O    5  
ATOM 7222  C CB   . ASP A 1 16  ? 17.537  1.517   -12.824 1.00 0.00 ? 16  ASP A CB   5  
ATOM 7223  C CG   . ASP A 1 16  ? 18.748  2.152   -12.138 1.00 0.00 ? 16  ASP A CG   5  
ATOM 7224  O OD1  . ASP A 1 16  ? 18.729  2.204   -10.889 1.00 0.00 ? 16  ASP A OD1  5  
ATOM 7225  O OD2  . ASP A 1 16  ? 19.665  2.571   -12.877 1.00 0.00 ? 16  ASP A OD2  5  
ATOM 7226  H H    . ASP A 1 16  ? 15.881  0.019   -13.973 1.00 0.00 ? 16  ASP A H    5  
ATOM 7227  H HA   . ASP A 1 16  ? 18.110  -0.509  -12.299 1.00 0.00 ? 16  ASP A HA   5  
ATOM 7228  H HB2  . ASP A 1 16  ? 17.713  1.505   -13.900 1.00 0.00 ? 16  ASP A HB2  5  
ATOM 7229  H HB3  . ASP A 1 16  ? 16.667  2.151   -12.652 1.00 0.00 ? 16  ASP A HB3  5  
ATOM 7230  N N    . VAL A 1 17  ? 15.288  0.799   -11.087 1.00 0.00 ? 17  VAL A N    5  
ATOM 7231  C CA   . VAL A 1 17  ? 14.473  0.961   -9.895  1.00 0.00 ? 17  VAL A CA   5  
ATOM 7232  C C    . VAL A 1 17  ? 14.477  -0.345  -9.098  1.00 0.00 ? 17  VAL A C    5  
ATOM 7233  O O    . VAL A 1 17  ? 14.880  -1.388  -9.611  1.00 0.00 ? 17  VAL A O    5  
ATOM 7234  C CB   . VAL A 1 17  ? 13.065  1.420   -10.282 1.00 0.00 ? 17  VAL A CB   5  
ATOM 7235  C CG1  . VAL A 1 17  ? 13.015  2.938   -10.465 1.00 0.00 ? 17  VAL A CG1  5  
ATOM 7236  C CG2  . VAL A 1 17  ? 12.581  0.699   -11.542 1.00 0.00 ? 17  VAL A CG2  5  
ATOM 7237  H H    . VAL A 1 17  ? 14.893  1.178   -11.924 1.00 0.00 ? 17  VAL A H    5  
ATOM 7238  H HA   . VAL A 1 17  ? 14.928  1.744   -9.289  1.00 0.00 ? 17  VAL A HA   5  
ATOM 7239  H HB   . VAL A 1 17  ? 12.391  1.158   -9.466  1.00 0.00 ? 17  VAL A HB   5  
ATOM 7240  H HG11 . VAL A 1 17  ? 12.771  3.411   -9.514  1.00 0.00 ? 17  VAL A HG11 5  
ATOM 7241  H HG12 . VAL A 1 17  ? 13.985  3.295   -10.811 1.00 0.00 ? 17  VAL A HG12 5  
ATOM 7242  H HG13 . VAL A 1 17  ? 12.252  3.190   -11.202 1.00 0.00 ? 17  VAL A HG13 5  
ATOM 7243  H HG21 . VAL A 1 17  ? 12.879  -0.348  -11.498 1.00 0.00 ? 17  VAL A HG21 5  
ATOM 7244  H HG22 . VAL A 1 17  ? 11.494  0.765   -11.603 1.00 0.00 ? 17  VAL A HG22 5  
ATOM 7245  H HG23 . VAL A 1 17  ? 13.023  1.167   -12.421 1.00 0.00 ? 17  VAL A HG23 5  
ATOM 7246  N N    . PRO A 1 18  ? 14.014  -0.243  -7.824  1.00 0.00 ? 18  PRO A N    5  
ATOM 7247  C CA   . PRO A 1 18  ? 13.961  -1.403  -6.951  1.00 0.00 ? 18  PRO A CA   5  
ATOM 7248  C C    . PRO A 1 18  ? 12.802  -2.326  -7.335  1.00 0.00 ? 18  PRO A C    5  
ATOM 7249  O O    . PRO A 1 18  ? 12.062  -2.040  -8.275  1.00 0.00 ? 18  PRO A O    5  
ATOM 7250  C CB   . PRO A 1 18  ? 13.827  -0.834  -5.548  1.00 0.00 ? 18  PRO A CB   5  
ATOM 7251  C CG   . PRO A 1 18  ? 13.343  0.596   -5.723  1.00 0.00 ? 18  PRO A CG   5  
ATOM 7252  C CD   . PRO A 1 18  ? 13.529  0.976   -7.183  1.00 0.00 ? 18  PRO A CD   5  
ATOM 7253  H HA   . PRO A 1 18  ? 14.792  -1.951  -7.051  1.00 0.00 ? 18  PRO A HA   5  
ATOM 7254  H HB2  . PRO A 1 18  ? 13.120  -1.416  -4.956  1.00 0.00 ? 18  PRO A HB2  5  
ATOM 7255  H HB3  . PRO A 1 18  ? 14.781  -0.862  -5.022  1.00 0.00 ? 18  PRO A HB3  5  
ATOM 7256  H HG2  . PRO A 1 18  ? 12.295  0.683   -5.436  1.00 0.00 ? 18  PRO A HG2  5  
ATOM 7257  H HG3  . PRO A 1 18  ? 13.907  1.271   -5.078  1.00 0.00 ? 18  PRO A HG3  5  
ATOM 7258  H HD2  . PRO A 1 18  ? 12.592  1.311   -7.627  1.00 0.00 ? 18  PRO A HD2  5  
ATOM 7259  H HD3  . PRO A 1 18  ? 14.243  1.792   -7.292  1.00 0.00 ? 18  PRO A HD3  5  
ATOM 7260  N N    . GLY A 1 19  ? 12.682  -3.413  -6.588  1.00 0.00 ? 19  GLY A N    5  
ATOM 7261  C CA   . GLY A 1 19  ? 11.626  -4.380  -6.839  1.00 0.00 ? 19  GLY A CA   5  
ATOM 7262  C C    . GLY A 1 19  ? 10.510  -4.254  -5.800  1.00 0.00 ? 19  GLY A C    5  
ATOM 7263  O O    . GLY A 1 19  ? 10.281  -3.174  -5.257  1.00 0.00 ? 19  GLY A O    5  
ATOM 7264  H H    . GLY A 1 19  ? 13.288  -3.638  -5.825  1.00 0.00 ? 19  GLY A H    5  
ATOM 7265  H HA2  . GLY A 1 19  ? 11.217  -4.227  -7.837  1.00 0.00 ? 19  GLY A HA2  5  
ATOM 7266  H HA3  . GLY A 1 19  ? 12.038  -5.389  -6.814  1.00 0.00 ? 19  GLY A HA3  5  
ATOM 7267  N N    . PRO A 1 20  ? 9.826   -5.403  -5.548  1.00 0.00 ? 20  PRO A N    5  
ATOM 7268  C CA   . PRO A 1 20  ? 8.739   -5.431  -4.585  1.00 0.00 ? 20  PRO A CA   5  
ATOM 7269  C C    . PRO A 1 20  ? 9.276   -5.396  -3.152  1.00 0.00 ? 20  PRO A C    5  
ATOM 7270  O O    . PRO A 1 20  ? 10.162  -6.172  -2.798  1.00 0.00 ? 20  PRO A O    5  
ATOM 7271  C CB   . PRO A 1 20  ? 7.968   -6.703  -4.899  1.00 0.00 ? 20  PRO A CB   5  
ATOM 7272  C CG   . PRO A 1 20  ? 8.912   -7.572  -5.715  1.00 0.00 ? 20  PRO A CG   5  
ATOM 7273  C CD   . PRO A 1 20  ? 10.069  -6.700  -6.173  1.00 0.00 ? 20  PRO A CD   5  
ATOM 7274  H HA   . PRO A 1 20  ? 8.167   -4.617  -4.682  1.00 0.00 ? 20  PRO A HA   5  
ATOM 7275  H HB2  . PRO A 1 20  ? 7.662   -7.210  -3.984  1.00 0.00 ? 20  PRO A HB2  5  
ATOM 7276  H HB3  . PRO A 1 20  ? 7.060   -6.480  -5.459  1.00 0.00 ? 20  PRO A HB3  5  
ATOM 7277  H HG2  . PRO A 1 20  ? 9.276   -8.406  -5.116  1.00 0.00 ? 20  PRO A HG2  5  
ATOM 7278  H HG3  . PRO A 1 20  ? 8.392   -7.998  -6.573  1.00 0.00 ? 20  PRO A HG3  5  
ATOM 7279  H HD2  . PRO A 1 20  ? 11.027  -7.116  -5.860  1.00 0.00 ? 20  PRO A HD2  5  
ATOM 7280  H HD3  . PRO A 1 20  ? 10.097  -6.617  -7.259  1.00 0.00 ? 20  PRO A HD3  5  
ATOM 7281  N N    . VAL A 1 21  ? 8.716   -4.488  -2.367  1.00 0.00 ? 21  VAL A N    5  
ATOM 7282  C CA   . VAL A 1 21  ? 9.127   -4.341  -0.981  1.00 0.00 ? 21  VAL A CA   5  
ATOM 7283  C C    . VAL A 1 21  ? 8.999   -5.690  -0.270  1.00 0.00 ? 21  VAL A C    5  
ATOM 7284  O O    . VAL A 1 21  ? 8.727   -6.707  -0.906  1.00 0.00 ? 21  VAL A O    5  
ATOM 7285  C CB   . VAL A 1 21  ? 8.315   -3.232  -0.309  1.00 0.00 ? 21  VAL A CB   5  
ATOM 7286  C CG1  . VAL A 1 21  ? 8.839   -1.851  -0.707  1.00 0.00 ? 21  VAL A CG1  5  
ATOM 7287  C CG2  . VAL A 1 21  ? 6.827   -3.368  -0.633  1.00 0.00 ? 21  VAL A CG2  5  
ATOM 7288  H H    . VAL A 1 21  ? 7.996   -3.860  -2.662  1.00 0.00 ? 21  VAL A H    5  
ATOM 7289  H HA   . VAL A 1 21  ? 10.175  -4.041  -0.978  1.00 0.00 ? 21  VAL A HA   5  
ATOM 7290  H HB   . VAL A 1 21  ? 8.434   -3.337  0.770   1.00 0.00 ? 21  VAL A HB   5  
ATOM 7291  H HG11 . VAL A 1 21  ? 8.277   -1.082  -0.177  1.00 0.00 ? 21  VAL A HG11 5  
ATOM 7292  H HG12 . VAL A 1 21  ? 9.895   -1.774  -0.447  1.00 0.00 ? 21  VAL A HG12 5  
ATOM 7293  H HG13 . VAL A 1 21  ? 8.719   -1.713  -1.782  1.00 0.00 ? 21  VAL A HG13 5  
ATOM 7294  H HG21 . VAL A 1 21  ? 6.254   -3.404  0.294   1.00 0.00 ? 21  VAL A HG21 5  
ATOM 7295  H HG22 . VAL A 1 21  ? 6.504   -2.513  -1.227  1.00 0.00 ? 21  VAL A HG22 5  
ATOM 7296  H HG23 . VAL A 1 21  ? 6.660   -4.286  -1.198  1.00 0.00 ? 21  VAL A HG23 5  
ATOM 7297  N N    . GLY A 1 22  ? 9.201   -5.655  1.039   1.00 0.00 ? 22  GLY A N    5  
ATOM 7298  C CA   . GLY A 1 22  ? 9.111   -6.862  1.843   1.00 0.00 ? 22  GLY A CA   5  
ATOM 7299  C C    . GLY A 1 22  ? 7.715   -7.480  1.750   1.00 0.00 ? 22  GLY A C    5  
ATOM 7300  O O    . GLY A 1 22  ? 7.044   -7.357  0.727   1.00 0.00 ? 22  GLY A O    5  
ATOM 7301  H H    . GLY A 1 22  ? 9.422   -4.823  1.548   1.00 0.00 ? 22  GLY A H    5  
ATOM 7302  H HA2  . GLY A 1 22  ? 9.855   -7.583  1.506   1.00 0.00 ? 22  GLY A HA2  5  
ATOM 7303  H HA3  . GLY A 1 22  ? 9.342   -6.628  2.882   1.00 0.00 ? 22  GLY A HA3  5  
ATOM 7304  N N    . HIS A 1 23  ? 7.318   -8.131  2.834   1.00 0.00 ? 23  HIS A N    5  
ATOM 7305  C CA   . HIS A 1 23  ? 6.013   -8.768  2.888   1.00 0.00 ? 23  HIS A CA   5  
ATOM 7306  C C    . HIS A 1 23  ? 4.993   -7.799  3.488   1.00 0.00 ? 23  HIS A C    5  
ATOM 7307  O O    . HIS A 1 23  ? 5.110   -7.409  4.649   1.00 0.00 ? 23  HIS A O    5  
ATOM 7308  C CB   . HIS A 1 23  ? 6.088   -10.095 3.646   1.00 0.00 ? 23  HIS A CB   5  
ATOM 7309  C CG   . HIS A 1 23  ? 7.477   -10.683 3.720   1.00 0.00 ? 23  HIS A CG   5  
ATOM 7310  N ND1  . HIS A 1 23  ? 7.842   -11.833 3.042   1.00 0.00 ? 23  HIS A ND1  5  
ATOM 7311  C CD2  . HIS A 1 23  ? 8.585   -10.268 4.398   1.00 0.00 ? 23  HIS A CD2  5  
ATOM 7312  C CE1  . HIS A 1 23  ? 9.114   -12.089 3.307   1.00 0.00 ? 23  HIS A CE1  5  
ATOM 7313  N NE2  . HIS A 1 23  ? 9.573   -11.118 4.148   1.00 0.00 ? 23  HIS A NE2  5  
ATOM 7314  H H    . HIS A 1 23  ? 7.869   -8.226  3.663   1.00 0.00 ? 23  HIS A H    5  
ATOM 7315  H HA   . HIS A 1 23  ? 5.730   -8.989  1.859   1.00 0.00 ? 23  HIS A HA   5  
ATOM 7316  H HB2  . HIS A 1 23  ? 5.714   -9.945  4.659   1.00 0.00 ? 23  HIS A HB2  5  
ATOM 7317  H HB3  . HIS A 1 23  ? 5.425   -10.814 3.165   1.00 0.00 ? 23  HIS A HB3  5  
ATOM 7318  H HD1  . HIS A 1 23  ? 7.246   -12.377 2.451   1.00 0.00 ? 23  HIS A HD1  5  
ATOM 7319  H HD2  . HIS A 1 23  ? 8.649   -9.387  5.037   1.00 0.00 ? 23  HIS A HD2  5  
ATOM 7320  H HE1  . HIS A 1 23  ? 9.693   -12.928 2.921   1.00 0.00 ? 23  HIS A HE1  5  
ATOM 7321  N N    . LEU A 1 24  ? 4.015   -7.438  2.670   1.00 0.00 ? 24  LEU A N    5  
ATOM 7322  C CA   . LEU A 1 24  ? 2.975   -6.522  3.106   1.00 0.00 ? 24  LEU A CA   5  
ATOM 7323  C C    . LEU A 1 24  ? 2.222   -7.136  4.288   1.00 0.00 ? 24  LEU A C    5  
ATOM 7324  O O    . LEU A 1 24  ? 2.065   -8.354  4.363   1.00 0.00 ? 24  LEU A O    5  
ATOM 7325  C CB   . LEU A 1 24  ? 2.071   -6.140  1.932   1.00 0.00 ? 24  LEU A CB   5  
ATOM 7326  C CG   . LEU A 1 24  ? 2.165   -4.689  1.457   1.00 0.00 ? 24  LEU A CG   5  
ATOM 7327  C CD1  . LEU A 1 24  ? 3.300   -4.516  0.446   1.00 0.00 ? 24  LEU A CD1  5  
ATOM 7328  C CD2  . LEU A 1 24  ? 0.824   -4.206  0.900   1.00 0.00 ? 24  LEU A CD2  5  
ATOM 7329  H H    . LEU A 1 24  ? 3.927   -7.760  1.728   1.00 0.00 ? 24  LEU A H    5  
ATOM 7330  H HA   . LEU A 1 24  ? 3.465   -5.609  3.445   1.00 0.00 ? 24  LEU A HA   5  
ATOM 7331  H HB2  . LEU A 1 24  ? 2.305   -6.793  1.092   1.00 0.00 ? 24  LEU A HB2  5  
ATOM 7332  H HB3  . LEU A 1 24  ? 1.038   -6.343  2.215   1.00 0.00 ? 24  LEU A HB3  5  
ATOM 7333  H HG   . LEU A 1 24  ? 2.401   -4.063  2.317   1.00 0.00 ? 24  LEU A HG   5  
ATOM 7334  H HD11 . LEU A 1 24  ? 3.819   -5.466  0.316   1.00 0.00 ? 24  LEU A HD11 5  
ATOM 7335  H HD12 . LEU A 1 24  ? 2.889   -4.193  -0.511  1.00 0.00 ? 24  LEU A HD12 5  
ATOM 7336  H HD13 . LEU A 1 24  ? 4.001   -3.766  0.812   1.00 0.00 ? 24  LEU A HD13 5  
ATOM 7337  H HD21 . LEU A 1 24  ? 0.899   -3.152  0.636   1.00 0.00 ? 24  LEU A HD21 5  
ATOM 7338  H HD22 . LEU A 1 24  ? 0.568   -4.786  0.014   1.00 0.00 ? 24  LEU A HD22 5  
ATOM 7339  H HD23 . LEU A 1 24  ? 0.049   -4.337  1.656   1.00 0.00 ? 24  LEU A HD23 5  
ATOM 7340  N N    . SER A 1 25  ? 1.777   -6.266  5.182   1.00 0.00 ? 25  SER A N    5  
ATOM 7341  C CA   . SER A 1 25  ? 1.045   -6.707  6.357   1.00 0.00 ? 25  SER A CA   5  
ATOM 7342  C C    . SER A 1 25  ? -0.050  -5.696  6.702   1.00 0.00 ? 25  SER A C    5  
ATOM 7343  O O    . SER A 1 25  ? -0.080  -4.596  6.151   1.00 0.00 ? 25  SER A O    5  
ATOM 7344  C CB   . SER A 1 25  ? 1.983   -6.902  7.549   1.00 0.00 ? 25  SER A CB   5  
ATOM 7345  O OG   . SER A 1 25  ? 3.275   -7.346  7.146   1.00 0.00 ? 25  SER A OG   5  
ATOM 7346  H H    . SER A 1 25  ? 1.909   -5.277  5.114   1.00 0.00 ? 25  SER A H    5  
ATOM 7347  H HA   . SER A 1 25  ? 0.607   -7.666  6.080   1.00 0.00 ? 25  SER A HA   5  
ATOM 7348  H HB2  . SER A 1 25  ? 2.077   -5.962  8.094   1.00 0.00 ? 25  SER A HB2  5  
ATOM 7349  H HB3  . SER A 1 25  ? 1.549   -7.627  8.238   1.00 0.00 ? 25  SER A HB3  5  
ATOM 7350  H HG   . SER A 1 25  ? 3.430   -8.282  7.463   1.00 0.00 ? 25  SER A HG   5  
ATOM 7351  N N    . PHE A 1 26  ? -0.922  -6.104  7.612   1.00 0.00 ? 26  PHE A N    5  
ATOM 7352  C CA   . PHE A 1 26  ? -2.016  -5.247  8.037   1.00 0.00 ? 26  PHE A CA   5  
ATOM 7353  C C    . PHE A 1 26  ? -2.346  -5.471  9.514   1.00 0.00 ? 26  PHE A C    5  
ATOM 7354  O O    . PHE A 1 26  ? -2.116  -6.555  10.047  1.00 0.00 ? 26  PHE A O    5  
ATOM 7355  C CB   . PHE A 1 26  ? -3.234  -5.623  7.191   1.00 0.00 ? 26  PHE A CB   5  
ATOM 7356  C CG   . PHE A 1 26  ? -3.018  -5.467  5.685   1.00 0.00 ? 26  PHE A CG   5  
ATOM 7357  C CD1  . PHE A 1 26  ? -3.086  -4.235  5.112   1.00 0.00 ? 26  PHE A CD1  5  
ATOM 7358  C CD2  . PHE A 1 26  ? -2.758  -6.560  4.918   1.00 0.00 ? 26  PHE A CD2  5  
ATOM 7359  C CE1  . PHE A 1 26  ? -2.885  -4.090  3.714   1.00 0.00 ? 26  PHE A CE1  5  
ATOM 7360  C CE2  . PHE A 1 26  ? -2.558  -6.415  3.520   1.00 0.00 ? 26  PHE A CE2  5  
ATOM 7361  C CZ   . PHE A 1 26  ? -2.626  -5.183  2.947   1.00 0.00 ? 26  PHE A CZ   5  
ATOM 7362  H H    . PHE A 1 26  ? -0.891  -6.999  8.055   1.00 0.00 ? 26  PHE A H    5  
ATOM 7363  H HA   . PHE A 1 26  ? -1.694  -4.215  7.891   1.00 0.00 ? 26  PHE A HA   5  
ATOM 7364  H HB2  . PHE A 1 26  ? -3.506  -6.657  7.404   1.00 0.00 ? 26  PHE A HB2  5  
ATOM 7365  H HB3  . PHE A 1 26  ? -4.079  -5.004  7.493   1.00 0.00 ? 26  PHE A HB3  5  
ATOM 7366  H HD1  . PHE A 1 26  ? -3.294  -3.360  5.727   1.00 0.00 ? 26  PHE A HD1  5  
ATOM 7367  H HD2  . PHE A 1 26  ? -2.704  -7.547  5.377   1.00 0.00 ? 26  PHE A HD2  5  
ATOM 7368  H HE1  . PHE A 1 26  ? -2.940  -3.103  3.255   1.00 0.00 ? 26  PHE A HE1  5  
ATOM 7369  H HE2  . PHE A 1 26  ? -2.350  -7.291  2.905   1.00 0.00 ? 26  PHE A HE2  5  
ATOM 7370  H HZ   . PHE A 1 26  ? -2.472  -5.072  1.874   1.00 0.00 ? 26  PHE A HZ   5  
ATOM 7371  N N    . SER A 1 27  ? -2.880  -4.429  10.133  1.00 0.00 ? 27  SER A N    5  
ATOM 7372  C CA   . SER A 1 27  ? -3.244  -4.498  11.538  1.00 0.00 ? 27  SER A CA   5  
ATOM 7373  C C    . SER A 1 27  ? -4.285  -3.425  11.863  1.00 0.00 ? 27  SER A C    5  
ATOM 7374  O O    . SER A 1 27  ? -4.557  -2.550  11.042  1.00 0.00 ? 27  SER A O    5  
ATOM 7375  C CB   . SER A 1 27  ? -2.015  -4.334  12.434  1.00 0.00 ? 27  SER A CB   5  
ATOM 7376  O OG   . SER A 1 27  ? -1.705  -5.533  13.139  1.00 0.00 ? 27  SER A OG   5  
ATOM 7377  H H    . SER A 1 27  ? -3.064  -3.550  9.692   1.00 0.00 ? 27  SER A H    5  
ATOM 7378  H HA   . SER A 1 27  ? -3.665  -5.494  11.678  1.00 0.00 ? 27  SER A HA   5  
ATOM 7379  H HB2  . SER A 1 27  ? -1.160  -4.039  11.826  1.00 0.00 ? 27  SER A HB2  5  
ATOM 7380  H HB3  . SER A 1 27  ? -2.192  -3.529  13.147  1.00 0.00 ? 27  SER A HB3  5  
ATOM 7381  H HG   . SER A 1 27  ? -2.001  -5.456  14.091  1.00 0.00 ? 27  SER A HG   5  
ATOM 7382  N N    . GLU A 1 28  ? -4.840  -3.527  13.061  1.00 0.00 ? 28  GLU A N    5  
ATOM 7383  C CA   . GLU A 1 28  ? -5.845  -2.576  13.505  1.00 0.00 ? 28  GLU A CA   5  
ATOM 7384  C C    . GLU A 1 28  ? -6.816  -2.260  12.365  1.00 0.00 ? 28  GLU A C    5  
ATOM 7385  O O    . GLU A 1 28  ? -7.005  -1.098  12.010  1.00 0.00 ? 28  GLU A O    5  
ATOM 7386  C CB   . GLU A 1 28  ? -5.194  -1.300  14.040  1.00 0.00 ? 28  GLU A CB   5  
ATOM 7387  C CG   . GLU A 1 28  ? -4.405  -1.582  15.320  1.00 0.00 ? 28  GLU A CG   5  
ATOM 7388  C CD   . GLU A 1 28  ? -5.339  -1.695  16.526  1.00 0.00 ? 28  GLU A CD   5  
ATOM 7389  O OE1  . GLU A 1 28  ? -5.876  -2.806  16.726  1.00 0.00 ? 28  GLU A OE1  5  
ATOM 7390  O OE2  . GLU A 1 28  ? -5.496  -0.668  17.221  1.00 0.00 ? 28  GLU A OE2  5  
ATOM 7391  H H    . GLU A 1 28  ? -4.614  -4.242  13.723  1.00 0.00 ? 28  GLU A H    5  
ATOM 7392  H HA   . GLU A 1 28  ? -6.376  -3.073  14.316  1.00 0.00 ? 28  GLU A HA   5  
ATOM 7393  H HB2  . GLU A 1 28  ? -4.529  -0.882  13.284  1.00 0.00 ? 28  GLU A HB2  5  
ATOM 7394  H HB3  . GLU A 1 28  ? -5.961  -0.551  14.239  1.00 0.00 ? 28  GLU A HB3  5  
ATOM 7395  H HG2  . GLU A 1 28  ? -3.839  -2.506  15.206  1.00 0.00 ? 28  GLU A HG2  5  
ATOM 7396  H HG3  . GLU A 1 28  ? -3.682  -0.784  15.489  1.00 0.00 ? 28  GLU A HG3  5  
ATOM 7397  N N    . ILE A 1 29  ? -7.406  -3.316  11.823  1.00 0.00 ? 29  ILE A N    5  
ATOM 7398  C CA   . ILE A 1 29  ? -8.353  -3.165  10.731  1.00 0.00 ? 29  ILE A CA   5  
ATOM 7399  C C    . ILE A 1 29  ? -9.738  -2.855  11.302  1.00 0.00 ? 29  ILE A C    5  
ATOM 7400  O O    . ILE A 1 29  ? -10.157 -3.460  12.288  1.00 0.00 ? 29  ILE A O    5  
ATOM 7401  C CB   . ILE A 1 29  ? -8.323  -4.397  9.823   1.00 0.00 ? 29  ILE A CB   5  
ATOM 7402  C CG1  . ILE A 1 29  ? -6.885  -4.816  9.514   1.00 0.00 ? 29  ILE A CG1  5  
ATOM 7403  C CG2  . ILE A 1 29  ? -9.137  -4.159  8.550   1.00 0.00 ? 29  ILE A CG2  5  
ATOM 7404  C CD1  . ILE A 1 29  ? -6.816  -5.627  8.219   1.00 0.00 ? 29  ILE A CD1  5  
ATOM 7405  H H    . ILE A 1 29  ? -7.247  -4.258  12.118  1.00 0.00 ? 29  ILE A H    5  
ATOM 7406  H HA   . ILE A 1 29  ? -8.027  -2.315  10.132  1.00 0.00 ? 29  ILE A HA   5  
ATOM 7407  H HB   . ILE A 1 29  ? -8.793  -5.224  10.355  1.00 0.00 ? 29  ILE A HB   5  
ATOM 7408  H HG12 . ILE A 1 29  ? -6.255  -3.931  9.427   1.00 0.00 ? 29  ILE A HG12 5  
ATOM 7409  H HG13 . ILE A 1 29  ? -6.489  -5.408  10.340  1.00 0.00 ? 29  ILE A HG13 5  
ATOM 7410  H HG21 . ILE A 1 29  ? -9.795  -3.301  8.694   1.00 0.00 ? 29  ILE A HG21 5  
ATOM 7411  H HG22 . ILE A 1 29  ? -8.461  -3.962  7.718   1.00 0.00 ? 29  ILE A HG22 5  
ATOM 7412  H HG23 . ILE A 1 29  ? -9.736  -5.043  8.331   1.00 0.00 ? 29  ILE A HG23 5  
ATOM 7413  H HD11 . ILE A 1 29  ? -6.509  -4.978  7.399   1.00 0.00 ? 29  ILE A HD11 5  
ATOM 7414  H HD12 . ILE A 1 29  ? -6.093  -6.435  8.334   1.00 0.00 ? 29  ILE A HD12 5  
ATOM 7415  H HD13 . ILE A 1 29  ? -7.798  -6.047  8.001   1.00 0.00 ? 29  ILE A HD13 5  
ATOM 7416  N N    . LEU A 1 30  ? -10.410 -1.913  10.658  1.00 0.00 ? 30  LEU A N    5  
ATOM 7417  C CA   . LEU A 1 30  ? -11.740 -1.514  11.089  1.00 0.00 ? 30  LEU A CA   5  
ATOM 7418  C C    . LEU A 1 30  ? -12.760 -1.921  10.024  1.00 0.00 ? 30  LEU A C    5  
ATOM 7419  O O    . LEU A 1 30  ? -12.841 -3.091  9.652   1.00 0.00 ? 30  LEU A O    5  
ATOM 7420  C CB   . LEU A 1 30  ? -11.768 -0.023  11.430  1.00 0.00 ? 30  LEU A CB   5  
ATOM 7421  C CG   . LEU A 1 30  ? -10.949 0.401   12.651  1.00 0.00 ? 30  LEU A CG   5  
ATOM 7422  C CD1  . LEU A 1 30  ? -11.330 -0.426  13.880  1.00 0.00 ? 30  LEU A CD1  5  
ATOM 7423  C CD2  . LEU A 1 30  ? -9.450  0.334   12.356  1.00 0.00 ? 30  LEU A CD2  5  
ATOM 7424  H H    . LEU A 1 30  ? -10.062 -1.425  9.857   1.00 0.00 ? 30  LEU A H    5  
ATOM 7425  H HA   . LEU A 1 30  ? -11.962 -2.059  12.006  1.00 0.00 ? 30  LEU A HA   5  
ATOM 7426  H HB2  . LEU A 1 30  ? -11.409 0.534   10.565  1.00 0.00 ? 30  LEU A HB2  5  
ATOM 7427  H HB3  . LEU A 1 30  ? -12.805 0.272   11.592  1.00 0.00 ? 30  LEU A HB3  5  
ATOM 7428  H HG   . LEU A 1 30  ? -11.186 1.441   12.876  1.00 0.00 ? 30  LEU A HG   5  
ATOM 7429  H HD11 . LEU A 1 30  ? -10.789 -1.372  13.863  1.00 0.00 ? 30  LEU A HD11 5  
ATOM 7430  H HD12 . LEU A 1 30  ? -11.068 0.125   14.784  1.00 0.00 ? 30  LEU A HD12 5  
ATOM 7431  H HD13 . LEU A 1 30  ? -12.402 -0.619  13.871  1.00 0.00 ? 30  LEU A HD13 5  
ATOM 7432  H HD21 . LEU A 1 30  ? -9.092  -0.683  12.521  1.00 0.00 ? 30  LEU A HD21 5  
ATOM 7433  H HD22 . LEU A 1 30  ? -9.270  0.618   11.319  1.00 0.00 ? 30  LEU A HD22 5  
ATOM 7434  H HD23 . LEU A 1 30  ? -8.918  1.017   13.017  1.00 0.00 ? 30  LEU A HD23 5  
ATOM 7435  N N    . ASP A 1 31  ? -13.512 -0.933  9.563   1.00 0.00 ? 31  ASP A N    5  
ATOM 7436  C CA   . ASP A 1 31  ? -14.524 -1.173  8.547   1.00 0.00 ? 31  ASP A CA   5  
ATOM 7437  C C    . ASP A 1 31  ? -14.121 -0.462  7.254   1.00 0.00 ? 31  ASP A C    5  
ATOM 7438  O O    . ASP A 1 31  ? -14.407 -0.946  6.160   1.00 0.00 ? 31  ASP A O    5  
ATOM 7439  C CB   . ASP A 1 31  ? -15.884 -0.626  8.984   1.00 0.00 ? 31  ASP A CB   5  
ATOM 7440  C CG   . ASP A 1 31  ? -15.831 0.692   9.761   1.00 0.00 ? 31  ASP A CG   5  
ATOM 7441  O OD1  . ASP A 1 31  ? -15.335 1.677   9.173   1.00 0.00 ? 31  ASP A OD1  5  
ATOM 7442  O OD2  . ASP A 1 31  ? -16.289 0.684   10.924  1.00 0.00 ? 31  ASP A OD2  5  
ATOM 7443  H H    . ASP A 1 31  ? -13.439 0.016   9.870   1.00 0.00 ? 31  ASP A H    5  
ATOM 7444  H HA   . ASP A 1 31  ? -14.563 -2.257  8.433   1.00 0.00 ? 31  ASP A HA   5  
ATOM 7445  H HB2  . ASP A 1 31  ? -16.503 -0.484  8.099   1.00 0.00 ? 31  ASP A HB2  5  
ATOM 7446  H HB3  . ASP A 1 31  ? -16.379 -1.375  9.603   1.00 0.00 ? 31  ASP A HB3  5  
ATOM 7447  N N    . THR A 1 32  ? -13.463 0.676   7.422   1.00 0.00 ? 32  THR A N    5  
ATOM 7448  C CA   . THR A 1 32  ? -13.018 1.459   6.282   1.00 0.00 ? 32  THR A CA   5  
ATOM 7449  C C    . THR A 1 32  ? -11.645 2.073   6.560   1.00 0.00 ? 32  THR A C    5  
ATOM 7450  O O    . THR A 1 32  ? -11.258 3.051   5.922   1.00 0.00 ? 32  THR A O    5  
ATOM 7451  C CB   . THR A 1 32  ? -14.097 2.498   5.972   1.00 0.00 ? 32  THR A CB   5  
ATOM 7452  O OG1  . THR A 1 32  ? -14.071 3.372   7.097   1.00 0.00 ? 32  THR A OG1  5  
ATOM 7453  C CG2  . THR A 1 32  ? -15.507 1.903   5.995   1.00 0.00 ? 32  THR A CG2  5  
ATOM 7454  H H    . THR A 1 32  ? -13.234 1.063   8.315   1.00 0.00 ? 32  THR A H    5  
ATOM 7455  H HA   . THR A 1 32  ? -12.902 0.789   5.430   1.00 0.00 ? 32  THR A HA   5  
ATOM 7456  H HB   . THR A 1 32  ? -13.899 2.993   5.021   1.00 0.00 ? 32  THR A HB   5  
ATOM 7457  H HG1  . THR A 1 32  ? -13.216 3.890   7.108   1.00 0.00 ? 32  THR A HG1  5  
ATOM 7458  H HG21 . THR A 1 32  ? -16.206 2.607   5.543   1.00 0.00 ? 32  THR A HG21 5  
ATOM 7459  H HG22 . THR A 1 32  ? -15.517 0.970   5.432   1.00 0.00 ? 32  THR A HG22 5  
ATOM 7460  H HG23 . THR A 1 32  ? -15.803 1.709   7.026   1.00 0.00 ? 32  THR A HG23 5  
ATOM 7461  N N    . SER A 1 33  ? -10.946 1.474   7.513   1.00 0.00 ? 33  SER A N    5  
ATOM 7462  C CA   . SER A 1 33  ? -9.624  1.950   7.883   1.00 0.00 ? 33  SER A CA   5  
ATOM 7463  C C    . SER A 1 33  ? -8.766  0.783   8.374   1.00 0.00 ? 33  SER A C    5  
ATOM 7464  O O    . SER A 1 33  ? -9.201  -0.001  9.217   1.00 0.00 ? 33  SER A O    5  
ATOM 7465  C CB   . SER A 1 33  ? -9.711  3.035   8.959   1.00 0.00 ? 33  SER A CB   5  
ATOM 7466  O OG   . SER A 1 33  ? -10.872 2.889   9.771   1.00 0.00 ? 33  SER A OG   5  
ATOM 7467  H H    . SER A 1 33  ? -11.268 0.679   8.027   1.00 0.00 ? 33  SER A H    5  
ATOM 7468  H HA   . SER A 1 33  ? -9.205  2.376   6.972   1.00 0.00 ? 33  SER A HA   5  
ATOM 7469  H HB2  . SER A 1 33  ? -8.821  2.993   9.588   1.00 0.00 ? 33  SER A HB2  5  
ATOM 7470  H HB3  . SER A 1 33  ? -9.720  4.016   8.485   1.00 0.00 ? 33  SER A HB3  5  
ATOM 7471  H HG   . SER A 1 33  ? -10.611 2.839   10.735  1.00 0.00 ? 33  SER A HG   5  
ATOM 7472  N N    . LEU A 1 34  ? -7.562  0.703   7.826   1.00 0.00 ? 34  LEU A N    5  
ATOM 7473  C CA   . LEU A 1 34  ? -6.639  -0.355  8.198   1.00 0.00 ? 34  LEU A CA   5  
ATOM 7474  C C    . LEU A 1 34  ? -5.203  0.149   8.046   1.00 0.00 ? 34  LEU A C    5  
ATOM 7475  O O    . LEU A 1 34  ? -4.932  1.024   7.225   1.00 0.00 ? 34  LEU A O    5  
ATOM 7476  C CB   . LEU A 1 34  ? -6.932  -1.627  7.399   1.00 0.00 ? 34  LEU A CB   5  
ATOM 7477  C CG   . LEU A 1 34  ? -6.861  -1.494  5.877   1.00 0.00 ? 34  LEU A CG   5  
ATOM 7478  C CD1  . LEU A 1 34  ? -5.411  -1.536  5.390   1.00 0.00 ? 34  LEU A CD1  5  
ATOM 7479  C CD2  . LEU A 1 34  ? -7.727  -2.553  5.192   1.00 0.00 ? 34  LEU A CD2  5  
ATOM 7480  H H    . LEU A 1 34  ? -7.216  1.345   7.142   1.00 0.00 ? 34  LEU A H    5  
ATOM 7481  H HA   . LEU A 1 34  ? -6.814  -0.588  9.249   1.00 0.00 ? 34  LEU A HA   5  
ATOM 7482  H HB2  . LEU A 1 34  ? -6.227  -2.398  7.710   1.00 0.00 ? 34  LEU A HB2  5  
ATOM 7483  H HB3  . LEU A 1 34  ? -7.928  -1.979  7.667   1.00 0.00 ? 34  LEU A HB3  5  
ATOM 7484  H HG   . LEU A 1 34  ? -7.265  -0.520  5.600   1.00 0.00 ? 34  LEU A HG   5  
ATOM 7485  H HD11 . LEU A 1 34  ? -5.358  -1.145  4.374   1.00 0.00 ? 34  LEU A HD11 5  
ATOM 7486  H HD12 . LEU A 1 34  ? -4.789  -0.928  6.047   1.00 0.00 ? 34  LEU A HD12 5  
ATOM 7487  H HD13 . LEU A 1 34  ? -5.054  -2.566  5.402   1.00 0.00 ? 34  LEU A HD13 5  
ATOM 7488  H HD21 . LEU A 1 34  ? -8.001  -3.321  5.916   1.00 0.00 ? 34  LEU A HD21 5  
ATOM 7489  H HD22 . LEU A 1 34  ? -8.630  -2.086  4.799   1.00 0.00 ? 34  LEU A HD22 5  
ATOM 7490  H HD23 . LEU A 1 34  ? -7.167  -3.007  4.375   1.00 0.00 ? 34  LEU A HD23 5  
ATOM 7491  N N    . LYS A 1 35  ? -4.320  -0.424  8.850   1.00 0.00 ? 35  LYS A N    5  
ATOM 7492  C CA   . LYS A 1 35  ? -2.918  -0.043  8.815   1.00 0.00 ? 35  LYS A CA   5  
ATOM 7493  C C    . LYS A 1 35  ? -2.161  -0.986  7.878   1.00 0.00 ? 35  LYS A C    5  
ATOM 7494  O O    . LYS A 1 35  ? -2.375  -2.197  7.904   1.00 0.00 ? 35  LYS A O    5  
ATOM 7495  C CB   . LYS A 1 35  ? -2.341  0.009   10.232  1.00 0.00 ? 35  LYS A CB   5  
ATOM 7496  C CG   . LYS A 1 35  ? -1.128  0.939   10.296  1.00 0.00 ? 35  LYS A CG   5  
ATOM 7497  C CD   . LYS A 1 35  ? 0.159   0.186   9.951   1.00 0.00 ? 35  LYS A CD   5  
ATOM 7498  C CE   . LYS A 1 35  ? 0.782   -0.434  11.203  1.00 0.00 ? 35  LYS A CE   5  
ATOM 7499  N NZ   . LYS A 1 35  ? 0.909   -1.900  11.047  1.00 0.00 ? 35  LYS A NZ   5  
ATOM 7500  H H    . LYS A 1 35  ? -4.548  -1.135  9.516   1.00 0.00 ? 35  LYS A H    5  
ATOM 7501  H HA   . LYS A 1 35  ? -2.864  0.966   8.408   1.00 0.00 ? 35  LYS A HA   5  
ATOM 7502  H HB2  . LYS A 1 35  ? -3.106  0.355   10.927  1.00 0.00 ? 35  LYS A HB2  5  
ATOM 7503  H HB3  . LYS A 1 35  ? -2.053  -0.993  10.548  1.00 0.00 ? 35  LYS A HB3  5  
ATOM 7504  H HG2  . LYS A 1 35  ? -1.264  1.769   9.602   1.00 0.00 ? 35  LYS A HG2  5  
ATOM 7505  H HG3  . LYS A 1 35  ? -1.046  1.368   11.294  1.00 0.00 ? 35  LYS A HG3  5  
ATOM 7506  H HD2  . LYS A 1 35  ? -0.057  -0.595  9.223   1.00 0.00 ? 35  LYS A HD2  5  
ATOM 7507  H HD3  . LYS A 1 35  ? 0.870   0.868   9.486   1.00 0.00 ? 35  LYS A HD3  5  
ATOM 7508  H HE2  . LYS A 1 35  ? 1.764   0.005   11.383  1.00 0.00 ? 35  LYS A HE2  5  
ATOM 7509  H HE3  . LYS A 1 35  ? 0.167   -0.207  12.074  1.00 0.00 ? 35  LYS A HE3  5  
ATOM 7510  H HZ1  . LYS A 1 35  ? 1.215   -2.112  10.119  1.00 0.00 ? 35  LYS A HZ1  5  
ATOM 7511  H HZ2  . LYS A 1 35  ? 1.576   -2.249  11.706  1.00 0.00 ? 35  LYS A HZ2  5  
ATOM 7512  H HZ3  . LYS A 1 35  ? 0.021   -2.331  11.212  1.00 0.00 ? 35  LYS A HZ3  5  
ATOM 7513  N N    . VAL A 1 36  ? -1.291  -0.395  7.072   1.00 0.00 ? 36  VAL A N    5  
ATOM 7514  C CA   . VAL A 1 36  ? -0.501  -1.167  6.128   1.00 0.00 ? 36  VAL A CA   5  
ATOM 7515  C C    . VAL A 1 36  ? 0.971   -1.117  6.540   1.00 0.00 ? 36  VAL A C    5  
ATOM 7516  O O    . VAL A 1 36  ? 1.443   -0.100  7.046   1.00 0.00 ? 36  VAL A O    5  
ATOM 7517  C CB   . VAL A 1 36  ? -0.741  -0.658  4.705   1.00 0.00 ? 36  VAL A CB   5  
ATOM 7518  C CG1  . VAL A 1 36  ? 0.229   -1.310  3.718   1.00 0.00 ? 36  VAL A CG1  5  
ATOM 7519  C CG2  . VAL A 1 36  ? -2.193  -0.886  4.279   1.00 0.00 ? 36  VAL A CG2  5  
ATOM 7520  H H    . VAL A 1 36  ? -1.123  0.591   7.057   1.00 0.00 ? 36  VAL A H    5  
ATOM 7521  H HA   . VAL A 1 36  ? -0.845  -2.200  6.179   1.00 0.00 ? 36  VAL A HA   5  
ATOM 7522  H HB   . VAL A 1 36  ? -0.555  0.416   4.698   1.00 0.00 ? 36  VAL A HB   5  
ATOM 7523  H HG11 . VAL A 1 36  ? -0.163  -2.280  3.410   1.00 0.00 ? 36  VAL A HG11 5  
ATOM 7524  H HG12 . VAL A 1 36  ? 0.343   -0.670  2.844   1.00 0.00 ? 36  VAL A HG12 5  
ATOM 7525  H HG13 . VAL A 1 36  ? 1.198   -1.446  4.198   1.00 0.00 ? 36  VAL A HG13 5  
ATOM 7526  H HG21 . VAL A 1 36  ? -2.623  -1.693  4.872   1.00 0.00 ? 36  VAL A HG21 5  
ATOM 7527  H HG22 . VAL A 1 36  ? -2.766  0.027   4.438   1.00 0.00 ? 36  VAL A HG22 5  
ATOM 7528  H HG23 . VAL A 1 36  ? -2.224  -1.155  3.223   1.00 0.00 ? 36  VAL A HG23 5  
ATOM 7529  N N    . SER A 1 37  ? 1.656   -2.227  6.309   1.00 0.00 ? 37  SER A N    5  
ATOM 7530  C CA   . SER A 1 37  ? 3.065   -2.322  6.650   1.00 0.00 ? 37  SER A CA   5  
ATOM 7531  C C    . SER A 1 37  ? 3.807   -3.136  5.588   1.00 0.00 ? 37  SER A C    5  
ATOM 7532  O O    . SER A 1 37  ? 3.184   -3.837  4.791   1.00 0.00 ? 37  SER A O    5  
ATOM 7533  C CB   . SER A 1 37  ? 3.256   -2.953  8.031   1.00 0.00 ? 37  SER A CB   5  
ATOM 7534  O OG   . SER A 1 37  ? 4.065   -4.124  7.975   1.00 0.00 ? 37  SER A OG   5  
ATOM 7535  H H    . SER A 1 37  ? 1.264   -3.050  5.896   1.00 0.00 ? 37  SER A H    5  
ATOM 7536  H HA   . SER A 1 37  ? 3.428   -1.295  6.667   1.00 0.00 ? 37  SER A HA   5  
ATOM 7537  H HB2  . SER A 1 37  ? 3.716   -2.226  8.700   1.00 0.00 ? 37  SER A HB2  5  
ATOM 7538  H HB3  . SER A 1 37  ? 2.283   -3.204  8.452   1.00 0.00 ? 37  SER A HB3  5  
ATOM 7539  H HG   . SER A 1 37  ? 4.971   -3.933  8.353   1.00 0.00 ? 37  SER A HG   5  
ATOM 7540  N N    . TRP A 1 38  ? 5.126   -3.017  5.611   1.00 0.00 ? 38  TRP A N    5  
ATOM 7541  C CA   . TRP A 1 38  ? 5.959   -3.733  4.659   1.00 0.00 ? 38  TRP A CA   5  
ATOM 7542  C C    . TRP A 1 38  ? 7.410   -3.637  5.136   1.00 0.00 ? 38  TRP A C    5  
ATOM 7543  O O    . TRP A 1 38  ? 7.688   -3.039  6.174   1.00 0.00 ? 38  TRP A O    5  
ATOM 7544  C CB   . TRP A 1 38  ? 5.759   -3.194  3.241   1.00 0.00 ? 38  TRP A CB   5  
ATOM 7545  C CG   . TRP A 1 38  ? 6.042   -1.698  3.097   1.00 0.00 ? 38  TRP A CG   5  
ATOM 7546  C CD1  . TRP A 1 38  ? 7.215   -1.101  2.845   1.00 0.00 ? 38  TRP A CD1  5  
ATOM 7547  C CD2  . TRP A 1 38  ? 5.082   -0.626  3.209   1.00 0.00 ? 38  TRP A CD2  5  
ATOM 7548  N NE1  . TRP A 1 38  ? 7.082   0.271   2.785   1.00 0.00 ? 38  TRP A NE1  5  
ATOM 7549  C CE2  . TRP A 1 38  ? 5.744   0.569   3.014   1.00 0.00 ? 38  TRP A CE2  5  
ATOM 7550  C CE3  . TRP A 1 38  ? 3.701   -0.665  3.466   1.00 0.00 ? 38  TRP A CE3  5  
ATOM 7551  C CZ2  . TRP A 1 38  ? 5.105   1.814   3.055   1.00 0.00 ? 38  TRP A CZ2  5  
ATOM 7552  C CZ3  . TRP A 1 38  ? 3.077   0.587   3.505   1.00 0.00 ? 38  TRP A CZ3  5  
ATOM 7553  C CH2  . TRP A 1 38  ? 3.729   1.800   3.310   1.00 0.00 ? 38  TRP A CH2  5  
ATOM 7554  H H    . TRP A 1 38  ? 5.624   -2.444  6.262   1.00 0.00 ? 38  TRP A H    5  
ATOM 7555  H HA   . TRP A 1 38  ? 5.637   -4.774  4.652   1.00 0.00 ? 38  TRP A HA   5  
ATOM 7556  H HB2  . TRP A 1 38  ? 6.408   -3.744  2.560   1.00 0.00 ? 38  TRP A HB2  5  
ATOM 7557  H HB3  . TRP A 1 38  ? 4.732   -3.391  2.931   1.00 0.00 ? 38  TRP A HB3  5  
ATOM 7558  H HD1  . TRP A 1 38  ? 8.156   -1.633  2.704   1.00 0.00 ? 38  TRP A HD1  5  
ATOM 7559  H HE1  . TRP A 1 38  ? 7.880   0.989   2.594   1.00 0.00 ? 38  TRP A HE1  5  
ATOM 7560  H HE3  . TRP A 1 38  ? 3.155   -1.596  3.624   1.00 0.00 ? 38  TRP A HE3  5  
ATOM 7561  H HZ2  . TRP A 1 38  ? 5.650   2.745   2.898   1.00 0.00 ? 38  TRP A HZ2  5  
ATOM 7562  H HZ3  . TRP A 1 38  ? 2.005   0.614   3.701   1.00 0.00 ? 38  TRP A HZ3  5  
ATOM 7563  H HH2  . TRP A 1 38  ? 3.171   2.735   3.356   1.00 0.00 ? 38  TRP A HH2  5  
ATOM 7564  N N    . GLN A 1 39  ? 8.297   -4.235  4.354   1.00 0.00 ? 39  GLN A N    5  
ATOM 7565  C CA   . GLN A 1 39  ? 9.712   -4.224  4.683   1.00 0.00 ? 39  GLN A CA   5  
ATOM 7566  C C    . GLN A 1 39  ? 10.528  -3.699  3.500   1.00 0.00 ? 39  GLN A C    5  
ATOM 7567  O O    . GLN A 1 39  ? 9.971   -3.373  2.452   1.00 0.00 ? 39  GLN A O    5  
ATOM 7568  C CB   . GLN A 1 39  ? 10.188  -5.616  5.102   1.00 0.00 ? 39  GLN A CB   5  
ATOM 7569  C CG   . GLN A 1 39  ? 10.496  -5.663  6.599   1.00 0.00 ? 39  GLN A CG   5  
ATOM 7570  C CD   . GLN A 1 39  ? 11.579  -6.700  6.905   1.00 0.00 ? 39  GLN A CD   5  
ATOM 7571  O OE1  . GLN A 1 39  ? 12.766  -6.453  6.772   1.00 0.00 ? 39  GLN A OE1  5  
ATOM 7572  N NE2  . GLN A 1 39  ? 11.105  -7.871  7.320   1.00 0.00 ? 39  GLN A NE2  5  
ATOM 7573  H H    . GLN A 1 39  ? 8.062   -4.719  3.511   1.00 0.00 ? 39  GLN A H    5  
ATOM 7574  H HA   . GLN A 1 39  ? 9.808   -3.544  5.529   1.00 0.00 ? 39  GLN A HA   5  
ATOM 7575  H HB2  . GLN A 1 39  ? 9.422   -6.354  4.861   1.00 0.00 ? 39  GLN A HB2  5  
ATOM 7576  H HB3  . GLN A 1 39  ? 11.079  -5.886  4.535   1.00 0.00 ? 39  GLN A HB3  5  
ATOM 7577  H HG2  . GLN A 1 39  ? 10.823  -4.680  6.938   1.00 0.00 ? 39  GLN A HG2  5  
ATOM 7578  H HG3  . GLN A 1 39  ? 9.589   -5.905  7.154   1.00 0.00 ? 39  GLN A HG3  5  
ATOM 7579  H HE21 . GLN A 1 39  ? 10.118  -8.008  7.408   1.00 0.00 ? 39  GLN A HE21 5  
ATOM 7580  H HE22 . GLN A 1 39  ? 11.735  -8.614  7.545   1.00 0.00 ? 39  GLN A HE22 5  
ATOM 7581  N N    . GLU A 1 40  ? 11.835  -3.632  3.707   1.00 0.00 ? 40  GLU A N    5  
ATOM 7582  C CA   . GLU A 1 40  ? 12.733  -3.152  2.670   1.00 0.00 ? 40  GLU A CA   5  
ATOM 7583  C C    . GLU A 1 40  ? 13.025  -4.266  1.663   1.00 0.00 ? 40  GLU A C    5  
ATOM 7584  O O    . GLU A 1 40  ? 13.307  -5.399  2.049   1.00 0.00 ? 40  GLU A O    5  
ATOM 7585  C CB   . GLU A 1 40  ? 14.028  -2.607  3.276   1.00 0.00 ? 40  GLU A CB   5  
ATOM 7586  C CG   . GLU A 1 40  ? 14.090  -1.083  3.159   1.00 0.00 ? 40  GLU A CG   5  
ATOM 7587  C CD   . GLU A 1 40  ? 15.192  -0.509  4.052   1.00 0.00 ? 40  GLU A CD   5  
ATOM 7588  O OE1  . GLU A 1 40  ? 15.581  -1.221  5.002   1.00 0.00 ? 40  GLU A OE1  5  
ATOM 7589  O OE2  . GLU A 1 40  ? 15.620  0.629   3.763   1.00 0.00 ? 40  GLU A OE2  5  
ATOM 7590  H H    . GLU A 1 40  ? 12.280  -3.899  4.561   1.00 0.00 ? 40  GLU A H    5  
ATOM 7591  H HA   . GLU A 1 40  ? 12.199  -2.339  2.178   1.00 0.00 ? 40  GLU A HA   5  
ATOM 7592  H HB2  . GLU A 1 40  ? 14.094  -2.898  4.325   1.00 0.00 ? 40  GLU A HB2  5  
ATOM 7593  H HB3  . GLU A 1 40  ? 14.885  -3.050  2.769   1.00 0.00 ? 40  GLU A HB3  5  
ATOM 7594  H HG2  . GLU A 1 40  ? 14.273  -0.801  2.123   1.00 0.00 ? 40  GLU A HG2  5  
ATOM 7595  H HG3  . GLU A 1 40  ? 13.128  -0.654  3.441   1.00 0.00 ? 40  GLU A HG3  5  
ATOM 7596  N N    . PRO A 1 41  ? 12.946  -3.895  0.357   1.00 0.00 ? 41  PRO A N    5  
ATOM 7597  C CA   . PRO A 1 41  ? 13.198  -4.850  -0.709  1.00 0.00 ? 41  PRO A CA   5  
ATOM 7598  C C    . PRO A 1 41  ? 14.695  -5.136  -0.846  1.00 0.00 ? 41  PRO A C    5  
ATOM 7599  O O    . PRO A 1 41  ? 15.524  -4.274  -0.559  1.00 0.00 ? 41  PRO A O    5  
ATOM 7600  C CB   . PRO A 1 41  ? 12.598  -4.217  -1.954  1.00 0.00 ? 41  PRO A CB   5  
ATOM 7601  C CG   . PRO A 1 41  ? 12.447  -2.737  -1.639  1.00 0.00 ? 41  PRO A CG   5  
ATOM 7602  C CD   . PRO A 1 41  ? 12.615  -2.562  -0.138  1.00 0.00 ? 41  PRO A CD   5  
ATOM 7603  H HA   . PRO A 1 41  ? 12.770  -5.728  -0.497  1.00 0.00 ? 41  PRO A HA   5  
ATOM 7604  H HB2  . PRO A 1 41  ? 13.245  -4.368  -2.819  1.00 0.00 ? 41  PRO A HB2  5  
ATOM 7605  H HB3  . PRO A 1 41  ? 11.635  -4.665  -2.195  1.00 0.00 ? 41  PRO A HB3  5  
ATOM 7606  H HG2  . PRO A 1 41  ? 13.194  -2.154  -2.177  1.00 0.00 ? 41  PRO A HG2  5  
ATOM 7607  H HG3  . PRO A 1 41  ? 11.470  -2.377  -1.958  1.00 0.00 ? 41  PRO A HG3  5  
ATOM 7608  H HD2  . PRO A 1 41  ? 13.405  -1.847  0.091   1.00 0.00 ? 41  PRO A HD2  5  
ATOM 7609  H HD3  . PRO A 1 41  ? 11.701  -2.185  0.321   1.00 0.00 ? 41  PRO A HD3  5  
ATOM 7610  N N    . GLY A 1 42  ? 14.995  -6.350  -1.284  1.00 0.00 ? 42  GLY A N    5  
ATOM 7611  C CA   . GLY A 1 42  ? 16.377  -6.761  -1.462  1.00 0.00 ? 42  GLY A CA   5  
ATOM 7612  C C    . GLY A 1 42  ? 16.949  -6.209  -2.769  1.00 0.00 ? 42  GLY A C    5  
ATOM 7613  O O    . GLY A 1 42  ? 18.145  -6.332  -3.028  1.00 0.00 ? 42  GLY A O    5  
ATOM 7614  H H    . GLY A 1 42  ? 14.314  -7.045  -1.515  1.00 0.00 ? 42  GLY A H    5  
ATOM 7615  H HA2  . GLY A 1 42  ? 16.976  -6.408  -0.622  1.00 0.00 ? 42  GLY A HA2  5  
ATOM 7616  H HA3  . GLY A 1 42  ? 16.439  -7.849  -1.463  1.00 0.00 ? 42  GLY A HA3  5  
ATOM 7617  N N    . GLU A 1 43  ? 16.067  -5.614  -3.559  1.00 0.00 ? 43  GLU A N    5  
ATOM 7618  C CA   . GLU A 1 43  ? 16.469  -5.043  -4.833  1.00 0.00 ? 43  GLU A CA   5  
ATOM 7619  C C    . GLU A 1 43  ? 16.549  -3.519  -4.731  1.00 0.00 ? 43  GLU A C    5  
ATOM 7620  O O    . GLU A 1 43  ? 16.247  -2.812  -5.691  1.00 0.00 ? 43  GLU A O    5  
ATOM 7621  C CB   . GLU A 1 43  ? 15.514  -5.468  -5.950  1.00 0.00 ? 43  GLU A CB   5  
ATOM 7622  C CG   . GLU A 1 43  ? 15.977  -6.774  -6.601  1.00 0.00 ? 43  GLU A CG   5  
ATOM 7623  C CD   . GLU A 1 43  ? 17.281  -6.568  -7.375  1.00 0.00 ? 43  GLU A CD   5  
ATOM 7624  O OE1  . GLU A 1 43  ? 17.196  -6.015  -8.492  1.00 0.00 ? 43  GLU A OE1  5  
ATOM 7625  O OE2  . GLU A 1 43  ? 18.333  -6.969  -6.831  1.00 0.00 ? 43  GLU A OE2  5  
ATOM 7626  H H    . GLU A 1 43  ? 15.096  -5.518  -3.341  1.00 0.00 ? 43  GLU A H    5  
ATOM 7627  H HA   . GLU A 1 43  ? 17.459  -5.453  -5.035  1.00 0.00 ? 43  GLU A HA   5  
ATOM 7628  H HB2  . GLU A 1 43  ? 14.510  -5.596  -5.546  1.00 0.00 ? 43  GLU A HB2  5  
ATOM 7629  H HB3  . GLU A 1 43  ? 15.457  -4.683  -6.704  1.00 0.00 ? 43  GLU A HB3  5  
ATOM 7630  H HG2  . GLU A 1 43  ? 16.121  -7.535  -5.834  1.00 0.00 ? 43  GLU A HG2  5  
ATOM 7631  H HG3  . GLU A 1 43  ? 15.204  -7.142  -7.275  1.00 0.00 ? 43  GLU A HG3  5  
ATOM 7632  N N    . LYS A 1 44  ? 16.958  -3.057  -3.558  1.00 0.00 ? 44  LYS A N    5  
ATOM 7633  C CA   . LYS A 1 44  ? 17.081  -1.629  -3.318  1.00 0.00 ? 44  LYS A CA   5  
ATOM 7634  C C    . LYS A 1 44  ? 17.628  -0.950  -4.575  1.00 0.00 ? 44  LYS A C    5  
ATOM 7635  O O    . LYS A 1 44  ? 17.221  0.160   -4.912  1.00 0.00 ? 44  LYS A O    5  
ATOM 7636  C CB   . LYS A 1 44  ? 17.918  -1.368  -2.064  1.00 0.00 ? 44  LYS A CB   5  
ATOM 7637  C CG   . LYS A 1 44  ? 17.225  -1.921  -0.817  1.00 0.00 ? 44  LYS A CG   5  
ATOM 7638  C CD   . LYS A 1 44  ? 17.816  -1.310  0.455   1.00 0.00 ? 44  LYS A CD   5  
ATOM 7639  C CE   . LYS A 1 44  ? 16.926  -1.598  1.666   1.00 0.00 ? 44  LYS A CE   5  
ATOM 7640  N NZ   . LYS A 1 44  ? 17.682  -2.339  2.701   1.00 0.00 ? 44  LYS A NZ   5  
ATOM 7641  H H    . LYS A 1 44  ? 17.201  -3.639  -2.782  1.00 0.00 ? 44  LYS A H    5  
ATOM 7642  H HA   . LYS A 1 44  ? 16.080  -1.243  -3.124  1.00 0.00 ? 44  LYS A HA   5  
ATOM 7643  H HB2  . LYS A 1 44  ? 18.899  -1.829  -2.173  1.00 0.00 ? 44  LYS A HB2  5  
ATOM 7644  H HB3  . LYS A 1 44  ? 18.081  -0.296  -1.948  1.00 0.00 ? 44  LYS A HB3  5  
ATOM 7645  H HG2  . LYS A 1 44  ? 16.157  -1.707  -0.865  1.00 0.00 ? 44  LYS A HG2  5  
ATOM 7646  H HG3  . LYS A 1 44  ? 17.331  -3.005  -0.788  1.00 0.00 ? 44  LYS A HG3  5  
ATOM 7647  H HD2  . LYS A 1 44  ? 18.813  -1.715  0.628   1.00 0.00 ? 44  LYS A HD2  5  
ATOM 7648  H HD3  . LYS A 1 44  ? 17.927  -0.233  0.329   1.00 0.00 ? 44  LYS A HD3  5  
ATOM 7649  H HE2  . LYS A 1 44  ? 16.552  -0.662  2.081   1.00 0.00 ? 44  LYS A HE2  5  
ATOM 7650  H HE3  . LYS A 1 44  ? 16.057  -2.179  1.357   1.00 0.00 ? 44  LYS A HE3  5  
ATOM 7651  H HZ1  . LYS A 1 44  ? 18.387  -1.745  3.088   1.00 0.00 ? 44  LYS A HZ1  5  
ATOM 7652  H HZ2  . LYS A 1 44  ? 17.058  -2.631  3.425   1.00 0.00 ? 44  LYS A HZ2  5  
ATOM 7653  H HZ3  . LYS A 1 44  ? 18.113  -3.142  2.288   1.00 0.00 ? 44  LYS A HZ3  5  
ATOM 7654  N N    . ASN A 1 45  ? 18.543  -1.646  -5.234  1.00 0.00 ? 45  ASN A N    5  
ATOM 7655  C CA   . ASN A 1 45  ? 19.151  -1.124  -6.446  1.00 0.00 ? 45  ASN A CA   5  
ATOM 7656  C C    . ASN A 1 45  ? 19.384  0.380   -6.288  1.00 0.00 ? 45  ASN A C    5  
ATOM 7657  O O    . ASN A 1 45  ? 19.047  1.161   -7.177  1.00 0.00 ? 45  ASN A O    5  
ATOM 7658  C CB   . ASN A 1 45  ? 18.237  -1.336  -7.655  1.00 0.00 ? 45  ASN A CB   5  
ATOM 7659  C CG   . ASN A 1 45  ? 18.559  -2.655  -8.360  1.00 0.00 ? 45  ASN A CG   5  
ATOM 7660  O OD1  . ASN A 1 45  ? 19.650  -2.871  -8.862  1.00 0.00 ? 45  ASN A OD1  5  
ATOM 7661  N ND2  . ASN A 1 45  ? 17.551  -3.523  -8.371  1.00 0.00 ? 45  ASN A ND2  5  
ATOM 7662  H H    . ASN A 1 45  ? 18.869  -2.548  -4.952  1.00 0.00 ? 45  ASN A H    5  
ATOM 7663  H HA   . ASN A 1 45  ? 20.081  -1.680  -6.563  1.00 0.00 ? 45  ASN A HA   5  
ATOM 7664  H HB2  . ASN A 1 45  ? 17.196  -1.337  -7.333  1.00 0.00 ? 45  ASN A HB2  5  
ATOM 7665  H HB3  . ASN A 1 45  ? 18.354  -0.508  -8.354  1.00 0.00 ? 45  ASN A HB3  5  
ATOM 7666  H HD21 . ASN A 1 45  ? 16.681  -3.284  -7.941  1.00 0.00 ? 45  ASN A HD21 5  
ATOM 7667  H HD22 . ASN A 1 45  ? 17.664  -4.415  -8.809  1.00 0.00 ? 45  ASN A HD22 5  
ATOM 7668  N N    . GLY A 1 46  ? 19.958  0.741   -5.150  1.00 0.00 ? 46  GLY A N    5  
ATOM 7669  C CA   . GLY A 1 46  ? 20.240  2.137   -4.864  1.00 0.00 ? 46  GLY A CA   5  
ATOM 7670  C C    . GLY A 1 46  ? 19.772  2.514   -3.457  1.00 0.00 ? 46  GLY A C    5  
ATOM 7671  O O    . GLY A 1 46  ? 19.530  1.642   -2.625  1.00 0.00 ? 46  GLY A O    5  
ATOM 7672  H H    . GLY A 1 46  ? 20.229  0.100   -4.432  1.00 0.00 ? 46  GLY A H    5  
ATOM 7673  H HA2  . GLY A 1 46  ? 21.310  2.322   -4.957  1.00 0.00 ? 46  GLY A HA2  5  
ATOM 7674  H HA3  . GLY A 1 46  ? 19.743  2.770   -5.599  1.00 0.00 ? 46  GLY A HA3  5  
ATOM 7675  N N    . ILE A 1 47  ? 19.657  3.816   -3.235  1.00 0.00 ? 47  ILE A N    5  
ATOM 7676  C CA   . ILE A 1 47  ? 19.222  4.319   -1.944  1.00 0.00 ? 47  ILE A CA   5  
ATOM 7677  C C    . ILE A 1 47  ? 17.754  4.741   -2.034  1.00 0.00 ? 47  ILE A C    5  
ATOM 7678  O O    . ILE A 1 47  ? 17.432  5.753   -2.655  1.00 0.00 ? 47  ILE A O    5  
ATOM 7679  C CB   . ILE A 1 47  ? 20.153  5.433   -1.461  1.00 0.00 ? 47  ILE A CB   5  
ATOM 7680  C CG1  . ILE A 1 47  ? 21.491  4.862   -0.986  1.00 0.00 ? 47  ILE A CG1  5  
ATOM 7681  C CG2  . ILE A 1 47  ? 19.478  6.284   -0.383  1.00 0.00 ? 47  ILE A CG2  5  
ATOM 7682  C CD1  . ILE A 1 47  ? 21.279  3.770   0.065   1.00 0.00 ? 47  ILE A CD1  5  
ATOM 7683  H H    . ILE A 1 47  ? 19.856  4.519   -3.918  1.00 0.00 ? 47  ILE A H    5  
ATOM 7684  H HA   . ILE A 1 47  ? 19.303  3.499   -1.230  1.00 0.00 ? 47  ILE A HA   5  
ATOM 7685  H HB   . ILE A 1 47  ? 20.365  6.090   -2.304  1.00 0.00 ? 47  ILE A HB   5  
ATOM 7686  H HG12 . ILE A 1 47  ? 22.038  4.452   -1.836  1.00 0.00 ? 47  ILE A HG12 5  
ATOM 7687  H HG13 . ILE A 1 47  ? 22.104  5.661   -0.568  1.00 0.00 ? 47  ILE A HG13 5  
ATOM 7688  H HG21 . ILE A 1 47  ? 18.889  5.641   0.271   1.00 0.00 ? 47  ILE A HG21 5  
ATOM 7689  H HG22 . ILE A 1 47  ? 20.239  6.799   0.203   1.00 0.00 ? 47  ILE A HG22 5  
ATOM 7690  H HG23 . ILE A 1 47  ? 18.825  7.017   -0.856  1.00 0.00 ? 47  ILE A HG23 5  
ATOM 7691  H HD11 . ILE A 1 47  ? 20.418  4.024   0.683   1.00 0.00 ? 47  ILE A HD11 5  
ATOM 7692  H HD12 . ILE A 1 47  ? 21.102  2.817   -0.432  1.00 0.00 ? 47  ILE A HD12 5  
ATOM 7693  H HD13 . ILE A 1 47  ? 22.167  3.693   0.693   1.00 0.00 ? 47  ILE A HD13 5  
ATOM 7694  N N    . LEU A 1 48  ? 16.903  3.944   -1.405  1.00 0.00 ? 48  LEU A N    5  
ATOM 7695  C CA   . LEU A 1 48  ? 15.477  4.222   -1.407  1.00 0.00 ? 48  LEU A CA   5  
ATOM 7696  C C    . LEU A 1 48  ? 15.237  5.639   -0.884  1.00 0.00 ? 48  LEU A C    5  
ATOM 7697  O O    . LEU A 1 48  ? 15.673  5.982   0.214   1.00 0.00 ? 48  LEU A O    5  
ATOM 7698  C CB   . LEU A 1 48  ? 14.720  3.143   -0.629  1.00 0.00 ? 48  LEU A CB   5  
ATOM 7699  C CG   . LEU A 1 48  ? 15.012  1.696   -1.031  1.00 0.00 ? 48  LEU A CG   5  
ATOM 7700  C CD1  . LEU A 1 48  ? 14.394  0.715   -0.033  1.00 0.00 ? 48  LEU A CD1  5  
ATOM 7701  C CD2  . LEU A 1 48  ? 14.553  1.422   -2.464  1.00 0.00 ? 48  LEU A CD2  5  
ATOM 7702  H H    . LEU A 1 48  ? 17.173  3.122   -0.903  1.00 0.00 ? 48  LEU A H    5  
ATOM 7703  H HA   . LEU A 1 48  ? 15.135  4.172   -2.441  1.00 0.00 ? 48  LEU A HA   5  
ATOM 7704  H HB2  . LEU A 1 48  ? 14.950  3.259   0.431   1.00 0.00 ? 48  LEU A HB2  5  
ATOM 7705  H HB3  . LEU A 1 48  ? 13.651  3.323   -0.744  1.00 0.00 ? 48  LEU A HB3  5  
ATOM 7706  H HG   . LEU A 1 48  ? 16.091  1.546   -1.004  1.00 0.00 ? 48  LEU A HG   5  
ATOM 7707  H HD11 . LEU A 1 48  ? 14.872  -0.259  -0.138  1.00 0.00 ? 48  LEU A HD11 5  
ATOM 7708  H HD12 . LEU A 1 48  ? 14.543  1.085   0.981   1.00 0.00 ? 48  LEU A HD12 5  
ATOM 7709  H HD13 . LEU A 1 48  ? 13.326  0.619   -0.232  1.00 0.00 ? 48  LEU A HD13 5  
ATOM 7710  H HD21 . LEU A 1 48  ? 13.464  1.421   -2.503  1.00 0.00 ? 48  LEU A HD21 5  
ATOM 7711  H HD22 . LEU A 1 48  ? 14.939  2.199   -3.124  1.00 0.00 ? 48  LEU A HD22 5  
ATOM 7712  H HD23 . LEU A 1 48  ? 14.929  0.451   -2.786  1.00 0.00 ? 48  LEU A HD23 5  
ATOM 7713  N N    . THR A 1 49  ? 14.546  6.426   -1.696  1.00 0.00 ? 49  THR A N    5  
ATOM 7714  C CA   . THR A 1 49  ? 14.243  7.799   -1.329  1.00 0.00 ? 49  THR A CA   5  
ATOM 7715  C C    . THR A 1 49  ? 12.858  7.886   -0.685  1.00 0.00 ? 49  THR A C    5  
ATOM 7716  O O    . THR A 1 49  ? 12.526  8.888   -0.053  1.00 0.00 ? 49  THR A O    5  
ATOM 7717  C CB   . THR A 1 49  ? 14.386  8.666   -2.582  1.00 0.00 ? 49  THR A CB   5  
ATOM 7718  O OG1  . THR A 1 49  ? 13.388  8.165   -3.466  1.00 0.00 ? 49  THR A OG1  5  
ATOM 7719  C CG2  . THR A 1 49  ? 15.701  8.412   -3.322  1.00 0.00 ? 49  THR A CG2  5  
ATOM 7720  H H    . THR A 1 49  ? 14.195  6.140   -2.587  1.00 0.00 ? 49  THR A H    5  
ATOM 7721  H HA   . THR A 1 49  ? 14.965  8.121   -0.579  1.00 0.00 ? 49  THR A HA   5  
ATOM 7722  H HB   . THR A 1 49  ? 14.274  9.722   -2.339  1.00 0.00 ? 49  THR A HB   5  
ATOM 7723  H HG1  . THR A 1 49  ? 13.749  7.391   -3.987  1.00 0.00 ? 49  THR A HG1  5  
ATOM 7724  H HG21 . THR A 1 49  ? 16.088  7.430   -3.049  1.00 0.00 ? 49  THR A HG21 5  
ATOM 7725  H HG22 . THR A 1 49  ? 15.526  8.448   -4.397  1.00 0.00 ? 49  THR A HG22 5  
ATOM 7726  H HG23 . THR A 1 49  ? 16.427  9.178   -3.047  1.00 0.00 ? 49  THR A HG23 5  
ATOM 7727  N N    . GLY A 1 50  ? 12.088  6.824   -0.867  1.00 0.00 ? 50  GLY A N    5  
ATOM 7728  C CA   . GLY A 1 50  ? 10.746  6.768   -0.312  1.00 0.00 ? 50  GLY A CA   5  
ATOM 7729  C C    . GLY A 1 50  ? 9.970   5.575   -0.873  1.00 0.00 ? 50  GLY A C    5  
ATOM 7730  O O    . GLY A 1 50  ? 10.533  4.741   -1.581  1.00 0.00 ? 50  GLY A O    5  
ATOM 7731  H H    . GLY A 1 50  ? 12.366  6.014   -1.383  1.00 0.00 ? 50  GLY A H    5  
ATOM 7732  H HA2  . GLY A 1 50  ? 10.801  6.692   0.774   1.00 0.00 ? 50  GLY A HA2  5  
ATOM 7733  H HA3  . GLY A 1 50  ? 10.215  7.692   -0.541  1.00 0.00 ? 50  GLY A HA3  5  
ATOM 7734  N N    . TYR A 1 51  ? 8.690   5.531   -0.535  1.00 0.00 ? 51  TYR A N    5  
ATOM 7735  C CA   . TYR A 1 51  ? 7.831   4.453   -0.996  1.00 0.00 ? 51  TYR A CA   5  
ATOM 7736  C C    . TYR A 1 51  ? 6.487   4.996   -1.489  1.00 0.00 ? 51  TYR A C    5  
ATOM 7737  O O    . TYR A 1 51  ? 5.935   5.924   -0.900  1.00 0.00 ? 51  TYR A O    5  
ATOM 7738  C CB   . TYR A 1 51  ? 7.590   3.556   0.220   1.00 0.00 ? 51  TYR A CB   5  
ATOM 7739  C CG   . TYR A 1 51  ? 8.835   2.806   0.696   1.00 0.00 ? 51  TYR A CG   5  
ATOM 7740  C CD1  . TYR A 1 51  ? 9.285   1.703   -0.001  1.00 0.00 ? 51  TYR A CD1  5  
ATOM 7741  C CD2  . TYR A 1 51  ? 9.510   3.232   1.822   1.00 0.00 ? 51  TYR A CD2  5  
ATOM 7742  C CE1  . TYR A 1 51  ? 10.457  0.996   0.447   1.00 0.00 ? 51  TYR A CE1  5  
ATOM 7743  C CE2  . TYR A 1 51  ? 10.682  2.526   2.270   1.00 0.00 ? 51  TYR A CE2  5  
ATOM 7744  C CZ   . TYR A 1 51  ? 11.098  1.443   1.560   1.00 0.00 ? 51  TYR A CZ   5  
ATOM 7745  O OH   . TYR A 1 51  ? 12.205  0.776   1.983   1.00 0.00 ? 51  TYR A OH   5  
ATOM 7746  H H    . TYR A 1 51  ? 8.240   6.213   0.041   1.00 0.00 ? 51  TYR A H    5  
ATOM 7747  H HA   . TYR A 1 51  ? 8.335   3.950   -1.821  1.00 0.00 ? 51  TYR A HA   5  
ATOM 7748  H HB2  . TYR A 1 51  ? 7.211   4.167   1.039   1.00 0.00 ? 51  TYR A HB2  5  
ATOM 7749  H HB3  . TYR A 1 51  ? 6.813   2.832   -0.024  1.00 0.00 ? 51  TYR A HB3  5  
ATOM 7750  H HD1  . TYR A 1 51  ? 8.752   1.366   -0.891  1.00 0.00 ? 51  TYR A HD1  5  
ATOM 7751  H HD2  . TYR A 1 51  ? 9.155   4.104   2.372   1.00 0.00 ? 51  TYR A HD2  5  
ATOM 7752  H HE1  . TYR A 1 51  ? 10.822  0.124   -0.094  1.00 0.00 ? 51  TYR A HE1  5  
ATOM 7753  H HE2  . TYR A 1 51  ? 11.224  2.852   3.158   1.00 0.00 ? 51  TYR A HE2  5  
ATOM 7754  H HH   . TYR A 1 51  ? 12.097  -0.204  1.818   1.00 0.00 ? 51  TYR A HH   5  
ATOM 7755  N N    . ARG A 1 52  ? 6.000   4.393   -2.563  1.00 0.00 ? 52  ARG A N    5  
ATOM 7756  C CA   . ARG A 1 52  ? 4.732   4.804   -3.142  1.00 0.00 ? 52  ARG A CA   5  
ATOM 7757  C C    . ARG A 1 52  ? 3.646   3.775   -2.825  1.00 0.00 ? 52  ARG A C    5  
ATOM 7758  O O    . ARG A 1 52  ? 3.640   2.681   -3.387  1.00 0.00 ? 52  ARG A O    5  
ATOM 7759  C CB   . ARG A 1 52  ? 4.846   4.966   -4.659  1.00 0.00 ? 52  ARG A CB   5  
ATOM 7760  C CG   . ARG A 1 52  ? 3.470   5.192   -5.290  1.00 0.00 ? 52  ARG A CG   5  
ATOM 7761  C CD   . ARG A 1 52  ? 3.528   6.292   -6.352  1.00 0.00 ? 52  ARG A CD   5  
ATOM 7762  N NE   . ARG A 1 52  ? 4.108   5.758   -7.604  1.00 0.00 ? 52  ARG A NE   5  
ATOM 7763  C CZ   . ARG A 1 52  ? 3.431   5.007   -8.484  1.00 0.00 ? 52  ARG A CZ   5  
ATOM 7764  N NH1  . ARG A 1 52  ? 2.148   4.698   -8.254  1.00 0.00 ? 52  ARG A NH1  5  
ATOM 7765  N NH2  . ARG A 1 52  ? 4.038   4.565   -9.594  1.00 0.00 ? 52  ARG A NH2  5  
ATOM 7766  H H    . ARG A 1 52  ? 6.456   3.639   -3.036  1.00 0.00 ? 52  ARG A H    5  
ATOM 7767  H HA   . ARG A 1 52  ? 4.511   5.764   -2.675  1.00 0.00 ? 52  ARG A HA   5  
ATOM 7768  H HB2  . ARG A 1 52  ? 5.499   5.807   -4.891  1.00 0.00 ? 52  ARG A HB2  5  
ATOM 7769  H HB3  . ARG A 1 52  ? 5.306   4.077   -5.090  1.00 0.00 ? 52  ARG A HB3  5  
ATOM 7770  H HG2  . ARG A 1 52  ? 3.117   4.265   -5.742  1.00 0.00 ? 52  ARG A HG2  5  
ATOM 7771  H HG3  . ARG A 1 52  ? 2.752   5.464   -4.518  1.00 0.00 ? 52  ARG A HG3  5  
ATOM 7772  H HD2  . ARG A 1 52  ? 2.527   6.680   -6.541  1.00 0.00 ? 52  ARG A HD2  5  
ATOM 7773  H HD3  . ARG A 1 52  ? 4.130   7.126   -5.990  1.00 0.00 ? 52  ARG A HD3  5  
ATOM 7774  H HE   . ARG A 1 52  ? 5.064   5.970   -7.807  1.00 0.00 ? 52  ARG A HE   5  
ATOM 7775  H HH11 . ARG A 1 52  ? 1.695   5.027   -7.426  1.00 0.00 ? 52  ARG A HH11 5  
ATOM 7776  H HH12 . ARG A 1 52  ? 1.643   4.137   -8.911  1.00 0.00 ? 52  ARG A HH12 5  
ATOM 7777  H HH21 . ARG A 1 52  ? 4.996   4.796   -9.766  1.00 0.00 ? 52  ARG A HH21 5  
ATOM 7778  H HH22 . ARG A 1 52  ? 3.533   4.005   -10.251 1.00 0.00 ? 52  ARG A HH22 5  
ATOM 7779  N N    . ILE A 1 53  ? 2.753   4.161   -1.926  1.00 0.00 ? 53  ILE A N    5  
ATOM 7780  C CA   . ILE A 1 53  ? 1.664   3.286   -1.528  1.00 0.00 ? 53  ILE A CA   5  
ATOM 7781  C C    . ILE A 1 53  ? 0.386   3.704   -2.257  1.00 0.00 ? 53  ILE A C    5  
ATOM 7782  O O    . ILE A 1 53  ? 0.183   4.885   -2.534  1.00 0.00 ? 53  ILE A O    5  
ATOM 7783  C CB   . ILE A 1 53  ? 1.524   3.264   -0.004  1.00 0.00 ? 53  ILE A CB   5  
ATOM 7784  C CG1  . ILE A 1 53  ? 0.500   2.216   0.437   1.00 0.00 ? 53  ILE A CG1  5  
ATOM 7785  C CG2  . ILE A 1 53  ? 1.188   4.656   0.535   1.00 0.00 ? 53  ILE A CG2  5  
ATOM 7786  C CD1  . ILE A 1 53  ? 0.336   2.216   1.959   1.00 0.00 ? 53  ILE A CD1  5  
ATOM 7787  H H    . ILE A 1 53  ? 2.765   5.053   -1.473  1.00 0.00 ? 53  ILE A H    5  
ATOM 7788  H HA   . ILE A 1 53  ? 1.926   2.275   -1.841  1.00 0.00 ? 53  ILE A HA   5  
ATOM 7789  H HB   . ILE A 1 53  ? 2.484   2.976   0.423   1.00 0.00 ? 53  ILE A HB   5  
ATOM 7790  H HG12 . ILE A 1 53  ? -0.461  2.419   -0.036  1.00 0.00 ? 53  ILE A HG12 5  
ATOM 7791  H HG13 . ILE A 1 53  ? 0.818   1.229   0.102   1.00 0.00 ? 53  ILE A HG13 5  
ATOM 7792  H HG21 . ILE A 1 53  ? 1.151   5.367   -0.291  1.00 0.00 ? 53  ILE A HG21 5  
ATOM 7793  H HG22 . ILE A 1 53  ? 0.219   4.628   1.034   1.00 0.00 ? 53  ILE A HG22 5  
ATOM 7794  H HG23 . ILE A 1 53  ? 1.954   4.965   1.246   1.00 0.00 ? 53  ILE A HG23 5  
ATOM 7795  H HD11 . ILE A 1 53  ? 1.277   2.509   2.425   1.00 0.00 ? 53  ILE A HD11 5  
ATOM 7796  H HD12 . ILE A 1 53  ? -0.444  2.924   2.240   1.00 0.00 ? 53  ILE A HD12 5  
ATOM 7797  H HD13 . ILE A 1 53  ? 0.059   1.217   2.294   1.00 0.00 ? 53  ILE A HD13 5  
ATOM 7798  N N    . SER A 1 54  ? -0.442  2.712   -2.548  1.00 0.00 ? 54  SER A N    5  
ATOM 7799  C CA   . SER A 1 54  ? -1.695  2.962   -3.241  1.00 0.00 ? 54  SER A CA   5  
ATOM 7800  C C    . SER A 1 54  ? -2.721  1.889   -2.869  1.00 0.00 ? 54  SER A C    5  
ATOM 7801  O O    . SER A 1 54  ? -2.537  0.714   -3.183  1.00 0.00 ? 54  SER A O    5  
ATOM 7802  C CB   . SER A 1 54  ? -1.489  2.997   -4.756  1.00 0.00 ? 54  SER A CB   5  
ATOM 7803  O OG   . SER A 1 54  ? -0.215  2.483   -5.134  1.00 0.00 ? 54  SER A OG   5  
ATOM 7804  H H    . SER A 1 54  ? -0.270  1.753   -2.320  1.00 0.00 ? 54  SER A H    5  
ATOM 7805  H HA   . SER A 1 54  ? -2.025  3.942   -2.896  1.00 0.00 ? 54  SER A HA   5  
ATOM 7806  H HB2  . SER A 1 54  ? -2.274  2.417   -5.242  1.00 0.00 ? 54  SER A HB2  5  
ATOM 7807  H HB3  . SER A 1 54  ? -1.586  4.023   -5.111  1.00 0.00 ? 54  SER A HB3  5  
ATOM 7808  H HG   . SER A 1 54  ? 0.300   3.179   -5.633  1.00 0.00 ? 54  SER A HG   5  
ATOM 7809  N N    . TRP A 1 55  ? -3.780  2.332   -2.207  1.00 0.00 ? 55  TRP A N    5  
ATOM 7810  C CA   . TRP A 1 55  ? -4.835  1.425   -1.790  1.00 0.00 ? 55  TRP A CA   5  
ATOM 7811  C C    . TRP A 1 55  ? -6.007  1.585   -2.760  1.00 0.00 ? 55  TRP A C    5  
ATOM 7812  O O    . TRP A 1 55  ? -6.224  2.666   -3.304  1.00 0.00 ? 55  TRP A O    5  
ATOM 7813  C CB   . TRP A 1 55  ? -5.228  1.674   -0.332  1.00 0.00 ? 55  TRP A CB   5  
ATOM 7814  C CG   . TRP A 1 55  ? -5.905  3.025   -0.092  1.00 0.00 ? 55  TRP A CG   5  
ATOM 7815  C CD1  . TRP A 1 55  ? -7.145  3.400   -0.436  1.00 0.00 ? 55  TRP A CD1  5  
ATOM 7816  C CD2  . TRP A 1 55  ? -5.325  4.174   0.562   1.00 0.00 ? 55  TRP A CD2  5  
ATOM 7817  N NE1  . TRP A 1 55  ? -7.405  4.700   -0.053  1.00 0.00 ? 55  TRP A NE1  5  
ATOM 7818  C CE2  . TRP A 1 55  ? -6.263  5.185   0.573   1.00 0.00 ? 55  TRP A CE2  5  
ATOM 7819  C CE3  . TRP A 1 55  ? -4.049  4.352   1.125   1.00 0.00 ? 55  TRP A CE3  5  
ATOM 7820  C CZ2  . TRP A 1 55  ? -6.026  6.445   1.135   1.00 0.00 ? 55  TRP A CZ2  5  
ATOM 7821  C CZ3  . TRP A 1 55  ? -3.827  5.616   1.683   1.00 0.00 ? 55  TRP A CZ3  5  
ATOM 7822  C CH2  . TRP A 1 55  ? -4.762  6.645   1.703   1.00 0.00 ? 55  TRP A CH2  5  
ATOM 7823  H H    . TRP A 1 55  ? -3.922  3.290   -1.956  1.00 0.00 ? 55  TRP A H    5  
ATOM 7824  H HA   . TRP A 1 55  ? -4.442  0.410   -1.843  1.00 0.00 ? 55  TRP A HA   5  
ATOM 7825  H HB2  . TRP A 1 55  ? -5.900  0.880   -0.007  1.00 0.00 ? 55  TRP A HB2  5  
ATOM 7826  H HB3  . TRP A 1 55  ? -4.335  1.611   0.290   1.00 0.00 ? 55  TRP A HB3  5  
ATOM 7827  H HD1  . TRP A 1 55  ? -7.858  2.758   -0.953  1.00 0.00 ? 55  TRP A HD1  5  
ATOM 7828  H HE1  . TRP A 1 55  ? -8.335  5.245   -0.212  1.00 0.00 ? 55  TRP A HE1  5  
ATOM 7829  H HE3  . TRP A 1 55  ? -3.291  3.569   1.129   1.00 0.00 ? 55  TRP A HE3  5  
ATOM 7830  H HZ2  . TRP A 1 55  ? -6.784  7.228   1.131   1.00 0.00 ? 55  TRP A HZ2  5  
ATOM 7831  H HZ3  . TRP A 1 55  ? -2.853  5.808   2.134   1.00 0.00 ? 55  TRP A HZ3  5  
ATOM 7832  H HH2  . TRP A 1 55  ? -4.511  7.604   2.157   1.00 0.00 ? 55  TRP A HH2  5  
ATOM 7833  N N    . GLU A 1 56  ? -6.731  0.491   -2.949  1.00 0.00 ? 56  GLU A N    5  
ATOM 7834  C CA   . GLU A 1 56  ? -7.875  0.496   -3.844  1.00 0.00 ? 56  GLU A CA   5  
ATOM 7835  C C    . GLU A 1 56  ? -8.673  -0.800  -3.693  1.00 0.00 ? 56  GLU A C    5  
ATOM 7836  O O    . GLU A 1 56  ? -8.116  -1.839  -3.340  1.00 0.00 ? 56  GLU A O    5  
ATOM 7837  C CB   . GLU A 1 56  ? -7.435  0.703   -5.295  1.00 0.00 ? 56  GLU A CB   5  
ATOM 7838  C CG   . GLU A 1 56  ? -6.790  -0.566  -5.858  1.00 0.00 ? 56  GLU A CG   5  
ATOM 7839  C CD   . GLU A 1 56  ? -6.315  -0.347  -7.296  1.00 0.00 ? 56  GLU A CD   5  
ATOM 7840  O OE1  . GLU A 1 56  ? -7.161  0.072   -8.115  1.00 0.00 ? 56  GLU A OE1  5  
ATOM 7841  O OE2  . GLU A 1 56  ? -5.117  -0.605  -7.543  1.00 0.00 ? 56  GLU A OE2  5  
ATOM 7842  H H    . GLU A 1 56  ? -6.547  -0.385  -2.503  1.00 0.00 ? 56  GLU A H    5  
ATOM 7843  H HA   . GLU A 1 56  ? -8.484  1.344   -3.532  1.00 0.00 ? 56  GLU A HA   5  
ATOM 7844  H HB2  . GLU A 1 56  ? -8.295  0.979   -5.904  1.00 0.00 ? 56  GLU A HB2  5  
ATOM 7845  H HB3  . GLU A 1 56  ? -6.727  1.530   -5.350  1.00 0.00 ? 56  GLU A HB3  5  
ATOM 7846  H HG2  . GLU A 1 56  ? -5.946  -0.857  -5.233  1.00 0.00 ? 56  GLU A HG2  5  
ATOM 7847  H HG3  . GLU A 1 56  ? -7.507  -1.386  -5.829  1.00 0.00 ? 56  GLU A HG3  5  
ATOM 7848  N N    . GLU A 1 57  ? -9.966  -0.697  -3.967  1.00 0.00 ? 57  GLU A N    5  
ATOM 7849  C CA   . GLU A 1 57  ? -10.846 -1.848  -3.865  1.00 0.00 ? 57  GLU A CA   5  
ATOM 7850  C C    . GLU A 1 57  ? -10.298 -3.011  -4.695  1.00 0.00 ? 57  GLU A C    5  
ATOM 7851  O O    . GLU A 1 57  ? -9.310  -2.855  -5.411  1.00 0.00 ? 57  GLU A O    5  
ATOM 7852  C CB   . GLU A 1 57  ? -12.269 -1.490  -4.297  1.00 0.00 ? 57  GLU A CB   5  
ATOM 7853  C CG   . GLU A 1 57  ? -13.131 -1.114  -3.090  1.00 0.00 ? 57  GLU A CG   5  
ATOM 7854  C CD   . GLU A 1 57  ? -14.546 -1.678  -3.229  1.00 0.00 ? 57  GLU A CD   5  
ATOM 7855  O OE1  . GLU A 1 57  ? -14.653 -2.833  -3.693  1.00 0.00 ? 57  GLU A OE1  5  
ATOM 7856  O OE2  . GLU A 1 57  ? -15.489 -0.941  -2.867  1.00 0.00 ? 57  GLU A OE2  5  
ATOM 7857  H H    . GLU A 1 57  ? -10.411 0.151   -4.253  1.00 0.00 ? 57  GLU A H    5  
ATOM 7858  H HA   . GLU A 1 57  ? -10.851 -2.118  -2.809  1.00 0.00 ? 57  GLU A HA   5  
ATOM 7859  H HB2  . GLU A 1 57  ? -12.241 -0.658  -5.001  1.00 0.00 ? 57  GLU A HB2  5  
ATOM 7860  H HB3  . GLU A 1 57  ? -12.718 -2.335  -4.820  1.00 0.00 ? 57  GLU A HB3  5  
ATOM 7861  H HG2  . GLU A 1 57  ? -12.671 -1.496  -2.178  1.00 0.00 ? 57  GLU A HG2  5  
ATOM 7862  H HG3  . GLU A 1 57  ? -13.175 -0.029  -2.994  1.00 0.00 ? 57  GLU A HG3  5  
ATOM 7863  N N    . TYR A 1 58  ? -10.963 -4.150  -4.571  1.00 0.00 ? 58  TYR A N    5  
ATOM 7864  C CA   . TYR A 1 58  ? -10.554 -5.338  -5.301  1.00 0.00 ? 58  TYR A CA   5  
ATOM 7865  C C    . TYR A 1 58  ? -10.413 -5.043  -6.795  1.00 0.00 ? 58  TYR A C    5  
ATOM 7866  O O    . TYR A 1 58  ? -9.328  -5.179  -7.359  1.00 0.00 ? 58  TYR A O    5  
ATOM 7867  C CB   . TYR A 1 58  ? -11.673 -6.363  -5.099  1.00 0.00 ? 58  TYR A CB   5  
ATOM 7868  C CG   . TYR A 1 58  ? -11.580 -7.576  -6.027  1.00 0.00 ? 58  TYR A CG   5  
ATOM 7869  C CD1  . TYR A 1 58  ? -10.492 -8.421  -5.951  1.00 0.00 ? 58  TYR A CD1  5  
ATOM 7870  C CD2  . TYR A 1 58  ? -12.585 -7.825  -6.939  1.00 0.00 ? 58  TYR A CD2  5  
ATOM 7871  C CE1  . TYR A 1 58  ? -10.405 -9.563  -6.823  1.00 0.00 ? 58  TYR A CE1  5  
ATOM 7872  C CE2  . TYR A 1 58  ? -12.498 -8.967  -7.812  1.00 0.00 ? 58  TYR A CE2  5  
ATOM 7873  C CZ   . TYR A 1 58  ? -11.412 -9.780  -7.711  1.00 0.00 ? 58  TYR A CZ   5  
ATOM 7874  O OH   . TYR A 1 58  ? -11.329 -10.858 -8.535  1.00 0.00 ? 58  TYR A OH   5  
ATOM 7875  H H    . TYR A 1 58  ? -11.765 -4.269  -3.986  1.00 0.00 ? 58  TYR A H    5  
ATOM 7876  H HA   . TYR A 1 58  ? -9.589  -5.659  -4.909  1.00 0.00 ? 58  TYR A HA   5  
ATOM 7877  H HB2  . TYR A 1 58  ? -11.655 -6.706  -4.065  1.00 0.00 ? 58  TYR A HB2  5  
ATOM 7878  H HB3  . TYR A 1 58  ? -12.633 -5.872  -5.255  1.00 0.00 ? 58  TYR A HB3  5  
ATOM 7879  H HD1  . TYR A 1 58  ? -9.698  -8.224  -5.230  1.00 0.00 ? 58  TYR A HD1  5  
ATOM 7880  H HD2  . TYR A 1 58  ? -13.444 -7.158  -7.000  1.00 0.00 ? 58  TYR A HD2  5  
ATOM 7881  H HE1  . TYR A 1 58  ? -9.551  -10.239 -6.774  1.00 0.00 ? 58  TYR A HE1  5  
ATOM 7882  H HE2  . TYR A 1 58  ? -13.284 -9.176  -8.538  1.00 0.00 ? 58  TYR A HE2  5  
ATOM 7883  H HH   . TYR A 1 58  ? -10.397 -10.952 -8.884  1.00 0.00 ? 58  TYR A HH   5  
ATOM 7884  N N    . ASN A 1 59  ? -11.525 -4.643  -7.395  1.00 0.00 ? 59  ASN A N    5  
ATOM 7885  C CA   . ASN A 1 59  ? -11.539 -4.327  -8.813  1.00 0.00 ? 59  ASN A CA   5  
ATOM 7886  C C    . ASN A 1 59  ? -12.252 -2.990  -9.026  1.00 0.00 ? 59  ASN A C    5  
ATOM 7887  O O    . ASN A 1 59  ? -12.993 -2.825  -9.993  1.00 0.00 ? 59  ASN A O    5  
ATOM 7888  C CB   . ASN A 1 59  ? -12.290 -5.396  -9.608  1.00 0.00 ? 59  ASN A CB   5  
ATOM 7889  C CG   . ASN A 1 59  ? -12.110 -5.188  -11.113 1.00 0.00 ? 59  ASN A CG   5  
ATOM 7890  O OD1  . ASN A 1 59  ? -11.733 -4.124  -11.578 1.00 0.00 ? 59  ASN A OD1  5  
ATOM 7891  N ND2  . ASN A 1 59  ? -12.398 -6.259  -11.846 1.00 0.00 ? 59  ASN A ND2  5  
ATOM 7892  H H    . ASN A 1 59  ? -12.403 -4.535  -6.929  1.00 0.00 ? 59  ASN A H    5  
ATOM 7893  H HA   . ASN A 1 59  ? -10.490 -4.292  -9.108  1.00 0.00 ? 59  ASN A HA   5  
ATOM 7894  H HB2  . ASN A 1 59  ? -11.928 -6.385  -9.328  1.00 0.00 ? 59  ASN A HB2  5  
ATOM 7895  H HB3  . ASN A 1 59  ? -13.351 -5.362  -9.357  1.00 0.00 ? 59  ASN A HB3  5  
ATOM 7896  H HD21 . ASN A 1 59  ? -12.702 -7.102  -11.401 1.00 0.00 ? 59  ASN A HD21 5  
ATOM 7897  H HD22 . ASN A 1 59  ? -12.311 -6.223  -12.841 1.00 0.00 ? 59  ASN A HD22 5  
ATOM 7898  N N    . ARG A 1 60  ? -12.003 -2.069  -8.106  1.00 0.00 ? 60  ARG A N    5  
ATOM 7899  C CA   . ARG A 1 60  ? -12.612 -0.752  -8.181  1.00 0.00 ? 60  ARG A CA   5  
ATOM 7900  C C    . ARG A 1 60  ? -11.534 0.333   -8.156  1.00 0.00 ? 60  ARG A C    5  
ATOM 7901  O O    . ARG A 1 60  ? -11.245 0.902   -7.104  1.00 0.00 ? 60  ARG A O    5  
ATOM 7902  C CB   . ARG A 1 60  ? -13.581 -0.527  -7.018  1.00 0.00 ? 60  ARG A CB   5  
ATOM 7903  C CG   . ARG A 1 60  ? -15.018 -0.378  -7.522  1.00 0.00 ? 60  ARG A CG   5  
ATOM 7904  C CD   . ARG A 1 60  ? -15.982 -0.121  -6.363  1.00 0.00 ? 60  ARG A CD   5  
ATOM 7905  N NE   . ARG A 1 60  ? -17.234 0.483   -6.870  1.00 0.00 ? 60  ARG A NE   5  
ATOM 7906  C CZ   . ARG A 1 60  ? -18.365 0.577   -6.158  1.00 0.00 ? 60  ARG A CZ   5  
ATOM 7907  N NH1  . ARG A 1 60  ? -18.409 0.106   -4.904  1.00 0.00 ? 60  ARG A NH1  5  
ATOM 7908  N NH2  . ARG A 1 60  ? -19.454 1.140   -6.700  1.00 0.00 ? 60  ARG A NH2  5  
ATOM 7909  H H    . ARG A 1 60  ? -11.399 -2.212  -7.322  1.00 0.00 ? 60  ARG A H    5  
ATOM 7910  H HA   . ARG A 1 60  ? -13.151 -0.748  -9.128  1.00 0.00 ? 60  ARG A HA   5  
ATOM 7911  H HB2  . ARG A 1 60  ? -13.521 -1.363  -6.322  1.00 0.00 ? 60  ARG A HB2  5  
ATOM 7912  H HB3  . ARG A 1 60  ? -13.291 0.368   -6.467  1.00 0.00 ? 60  ARG A HB3  5  
ATOM 7913  H HG2  . ARG A 1 60  ? -15.073 0.445   -8.236  1.00 0.00 ? 60  ARG A HG2  5  
ATOM 7914  H HG3  . ARG A 1 60  ? -15.316 -1.282  -8.054  1.00 0.00 ? 60  ARG A HG3  5  
ATOM 7915  H HD2  . ARG A 1 60  ? -16.202 -1.056  -5.848  1.00 0.00 ? 60  ARG A HD2  5  
ATOM 7916  H HD3  . ARG A 1 60  ? -15.518 0.543   -5.633  1.00 0.00 ? 60  ARG A HD3  5  
ATOM 7917  H HE   . ARG A 1 60  ? -17.236 0.844   -7.803  1.00 0.00 ? 60  ARG A HE   5  
ATOM 7918  H HH11 . ARG A 1 60  ? -17.597 -0.315  -4.500  1.00 0.00 ? 60  ARG A HH11 5  
ATOM 7919  H HH12 . ARG A 1 60  ? -19.253 0.176   -4.373  1.00 0.00 ? 60  ARG A HH12 5  
ATOM 7920  H HH21 . ARG A 1 60  ? -19.421 1.491   -7.636  1.00 0.00 ? 60  ARG A HH21 5  
ATOM 7921  H HH22 . ARG A 1 60  ? -20.298 1.210   -6.169  1.00 0.00 ? 60  ARG A HH22 5  
ATOM 7922  N N    . THR A 1 61  ? -10.969 0.588   -9.327  1.00 0.00 ? 61  THR A N    5  
ATOM 7923  C CA   . THR A 1 61  ? -9.930  1.595   -9.453  1.00 0.00 ? 61  THR A CA   5  
ATOM 7924  C C    . THR A 1 61  ? -10.472 2.972   -9.064  1.00 0.00 ? 61  THR A C    5  
ATOM 7925  O O    . THR A 1 61  ? -9.739  3.803   -8.529  1.00 0.00 ? 61  THR A O    5  
ATOM 7926  C CB   . THR A 1 61  ? -9.386  1.538   -10.882 1.00 0.00 ? 61  THR A CB   5  
ATOM 7927  O OG1  . THR A 1 61  ? -8.832  0.229   -10.990 1.00 0.00 ? 61  THR A OG1  5  
ATOM 7928  C CG2  . THR A 1 61  ? -8.189  2.468   -11.091 1.00 0.00 ? 61  THR A CG2  5  
ATOM 7929  H H    . THR A 1 61  ? -11.210 0.121   -10.178 1.00 0.00 ? 61  THR A H    5  
ATOM 7930  H HA   . THR A 1 61  ? -9.132  1.356   -8.750  1.00 0.00 ? 61  THR A HA   5  
ATOM 7931  H HB   . THR A 1 61  ? -10.173 1.747   -11.606 1.00 0.00 ? 61  THR A HB   5  
ATOM 7932  H HG1  . THR A 1 61  ? -9.179  -0.222  -11.812 1.00 0.00 ? 61  THR A HG1  5  
ATOM 7933  H HG21 . THR A 1 61  ? -7.519  2.036   -11.833 1.00 0.00 ? 61  THR A HG21 5  
ATOM 7934  H HG22 . THR A 1 61  ? -8.540  3.439   -11.439 1.00 0.00 ? 61  THR A HG22 5  
ATOM 7935  H HG23 . THR A 1 61  ? -7.656  2.591   -10.148 1.00 0.00 ? 61  THR A HG23 5  
ATOM 7936  N N    . ASN A 1 62  ? -11.750 3.172   -9.349  1.00 0.00 ? 62  ASN A N    5  
ATOM 7937  C CA   . ASN A 1 62  ? -12.399 4.434   -9.036  1.00 0.00 ? 62  ASN A CA   5  
ATOM 7938  C C    . ASN A 1 62  ? -12.053 4.838   -7.601  1.00 0.00 ? 62  ASN A C    5  
ATOM 7939  O O    . ASN A 1 62  ? -12.095 6.018   -7.257  1.00 0.00 ? 62  ASN A O    5  
ATOM 7940  C CB   . ASN A 1 62  ? -13.920 4.312   -9.139  1.00 0.00 ? 62  ASN A CB   5  
ATOM 7941  C CG   . ASN A 1 62  ? -14.433 4.931   -10.441 1.00 0.00 ? 62  ASN A CG   5  
ATOM 7942  O OD1  . ASN A 1 62  ? -14.149 4.467   -11.533 1.00 0.00 ? 62  ASN A OD1  5  
ATOM 7943  N ND2  . ASN A 1 62  ? -15.202 6.001   -10.265 1.00 0.00 ? 62  ASN A ND2  5  
ATOM 7944  H H    . ASN A 1 62  ? -12.339 2.491   -9.784  1.00 0.00 ? 62  ASN A H    5  
ATOM 7945  H HA   . ASN A 1 62  ? -12.018 5.142   -9.772  1.00 0.00 ? 62  ASN A HA   5  
ATOM 7946  H HB2  . ASN A 1 62  ? -14.208 3.261   -9.093  1.00 0.00 ? 62  ASN A HB2  5  
ATOM 7947  H HB3  . ASN A 1 62  ? -14.387 4.808   -8.288  1.00 0.00 ? 62  ASN A HB3  5  
ATOM 7948  H HD21 . ASN A 1 62  ? -15.397 6.330   -9.340  1.00 0.00 ? 62  ASN A HD21 5  
ATOM 7949  H HD22 . ASN A 1 62  ? -15.586 6.477   -11.056 1.00 0.00 ? 62  ASN A HD22 5  
ATOM 7950  N N    . THR A 1 63  ? -11.719 3.835   -6.802  1.00 0.00 ? 63  THR A N    5  
ATOM 7951  C CA   . THR A 1 63  ? -11.366 4.071   -5.412  1.00 0.00 ? 63  THR A CA   5  
ATOM 7952  C C    . THR A 1 63  ? -9.866  3.856   -5.199  1.00 0.00 ? 63  THR A C    5  
ATOM 7953  O O    . THR A 1 63  ? -9.462  3.156   -4.272  1.00 0.00 ? 63  THR A O    5  
ATOM 7954  C CB   . THR A 1 63  ? -12.240 3.165   -4.542  1.00 0.00 ? 63  THR A CB   5  
ATOM 7955  O OG1  . THR A 1 63  ? -11.732 1.856   -4.785  1.00 0.00 ? 63  THR A OG1  5  
ATOM 7956  C CG2  . THR A 1 63  ? -13.687 3.100   -5.034  1.00 0.00 ? 63  THR A CG2  5  
ATOM 7957  H H    . THR A 1 63  ? -11.687 2.878   -7.089  1.00 0.00 ? 63  THR A H    5  
ATOM 7958  H HA   . THR A 1 63  ? -11.576 5.114   -5.177  1.00 0.00 ? 63  THR A HA   5  
ATOM 7959  H HB   . THR A 1 63  ? -12.197 3.470   -3.497  1.00 0.00 ? 63  THR A HB   5  
ATOM 7960  H HG1  . THR A 1 63  ? -12.026 1.235   -4.059  1.00 0.00 ? 63  THR A HG1  5  
ATOM 7961  H HG21 . THR A 1 63  ? -13.866 2.136   -5.510  1.00 0.00 ? 63  THR A HG21 5  
ATOM 7962  H HG22 . THR A 1 63  ? -14.364 3.218   -4.187  1.00 0.00 ? 63  THR A HG22 5  
ATOM 7963  H HG23 . THR A 1 63  ? -13.863 3.899   -5.754  1.00 0.00 ? 63  THR A HG23 5  
ATOM 7964  N N    . ARG A 1 64  ? -9.083  4.471   -6.072  1.00 0.00 ? 64  ARG A N    5  
ATOM 7965  C CA   . ARG A 1 64  ? -7.637  4.356   -5.991  1.00 0.00 ? 64  ARG A CA   5  
ATOM 7966  C C    . ARG A 1 64  ? -7.028  5.662   -5.476  1.00 0.00 ? 64  ARG A C    5  
ATOM 7967  O O    . ARG A 1 64  ? -7.574  6.740   -5.709  1.00 0.00 ? 64  ARG A O    5  
ATOM 7968  C CB   . ARG A 1 64  ? -7.033  4.024   -7.357  1.00 0.00 ? 64  ARG A CB   5  
ATOM 7969  C CG   . ARG A 1 64  ? -5.619  3.459   -7.209  1.00 0.00 ? 64  ARG A CG   5  
ATOM 7970  C CD   . ARG A 1 64  ? -4.567  4.536   -7.478  1.00 0.00 ? 64  ARG A CD   5  
ATOM 7971  N NE   . ARG A 1 64  ? -3.220  3.925   -7.539  1.00 0.00 ? 64  ARG A NE   5  
ATOM 7972  C CZ   . ARG A 1 64  ? -2.749  3.252   -8.597  1.00 0.00 ? 64  ARG A CZ   5  
ATOM 7973  N NH1  . ARG A 1 64  ? -3.511  3.099   -9.689  1.00 0.00 ? 64  ARG A NH1  5  
ATOM 7974  N NH2  . ARG A 1 64  ? -1.515  2.731   -8.564  1.00 0.00 ? 64  ARG A NH2  5  
ATOM 7975  H H    . ARG A 1 64  ? -9.420  5.039   -6.823  1.00 0.00 ? 64  ARG A H    5  
ATOM 7976  H HA   . ARG A 1 64  ? -7.461  3.539   -5.291  1.00 0.00 ? 64  ARG A HA   5  
ATOM 7977  H HB2  . ARG A 1 64  ? -7.666  3.301   -7.872  1.00 0.00 ? 64  ARG A HB2  5  
ATOM 7978  H HB3  . ARG A 1 64  ? -7.007  4.921   -7.975  1.00 0.00 ? 64  ARG A HB3  5  
ATOM 7979  H HG2  . ARG A 1 64  ? -5.487  3.059   -6.204  1.00 0.00 ? 64  ARG A HG2  5  
ATOM 7980  H HG3  . ARG A 1 64  ? -5.481  2.629   -7.902  1.00 0.00 ? 64  ARG A HG3  5  
ATOM 7981  H HD2  . ARG A 1 64  ? -4.787  5.046   -8.416  1.00 0.00 ? 64  ARG A HD2  5  
ATOM 7982  H HD3  . ARG A 1 64  ? -4.597  5.290   -6.691  1.00 0.00 ? 64  ARG A HD3  5  
ATOM 7983  H HE   . ARG A 1 64  ? -2.625  4.020   -6.741  1.00 0.00 ? 64  ARG A HE   5  
ATOM 7984  H HH11 . ARG A 1 64  ? -4.432  3.488   -9.713  1.00 0.00 ? 64  ARG A HH11 5  
ATOM 7985  H HH12 . ARG A 1 64  ? -3.159  2.597   -10.478 1.00 0.00 ? 64  ARG A HH12 5  
ATOM 7986  H HH21 . ARG A 1 64  ? -0.945  2.845   -7.750  1.00 0.00 ? 64  ARG A HH21 5  
ATOM 7987  H HH22 . ARG A 1 64  ? -1.162  2.228   -9.354  1.00 0.00 ? 64  ARG A HH22 5  
ATOM 7988  N N    . VAL A 1 65  ? -5.906  5.523   -4.787  1.00 0.00 ? 65  VAL A N    5  
ATOM 7989  C CA   . VAL A 1 65  ? -5.217  6.679   -4.237  1.00 0.00 ? 65  VAL A CA   5  
ATOM 7990  C C    . VAL A 1 65  ? -3.708  6.504   -4.422  1.00 0.00 ? 65  VAL A C    5  
ATOM 7991  O O    . VAL A 1 65  ? -3.229  5.388   -4.618  1.00 0.00 ? 65  VAL A O    5  
ATOM 7992  C CB   . VAL A 1 65  ? -5.621  6.882   -2.775  1.00 0.00 ? 65  VAL A CB   5  
ATOM 7993  C CG1  . VAL A 1 65  ? -5.004  5.805   -1.881  1.00 0.00 ? 65  VAL A CG1  5  
ATOM 7994  C CG2  . VAL A 1 65  ? -5.239  8.282   -2.291  1.00 0.00 ? 65  VAL A CG2  5  
ATOM 7995  H H    . VAL A 1 65  ? -5.468  4.643   -4.602  1.00 0.00 ? 65  VAL A H    5  
ATOM 7996  H HA   . VAL A 1 65  ? -5.541  7.554   -4.801  1.00 0.00 ? 65  VAL A HA   5  
ATOM 7997  H HB   . VAL A 1 65  ? -6.705  6.790   -2.711  1.00 0.00 ? 65  VAL A HB   5  
ATOM 7998  H HG11 . VAL A 1 65  ? -4.740  6.240   -0.917  1.00 0.00 ? 65  VAL A HG11 5  
ATOM 7999  H HG12 . VAL A 1 65  ? -5.724  5.001   -1.731  1.00 0.00 ? 65  VAL A HG12 5  
ATOM 8000  H HG13 . VAL A 1 65  ? -4.108  5.407   -2.357  1.00 0.00 ? 65  VAL A HG13 5  
ATOM 8001  H HG21 . VAL A 1 65  ? -5.062  8.929   -3.150  1.00 0.00 ? 65  VAL A HG21 5  
ATOM 8002  H HG22 . VAL A 1 65  ? -6.050  8.692   -1.689  1.00 0.00 ? 65  VAL A HG22 5  
ATOM 8003  H HG23 . VAL A 1 65  ? -4.333  8.223   -1.688  1.00 0.00 ? 65  VAL A HG23 5  
ATOM 8004  N N    . THR A 1 66  ? -3.002  7.623   -4.353  1.00 0.00 ? 66  THR A N    5  
ATOM 8005  C CA   . THR A 1 66  ? -1.558  7.607   -4.510  1.00 0.00 ? 66  THR A CA   5  
ATOM 8006  C C    . THR A 1 66  ? -0.897  8.491   -3.451  1.00 0.00 ? 66  THR A C    5  
ATOM 8007  O O    . THR A 1 66  ? -0.966  9.717   -3.529  1.00 0.00 ? 66  THR A O    5  
ATOM 8008  C CB   . THR A 1 66  ? -1.234  8.030   -5.944  1.00 0.00 ? 66  THR A CB   5  
ATOM 8009  O OG1  . THR A 1 66  ? -1.662  6.927   -6.737  1.00 0.00 ? 66  THR A OG1  5  
ATOM 8010  C CG2  . THR A 1 66  ? 0.272   8.114   -6.204  1.00 0.00 ? 66  THR A CG2  5  
ATOM 8011  H H    . THR A 1 66  ? -3.400  8.526   -4.193  1.00 0.00 ? 66  THR A H    5  
ATOM 8012  H HA   . THR A 1 66  ? -1.205  6.589   -4.342  1.00 0.00 ? 66  THR A HA   5  
ATOM 8013  H HB   . THR A 1 66  ? -1.725  8.971   -6.192  1.00 0.00 ? 66  THR A HB   5  
ATOM 8014  H HG1  . THR A 1 66  ? -1.635  7.171   -7.706  1.00 0.00 ? 66  THR A HG1  5  
ATOM 8015  H HG21 . THR A 1 66  ? 0.666   9.029   -5.763  1.00 0.00 ? 66  THR A HG21 5  
ATOM 8016  H HG22 . THR A 1 66  ? 0.766   7.252   -5.755  1.00 0.00 ? 66  THR A HG22 5  
ATOM 8017  H HG23 . THR A 1 66  ? 0.455   8.120   -7.278  1.00 0.00 ? 66  THR A HG23 5  
ATOM 8018  N N    . HIS A 1 67  ? -0.270  7.835   -2.485  1.00 0.00 ? 67  HIS A N    5  
ATOM 8019  C CA   . HIS A 1 67  ? 0.403   8.546   -1.412  1.00 0.00 ? 67  HIS A CA   5  
ATOM 8020  C C    . HIS A 1 67  ? 1.915   8.343   -1.531  1.00 0.00 ? 67  HIS A C    5  
ATOM 8021  O O    . HIS A 1 67  ? 2.372   7.478   -2.276  1.00 0.00 ? 67  HIS A O    5  
ATOM 8022  C CB   . HIS A 1 67  ? -0.147  8.121   -0.049  1.00 0.00 ? 67  HIS A CB   5  
ATOM 8023  C CG   . HIS A 1 67  ? -1.277  8.986   0.455   1.00 0.00 ? 67  HIS A CG   5  
ATOM 8024  N ND1  . HIS A 1 67  ? -1.359  10.342  0.188   1.00 0.00 ? 67  HIS A ND1  5  
ATOM 8025  C CD2  . HIS A 1 67  ? -2.369  8.675   1.210   1.00 0.00 ? 67  HIS A CD2  5  
ATOM 8026  C CE1  . HIS A 1 67  ? -2.455  10.815  0.763   1.00 0.00 ? 67  HIS A CE1  5  
ATOM 8027  N NE2  . HIS A 1 67  ? -3.079  9.781   1.396   1.00 0.00 ? 67  HIS A NE2  5  
ATOM 8028  H H    . HIS A 1 67  ? -0.218  6.838   -2.429  1.00 0.00 ? 67  HIS A H    5  
ATOM 8029  H HA   . HIS A 1 67  ? 0.176   9.604   -1.547  1.00 0.00 ? 67  HIS A HA   5  
ATOM 8030  H HB2  . HIS A 1 67  ? -0.494  7.090   -0.115  1.00 0.00 ? 67  HIS A HB2  5  
ATOM 8031  H HB3  . HIS A 1 67  ? 0.664   8.138   0.679   1.00 0.00 ? 67  HIS A HB3  5  
ATOM 8032  H HD1  . HIS A 1 67  ? -0.703  10.874  -0.347  1.00 0.00 ? 67  HIS A HD1  5  
ATOM 8033  H HD2  . HIS A 1 67  ? -2.616  7.686   1.595   1.00 0.00 ? 67  HIS A HD2  5  
ATOM 8034  H HE1  . HIS A 1 67  ? -2.797  11.850  0.734   1.00 0.00 ? 67  HIS A HE1  5  
ATOM 8035  N N    . TYR A 1 68  ? 2.649   9.156   -0.786  1.00 0.00 ? 68  TYR A N    5  
ATOM 8036  C CA   . TYR A 1 68  ? 4.100   9.077   -0.798  1.00 0.00 ? 68  TYR A CA   5  
ATOM 8037  C C    . TYR A 1 68  ? 4.662   9.073   0.625   1.00 0.00 ? 68  TYR A C    5  
ATOM 8038  O O    . TYR A 1 68  ? 4.191   9.818   1.483   1.00 0.00 ? 68  TYR A O    5  
ATOM 8039  C CB   . TYR A 1 68  ? 4.585   10.334  -1.522  1.00 0.00 ? 68  TYR A CB   5  
ATOM 8040  C CG   . TYR A 1 68  ? 4.469   10.259  -3.046  1.00 0.00 ? 68  TYR A CG   5  
ATOM 8041  C CD1  . TYR A 1 68  ? 5.155   9.285   -3.743  1.00 0.00 ? 68  TYR A CD1  5  
ATOM 8042  C CD2  . TYR A 1 68  ? 3.679   11.165  -3.723  1.00 0.00 ? 68  TYR A CD2  5  
ATOM 8043  C CE1  . TYR A 1 68  ? 5.046   9.215   -5.177  1.00 0.00 ? 68  TYR A CE1  5  
ATOM 8044  C CE2  . TYR A 1 68  ? 3.570   11.095  -5.157  1.00 0.00 ? 68  TYR A CE2  5  
ATOM 8045  C CZ   . TYR A 1 68  ? 4.259   10.123  -5.814  1.00 0.00 ? 68  TYR A CZ   5  
ATOM 8046  O OH   . TYR A 1 68  ? 4.156   10.056  -7.168  1.00 0.00 ? 68  TYR A OH   5  
ATOM 8047  H H    . TYR A 1 68  ? 2.270   9.858   -0.183  1.00 0.00 ? 68  TYR A H    5  
ATOM 8048  H HA   . TYR A 1 68  ? 4.382   8.148   -1.294  1.00 0.00 ? 68  TYR A HA   5  
ATOM 8049  H HB2  . TYR A 1 68  ? 4.011   11.190  -1.166  1.00 0.00 ? 68  TYR A HB2  5  
ATOM 8050  H HB3  . TYR A 1 68  ? 5.626   10.516  -1.256  1.00 0.00 ? 68  TYR A HB3  5  
ATOM 8051  H HD1  . TYR A 1 68  ? 5.779   8.570   -3.208  1.00 0.00 ? 68  TYR A HD1  5  
ATOM 8052  H HD2  . TYR A 1 68  ? 3.137   11.935  -3.173  1.00 0.00 ? 68  TYR A HD2  5  
ATOM 8053  H HE1  . TYR A 1 68  ? 5.582   8.451   -5.740  1.00 0.00 ? 68  TYR A HE1  5  
ATOM 8054  H HE2  . TYR A 1 68  ? 2.949   11.804  -5.705  1.00 0.00 ? 68  TYR A HE2  5  
ATOM 8055  H HH   . TYR A 1 68  ? 3.899   10.949  -7.536  1.00 0.00 ? 68  TYR A HH   5  
ATOM 8056  N N    . LEU A 1 69  ? 5.660   8.227   0.831   1.00 0.00 ? 69  LEU A N    5  
ATOM 8057  C CA   . LEU A 1 69  ? 6.290   8.117   2.135   1.00 0.00 ? 69  LEU A CA   5  
ATOM 8058  C C    . LEU A 1 69  ? 7.811   8.116   1.964   1.00 0.00 ? 69  LEU A C    5  
ATOM 8059  O O    . LEU A 1 69  ? 8.317   7.827   0.881   1.00 0.00 ? 69  LEU A O    5  
ATOM 8060  C CB   . LEU A 1 69  ? 5.756   6.897   2.888   1.00 0.00 ? 69  LEU A CB   5  
ATOM 8061  C CG   . LEU A 1 69  ? 4.246   6.662   2.798   1.00 0.00 ? 69  LEU A CG   5  
ATOM 8062  C CD1  . LEU A 1 69  ? 3.895   5.214   3.144   1.00 0.00 ? 69  LEU A CD1  5  
ATOM 8063  C CD2  . LEU A 1 69  ? 3.483   7.661   3.671   1.00 0.00 ? 69  LEU A CD2  5  
ATOM 8064  H H    . LEU A 1 69  ? 6.037   7.625   0.127   1.00 0.00 ? 69  LEU A H    5  
ATOM 8065  H HA   . LEU A 1 69  ? 6.008   8.999   2.710   1.00 0.00 ? 69  LEU A HA   5  
ATOM 8066  H HB2  . LEU A 1 69  ? 6.264   6.010   2.510   1.00 0.00 ? 69  LEU A HB2  5  
ATOM 8067  H HB3  . LEU A 1 69  ? 6.026   6.996   3.939   1.00 0.00 ? 69  LEU A HB3  5  
ATOM 8068  H HG   . LEU A 1 69  ? 3.935   6.832   1.768   1.00 0.00 ? 69  LEU A HG   5  
ATOM 8069  H HD11 . LEU A 1 69  ? 3.812   4.631   2.226   1.00 0.00 ? 69  LEU A HD11 5  
ATOM 8070  H HD12 . LEU A 1 69  ? 4.678   4.790   3.773   1.00 0.00 ? 69  LEU A HD12 5  
ATOM 8071  H HD13 . LEU A 1 69  ? 2.946   5.187   3.678   1.00 0.00 ? 69  LEU A HD13 5  
ATOM 8072  H HD21 . LEU A 1 69  ? 3.998   7.777   4.625   1.00 0.00 ? 69  LEU A HD21 5  
ATOM 8073  H HD22 . LEU A 1 69  ? 3.436   8.624   3.164   1.00 0.00 ? 69  LEU A HD22 5  
ATOM 8074  H HD23 . LEU A 1 69  ? 2.473   7.292   3.846   1.00 0.00 ? 69  LEU A HD23 5  
ATOM 8075  N N    . PRO A 1 70  ? 8.515   8.451   3.078   1.00 0.00 ? 70  PRO A N    5  
ATOM 8076  C CA   . PRO A 1 70  ? 9.967   8.492   3.061   1.00 0.00 ? 70  PRO A CA   5  
ATOM 8077  C C    . PRO A 1 70  ? 10.555  7.079   3.072   1.00 0.00 ? 70  PRO A C    5  
ATOM 8078  O O    . PRO A 1 70  ? 9.818   6.096   3.126   1.00 0.00 ? 70  PRO A O    5  
ATOM 8079  C CB   . PRO A 1 70  ? 10.353  9.305   4.286   1.00 0.00 ? 70  PRO A CB   5  
ATOM 8080  C CG   . PRO A 1 70  ? 9.133   9.296   5.193   1.00 0.00 ? 70  PRO A CG   5  
ATOM 8081  C CD   . PRO A 1 70  ? 7.950   8.800   4.378   1.00 0.00 ? 70  PRO A CD   5  
ATOM 8082  H HA   . PRO A 1 70  ? 10.293  8.916   2.216   1.00 0.00 ? 70  PRO A HA   5  
ATOM 8083  H HB2  . PRO A 1 70  ? 11.217  8.870   4.788   1.00 0.00 ? 70  PRO A HB2  5  
ATOM 8084  H HB3  . PRO A 1 70  ? 10.625  10.324  4.008   1.00 0.00 ? 70  PRO A HB3  5  
ATOM 8085  H HG2  . PRO A 1 70  ? 9.302   8.648   6.053   1.00 0.00 ? 70  PRO A HG2  5  
ATOM 8086  H HG3  . PRO A 1 70  ? 8.938   10.296  5.581   1.00 0.00 ? 70  PRO A HG3  5  
ATOM 8087  H HD2  . PRO A 1 70  ? 7.478   7.937   4.849   1.00 0.00 ? 70  PRO A HD2  5  
ATOM 8088  H HD3  . PRO A 1 70  ? 7.184   9.569   4.283   1.00 0.00 ? 70  PRO A HD3  5  
ATOM 8089  N N    . ASN A 1 71  ? 11.878  7.023   3.022   1.00 0.00 ? 71  ASN A N    5  
ATOM 8090  C CA   . ASN A 1 71  ? 12.574  5.747   3.025   1.00 0.00 ? 71  ASN A CA   5  
ATOM 8091  C C    . ASN A 1 71  ? 12.812  5.305   4.471   1.00 0.00 ? 71  ASN A C    5  
ATOM 8092  O O    . ASN A 1 71  ? 13.658  4.451   4.731   1.00 0.00 ? 71  ASN A O    5  
ATOM 8093  C CB   . ASN A 1 71  ? 13.934  5.859   2.335   1.00 0.00 ? 71  ASN A CB   5  
ATOM 8094  C CG   . ASN A 1 71  ? 14.888  6.743   3.143   1.00 0.00 ? 71  ASN A CG   5  
ATOM 8095  O OD1  . ASN A 1 71  ? 15.401  6.360   4.181   1.00 0.00 ? 71  ASN A OD1  5  
ATOM 8096  N ND2  . ASN A 1 71  ? 15.094  7.944   2.610   1.00 0.00 ? 71  ASN A ND2  5  
ATOM 8097  H H    . ASN A 1 71  ? 12.471  7.827   2.979   1.00 0.00 ? 71  ASN A H    5  
ATOM 8098  H HA   . ASN A 1 71  ? 11.921  5.064   2.483   1.00 0.00 ? 71  ASN A HA   5  
ATOM 8099  H HB2  . ASN A 1 71  ? 14.368  4.867   2.214   1.00 0.00 ? 71  ASN A HB2  5  
ATOM 8100  H HB3  . ASN A 1 71  ? 13.806  6.275   1.336   1.00 0.00 ? 71  ASN A HB3  5  
ATOM 8101  H HD21 . ASN A 1 71  ? 14.641  8.196   1.755   1.00 0.00 ? 71  ASN A HD21 5  
ATOM 8102  H HD22 . ASN A 1 71  ? 15.702  8.595   3.064   1.00 0.00 ? 71  ASN A HD22 5  
ATOM 8103  N N    . VAL A 1 72  ? 12.050  5.907   5.373   1.00 0.00 ? 72  VAL A N    5  
ATOM 8104  C CA   . VAL A 1 72  ? 12.168  5.586   6.785   1.00 0.00 ? 72  VAL A CA   5  
ATOM 8105  C C    . VAL A 1 72  ? 10.883  4.903   7.257   1.00 0.00 ? 72  VAL A C    5  
ATOM 8106  O O    . VAL A 1 72  ? 10.888  4.187   8.257   1.00 0.00 ? 72  VAL A O    5  
ATOM 8107  C CB   . VAL A 1 72  ? 12.501  6.849   7.583   1.00 0.00 ? 72  VAL A CB   5  
ATOM 8108  C CG1  . VAL A 1 72  ? 13.735  7.549   7.010   1.00 0.00 ? 72  VAL A CG1  5  
ATOM 8109  C CG2  . VAL A 1 72  ? 11.303  7.800   7.629   1.00 0.00 ? 72  VAL A CG2  5  
ATOM 8110  H H    . VAL A 1 72  ? 11.365  6.601   5.153   1.00 0.00 ? 72  VAL A H    5  
ATOM 8111  H HA   . VAL A 1 72  ? 12.998  4.888   6.896   1.00 0.00 ? 72  VAL A HA   5  
ATOM 8112  H HB   . VAL A 1 72  ? 12.730  6.549   8.605   1.00 0.00 ? 72  VAL A HB   5  
ATOM 8113  H HG11 . VAL A 1 72  ? 13.882  8.501   7.521   1.00 0.00 ? 72  VAL A HG11 5  
ATOM 8114  H HG12 . VAL A 1 72  ? 14.612  6.918   7.157   1.00 0.00 ? 72  VAL A HG12 5  
ATOM 8115  H HG13 . VAL A 1 72  ? 13.590  7.728   5.945   1.00 0.00 ? 72  VAL A HG13 5  
ATOM 8116  H HG21 . VAL A 1 72  ? 11.057  8.023   8.668   1.00 0.00 ? 72  VAL A HG21 5  
ATOM 8117  H HG22 . VAL A 1 72  ? 11.552  8.724   7.108   1.00 0.00 ? 72  VAL A HG22 5  
ATOM 8118  H HG23 . VAL A 1 72  ? 10.447  7.329   7.146   1.00 0.00 ? 72  VAL A HG23 5  
ATOM 8119  N N    . THR A 1 73  ? 9.813   5.147   6.515   1.00 0.00 ? 73  THR A N    5  
ATOM 8120  C CA   . THR A 1 73  ? 8.524   4.564   6.845   1.00 0.00 ? 73  THR A CA   5  
ATOM 8121  C C    . THR A 1 73  ? 8.217   3.388   5.916   1.00 0.00 ? 73  THR A C    5  
ATOM 8122  O O    . THR A 1 73  ? 8.564   3.417   4.736   1.00 0.00 ? 73  THR A O    5  
ATOM 8123  C CB   . THR A 1 73  ? 7.474   5.675   6.786   1.00 0.00 ? 73  THR A CB   5  
ATOM 8124  O OG1  . THR A 1 73  ? 7.690   6.421   7.980   1.00 0.00 ? 73  THR A OG1  5  
ATOM 8125  C CG2  . THR A 1 73  ? 6.047   5.141   6.933   1.00 0.00 ? 73  THR A CG2  5  
ATOM 8126  H H    . THR A 1 73  ? 9.818   5.731   5.703   1.00 0.00 ? 73  THR A H    5  
ATOM 8127  H HA   . THR A 1 73  ? 8.576   4.166   7.858   1.00 0.00 ? 73  THR A HA   5  
ATOM 8128  H HB   . THR A 1 73  ? 7.578   6.261   5.872   1.00 0.00 ? 73  THR A HB   5  
ATOM 8129  H HG1  . THR A 1 73  ? 8.213   7.249   7.777   1.00 0.00 ? 73  THR A HG1  5  
ATOM 8130  H HG21 . THR A 1 73  ? 5.853   4.404   6.154   1.00 0.00 ? 73  THR A HG21 5  
ATOM 8131  H HG22 . THR A 1 73  ? 5.934   4.674   7.911   1.00 0.00 ? 73  THR A HG22 5  
ATOM 8132  H HG23 . THR A 1 73  ? 5.339   5.964   6.839   1.00 0.00 ? 73  THR A HG23 5  
ATOM 8133  N N    . LEU A 1 74  ? 7.570   2.381   6.483   1.00 0.00 ? 74  LEU A N    5  
ATOM 8134  C CA   . LEU A 1 74  ? 7.213   1.196   5.720   1.00 0.00 ? 74  LEU A CA   5  
ATOM 8135  C C    . LEU A 1 74  ? 5.784   0.780   6.074   1.00 0.00 ? 74  LEU A C    5  
ATOM 8136  O O    . LEU A 1 74  ? 5.345   -0.312  5.715   1.00 0.00 ? 74  LEU A O    5  
ATOM 8137  C CB   . LEU A 1 74  ? 8.247   0.089   5.934   1.00 0.00 ? 74  LEU A CB   5  
ATOM 8138  C CG   . LEU A 1 74  ? 9.697   0.549   6.096   1.00 0.00 ? 74  LEU A CG   5  
ATOM 8139  C CD1  . LEU A 1 74  ? 10.422  -0.286  7.154   1.00 0.00 ? 74  LEU A CD1  5  
ATOM 8140  C CD2  . LEU A 1 74  ? 10.430  0.533   4.753   1.00 0.00 ? 74  LEU A CD2  5  
ATOM 8141  H H    . LEU A 1 74  ? 7.291   2.365   7.443   1.00 0.00 ? 74  LEU A H    5  
ATOM 8142  H HA   . LEU A 1 74  ? 7.243   1.466   4.665   1.00 0.00 ? 74  LEU A HA   5  
ATOM 8143  H HB2  . LEU A 1 74  ? 7.965   -0.478  6.821   1.00 0.00 ? 74  LEU A HB2  5  
ATOM 8144  H HB3  . LEU A 1 74  ? 8.196   -0.596  5.088   1.00 0.00 ? 74  LEU A HB3  5  
ATOM 8145  H HG   . LEU A 1 74  ? 9.692   1.580   6.448   1.00 0.00 ? 74  LEU A HG   5  
ATOM 8146  H HD11 . LEU A 1 74  ? 9.818   -0.325  8.061   1.00 0.00 ? 74  LEU A HD11 5  
ATOM 8147  H HD12 . LEU A 1 74  ? 10.577  -1.296  6.777   1.00 0.00 ? 74  LEU A HD12 5  
ATOM 8148  H HD13 . LEU A 1 74  ? 11.386  0.170   7.379   1.00 0.00 ? 74  LEU A HD13 5  
ATOM 8149  H HD21 . LEU A 1 74  ? 9.716   0.349   3.951   1.00 0.00 ? 74  LEU A HD21 5  
ATOM 8150  H HD22 . LEU A 1 74  ? 10.916  1.495   4.593   1.00 0.00 ? 74  LEU A HD22 5  
ATOM 8151  H HD23 . LEU A 1 74  ? 11.182  -0.257  4.759   1.00 0.00 ? 74  LEU A HD23 5  
ATOM 8152  N N    . GLU A 1 75  ? 5.097   1.671   6.773   1.00 0.00 ? 75  GLU A N    5  
ATOM 8153  C CA   . GLU A 1 75  ? 3.727   1.410   7.179   1.00 0.00 ? 75  GLU A CA   5  
ATOM 8154  C C    . GLU A 1 75  ? 2.902   2.697   7.125   1.00 0.00 ? 75  GLU A C    5  
ATOM 8155  O O    . GLU A 1 75  ? 3.438   3.790   7.301   1.00 0.00 ? 75  GLU A O    5  
ATOM 8156  C CB   . GLU A 1 75  ? 3.678   0.786   8.576   1.00 0.00 ? 75  GLU A CB   5  
ATOM 8157  C CG   . GLU A 1 75  ? 4.115   1.793   9.641   1.00 0.00 ? 75  GLU A CG   5  
ATOM 8158  C CD   . GLU A 1 75  ? 5.500   1.444   10.190  1.00 0.00 ? 75  GLU A CD   5  
ATOM 8159  O OE1  . GLU A 1 75  ? 5.599   0.388   10.852  1.00 0.00 ? 75  GLU A OE1  5  
ATOM 8160  O OE2  . GLU A 1 75  ? 6.429   2.241   9.936   1.00 0.00 ? 75  GLU A OE2  5  
ATOM 8161  H H    . GLU A 1 75  ? 5.461   2.557   7.061   1.00 0.00 ? 75  GLU A H    5  
ATOM 8162  H HA   . GLU A 1 75  ? 3.342   0.692   6.454   1.00 0.00 ? 75  GLU A HA   5  
ATOM 8163  H HB2  . GLU A 1 75  ? 2.666   0.442   8.789   1.00 0.00 ? 75  GLU A HB2  5  
ATOM 8164  H HB3  . GLU A 1 75  ? 4.326   -0.089  8.610   1.00 0.00 ? 75  GLU A HB3  5  
ATOM 8165  H HG2  . GLU A 1 75  ? 4.131   2.796   9.214   1.00 0.00 ? 75  GLU A HG2  5  
ATOM 8166  H HG3  . GLU A 1 75  ? 3.390   1.805   10.455  1.00 0.00 ? 75  GLU A HG3  5  
ATOM 8167  N N    . TYR A 1 76  ? 1.611   2.525   6.880   1.00 0.00 ? 76  TYR A N    5  
ATOM 8168  C CA   . TYR A 1 76  ? 0.707   3.660   6.800   1.00 0.00 ? 76  TYR A CA   5  
ATOM 8169  C C    . TYR A 1 76  ? -0.739  3.227   7.052   1.00 0.00 ? 76  TYR A C    5  
ATOM 8170  O O    . TYR A 1 76  ? -1.097  2.075   6.815   1.00 0.00 ? 76  TYR A O    5  
ATOM 8171  C CB   . TYR A 1 76  ? 0.825   4.193   5.371   1.00 0.00 ? 76  TYR A CB   5  
ATOM 8172  C CG   . TYR A 1 76  ? -0.081  5.390   5.076   1.00 0.00 ? 76  TYR A CG   5  
ATOM 8173  C CD1  . TYR A 1 76  ? -1.378  5.185   4.650   1.00 0.00 ? 76  TYR A CD1  5  
ATOM 8174  C CD2  . TYR A 1 76  ? 0.397   6.674   5.237   1.00 0.00 ? 76  TYR A CD2  5  
ATOM 8175  C CE1  . TYR A 1 76  ? -2.231  6.312   4.372   1.00 0.00 ? 76  TYR A CE1  5  
ATOM 8176  C CE2  . TYR A 1 76  ? -0.456  7.801   4.960   1.00 0.00 ? 76  TYR A CE2  5  
ATOM 8177  C CZ   . TYR A 1 76  ? -1.728  7.564   4.541   1.00 0.00 ? 76  TYR A CZ   5  
ATOM 8178  O OH   . TYR A 1 76  ? -2.534  8.628   4.280   1.00 0.00 ? 76  TYR A OH   5  
ATOM 8179  H H    . TYR A 1 76  ? 1.183   1.633   6.738   1.00 0.00 ? 76  TYR A H    5  
ATOM 8180  H HA   . TYR A 1 76  ? 1.002   4.379   7.563   1.00 0.00 ? 76  TYR A HA   5  
ATOM 8181  H HB2  . TYR A 1 76  ? 1.860   4.480   5.185   1.00 0.00 ? 76  TYR A HB2  5  
ATOM 8182  H HB3  . TYR A 1 76  ? 0.587   3.390   4.673   1.00 0.00 ? 76  TYR A HB3  5  
ATOM 8183  H HD1  . TYR A 1 76  ? -1.756  4.171   4.523   1.00 0.00 ? 76  TYR A HD1  5  
ATOM 8184  H HD2  . TYR A 1 76  ? 1.421   6.836   5.574   1.00 0.00 ? 76  TYR A HD2  5  
ATOM 8185  H HE1  . TYR A 1 76  ? -3.257  6.164   4.035   1.00 0.00 ? 76  TYR A HE1  5  
ATOM 8186  H HE2  . TYR A 1 76  ? -0.090  8.820   5.083   1.00 0.00 ? 76  TYR A HE2  5  
ATOM 8187  H HH   . TYR A 1 76  ? -3.461  8.313   4.078   1.00 0.00 ? 76  TYR A HH   5  
ATOM 8188  N N    . ARG A 1 77  ? -1.532  4.176   7.530   1.00 0.00 ? 77  ARG A N    5  
ATOM 8189  C CA   . ARG A 1 77  ? -2.930  3.908   7.817   1.00 0.00 ? 77  ARG A CA   5  
ATOM 8190  C C    . ARG A 1 77  ? -3.808  4.352   6.645   1.00 0.00 ? 77  ARG A C    5  
ATOM 8191  O O    . ARG A 1 77  ? -3.747  5.505   6.222   1.00 0.00 ? 77  ARG A O    5  
ATOM 8192  C CB   . ARG A 1 77  ? -3.381  4.634   9.086   1.00 0.00 ? 77  ARG A CB   5  
ATOM 8193  C CG   . ARG A 1 77  ? -4.696  4.054   9.612   1.00 0.00 ? 77  ARG A CG   5  
ATOM 8194  C CD   . ARG A 1 77  ? -5.878  4.950   9.240   1.00 0.00 ? 77  ARG A CD   5  
ATOM 8195  N NE   . ARG A 1 77  ? -6.607  5.360   10.461  1.00 0.00 ? 77  ARG A NE   5  
ATOM 8196  C CZ   . ARG A 1 77  ? -6.174  6.298   11.314  1.00 0.00 ? 77  ARG A CZ   5  
ATOM 8197  N NH1  . ARG A 1 77  ? -5.014  6.928   11.086  1.00 0.00 ? 77  ARG A NH1  5  
ATOM 8198  N NH2  . ARG A 1 77  ? -6.901  6.605   12.397  1.00 0.00 ? 77  ARG A NH2  5  
ATOM 8199  H H    . ARG A 1 77  ? -1.233  5.111   7.720   1.00 0.00 ? 77  ARG A H    5  
ATOM 8200  H HA   . ARG A 1 77  ? -2.984  2.828   7.960   1.00 0.00 ? 77  ARG A HA   5  
ATOM 8201  H HB2  . ARG A 1 77  ? -2.610  4.549   9.852   1.00 0.00 ? 77  ARG A HB2  5  
ATOM 8202  H HB3  . ARG A 1 77  ? -3.506  5.696   8.877   1.00 0.00 ? 77  ARG A HB3  5  
ATOM 8203  H HG2  . ARG A 1 77  ? -4.847  3.056   9.201   1.00 0.00 ? 77  ARG A HG2  5  
ATOM 8204  H HG3  . ARG A 1 77  ? -4.642  3.947   10.696  1.00 0.00 ? 77  ARG A HG3  5  
ATOM 8205  H HD2  . ARG A 1 77  ? -5.523  5.831   8.705   1.00 0.00 ? 77  ARG A HD2  5  
ATOM 8206  H HD3  . ARG A 1 77  ? -6.551  4.418   8.567   1.00 0.00 ? 77  ARG A HD3  5  
ATOM 8207  H HE   . ARG A 1 77  ? -7.477  4.909   10.662  1.00 0.00 ? 77  ARG A HE   5  
ATOM 8208  H HH11 . ARG A 1 77  ? -4.471  6.699   10.278  1.00 0.00 ? 77  ARG A HH11 5  
ATOM 8209  H HH12 . ARG A 1 77  ? -4.691  7.628   11.723  1.00 0.00 ? 77  ARG A HH12 5  
ATOM 8210  H HH21 . ARG A 1 77  ? -7.767  6.135   12.568  1.00 0.00 ? 77  ARG A HH21 5  
ATOM 8211  H HH22 . ARG A 1 77  ? -6.578  7.305   13.034  1.00 0.00 ? 77  ARG A HH22 5  
ATOM 8212  N N    . VAL A 1 78  ? -4.602  3.413   6.153   1.00 0.00 ? 78  VAL A N    5  
ATOM 8213  C CA   . VAL A 1 78  ? -5.491  3.693   5.038   1.00 0.00 ? 78  VAL A CA   5  
ATOM 8214  C C    . VAL A 1 78  ? -6.875  4.062   5.574   1.00 0.00 ? 78  VAL A C    5  
ATOM 8215  O O    . VAL A 1 78  ? -7.263  3.622   6.656   1.00 0.00 ? 78  VAL A O    5  
ATOM 8216  C CB   . VAL A 1 78  ? -5.519  2.501   4.079   1.00 0.00 ? 78  VAL A CB   5  
ATOM 8217  C CG1  . VAL A 1 78  ? -6.507  2.740   2.936   1.00 0.00 ? 78  VAL A CG1  5  
ATOM 8218  C CG2  . VAL A 1 78  ? -4.120  2.197   3.541   1.00 0.00 ? 78  VAL A CG2  5  
ATOM 8219  H H    . VAL A 1 78  ? -4.645  2.477   6.503   1.00 0.00 ? 78  VAL A H    5  
ATOM 8220  H HA   . VAL A 1 78  ? -5.083  4.549   4.500   1.00 0.00 ? 78  VAL A HA   5  
ATOM 8221  H HB   . VAL A 1 78  ? -5.860  1.629   4.638   1.00 0.00 ? 78  VAL A HB   5  
ATOM 8222  H HG11 . VAL A 1 78  ? -7.516  2.499   3.270   1.00 0.00 ? 78  VAL A HG11 5  
ATOM 8223  H HG12 . VAL A 1 78  ? -6.466  3.787   2.633   1.00 0.00 ? 78  VAL A HG12 5  
ATOM 8224  H HG13 . VAL A 1 78  ? -6.244  2.106   2.089   1.00 0.00 ? 78  VAL A HG13 5  
ATOM 8225  H HG21 . VAL A 1 78  ? -3.707  3.092   3.077   1.00 0.00 ? 78  VAL A HG21 5  
ATOM 8226  H HG22 . VAL A 1 78  ? -3.475  1.882   4.361   1.00 0.00 ? 78  VAL A HG22 5  
ATOM 8227  H HG23 . VAL A 1 78  ? -4.181  1.399   2.800   1.00 0.00 ? 78  VAL A HG23 5  
ATOM 8228  N N    . THR A 1 79  ? -7.582  4.866   4.794   1.00 0.00 ? 79  THR A N    5  
ATOM 8229  C CA   . THR A 1 79  ? -8.915  5.299   5.177   1.00 0.00 ? 79  THR A CA   5  
ATOM 8230  C C    . THR A 1 79  ? -9.741  5.645   3.937   1.00 0.00 ? 79  THR A C    5  
ATOM 8231  O O    . THR A 1 79  ? -9.187  5.996   2.896   1.00 0.00 ? 79  THR A O    5  
ATOM 8232  C CB   . THR A 1 79  ? -8.770  6.466   6.156   1.00 0.00 ? 79  THR A CB   5  
ATOM 8233  O OG1  . THR A 1 79  ? -8.023  7.437   5.429   1.00 0.00 ? 79  THR A OG1  5  
ATOM 8234  C CG2  . THR A 1 79  ? -7.875  6.123   7.348   1.00 0.00 ? 79  THR A CG2  5  
ATOM 8235  H H    . THR A 1 79  ? -7.259  5.219   3.916   1.00 0.00 ? 79  THR A H    5  
ATOM 8236  H HA   . THR A 1 79  ? -9.417  4.468   5.674   1.00 0.00 ? 79  THR A HA   5  
ATOM 8237  H HB   . THR A 1 79  ? -9.746  6.817   6.490   1.00 0.00 ? 79  THR A HB   5  
ATOM 8238  H HG1  . THR A 1 79  ? -8.620  7.921   4.790   1.00 0.00 ? 79  THR A HG1  5  
ATOM 8239  H HG21 . THR A 1 79  ? -7.903  6.939   8.070   1.00 0.00 ? 79  THR A HG21 5  
ATOM 8240  H HG22 . THR A 1 79  ? -8.233  5.208   7.820   1.00 0.00 ? 79  THR A HG22 5  
ATOM 8241  H HG23 . THR A 1 79  ? -6.851  5.977   7.004   1.00 0.00 ? 79  THR A HG23 5  
ATOM 8242  N N    . GLY A 1 80  ? -11.053 5.534   4.088   1.00 0.00 ? 80  GLY A N    5  
ATOM 8243  C CA   . GLY A 1 80  ? -11.960 5.831   2.993   1.00 0.00 ? 80  GLY A CA   5  
ATOM 8244  C C    . GLY A 1 80  ? -12.262 4.574   2.175   1.00 0.00 ? 80  GLY A C    5  
ATOM 8245  O O    . GLY A 1 80  ? -12.471 4.652   0.965   1.00 0.00 ? 80  GLY A O    5  
ATOM 8246  H H    . GLY A 1 80  ? -11.495 5.248   4.938   1.00 0.00 ? 80  GLY A H    5  
ATOM 8247  H HA2  . GLY A 1 80  ? -12.889 6.244   3.387   1.00 0.00 ? 80  GLY A HA2  5  
ATOM 8248  H HA3  . GLY A 1 80  ? -11.521 6.592   2.348   1.00 0.00 ? 80  GLY A HA3  5  
ATOM 8249  N N    . LEU A 1 81  ? -12.274 3.445   2.867   1.00 0.00 ? 81  LEU A N    5  
ATOM 8250  C CA   . LEU A 1 81  ? -12.547 2.173   2.220   1.00 0.00 ? 81  LEU A CA   5  
ATOM 8251  C C    . LEU A 1 81  ? -14.028 1.827   2.388   1.00 0.00 ? 81  LEU A C    5  
ATOM 8252  O O    . LEU A 1 81  ? -14.877 2.716   2.420   1.00 0.00 ? 81  LEU A O    5  
ATOM 8253  C CB   . LEU A 1 81  ? -11.600 1.091   2.744   1.00 0.00 ? 81  LEU A CB   5  
ATOM 8254  C CG   . LEU A 1 81  ? -10.163 1.537   3.026   1.00 0.00 ? 81  LEU A CG   5  
ATOM 8255  C CD1  . LEU A 1 81  ? -9.471  0.574   3.993   1.00 0.00 ? 81  LEU A CD1  5  
ATOM 8256  C CD2  . LEU A 1 81  ? -9.376  1.708   1.726   1.00 0.00 ? 81  LEU A CD2  5  
ATOM 8257  H H    . LEU A 1 81  ? -12.103 3.390   3.851   1.00 0.00 ? 81  LEU A H    5  
ATOM 8258  H HA   . LEU A 1 81  ? -12.339 2.296   1.157   1.00 0.00 ? 81  LEU A HA   5  
ATOM 8259  H HB2  . LEU A 1 81  ? -12.020 0.682   3.663   1.00 0.00 ? 81  LEU A HB2  5  
ATOM 8260  H HB3  . LEU A 1 81  ? -11.571 0.279   2.018   1.00 0.00 ? 81  LEU A HB3  5  
ATOM 8261  H HG   . LEU A 1 81  ? -10.198 2.512   3.513   1.00 0.00 ? 81  LEU A HG   5  
ATOM 8262  H HD11 . LEU A 1 81  ? -8.662  0.059   3.475   1.00 0.00 ? 81  LEU A HD11 5  
ATOM 8263  H HD12 . LEU A 1 81  ? -9.065  1.134   4.835   1.00 0.00 ? 81  LEU A HD12 5  
ATOM 8264  H HD13 . LEU A 1 81  ? -10.193 -0.157  4.357   1.00 0.00 ? 81  LEU A HD13 5  
ATOM 8265  H HD21 . LEU A 1 81  ? -9.280  2.769   1.496   1.00 0.00 ? 81  LEU A HD21 5  
ATOM 8266  H HD22 . LEU A 1 81  ? -8.385  1.269   1.840   1.00 0.00 ? 81  LEU A HD22 5  
ATOM 8267  H HD23 . LEU A 1 81  ? -9.904  1.207   0.913   1.00 0.00 ? 81  LEU A HD23 5  
ATOM 8268  N N    . THR A 1 82  ? -14.292 0.533   2.490   1.00 0.00 ? 82  THR A N    5  
ATOM 8269  C CA   . THR A 1 82  ? -15.656 0.059   2.653   1.00 0.00 ? 82  THR A CA   5  
ATOM 8270  C C    . THR A 1 82  ? -15.706 -1.083  3.671   1.00 0.00 ? 82  THR A C    5  
ATOM 8271  O O    . THR A 1 82  ? -14.761 -1.863  3.780   1.00 0.00 ? 82  THR A O    5  
ATOM 8272  C CB   . THR A 1 82  ? -16.189 -0.334  1.273   1.00 0.00 ? 82  THR A CB   5  
ATOM 8273  O OG1  . THR A 1 82  ? -15.916 0.803   0.459   1.00 0.00 ? 82  THR A OG1  5  
ATOM 8274  C CG2  . THR A 1 82  ? -17.714 -0.455  1.247   1.00 0.00 ? 82  THR A CG2  5  
ATOM 8275  H H    . THR A 1 82  ? -13.596 -0.184  2.462   1.00 0.00 ? 82  THR A H    5  
ATOM 8276  H HA   . THR A 1 82  ? -16.257 0.873   3.056   1.00 0.00 ? 82  THR A HA   5  
ATOM 8277  H HB   . THR A 1 82  ? -15.719 -1.253  0.922   1.00 0.00 ? 82  THR A HB   5  
ATOM 8278  H HG1  . THR A 1 82  ? -16.190 0.621   -0.485  1.00 0.00 ? 82  THR A HG1  5  
ATOM 8279  H HG21 . THR A 1 82  ? -18.130 0.338   0.627   1.00 0.00 ? 82  THR A HG21 5  
ATOM 8280  H HG22 . THR A 1 82  ? -17.994 -1.424  0.834   1.00 0.00 ? 82  THR A HG22 5  
ATOM 8281  H HG23 . THR A 1 82  ? -18.103 -0.367  2.261   1.00 0.00 ? 82  THR A HG23 5  
ATOM 8282  N N    . ALA A 1 83  ? -16.817 -1.143  4.390   1.00 0.00 ? 83  ALA A N    5  
ATOM 8283  C CA   . ALA A 1 83  ? -17.002 -2.176  5.396   1.00 0.00 ? 83  ALA A CA   5  
ATOM 8284  C C    . ALA A 1 83  ? -17.164 -3.531  4.705   1.00 0.00 ? 83  ALA A C    5  
ATOM 8285  O O    . ALA A 1 83  ? -17.784 -3.622  3.646   1.00 0.00 ? 83  ALA A O    5  
ATOM 8286  C CB   . ALA A 1 83  ? -18.203 -1.823  6.276   1.00 0.00 ? 83  ALA A CB   5  
ATOM 8287  H H    . ALA A 1 83  ? -17.580 -0.504  4.295   1.00 0.00 ? 83  ALA A H    5  
ATOM 8288  H HA   . ALA A 1 83  ? -16.106 -2.199  6.017   1.00 0.00 ? 83  ALA A HA   5  
ATOM 8289  H HB1  . ALA A 1 83  ? -19.107 -1.811  5.668   1.00 0.00 ? 83  ALA A HB1  5  
ATOM 8290  H HB2  . ALA A 1 83  ? -18.305 -2.566  7.066   1.00 0.00 ? 83  ALA A HB2  5  
ATOM 8291  H HB3  . ALA A 1 83  ? -18.051 -0.839  6.719   1.00 0.00 ? 83  ALA A HB3  5  
ATOM 8292  N N    . LEU A 1 84  ? -16.595 -4.551  5.332   1.00 0.00 ? 84  LEU A N    5  
ATOM 8293  C CA   . LEU A 1 84  ? -16.669 -5.897  4.790   1.00 0.00 ? 84  LEU A CA   5  
ATOM 8294  C C    . LEU A 1 84  ? -16.488 -5.842  3.272   1.00 0.00 ? 84  LEU A C    5  
ATOM 8295  O O    . LEU A 1 84  ? -17.318 -6.359  2.525   1.00 0.00 ? 84  LEU A O    5  
ATOM 8296  C CB   . LEU A 1 84  ? -17.965 -6.582  5.231   1.00 0.00 ? 84  LEU A CB   5  
ATOM 8297  C CG   . LEU A 1 84  ? -18.223 -6.622  6.739   1.00 0.00 ? 84  LEU A CG   5  
ATOM 8298  C CD1  . LEU A 1 84  ? -19.355 -7.594  7.075   1.00 0.00 ? 84  LEU A CD1  5  
ATOM 8299  C CD2  . LEU A 1 84  ? -16.940 -6.948  7.506   1.00 0.00 ? 84  LEU A CD2  5  
ATOM 8300  H H    . LEU A 1 84  ? -16.093 -4.468  6.192   1.00 0.00 ? 84  LEU A H    5  
ATOM 8301  H HA   . LEU A 1 84  ? -15.843 -6.466  5.216   1.00 0.00 ? 84  LEU A HA   5  
ATOM 8302  H HB2  . LEU A 1 84  ? -18.802 -6.073  4.753   1.00 0.00 ? 84  LEU A HB2  5  
ATOM 8303  H HB3  . LEU A 1 84  ? -17.957 -7.605  4.856   1.00 0.00 ? 84  LEU A HB3  5  
ATOM 8304  H HG   . LEU A 1 84  ? -18.544 -5.630  7.057   1.00 0.00 ? 84  LEU A HG   5  
ATOM 8305  H HD11 . LEU A 1 84  ? -20.256 -7.032  7.320   1.00 0.00 ? 84  LEU A HD11 5  
ATOM 8306  H HD12 . LEU A 1 84  ? -19.549 -8.237  6.216   1.00 0.00 ? 84  LEU A HD12 5  
ATOM 8307  H HD13 . LEU A 1 84  ? -19.066 -8.207  7.929   1.00 0.00 ? 84  LEU A HD13 5  
ATOM 8308  H HD21 . LEU A 1 84  ? -16.348 -6.041  7.628   1.00 0.00 ? 84  LEU A HD21 5  
ATOM 8309  H HD22 . LEU A 1 84  ? -17.195 -7.350  8.486   1.00 0.00 ? 84  LEU A HD22 5  
ATOM 8310  H HD23 . LEU A 1 84  ? -16.362 -7.687  6.950   1.00 0.00 ? 84  LEU A HD23 5  
ATOM 8311  N N    . THR A 1 85  ? -15.398 -5.211  2.860   1.00 0.00 ? 85  THR A N    5  
ATOM 8312  C CA   . THR A 1 85  ? -15.098 -5.082  1.444   1.00 0.00 ? 85  THR A CA   5  
ATOM 8313  C C    . THR A 1 85  ? -13.639 -5.453  1.173   1.00 0.00 ? 85  THR A C    5  
ATOM 8314  O O    . THR A 1 85  ? -12.763 -5.184  1.994   1.00 0.00 ? 85  THR A O    5  
ATOM 8315  C CB   . THR A 1 85  ? -15.453 -3.658  1.014   1.00 0.00 ? 85  THR A CB   5  
ATOM 8316  O OG1  . THR A 1 85  ? -16.874 -3.672  0.905   1.00 0.00 ? 85  THR A OG1  5  
ATOM 8317  C CG2  . THR A 1 85  ? -14.974 -3.338  -0.404  1.00 0.00 ? 85  THR A CG2  5  
ATOM 8318  H H    . THR A 1 85  ? -14.729 -4.794  3.474   1.00 0.00 ? 85  THR A H    5  
ATOM 8319  H HA   . THR A 1 85  ? -15.716 -5.793  0.896   1.00 0.00 ? 85  THR A HA   5  
ATOM 8320  H HB   . THR A 1 85  ? -15.071 -2.929  1.728   1.00 0.00 ? 85  THR A HB   5  
ATOM 8321  H HG1  . THR A 1 85  ? -17.168 -4.464  0.370   1.00 0.00 ? 85  THR A HG1  5  
ATOM 8322  H HG21 . THR A 1 85  ? -15.185 -4.184  -1.058  1.00 0.00 ? 85  THR A HG21 5  
ATOM 8323  H HG22 . THR A 1 85  ? -15.496 -2.455  -0.773  1.00 0.00 ? 85  THR A HG22 5  
ATOM 8324  H HG23 . THR A 1 85  ? -13.901 -3.147  -0.390  1.00 0.00 ? 85  THR A HG23 5  
ATOM 8325  N N    . THR A 1 86  ? -13.422 -6.065  0.018   1.00 0.00 ? 86  THR A N    5  
ATOM 8326  C CA   . THR A 1 86  ? -12.084 -6.475  -0.372  1.00 0.00 ? 86  THR A CA   5  
ATOM 8327  C C    . THR A 1 86  ? -11.327 -5.302  -0.997  1.00 0.00 ? 86  THR A C    5  
ATOM 8328  O O    . THR A 1 86  ? -11.873 -4.579  -1.829  1.00 0.00 ? 86  THR A O    5  
ATOM 8329  C CB   . THR A 1 86  ? -12.213 -7.681  -1.305  1.00 0.00 ? 86  THR A CB   5  
ATOM 8330  O OG1  . THR A 1 86  ? -12.845 -8.675  -0.503  1.00 0.00 ? 86  THR A OG1  5  
ATOM 8331  C CG2  . THR A 1 86  ? -10.857 -8.295  -1.659  1.00 0.00 ? 86  THR A CG2  5  
ATOM 8332  H H    . THR A 1 86  ? -14.140 -6.280  -0.644  1.00 0.00 ? 86  THR A H    5  
ATOM 8333  H HA   . THR A 1 86  ? -11.539 -6.766  0.525   1.00 0.00 ? 86  THR A HA   5  
ATOM 8334  H HB   . THR A 1 86  ? -12.769 -7.419  -2.206  1.00 0.00 ? 86  THR A HB   5  
ATOM 8335  H HG1  . THR A 1 86  ? -12.194 -9.045  0.160   1.00 0.00 ? 86  THR A HG1  5  
ATOM 8336  H HG21 . THR A 1 86  ? -10.273 -7.578  -2.238  1.00 0.00 ? 86  THR A HG21 5  
ATOM 8337  H HG22 . THR A 1 86  ? -10.321 -8.545  -0.744  1.00 0.00 ? 86  THR A HG22 5  
ATOM 8338  H HG23 . THR A 1 86  ? -11.010 -9.199  -2.249  1.00 0.00 ? 86  THR A HG23 5  
ATOM 8339  N N    . TYR A 1 87  ? -10.082 -5.149  -0.572  1.00 0.00 ? 87  TYR A N    5  
ATOM 8340  C CA   . TYR A 1 87  ? -9.244  -4.076  -1.080  1.00 0.00 ? 87  TYR A CA   5  
ATOM 8341  C C    . TYR A 1 87  ? -7.819  -4.568  -1.339  1.00 0.00 ? 87  TYR A C    5  
ATOM 8342  O O    . TYR A 1 87  ? -7.390  -5.568  -0.766  1.00 0.00 ? 87  TYR A O    5  
ATOM 8343  C CB   . TYR A 1 87  ? -9.211  -3.011  0.019   1.00 0.00 ? 87  TYR A CB   5  
ATOM 8344  C CG   . TYR A 1 87  ? -10.374 -2.019  -0.041  1.00 0.00 ? 87  TYR A CG   5  
ATOM 8345  C CD1  . TYR A 1 87  ? -11.552 -2.295  0.622   1.00 0.00 ? 87  TYR A CD1  5  
ATOM 8346  C CD2  . TYR A 1 87  ? -10.245 -0.847  -0.759  1.00 0.00 ? 87  TYR A CD2  5  
ATOM 8347  C CE1  . TYR A 1 87  ? -12.646 -1.361  0.566   1.00 0.00 ? 87  TYR A CE1  5  
ATOM 8348  C CE2  . TYR A 1 87  ? -11.339 0.087   -0.816  1.00 0.00 ? 87  TYR A CE2  5  
ATOM 8349  C CZ   . TYR A 1 87  ? -12.486 -0.216  -0.150  1.00 0.00 ? 87  TYR A CZ   5  
ATOM 8350  O OH   . TYR A 1 87  ? -13.519 0.666   -0.204  1.00 0.00 ? 87  TYR A OH   5  
ATOM 8351  H H    . TYR A 1 87  ? -9.645  -5.742  0.104   1.00 0.00 ? 87  TYR A H    5  
ATOM 8352  H HA   . TYR A 1 87  ? -9.676  -3.726  -2.018  1.00 0.00 ? 87  TYR A HA   5  
ATOM 8353  H HB2  . TYR A 1 87  ? -9.219  -3.506  0.990   1.00 0.00 ? 87  TYR A HB2  5  
ATOM 8354  H HB3  . TYR A 1 87  ? -8.273  -2.461  -0.051  1.00 0.00 ? 87  TYR A HB3  5  
ATOM 8355  H HD1  . TYR A 1 87  ? -11.654 -3.220  1.189   1.00 0.00 ? 87  TYR A HD1  5  
ATOM 8356  H HD2  . TYR A 1 87  ? -9.314  -0.629  -1.283  1.00 0.00 ? 87  TYR A HD2  5  
ATOM 8357  H HE1  . TYR A 1 87  ? -13.582 -1.567  1.086   1.00 0.00 ? 87  TYR A HE1  5  
ATOM 8358  H HE2  . TYR A 1 87  ? -11.250 1.016   -1.379  1.00 0.00 ? 87  TYR A HE2  5  
ATOM 8359  H HH   . TYR A 1 87  ? -13.284 1.433   -0.801  1.00 0.00 ? 87  TYR A HH   5  
ATOM 8360  N N    . THR A 1 88  ? -7.125  -3.843  -2.204  1.00 0.00 ? 88  THR A N    5  
ATOM 8361  C CA   . THR A 1 88  ? -5.757  -4.193  -2.547  1.00 0.00 ? 88  THR A CA   5  
ATOM 8362  C C    . THR A 1 88  ? -4.820  -3.015  -2.274  1.00 0.00 ? 88  THR A C    5  
ATOM 8363  O O    . THR A 1 88  ? -4.991  -1.937  -2.841  1.00 0.00 ? 88  THR A O    5  
ATOM 8364  C CB   . THR A 1 88  ? -5.739  -4.659  -4.004  1.00 0.00 ? 88  THR A CB   5  
ATOM 8365  O OG1  . THR A 1 88  ? -5.975  -6.062  -3.923  1.00 0.00 ? 88  THR A OG1  5  
ATOM 8366  C CG2  . THR A 1 88  ? -4.350  -4.551  -4.636  1.00 0.00 ? 88  THR A CG2  5  
ATOM 8367  H H    . THR A 1 88  ? -7.481  -3.031  -2.666  1.00 0.00 ? 88  THR A H    5  
ATOM 8368  H HA   . THR A 1 88  ? -5.440  -5.011  -1.899  1.00 0.00 ? 88  THR A HA   5  
ATOM 8369  H HB   . THR A 1 88  ? -6.479  -4.118  -4.594  1.00 0.00 ? 88  THR A HB   5  
ATOM 8370  H HG1  . THR A 1 88  ? -5.905  -6.474  -4.832  1.00 0.00 ? 88  THR A HG1  5  
ATOM 8371  H HG21 . THR A 1 88  ? -3.943  -3.557  -4.451  1.00 0.00 ? 88  THR A HG21 5  
ATOM 8372  H HG22 . THR A 1 88  ? -3.692  -5.301  -4.197  1.00 0.00 ? 88  THR A HG22 5  
ATOM 8373  H HG23 . THR A 1 88  ? -4.426  -4.718  -5.711  1.00 0.00 ? 88  THR A HG23 5  
ATOM 8374  N N    . ILE A 1 89  ? -3.851  -3.260  -1.404  1.00 0.00 ? 89  ILE A N    5  
ATOM 8375  C CA   . ILE A 1 89  ? -2.887  -2.233  -1.049  1.00 0.00 ? 89  ILE A CA   5  
ATOM 8376  C C    . ILE A 1 89  ? -1.575  -2.492  -1.792  1.00 0.00 ? 89  ILE A C    5  
ATOM 8377  O O    . ILE A 1 89  ? -0.929  -3.518  -1.580  1.00 0.00 ? 89  ILE A O    5  
ATOM 8378  C CB   . ILE A 1 89  ? -2.727  -2.150  0.470   1.00 0.00 ? 89  ILE A CB   5  
ATOM 8379  C CG1  . ILE A 1 89  ? -4.088  -2.196  1.168   1.00 0.00 ? 89  ILE A CG1  5  
ATOM 8380  C CG2  . ILE A 1 89  ? -1.919  -0.914  0.870   1.00 0.00 ? 89  ILE A CG2  5  
ATOM 8381  C CD1  . ILE A 1 89  ? -5.124  -1.370  0.403   1.00 0.00 ? 89  ILE A CD1  5  
ATOM 8382  H H    . ILE A 1 89  ? -3.719  -4.140  -0.947  1.00 0.00 ? 89  ILE A H    5  
ATOM 8383  H HA   . ILE A 1 89  ? -3.290  -1.277  -1.383  1.00 0.00 ? 89  ILE A HA   5  
ATOM 8384  H HB   . ILE A 1 89  ? -2.165  -3.023  0.803   1.00 0.00 ? 89  ILE A HB   5  
ATOM 8385  H HG12 . ILE A 1 89  ? -4.426  -3.229  1.245   1.00 0.00 ? 89  ILE A HG12 5  
ATOM 8386  H HG13 . ILE A 1 89  ? -3.993  -1.815  2.185   1.00 0.00 ? 89  ILE A HG13 5  
ATOM 8387  H HG21 . ILE A 1 89  ? -1.119  -1.208  1.550   1.00 0.00 ? 89  ILE A HG21 5  
ATOM 8388  H HG22 . ILE A 1 89  ? -1.490  -0.457  -0.021  1.00 0.00 ? 89  ILE A HG22 5  
ATOM 8389  H HG23 . ILE A 1 89  ? -2.573  -0.198  1.368   1.00 0.00 ? 89  ILE A HG23 5  
ATOM 8390  H HD11 . ILE A 1 89  ? -5.822  -0.919  1.108   1.00 0.00 ? 89  ILE A HD11 5  
ATOM 8391  H HD12 . ILE A 1 89  ? -4.619  -0.586  -0.161  1.00 0.00 ? 89  ILE A HD12 5  
ATOM 8392  H HD13 . ILE A 1 89  ? -5.670  -2.018  -0.284  1.00 0.00 ? 89  ILE A HD13 5  
ATOM 8393  N N    . GLU A 1 90  ? -1.219  -1.545  -2.648  1.00 0.00 ? 90  GLU A N    5  
ATOM 8394  C CA   . GLU A 1 90  ? 0.005   -1.658  -3.423  1.00 0.00 ? 90  GLU A CA   5  
ATOM 8395  C C    . GLU A 1 90  ? 1.105   -0.792  -2.808  1.00 0.00 ? 90  GLU A C    5  
ATOM 8396  O O    . GLU A 1 90  ? 0.940   0.419   -2.666  1.00 0.00 ? 90  GLU A O    5  
ATOM 8397  C CB   . GLU A 1 90  ? -0.237  -1.281  -4.886  1.00 0.00 ? 90  GLU A CB   5  
ATOM 8398  C CG   . GLU A 1 90  ? -1.432  -2.045  -5.459  1.00 0.00 ? 90  GLU A CG   5  
ATOM 8399  C CD   . GLU A 1 90  ? -2.406  -1.095  -6.158  1.00 0.00 ? 90  GLU A CD   5  
ATOM 8400  O OE1  . GLU A 1 90  ? -2.613  0.009   -5.611  1.00 0.00 ? 90  GLU A OE1  5  
ATOM 8401  O OE2  . GLU A 1 90  ? -2.922  -1.495  -7.224  1.00 0.00 ? 90  GLU A OE2  5  
ATOM 8402  H H    . GLU A 1 90  ? -1.749  -0.714  -2.814  1.00 0.00 ? 90  GLU A H    5  
ATOM 8403  H HA   . GLU A 1 90  ? 0.287   -2.710  -3.367  1.00 0.00 ? 90  GLU A HA   5  
ATOM 8404  H HB2  . GLU A 1 90  ? -0.415  -0.209  -4.964  1.00 0.00 ? 90  GLU A HB2  5  
ATOM 8405  H HB3  . GLU A 1 90  ? 0.655   -1.499  -5.474  1.00 0.00 ? 90  GLU A HB3  5  
ATOM 8406  H HG2  . GLU A 1 90  ? -1.081  -2.797  -6.166  1.00 0.00 ? 90  GLU A HG2  5  
ATOM 8407  H HG3  . GLU A 1 90  ? -1.947  -2.576  -4.659  1.00 0.00 ? 90  GLU A HG3  5  
ATOM 8408  N N    . VAL A 1 91  ? 2.203   -1.445  -2.458  1.00 0.00 ? 91  VAL A N    5  
ATOM 8409  C CA   . VAL A 1 91  ? 3.331   -0.750  -1.862  1.00 0.00 ? 91  VAL A CA   5  
ATOM 8410  C C    . VAL A 1 91  ? 4.519   -0.793  -2.824  1.00 0.00 ? 91  VAL A C    5  
ATOM 8411  O O    . VAL A 1 91  ? 5.014   -1.869  -3.156  1.00 0.00 ? 91  VAL A O    5  
ATOM 8412  C CB   . VAL A 1 91  ? 3.650   -1.350  -0.491  1.00 0.00 ? 91  VAL A CB   5  
ATOM 8413  C CG1  . VAL A 1 91  ? 4.903   -0.709  0.110   1.00 0.00 ? 91  VAL A CG1  5  
ATOM 8414  C CG2  . VAL A 1 91  ? 2.457   -1.214  0.458   1.00 0.00 ? 91  VAL A CG2  5  
ATOM 8415  H H    . VAL A 1 91  ? 2.329   -2.430  -2.577  1.00 0.00 ? 91  VAL A H    5  
ATOM 8416  H HA   . VAL A 1 91  ? 3.036   0.289   -1.715  1.00 0.00 ? 91  VAL A HA   5  
ATOM 8417  H HB   . VAL A 1 91  ? 3.849   -2.412  -0.628  1.00 0.00 ? 91  VAL A HB   5  
ATOM 8418  H HG11 . VAL A 1 91  ? 4.617   -0.049  0.929   1.00 0.00 ? 91  VAL A HG11 5  
ATOM 8419  H HG12 . VAL A 1 91  ? 5.564   -1.489  0.486   1.00 0.00 ? 91  VAL A HG12 5  
ATOM 8420  H HG13 . VAL A 1 91  ? 5.420   -0.133  -0.658  1.00 0.00 ? 91  VAL A HG13 5  
ATOM 8421  H HG21 . VAL A 1 91  ? 2.448   -0.214  0.891   1.00 0.00 ? 91  VAL A HG21 5  
ATOM 8422  H HG22 . VAL A 1 91  ? 1.532   -1.378  -0.096  1.00 0.00 ? 91  VAL A HG22 5  
ATOM 8423  H HG23 . VAL A 1 91  ? 2.540   -1.954  1.254   1.00 0.00 ? 91  VAL A HG23 5  
ATOM 8424  N N    . ALA A 1 92  ? 4.942   0.390   -3.245  1.00 0.00 ? 92  ALA A N    5  
ATOM 8425  C CA   . ALA A 1 92  ? 6.063   0.500   -4.163  1.00 0.00 ? 92  ALA A CA   5  
ATOM 8426  C C    . ALA A 1 92  ? 7.179   1.313   -3.504  1.00 0.00 ? 92  ALA A C    5  
ATOM 8427  O O    . ALA A 1 92  ? 6.940   2.025   -2.529  1.00 0.00 ? 92  ALA A O    5  
ATOM 8428  C CB   . ALA A 1 92  ? 5.587   1.122   -5.478  1.00 0.00 ? 92  ALA A CB   5  
ATOM 8429  H H    . ALA A 1 92  ? 4.534   1.260   -2.970  1.00 0.00 ? 92  ALA A H    5  
ATOM 8430  H HA   . ALA A 1 92  ? 6.429   -0.507  -4.363  1.00 0.00 ? 92  ALA A HA   5  
ATOM 8431  H HB1  . ALA A 1 92  ? 5.449   0.337   -6.221  1.00 0.00 ? 92  ALA A HB1  5  
ATOM 8432  H HB2  . ALA A 1 92  ? 4.642   1.638   -5.314  1.00 0.00 ? 92  ALA A HB2  5  
ATOM 8433  H HB3  . ALA A 1 92  ? 6.333   1.832   -5.834  1.00 0.00 ? 92  ALA A HB3  5  
ATOM 8434  N N    . ALA A 1 93  ? 8.373   1.181   -4.062  1.00 0.00 ? 93  ALA A N    5  
ATOM 8435  C CA   . ALA A 1 93  ? 9.526   1.895   -3.540  1.00 0.00 ? 93  ALA A CA   5  
ATOM 8436  C C    . ALA A 1 93  ? 9.877   3.047   -4.483  1.00 0.00 ? 93  ALA A C    5  
ATOM 8437  O O    . ALA A 1 93  ? 9.451   3.061   -5.637  1.00 0.00 ? 93  ALA A O    5  
ATOM 8438  C CB   . ALA A 1 93  ? 10.689  0.919   -3.353  1.00 0.00 ? 93  ALA A CB   5  
ATOM 8439  H H    . ALA A 1 93  ? 8.559   0.600   -4.854  1.00 0.00 ? 93  ALA A H    5  
ATOM 8440  H HA   . ALA A 1 93  ? 9.251   2.304   -2.567  1.00 0.00 ? 93  ALA A HA   5  
ATOM 8441  H HB1  . ALA A 1 93  ? 11.618  1.478   -3.239  1.00 0.00 ? 93  ALA A HB1  5  
ATOM 8442  H HB2  . ALA A 1 93  ? 10.518  0.315   -2.462  1.00 0.00 ? 93  ALA A HB2  5  
ATOM 8443  H HB3  . ALA A 1 93  ? 10.761  0.269   -4.225  1.00 0.00 ? 93  ALA A HB3  5  
ATOM 8444  N N    . MET A 1 94  ? 10.651  3.985   -3.958  1.00 0.00 ? 94  MET A N    5  
ATOM 8445  C CA   . MET A 1 94  ? 11.064  5.139   -4.739  1.00 0.00 ? 94  MET A CA   5  
ATOM 8446  C C    . MET A 1 94  ? 12.564  5.398   -4.582  1.00 0.00 ? 94  MET A C    5  
ATOM 8447  O O    . MET A 1 94  ? 13.059  5.540   -3.465  1.00 0.00 ? 94  MET A O    5  
ATOM 8448  C CB   . MET A 1 94  ? 10.282  6.372   -4.282  1.00 0.00 ? 94  MET A CB   5  
ATOM 8449  C CG   . MET A 1 94  ? 8.803   6.251   -4.656  1.00 0.00 ? 94  MET A CG   5  
ATOM 8450  S SD   . MET A 1 94  ? 7.967   7.798   -4.344  1.00 0.00 ? 94  MET A SD   5  
ATOM 8451  C CE   . MET A 1 94  ? 7.994   7.811   -2.560  1.00 0.00 ? 94  MET A CE   5  
ATOM 8452  H H    . MET A 1 94  ? 10.994  3.966   -3.019  1.00 0.00 ? 94  MET A H    5  
ATOM 8453  H HA   . MET A 1 94  ? 10.839  4.886   -5.775  1.00 0.00 ? 94  MET A HA   5  
ATOM 8454  H HB2  . MET A 1 94  ? 10.380  6.490   -3.203  1.00 0.00 ? 94  MET A HB2  5  
ATOM 8455  H HB3  . MET A 1 94  ? 10.705  7.265   -4.741  1.00 0.00 ? 94  MET A HB3  5  
ATOM 8456  H HG2  . MET A 1 94  ? 8.705   5.981   -5.707  1.00 0.00 ? 94  MET A HG2  5  
ATOM 8457  H HG3  . MET A 1 94  ? 8.337   5.454   -4.077  1.00 0.00 ? 94  MET A HG3  5  
ATOM 8458  H HE1  . MET A 1 94  ? 8.140   8.832   -2.206  1.00 0.00 ? 94  MET A HE1  5  
ATOM 8459  H HE2  . MET A 1 94  ? 7.049   7.425   -2.179  1.00 0.00 ? 94  MET A HE2  5  
ATOM 8460  H HE3  . MET A 1 94  ? 8.812   7.184   -2.204  1.00 0.00 ? 94  MET A HE3  5  
ATOM 8461  N N    . THR A 1 95  ? 13.245  5.454   -5.717  1.00 0.00 ? 95  THR A N    5  
ATOM 8462  C CA   . THR A 1 95  ? 14.678  5.694   -5.720  1.00 0.00 ? 95  THR A CA   5  
ATOM 8463  C C    . THR A 1 95  ? 15.007  6.943   -6.539  1.00 0.00 ? 95  THR A C    5  
ATOM 8464  O O    . THR A 1 95  ? 14.120  7.732   -6.859  1.00 0.00 ? 95  THR A O    5  
ATOM 8465  C CB   . THR A 1 95  ? 15.368  4.430   -6.235  1.00 0.00 ? 95  THR A CB   5  
ATOM 8466  O OG1  . THR A 1 95  ? 14.585  4.040   -7.360  1.00 0.00 ? 95  THR A OG1  5  
ATOM 8467  C CG2  . THR A 1 95  ? 15.237  3.254   -5.265  1.00 0.00 ? 95  THR A CG2  5  
ATOM 8468  H H    . THR A 1 95  ? 12.834  5.338   -6.622  1.00 0.00 ? 95  THR A H    5  
ATOM 8469  H HA   . THR A 1 95  ? 14.995  5.890   -4.696  1.00 0.00 ? 95  THR A HA   5  
ATOM 8470  H HB   . THR A 1 95  ? 16.414  4.626   -6.470  1.00 0.00 ? 95  THR A HB   5  
ATOM 8471  H HG1  . THR A 1 95  ? 13.705  3.677   -7.055  1.00 0.00 ? 95  THR A HG1  5  
ATOM 8472  H HG21 . THR A 1 95  ? 15.443  2.323   -5.792  1.00 0.00 ? 95  THR A HG21 5  
ATOM 8473  H HG22 . THR A 1 95  ? 15.950  3.375   -4.449  1.00 0.00 ? 95  THR A HG22 5  
ATOM 8474  H HG23 . THR A 1 95  ? 14.225  3.227   -4.861  1.00 0.00 ? 95  THR A HG23 5  
ATOM 8475  N N    . SER A 1 96  ? 16.286  7.084   -6.856  1.00 0.00 ? 96  SER A N    5  
ATOM 8476  C CA   . SER A 1 96  ? 16.744  8.224   -7.632  1.00 0.00 ? 96  SER A CA   5  
ATOM 8477  C C    . SER A 1 96  ? 16.279  8.090   -9.083  1.00 0.00 ? 96  SER A C    5  
ATOM 8478  O O    . SER A 1 96  ? 16.331  9.052   -9.847  1.00 0.00 ? 96  SER A O    5  
ATOM 8479  C CB   . SER A 1 96  ? 18.268  8.354   -7.573  1.00 0.00 ? 96  SER A CB   5  
ATOM 8480  O OG   . SER A 1 96  ? 18.902  7.699   -8.667  1.00 0.00 ? 96  SER A OG   5  
ATOM 8481  H H    . SER A 1 96  ? 17.002  6.437   -6.591  1.00 0.00 ? 96  SER A H    5  
ATOM 8482  H HA   . SER A 1 96  ? 16.287  9.095   -7.162  1.00 0.00 ? 96  SER A HA   5  
ATOM 8483  H HB2  . SER A 1 96  ? 18.541  9.409   -7.573  1.00 0.00 ? 96  SER A HB2  5  
ATOM 8484  H HB3  . SER A 1 96  ? 18.632  7.931   -6.636  1.00 0.00 ? 96  SER A HB3  5  
ATOM 8485  H HG   . SER A 1 96  ? 18.960  8.318   -9.450  1.00 0.00 ? 96  SER A HG   5  
ATOM 8486  N N    . LYS A 1 97  ? 15.835  6.888   -9.420  1.00 0.00 ? 97  LYS A N    5  
ATOM 8487  C CA   . LYS A 1 97  ? 15.360  6.615   -10.766 1.00 0.00 ? 97  LYS A CA   5  
ATOM 8488  C C    . LYS A 1 97  ? 13.866  6.931   -10.849 1.00 0.00 ? 97  LYS A C    5  
ATOM 8489  O O    . LYS A 1 97  ? 13.430  7.661   -11.738 1.00 0.00 ? 97  LYS A O    5  
ATOM 8490  C CB   . LYS A 1 97  ? 15.711  5.184   -11.178 1.00 0.00 ? 97  LYS A CB   5  
ATOM 8491  C CG   . LYS A 1 97  ? 17.030  5.144   -11.952 1.00 0.00 ? 97  LYS A CG   5  
ATOM 8492  C CD   . LYS A 1 97  ? 16.850  5.682   -13.372 1.00 0.00 ? 97  LYS A CD   5  
ATOM 8493  C CE   . LYS A 1 97  ? 16.267  4.609   -14.295 1.00 0.00 ? 97  LYS A CE   5  
ATOM 8494  N NZ   . LYS A 1 97  ? 17.243  4.244   -15.346 1.00 0.00 ? 97  LYS A NZ   5  
ATOM 8495  H H    . LYS A 1 97  ? 15.796  6.110   -8.792  1.00 0.00 ? 97  LYS A H    5  
ATOM 8496  H HA   . LYS A 1 97  ? 15.893  7.285   -11.442 1.00 0.00 ? 97  LYS A HA   5  
ATOM 8497  H HB2  . LYS A 1 97  ? 15.785  4.554   -10.292 1.00 0.00 ? 97  LYS A HB2  5  
ATOM 8498  H HB3  . LYS A 1 97  ? 14.911  4.773   -11.794 1.00 0.00 ? 97  LYS A HB3  5  
ATOM 8499  H HG2  . LYS A 1 97  ? 17.781  5.735   -11.428 1.00 0.00 ? 97  LYS A HG2  5  
ATOM 8500  H HG3  . LYS A 1 97  ? 17.402  4.120   -11.991 1.00 0.00 ? 97  LYS A HG3  5  
ATOM 8501  H HD2  . LYS A 1 97  ? 16.190  6.549   -13.355 1.00 0.00 ? 97  LYS A HD2  5  
ATOM 8502  H HD3  . LYS A 1 97  ? 17.810  6.020   -13.762 1.00 0.00 ? 97  LYS A HD3  5  
ATOM 8503  H HE2  . LYS A 1 97  ? 16.002  3.726   -13.714 1.00 0.00 ? 97  LYS A HE2  5  
ATOM 8504  H HE3  . LYS A 1 97  ? 15.349  4.976   -14.754 1.00 0.00 ? 97  LYS A HE3  5  
ATOM 8505  H HZ1  . LYS A 1 97  ? 17.180  3.264   -15.533 1.00 0.00 ? 97  LYS A HZ1  5  
ATOM 8506  H HZ2  . LYS A 1 97  ? 17.041  4.756   -16.181 1.00 0.00 ? 97  LYS A HZ2  5  
ATOM 8507  H HZ3  . LYS A 1 97  ? 18.167  4.465   -15.034 1.00 0.00 ? 97  LYS A HZ3  5  
ATOM 8508  N N    . GLY A 1 98  ? 13.121  6.364   -9.911  1.00 0.00 ? 98  GLY A N    5  
ATOM 8509  C CA   . GLY A 1 98  ? 11.684  6.576   -9.867  1.00 0.00 ? 98  GLY A CA   5  
ATOM 8510  C C    . GLY A 1 98  ? 11.008  5.561   -8.942  1.00 0.00 ? 98  GLY A C    5  
ATOM 8511  O O    . GLY A 1 98  ? 11.416  5.396   -7.794  1.00 0.00 ? 98  GLY A O    5  
ATOM 8512  H H    . GLY A 1 98  ? 13.483  5.771   -9.192  1.00 0.00 ? 98  GLY A H    5  
ATOM 8513  H HA2  . GLY A 1 98  ? 11.472  7.587   -9.520  1.00 0.00 ? 98  GLY A HA2  5  
ATOM 8514  H HA3  . GLY A 1 98  ? 11.269  6.490   -10.872 1.00 0.00 ? 98  GLY A HA3  5  
ATOM 8515  N N    . GLN A 1 99  ? 9.987   4.908   -9.478  1.00 0.00 ? 99  GLN A N    5  
ATOM 8516  C CA   . GLN A 1 99  ? 9.251   3.915   -8.715  1.00 0.00 ? 99  GLN A CA   5  
ATOM 8517  C C    . GLN A 1 99  ? 9.480   2.520   -9.300  1.00 0.00 ? 99  GLN A C    5  
ATOM 8518  O O    . GLN A 1 99  ? 9.385   2.327   -10.511 1.00 0.00 ? 99  GLN A O    5  
ATOM 8519  C CB   . GLN A 1 99  ? 7.760   4.252   -8.670  1.00 0.00 ? 99  GLN A CB   5  
ATOM 8520  C CG   . GLN A 1 99  ? 6.986   3.210   -7.860  1.00 0.00 ? 99  GLN A CG   5  
ATOM 8521  C CD   . GLN A 1 99  ? 5.761   2.715   -8.632  1.00 0.00 ? 99  GLN A CD   5  
ATOM 8522  O OE1  . GLN A 1 99  ? 5.803   2.477   -9.828  1.00 0.00 ? 99  GLN A OE1  5  
ATOM 8523  N NE2  . GLN A 1 99  ? 4.671   2.573   -7.883  1.00 0.00 ? 99  GLN A NE2  5  
ATOM 8524  H H    . GLN A 1 99  ? 9.662   5.049   -10.413 1.00 0.00 ? 99  GLN A H    5  
ATOM 8525  H HA   . GLN A 1 99  ? 9.659   3.964   -7.705  1.00 0.00 ? 99  GLN A HA   5  
ATOM 8526  H HB2  . GLN A 1 99  ? 7.619   5.239   -8.228  1.00 0.00 ? 99  GLN A HB2  5  
ATOM 8527  H HB3  . GLN A 1 99  ? 7.363   4.298   -9.684  1.00 0.00 ? 99  GLN A HB3  5  
ATOM 8528  H HG2  . GLN A 1 99  ? 7.638   2.368   -7.627  1.00 0.00 ? 99  GLN A HG2  5  
ATOM 8529  H HG3  . GLN A 1 99  ? 6.671   3.643   -6.910  1.00 0.00 ? 99  GLN A HG3  5  
ATOM 8530  H HE21 . GLN A 1 99  ? 4.704   2.785   -6.906  1.00 0.00 ? 99  GLN A HE21 5  
ATOM 8531  H HE22 . GLN A 1 99  ? 3.818   2.254   -8.297  1.00 0.00 ? 99  GLN A HE22 5  
ATOM 8532  N N    . GLY A 1 100 ? 9.778   1.582   -8.412  1.00 0.00 ? 100 GLY A N    5  
ATOM 8533  C CA   . GLY A 1 100 ? 10.022  0.211   -8.825  1.00 0.00 ? 100 GLY A CA   5  
ATOM 8534  C C    . GLY A 1 100 ? 8.770   -0.649  -8.636  1.00 0.00 ? 100 GLY A C    5  
ATOM 8535  O O    . GLY A 1 100 ? 7.669   -0.124  -8.485  1.00 0.00 ? 100 GLY A O    5  
ATOM 8536  H H    . GLY A 1 100 ? 9.854   1.747   -7.429  1.00 0.00 ? 100 GLY A H    5  
ATOM 8537  H HA2  . GLY A 1 100 ? 10.326  0.191   -9.872  1.00 0.00 ? 100 GLY A HA2  5  
ATOM 8538  H HA3  . GLY A 1 100 ? 10.845  -0.207  -8.246  1.00 0.00 ? 100 GLY A HA3  5  
ATOM 8539  N N    . GLN A 1 101 ? 8.982   -1.957  -8.651  1.00 0.00 ? 101 GLN A N    5  
ATOM 8540  C CA   . GLN A 1 101 ? 7.885   -2.895  -8.483  1.00 0.00 ? 101 GLN A CA   5  
ATOM 8541  C C    . GLN A 1 101 ? 6.968   -2.440  -7.346  1.00 0.00 ? 101 GLN A C    5  
ATOM 8542  O O    . GLN A 1 101 ? 7.312   -1.533  -6.591  1.00 0.00 ? 101 GLN A O    5  
ATOM 8543  C CB   . GLN A 1 101 ? 8.408   -4.311  -8.233  1.00 0.00 ? 101 GLN A CB   5  
ATOM 8544  C CG   . GLN A 1 101 ? 7.465   -5.357  -8.831  1.00 0.00 ? 101 GLN A CG   5  
ATOM 8545  C CD   . GLN A 1 101 ? 8.247   -6.560  -9.363  1.00 0.00 ? 101 GLN A CD   5  
ATOM 8546  O OE1  . GLN A 1 101 ? 9.409   -6.467  -9.724  1.00 0.00 ? 101 GLN A OE1  5  
ATOM 8547  N NE2  . GLN A 1 101 ? 7.547   -7.691  -9.391  1.00 0.00 ? 101 GLN A NE2  5  
ATOM 8548  H H    . GLN A 1 101 ? 9.882   -2.377  -8.775  1.00 0.00 ? 101 GLN A H    5  
ATOM 8549  H HA   . GLN A 1 101 ? 7.341   -2.876  -9.427  1.00 0.00 ? 101 GLN A HA   5  
ATOM 8550  H HB2  . GLN A 1 101 ? 9.401   -4.419  -8.670  1.00 0.00 ? 101 GLN A HB2  5  
ATOM 8551  H HB3  . GLN A 1 101 ? 8.512   -4.480  -7.161  1.00 0.00 ? 101 GLN A HB3  5  
ATOM 8552  H HG2  . GLN A 1 101 ? 6.754   -5.687  -8.074  1.00 0.00 ? 101 GLN A HG2  5  
ATOM 8553  H HG3  . GLN A 1 101 ? 6.886   -4.910  -9.639  1.00 0.00 ? 101 GLN A HG3  5  
ATOM 8554  H HE21 . GLN A 1 101 ? 6.597   -7.698  -9.080  1.00 0.00 ? 101 GLN A HE21 5  
ATOM 8555  H HE22 . GLN A 1 101 ? 7.972   -8.533  -9.723  1.00 0.00 ? 101 GLN A HE22 5  
ATOM 8556  N N    . VAL A 1 102 ? 5.818   -3.093  -7.260  1.00 0.00 ? 102 VAL A N    5  
ATOM 8557  C CA   . VAL A 1 102 ? 4.848   -2.767  -6.228  1.00 0.00 ? 102 VAL A CA   5  
ATOM 8558  C C    . VAL A 1 102 ? 4.266   -4.060  -5.655  1.00 0.00 ? 102 VAL A C    5  
ATOM 8559  O O    . VAL A 1 102 ? 4.024   -5.016  -6.391  1.00 0.00 ? 102 VAL A O    5  
ATOM 8560  C CB   . VAL A 1 102 ? 3.780   -1.828  -6.791  1.00 0.00 ? 102 VAL A CB   5  
ATOM 8561  C CG1  . VAL A 1 102 ? 2.686   -2.615  -7.517  1.00 0.00 ? 102 VAL A CG1  5  
ATOM 8562  C CG2  . VAL A 1 102 ? 3.184   -0.951  -5.688  1.00 0.00 ? 102 VAL A CG2  5  
ATOM 8563  H H    . VAL A 1 102 ? 5.545   -3.830  -7.878  1.00 0.00 ? 102 VAL A H    5  
ATOM 8564  H HA   . VAL A 1 102 ? 5.377   -2.239  -5.434  1.00 0.00 ? 102 VAL A HA   5  
ATOM 8565  H HB   . VAL A 1 102 ? 4.259   -1.172  -7.518  1.00 0.00 ? 102 VAL A HB   5  
ATOM 8566  H HG11 . VAL A 1 102 ? 1.858   -2.800  -6.833  1.00 0.00 ? 102 VAL A HG11 5  
ATOM 8567  H HG12 . VAL A 1 102 ? 2.330   -2.039  -8.371  1.00 0.00 ? 102 VAL A HG12 5  
ATOM 8568  H HG13 . VAL A 1 102 ? 3.092   -3.565  -7.863  1.00 0.00 ? 102 VAL A HG13 5  
ATOM 8569  H HG21 . VAL A 1 102 ? 2.565   -1.563  -5.032  1.00 0.00 ? 102 VAL A HG21 5  
ATOM 8570  H HG22 . VAL A 1 102 ? 3.989   -0.498  -5.109  1.00 0.00 ? 102 VAL A HG22 5  
ATOM 8571  H HG23 . VAL A 1 102 ? 2.574   -0.167  -6.137  1.00 0.00 ? 102 VAL A HG23 5  
ATOM 8572  N N    . SER A 1 103 ? 4.057   -4.049  -4.346  1.00 0.00 ? 103 SER A N    5  
ATOM 8573  C CA   . SER A 1 103 ? 3.507   -5.210  -3.666  1.00 0.00 ? 103 SER A CA   5  
ATOM 8574  C C    . SER A 1 103 ? 2.029   -4.978  -3.348  1.00 0.00 ? 103 SER A C    5  
ATOM 8575  O O    . SER A 1 103 ? 1.698   -4.276  -2.394  1.00 0.00 ? 103 SER A O    5  
ATOM 8576  C CB   . SER A 1 103 ? 4.285   -5.517  -2.385  1.00 0.00 ? 103 SER A CB   5  
ATOM 8577  O OG   . SER A 1 103 ? 5.287   -6.508  -2.592  1.00 0.00 ? 103 SER A OG   5  
ATOM 8578  H H    . SER A 1 103 ? 4.256   -3.268  -3.755  1.00 0.00 ? 103 SER A H    5  
ATOM 8579  H HA   . SER A 1 103 ? 3.623   -6.037  -4.367  1.00 0.00 ? 103 SER A HA   5  
ATOM 8580  H HB2  . SER A 1 103 ? 4.750   -4.603  -2.015  1.00 0.00 ? 103 SER A HB2  5  
ATOM 8581  H HB3  . SER A 1 103 ? 3.593   -5.856  -1.614  1.00 0.00 ? 103 SER A HB3  5  
ATOM 8582  H HG   . SER A 1 103 ? 5.808   -6.299  -3.419  1.00 0.00 ? 103 SER A HG   5  
ATOM 8583  N N    . ALA A 1 104 ? 1.179   -5.582  -4.165  1.00 0.00 ? 104 ALA A N    5  
ATOM 8584  C CA   . ALA A 1 104 ? -0.257  -5.450  -3.983  1.00 0.00 ? 104 ALA A CA   5  
ATOM 8585  C C    . ALA A 1 104 ? -0.788  -6.681  -3.245  1.00 0.00 ? 104 ALA A C    5  
ATOM 8586  O O    . ALA A 1 104 ? -0.703  -7.798  -3.754  1.00 0.00 ? 104 ALA A O    5  
ATOM 8587  C CB   . ALA A 1 104 ? -0.928  -5.251  -5.343  1.00 0.00 ? 104 ALA A CB   5  
ATOM 8588  H H    . ALA A 1 104 ? 1.456   -6.152  -4.939  1.00 0.00 ? 104 ALA A H    5  
ATOM 8589  H HA   . ALA A 1 104 ? -0.434  -4.566  -3.371  1.00 0.00 ? 104 ALA A HA   5  
ATOM 8590  H HB1  . ALA A 1 104 ? -1.412  -6.178  -5.649  1.00 0.00 ? 104 ALA A HB1  5  
ATOM 8591  H HB2  . ALA A 1 104 ? -1.675  -4.460  -5.267  1.00 0.00 ? 104 ALA A HB2  5  
ATOM 8592  H HB3  . ALA A 1 104 ? -0.177  -4.972  -6.082  1.00 0.00 ? 104 ALA A HB3  5  
ATOM 8593  N N    . SER A 1 105 ? -1.323  -6.435  -2.059  1.00 0.00 ? 105 SER A N    5  
ATOM 8594  C CA   . SER A 1 105 ? -1.868  -7.510  -1.246  1.00 0.00 ? 105 SER A CA   5  
ATOM 8595  C C    . SER A 1 105 ? -3.363  -7.284  -1.014  1.00 0.00 ? 105 SER A C    5  
ATOM 8596  O O    . SER A 1 105 ? -3.778  -6.188  -0.639  1.00 0.00 ? 105 SER A O    5  
ATOM 8597  C CB   . SER A 1 105 ? -1.133  -7.616  0.091   1.00 0.00 ? 105 SER A CB   5  
ATOM 8598  O OG   . SER A 1 105 ? -0.198  -8.691  0.103   1.00 0.00 ? 105 SER A OG   5  
ATOM 8599  H H    . SER A 1 105 ? -1.388  -5.524  -1.653  1.00 0.00 ? 105 SER A H    5  
ATOM 8600  H HA   . SER A 1 105 ? -1.704  -8.420  -1.824  1.00 0.00 ? 105 SER A HA   5  
ATOM 8601  H HB2  . SER A 1 105 ? -0.612  -6.680  0.294   1.00 0.00 ? 105 SER A HB2  5  
ATOM 8602  H HB3  . SER A 1 105 ? -1.858  -7.757  0.893   1.00 0.00 ? 105 SER A HB3  5  
ATOM 8603  H HG   . SER A 1 105 ? 0.577   -8.464  0.692   1.00 0.00 ? 105 SER A HG   5  
ATOM 8604  N N    . THR A 1 106 ? -4.132  -8.338  -1.247  1.00 0.00 ? 106 THR A N    5  
ATOM 8605  C CA   . THR A 1 106 ? -5.572  -8.268  -1.067  1.00 0.00 ? 106 THR A CA   5  
ATOM 8606  C C    . THR A 1 106 ? -5.927  -8.316  0.420   1.00 0.00 ? 106 THR A C    5  
ATOM 8607  O O    . THR A 1 106 ? -5.563  -9.260  1.119   1.00 0.00 ? 106 THR A O    5  
ATOM 8608  C CB   . THR A 1 106 ? -6.205  -9.399  -1.880  1.00 0.00 ? 106 THR A CB   5  
ATOM 8609  O OG1  . THR A 1 106 ? -5.240  -9.684  -2.889  1.00 0.00 ? 106 THR A OG1  5  
ATOM 8610  C CG2  . THR A 1 106 ? -7.437  -8.939  -2.663  1.00 0.00 ? 106 THR A CG2  5  
ATOM 8611  H H    . THR A 1 106 ? -3.787  -9.225  -1.552  1.00 0.00 ? 106 THR A H    5  
ATOM 8612  H HA   . THR A 1 106 ? -5.920  -7.307  -1.448  1.00 0.00 ? 106 THR A HA   5  
ATOM 8613  H HB   . THR A 1 106 ? -6.444  -10.250 -1.242  1.00 0.00 ? 106 THR A HB   5  
ATOM 8614  H HG1  . THR A 1 106 ? -5.542  -10.460 -3.442  1.00 0.00 ? 106 THR A HG1  5  
ATOM 8615  H HG21 . THR A 1 106 ? -7.734  -9.719  -3.364  1.00 0.00 ? 106 THR A HG21 5  
ATOM 8616  H HG22 . THR A 1 106 ? -8.255  -8.744  -1.970  1.00 0.00 ? 106 THR A HG22 5  
ATOM 8617  H HG23 . THR A 1 106 ? -7.200  -8.028  -3.211  1.00 0.00 ? 106 THR A HG23 5  
ATOM 8618  N N    . ILE A 1 107 ? -6.634  -7.285  0.860   1.00 0.00 ? 107 ILE A N    5  
ATOM 8619  C CA   . ILE A 1 107 ? -7.043  -7.198  2.252   1.00 0.00 ? 107 ILE A CA   5  
ATOM 8620  C C    . ILE A 1 107 ? -8.456  -6.617  2.329   1.00 0.00 ? 107 ILE A C    5  
ATOM 8621  O O    . ILE A 1 107 ? -8.731  -5.566  1.752   1.00 0.00 ? 107 ILE A O    5  
ATOM 8622  C CB   . ILE A 1 107 ? -6.010  -6.415  3.065   1.00 0.00 ? 107 ILE A CB   5  
ATOM 8623  C CG1  . ILE A 1 107 ? -6.268  -6.562  4.566   1.00 0.00 ? 107 ILE A CG1  5  
ATOM 8624  C CG2  . ILE A 1 107 ? -5.969  -4.948  2.632   1.00 0.00 ? 107 ILE A CG2  5  
ATOM 8625  C CD1  . ILE A 1 107 ? -7.112  -5.400  5.094   1.00 0.00 ? 107 ILE A CD1  5  
ATOM 8626  H H    . ILE A 1 107 ? -6.926  -6.521  0.285   1.00 0.00 ? 107 ILE A H    5  
ATOM 8627  H HA   . ILE A 1 107 ? -7.064  -8.212  2.650   1.00 0.00 ? 107 ILE A HA   5  
ATOM 8628  H HB   . ILE A 1 107 ? -5.026  -6.837  2.865   1.00 0.00 ? 107 ILE A HB   5  
ATOM 8629  H HG12 . ILE A 1 107 ? -6.780  -7.505  4.760   1.00 0.00 ? 107 ILE A HG12 5  
ATOM 8630  H HG13 . ILE A 1 107 ? -5.319  -6.598  5.100   1.00 0.00 ? 107 ILE A HG13 5  
ATOM 8631  H HG21 . ILE A 1 107 ? -5.386  -4.373  3.351   1.00 0.00 ? 107 ILE A HG21 5  
ATOM 8632  H HG22 . ILE A 1 107 ? -5.507  -4.873  1.647   1.00 0.00 ? 107 ILE A HG22 5  
ATOM 8633  H HG23 . ILE A 1 107 ? -6.984  -4.553  2.588   1.00 0.00 ? 107 ILE A HG23 5  
ATOM 8634  H HD11 . ILE A 1 107 ? -7.659  -5.721  5.980   1.00 0.00 ? 107 ILE A HD11 5  
ATOM 8635  H HD12 . ILE A 1 107 ? -6.460  -4.565  5.352   1.00 0.00 ? 107 ILE A HD12 5  
ATOM 8636  H HD13 . ILE A 1 107 ? -7.818  -5.085  4.325   1.00 0.00 ? 107 ILE A HD13 5  
ATOM 8637  N N    . SER A 1 108 ? -9.315  -7.326  3.046   1.00 0.00 ? 108 SER A N    5  
ATOM 8638  C CA   . SER A 1 108 ? -10.693 -6.893  3.206   1.00 0.00 ? 108 SER A CA   5  
ATOM 8639  C C    . SER A 1 108 ? -10.885 -6.259  4.585   1.00 0.00 ? 108 SER A C    5  
ATOM 8640  O O    . SER A 1 108 ? -10.388 -6.775  5.585   1.00 0.00 ? 108 SER A O    5  
ATOM 8641  C CB   . SER A 1 108 ? -11.662 -8.062  3.019   1.00 0.00 ? 108 SER A CB   5  
ATOM 8642  O OG   . SER A 1 108 ? -12.972 -7.748  3.483   1.00 0.00 ? 108 SER A OG   5  
ATOM 8643  H H    . SER A 1 108 ? -9.083  -8.179  3.513   1.00 0.00 ? 108 SER A H    5  
ATOM 8644  H HA   . SER A 1 108 ? -10.857 -6.156  2.420   1.00 0.00 ? 108 SER A HA   5  
ATOM 8645  H HB2  . SER A 1 108 ? -11.706 -8.331  1.964   1.00 0.00 ? 108 SER A HB2  5  
ATOM 8646  H HB3  . SER A 1 108 ? -11.287 -8.934  3.555   1.00 0.00 ? 108 SER A HB3  5  
ATOM 8647  H HG   . SER A 1 108 ? -13.415 -8.571  3.841   1.00 0.00 ? 108 SER A HG   5  
ATOM 8648  N N    . SER A 1 109 ? -11.609 -5.149  4.595   1.00 0.00 ? 109 SER A N    5  
ATOM 8649  C CA   . SER A 1 109 ? -11.873 -4.439  5.834   1.00 0.00 ? 109 SER A CA   5  
ATOM 8650  C C    . SER A 1 109 ? -12.309 -5.426  6.920   1.00 0.00 ? 109 SER A C    5  
ATOM 8651  O O    . SER A 1 109 ? -12.707 -6.550  6.618   1.00 0.00 ? 109 SER A O    5  
ATOM 8652  C CB   . SER A 1 109 ? -12.943 -3.363  5.635   1.00 0.00 ? 109 SER A CB   5  
ATOM 8653  O OG   . SER A 1 109 ? -14.202 -3.922  5.274   1.00 0.00 ? 109 SER A OG   5  
ATOM 8654  H H    . SER A 1 109 ? -12.010 -4.736  3.777   1.00 0.00 ? 109 SER A H    5  
ATOM 8655  H HA   . SER A 1 109 ? -10.929 -3.967  6.104   1.00 0.00 ? 109 SER A HA   5  
ATOM 8656  H HB2  . SER A 1 109 ? -13.052 -2.786  6.554   1.00 0.00 ? 109 SER A HB2  5  
ATOM 8657  H HB3  . SER A 1 109 ? -12.618 -2.669  4.860   1.00 0.00 ? 109 SER A HB3  5  
ATOM 8658  H HG   . SER A 1 109 ? -14.708 -3.281  4.697   1.00 0.00 ? 109 SER A HG   5  
ATOM 8659  N N    . GLY A 1 110 ? -12.219 -4.969  8.160   1.00 0.00 ? 110 GLY A N    5  
ATOM 8660  C CA   . GLY A 1 110 ? -12.599 -5.798  9.292   1.00 0.00 ? 110 GLY A CA   5  
ATOM 8661  C C    . GLY A 1 110 ? -14.121 -5.896  9.413   1.00 0.00 ? 110 GLY A C    5  
ATOM 8662  O O    . GLY A 1 110 ? -14.731 -6.823  8.883   1.00 0.00 ? 110 GLY A O    5  
ATOM 8663  H H    . GLY A 1 110 ? -11.894 -4.054  8.397   1.00 0.00 ? 110 GLY A H    5  
ATOM 8664  H HA2  . GLY A 1 110 ? -12.175 -6.795  9.176   1.00 0.00 ? 110 GLY A HA2  5  
ATOM 8665  H HA3  . GLY A 1 110 ? -12.183 -5.380  10.209  1.00 0.00 ? 110 GLY A HA3  5  
ATOM 8666  N N    . VAL A 1 111 ? -14.690 -4.927  10.115  1.00 0.00 ? 111 VAL A N    5  
ATOM 8667  C CA   . VAL A 1 111 ? -16.129 -4.892  10.313  1.00 0.00 ? 111 VAL A CA   5  
ATOM 8668  C C    . VAL A 1 111 ? -16.502 -3.629  11.090  1.00 0.00 ? 111 VAL A C    5  
ATOM 8669  O O    . VAL A 1 111 ? -15.777 -3.214  11.994  1.00 0.00 ? 111 VAL A O    5  
ATOM 8670  C CB   . VAL A 1 111 ? -16.594 -6.177  11.001  1.00 0.00 ? 111 VAL A CB   5  
ATOM 8671  C CG1  . VAL A 1 111 ? -15.884 -6.368  12.343  1.00 0.00 ? 111 VAL A CG1  5  
ATOM 8672  C CG2  . VAL A 1 111 ? -18.113 -6.185  11.179  1.00 0.00 ? 111 VAL A CG2  5  
ATOM 8673  H H    . VAL A 1 111 ? -14.186 -4.176  10.543  1.00 0.00 ? 111 VAL A H    5  
ATOM 8674  H HA   . VAL A 1 111 ? -16.595 -4.849  9.328   1.00 0.00 ? 111 VAL A HA   5  
ATOM 8675  H HB   . VAL A 1 111 ? -16.327 -7.016  10.359  1.00 0.00 ? 111 VAL A HB   5  
ATOM 8676  H HG11 . VAL A 1 111 ? -14.807 -6.427  12.179  1.00 0.00 ? 111 VAL A HG11 5  
ATOM 8677  H HG12 . VAL A 1 111 ? -16.106 -5.523  12.995  1.00 0.00 ? 111 VAL A HG12 5  
ATOM 8678  H HG13 . VAL A 1 111 ? -16.231 -7.289  12.810  1.00 0.00 ? 111 VAL A HG13 5  
ATOM 8679  H HG21 . VAL A 1 111 ? -18.397 -6.998  11.847  1.00 0.00 ? 111 VAL A HG21 5  
ATOM 8680  H HG22 . VAL A 1 111 ? -18.434 -5.235  11.606  1.00 0.00 ? 111 VAL A HG22 5  
ATOM 8681  H HG23 . VAL A 1 111 ? -18.592 -6.328  10.210  1.00 0.00 ? 111 VAL A HG23 5  
ATOM 8682  N N    . PRO A 1 112 ? -17.663 -3.036  10.701  1.00 0.00 ? 112 PRO A N    5  
ATOM 8683  C CA   . PRO A 1 112 ? -18.141 -1.828  11.352  1.00 0.00 ? 112 PRO A CA   5  
ATOM 8684  C C    . PRO A 1 112 ? -18.724 -2.142  12.732  1.00 0.00 ? 112 PRO A C    5  
ATOM 8685  O O    . PRO A 1 112 ? -19.594 -3.002  12.861  1.00 0.00 ? 112 PRO A O    5  
ATOM 8686  C CB   . PRO A 1 112 ? -19.166 -1.244  10.394  1.00 0.00 ? 112 PRO A CB   5  
ATOM 8687  C CG   . PRO A 1 112 ? -19.563 -2.381  9.465   1.00 0.00 ? 112 PRO A CG   5  
ATOM 8688  C CD   . PRO A 1 112 ? -18.547 -3.498  9.636   1.00 0.00 ? 112 PRO A CD   5  
ATOM 8689  H HA   . PRO A 1 112 ? -17.383 -1.197  11.513  1.00 0.00 ? 112 PRO A HA   5  
ATOM 8690  H HB2  . PRO A 1 112 ? -20.032 -0.861  10.933  1.00 0.00 ? 112 PRO A HB2  5  
ATOM 8691  H HB3  . PRO A 1 112 ? -18.746 -0.410  9.832   1.00 0.00 ? 112 PRO A HB3  5  
ATOM 8692  H HG2  . PRO A 1 112 ? -20.566 -2.736  9.703   1.00 0.00 ? 112 PRO A HG2  5  
ATOM 8693  H HG3  . PRO A 1 112 ? -19.583 -2.038  8.430   1.00 0.00 ? 112 PRO A HG3  5  
ATOM 8694  H HD2  . PRO A 1 112 ? -19.033 -4.437  9.903   1.00 0.00 ? 112 PRO A HD2  5  
ATOM 8695  H HD3  . PRO A 1 112 ? -17.996 -3.677  8.713   1.00 0.00 ? 112 PRO A HD3  5  
ATOM 8696  N N    . PRO A 1 113 ? -18.207 -1.410  13.754  1.00 0.00 ? 113 PRO A N    5  
ATOM 8697  C CA   . PRO A 1 113 ? -18.666 -1.601  15.119  1.00 0.00 ? 113 PRO A CA   5  
ATOM 8698  C C    . PRO A 1 113 ? -20.048 -0.978  15.325  1.00 0.00 ? 113 PRO A C    5  
ATOM 8699  O O    . PRO A 1 113 ? -20.547 -0.265  14.456  1.00 0.00 ? 113 PRO A O    5  
ATOM 8700  C CB   . PRO A 1 113 ? -17.593 -0.967  15.988  1.00 0.00 ? 113 PRO A CB   5  
ATOM 8701  C CG   . PRO A 1 113 ? -16.809 -0.040  15.073  1.00 0.00 ? 113 PRO A CG   5  
ATOM 8702  C CD   . PRO A 1 113 ? -17.175 -0.383  13.638  1.00 0.00 ? 113 PRO A CD   5  
ATOM 8703  H HA   . PRO A 1 113 ? -18.774 -2.576  15.315  1.00 0.00 ? 113 PRO A HA   5  
ATOM 8704  H HB2  . PRO A 1 113 ? -18.037 -0.415  16.817  1.00 0.00 ? 113 PRO A HB2  5  
ATOM 8705  H HB3  . PRO A 1 113 ? -16.943 -1.727  16.424  1.00 0.00 ? 113 PRO A HB3  5  
ATOM 8706  H HG2  . PRO A 1 113 ? -17.048 1.001   15.290  1.00 0.00 ? 113 PRO A HG2  5  
ATOM 8707  H HG3  . PRO A 1 113 ? -15.738 -0.161  15.234  1.00 0.00 ? 113 PRO A HG3  5  
ATOM 8708  H HD2  . PRO A 1 113 ? -17.545 0.492   13.104  1.00 0.00 ? 113 PRO A HD2  5  
ATOM 8709  H HD3  . PRO A 1 113 ? -16.310 -0.751  13.087  1.00 0.00 ? 113 PRO A HD3  5  
ATOM 8710  N N    . SER A 1 114 ? -20.627 -1.269  16.481  1.00 0.00 ? 114 SER A N    5  
ATOM 8711  C CA   . SER A 1 114 ? -21.942 -0.746  16.812  1.00 0.00 ? 114 SER A CA   5  
ATOM 8712  C C    . SER A 1 114 ? -22.351 -1.209  18.212  1.00 0.00 ? 114 SER A C    5  
ATOM 8713  O O    . SER A 1 114 ? -22.494 -2.406  18.457  1.00 0.00 ? 114 SER A O    5  
ATOM 8714  C CB   . SER A 1 114 ? -22.984 -1.184  15.782  1.00 0.00 ? 114 SER A CB   5  
ATOM 8715  O OG   . SER A 1 114 ? -23.701 -0.076  15.244  1.00 0.00 ? 114 SER A OG   5  
ATOM 8716  H H    . SER A 1 114 ? -20.214 -1.850  17.183  1.00 0.00 ? 114 SER A H    5  
ATOM 8717  H HA   . SER A 1 114 ? -21.836 0.338   16.784  1.00 0.00 ? 114 SER A HA   5  
ATOM 8718  H HB2  . SER A 1 114 ? -22.491 -1.723  14.973  1.00 0.00 ? 114 SER A HB2  5  
ATOM 8719  H HB3  . SER A 1 114 ? -23.684 -1.878  16.247  1.00 0.00 ? 114 SER A HB3  5  
ATOM 8720  H HG   . SER A 1 114 ? -23.245 0.259   14.420  1.00 0.00 ? 114 SER A HG   5  
ATOM 8721  N N    . GLY A 1 115 ? -22.530 -0.236  19.094  1.00 0.00 ? 115 GLY A N    5  
ATOM 8722  C CA   . GLY A 1 115 ? -22.920 -0.529  20.462  1.00 0.00 ? 115 GLY A CA   5  
ATOM 8723  C C    . GLY A 1 115 ? -21.852 -1.365  21.170  1.00 0.00 ? 115 GLY A C    5  
ATOM 8724  O O    . GLY A 1 115 ? -20.674 -1.297  20.823  1.00 0.00 ? 115 GLY A O    5  
ATOM 8725  H H    . GLY A 1 115 ? -22.412 0.735   18.886  1.00 0.00 ? 115 GLY A H    5  
ATOM 8726  H HA2  . GLY A 1 115 ? -23.078 0.402   21.006  1.00 0.00 ? 115 GLY A HA2  5  
ATOM 8727  H HA3  . GLY A 1 115 ? -23.869 -1.066  20.466  1.00 0.00 ? 115 GLY A HA3  5  
ATOM 8728  N N    . PRO A 1 116 ? -22.314 -2.155  22.176  1.00 0.00 ? 116 PRO A N    5  
ATOM 8729  C CA   . PRO A 1 116 ? -21.412 -3.003  22.936  1.00 0.00 ? 116 PRO A CA   5  
ATOM 8730  C C    . PRO A 1 116 ? -20.992 -4.228  22.121  1.00 0.00 ? 116 PRO A C    5  
ATOM 8731  O O    . PRO A 1 116 ? -21.670 -4.604  21.166  1.00 0.00 ? 116 PRO A O    5  
ATOM 8732  C CB   . PRO A 1 116 ? -22.180 -3.364  24.197  1.00 0.00 ? 116 PRO A CB   5  
ATOM 8733  C CG   . PRO A 1 116 ? -23.643 -3.092  23.887  1.00 0.00 ? 116 PRO A CG   5  
ATOM 8734  C CD   . PRO A 1 116 ? -23.702 -2.262  22.615  1.00 0.00 ? 116 PRO A CD   5  
ATOM 8735  H HA   . PRO A 1 116 ? -20.566 -2.511  23.145  1.00 0.00 ? 116 PRO A HA   5  
ATOM 8736  H HB2  . PRO A 1 116 ? -22.025 -4.410  24.463  1.00 0.00 ? 116 PRO A HB2  5  
ATOM 8737  H HB3  . PRO A 1 116 ? -21.843 -2.767  25.045  1.00 0.00 ? 116 PRO A HB3  5  
ATOM 8738  H HG2  . PRO A 1 116 ? -24.186 -4.028  23.757  1.00 0.00 ? 116 PRO A HG2  5  
ATOM 8739  H HG3  . PRO A 1 116 ? -24.116 -2.561  24.712  1.00 0.00 ? 116 PRO A HG3  5  
ATOM 8740  H HD2  . PRO A 1 116 ? -24.321 -2.742  21.857  1.00 0.00 ? 116 PRO A HD2  5  
ATOM 8741  H HD3  . PRO A 1 116 ? -24.135 -1.279  22.804  1.00 0.00 ? 116 PRO A HD3  5  
ATOM 8742  N N    . SER A 1 117 ? -19.877 -4.816  22.527  1.00 0.00 ? 117 SER A N    5  
ATOM 8743  C CA   . SER A 1 117 ? -19.359 -5.990  21.845  1.00 0.00 ? 117 SER A CA   5  
ATOM 8744  C C    . SER A 1 117 ? -19.567 -7.233  22.713  1.00 0.00 ? 117 SER A C    5  
ATOM 8745  O O    . SER A 1 117 ? -19.679 -7.131  23.934  1.00 0.00 ? 117 SER A O    5  
ATOM 8746  C CB   . SER A 1 117 ? -17.876 -5.821  21.507  1.00 0.00 ? 117 SER A CB   5  
ATOM 8747  O OG   . SER A 1 117 ? -17.651 -4.724  20.626  1.00 0.00 ? 117 SER A OG   5  
ATOM 8748  H H    . SER A 1 117 ? -19.331 -4.504  23.304  1.00 0.00 ? 117 SER A H    5  
ATOM 8749  H HA   . SER A 1 117 ? -19.935 -6.066  20.923  1.00 0.00 ? 117 SER A HA   5  
ATOM 8750  H HB2  . SER A 1 117 ? -17.310 -5.671  22.426  1.00 0.00 ? 117 SER A HB2  5  
ATOM 8751  H HB3  . SER A 1 117 ? -17.503 -6.737  21.049  1.00 0.00 ? 117 SER A HB3  5  
ATOM 8752  H HG   . SER A 1 117 ? -17.407 -5.060  19.717  1.00 0.00 ? 117 SER A HG   5  
ATOM 8753  N N    . SER A 1 118 ? -19.613 -8.378  22.049  1.00 0.00 ? 118 SER A N    5  
ATOM 8754  C CA   . SER A 1 118 ? -19.806 -9.640  22.744  1.00 0.00 ? 118 SER A CA   5  
ATOM 8755  C C    . SER A 1 118 ? -19.405 -10.804 21.836  1.00 0.00 ? 118 SER A C    5  
ATOM 8756  O O    . SER A 1 118 ? -20.213 -11.283 21.042  1.00 0.00 ? 118 SER A O    5  
ATOM 8757  C CB   . SER A 1 118 ? -21.257 -9.799  23.203  1.00 0.00 ? 118 SER A CB   5  
ATOM 8758  O OG   . SER A 1 118 ? -21.345 -10.152 24.580  1.00 0.00 ? 118 SER A OG   5  
ATOM 8759  H H    . SER A 1 118 ? -19.521 -8.453  21.056  1.00 0.00 ? 118 SER A H    5  
ATOM 8760  H HA   . SER A 1 118 ? -19.153 -9.591  23.615  1.00 0.00 ? 118 SER A HA   5  
ATOM 8761  H HB2  . SER A 1 118 ? -21.796 -8.867  23.032  1.00 0.00 ? 118 SER A HB2  5  
ATOM 8762  H HB3  . SER A 1 118 ? -21.745 -10.565 22.600  1.00 0.00 ? 118 SER A HB3  5  
ATOM 8763  H HG   . SER A 1 118 ? -20.514 -10.630 24.865  1.00 0.00 ? 118 SER A HG   5  
ATOM 8764  N N    . GLY A 1 119 ? -18.158 -11.226 21.984  1.00 0.00 ? 119 GLY A N    5  
ATOM 8765  C CA   . GLY A 1 119 ? -17.640 -12.326 21.188  1.00 0.00 ? 119 GLY A CA   5  
ATOM 8766  C C    . GLY A 1 119 ? -16.585 -11.834 20.195  1.00 0.00 ? 119 GLY A C    5  
ATOM 8767  O O    . GLY A 1 119 ? -15.710 -11.047 20.553  1.00 0.00 ? 119 GLY A O    5  
ATOM 8768  H H    . GLY A 1 119 ? -17.507 -10.831 22.633  1.00 0.00 ? 119 GLY A H    5  
ATOM 8769  H HA2  . GLY A 1 119 ? -17.205 -13.080 21.843  1.00 0.00 ? 119 GLY A HA2  5  
ATOM 8770  H HA3  . GLY A 1 119 ? -18.457 -12.805 20.648  1.00 0.00 ? 119 GLY A HA3  5  
ATOM 8771  N N    . GLY A 1 1   ? -0.610  -13.920 8.956   1.00 0.00 ? 1   GLY A N    6  
ATOM 8772  C CA   . GLY A 1 1   ? 0.151   -14.840 8.129   1.00 0.00 ? 1   GLY A CA   6  
ATOM 8773  C C    . GLY A 1 1   ? -0.772  -15.832 7.419   1.00 0.00 ? 1   GLY A C    6  
ATOM 8774  O O    . GLY A 1 1   ? -1.445  -16.632 8.067   1.00 0.00 ? 1   GLY A O    6  
ATOM 8775  H H1   . GLY A 1 1   ? -0.062  -13.340 9.558   1.00 0.00 ? 1   GLY A H1   6  
ATOM 8776  H HA2  . GLY A 1 1   ? 0.726   -14.280 7.391   1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8777  H HA3  . GLY A 1 1   ? 0.868   -15.382 8.746   1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8778  N N    . SER A 1 2   ? -0.774  -15.748 6.096   1.00 0.00 ? 2   SER A N    6  
ATOM 8779  C CA   . SER A 1 2   ? -1.603  -16.628 5.291   1.00 0.00 ? 2   SER A CA   6  
ATOM 8780  C C    . SER A 1 2   ? -0.727  -17.453 4.346   1.00 0.00 ? 2   SER A C    6  
ATOM 8781  O O    . SER A 1 2   ? 0.423   -17.098 4.091   1.00 0.00 ? 2   SER A O    6  
ATOM 8782  C CB   . SER A 1 2   ? -2.640  -15.833 4.496   1.00 0.00 ? 2   SER A CB   6  
ATOM 8783  O OG   . SER A 1 2   ? -2.054  -14.733 3.806   1.00 0.00 ? 2   SER A OG   6  
ATOM 8784  H H    . SER A 1 2   ? -0.223  -15.095 5.577   1.00 0.00 ? 2   SER A H    6  
ATOM 8785  H HA   . SER A 1 2   ? -2.112  -17.277 6.004   1.00 0.00 ? 2   SER A HA   6  
ATOM 8786  H HB2  . SER A 1 2   ? -3.130  -16.492 3.779   1.00 0.00 ? 2   SER A HB2  6  
ATOM 8787  H HB3  . SER A 1 2   ? -3.413  -15.468 5.172   1.00 0.00 ? 2   SER A HB3  6  
ATOM 8788  H HG   . SER A 1 2   ? -1.980  -13.945 4.418   1.00 0.00 ? 2   SER A HG   6  
ATOM 8789  N N    . SER A 1 3   ? -1.304  -18.538 3.852   1.00 0.00 ? 3   SER A N    6  
ATOM 8790  C CA   . SER A 1 3   ? -0.590  -19.416 2.940   1.00 0.00 ? 3   SER A CA   6  
ATOM 8791  C C    . SER A 1 3   ? 0.138   -18.588 1.879   1.00 0.00 ? 3   SER A C    6  
ATOM 8792  O O    . SER A 1 3   ? 1.362   -18.640 1.778   1.00 0.00 ? 3   SER A O    6  
ATOM 8793  C CB   . SER A 1 3   ? -1.543  -20.412 2.275   1.00 0.00 ? 3   SER A CB   6  
ATOM 8794  O OG   . SER A 1 3   ? -0.841  -21.431 1.568   1.00 0.00 ? 3   SER A OG   6  
ATOM 8795  H H    . SER A 1 3   ? -2.240  -18.820 4.064   1.00 0.00 ? 3   SER A H    6  
ATOM 8796  H HA   . SER A 1 3   ? 0.125   -19.957 3.560   1.00 0.00 ? 3   SER A HA   6  
ATOM 8797  H HB2  . SER A 1 3   ? -2.177  -20.869 3.035   1.00 0.00 ? 3   SER A HB2  6  
ATOM 8798  H HB3  . SER A 1 3   ? -2.201  -19.881 1.588   1.00 0.00 ? 3   SER A HB3  6  
ATOM 8799  H HG   . SER A 1 3   ? -0.147  -21.021 0.976   1.00 0.00 ? 3   SER A HG   6  
ATOM 8800  N N    . GLY A 1 4   ? -0.647  -17.844 1.114   1.00 0.00 ? 4   GLY A N    6  
ATOM 8801  C CA   . GLY A 1 4   ? -0.093  -17.006 0.064   1.00 0.00 ? 4   GLY A CA   6  
ATOM 8802  C C    . GLY A 1 4   ? -0.915  -17.121 -1.221  1.00 0.00 ? 4   GLY A C    6  
ATOM 8803  O O    . GLY A 1 4   ? -2.145  -17.105 -1.179  1.00 0.00 ? 4   GLY A O    6  
ATOM 8804  H H    . GLY A 1 4   ? -1.643  -17.807 1.202   1.00 0.00 ? 4   GLY A H    6  
ATOM 8805  H HA2  . GLY A 1 4   ? -0.072  -15.968 0.395   1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8806  H HA3  . GLY A 1 4   ? 0.939   -17.299 -0.133  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8807  N N    . SER A 1 5   ? -0.204  -17.235 -2.333  1.00 0.00 ? 5   SER A N    6  
ATOM 8808  C CA   . SER A 1 5   ? -0.853  -17.352 -3.628  1.00 0.00 ? 5   SER A CA   6  
ATOM 8809  C C    . SER A 1 5   ? 0.101   -18.000 -4.634  1.00 0.00 ? 5   SER A C    6  
ATOM 8810  O O    . SER A 1 5   ? 1.036   -17.358 -5.110  1.00 0.00 ? 5   SER A O    6  
ATOM 8811  C CB   . SER A 1 5   ? -1.315  -15.986 -4.138  1.00 0.00 ? 5   SER A CB   6  
ATOM 8812  O OG   . SER A 1 5   ? -2.711  -15.784 -3.933  1.00 0.00 ? 5   SER A OG   6  
ATOM 8813  H H    . SER A 1 5   ? 0.796   -17.247 -2.358  1.00 0.00 ? 5   SER A H    6  
ATOM 8814  H HA   . SER A 1 5   ? -1.721  -17.989 -3.459  1.00 0.00 ? 5   SER A HA   6  
ATOM 8815  H HB2  . SER A 1 5   ? -0.756  -15.201 -3.629  1.00 0.00 ? 5   SER A HB2  6  
ATOM 8816  H HB3  . SER A 1 5   ? -1.089  -15.901 -5.201  1.00 0.00 ? 5   SER A HB3  6  
ATOM 8817  H HG   . SER A 1 5   ? -2.895  -15.634 -2.962  1.00 0.00 ? 5   SER A HG   6  
ATOM 8818  N N    . SER A 1 6   ? -0.169  -19.264 -4.927  1.00 0.00 ? 6   SER A N    6  
ATOM 8819  C CA   . SER A 1 6   ? 0.654   -20.005 -5.868  1.00 0.00 ? 6   SER A CA   6  
ATOM 8820  C C    . SER A 1 6   ? 0.617   -19.330 -7.240  1.00 0.00 ? 6   SER A C    6  
ATOM 8821  O O    . SER A 1 6   ? -0.456  -19.094 -7.792  1.00 0.00 ? 6   SER A O    6  
ATOM 8822  C CB   . SER A 1 6   ? 0.189   -21.459 -5.979  1.00 0.00 ? 6   SER A CB   6  
ATOM 8823  O OG   . SER A 1 6   ? 0.808   -22.294 -5.005  1.00 0.00 ? 6   SER A OG   6  
ATOM 8824  H H    . SER A 1 6   ? -0.931  -19.779 -4.535  1.00 0.00 ? 6   SER A H    6  
ATOM 8825  H HA   . SER A 1 6   ? 1.662   -19.978 -5.454  1.00 0.00 ? 6   SER A HA   6  
ATOM 8826  H HB2  . SER A 1 6   ? -0.894  -21.503 -5.859  1.00 0.00 ? 6   SER A HB2  6  
ATOM 8827  H HB3  . SER A 1 6   ? 0.414   -21.836 -6.977  1.00 0.00 ? 6   SER A HB3  6  
ATOM 8828  H HG   . SER A 1 6   ? 0.400   -23.206 -5.028  1.00 0.00 ? 6   SER A HG   6  
ATOM 8829  N N    . GLY A 1 7   ? 1.804   -19.037 -7.752  1.00 0.00 ? 7   GLY A N    6  
ATOM 8830  C CA   . GLY A 1 7   ? 1.922   -18.393 -9.049  1.00 0.00 ? 7   GLY A CA   6  
ATOM 8831  C C    . GLY A 1 7   ? 3.083   -17.397 -9.063  1.00 0.00 ? 7   GLY A C    6  
ATOM 8832  O O    . GLY A 1 7   ? 2.898   -16.218 -8.764  1.00 0.00 ? 7   GLY A O    6  
ATOM 8833  H H    . GLY A 1 7   ? 2.673   -19.232 -7.297  1.00 0.00 ? 7   GLY A H    6  
ATOM 8834  H HA2  . GLY A 1 7   ? 2.076   -19.148 -9.821  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8835  H HA3  . GLY A 1 7   ? 0.992   -17.877 -9.288  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8836  N N    . PRO A 1 8   ? 4.285   -17.921 -9.424  1.00 0.00 ? 8   PRO A N    6  
ATOM 8837  C CA   . PRO A 1 8   ? 5.476   -17.091 -9.481  1.00 0.00 ? 8   PRO A CA   6  
ATOM 8838  C C    . PRO A 1 8   ? 5.458   -16.191 -10.719 1.00 0.00 ? 8   PRO A C    6  
ATOM 8839  O O    . PRO A 1 8   ? 4.559   -16.292 -11.552 1.00 0.00 ? 8   PRO A O    6  
ATOM 8840  C CB   . PRO A 1 8   ? 6.639   -18.070 -9.476  1.00 0.00 ? 8   PRO A CB   6  
ATOM 8841  C CG   . PRO A 1 8   ? 6.055   -19.412 -9.884  1.00 0.00 ? 8   PRO A CG   6  
ATOM 8842  C CD   . PRO A 1 8   ? 4.541   -19.312 -9.785  1.00 0.00 ? 8   PRO A CD   6  
ATOM 8843  H HA   . PRO A 1 8   ? 5.507   -16.474 -8.695  1.00 0.00 ? 8   PRO A HA   6  
ATOM 8844  H HB2  . PRO A 1 8   ? 7.418   -17.755 -10.171 1.00 0.00 ? 8   PRO A HB2  6  
ATOM 8845  H HB3  . PRO A 1 8   ? 7.097   -18.127 -8.489  1.00 0.00 ? 8   PRO A HB3  6  
ATOM 8846  H HG2  . PRO A 1 8   ? 6.355   -19.666 -10.901 1.00 0.00 ? 8   PRO A HG2  6  
ATOM 8847  H HG3  . PRO A 1 8   ? 6.428   -20.204 -9.235  1.00 0.00 ? 8   PRO A HG3  6  
ATOM 8848  H HD2  . PRO A 1 8   ? 4.065   -19.570 -10.731 1.00 0.00 ? 8   PRO A HD2  6  
ATOM 8849  H HD3  . PRO A 1 8   ? 4.147   -19.995 -9.033  1.00 0.00 ? 8   PRO A HD3  6  
ATOM 8850  N N    . GLN A 1 9   ? 6.462   -15.330 -10.800 1.00 0.00 ? 9   GLN A N    6  
ATOM 8851  C CA   . GLN A 1 9   ? 6.573   -14.413 -11.921 1.00 0.00 ? 9   GLN A CA   6  
ATOM 8852  C C    . GLN A 1 9   ? 7.887   -14.646 -12.670 1.00 0.00 ? 9   GLN A C    6  
ATOM 8853  O O    . GLN A 1 9   ? 7.881   -15.072 -13.824 1.00 0.00 ? 9   GLN A O    6  
ATOM 8854  C CB   . GLN A 1 9   ? 6.458   -12.960 -11.455 1.00 0.00 ? 9   GLN A CB   6  
ATOM 8855  C CG   . GLN A 1 9   ? 5.003   -12.593 -11.157 1.00 0.00 ? 9   GLN A CG   6  
ATOM 8856  C CD   . GLN A 1 9   ? 4.190   -12.481 -12.448 1.00 0.00 ? 9   GLN A CD   6  
ATOM 8857  O OE1  . GLN A 1 9   ? 3.867   -13.463 -13.096 1.00 0.00 ? 9   GLN A OE1  6  
ATOM 8858  N NE2  . GLN A 1 9   ? 3.879   -11.233 -12.785 1.00 0.00 ? 9   GLN A NE2  6  
ATOM 8859  H H    . GLN A 1 9   ? 7.190   -15.254 -10.118 1.00 0.00 ? 9   GLN A H    6  
ATOM 8860  H HA   . GLN A 1 9   ? 5.730   -14.647 -12.571 1.00 0.00 ? 9   GLN A HA   6  
ATOM 8861  H HB2  . GLN A 1 9   ? 7.065   -12.812 -10.561 1.00 0.00 ? 9   GLN A HB2  6  
ATOM 8862  H HB3  . GLN A 1 9   ? 6.855   -12.296 -12.222 1.00 0.00 ? 9   GLN A HB3  6  
ATOM 8863  H HG2  . GLN A 1 9   ? 4.560   -13.349 -10.508 1.00 0.00 ? 9   GLN A HG2  6  
ATOM 8864  H HG3  . GLN A 1 9   ? 4.966   -11.648 -10.616 1.00 0.00 ? 9   GLN A HG3  6  
ATOM 8865  H HE21 . GLN A 1 9   ? 4.175   -10.471 -12.208 1.00 0.00 ? 9   GLN A HE21 6  
ATOM 8866  H HE22 . GLN A 1 9   ? 3.348   -11.056 -13.614 1.00 0.00 ? 9   GLN A HE22 6  
ATOM 8867  N N    . LEU A 1 10  ? 8.982   -14.357 -11.983 1.00 0.00 ? 10  LEU A N    6  
ATOM 8868  C CA   . LEU A 1 10  ? 10.301  -14.530 -12.568 1.00 0.00 ? 10  LEU A CA   6  
ATOM 8869  C C    . LEU A 1 10  ? 10.497  -13.501 -13.684 1.00 0.00 ? 10  LEU A C    6  
ATOM 8870  O O    . LEU A 1 10  ? 9.777   -13.517 -14.681 1.00 0.00 ? 10  LEU A O    6  
ATOM 8871  C CB   . LEU A 1 10  ? 10.499  -15.977 -13.023 1.00 0.00 ? 10  LEU A CB   6  
ATOM 8872  C CG   . LEU A 1 10  ? 11.474  -16.813 -12.192 1.00 0.00 ? 10  LEU A CG   6  
ATOM 8873  C CD1  . LEU A 1 10  ? 10.900  -17.107 -10.805 1.00 0.00 ? 10  LEU A CD1  6  
ATOM 8874  C CD2  . LEU A 1 10  ? 11.867  -18.094 -12.933 1.00 0.00 ? 10  LEU A CD2  6  
ATOM 8875  H H    . LEU A 1 10  ? 8.978   -14.011 -11.044 1.00 0.00 ? 10  LEU A H    6  
ATOM 8876  H HA   . LEU A 1 10  ? 11.034  -14.334 -11.785 1.00 0.00 ? 10  LEU A HA   6  
ATOM 8877  H HB2  . LEU A 1 10  ? 9.529   -16.474 -13.019 1.00 0.00 ? 10  LEU A HB2  6  
ATOM 8878  H HB3  . LEU A 1 10  ? 10.848  -15.967 -14.056 1.00 0.00 ? 10  LEU A HB3  6  
ATOM 8879  H HG   . LEU A 1 10  ? 12.385  -16.233 -12.047 1.00 0.00 ? 10  LEU A HG   6  
ATOM 8880  H HD11 . LEU A 1 10  ? 9.839   -17.342 -10.893 1.00 0.00 ? 10  LEU A HD11 6  
ATOM 8881  H HD12 . LEU A 1 10  ? 11.424  -17.956 -10.367 1.00 0.00 ? 10  LEU A HD12 6  
ATOM 8882  H HD13 . LEU A 1 10  ? 11.027  -16.233 -10.167 1.00 0.00 ? 10  LEU A HD13 6  
ATOM 8883  H HD21 . LEU A 1 10  ? 11.381  -18.949 -12.463 1.00 0.00 ? 10  LEU A HD21 6  
ATOM 8884  H HD22 . LEU A 1 10  ? 11.551  -18.023 -13.973 1.00 0.00 ? 10  LEU A HD22 6  
ATOM 8885  H HD23 . LEU A 1 10  ? 12.949  -18.221 -12.889 1.00 0.00 ? 10  LEU A HD23 6  
ATOM 8886  N N    . VAL A 1 11  ? 11.476  -12.632 -13.478 1.00 0.00 ? 11  VAL A N    6  
ATOM 8887  C CA   . VAL A 1 11  ? 11.776  -11.599 -14.455 1.00 0.00 ? 11  VAL A CA   6  
ATOM 8888  C C    . VAL A 1 11  ? 13.037  -10.847 -14.024 1.00 0.00 ? 11  VAL A C    6  
ATOM 8889  O O    . VAL A 1 11  ? 13.144  -10.412 -12.878 1.00 0.00 ? 11  VAL A O    6  
ATOM 8890  C CB   . VAL A 1 11  ? 10.565  -10.681 -14.635 1.00 0.00 ? 11  VAL A CB   6  
ATOM 8891  C CG1  . VAL A 1 11  ? 10.390  -9.762  -13.424 1.00 0.00 ? 11  VAL A CG1  6  
ATOM 8892  C CG2  . VAL A 1 11  ? 10.679  -9.871  -15.927 1.00 0.00 ? 11  VAL A CG2  6  
ATOM 8893  H H    . VAL A 1 11  ? 12.057  -12.627 -12.665 1.00 0.00 ? 11  VAL A H    6  
ATOM 8894  H HA   . VAL A 1 11  ? 11.970  -12.092 -15.407 1.00 0.00 ? 11  VAL A HA   6  
ATOM 8895  H HB   . VAL A 1 11  ? 9.677   -11.309 -14.710 1.00 0.00 ? 11  VAL A HB   6  
ATOM 8896  H HG11 . VAL A 1 11  ? 10.902  -10.192 -12.564 1.00 0.00 ? 11  VAL A HG11 6  
ATOM 8897  H HG12 . VAL A 1 11  ? 10.813  -8.782  -13.648 1.00 0.00 ? 11  VAL A HG12 6  
ATOM 8898  H HG13 . VAL A 1 11  ? 9.328   -9.656  -13.200 1.00 0.00 ? 11  VAL A HG13 6  
ATOM 8899  H HG21 . VAL A 1 11  ? 10.020  -10.298 -16.683 1.00 0.00 ? 11  VAL A HG21 6  
ATOM 8900  H HG22 . VAL A 1 11  ? 10.390  -8.837  -15.735 1.00 0.00 ? 11  VAL A HG22 6  
ATOM 8901  H HG23 . VAL A 1 11  ? 11.708  -9.899  -16.285 1.00 0.00 ? 11  VAL A HG23 6  
ATOM 8902  N N    . ARG A 1 12  ? 13.961  -10.718 -14.965 1.00 0.00 ? 12  ARG A N    6  
ATOM 8903  C CA   . ARG A 1 12  ? 15.211  -10.026 -14.697 1.00 0.00 ? 12  ARG A CA   6  
ATOM 8904  C C    . ARG A 1 12  ? 15.918  -9.681  -16.008 1.00 0.00 ? 12  ARG A C    6  
ATOM 8905  O O    . ARG A 1 12  ? 16.326  -10.573 -16.751 1.00 0.00 ? 12  ARG A O    6  
ATOM 8906  C CB   . ARG A 1 12  ? 16.140  -10.882 -13.833 1.00 0.00 ? 12  ARG A CB   6  
ATOM 8907  C CG   . ARG A 1 12  ? 16.784  -10.046 -12.726 1.00 0.00 ? 12  ARG A CG   6  
ATOM 8908  C CD   . ARG A 1 12  ? 18.050  -10.721 -12.196 1.00 0.00 ? 12  ARG A CD   6  
ATOM 8909  N NE   . ARG A 1 12  ? 19.213  -9.821  -12.366 1.00 0.00 ? 12  ARG A NE   6  
ATOM 8910  C CZ   . ARG A 1 12  ? 20.461  -10.126 -11.987 1.00 0.00 ? 12  ARG A CZ   6  
ATOM 8911  N NH1  . ARG A 1 12  ? 20.717  -11.311 -11.415 1.00 0.00 ? 12  ARG A NH1  6  
ATOM 8912  N NH2  . ARG A 1 12  ? 21.454  -9.247  -12.181 1.00 0.00 ? 12  ARG A NH2  6  
ATOM 8913  H H    . ARG A 1 12  ? 13.867  -11.075 -15.894 1.00 0.00 ? 12  ARG A H    6  
ATOM 8914  H HA   . ARG A 1 12  ? 14.920  -9.124  -14.159 1.00 0.00 ? 12  ARG A HA   6  
ATOM 8915  H HB2  . ARG A 1 12  ? 15.577  -11.705 -13.392 1.00 0.00 ? 12  ARG A HB2  6  
ATOM 8916  H HB3  . ARG A 1 12  ? 16.916  -11.326 -14.457 1.00 0.00 ? 12  ARG A HB3  6  
ATOM 8917  H HG2  . ARG A 1 12  ? 17.029  -9.055  -13.109 1.00 0.00 ? 12  ARG A HG2  6  
ATOM 8918  H HG3  . ARG A 1 12  ? 16.074  -9.906  -11.911 1.00 0.00 ? 12  ARG A HG3  6  
ATOM 8919  H HD2  . ARG A 1 12  ? 17.925  -10.971 -11.142 1.00 0.00 ? 12  ARG A HD2  6  
ATOM 8920  H HD3  . ARG A 1 12  ? 18.224  -11.656 -12.727 1.00 0.00 ? 12  ARG A HD3  6  
ATOM 8921  H HE   . ARG A 1 12  ? 19.057  -8.928  -12.789 1.00 0.00 ? 12  ARG A HE   6  
ATOM 8922  H HH11 . ARG A 1 12  ? 19.976  -11.967 -11.271 1.00 0.00 ? 12  ARG A HH11 6  
ATOM 8923  H HH12 . ARG A 1 12  ? 21.649  -11.539 -11.133 1.00 0.00 ? 12  ARG A HH12 6  
ATOM 8924  H HH21 . ARG A 1 12  ? 21.263  -8.363  -12.608 1.00 0.00 ? 12  ARG A HH21 6  
ATOM 8925  H HH22 . ARG A 1 12  ? 22.386  -9.476  -11.899 1.00 0.00 ? 12  ARG A HH22 6  
ATOM 8926  N N    . THR A 1 13  ? 16.043  -8.385  -16.253 1.00 0.00 ? 13  THR A N    6  
ATOM 8927  C CA   . THR A 1 13  ? 16.695  -7.912  -17.463 1.00 0.00 ? 13  THR A CA   6  
ATOM 8928  C C    . THR A 1 13  ? 17.172  -6.469  -17.282 1.00 0.00 ? 13  THR A C    6  
ATOM 8929  O O    . THR A 1 13  ? 16.802  -5.588  -18.056 1.00 0.00 ? 13  THR A O    6  
ATOM 8930  C CB   . THR A 1 13  ? 15.717  -8.087  -18.626 1.00 0.00 ? 13  THR A CB   6  
ATOM 8931  O OG1  . THR A 1 13  ? 16.489  -7.764  -19.780 1.00 0.00 ? 13  THR A OG1  6  
ATOM 8932  C CG2  . THR A 1 13  ? 14.603  -7.038  -18.618 1.00 0.00 ? 13  THR A CG2  6  
ATOM 8933  H H    . THR A 1 13  ? 15.709  -7.666  -15.644 1.00 0.00 ? 13  THR A H    6  
ATOM 8934  H HA   . THR A 1 13  ? 17.581  -8.522  -17.637 1.00 0.00 ? 13  THR A HA   6  
ATOM 8935  H HB   . THR A 1 13  ? 15.303  -9.095  -18.638 1.00 0.00 ? 13  THR A HB   6  
ATOM 8936  H HG1  . THR A 1 13  ? 16.788  -8.602  -20.237 1.00 0.00 ? 13  THR A HG1  6  
ATOM 8937  H HG21 . THR A 1 13  ? 14.755  -6.354  -17.784 1.00 0.00 ? 13  THR A HG21 6  
ATOM 8938  H HG22 . THR A 1 13  ? 14.622  -6.480  -19.554 1.00 0.00 ? 13  THR A HG22 6  
ATOM 8939  H HG23 . THR A 1 13  ? 13.638  -7.534  -18.510 1.00 0.00 ? 13  THR A HG23 6  
ATOM 8940  N N    . HIS A 1 14  ? 17.986  -6.273  -16.255 1.00 0.00 ? 14  HIS A N    6  
ATOM 8941  C CA   . HIS A 1 14  ? 18.517  -4.953  -15.962 1.00 0.00 ? 14  HIS A CA   6  
ATOM 8942  C C    . HIS A 1 14  ? 17.386  -4.037  -15.491 1.00 0.00 ? 14  HIS A C    6  
ATOM 8943  O O    . HIS A 1 14  ? 16.371  -3.898  -16.171 1.00 0.00 ? 14  HIS A O    6  
ATOM 8944  C CB   . HIS A 1 14  ? 19.270  -4.390  -17.170 1.00 0.00 ? 14  HIS A CB   6  
ATOM 8945  C CG   . HIS A 1 14  ? 20.773  -4.472  -17.048 1.00 0.00 ? 14  HIS A CG   6  
ATOM 8946  N ND1  . HIS A 1 14  ? 21.632  -3.810  -17.909 1.00 0.00 ? 14  HIS A ND1  6  
ATOM 8947  C CD2  . HIS A 1 14  ? 21.560  -5.143  -16.159 1.00 0.00 ? 14  HIS A CD2  6  
ATOM 8948  C CE1  . HIS A 1 14  ? 22.877  -4.079  -17.545 1.00 0.00 ? 14  HIS A CE1  6  
ATOM 8949  N NE2  . HIS A 1 14  ? 22.831  -4.905  -16.461 1.00 0.00 ? 14  HIS A NE2  6  
ATOM 8950  H H    . HIS A 1 14  ? 18.282  -6.996  -15.630 1.00 0.00 ? 14  HIS A H    6  
ATOM 8951  H HA   . HIS A 1 14  ? 19.235  -5.077  -15.151 1.00 0.00 ? 14  HIS A HA   6  
ATOM 8952  H HB2  . HIS A 1 14  ? 18.958  -4.931  -18.064 1.00 0.00 ? 14  HIS A HB2  6  
ATOM 8953  H HB3  . HIS A 1 14  ? 18.983  -3.348  -17.311 1.00 0.00 ? 14  HIS A HB3  6  
ATOM 8954  H HD1  . HIS A 1 14  ? 21.358  -3.228  -18.675 1.00 0.00 ? 14  HIS A HD1  6  
ATOM 8955  H HD2  . HIS A 1 14  ? 21.206  -5.769  -15.340 1.00 0.00 ? 14  HIS A HD2  6  
ATOM 8956  H HE1  . HIS A 1 14  ? 23.780  -3.705  -18.027 1.00 0.00 ? 14  HIS A HE1  6  
ATOM 8957  N N    . GLU A 1 15  ? 17.598  -3.438  -14.328 1.00 0.00 ? 15  GLU A N    6  
ATOM 8958  C CA   . GLU A 1 15  ? 16.609  -2.540  -13.757 1.00 0.00 ? 15  GLU A CA   6  
ATOM 8959  C C    . GLU A 1 15  ? 17.299  -1.390  -13.020 1.00 0.00 ? 15  GLU A C    6  
ATOM 8960  O O    . GLU A 1 15  ? 18.414  -1.546  -12.525 1.00 0.00 ? 15  GLU A O    6  
ATOM 8961  C CB   . GLU A 1 15  ? 15.655  -3.294  -12.829 1.00 0.00 ? 15  GLU A CB   6  
ATOM 8962  C CG   . GLU A 1 15  ? 14.700  -4.182  -13.627 1.00 0.00 ? 15  GLU A CG   6  
ATOM 8963  C CD   . GLU A 1 15  ? 13.264  -4.041  -13.116 1.00 0.00 ? 15  GLU A CD   6  
ATOM 8964  O OE1  . GLU A 1 15  ? 12.970  -4.663  -12.072 1.00 0.00 ? 15  GLU A OE1  6  
ATOM 8965  O OE2  . GLU A 1 15  ? 12.493  -3.316  -13.781 1.00 0.00 ? 15  GLU A OE2  6  
ATOM 8966  H H    . GLU A 1 15  ? 18.427  -3.557  -13.781 1.00 0.00 ? 15  GLU A H    6  
ATOM 8967  H HA   . GLU A 1 15  ? 16.047  -2.150  -14.606 1.00 0.00 ? 15  GLU A HA   6  
ATOM 8968  H HB2  . GLU A 1 15  ? 16.229  -3.905  -12.131 1.00 0.00 ? 15  GLU A HB2  6  
ATOM 8969  H HB3  . GLU A 1 15  ? 15.084  -2.582  -12.233 1.00 0.00 ? 15  GLU A HB3  6  
ATOM 8970  H HG2  . GLU A 1 15  ? 14.742  -3.911  -14.682 1.00 0.00 ? 15  GLU A HG2  6  
ATOM 8971  H HG3  . GLU A 1 15  ? 15.016  -5.222  -13.552 1.00 0.00 ? 15  GLU A HG3  6  
ATOM 8972  N N    . ASP A 1 16  ? 16.606  -0.262  -12.969 1.00 0.00 ? 16  ASP A N    6  
ATOM 8973  C CA   . ASP A 1 16  ? 17.138  0.913   -12.301 1.00 0.00 ? 16  ASP A CA   6  
ATOM 8974  C C    . ASP A 1 16  ? 16.343  1.169   -11.018 1.00 0.00 ? 16  ASP A C    6  
ATOM 8975  O O    . ASP A 1 16  ? 16.833  1.824   -10.100 1.00 0.00 ? 16  ASP A O    6  
ATOM 8976  C CB   . ASP A 1 16  ? 17.016  2.154   -13.187 1.00 0.00 ? 16  ASP A CB   6  
ATOM 8977  C CG   . ASP A 1 16  ? 17.927  3.320   -12.797 1.00 0.00 ? 16  ASP A CG   6  
ATOM 8978  O OD1  . ASP A 1 16  ? 17.873  3.709   -11.610 1.00 0.00 ? 16  ASP A OD1  6  
ATOM 8979  O OD2  . ASP A 1 16  ? 18.656  3.796   -13.694 1.00 0.00 ? 16  ASP A OD2  6  
ATOM 8980  H H    . ASP A 1 16  ? 15.699  -0.144  -13.375 1.00 0.00 ? 16  ASP A H    6  
ATOM 8981  H HA   . ASP A 1 16  ? 18.184  0.682   -12.103 1.00 0.00 ? 16  ASP A HA   6  
ATOM 8982  H HB2  . ASP A 1 16  ? 17.235  1.870   -14.216 1.00 0.00 ? 16  ASP A HB2  6  
ATOM 8983  H HB3  . ASP A 1 16  ? 15.982  2.498   -13.165 1.00 0.00 ? 16  ASP A HB3  6  
ATOM 8984  N N    . VAL A 1 17  ? 15.129  0.637   -10.997 1.00 0.00 ? 17  VAL A N    6  
ATOM 8985  C CA   . VAL A 1 17  ? 14.262  0.799   -9.842  1.00 0.00 ? 17  VAL A CA   6  
ATOM 8986  C C    . VAL A 1 17  ? 14.324  -0.465  -8.982  1.00 0.00 ? 17  VAL A C    6  
ATOM 8987  O O    . VAL A 1 17  ? 14.804  -1.504  -9.433  1.00 0.00 ? 17  VAL A O    6  
ATOM 8988  C CB   . VAL A 1 17  ? 12.843  1.143   -10.298 1.00 0.00 ? 17  VAL A CB   6  
ATOM 8989  C CG1  . VAL A 1 17  ? 12.710  2.638   -10.596 1.00 0.00 ? 17  VAL A CG1  6  
ATOM 8990  C CG2  . VAL A 1 17  ? 12.438  0.303   -11.512 1.00 0.00 ? 17  VAL A CG2  6  
ATOM 8991  H H    . VAL A 1 17  ? 14.739  0.105   -11.748 1.00 0.00 ? 17  VAL A H    6  
ATOM 8992  H HA   . VAL A 1 17  ? 14.642  1.639   -9.260  1.00 0.00 ? 17  VAL A HA   6  
ATOM 8993  H HB   . VAL A 1 17  ? 12.161  0.902   -9.483  1.00 0.00 ? 17  VAL A HB   6  
ATOM 8994  H HG11 . VAL A 1 17  ? 12.758  3.200   -9.664  1.00 0.00 ? 17  VAL A HG11 6  
ATOM 8995  H HG12 . VAL A 1 17  ? 13.522  2.951   -11.252 1.00 0.00 ? 17  VAL A HG12 6  
ATOM 8996  H HG13 . VAL A 1 17  ? 11.754  2.827   -11.085 1.00 0.00 ? 17  VAL A HG13 6  
ATOM 8997  H HG21 . VAL A 1 17  ? 12.923  0.699   -12.405 1.00 0.00 ? 17  VAL A HG21 6  
ATOM 8998  H HG22 . VAL A 1 17  ? 12.748  -0.730  -11.358 1.00 0.00 ? 17  VAL A HG22 6  
ATOM 8999  H HG23 . VAL A 1 17  ? 11.357  0.344   -11.638 1.00 0.00 ? 17  VAL A HG23 6  
ATOM 9000  N N    . PRO A 1 18  ? 13.819  -0.331  -7.726  1.00 0.00 ? 18  PRO A N    6  
ATOM 9001  C CA   . PRO A 1 18  ? 13.812  -1.449  -6.799  1.00 0.00 ? 18  PRO A CA   6  
ATOM 9002  C C    . PRO A 1 18  ? 12.724  -2.460  -7.167  1.00 0.00 ? 18  PRO A C    6  
ATOM 9003  O O    . PRO A 1 18  ? 11.997  -2.268  -8.140  1.00 0.00 ? 18  PRO A O    6  
ATOM 9004  C CB   . PRO A 1 18  ? 13.604  -0.824  -5.430  1.00 0.00 ? 18  PRO A CB   6  
ATOM 9005  C CG   . PRO A 1 18  ? 13.039  0.564   -5.687  1.00 0.00 ? 18  PRO A CG   6  
ATOM 9006  C CD   . PRO A 1 18  ? 13.243  0.885   -7.159  1.00 0.00 ? 18  PRO A CD   6  
ATOM 9007  H HA   . PRO A 1 18  ? 14.677  -1.948  -6.851  1.00 0.00 ? 18  PRO A HA   6  
ATOM 9008  H HB2  . PRO A 1 18  ? 12.917  -1.419  -4.828  1.00 0.00 ? 18  PRO A HB2  6  
ATOM 9009  H HB3  . PRO A 1 18  ? 14.543  -0.767  -4.879  1.00 0.00 ? 18  PRO A HB3  6  
ATOM 9010  H HG2  . PRO A 1 18  ? 11.980  0.599   -5.432  1.00 0.00 ? 18  PRO A HG2  6  
ATOM 9011  H HG3  . PRO A 1 18  ? 13.542  1.303   -5.062  1.00 0.00 ? 18  PRO A HG3  6  
ATOM 9012  H HD2  . PRO A 1 18  ? 12.300  1.139   -7.643  1.00 0.00 ? 18  PRO A HD2  6  
ATOM 9013  H HD3  . PRO A 1 18  ? 13.909  1.737   -7.290  1.00 0.00 ? 18  PRO A HD3  6  
ATOM 9014  N N    . GLY A 1 19  ? 12.645  -3.514  -6.368  1.00 0.00 ? 19  GLY A N    6  
ATOM 9015  C CA   . GLY A 1 19  ? 11.658  -4.555  -6.597  1.00 0.00 ? 19  GLY A CA   6  
ATOM 9016  C C    . GLY A 1 19  ? 10.525  -4.471  -5.571  1.00 0.00 ? 19  GLY A C    6  
ATOM 9017  O O    . GLY A 1 19  ? 10.251  -3.401  -5.030  1.00 0.00 ? 19  GLY A O    6  
ATOM 9018  H H    . GLY A 1 19  ? 13.240  -3.662  -5.578  1.00 0.00 ? 19  GLY A H    6  
ATOM 9019  H HA2  . GLY A 1 19  ? 11.250  -4.459  -7.603  1.00 0.00 ? 19  GLY A HA2  6  
ATOM 9020  H HA3  . GLY A 1 19  ? 12.135  -5.533  -6.538  1.00 0.00 ? 19  GLY A HA3  6  
ATOM 9021  N N    . PRO A 1 20  ? 9.881   -5.644  -5.329  1.00 0.00 ? 20  PRO A N    6  
ATOM 9022  C CA   . PRO A 1 20  ? 8.785   -5.714  -4.379  1.00 0.00 ? 20  PRO A CA   6  
ATOM 9023  C C    . PRO A 1 20  ? 9.303   -5.661  -2.940  1.00 0.00 ? 20  PRO A C    6  
ATOM 9024  O O    . PRO A 1 20  ? 10.237  -6.379  -2.586  1.00 0.00 ? 20  PRO A O    6  
ATOM 9025  C CB   . PRO A 1 20  ? 8.065   -7.012  -4.703  1.00 0.00 ? 20  PRO A CB   6  
ATOM 9026  C CG   . PRO A 1 20  ? 9.049   -7.845  -5.508  1.00 0.00 ? 20  PRO A CG   6  
ATOM 9027  C CD   . PRO A 1 20  ? 10.179  -6.931  -5.952  1.00 0.00 ? 20  PRO A CD   6  
ATOM 9028  H HA   . PRO A 1 20  ? 8.185   -4.921  -4.482  1.00 0.00 ? 20  PRO A HA   6  
ATOM 9029  H HB2  . PRO A 1 20  ? 7.767   -7.532  -3.793  1.00 0.00 ? 20  PRO A HB2  6  
ATOM 9030  H HB3  . PRO A 1 20  ? 7.155   -6.823  -5.274  1.00 0.00 ? 20  PRO A HB3  6  
ATOM 9031  H HG2  . PRO A 1 20  ? 9.436   -8.667  -4.906  1.00 0.00 ? 20  PRO A HG2  6  
ATOM 9032  H HG3  . PRO A 1 20  ? 8.555   -8.289  -6.373  1.00 0.00 ? 20  PRO A HG3  6  
ATOM 9033  H HD2  . PRO A 1 20  ? 11.148  -7.313  -5.628  1.00 0.00 ? 20  PRO A HD2  6  
ATOM 9034  H HD3  . PRO A 1 20  ? 10.217  -6.846  -7.038  1.00 0.00 ? 20  PRO A HD3  6  
ATOM 9035  N N    . VAL A 1 21  ? 8.673   -4.804  -2.149  1.00 0.00 ? 21  VAL A N    6  
ATOM 9036  C CA   . VAL A 1 21  ? 9.058   -4.649  -0.757  1.00 0.00 ? 21  VAL A CA   6  
ATOM 9037  C C    . VAL A 1 21  ? 8.960   -6.002  -0.050  1.00 0.00 ? 21  VAL A C    6  
ATOM 9038  O O    . VAL A 1 21  ? 8.447   -6.966  -0.617  1.00 0.00 ? 21  VAL A O    6  
ATOM 9039  C CB   . VAL A 1 21  ? 8.203   -3.565  -0.096  1.00 0.00 ? 21  VAL A CB   6  
ATOM 9040  C CG1  . VAL A 1 21  ? 8.710   -2.168  -0.461  1.00 0.00 ? 21  VAL A CG1  6  
ATOM 9041  C CG2  . VAL A 1 21  ? 6.728   -3.728  -0.467  1.00 0.00 ? 21  VAL A CG2  6  
ATOM 9042  H H    . VAL A 1 21  ? 7.914   -4.224  -2.445  1.00 0.00 ? 21  VAL A H    6  
ATOM 9043  H HA   . VAL A 1 21  ? 10.096  -4.318  -0.738  1.00 0.00 ? 21  VAL A HA   6  
ATOM 9044  H HB   . VAL A 1 21  ? 8.292   -3.682  0.985   1.00 0.00 ? 21  VAL A HB   6  
ATOM 9045  H HG11 . VAL A 1 21  ? 8.452   -1.948  -1.497  1.00 0.00 ? 21  VAL A HG11 6  
ATOM 9046  H HG12 . VAL A 1 21  ? 8.246   -1.431  0.194   1.00 0.00 ? 21  VAL A HG12 6  
ATOM 9047  H HG13 . VAL A 1 21  ? 9.792   -2.132  -0.341  1.00 0.00 ? 21  VAL A HG13 6  
ATOM 9048  H HG21 . VAL A 1 21  ? 6.463   -2.999  -1.232  1.00 0.00 ? 21  VAL A HG21 6  
ATOM 9049  H HG22 . VAL A 1 21  ? 6.559   -4.735  -0.850  1.00 0.00 ? 21  VAL A HG22 6  
ATOM 9050  H HG23 . VAL A 1 21  ? 6.111   -3.568  0.417   1.00 0.00 ? 21  VAL A HG23 6  
ATOM 9051  N N    . GLY A 1 22  ? 9.459   -6.031  1.176   1.00 0.00 ? 22  GLY A N    6  
ATOM 9052  C CA   . GLY A 1 22  ? 9.434   -7.250  1.966   1.00 0.00 ? 22  GLY A CA   6  
ATOM 9053  C C    . GLY A 1 22  ? 8.132   -8.022  1.742   1.00 0.00 ? 22  GLY A C    6  
ATOM 9054  O O    . GLY A 1 22  ? 8.037   -8.833  0.822   1.00 0.00 ? 22  GLY A O    6  
ATOM 9055  H H    . GLY A 1 22  ? 9.874   -5.242  1.630   1.00 0.00 ? 22  GLY A H    6  
ATOM 9056  H HA2  . GLY A 1 22  ? 10.284  -7.878  1.699   1.00 0.00 ? 22  GLY A HA2  6  
ATOM 9057  H HA3  . GLY A 1 22  ? 9.538   -7.005  3.023   1.00 0.00 ? 22  GLY A HA3  6  
ATOM 9058  N N    . HIS A 1 23  ? 7.160   -7.742  2.598   1.00 0.00 ? 23  HIS A N    6  
ATOM 9059  C CA   . HIS A 1 23  ? 5.868   -8.400  2.505   1.00 0.00 ? 23  HIS A CA   6  
ATOM 9060  C C    . HIS A 1 23  ? 4.778   -7.470  3.041   1.00 0.00 ? 23  HIS A C    6  
ATOM 9061  O O    . HIS A 1 23  ? 4.960   -6.824  4.072   1.00 0.00 ? 23  HIS A O    6  
ATOM 9062  C CB   . HIS A 1 23  ? 5.895   -9.754  3.217   1.00 0.00 ? 23  HIS A CB   6  
ATOM 9063  C CG   . HIS A 1 23  ? 5.485   -9.692  4.669   1.00 0.00 ? 23  HIS A CG   6  
ATOM 9064  N ND1  . HIS A 1 23  ? 4.240   -10.100 5.115   1.00 0.00 ? 23  HIS A ND1  6  
ATOM 9065  C CD2  . HIS A 1 23  ? 6.169   -9.268  5.771   1.00 0.00 ? 23  HIS A CD2  6  
ATOM 9066  C CE1  . HIS A 1 23  ? 4.187   -9.924  6.427   1.00 0.00 ? 23  HIS A CE1  6  
ATOM 9067  N NE2  . HIS A 1 23  ? 5.383   -9.407  6.831   1.00 0.00 ? 23  HIS A NE2  6  
ATOM 9068  H H    . HIS A 1 23  ? 7.245   -7.081  3.344   1.00 0.00 ? 23  HIS A H    6  
ATOM 9069  H HA   . HIS A 1 23  ? 5.687   -8.585  1.446   1.00 0.00 ? 23  HIS A HA   6  
ATOM 9070  H HB2  . HIS A 1 23  ? 5.232   -10.442 2.692   1.00 0.00 ? 23  HIS A HB2  6  
ATOM 9071  H HB3  . HIS A 1 23  ? 6.901   -10.168 3.151   1.00 0.00 ? 23  HIS A HB3  6  
ATOM 9072  H HD1  . HIS A 1 23  ? 3.505   -10.466 4.544   1.00 0.00 ? 23  HIS A HD1  6  
ATOM 9073  H HD2  . HIS A 1 23  ? 7.187   -8.879  5.778   1.00 0.00 ? 23  HIS A HD2  6  
ATOM 9074  H HE1  . HIS A 1 23  ? 3.337   -10.151 7.070   1.00 0.00 ? 23  HIS A HE1  6  
ATOM 9075  N N    . LEU A 1 24  ? 3.670   -7.430  2.317   1.00 0.00 ? 24  LEU A N    6  
ATOM 9076  C CA   . LEU A 1 24  ? 2.551   -6.589  2.707   1.00 0.00 ? 24  LEU A CA   6  
ATOM 9077  C C    . LEU A 1 24  ? 1.969   -7.102  4.026   1.00 0.00 ? 24  LEU A C    6  
ATOM 9078  O O    . LEU A 1 24  ? 1.860   -8.309  4.233   1.00 0.00 ? 24  LEU A O    6  
ATOM 9079  C CB   . LEU A 1 24  ? 1.525   -6.503  1.575   1.00 0.00 ? 24  LEU A CB   6  
ATOM 9080  C CG   . LEU A 1 24  ? 1.576   -5.236  0.719   1.00 0.00 ? 24  LEU A CG   6  
ATOM 9081  C CD1  . LEU A 1 24  ? 0.843   -4.081  1.404   1.00 0.00 ? 24  LEU A CD1  6  
ATOM 9082  C CD2  . LEU A 1 24  ? 3.020   -4.869  0.367   1.00 0.00 ? 24  LEU A CD2  6  
ATOM 9083  H H    . LEU A 1 24  ? 3.530   -7.958  1.479   1.00 0.00 ? 24  LEU A H    6  
ATOM 9084  H HA   . LEU A 1 24  ? 2.938   -5.583  2.868   1.00 0.00 ? 24  LEU A HA   6  
ATOM 9085  H HB2  . LEU A 1 24  ? 1.661   -7.365  0.921   1.00 0.00 ? 24  LEU A HB2  6  
ATOM 9086  H HB3  . LEU A 1 24  ? 0.528   -6.585  2.007   1.00 0.00 ? 24  LEU A HB3  6  
ATOM 9087  H HG   . LEU A 1 24  ? 1.058   -5.435  -0.219  1.00 0.00 ? 24  LEU A HG   6  
ATOM 9088  H HD11 . LEU A 1 24  ? 0.768   -4.282  2.473   1.00 0.00 ? 24  LEU A HD11 6  
ATOM 9089  H HD12 . LEU A 1 24  ? 1.395   -3.155  1.246   1.00 0.00 ? 24  LEU A HD12 6  
ATOM 9090  H HD13 . LEU A 1 24  ? -0.158  -3.985  0.982   1.00 0.00 ? 24  LEU A HD13 6  
ATOM 9091  H HD21 . LEU A 1 24  ? 3.643   -5.762  0.413   1.00 0.00 ? 24  LEU A HD21 6  
ATOM 9092  H HD22 . LEU A 1 24  ? 3.054   -4.453  -0.640  1.00 0.00 ? 24  LEU A HD22 6  
ATOM 9093  H HD23 . LEU A 1 24  ? 3.390   -4.131  1.078   1.00 0.00 ? 24  LEU A HD23 6  
ATOM 9094  N N    . SER A 1 25  ? 1.610   -6.158  4.884   1.00 0.00 ? 25  SER A N    6  
ATOM 9095  C CA   . SER A 1 25  ? 1.042   -6.499  6.177   1.00 0.00 ? 25  SER A CA   6  
ATOM 9096  C C    . SER A 1 25  ? -0.054  -5.497  6.547   1.00 0.00 ? 25  SER A C    6  
ATOM 9097  O O    . SER A 1 25  ? 0.038   -4.318  6.209   1.00 0.00 ? 25  SER A O    6  
ATOM 9098  C CB   . SER A 1 25  ? 2.121   -6.531  7.261   1.00 0.00 ? 25  SER A CB   6  
ATOM 9099  O OG   . SER A 1 25  ? 1.666   -7.176  8.448   1.00 0.00 ? 25  SER A OG   6  
ATOM 9100  H H    . SER A 1 25  ? 1.702   -5.178  4.708   1.00 0.00 ? 25  SER A H    6  
ATOM 9101  H HA   . SER A 1 25  ? 0.622   -7.497  6.053   1.00 0.00 ? 25  SER A HA   6  
ATOM 9102  H HB2  . SER A 1 25  ? 3.001   -7.049  6.881   1.00 0.00 ? 25  SER A HB2  6  
ATOM 9103  H HB3  . SER A 1 25  ? 2.428   -5.512  7.498   1.00 0.00 ? 25  SER A HB3  6  
ATOM 9104  H HG   . SER A 1 25  ? 1.121   -7.981  8.212   1.00 0.00 ? 25  SER A HG   6  
ATOM 9105  N N    . PHE A 1 26  ? -1.065  -6.004  7.238   1.00 0.00 ? 26  PHE A N    6  
ATOM 9106  C CA   . PHE A 1 26  ? -2.177  -5.168  7.658   1.00 0.00 ? 26  PHE A CA   6  
ATOM 9107  C C    . PHE A 1 26  ? -2.554  -5.448  9.114   1.00 0.00 ? 26  PHE A C    6  
ATOM 9108  O O    . PHE A 1 26  ? -2.672  -6.604  9.517   1.00 0.00 ? 26  PHE A O    6  
ATOM 9109  C CB   . PHE A 1 26  ? -3.365  -5.519  6.760   1.00 0.00 ? 26  PHE A CB   6  
ATOM 9110  C CG   . PHE A 1 26  ? -3.070  -5.399  5.263   1.00 0.00 ? 26  PHE A CG   6  
ATOM 9111  C CD1  . PHE A 1 26  ? -2.354  -4.342  4.794   1.00 0.00 ? 26  PHE A CD1  6  
ATOM 9112  C CD2  . PHE A 1 26  ? -3.524  -6.349  4.402   1.00 0.00 ? 26  PHE A CD2  6  
ATOM 9113  C CE1  . PHE A 1 26  ? -2.081  -4.231  3.405   1.00 0.00 ? 26  PHE A CE1  6  
ATOM 9114  C CE2  . PHE A 1 26  ? -3.251  -6.238  3.013   1.00 0.00 ? 26  PHE A CE2  6  
ATOM 9115  C CZ   . PHE A 1 26  ? -2.535  -5.181  2.544   1.00 0.00 ? 26  PHE A CZ   6  
ATOM 9116  H H    . PHE A 1 26  ? -1.132  -6.964  7.509   1.00 0.00 ? 26  PHE A H    6  
ATOM 9117  H HA   . PHE A 1 26  ? -1.857  -4.131  7.560   1.00 0.00 ? 26  PHE A HA   6  
ATOM 9118  H HB2  . PHE A 1 26  ? -3.682  -6.539  6.976   1.00 0.00 ? 26  PHE A HB2  6  
ATOM 9119  H HB3  . PHE A 1 26  ? -4.201  -4.866  7.008   1.00 0.00 ? 26  PHE A HB3  6  
ATOM 9120  H HD1  . PHE A 1 26  ? -1.991  -3.581  5.483   1.00 0.00 ? 26  PHE A HD1  6  
ATOM 9121  H HD2  . PHE A 1 26  ? -4.098  -7.196  4.779   1.00 0.00 ? 26  PHE A HD2  6  
ATOM 9122  H HE1  . PHE A 1 26  ? -1.507  -3.384  3.028   1.00 0.00 ? 26  PHE A HE1  6  
ATOM 9123  H HE2  . PHE A 1 26  ? -3.614  -7.000  2.324   1.00 0.00 ? 26  PHE A HE2  6  
ATOM 9124  H HZ   . PHE A 1 26  ? -2.325  -5.096  1.478   1.00 0.00 ? 26  PHE A HZ   6  
ATOM 9125  N N    . SER A 1 27  ? -2.732  -4.370  9.864   1.00 0.00 ? 27  SER A N    6  
ATOM 9126  C CA   . SER A 1 27  ? -3.092  -4.486  11.267  1.00 0.00 ? 27  SER A CA   6  
ATOM 9127  C C    . SER A 1 27  ? -4.147  -3.437  11.624  1.00 0.00 ? 27  SER A C    6  
ATOM 9128  O O    . SER A 1 27  ? -4.442  -2.550  10.823  1.00 0.00 ? 27  SER A O    6  
ATOM 9129  C CB   . SER A 1 27  ? -1.864  -4.331  12.166  1.00 0.00 ? 27  SER A CB   6  
ATOM 9130  O OG   . SER A 1 27  ? -1.015  -5.474  12.112  1.00 0.00 ? 27  SER A OG   6  
ATOM 9131  H H    . SER A 1 27  ? -2.633  -3.434  9.528   1.00 0.00 ? 27  SER A H    6  
ATOM 9132  H HA   . SER A 1 27  ? -3.499  -5.491  11.378  1.00 0.00 ? 27  SER A HA   6  
ATOM 9133  H HB2  . SER A 1 27  ? -1.302  -3.447  11.862  1.00 0.00 ? 27  SER A HB2  6  
ATOM 9134  H HB3  . SER A 1 27  ? -2.186  -4.166  13.194  1.00 0.00 ? 27  SER A HB3  6  
ATOM 9135  H HG   . SER A 1 27  ? -1.263  -6.118  12.835  1.00 0.00 ? 27  SER A HG   6  
ATOM 9136  N N    . GLU A 1 28  ? -4.687  -3.572  12.826  1.00 0.00 ? 28  GLU A N    6  
ATOM 9137  C CA   . GLU A 1 28  ? -5.703  -2.647  13.299  1.00 0.00 ? 28  GLU A CA   6  
ATOM 9138  C C    . GLU A 1 28  ? -6.677  -2.306  12.169  1.00 0.00 ? 28  GLU A C    6  
ATOM 9139  O O    . GLU A 1 28  ? -6.882  -1.135  11.853  1.00 0.00 ? 28  GLU A O    6  
ATOM 9140  C CB   . GLU A 1 28  ? -5.066  -1.380  13.874  1.00 0.00 ? 28  GLU A CB   6  
ATOM 9141  C CG   . GLU A 1 28  ? -4.260  -1.696  15.135  1.00 0.00 ? 28  GLU A CG   6  
ATOM 9142  C CD   . GLU A 1 28  ? -4.898  -1.053  16.369  1.00 0.00 ? 28  GLU A CD   6  
ATOM 9143  O OE1  . GLU A 1 28  ? -6.142  -1.123  16.466  1.00 0.00 ? 28  GLU A OE1  6  
ATOM 9144  O OE2  . GLU A 1 28  ? -4.126  -0.506  17.186  1.00 0.00 ? 28  GLU A OE2  6  
ATOM 9145  H H    . GLU A 1 28  ? -4.442  -4.296  13.471  1.00 0.00 ? 28  GLU A H    6  
ATOM 9146  H HA   . GLU A 1 28  ? -6.228  -3.175  14.094  1.00 0.00 ? 28  GLU A HA   6  
ATOM 9147  H HB2  . GLU A 1 28  ? -4.415  -0.924  13.127  1.00 0.00 ? 28  GLU A HB2  6  
ATOM 9148  H HB3  . GLU A 1 28  ? -5.842  -0.652  14.107  1.00 0.00 ? 28  GLU A HB3  6  
ATOM 9149  H HG2  . GLU A 1 28  ? -4.201  -2.776  15.273  1.00 0.00 ? 28  GLU A HG2  6  
ATOM 9150  H HG3  . GLU A 1 28  ? -3.239  -1.334  15.019  1.00 0.00 ? 28  GLU A HG3  6  
ATOM 9151  N N    . ILE A 1 29  ? -7.253  -3.351  11.592  1.00 0.00 ? 29  ILE A N    6  
ATOM 9152  C CA   . ILE A 1 29  ? -8.201  -3.177  10.505  1.00 0.00 ? 29  ILE A CA   6  
ATOM 9153  C C    . ILE A 1 29  ? -9.577  -2.842  11.083  1.00 0.00 ? 29  ILE A C    6  
ATOM 9154  O O    . ILE A 1 29  ? -9.917  -3.281  12.180  1.00 0.00 ? 29  ILE A O    6  
ATOM 9155  C CB   . ILE A 1 29  ? -8.200  -4.404  9.592   1.00 0.00 ? 29  ILE A CB   6  
ATOM 9156  C CG1  . ILE A 1 29  ? -6.771  -4.842  9.263   1.00 0.00 ? 29  ILE A CG1  6  
ATOM 9157  C CG2  . ILE A 1 29  ? -9.025  -4.149  8.329   1.00 0.00 ? 29  ILE A CG2  6  
ATOM 9158  C CD1  . ILE A 1 29  ? -6.702  -5.498  7.883   1.00 0.00 ? 29  ILE A CD1  6  
ATOM 9159  H H    . ILE A 1 29  ? -7.081  -4.300  11.855  1.00 0.00 ? 29  ILE A H    6  
ATOM 9160  H HA   . ILE A 1 29  ? -7.861  -2.330  9.908   1.00 0.00 ? 29  ILE A HA   6  
ATOM 9161  H HB   . ILE A 1 29  ? -8.674  -5.228  10.125  1.00 0.00 ? 29  ILE A HB   6  
ATOM 9162  H HG12 . ILE A 1 29  ? -6.106  -3.979  9.293   1.00 0.00 ? 29  ILE A HG12 6  
ATOM 9163  H HG13 . ILE A 1 29  ? -6.418  -5.542  10.021  1.00 0.00 ? 29  ILE A HG13 6  
ATOM 9164  H HG21 . ILE A 1 29  ? -9.416  -5.095  7.953   1.00 0.00 ? 29  ILE A HG21 6  
ATOM 9165  H HG22 . ILE A 1 29  ? -9.854  -3.482  8.565   1.00 0.00 ? 29  ILE A HG22 6  
ATOM 9166  H HG23 . ILE A 1 29  ? -8.394  -3.689  7.569   1.00 0.00 ? 29  ILE A HG23 6  
ATOM 9167  H HD11 . ILE A 1 29  ? -6.689  -4.726  7.114   1.00 0.00 ? 29  ILE A HD11 6  
ATOM 9168  H HD12 . ILE A 1 29  ? -5.795  -6.098  7.811   1.00 0.00 ? 29  ILE A HD12 6  
ATOM 9169  H HD13 . ILE A 1 29  ? -7.573  -6.138  7.741   1.00 0.00 ? 29  ILE A HD13 6  
ATOM 9170  N N    . LEU A 1 30  ? -10.332 -2.066  10.318  1.00 0.00 ? 30  LEU A N    6  
ATOM 9171  C CA   . LEU A 1 30  ? -11.664 -1.667  10.741  1.00 0.00 ? 30  LEU A CA   6  
ATOM 9172  C C    . LEU A 1 30  ? -12.666 -1.999  9.633   1.00 0.00 ? 30  LEU A C    6  
ATOM 9173  O O    . LEU A 1 30  ? -12.601 -3.071  9.033   1.00 0.00 ? 30  LEU A O    6  
ATOM 9174  C CB   . LEU A 1 30  ? -11.674 -0.195  11.159  1.00 0.00 ? 30  LEU A CB   6  
ATOM 9175  C CG   . LEU A 1 30  ? -10.598 0.225   12.161  1.00 0.00 ? 30  LEU A CG   6  
ATOM 9176  C CD1  . LEU A 1 30  ? -10.295 1.720   12.046  1.00 0.00 ? 30  LEU A CD1  6  
ATOM 9177  C CD2  . LEU A 1 30  ? -10.989 -0.172  13.586  1.00 0.00 ? 30  LEU A CD2  6  
ATOM 9178  H H    . LEU A 1 30  ? -10.048 -1.713  9.427   1.00 0.00 ? 30  LEU A H    6  
ATOM 9179  H HA   . LEU A 1 30  ? -11.916 -2.255  11.623  1.00 0.00 ? 30  LEU A HA   6  
ATOM 9180  H HB2  . LEU A 1 30  ? -11.568 0.417   10.263  1.00 0.00 ? 30  LEU A HB2  6  
ATOM 9181  H HB3  . LEU A 1 30  ? -12.650 0.033   11.587  1.00 0.00 ? 30  LEU A HB3  6  
ATOM 9182  H HG   . LEU A 1 30  ? -9.679  -0.309  11.919  1.00 0.00 ? 30  LEU A HG   6  
ATOM 9183  H HD11 . LEU A 1 30  ? -9.632  1.893   11.198  1.00 0.00 ? 30  LEU A HD11 6  
ATOM 9184  H HD12 . LEU A 1 30  ? -11.225 2.269   11.898  1.00 0.00 ? 30  LEU A HD12 6  
ATOM 9185  H HD13 . LEU A 1 30  ? -9.812  2.065   12.960  1.00 0.00 ? 30  LEU A HD13 6  
ATOM 9186  H HD21 . LEU A 1 30  ? -10.449 -1.074  13.873  1.00 0.00 ? 30  LEU A HD21 6  
ATOM 9187  H HD22 . LEU A 1 30  ? -10.737 0.637   14.271  1.00 0.00 ? 30  LEU A HD22 6  
ATOM 9188  H HD23 . LEU A 1 30  ? -12.062 -0.363  13.628  1.00 0.00 ? 30  LEU A HD23 6  
ATOM 9189  N N    . ASP A 1 31  ? -13.570 -1.060  9.396   1.00 0.00 ? 31  ASP A N    6  
ATOM 9190  C CA   . ASP A 1 31  ? -14.585 -1.239  8.372   1.00 0.00 ? 31  ASP A CA   6  
ATOM 9191  C C    . ASP A 1 31  ? -14.248 -0.358  7.167   1.00 0.00 ? 31  ASP A C    6  
ATOM 9192  O O    . ASP A 1 31  ? -14.673 -0.642  6.048   1.00 0.00 ? 31  ASP A O    6  
ATOM 9193  C CB   . ASP A 1 31  ? -15.966 -0.829  8.887   1.00 0.00 ? 31  ASP A CB   6  
ATOM 9194  C CG   . ASP A 1 31  ? -16.086 0.633   9.321   1.00 0.00 ? 31  ASP A CG   6  
ATOM 9195  O OD1  . ASP A 1 31  ? -15.149 1.102   10.003  1.00 0.00 ? 31  ASP A OD1  6  
ATOM 9196  O OD2  . ASP A 1 31  ? -17.112 1.250   8.961   1.00 0.00 ? 31  ASP A OD2  6  
ATOM 9197  H H    . ASP A 1 31  ? -13.616 -0.191  9.889   1.00 0.00 ? 31  ASP A H    6  
ATOM 9198  H HA   . ASP A 1 31  ? -14.563 -2.302  8.130   1.00 0.00 ? 31  ASP A HA   6  
ATOM 9199  H HB2  . ASP A 1 31  ? -16.700 -1.021  8.105   1.00 0.00 ? 31  ASP A HB2  6  
ATOM 9200  H HB3  . ASP A 1 31  ? -16.226 -1.466  9.732   1.00 0.00 ? 31  ASP A HB3  6  
ATOM 9201  N N    . THR A 1 32  ? -13.488 0.693   7.437   1.00 0.00 ? 32  THR A N    6  
ATOM 9202  C CA   . THR A 1 32  ? -13.090 1.617   6.389   1.00 0.00 ? 32  THR A CA   6  
ATOM 9203  C C    . THR A 1 32  ? -11.752 2.273   6.736   1.00 0.00 ? 32  THR A C    6  
ATOM 9204  O O    . THR A 1 32  ? -11.463 3.380   6.284   1.00 0.00 ? 32  THR A O    6  
ATOM 9205  C CB   . THR A 1 32  ? -14.225 2.622   6.188   1.00 0.00 ? 32  THR A CB   6  
ATOM 9206  O OG1  . THR A 1 32  ? -14.265 3.350   7.413   1.00 0.00 ? 32  THR A OG1  6  
ATOM 9207  C CG2  . THR A 1 32  ? -15.597 1.949   6.111   1.00 0.00 ? 32  THR A CG2  6  
ATOM 9208  H H    . THR A 1 32  ? -13.146 0.916   8.350   1.00 0.00 ? 32  THR A H    6  
ATOM 9209  H HA   . THR A 1 32  ? -12.939 1.050   5.470   1.00 0.00 ? 32  THR A HA   6  
ATOM 9210  H HB   . THR A 1 32  ? -14.046 3.242   5.310   1.00 0.00 ? 32  THR A HB   6  
ATOM 9211  H HG1  . THR A 1 32  ? -14.573 2.755   8.155   1.00 0.00 ? 32  THR A HG1  6  
ATOM 9212  H HG21 . THR A 1 32  ? -16.360 2.701   5.912   1.00 0.00 ? 32  THR A HG21 6  
ATOM 9213  H HG22 . THR A 1 32  ? -15.595 1.212   5.308   1.00 0.00 ? 32  THR A HG22 6  
ATOM 9214  H HG23 . THR A 1 32  ? -15.812 1.454   7.058   1.00 0.00 ? 32  THR A HG23 6  
ATOM 9215  N N    . SER A 1 33  ? -10.971 1.562   7.537   1.00 0.00 ? 33  SER A N    6  
ATOM 9216  C CA   . SER A 1 33  ? -9.671  2.062   7.950   1.00 0.00 ? 33  SER A CA   6  
ATOM 9217  C C    . SER A 1 33  ? -8.792  0.903   8.426   1.00 0.00 ? 33  SER A C    6  
ATOM 9218  O O    . SER A 1 33  ? -9.208  0.109   9.268   1.00 0.00 ? 33  SER A O    6  
ATOM 9219  C CB   . SER A 1 33  ? -9.809  3.110   9.056   1.00 0.00 ? 33  SER A CB   6  
ATOM 9220  O OG   . SER A 1 33  ? -10.996 2.925   9.822   1.00 0.00 ? 33  SER A OG   6  
ATOM 9221  H H    . SER A 1 33  ? -11.214 0.663   7.901   1.00 0.00 ? 33  SER A H    6  
ATOM 9222  H HA   . SER A 1 33  ? -9.244  2.526   7.062   1.00 0.00 ? 33  SER A HA   6  
ATOM 9223  H HB2  . SER A 1 33  ? -8.942  3.060   9.714   1.00 0.00 ? 33  SER A HB2  6  
ATOM 9224  H HB3  . SER A 1 33  ? -9.816  4.106   8.612   1.00 0.00 ? 33  SER A HB3  6  
ATOM 9225  H HG   . SER A 1 33  ? -11.703 2.496   9.259   1.00 0.00 ? 33  SER A HG   6  
ATOM 9226  N N    . LEU A 1 34  ? -7.593  0.842   7.864   1.00 0.00 ? 34  LEU A N    6  
ATOM 9227  C CA   . LEU A 1 34  ? -6.653  -0.207  8.220   1.00 0.00 ? 34  LEU A CA   6  
ATOM 9228  C C    . LEU A 1 34  ? -5.225  0.316   8.050   1.00 0.00 ? 34  LEU A C    6  
ATOM 9229  O O    . LEU A 1 34  ? -4.976  1.194   7.226   1.00 0.00 ? 34  LEU A O    6  
ATOM 9230  C CB   . LEU A 1 34  ? -6.941  -1.479  7.421   1.00 0.00 ? 34  LEU A CB   6  
ATOM 9231  C CG   . LEU A 1 34  ? -6.673  -1.401  5.916   1.00 0.00 ? 34  LEU A CG   6  
ATOM 9232  C CD1  . LEU A 1 34  ? -5.171  -1.387  5.627   1.00 0.00 ? 34  LEU A CD1  6  
ATOM 9233  C CD2  . LEU A 1 34  ? -7.389  -2.531  5.173   1.00 0.00 ? 34  LEU A CD2  6  
ATOM 9234  H H    . LEU A 1 34  ? -7.263  1.491   7.179   1.00 0.00 ? 34  LEU A H    6  
ATOM 9235  H HA   . LEU A 1 34  ? -6.811  -0.444  9.272   1.00 0.00 ? 34  LEU A HA   6  
ATOM 9236  H HB2  . LEU A 1 34  ? -6.341  -2.289  7.835   1.00 0.00 ? 34  LEU A HB2  6  
ATOM 9237  H HB3  . LEU A 1 34  ? -7.987  -1.749  7.570   1.00 0.00 ? 34  LEU A HB3  6  
ATOM 9238  H HG   . LEU A 1 34  ? -7.081  -0.462  5.545   1.00 0.00 ? 34  LEU A HG   6  
ATOM 9239  H HD11 . LEU A 1 34  ? -4.626  -1.692  6.521   1.00 0.00 ? 34  LEU A HD11 6  
ATOM 9240  H HD12 . LEU A 1 34  ? -4.950  -2.078  4.813   1.00 0.00 ? 34  LEU A HD12 6  
ATOM 9241  H HD13 . LEU A 1 34  ? -4.865  -0.380  5.342   1.00 0.00 ? 34  LEU A HD13 6  
ATOM 9242  H HD21 . LEU A 1 34  ? -6.701  -3.364  5.028   1.00 0.00 ? 34  LEU A HD21 6  
ATOM 9243  H HD22 . LEU A 1 34  ? -8.246  -2.864  5.757   1.00 0.00 ? 34  LEU A HD22 6  
ATOM 9244  H HD23 . LEU A 1 34  ? -7.729  -2.168  4.203   1.00 0.00 ? 34  LEU A HD23 6  
ATOM 9245  N N    . LYS A 1 35  ? -4.325  -0.247  8.843   1.00 0.00 ? 35  LYS A N    6  
ATOM 9246  C CA   . LYS A 1 35  ? -2.928  0.151   8.791   1.00 0.00 ? 35  LYS A CA   6  
ATOM 9247  C C    . LYS A 1 35  ? -2.169  -0.788  7.851   1.00 0.00 ? 35  LYS A C    6  
ATOM 9248  O O    . LYS A 1 35  ? -2.373  -2.000  7.881   1.00 0.00 ? 35  LYS A O    6  
ATOM 9249  C CB   . LYS A 1 35  ? -2.337  0.220   10.200  1.00 0.00 ? 35  LYS A CB   6  
ATOM 9250  C CG   . LYS A 1 35  ? -1.096  1.113   10.232  1.00 0.00 ? 35  LYS A CG   6  
ATOM 9251  C CD   . LYS A 1 35  ? 0.160   0.320   9.863   1.00 0.00 ? 35  LYS A CD   6  
ATOM 9252  C CE   . LYS A 1 35  ? 0.815   -0.279  11.109  1.00 0.00 ? 35  LYS A CE   6  
ATOM 9253  N NZ   . LYS A 1 35  ? 0.878   -1.754  11.003  1.00 0.00 ? 35  LYS A NZ   6  
ATOM 9254  H H    . LYS A 1 35  ? -4.536  -0.961  9.510   1.00 0.00 ? 35  LYS A H    6  
ATOM 9255  H HA   . LYS A 1 35  ? -2.891  1.159   8.376   1.00 0.00 ? 35  LYS A HA   6  
ATOM 9256  H HB2  . LYS A 1 35  ? -3.085  0.605   10.894  1.00 0.00 ? 35  LYS A HB2  6  
ATOM 9257  H HB3  . LYS A 1 35  ? -2.077  -0.783  10.538  1.00 0.00 ? 35  LYS A HB3  6  
ATOM 9258  H HG2  . LYS A 1 35  ? -1.223  1.943   9.537   1.00 0.00 ? 35  LYS A HG2  6  
ATOM 9259  H HG3  . LYS A 1 35  ? -0.979  1.545   11.226  1.00 0.00 ? 35  LYS A HG3  6  
ATOM 9260  H HD2  . LYS A 1 35  ? -0.100  -0.476  9.166   1.00 0.00 ? 35  LYS A HD2  6  
ATOM 9261  H HD3  . LYS A 1 35  ? 0.869   0.972   9.352   1.00 0.00 ? 35  LYS A HD3  6  
ATOM 9262  H HE2  . LYS A 1 35  ? 1.820   0.126   11.229  1.00 0.00 ? 35  LYS A HE2  6  
ATOM 9263  H HE3  . LYS A 1 35  ? 0.249   0.004   11.996  1.00 0.00 ? 35  LYS A HE3  6  
ATOM 9264  H HZ1  . LYS A 1 35  ? 1.254   -2.009  10.112  1.00 0.00 ? 35  LYS A HZ1  6  
ATOM 9265  H HZ2  . LYS A 1 35  ? 1.464   -2.116  11.728  1.00 0.00 ? 35  LYS A HZ2  6  
ATOM 9266  H HZ3  . LYS A 1 35  ? -0.042  -2.134  11.097  1.00 0.00 ? 35  LYS A HZ3  6  
ATOM 9267  N N    . VAL A 1 36  ? -1.310  -0.191  7.037   1.00 0.00 ? 36  VAL A N    6  
ATOM 9268  C CA   . VAL A 1 36  ? -0.520  -0.960  6.090   1.00 0.00 ? 36  VAL A CA   6  
ATOM 9269  C C    . VAL A 1 36  ? 0.952   -0.914  6.505   1.00 0.00 ? 36  VAL A C    6  
ATOM 9270  O O    . VAL A 1 36  ? 1.452   0.132   6.918   1.00 0.00 ? 36  VAL A O    6  
ATOM 9271  C CB   . VAL A 1 36  ? -0.757  -0.442  4.670   1.00 0.00 ? 36  VAL A CB   6  
ATOM 9272  C CG1  . VAL A 1 36  ? 0.239   -1.061  3.688   1.00 0.00 ? 36  VAL A CG1  6  
ATOM 9273  C CG2  . VAL A 1 36  ? -2.198  -0.701  4.226   1.00 0.00 ? 36  VAL A CG2  6  
ATOM 9274  H H    . VAL A 1 36  ? -1.150  0.795   7.019   1.00 0.00 ? 36  VAL A H    6  
ATOM 9275  H HA   . VAL A 1 36  ? -0.865  -1.992  6.135   1.00 0.00 ? 36  VAL A HA   6  
ATOM 9276  H HB   . VAL A 1 36  ? -0.597  0.636   4.675   1.00 0.00 ? 36  VAL A HB   6  
ATOM 9277  H HG11 . VAL A 1 36  ? 1.234   -1.065  4.133   1.00 0.00 ? 36  VAL A HG11 6  
ATOM 9278  H HG12 . VAL A 1 36  ? -0.062  -2.084  3.461   1.00 0.00 ? 36  VAL A HG12 6  
ATOM 9279  H HG13 . VAL A 1 36  ? 0.255   -0.475  2.769   1.00 0.00 ? 36  VAL A HG13 6  
ATOM 9280  H HG21 . VAL A 1 36  ? -2.534  0.116   3.587   1.00 0.00 ? 36  VAL A HG21 6  
ATOM 9281  H HG22 . VAL A 1 36  ? -2.244  -1.638  3.671   1.00 0.00 ? 36  VAL A HG22 6  
ATOM 9282  H HG23 . VAL A 1 36  ? -2.843  -0.765  5.102   1.00 0.00 ? 36  VAL A HG23 6  
ATOM 9283  N N    . SER A 1 37  ? 1.605   -2.060  6.381   1.00 0.00 ? 37  SER A N    6  
ATOM 9284  C CA   . SER A 1 37  ? 3.009   -2.164  6.738   1.00 0.00 ? 37  SER A CA   6  
ATOM 9285  C C    . SER A 1 37  ? 3.738   -3.066  5.740   1.00 0.00 ? 37  SER A C    6  
ATOM 9286  O O    . SER A 1 37  ? 3.127   -3.944  5.131   1.00 0.00 ? 37  SER A O    6  
ATOM 9287  C CB   . SER A 1 37  ? 3.178   -2.701  8.161   1.00 0.00 ? 37  SER A CB   6  
ATOM 9288  O OG   . SER A 1 37  ? 2.036   -3.436  8.592   1.00 0.00 ? 37  SER A OG   6  
ATOM 9289  H H    . SER A 1 37  ? 1.191   -2.905  6.044   1.00 0.00 ? 37  SER A H    6  
ATOM 9290  H HA   . SER A 1 37  ? 3.396   -1.146  6.686   1.00 0.00 ? 37  SER A HA   6  
ATOM 9291  H HB2  . SER A 1 37  ? 4.059   -3.341  8.205   1.00 0.00 ? 37  SER A HB2  6  
ATOM 9292  H HB3  . SER A 1 37  ? 3.353   -1.870  8.844   1.00 0.00 ? 37  SER A HB3  6  
ATOM 9293  H HG   . SER A 1 37  ? 2.199   -3.818  9.502   1.00 0.00 ? 37  SER A HG   6  
ATOM 9294  N N    . TRP A 1 38  ? 5.032   -2.820  5.604   1.00 0.00 ? 38  TRP A N    6  
ATOM 9295  C CA   . TRP A 1 38  ? 5.850   -3.600  4.690   1.00 0.00 ? 38  TRP A CA   6  
ATOM 9296  C C    . TRP A 1 38  ? 7.295   -3.553  5.192   1.00 0.00 ? 38  TRP A C    6  
ATOM 9297  O O    . TRP A 1 38  ? 7.551   -3.130  6.318   1.00 0.00 ? 38  TRP A O    6  
ATOM 9298  C CB   . TRP A 1 38  ? 5.700   -3.096  3.253   1.00 0.00 ? 38  TRP A CB   6  
ATOM 9299  C CG   . TRP A 1 38  ? 5.999   -1.605  3.082   1.00 0.00 ? 38  TRP A CG   6  
ATOM 9300  C CD1  . TRP A 1 38  ? 7.175   -1.026  2.806   1.00 0.00 ? 38  TRP A CD1  6  
ATOM 9301  C CD2  . TRP A 1 38  ? 5.052   -0.521  3.188   1.00 0.00 ? 38  TRP A CD2  6  
ATOM 9302  N NE1  . TRP A 1 38  ? 7.057   0.347   2.726   1.00 0.00 ? 38  TRP A NE1  6  
ATOM 9303  C CE2  . TRP A 1 38  ? 5.725   0.664   2.966   1.00 0.00 ? 38  TRP A CE2  6  
ATOM 9304  C CE3  . TRP A 1 38  ? 3.674   -0.540  3.463   1.00 0.00 ? 38  TRP A CE3  6  
ATOM 9305  C CZ2  . TRP A 1 38  ? 5.101   1.917   2.995   1.00 0.00 ? 38  TRP A CZ2  6  
ATOM 9306  C CZ3  . TRP A 1 38  ? 3.065   0.720   3.489   1.00 0.00 ? 38  TRP A CZ3  6  
ATOM 9307  C CH2  . TRP A 1 38  ? 3.728   1.922   3.267   1.00 0.00 ? 38  TRP A CH2  6  
ATOM 9308  H H    . TRP A 1 38  ? 5.521   -2.105  6.103   1.00 0.00 ? 38  TRP A H    6  
ATOM 9309  H HA   . TRP A 1 38  ? 5.483   -4.626  4.707   1.00 0.00 ? 38  TRP A HA   6  
ATOM 9310  H HB2  . TRP A 1 38  ? 6.368   -3.666  2.608   1.00 0.00 ? 38  TRP A HB2  6  
ATOM 9311  H HB3  . TRP A 1 38  ? 4.683   -3.293  2.914   1.00 0.00 ? 38  TRP A HB3  6  
ATOM 9312  H HD1  . TRP A 1 38  ? 8.108   -1.571  2.662   1.00 0.00 ? 38  TRP A HD1  6  
ATOM 9313  H HE1  . TRP A 1 38  ? 7.860   1.052   2.514   1.00 0.00 ? 38  TRP A HE1  6  
ATOM 9314  H HE3  . TRP A 1 38  ? 3.120   -1.462  3.642   1.00 0.00 ? 38  TRP A HE3  6  
ATOM 9315  H HZ2  . TRP A 1 38  ? 5.655   2.838   2.817   1.00 0.00 ? 38  TRP A HZ2  6  
ATOM 9316  H HZ3  . TRP A 1 38  ? 1.996   0.762   3.697   1.00 0.00 ? 38  TRP A HZ3  6  
ATOM 9317  H HH2  . TRP A 1 38  ? 3.181   2.864   3.304   1.00 0.00 ? 38  TRP A HH2  6  
ATOM 9318  N N    . GLN A 1 39  ? 8.201   -3.995  4.332   1.00 0.00 ? 39  GLN A N    6  
ATOM 9319  C CA   . GLN A 1 39  ? 9.613   -4.009  4.674   1.00 0.00 ? 39  GLN A CA   6  
ATOM 9320  C C    . GLN A 1 39  ? 10.455  -3.576  3.472   1.00 0.00 ? 39  GLN A C    6  
ATOM 9321  O O    . GLN A 1 39  ? 9.917   -3.303  2.399   1.00 0.00 ? 39  GLN A O    6  
ATOM 9322  C CB   . GLN A 1 39  ? 10.042  -5.390  5.175   1.00 0.00 ? 39  GLN A CB   6  
ATOM 9323  C CG   . GLN A 1 39  ? 10.130  -5.416  6.702   1.00 0.00 ? 39  GLN A CG   6  
ATOM 9324  C CD   . GLN A 1 39  ? 11.587  -5.386  7.168   1.00 0.00 ? 39  GLN A CD   6  
ATOM 9325  O OE1  . GLN A 1 39  ? 12.112  -4.367  7.586   1.00 0.00 ? 39  GLN A OE1  6  
ATOM 9326  N NE2  . GLN A 1 39  ? 12.209  -6.558  7.073   1.00 0.00 ? 39  GLN A NE2  6  
ATOM 9327  H H    . GLN A 1 39  ? 7.984   -4.338  3.418   1.00 0.00 ? 39  GLN A H    6  
ATOM 9328  H HA   . GLN A 1 39  ? 9.723   -3.286  5.482   1.00 0.00 ? 39  GLN A HA   6  
ATOM 9329  H HB2  . GLN A 1 39  ? 9.329   -6.141  4.835   1.00 0.00 ? 39  GLN A HB2  6  
ATOM 9330  H HB3  . GLN A 1 39  ? 11.009  -5.651  4.747   1.00 0.00 ? 39  GLN A HB3  6  
ATOM 9331  H HG2  . GLN A 1 39  ? 9.595   -4.561  7.115   1.00 0.00 ? 39  GLN A HG2  6  
ATOM 9332  H HG3  . GLN A 1 39  ? 9.641   -6.312  7.083   1.00 0.00 ? 39  GLN A HG3  6  
ATOM 9333  H HE21 . GLN A 1 39  ? 11.721  -7.356  6.721   1.00 0.00 ? 39  GLN A HE21 6  
ATOM 9334  H HE22 . GLN A 1 39  ? 13.166  -6.640  7.353   1.00 0.00 ? 39  GLN A HE22 6  
ATOM 9335  N N    . GLU A 1 40  ? 11.760  -3.527  3.691   1.00 0.00 ? 40  GLU A N    6  
ATOM 9336  C CA   . GLU A 1 40  ? 12.681  -3.132  2.639   1.00 0.00 ? 40  GLU A CA   6  
ATOM 9337  C C    . GLU A 1 40  ? 12.955  -4.311  1.703   1.00 0.00 ? 40  GLU A C    6  
ATOM 9338  O O    . GLU A 1 40  ? 13.152  -5.437  2.158   1.00 0.00 ? 40  GLU A O    6  
ATOM 9339  C CB   . GLU A 1 40  ? 13.983  -2.585  3.227   1.00 0.00 ? 40  GLU A CB   6  
ATOM 9340  C CG   . GLU A 1 40  ? 14.181  -1.116  2.849   1.00 0.00 ? 40  GLU A CG   6  
ATOM 9341  C CD   . GLU A 1 40  ? 15.246  -0.461  3.731   1.00 0.00 ? 40  GLU A CD   6  
ATOM 9342  O OE1  . GLU A 1 40  ? 16.119  -1.212  4.218   1.00 0.00 ? 40  GLU A OE1  6  
ATOM 9343  O OE2  . GLU A 1 40  ? 15.164  0.775   3.898   1.00 0.00 ? 40  GLU A OE2  6  
ATOM 9344  H H    . GLU A 1 40  ? 12.189  -3.751  4.566   1.00 0.00 ? 40  GLU A H    6  
ATOM 9345  H HA   . GLU A 1 40  ? 12.174  -2.337  2.093   1.00 0.00 ? 40  GLU A HA   6  
ATOM 9346  H HB2  . GLU A 1 40  ? 13.967  -2.687  4.312   1.00 0.00 ? 40  GLU A HB2  6  
ATOM 9347  H HB3  . GLU A 1 40  ? 14.826  -3.174  2.864   1.00 0.00 ? 40  GLU A HB3  6  
ATOM 9348  H HG2  . GLU A 1 40  ? 14.474  -1.042  1.802   1.00 0.00 ? 40  GLU A HG2  6  
ATOM 9349  H HG3  . GLU A 1 40  ? 13.237  -0.580  2.955   1.00 0.00 ? 40  GLU A HG3  6  
ATOM 9350  N N    . PRO A 1 41  ? 12.960  -4.005  0.378   1.00 0.00 ? 41  PRO A N    6  
ATOM 9351  C CA   . PRO A 1 41  ? 13.206  -5.026  -0.626  1.00 0.00 ? 41  PRO A CA   6  
ATOM 9352  C C    . PRO A 1 41  ? 14.689  -5.402  -0.673  1.00 0.00 ? 41  PRO A C    6  
ATOM 9353  O O    . PRO A 1 41  ? 15.553  -4.568  -0.406  1.00 0.00 ? 41  PRO A O    6  
ATOM 9354  C CB   . PRO A 1 41  ? 12.705  -4.426  -1.929  1.00 0.00 ? 41  PRO A CB   6  
ATOM 9355  C CG   . PRO A 1 41  ? 12.625  -2.926  -1.694  1.00 0.00 ? 41  PRO A CG   6  
ATOM 9356  C CD   . PRO A 1 41  ? 12.731  -2.683  -0.197  1.00 0.00 ? 41  PRO A CD   6  
ATOM 9357  H HA   . PRO A 1 41  ? 12.718  -5.867  -0.393  1.00 0.00 ? 41  PRO A HA   6  
ATOM 9358  H HB2  . PRO A 1 41  ? 13.381  -4.657  -2.752  1.00 0.00 ? 41  PRO A HB2  6  
ATOM 9359  H HB3  . PRO A 1 41  ? 11.729  -4.832  -2.196  1.00 0.00 ? 41  PRO A HB3  6  
ATOM 9360  H HG2  . PRO A 1 41  ? 13.429  -2.414  -2.222  1.00 0.00 ? 41  PRO A HG2  6  
ATOM 9361  H HG3  . PRO A 1 41  ? 11.686  -2.529  -2.080  1.00 0.00 ? 41  PRO A HG3  6  
ATOM 9362  H HD2  . PRO A 1 41  ? 13.550  -2.002  0.036   1.00 0.00 ? 41  PRO A HD2  6  
ATOM 9363  H HD3  . PRO A 1 41  ? 11.820  -2.232  0.196   1.00 0.00 ? 41  PRO A HD3  6  
ATOM 9364  N N    . GLY A 1 42  ? 14.937  -6.658  -1.014  1.00 0.00 ? 42  GLY A N    6  
ATOM 9365  C CA   . GLY A 1 42  ? 16.300  -7.154  -1.099  1.00 0.00 ? 42  GLY A CA   6  
ATOM 9366  C C    . GLY A 1 42  ? 17.031  -6.547  -2.298  1.00 0.00 ? 42  GLY A C    6  
ATOM 9367  O O    . GLY A 1 42  ? 18.223  -6.784  -2.488  1.00 0.00 ? 42  GLY A O    6  
ATOM 9368  H H    . GLY A 1 42  ? 14.229  -7.329  -1.229  1.00 0.00 ? 42  GLY A H    6  
ATOM 9369  H HA2  . GLY A 1 42  ? 16.837  -6.914  -0.181  1.00 0.00 ? 42  GLY A HA2  6  
ATOM 9370  H HA3  . GLY A 1 42  ? 16.290  -8.241  -1.187  1.00 0.00 ? 42  GLY A HA3  6  
ATOM 9371  N N    . GLU A 1 43  ? 16.286  -5.776  -3.076  1.00 0.00 ? 43  GLU A N    6  
ATOM 9372  C CA   . GLU A 1 43  ? 16.848  -5.132  -4.251  1.00 0.00 ? 43  GLU A CA   6  
ATOM 9373  C C    . GLU A 1 43  ? 17.345  -3.728  -3.901  1.00 0.00 ? 43  GLU A C    6  
ATOM 9374  O O    . GLU A 1 43  ? 18.508  -3.548  -3.543  1.00 0.00 ? 43  GLU A O    6  
ATOM 9375  C CB   . GLU A 1 43  ? 15.829  -5.085  -5.391  1.00 0.00 ? 43  GLU A CB   6  
ATOM 9376  C CG   . GLU A 1 43  ? 15.842  -6.388  -6.193  1.00 0.00 ? 43  GLU A CG   6  
ATOM 9377  C CD   . GLU A 1 43  ? 16.859  -6.320  -7.334  1.00 0.00 ? 43  GLU A CD   6  
ATOM 9378  O OE1  . GLU A 1 43  ? 18.025  -6.690  -7.077  1.00 0.00 ? 43  GLU A OE1  6  
ATOM 9379  O OE2  . GLU A 1 43  ? 16.448  -5.899  -8.436  1.00 0.00 ? 43  GLU A OE2  6  
ATOM 9380  H H    . GLU A 1 43  ? 15.317  -5.588  -2.915  1.00 0.00 ? 43  GLU A H    6  
ATOM 9381  H HA   . GLU A 1 43  ? 17.689  -5.758  -4.550  1.00 0.00 ? 43  GLU A HA   6  
ATOM 9382  H HB2  . GLU A 1 43  ? 14.832  -4.914  -4.985  1.00 0.00 ? 43  GLU A HB2  6  
ATOM 9383  H HB3  . GLU A 1 43  ? 16.053  -4.247  -6.050  1.00 0.00 ? 43  GLU A HB3  6  
ATOM 9384  H HG2  . GLU A 1 43  ? 16.085  -7.222  -5.534  1.00 0.00 ? 43  GLU A HG2  6  
ATOM 9385  H HG3  . GLU A 1 43  ? 14.848  -6.581  -6.597  1.00 0.00 ? 43  GLU A HG3  6  
ATOM 9386  N N    . LYS A 1 44  ? 16.439  -2.768  -4.018  1.00 0.00 ? 44  LYS A N    6  
ATOM 9387  C CA   . LYS A 1 44  ? 16.770  -1.386  -3.719  1.00 0.00 ? 44  LYS A CA   6  
ATOM 9388  C C    . LYS A 1 44  ? 17.305  -0.709  -4.982  1.00 0.00 ? 44  LYS A C    6  
ATOM 9389  O O    . LYS A 1 44  ? 17.048  0.471   -5.215  1.00 0.00 ? 44  LYS A O    6  
ATOM 9390  C CB   . LYS A 1 44  ? 17.728  -1.310  -2.528  1.00 0.00 ? 44  LYS A CB   6  
ATOM 9391  C CG   . LYS A 1 44  ? 17.232  -2.178  -1.370  1.00 0.00 ? 44  LYS A CG   6  
ATOM 9392  C CD   . LYS A 1 44  ? 16.813  -1.315  -0.178  1.00 0.00 ? 44  LYS A CD   6  
ATOM 9393  C CE   . LYS A 1 44  ? 16.868  -2.114  1.125   1.00 0.00 ? 44  LYS A CE   6  
ATOM 9394  N NZ   . LYS A 1 44  ? 18.272  -2.392  1.503   1.00 0.00 ? 44  LYS A NZ   6  
ATOM 9395  H H    . LYS A 1 44  ? 15.495  -2.923  -4.311  1.00 0.00 ? 44  LYS A H    6  
ATOM 9396  H HA   . LYS A 1 44  ? 15.848  -0.886  -3.423  1.00 0.00 ? 44  LYS A HA   6  
ATOM 9397  H HB2  . LYS A 1 44  ? 18.721  -1.639  -2.834  1.00 0.00 ? 44  LYS A HB2  6  
ATOM 9398  H HB3  . LYS A 1 44  ? 17.822  -0.276  -2.198  1.00 0.00 ? 44  LYS A HB3  6  
ATOM 9399  H HG2  . LYS A 1 44  ? 16.388  -2.783  -1.699  1.00 0.00 ? 44  LYS A HG2  6  
ATOM 9400  H HG3  . LYS A 1 44  ? 18.019  -2.868  -1.065  1.00 0.00 ? 44  LYS A HG3  6  
ATOM 9401  H HD2  . LYS A 1 44  ? 17.469  -0.447  -0.105  1.00 0.00 ? 44  LYS A HD2  6  
ATOM 9402  H HD3  . LYS A 1 44  ? 15.802  -0.938  -0.335  1.00 0.00 ? 44  LYS A HD3  6  
ATOM 9403  H HE2  . LYS A 1 44  ? 16.374  -1.558  1.921   1.00 0.00 ? 44  LYS A HE2  6  
ATOM 9404  H HE3  . LYS A 1 44  ? 16.325  -3.052  1.007   1.00 0.00 ? 44  LYS A HE3  6  
ATOM 9405  H HZ1  . LYS A 1 44  ? 18.291  -3.062  2.246   1.00 0.00 ? 44  LYS A HZ1  6  
ATOM 9406  H HZ2  . LYS A 1 44  ? 18.765  -2.756  0.713   1.00 0.00 ? 44  LYS A HZ2  6  
ATOM 9407  H HZ3  . LYS A 1 44  ? 18.709  -1.545  1.807   1.00 0.00 ? 44  LYS A HZ3  6  
ATOM 9408  N N    . ASN A 1 45  ? 18.040  -1.485  -5.765  1.00 0.00 ? 45  ASN A N    6  
ATOM 9409  C CA   . ASN A 1 45  ? 18.613  -0.976  -6.999  1.00 0.00 ? 45  ASN A CA   6  
ATOM 9410  C C    . ASN A 1 45  ? 19.108  0.455   -6.774  1.00 0.00 ? 45  ASN A C    6  
ATOM 9411  O O    . ASN A 1 45  ? 19.106  1.268   -7.696  1.00 0.00 ? 45  ASN A O    6  
ATOM 9412  C CB   . ASN A 1 45  ? 17.572  -0.945  -8.119  1.00 0.00 ? 45  ASN A CB   6  
ATOM 9413  C CG   . ASN A 1 45  ? 17.663  -2.202  -8.987  1.00 0.00 ? 45  ASN A CG   6  
ATOM 9414  O OD1  . ASN A 1 45  ? 18.334  -2.237  -10.005 1.00 0.00 ? 45  ASN A OD1  6  
ATOM 9415  N ND2  . ASN A 1 45  ? 16.951  -3.228  -8.529  1.00 0.00 ? 45  ASN A ND2  6  
ATOM 9416  H H    . ASN A 1 45  ? 18.244  -2.444  -5.569  1.00 0.00 ? 45  ASN A H    6  
ATOM 9417  H HA   . ASN A 1 45  ? 19.423  -1.663  -7.244  1.00 0.00 ? 45  ASN A HA   6  
ATOM 9418  H HB2  . ASN A 1 45  ? 16.573  -0.867  -7.690  1.00 0.00 ? 45  ASN A HB2  6  
ATOM 9419  H HB3  . ASN A 1 45  ? 17.723  -0.060  -8.737  1.00 0.00 ? 45  ASN A HB3  6  
ATOM 9420  H HD21 . ASN A 1 45  ? 16.421  -3.132  -7.686  1.00 0.00 ? 45  ASN A HD21 6  
ATOM 9421  H HD22 . ASN A 1 45  ? 16.946  -4.095  -9.027  1.00 0.00 ? 45  ASN A HD22 6  
ATOM 9422  N N    . GLY A 1 46  ? 19.519  0.718   -5.542  1.00 0.00 ? 46  GLY A N    6  
ATOM 9423  C CA   . GLY A 1 46  ? 20.015  2.036   -5.184  1.00 0.00 ? 46  GLY A CA   6  
ATOM 9424  C C    . GLY A 1 46  ? 19.468  2.477   -3.825  1.00 0.00 ? 46  GLY A C    6  
ATOM 9425  O O    . GLY A 1 46  ? 18.676  1.765   -3.210  1.00 0.00 ? 46  GLY A O    6  
ATOM 9426  H H    . GLY A 1 46  ? 19.517  0.050   -4.797  1.00 0.00 ? 46  GLY A H    6  
ATOM 9427  H HA2  . GLY A 1 46  ? 21.104  2.022   -5.154  1.00 0.00 ? 46  GLY A HA2  6  
ATOM 9428  H HA3  . GLY A 1 46  ? 19.725  2.757   -5.948  1.00 0.00 ? 46  GLY A HA3  6  
ATOM 9429  N N    . ILE A 1 47  ? 19.912  3.649   -3.397  1.00 0.00 ? 47  ILE A N    6  
ATOM 9430  C CA   . ILE A 1 47  ? 19.476  4.194   -2.122  1.00 0.00 ? 47  ILE A CA   6  
ATOM 9431  C C    . ILE A 1 47  ? 18.024  4.660   -2.241  1.00 0.00 ? 47  ILE A C    6  
ATOM 9432  O O    . ILE A 1 47  ? 17.738  5.646   -2.918  1.00 0.00 ? 47  ILE A O    6  
ATOM 9433  C CB   . ILE A 1 47  ? 20.437  5.288   -1.651  1.00 0.00 ? 47  ILE A CB   6  
ATOM 9434  C CG1  . ILE A 1 47  ? 21.786  4.694   -1.242  1.00 0.00 ? 47  ILE A CG1  6  
ATOM 9435  C CG2  . ILE A 1 47  ? 19.812  6.119   -0.528  1.00 0.00 ? 47  ILE A CG2  6  
ATOM 9436  C CD1  . ILE A 1 47  ? 21.598  3.503   -0.299  1.00 0.00 ? 47  ILE A CD1  6  
ATOM 9437  H H    . ILE A 1 47  ? 20.556  4.223   -3.903  1.00 0.00 ? 47  ILE A H    6  
ATOM 9438  H HA   . ILE A 1 47  ? 19.522  3.388   -1.390  1.00 0.00 ? 47  ILE A HA   6  
ATOM 9439  H HB   . ILE A 1 47  ? 20.622  5.963   -2.486  1.00 0.00 ? 47  ILE A HB   6  
ATOM 9440  H HG12 . ILE A 1 47  ? 22.332  4.376   -2.130  1.00 0.00 ? 47  ILE A HG12 6  
ATOM 9441  H HG13 . ILE A 1 47  ? 22.390  5.458   -0.753  1.00 0.00 ? 47  ILE A HG13 6  
ATOM 9442  H HG21 . ILE A 1 47  ? 19.038  5.535   -0.031  1.00 0.00 ? 47  ILE A HG21 6  
ATOM 9443  H HG22 . ILE A 1 47  ? 20.582  6.390   0.195   1.00 0.00 ? 47  ILE A HG22 6  
ATOM 9444  H HG23 . ILE A 1 47  ? 19.373  7.024   -0.947  1.00 0.00 ? 47  ILE A HG23 6  
ATOM 9445  H HD11 . ILE A 1 47  ? 22.501  3.366   0.296   1.00 0.00 ? 47  ILE A HD11 6  
ATOM 9446  H HD12 . ILE A 1 47  ? 20.752  3.693   0.361   1.00 0.00 ? 47  ILE A HD12 6  
ATOM 9447  H HD13 . ILE A 1 47  ? 21.408  2.603   -0.884  1.00 0.00 ? 47  ILE A HD13 6  
ATOM 9448  N N    . LEU A 1 48  ? 17.144  3.929   -1.571  1.00 0.00 ? 48  LEU A N    6  
ATOM 9449  C CA   . LEU A 1 48  ? 15.729  4.256   -1.593  1.00 0.00 ? 48  LEU A CA   6  
ATOM 9450  C C    . LEU A 1 48  ? 15.546  5.738   -1.261  1.00 0.00 ? 48  LEU A C    6  
ATOM 9451  O O    . LEU A 1 48  ? 16.306  6.299   -0.473  1.00 0.00 ? 48  LEU A O    6  
ATOM 9452  C CB   . LEU A 1 48  ? 14.948  3.318   -0.670  1.00 0.00 ? 48  LEU A CB   6  
ATOM 9453  C CG   . LEU A 1 48  ? 15.203  1.821   -0.864  1.00 0.00 ? 48  LEU A CG   6  
ATOM 9454  C CD1  . LEU A 1 48  ? 14.397  0.994   0.139   1.00 0.00 ? 48  LEU A CD1  6  
ATOM 9455  C CD2  . LEU A 1 48  ? 14.924  1.400   -2.309  1.00 0.00 ? 48  LEU A CD2  6  
ATOM 9456  H H    . LEU A 1 48  ? 17.385  3.129   -1.022  1.00 0.00 ? 48  LEU A H    6  
ATOM 9457  H HA   . LEU A 1 48  ? 15.369  4.082   -2.608  1.00 0.00 ? 48  LEU A HA   6  
ATOM 9458  H HB2  . LEU A 1 48  ? 15.185  3.575   0.362   1.00 0.00 ? 48  LEU A HB2  6  
ATOM 9459  H HB3  . LEU A 1 48  ? 13.884  3.506   -0.810  1.00 0.00 ? 48  LEU A HB3  6  
ATOM 9460  H HG   . LEU A 1 48  ? 16.257  1.626   -0.670  1.00 0.00 ? 48  LEU A HG   6  
ATOM 9461  H HD11 . LEU A 1 48  ? 13.541  1.574   0.484   1.00 0.00 ? 48  LEU A HD11 6  
ATOM 9462  H HD12 . LEU A 1 48  ? 14.047  0.080   -0.341  1.00 0.00 ? 48  LEU A HD12 6  
ATOM 9463  H HD13 . LEU A 1 48  ? 15.029  0.738   0.990   1.00 0.00 ? 48  LEU A HD13 6  
ATOM 9464  H HD21 . LEU A 1 48  ? 15.800  1.610   -2.923  1.00 0.00 ? 48  LEU A HD21 6  
ATOM 9465  H HD22 . LEU A 1 48  ? 14.705  0.333   -2.340  1.00 0.00 ? 48  LEU A HD22 6  
ATOM 9466  H HD23 . LEU A 1 48  ? 14.070  1.958   -2.691  1.00 0.00 ? 48  LEU A HD23 6  
ATOM 9467  N N    . THR A 1 49  ? 14.534  6.330   -1.878  1.00 0.00 ? 49  THR A N    6  
ATOM 9468  C CA   . THR A 1 49  ? 14.242  7.736   -1.657  1.00 0.00 ? 49  THR A CA   6  
ATOM 9469  C C    . THR A 1 49  ? 12.875  7.898   -0.991  1.00 0.00 ? 49  THR A C    6  
ATOM 9470  O O    . THR A 1 49  ? 12.579  8.947   -0.420  1.00 0.00 ? 49  THR A O    6  
ATOM 9471  C CB   . THR A 1 49  ? 14.353  8.459   -3.001  1.00 0.00 ? 49  THR A CB   6  
ATOM 9472  O OG1  . THR A 1 49  ? 13.470  7.738   -3.857  1.00 0.00 ? 49  THR A OG1  6  
ATOM 9473  C CG2  . THR A 1 49  ? 15.728  8.281   -3.650  1.00 0.00 ? 49  THR A CG2  6  
ATOM 9474  H H    . THR A 1 49  ? 13.921  5.866   -2.518  1.00 0.00 ? 49  THR A H    6  
ATOM 9475  H HA   . THR A 1 49  ? 14.984  8.137   -0.966  1.00 0.00 ? 49  THR A HA   6  
ATOM 9476  H HB   . THR A 1 49  ? 14.105  9.515   -2.897  1.00 0.00 ? 49  THR A HB   6  
ATOM 9477  H HG1  . THR A 1 49  ? 12.949  8.375   -4.425  1.00 0.00 ? 49  THR A HG1  6  
ATOM 9478  H HG21 . THR A 1 49  ? 16.461  8.889   -3.120  1.00 0.00 ? 49  THR A HG21 6  
ATOM 9479  H HG22 . THR A 1 49  ? 16.021  7.233   -3.599  1.00 0.00 ? 49  THR A HG22 6  
ATOM 9480  H HG23 . THR A 1 49  ? 15.681  8.595   -4.692  1.00 0.00 ? 49  THR A HG23 6  
ATOM 9481  N N    . GLY A 1 50  ? 12.076  6.845   -1.087  1.00 0.00 ? 50  GLY A N    6  
ATOM 9482  C CA   . GLY A 1 50  ? 10.747  6.858   -0.501  1.00 0.00 ? 50  GLY A CA   6  
ATOM 9483  C C    . GLY A 1 50  ? 9.925   5.659   -0.980  1.00 0.00 ? 50  GLY A C    6  
ATOM 9484  O O    . GLY A 1 50  ? 10.465  4.733   -1.583  1.00 0.00 ? 50  GLY A O    6  
ATOM 9485  H H    . GLY A 1 50  ? 12.325  5.996   -1.554  1.00 0.00 ? 50  GLY A H    6  
ATOM 9486  H HA2  . GLY A 1 50  ? 10.825  6.839   0.586   1.00 0.00 ? 50  GLY A HA2  6  
ATOM 9487  H HA3  . GLY A 1 50  ? 10.237  7.783   -0.768  1.00 0.00 ? 50  GLY A HA3  6  
ATOM 9488  N N    . TYR A 1 51  ? 8.633   5.716   -0.692  1.00 0.00 ? 51  TYR A N    6  
ATOM 9489  C CA   . TYR A 1 51  ? 7.732   4.646   -1.086  1.00 0.00 ? 51  TYR A CA   6  
ATOM 9490  C C    . TYR A 1 51  ? 6.389   5.207   -1.560  1.00 0.00 ? 51  TYR A C    6  
ATOM 9491  O O    . TYR A 1 51  ? 5.885   6.179   -0.999  1.00 0.00 ? 51  TYR A O    6  
ATOM 9492  C CB   . TYR A 1 51  ? 7.503   3.804   0.170   1.00 0.00 ? 51  TYR A CB   6  
ATOM 9493  C CG   . TYR A 1 51  ? 8.702   2.940   0.567   1.00 0.00 ? 51  TYR A CG   6  
ATOM 9494  C CD1  . TYR A 1 51  ? 8.941   1.749   -0.087  1.00 0.00 ? 51  TYR A CD1  6  
ATOM 9495  C CD2  . TYR A 1 51  ? 9.545   3.353   1.579   1.00 0.00 ? 51  TYR A CD2  6  
ATOM 9496  C CE1  . TYR A 1 51  ? 10.070  0.936   0.287   1.00 0.00 ? 51  TYR A CE1  6  
ATOM 9497  C CE2  . TYR A 1 51  ? 10.673  2.540   1.953   1.00 0.00 ? 51  TYR A CE2  6  
ATOM 9498  C CZ   . TYR A 1 51  ? 10.880  1.372   1.288   1.00 0.00 ? 51  TYR A CZ   6  
ATOM 9499  O OH   . TYR A 1 51  ? 11.946  0.605   1.641   1.00 0.00 ? 51  TYR A OH   6  
ATOM 9500  H H    . TYR A 1 51  ? 8.202   6.473   -0.201  1.00 0.00 ? 51  TYR A H    6  
ATOM 9501  H HA   . TYR A 1 51  ? 8.197   4.098   -1.904  1.00 0.00 ? 51  TYR A HA   6  
ATOM 9502  H HB2  . TYR A 1 51  ? 7.255   4.466   1.000   1.00 0.00 ? 51  TYR A HB2  6  
ATOM 9503  H HB3  . TYR A 1 51  ? 6.640   3.157   0.010   1.00 0.00 ? 51  TYR A HB3  6  
ATOM 9504  H HD1  . TYR A 1 51  ? 8.276   1.423   -0.886  1.00 0.00 ? 51  TYR A HD1  6  
ATOM 9505  H HD2  . TYR A 1 51  ? 9.356   4.294   2.096   1.00 0.00 ? 51  TYR A HD2  6  
ATOM 9506  H HE1  . TYR A 1 51  ? 10.270  -0.007  -0.222  1.00 0.00 ? 51  TYR A HE1  6  
ATOM 9507  H HE2  . TYR A 1 51  ? 11.346  2.855   2.751   1.00 0.00 ? 51  TYR A HE2  6  
ATOM 9508  H HH   . TYR A 1 51  ? 12.589  1.143   2.186   1.00 0.00 ? 51  TYR A HH   6  
ATOM 9509  N N    . ARG A 1 52  ? 5.849   4.572   -2.590  1.00 0.00 ? 52  ARG A N    6  
ATOM 9510  C CA   . ARG A 1 52  ? 4.576   4.995   -3.146  1.00 0.00 ? 52  ARG A CA   6  
ATOM 9511  C C    . ARG A 1 52  ? 3.496   3.951   -2.855  1.00 0.00 ? 52  ARG A C    6  
ATOM 9512  O O    . ARG A 1 52  ? 3.463   2.895   -3.485  1.00 0.00 ? 52  ARG A O    6  
ATOM 9513  C CB   . ARG A 1 52  ? 4.678   5.206   -4.658  1.00 0.00 ? 52  ARG A CB   6  
ATOM 9514  C CG   . ARG A 1 52  ? 3.582   6.151   -5.155  1.00 0.00 ? 52  ARG A CG   6  
ATOM 9515  C CD   . ARG A 1 52  ? 3.120   5.764   -6.561  1.00 0.00 ? 52  ARG A CD   6  
ATOM 9516  N NE   . ARG A 1 52  ? 4.134   6.174   -7.558  1.00 0.00 ? 52  ARG A NE   6  
ATOM 9517  C CZ   . ARG A 1 52  ? 3.941   6.140   -8.884  1.00 0.00 ? 52  ARG A CZ   6  
ATOM 9518  N NH1  . ARG A 1 52  ? 2.771   5.714   -9.380  1.00 0.00 ? 52  ARG A NH1  6  
ATOM 9519  N NH2  . ARG A 1 52  ? 4.918   6.532   -9.713  1.00 0.00 ? 52  ARG A NH2  6  
ATOM 9520  H H    . ARG A 1 52  ? 6.266   3.782   -3.041  1.00 0.00 ? 52  ARG A H    6  
ATOM 9521  H HA   . ARG A 1 52  ? 4.353   5.938   -2.647  1.00 0.00 ? 52  ARG A HA   6  
ATOM 9522  H HB2  . ARG A 1 52  ? 5.657   5.616   -4.906  1.00 0.00 ? 52  ARG A HB2  6  
ATOM 9523  H HB3  . ARG A 1 52  ? 4.595   4.247   -5.169  1.00 0.00 ? 52  ARG A HB3  6  
ATOM 9524  H HG2  . ARG A 1 52  ? 2.735   6.124   -4.470  1.00 0.00 ? 52  ARG A HG2  6  
ATOM 9525  H HG3  . ARG A 1 52  ? 3.955   7.175   -5.160  1.00 0.00 ? 52  ARG A HG3  6  
ATOM 9526  H HD2  . ARG A 1 52  ? 2.959   4.687   -6.616  1.00 0.00 ? 52  ARG A HD2  6  
ATOM 9527  H HD3  . ARG A 1 52  ? 2.165   6.240   -6.784  1.00 0.00 ? 52  ARG A HD3  6  
ATOM 9528  H HE   . ARG A 1 52  ? 5.018   6.498   -7.221  1.00 0.00 ? 52  ARG A HE   6  
ATOM 9529  H HH11 . ARG A 1 52  ? 2.043   5.422   -8.761  1.00 0.00 ? 52  ARG A HH11 6  
ATOM 9530  H HH12 . ARG A 1 52  ? 2.627   5.689   -10.369 1.00 0.00 ? 52  ARG A HH12 6  
ATOM 9531  H HH21 . ARG A 1 52  ? 5.791   6.850   -9.343  1.00 0.00 ? 52  ARG A HH21 6  
ATOM 9532  H HH22 . ARG A 1 52  ? 4.774   6.507   -10.703 1.00 0.00 ? 52  ARG A HH22 6  
ATOM 9533  N N    . ILE A 1 53  ? 2.639   4.282   -1.901  1.00 0.00 ? 53  ILE A N    6  
ATOM 9534  C CA   . ILE A 1 53  ? 1.561   3.386   -1.519  1.00 0.00 ? 53  ILE A CA   6  
ATOM 9535  C C    . ILE A 1 53  ? 0.287   3.777   -2.272  1.00 0.00 ? 53  ILE A C    6  
ATOM 9536  O O    . ILE A 1 53  ? 0.071   4.952   -2.563  1.00 0.00 ? 53  ILE A O    6  
ATOM 9537  C CB   . ILE A 1 53  ? 1.394   3.365   0.002   1.00 0.00 ? 53  ILE A CB   6  
ATOM 9538  C CG1  . ILE A 1 53  ? 0.367   2.314   0.426   1.00 0.00 ? 53  ILE A CG1  6  
ATOM 9539  C CG2  . ILE A 1 53  ? 1.044   4.757   0.534   1.00 0.00 ? 53  ILE A CG2  6  
ATOM 9540  C CD1  . ILE A 1 53  ? 0.078   2.404   1.926   1.00 0.00 ? 53  ILE A CD1  6  
ATOM 9541  H H    . ILE A 1 53  ? 2.672   5.143   -1.393  1.00 0.00 ? 53  ILE A H    6  
ATOM 9542  H HA   . ILE A 1 53  ? 1.848   2.380   -1.825  1.00 0.00 ? 53  ILE A HA   6  
ATOM 9543  H HB   . ILE A 1 53  ? 2.348   3.081   0.446   1.00 0.00 ? 53  ILE A HB   6  
ATOM 9544  H HG12 . ILE A 1 53  ? -0.557  2.456   -0.134  1.00 0.00 ? 53  ILE A HG12 6  
ATOM 9545  H HG13 . ILE A 1 53  ? 0.738   1.319   0.183   1.00 0.00 ? 53  ILE A HG13 6  
ATOM 9546  H HG21 . ILE A 1 53  ? 0.059   4.730   0.999   1.00 0.00 ? 53  ILE A HG21 6  
ATOM 9547  H HG22 . ILE A 1 53  ? 1.786   5.060   1.272   1.00 0.00 ? 53  ILE A HG22 6  
ATOM 9548  H HG23 . ILE A 1 53  ? 1.038   5.470   -0.291  1.00 0.00 ? 53  ILE A HG23 6  
ATOM 9549  H HD11 . ILE A 1 53  ? 0.402   1.485   2.414   1.00 0.00 ? 53  ILE A HD11 6  
ATOM 9550  H HD12 . ILE A 1 53  ? 0.619   3.250   2.350   1.00 0.00 ? 53  ILE A HD12 6  
ATOM 9551  H HD13 . ILE A 1 53  ? -0.992  2.542   2.083   1.00 0.00 ? 53  ILE A HD13 6  
ATOM 9552  N N    . SER A 1 54  ? -0.521  2.769   -2.566  1.00 0.00 ? 54  SER A N    6  
ATOM 9553  C CA   . SER A 1 54  ? -1.767  2.993   -3.279  1.00 0.00 ? 54  SER A CA   6  
ATOM 9554  C C    . SER A 1 54  ? -2.787  1.917   -2.901  1.00 0.00 ? 54  SER A C    6  
ATOM 9555  O O    . SER A 1 54  ? -2.621  0.749   -3.250  1.00 0.00 ? 54  SER A O    6  
ATOM 9556  C CB   . SER A 1 54  ? -1.542  3.003   -4.792  1.00 0.00 ? 54  SER A CB   6  
ATOM 9557  O OG   . SER A 1 54  ? -0.164  2.861   -5.127  1.00 0.00 ? 54  SER A OG   6  
ATOM 9558  H H    . SER A 1 54  ? -0.338  1.816   -2.325  1.00 0.00 ? 54  SER A H    6  
ATOM 9559  H HA   . SER A 1 54  ? -2.111  3.976   -2.957  1.00 0.00 ? 54  SER A HA   6  
ATOM 9560  H HB2  . SER A 1 54  ? -2.110  2.193   -5.249  1.00 0.00 ? 54  SER A HB2  6  
ATOM 9561  H HB3  . SER A 1 54  ? -1.923  3.935   -5.210  1.00 0.00 ? 54  SER A HB3  6  
ATOM 9562  H HG   . SER A 1 54  ? 0.195   2.009   -4.747  1.00 0.00 ? 54  SER A HG   6  
ATOM 9563  N N    . TRP A 1 55  ? -3.820  2.349   -2.193  1.00 0.00 ? 55  TRP A N    6  
ATOM 9564  C CA   . TRP A 1 55  ? -4.867  1.437   -1.765  1.00 0.00 ? 55  TRP A CA   6  
ATOM 9565  C C    . TRP A 1 55  ? -6.062  1.612   -2.705  1.00 0.00 ? 55  TRP A C    6  
ATOM 9566  O O    . TRP A 1 55  ? -6.301  2.707   -3.212  1.00 0.00 ? 55  TRP A O    6  
ATOM 9567  C CB   . TRP A 1 55  ? -5.225  1.665   -0.295  1.00 0.00 ? 55  TRP A CB   6  
ATOM 9568  C CG   . TRP A 1 55  ? -5.886  3.017   -0.017  1.00 0.00 ? 55  TRP A CG   6  
ATOM 9569  C CD1  . TRP A 1 55  ? -7.126  3.410   -0.338  1.00 0.00 ? 55  TRP A CD1  6  
ATOM 9570  C CD2  . TRP A 1 55  ? -5.287  4.145   0.655   1.00 0.00 ? 55  TRP A CD2  6  
ATOM 9571  N NE1  . TRP A 1 55  ? -7.369  4.704   0.076   1.00 0.00 ? 55  TRP A NE1  6  
ATOM 9572  C CE2  . TRP A 1 55  ? -6.215  5.165   0.699   1.00 0.00 ? 55  TRP A CE2  6  
ATOM 9573  C CE3  . TRP A 1 55  ? -4.003  4.298   1.208   1.00 0.00 ? 55  TRP A CE3  6  
ATOM 9574  C CZ2  . TRP A 1 55  ? -5.959  6.410   1.286   1.00 0.00 ? 55  TRP A CZ2  6  
ATOM 9575  C CZ3  . TRP A 1 55  ? -3.763  5.548   1.791   1.00 0.00 ? 55  TRP A CZ3  6  
ATOM 9576  C CH2  . TRP A 1 55  ? -4.687  6.585   1.843   1.00 0.00 ? 55  TRP A CH2  6  
ATOM 9577  H H    . TRP A 1 55  ? -3.948  3.300   -1.914  1.00 0.00 ? 55  TRP A H    6  
ATOM 9578  H HA   . TRP A 1 55  ? -4.477  0.422   -1.842  1.00 0.00 ? 55  TRP A HA   6  
ATOM 9579  H HB2  . TRP A 1 55  ? -5.896  0.870   0.033   1.00 0.00 ? 55  TRP A HB2  6  
ATOM 9580  H HB3  . TRP A 1 55  ? -4.319  1.585   0.306   1.00 0.00 ? 55  TRP A HB3  6  
ATOM 9581  H HD1  . TRP A 1 55  ? -7.851  2.787   -0.861  1.00 0.00 ? 55  TRP A HD1  6  
ATOM 9582  H HE1  . TRP A 1 55  ? -8.295  5.262   -0.060  1.00 0.00 ? 55  TRP A HE1  6  
ATOM 9583  H HE3  . TRP A 1 55  ? -3.253  3.508   1.186   1.00 0.00 ? 55  TRP A HE3  6  
ATOM 9584  H HZ2  . TRP A 1 55  ? -6.710  7.200   1.309   1.00 0.00 ? 55  TRP A HZ2  6  
ATOM 9585  H HZ3  . TRP A 1 55  ? -2.782  5.720   2.234   1.00 0.00 ? 55  TRP A HZ3  6  
ATOM 9586  H HH2  . TRP A 1 55  ? -4.422  7.531   2.316   1.00 0.00 ? 55  TRP A HH2  6  
ATOM 9587  N N    . GLU A 1 56  ? -6.779  0.517   -2.909  1.00 0.00 ? 56  GLU A N    6  
ATOM 9588  C CA   . GLU A 1 56  ? -7.943  0.537   -3.779  1.00 0.00 ? 56  GLU A CA   6  
ATOM 9589  C C    . GLU A 1 56  ? -8.775  -0.732  -3.580  1.00 0.00 ? 56  GLU A C    6  
ATOM 9590  O O    . GLU A 1 56  ? -8.251  -1.763  -3.162  1.00 0.00 ? 56  GLU A O    6  
ATOM 9591  C CB   . GLU A 1 56  ? -7.529  0.697   -5.243  1.00 0.00 ? 56  GLU A CB   6  
ATOM 9592  C CG   . GLU A 1 56  ? -6.958  -0.609  -5.799  1.00 0.00 ? 56  GLU A CG   6  
ATOM 9593  C CD   . GLU A 1 56  ? -6.468  -0.425  -7.236  1.00 0.00 ? 56  GLU A CD   6  
ATOM 9594  O OE1  . GLU A 1 56  ? -7.247  0.139   -8.034  1.00 0.00 ? 56  GLU A OE1  6  
ATOM 9595  O OE2  . GLU A 1 56  ? -5.324  -0.853  -7.505  1.00 0.00 ? 56  GLU A OE2  6  
ATOM 9596  H H    . GLU A 1 56  ? -6.577  -0.369  -2.492  1.00 0.00 ? 56  GLU A H    6  
ATOM 9597  H HA   . GLU A 1 56  ? -8.519  1.409   -3.472  1.00 0.00 ? 56  GLU A HA   6  
ATOM 9598  H HB2  . GLU A 1 56  ? -8.391  1.003   -5.836  1.00 0.00 ? 56  GLU A HB2  6  
ATOM 9599  H HB3  . GLU A 1 56  ? -6.786  1.490   -5.330  1.00 0.00 ? 56  GLU A HB3  6  
ATOM 9600  H HG2  . GLU A 1 56  ? -6.134  -0.946  -5.170  1.00 0.00 ? 56  GLU A HG2  6  
ATOM 9601  H HG3  . GLU A 1 56  ? -7.722  -1.386  -5.767  1.00 0.00 ? 56  GLU A HG3  6  
ATOM 9602  N N    . GLU A 1 57  ? -10.058 -0.614  -3.889  1.00 0.00 ? 57  GLU A N    6  
ATOM 9603  C CA   . GLU A 1 57  ? -10.968 -1.738  -3.750  1.00 0.00 ? 57  GLU A CA   6  
ATOM 9604  C C    . GLU A 1 57  ? -10.464 -2.933  -4.562  1.00 0.00 ? 57  GLU A C    6  
ATOM 9605  O O    . GLU A 1 57  ? -9.531  -2.801  -5.353  1.00 0.00 ? 57  GLU A O    6  
ATOM 9606  C CB   . GLU A 1 57  ? -12.387 -1.350  -4.169  1.00 0.00 ? 57  GLU A CB   6  
ATOM 9607  C CG   . GLU A 1 57  ? -13.273 -1.108  -2.946  1.00 0.00 ? 57  GLU A CG   6  
ATOM 9608  C CD   . GLU A 1 57  ? -14.744 -1.376  -3.272  1.00 0.00 ? 57  GLU A CD   6  
ATOM 9609  O OE1  . GLU A 1 57  ? -15.098 -2.571  -3.355  1.00 0.00 ? 57  GLU A OE1  6  
ATOM 9610  O OE2  . GLU A 1 57  ? -15.480 -0.378  -3.431  1.00 0.00 ? 57  GLU A OE2  6  
ATOM 9611  H H    . GLU A 1 57  ? -10.476 0.229   -4.229  1.00 0.00 ? 57  GLU A H    6  
ATOM 9612  H HA   . GLU A 1 57  ? -10.964 -1.984  -2.688  1.00 0.00 ? 57  GLU A HA   6  
ATOM 9613  H HB2  . GLU A 1 57  ? -12.356 -0.450  -4.783  1.00 0.00 ? 57  GLU A HB2  6  
ATOM 9614  H HB3  . GLU A 1 57  ? -12.818 -2.140  -4.784  1.00 0.00 ? 57  GLU A HB3  6  
ATOM 9615  H HG2  . GLU A 1 57  ? -12.955 -1.755  -2.128  1.00 0.00 ? 57  GLU A HG2  6  
ATOM 9616  H HG3  . GLU A 1 57  ? -13.154 -0.080  -2.603  1.00 0.00 ? 57  GLU A HG3  6  
ATOM 9617  N N    . TYR A 1 58  ? -11.103 -4.072  -4.339  1.00 0.00 ? 58  TYR A N    6  
ATOM 9618  C CA   . TYR A 1 58  ? -10.731 -5.289  -5.040  1.00 0.00 ? 58  TYR A CA   6  
ATOM 9619  C C    . TYR A 1 58  ? -10.490 -5.014  -6.525  1.00 0.00 ? 58  TYR A C    6  
ATOM 9620  O O    . TYR A 1 58  ? -9.385  -5.215  -7.027  1.00 0.00 ? 58  TYR A O    6  
ATOM 9621  C CB   . TYR A 1 58  ? -11.921 -6.239  -4.895  1.00 0.00 ? 58  TYR A CB   6  
ATOM 9622  C CG   . TYR A 1 58  ? -11.880 -7.436  -5.847  1.00 0.00 ? 58  TYR A CG   6  
ATOM 9623  C CD1  . TYR A 1 58  ? -10.780 -8.268  -5.863  1.00 0.00 ? 58  TYR A CD1  6  
ATOM 9624  C CD2  . TYR A 1 58  ? -12.945 -7.684  -6.690  1.00 0.00 ? 58  TYR A CD2  6  
ATOM 9625  C CE1  . TYR A 1 58  ? -10.742 -9.395  -6.759  1.00 0.00 ? 58  TYR A CE1  6  
ATOM 9626  C CE2  . TYR A 1 58  ? -12.907 -8.810  -7.586  1.00 0.00 ? 58  TYR A CE2  6  
ATOM 9627  C CZ   . TYR A 1 58  ? -11.807 -9.610  -7.576  1.00 0.00 ? 58  TYR A CZ   6  
ATOM 9628  O OH   . TYR A 1 58  ? -11.771 -10.674 -8.423  1.00 0.00 ? 58  TYR A OH   6  
ATOM 9629  H H    . TYR A 1 58  ? -11.860 -4.170  -3.693  1.00 0.00 ? 58  TYR A H    6  
ATOM 9630  H HA   . TYR A 1 58  ? -9.810  -5.666  -4.594  1.00 0.00 ? 58  TYR A HA   6  
ATOM 9631  H HB2  . TYR A 1 58  ? -11.958 -6.605  -3.869  1.00 0.00 ? 58  TYR A HB2  6  
ATOM 9632  H HB3  . TYR A 1 58  ? -12.841 -5.681  -5.068  1.00 0.00 ? 58  TYR A HB3  6  
ATOM 9633  H HD1  . TYR A 1 58  ? -9.939  -8.073  -5.197  1.00 0.00 ? 58  TYR A HD1  6  
ATOM 9634  H HD2  . TYR A 1 58  ? -13.814 -7.026  -6.678  1.00 0.00 ? 58  TYR A HD2  6  
ATOM 9635  H HE1  . TYR A 1 58  ? -9.878  -10.060 -6.781  1.00 0.00 ? 58  TYR A HE1  6  
ATOM 9636  H HE2  . TYR A 1 58  ? -13.740 -9.017  -8.257  1.00 0.00 ? 58  TYR A HE2  6  
ATOM 9637  H HH   . TYR A 1 58  ? -11.016 -10.571 -9.070  1.00 0.00 ? 58  TYR A HH   6  
ATOM 9638  N N    . ASN A 1 59  ? -11.543 -4.558  -7.188  1.00 0.00 ? 59  ASN A N    6  
ATOM 9639  C CA   . ASN A 1 59  ? -11.460 -4.254  -8.607  1.00 0.00 ? 59  ASN A CA   6  
ATOM 9640  C C    . ASN A 1 59  ? -12.172 -2.928  -8.882  1.00 0.00 ? 59  ASN A C    6  
ATOM 9641  O O    . ASN A 1 59  ? -13.025 -2.848  -9.765  1.00 0.00 ? 59  ASN A O    6  
ATOM 9642  C CB   . ASN A 1 59  ? -12.141 -5.339  -9.443  1.00 0.00 ? 59  ASN A CB   6  
ATOM 9643  C CG   . ASN A 1 59  ? -11.657 -5.297  -10.894 1.00 0.00 ? 59  ASN A CG   6  
ATOM 9644  O OD1  . ASN A 1 59  ? -10.957 -4.391  -11.317 1.00 0.00 ? 59  ASN A OD1  6  
ATOM 9645  N ND2  . ASN A 1 59  ? -12.067 -6.325  -11.631 1.00 0.00 ? 59  ASN A ND2  6  
ATOM 9646  H H    . ASN A 1 59  ? -12.439 -4.398  -6.773  1.00 0.00 ? 59  ASN A H    6  
ATOM 9647  H HA   . ASN A 1 59  ? -10.394 -4.209  -8.828  1.00 0.00 ? 59  ASN A HA   6  
ATOM 9648  H HB2  . ASN A 1 59  ? -11.933 -6.319  -9.015  1.00 0.00 ? 59  ASN A HB2  6  
ATOM 9649  H HB3  . ASN A 1 59  ? -13.222 -5.201  -9.413  1.00 0.00 ? 59  ASN A HB3  6  
ATOM 9650  H HD21 . ASN A 1 59  ? -12.640 -7.036  -11.223 1.00 0.00 ? 59  ASN A HD21 6  
ATOM 9651  H HD22 . ASN A 1 59  ? -11.802 -6.388  -12.593 1.00 0.00 ? 59  ASN A HD22 6  
ATOM 9652  N N    . ARG A 1 60  ? -11.796 -1.920  -8.109  1.00 0.00 ? 60  ARG A N    6  
ATOM 9653  C CA   . ARG A 1 60  ? -12.388 -0.601  -8.258  1.00 0.00 ? 60  ARG A CA   6  
ATOM 9654  C C    . ARG A 1 60  ? -11.309 0.479   -8.163  1.00 0.00 ? 60  ARG A C    6  
ATOM 9655  O O    . ARG A 1 60  ? -11.069 1.030   -7.090  1.00 0.00 ? 60  ARG A O    6  
ATOM 9656  C CB   . ARG A 1 60  ? -13.448 -0.348  -7.184  1.00 0.00 ? 60  ARG A CB   6  
ATOM 9657  C CG   . ARG A 1 60  ? -14.858 -0.501  -7.759  1.00 0.00 ? 60  ARG A CG   6  
ATOM 9658  C CD   . ARG A 1 60  ? -15.916 -0.343  -6.665  1.00 0.00 ? 60  ARG A CD   6  
ATOM 9659  N NE   . ARG A 1 60  ? -17.177 0.163   -7.250  1.00 0.00 ? 60  ARG A NE   6  
ATOM 9660  C CZ   . ARG A 1 60  ? -18.357 0.158   -6.614  1.00 0.00 ? 60  ARG A CZ   6  
ATOM 9661  N NH1  . ARG A 1 60  ? -18.443 -0.327  -5.368  1.00 0.00 ? 60  ARG A NH1  6  
ATOM 9662  N NH2  . ARG A 1 60  ? -19.449 0.638   -7.223  1.00 0.00 ? 60  ARG A NH2  6  
ATOM 9663  H H    . ARG A 1 60  ? -11.102 -1.993  -7.393  1.00 0.00 ? 60  ARG A H    6  
ATOM 9664  H HA   . ARG A 1 60  ? -12.847 -0.612  -9.247  1.00 0.00 ? 60  ARG A HA   6  
ATOM 9665  H HB2  . ARG A 1 60  ? -13.310 -1.048  -6.360  1.00 0.00 ? 60  ARG A HB2  6  
ATOM 9666  H HB3  . ARG A 1 60  ? -13.325 0.654   -6.775  1.00 0.00 ? 60  ARG A HB3  6  
ATOM 9667  H HG2  . ARG A 1 60  ? -15.020 0.245   -8.537  1.00 0.00 ? 60  ARG A HG2  6  
ATOM 9668  H HG3  . ARG A 1 60  ? -14.959 -1.479  -8.229  1.00 0.00 ? 60  ARG A HG3  6  
ATOM 9669  H HD2  . ARG A 1 60  ? -16.091 -1.301  -6.176  1.00 0.00 ? 60  ARG A HD2  6  
ATOM 9670  H HD3  . ARG A 1 60  ? -15.559 0.345   -5.899  1.00 0.00 ? 60  ARG A HD3  6  
ATOM 9671  H HE   . ARG A 1 60  ? -17.148 0.533   -8.179  1.00 0.00 ? 60  ARG A HE   6  
ATOM 9672  H HH11 . ARG A 1 60  ? -17.628 -0.686  -4.913  1.00 0.00 ? 60  ARG A HH11 6  
ATOM 9673  H HH12 . ARG A 1 60  ? -19.323 -0.331  -4.893  1.00 0.00 ? 60  ARG A HH12 6  
ATOM 9674  H HH21 . ARG A 1 60  ? -19.385 1.000   -8.153  1.00 0.00 ? 60  ARG A HH21 6  
ATOM 9675  H HH22 . ARG A 1 60  ? -20.329 0.634   -6.748  1.00 0.00 ? 60  ARG A HH22 6  
ATOM 9676  N N    . THR A 1 61  ? -10.686 0.750   -9.301  1.00 0.00 ? 61  THR A N    6  
ATOM 9677  C CA   . THR A 1 61  ? -9.638  1.754   -9.359  1.00 0.00 ? 61  THR A CA   6  
ATOM 9678  C C    . THR A 1 61  ? -10.184 3.121   -8.943  1.00 0.00 ? 61  THR A C    6  
ATOM 9679  O O    . THR A 1 61  ? -9.421  4.014   -8.578  1.00 0.00 ? 61  THR A O    6  
ATOM 9680  C CB   . THR A 1 61  ? -9.048  1.740   -10.771 1.00 0.00 ? 61  THR A CB   6  
ATOM 9681  O OG1  . THR A 1 61  ? -8.468  0.445   -10.893 1.00 0.00 ? 61  THR A OG1  6  
ATOM 9682  C CG2  . THR A 1 61  ? -7.862  2.696   -10.920 1.00 0.00 ? 61  THR A CG2  6  
ATOM 9683  H H    . THR A 1 61  ? -10.886 0.297   -10.169 1.00 0.00 ? 61  THR A H    6  
ATOM 9684  H HA   . THR A 1 61  ? -8.864  1.486   -8.640  1.00 0.00 ? 61  THR A HA   6  
ATOM 9685  H HB   . THR A 1 61  ? -9.815  1.954   -11.515 1.00 0.00 ? 61  THR A HB   6  
ATOM 9686  H HG1  . THR A 1 61  ? -9.184  -0.240  -11.027 1.00 0.00 ? 61  THR A HG1  6  
ATOM 9687  H HG21 . THR A 1 61  ? -8.228  3.697   -11.146 1.00 0.00 ? 61  THR A HG21 6  
ATOM 9688  H HG22 . THR A 1 61  ? -7.295  2.718   -9.990  1.00 0.00 ? 61  THR A HG22 6  
ATOM 9689  H HG23 . THR A 1 61  ? -7.218  2.352   -11.730 1.00 0.00 ? 61  THR A HG23 6  
ATOM 9690  N N    . ASN A 1 62  ? -11.502 3.241   -9.010  1.00 0.00 ? 62  ASN A N    6  
ATOM 9691  C CA   . ASN A 1 62  ? -12.160 4.484   -8.644  1.00 0.00 ? 62  ASN A CA   6  
ATOM 9692  C C    . ASN A 1 62  ? -11.853 4.807   -7.181  1.00 0.00 ? 62  ASN A C    6  
ATOM 9693  O O    . ASN A 1 62  ? -12.067 5.931   -6.731  1.00 0.00 ? 62  ASN A O    6  
ATOM 9694  C CB   . ASN A 1 62  ? -13.678 4.368   -8.795  1.00 0.00 ? 62  ASN A CB   6  
ATOM 9695  C CG   . ASN A 1 62  ? -14.184 3.034   -8.242  1.00 0.00 ? 62  ASN A CG   6  
ATOM 9696  O OD1  . ASN A 1 62  ? -13.629 1.977   -8.496  1.00 0.00 ? 62  ASN A OD1  6  
ATOM 9697  N ND2  . ASN A 1 62  ? -15.265 3.141   -7.475  1.00 0.00 ? 62  ASN A ND2  6  
ATOM 9698  H H    . ASN A 1 62  ? -12.116 2.510   -9.308  1.00 0.00 ? 62  ASN A H    6  
ATOM 9699  H HA   . ASN A 1 62  ? -11.761 5.232   -9.329  1.00 0.00 ? 62  ASN A HA   6  
ATOM 9700  H HB2  . ASN A 1 62  ? -14.163 5.190   -8.269  1.00 0.00 ? 62  ASN A HB2  6  
ATOM 9701  H HB3  . ASN A 1 62  ? -13.951 4.457   -9.846  1.00 0.00 ? 62  ASN A HB3  6  
ATOM 9702  H HD21 . ASN A 1 62  ? -15.671 4.039   -7.306  1.00 0.00 ? 62  ASN A HD21 6  
ATOM 9703  H HD22 . ASN A 1 62  ? -15.671 2.323   -7.067  1.00 0.00 ? 62  ASN A HD22 6  
ATOM 9704  N N    . THR A 1 63  ? -11.356 3.800   -6.478  1.00 0.00 ? 63  THR A N    6  
ATOM 9705  C CA   . THR A 1 63  ? -11.017 3.962   -5.074  1.00 0.00 ? 63  THR A CA   6  
ATOM 9706  C C    . THR A 1 63  ? -9.501  3.890   -4.879  1.00 0.00 ? 63  THR A C    6  
ATOM 9707  O O    . THR A 1 63  ? -9.026  3.531   -3.803  1.00 0.00 ? 63  THR A O    6  
ATOM 9708  C CB   . THR A 1 63  ? -11.783 2.905   -4.277  1.00 0.00 ? 63  THR A CB   6  
ATOM 9709  O OG1  . THR A 1 63  ? -11.168 1.675   -4.652  1.00 0.00 ? 63  THR A OG1  6  
ATOM 9710  C CG2  . THR A 1 63  ? -13.232 2.755   -4.745  1.00 0.00 ? 63  THR A CG2  6  
ATOM 9711  H H    . THR A 1 63  ? -11.184 2.888   -6.851  1.00 0.00 ? 63  THR A H    6  
ATOM 9712  H HA   . THR A 1 63  ? -11.333 4.956   -4.757  1.00 0.00 ? 63  THR A HA   6  
ATOM 9713  H HB   . THR A 1 63  ? -11.738 3.115   -3.208  1.00 0.00 ? 63  THR A HB   6  
ATOM 9714  H HG1  . THR A 1 63  ? -11.430 1.433   -5.586  1.00 0.00 ? 63  THR A HG1  6  
ATOM 9715  H HG21 . THR A 1 63  ? -13.423 3.448   -5.564  1.00 0.00 ? 63  THR A HG21 6  
ATOM 9716  H HG22 . THR A 1 63  ? -13.400 1.733   -5.087  1.00 0.00 ? 63  THR A HG22 6  
ATOM 9717  H HG23 . THR A 1 63  ? -13.906 2.976   -3.917  1.00 0.00 ? 63  THR A HG23 6  
ATOM 9718  N N    . ARG A 1 64  ? -8.784  4.237   -5.938  1.00 0.00 ? 64  ARG A N    6  
ATOM 9719  C CA   . ARG A 1 64  ? -7.331  4.216   -5.897  1.00 0.00 ? 64  ARG A CA   6  
ATOM 9720  C C    . ARG A 1 64  ? -6.793  5.581   -5.462  1.00 0.00 ? 64  ARG A C    6  
ATOM 9721  O O    . ARG A 1 64  ? -7.245  6.615   -5.950  1.00 0.00 ? 64  ARG A O    6  
ATOM 9722  C CB   . ARG A 1 64  ? -6.747  3.858   -7.265  1.00 0.00 ? 64  ARG A CB   6  
ATOM 9723  C CG   . ARG A 1 64  ? -5.229  4.050   -7.279  1.00 0.00 ? 64  ARG A CG   6  
ATOM 9724  C CD   . ARG A 1 64  ? -4.511  2.721   -7.526  1.00 0.00 ? 64  ARG A CD   6  
ATOM 9725  N NE   . ARG A 1 64  ? -3.437  2.904   -8.527  1.00 0.00 ? 64  ARG A NE   6  
ATOM 9726  C CZ   . ARG A 1 64  ? -2.368  2.103   -8.638  1.00 0.00 ? 64  ARG A CZ   6  
ATOM 9727  N NH1  . ARG A 1 64  ? -2.225  1.060   -7.809  1.00 0.00 ? 64  ARG A NH1  6  
ATOM 9728  N NH2  . ARG A 1 64  ? -1.443  2.346   -9.576  1.00 0.00 ? 64  ARG A NH2  6  
ATOM 9729  H H    . ARG A 1 64  ? -9.178  4.528   -6.809  1.00 0.00 ? 64  ARG A H    6  
ATOM 9730  H HA   . ARG A 1 64  ? -7.084  3.446   -5.166  1.00 0.00 ? 64  ARG A HA   6  
ATOM 9731  H HB2  . ARG A 1 64  ? -6.989  2.823   -7.507  1.00 0.00 ? 64  ARG A HB2  6  
ATOM 9732  H HB3  . ARG A 1 64  ? -7.203  4.481   -8.034  1.00 0.00 ? 64  ARG A HB3  6  
ATOM 9733  H HG2  . ARG A 1 64  ? -4.957  4.764   -8.057  1.00 0.00 ? 64  ARG A HG2  6  
ATOM 9734  H HG3  . ARG A 1 64  ? -4.903  4.473   -6.329  1.00 0.00 ? 64  ARG A HG3  6  
ATOM 9735  H HD2  . ARG A 1 64  ? -4.090  2.347   -6.592  1.00 0.00 ? 64  ARG A HD2  6  
ATOM 9736  H HD3  . ARG A 1 64  ? -5.223  1.973   -7.876  1.00 0.00 ? 64  ARG A HD3  6  
ATOM 9737  H HE   . ARG A 1 64  ? -3.513  3.674   -9.161  1.00 0.00 ? 64  ARG A HE   6  
ATOM 9738  H HH11 . ARG A 1 64  ? -2.915  0.879   -7.109  1.00 0.00 ? 64  ARG A HH11 6  
ATOM 9739  H HH12 . ARG A 1 64  ? -1.427  0.462   -7.892  1.00 0.00 ? 64  ARG A HH12 6  
ATOM 9740  H HH21 . ARG A 1 64  ? -1.550  3.125   -10.194 1.00 0.00 ? 64  ARG A HH21 6  
ATOM 9741  H HH22 . ARG A 1 64  ? -0.646  1.748   -9.659  1.00 0.00 ? 64  ARG A HH22 6  
ATOM 9742  N N    . VAL A 1 65  ? -5.835  5.539   -4.547  1.00 0.00 ? 65  VAL A N    6  
ATOM 9743  C CA   . VAL A 1 65  ? -5.230  6.759   -4.041  1.00 0.00 ? 65  VAL A CA   6  
ATOM 9744  C C    . VAL A 1 65  ? -3.719  6.712   -4.280  1.00 0.00 ? 65  VAL A C    6  
ATOM 9745  O O    . VAL A 1 65  ? -3.151  5.638   -4.469  1.00 0.00 ? 65  VAL A O    6  
ATOM 9746  C CB   . VAL A 1 65  ? -5.597  6.953   -2.568  1.00 0.00 ? 65  VAL A CB   6  
ATOM 9747  C CG1  . VAL A 1 65  ? -4.887  5.923   -1.687  1.00 0.00 ? 65  VAL A CG1  6  
ATOM 9748  C CG2  . VAL A 1 65  ? -5.283  8.378   -2.108  1.00 0.00 ? 65  VAL A CG2  6  
ATOM 9749  H H    . VAL A 1 65  ? -5.473  4.694   -4.155  1.00 0.00 ? 65  VAL A H    6  
ATOM 9750  H HA   . VAL A 1 65  ? -5.648  7.593   -4.605  1.00 0.00 ? 65  VAL A HA   6  
ATOM 9751  H HB   . VAL A 1 65  ? -6.671  6.797   -2.467  1.00 0.00 ? 65  VAL A HB   6  
ATOM 9752  H HG11 . VAL A 1 65  ? -3.943  5.638   -2.150  1.00 0.00 ? 65  VAL A HG11 6  
ATOM 9753  H HG12 . VAL A 1 65  ? -4.694  6.357   -0.705  1.00 0.00 ? 65  VAL A HG12 6  
ATOM 9754  H HG13 . VAL A 1 65  ? -5.519  5.042   -1.577  1.00 0.00 ? 65  VAL A HG13 6  
ATOM 9755  H HG21 . VAL A 1 65  ? -4.250  8.430   -1.765  1.00 0.00 ? 65  VAL A HG21 6  
ATOM 9756  H HG22 . VAL A 1 65  ? -5.425  9.068   -2.940  1.00 0.00 ? 65  VAL A HG22 6  
ATOM 9757  H HG23 . VAL A 1 65  ? -5.952  8.651   -1.291  1.00 0.00 ? 65  VAL A HG23 6  
ATOM 9758  N N    . THR A 1 66  ? -3.113  7.889   -4.262  1.00 0.00 ? 66  THR A N    6  
ATOM 9759  C CA   . THR A 1 66  ? -1.679  7.996   -4.475  1.00 0.00 ? 66  THR A CA   6  
ATOM 9760  C C    . THR A 1 66  ? -1.023  8.752   -3.318  1.00 0.00 ? 66  THR A C    6  
ATOM 9761  O O    . THR A 1 66  ? -1.239  9.952   -3.155  1.00 0.00 ? 66  THR A O    6  
ATOM 9762  C CB   . THR A 1 66  ? -1.450  8.653   -5.837  1.00 0.00 ? 66  THR A CB   6  
ATOM 9763  O OG1  . THR A 1 66  ? -2.126  7.796   -6.754  1.00 0.00 ? 66  THR A OG1  6  
ATOM 9764  C CG2  . THR A 1 66  ? 0.013   8.590   -6.279  1.00 0.00 ? 66  THR A CG2  6  
ATOM 9765  H H    . THR A 1 66  ? -3.582  8.758   -4.108  1.00 0.00 ? 66  THR A H    6  
ATOM 9766  H HA   . THR A 1 66  ? -1.257  6.991   -4.480  1.00 0.00 ? 66  THR A HA   6  
ATOM 9767  H HB   . THR A 1 66  ? -1.815  9.680   -5.840  1.00 0.00 ? 66  THR A HB   6  
ATOM 9768  H HG1  . THR A 1 66  ? -2.809  8.315   -7.267  1.00 0.00 ? 66  THR A HG1  6  
ATOM 9769  H HG21 . THR A 1 66  ? 0.215   9.398   -6.982  1.00 0.00 ? 66  THR A HG21 6  
ATOM 9770  H HG22 . THR A 1 66  ? 0.660   8.696   -5.408  1.00 0.00 ? 66  THR A HG22 6  
ATOM 9771  H HG23 . THR A 1 66  ? 0.207   7.632   -6.761  1.00 0.00 ? 66  THR A HG23 6  
ATOM 9772  N N    . HIS A 1 67  ? -0.236  8.019   -2.544  1.00 0.00 ? 67  HIS A N    6  
ATOM 9773  C CA   . HIS A 1 67  ? 0.452   8.605   -1.407  1.00 0.00 ? 67  HIS A CA   6  
ATOM 9774  C C    . HIS A 1 67  ? 1.961   8.403   -1.560  1.00 0.00 ? 67  HIS A C    6  
ATOM 9775  O O    . HIS A 1 67  ? 2.401   7.488   -2.255  1.00 0.00 ? 67  HIS A O    6  
ATOM 9776  C CB   . HIS A 1 67  ? -0.091  8.042   -0.093  1.00 0.00 ? 67  HIS A CB   6  
ATOM 9777  C CG   . HIS A 1 67  ? -1.147  8.905   0.556   1.00 0.00 ? 67  HIS A CG   6  
ATOM 9778  N ND1  . HIS A 1 67  ? -1.120  10.288  0.505   1.00 0.00 ? 67  HIS A ND1  6  
ATOM 9779  C CD2  . HIS A 1 67  ? -2.259  8.568   1.270   1.00 0.00 ? 67  HIS A CD2  6  
ATOM 9780  C CE1  . HIS A 1 67  ? -2.173  10.751  1.162   1.00 0.00 ? 67  HIS A CE1  6  
ATOM 9781  N NE2  . HIS A 1 67  ? -2.877  9.684   1.636   1.00 0.00 ? 67  HIS A NE2  6  
ATOM 9782  H H    . HIS A 1 67  ? -0.066  7.043   -2.684  1.00 0.00 ? 67  HIS A H    6  
ATOM 9783  H HA   . HIS A 1 67  ? 0.234   9.673   -1.426  1.00 0.00 ? 67  HIS A HA   6  
ATOM 9784  H HB2  . HIS A 1 67  ? -0.510  7.052   -0.279  1.00 0.00 ? 67  HIS A HB2  6  
ATOM 9785  H HB3  . HIS A 1 67  ? 0.736   7.911   0.605   1.00 0.00 ? 67  HIS A HB3  6  
ATOM 9786  H HD1  . HIS A 1 67  ? -0.424  10.843  0.049   1.00 0.00 ? 67  HIS A HD1  6  
ATOM 9787  H HD2  . HIS A 1 67  ? -2.585  7.553   1.500   1.00 0.00 ? 67  HIS A HD2  6  
ATOM 9788  H HE1  . HIS A 1 67  ? -2.431  11.801  1.299   1.00 0.00 ? 67  HIS A HE1  6  
ATOM 9789  N N    . TYR A 1 68  ? 2.713   9.271   -0.899  1.00 0.00 ? 68  TYR A N    6  
ATOM 9790  C CA   . TYR A 1 68  ? 4.163   9.198   -0.953  1.00 0.00 ? 68  TYR A CA   6  
ATOM 9791  C C    . TYR A 1 68  ? 4.767   9.255   0.451   1.00 0.00 ? 68  TYR A C    6  
ATOM 9792  O O    . TYR A 1 68  ? 4.425   10.131  1.244   1.00 0.00 ? 68  TYR A O    6  
ATOM 9793  C CB   . TYR A 1 68  ? 4.617   10.429  -1.741  1.00 0.00 ? 68  TYR A CB   6  
ATOM 9794  C CG   . TYR A 1 68  ? 4.117   10.463  -3.186  1.00 0.00 ? 68  TYR A CG   6  
ATOM 9795  C CD1  . TYR A 1 68  ? 4.625   9.575   -4.113  1.00 0.00 ? 68  TYR A CD1  6  
ATOM 9796  C CD2  . TYR A 1 68  ? 3.157   11.380  -3.562  1.00 0.00 ? 68  TYR A CD2  6  
ATOM 9797  C CE1  . TYR A 1 68  ? 4.154   9.607   -5.473  1.00 0.00 ? 68  TYR A CE1  6  
ATOM 9798  C CE2  . TYR A 1 68  ? 2.686   11.412  -4.923  1.00 0.00 ? 68  TYR A CE2  6  
ATOM 9799  C CZ   . TYR A 1 68  ? 3.207   10.524  -5.811  1.00 0.00 ? 68  TYR A CZ   6  
ATOM 9800  O OH   . TYR A 1 68  ? 2.762   10.554  -7.096  1.00 0.00 ? 68  TYR A OH   6  
ATOM 9801  H H    . TYR A 1 68  ? 2.347   10.012  -0.336  1.00 0.00 ? 68  TYR A H    6  
ATOM 9802  H HA   . TYR A 1 68  ? 4.435   8.252   -1.420  1.00 0.00 ? 68  TYR A HA   6  
ATOM 9803  H HB2  . TYR A 1 68  ? 4.271   11.325  -1.226  1.00 0.00 ? 68  TYR A HB2  6  
ATOM 9804  H HB3  . TYR A 1 68  ? 5.707   10.464  -1.743  1.00 0.00 ? 68  TYR A HB3  6  
ATOM 9805  H HD1  . TYR A 1 68  ? 5.383   8.851   -3.815  1.00 0.00 ? 68  TYR A HD1  6  
ATOM 9806  H HD2  . TYR A 1 68  ? 2.756   12.081  -2.830  1.00 0.00 ? 68  TYR A HD2  6  
ATOM 9807  H HE1  . TYR A 1 68  ? 4.546   8.912   -6.216  1.00 0.00 ? 68  TYR A HE1  6  
ATOM 9808  H HE2  . TYR A 1 68  ? 1.928   12.131  -5.234  1.00 0.00 ? 68  TYR A HE2  6  
ATOM 9809  H HH   . TYR A 1 68  ? 2.635   11.500  -7.392  1.00 0.00 ? 68  TYR A HH   6  
ATOM 9810  N N    . LEU A 1 69  ? 5.656   8.308   0.717   1.00 0.00 ? 69  LEU A N    6  
ATOM 9811  C CA   . LEU A 1 69  ? 6.311   8.239   2.012   1.00 0.00 ? 69  LEU A CA   6  
ATOM 9812  C C    . LEU A 1 69  ? 7.828   8.234   1.812   1.00 0.00 ? 69  LEU A C    6  
ATOM 9813  O O    . LEU A 1 69  ? 8.313   7.918   0.726   1.00 0.00 ? 69  LEU A O    6  
ATOM 9814  C CB   . LEU A 1 69  ? 5.792   7.042   2.812   1.00 0.00 ? 69  LEU A CB   6  
ATOM 9815  C CG   . LEU A 1 69  ? 4.291   6.764   2.705   1.00 0.00 ? 69  LEU A CG   6  
ATOM 9816  C CD1  . LEU A 1 69  ? 3.980   5.302   3.031   1.00 0.00 ? 69  LEU A CD1  6  
ATOM 9817  C CD2  . LEU A 1 69  ? 3.491   7.730   3.581   1.00 0.00 ? 69  LEU A CD2  6  
ATOM 9818  H H    . LEU A 1 69  ? 5.929   7.599   0.067   1.00 0.00 ? 69  LEU A H    6  
ATOM 9819  H HA   . LEU A 1 69  ? 6.039   9.138   2.564   1.00 0.00 ? 69  LEU A HA   6  
ATOM 9820  H HB2  . LEU A 1 69  ? 6.330   6.152   2.486   1.00 0.00 ? 69  LEU A HB2  6  
ATOM 9821  H HB3  . LEU A 1 69  ? 6.039   7.198   3.862   1.00 0.00 ? 69  LEU A HB3  6  
ATOM 9822  H HG   . LEU A 1 69  ? 3.984   6.936   1.673   1.00 0.00 ? 69  LEU A HG   6  
ATOM 9823  H HD11 . LEU A 1 69  ? 4.812   4.869   3.586   1.00 0.00 ? 69  LEU A HD11 6  
ATOM 9824  H HD12 . LEU A 1 69  ? 3.075   5.250   3.636   1.00 0.00 ? 69  LEU A HD12 6  
ATOM 9825  H HD13 . LEU A 1 69  ? 3.831   4.747   2.105   1.00 0.00 ? 69  LEU A HD13 6  
ATOM 9826  H HD21 . LEU A 1 69  ? 3.988   7.843   4.545   1.00 0.00 ? 69  LEU A HD21 6  
ATOM 9827  H HD22 . LEU A 1 69  ? 3.429   8.701   3.089   1.00 0.00 ? 69  LEU A HD22 6  
ATOM 9828  H HD23 . LEU A 1 69  ? 2.487   7.335   3.734   1.00 0.00 ? 69  LEU A HD23 6  
ATOM 9829  N N    . PRO A 1 70  ? 8.553   8.596   2.904   1.00 0.00 ? 70  PRO A N    6  
ATOM 9830  C CA   . PRO A 1 70  ? 10.005  8.636   2.858   1.00 0.00 ? 70  PRO A CA   6  
ATOM 9831  C C    . PRO A 1 70  ? 10.593  7.224   2.893   1.00 0.00 ? 70  PRO A C    6  
ATOM 9832  O O    . PRO A 1 70  ? 9.857   6.243   2.988   1.00 0.00 ? 70  PRO A O    6  
ATOM 9833  C CB   . PRO A 1 70  ? 10.413  9.478   4.056   1.00 0.00 ? 70  PRO A CB   6  
ATOM 9834  C CG   . PRO A 1 70  ? 9.211   9.491   4.986   1.00 0.00 ? 70  PRO A CG   6  
ATOM 9835  C CD   . PRO A 1 70  ? 8.012   8.975   4.206   1.00 0.00 ? 70  PRO A CD   6  
ATOM 9836  H HA   . PRO A 1 70  ? 10.314  9.040   1.998   1.00 0.00 ? 70  PRO A HA   6  
ATOM 9837  H HB2  . PRO A 1 70  ? 11.286  9.055   4.552   1.00 0.00 ? 70  PRO A HB2  6  
ATOM 9838  H HB3  . PRO A 1 70  ? 10.679  10.490  3.749   1.00 0.00 ? 70  PRO A HB3  6  
ATOM 9839  H HG2  . PRO A 1 70  ? 9.396   8.864   5.858   1.00 0.00 ? 70  PRO A HG2  6  
ATOM 9840  H HG3  . PRO A 1 70  ? 9.022   10.500  5.353   1.00 0.00 ? 70  PRO A HG3  6  
ATOM 9841  H HD2  . PRO A 1 70  ? 7.550   8.124   4.706   1.00 0.00 ? 70  PRO A HD2  6  
ATOM 9842  H HD3  . PRO A 1 70  ? 7.244   9.742   4.107   1.00 0.00 ? 70  PRO A HD3  6  
ATOM 9843  N N    . ASN A 1 71  ? 11.915  7.166   2.813   1.00 0.00 ? 71  ASN A N    6  
ATOM 9844  C CA   . ASN A 1 71  ? 12.610  5.890   2.834   1.00 0.00 ? 71  ASN A CA   6  
ATOM 9845  C C    . ASN A 1 71  ? 12.858  5.473   4.285   1.00 0.00 ? 71  ASN A C    6  
ATOM 9846  O O    . ASN A 1 71  ? 13.704  4.621   4.553   1.00 0.00 ? 71  ASN A O    6  
ATOM 9847  C CB   . ASN A 1 71  ? 13.966  5.991   2.133   1.00 0.00 ? 71  ASN A CB   6  
ATOM 9848  C CG   . ASN A 1 71  ? 14.860  7.031   2.813   1.00 0.00 ? 71  ASN A CG   6  
ATOM 9849  O OD1  . ASN A 1 71  ? 14.397  7.980   3.424   1.00 0.00 ? 71  ASN A OD1  6  
ATOM 9850  N ND2  . ASN A 1 71  ? 16.162  6.799   2.673   1.00 0.00 ? 71  ASN A ND2  6  
ATOM 9851  H H    . ASN A 1 71  ? 12.506  7.969   2.736   1.00 0.00 ? 71  ASN A H    6  
ATOM 9852  H HA   . ASN A 1 71  ? 11.954  5.198   2.307   1.00 0.00 ? 71  ASN A HA   6  
ATOM 9853  H HB2  . ASN A 1 71  ? 14.460  5.019   2.145   1.00 0.00 ? 71  ASN A HB2  6  
ATOM 9854  H HB3  . ASN A 1 71  ? 13.820  6.261   1.087   1.00 0.00 ? 71  ASN A HB3  6  
ATOM 9855  H HD21 . ASN A 1 71  ? 16.476  6.001   2.159   1.00 0.00 ? 71  ASN A HD21 6  
ATOM 9856  H HD22 . ASN A 1 71  ? 16.827  7.424   3.083   1.00 0.00 ? 71  ASN A HD22 6  
ATOM 9857  N N    . VAL A 1 72  ? 12.106  6.093   5.182   1.00 0.00 ? 72  VAL A N    6  
ATOM 9858  C CA   . VAL A 1 72  ? 12.234  5.797   6.599   1.00 0.00 ? 72  VAL A CA   6  
ATOM 9859  C C    . VAL A 1 72  ? 10.951  5.124   7.092   1.00 0.00 ? 72  VAL A C    6  
ATOM 9860  O O    . VAL A 1 72  ? 10.958  4.440   8.115   1.00 0.00 ? 72  VAL A O    6  
ATOM 9861  C CB   . VAL A 1 72  ? 12.575  7.072   7.371   1.00 0.00 ? 72  VAL A CB   6  
ATOM 9862  C CG1  . VAL A 1 72  ? 13.801  7.765   6.772   1.00 0.00 ? 72  VAL A CG1  6  
ATOM 9863  C CG2  . VAL A 1 72  ? 11.377  8.022   7.419   1.00 0.00 ? 72  VAL A CG2  6  
ATOM 9864  H H    . VAL A 1 72  ? 11.421  6.785   4.955   1.00 0.00 ? 72  VAL A H    6  
ATOM 9865  H HA   . VAL A 1 72  ? 13.063  5.099   6.715   1.00 0.00 ? 72  VAL A HA   6  
ATOM 9866  H HB   . VAL A 1 72  ? 12.819  6.788   8.395   1.00 0.00 ? 72  VAL A HB   6  
ATOM 9867  H HG11 . VAL A 1 72  ? 13.630  7.950   5.711   1.00 0.00 ? 72  VAL A HG11 6  
ATOM 9868  H HG12 . VAL A 1 72  ? 13.970  8.712   7.283   1.00 0.00 ? 72  VAL A HG12 6  
ATOM 9869  H HG13 . VAL A 1 72  ? 14.675  7.125   6.893   1.00 0.00 ? 72  VAL A HG13 6  
ATOM 9870  H HG21 . VAL A 1 72  ? 10.454  7.442   7.430   1.00 0.00 ? 72  VAL A HG21 6  
ATOM 9871  H HG22 . VAL A 1 72  ? 11.433  8.633   8.321   1.00 0.00 ? 72  VAL A HG22 6  
ATOM 9872  H HG23 . VAL A 1 72  ? 11.390  8.668   6.541   1.00 0.00 ? 72  VAL A HG23 6  
ATOM 9873  N N    . THR A 1 73  ? 9.880   5.342   6.343   1.00 0.00 ? 73  THR A N    6  
ATOM 9874  C CA   . THR A 1 73  ? 8.593   4.766   6.691   1.00 0.00 ? 73  THR A CA   6  
ATOM 9875  C C    . THR A 1 73  ? 8.273   3.583   5.776   1.00 0.00 ? 73  THR A C    6  
ATOM 9876  O O    . THR A 1 73  ? 8.605   3.601   4.592   1.00 0.00 ? 73  THR A O    6  
ATOM 9877  C CB   . THR A 1 73  ? 7.545   5.880   6.633   1.00 0.00 ? 73  THR A CB   6  
ATOM 9878  O OG1  . THR A 1 73  ? 7.752   6.614   7.836   1.00 0.00 ? 73  THR A OG1  6  
ATOM 9879  C CG2  . THR A 1 73  ? 6.117   5.347   6.762   1.00 0.00 ? 73  THR A CG2  6  
ATOM 9880  H H    . THR A 1 73  ? 9.883   5.900   5.512   1.00 0.00 ? 73  THR A H    6  
ATOM 9881  H HA   . THR A 1 73  ? 8.654   4.377   7.707   1.00 0.00 ? 73  THR A HA   6  
ATOM 9882  H HB   . THR A 1 73  ? 7.658   6.474   5.726   1.00 0.00 ? 73  THR A HB   6  
ATOM 9883  H HG1  . THR A 1 73  ? 7.652   6.011   8.627   1.00 0.00 ? 73  THR A HG1  6  
ATOM 9884  H HG21 . THR A 1 73  ? 5.934   4.603   5.987   1.00 0.00 ? 73  THR A HG21 6  
ATOM 9885  H HG22 . THR A 1 73  ? 5.987   4.889   7.743   1.00 0.00 ? 73  THR A HG22 6  
ATOM 9886  H HG23 . THR A 1 73  ? 5.410   6.170   6.649   1.00 0.00 ? 73  THR A HG23 6  
ATOM 9887  N N    . LEU A 1 74  ? 7.632   2.581   6.360   1.00 0.00 ? 74  LEU A N    6  
ATOM 9888  C CA   . LEU A 1 74  ? 7.263   1.391   5.611   1.00 0.00 ? 74  LEU A CA   6  
ATOM 9889  C C    . LEU A 1 74  ? 5.840   0.976   5.990   1.00 0.00 ? 74  LEU A C    6  
ATOM 9890  O O    . LEU A 1 74  ? 5.399   -0.122  5.654   1.00 0.00 ? 74  LEU A O    6  
ATOM 9891  C CB   . LEU A 1 74  ? 8.301   0.286   5.818   1.00 0.00 ? 74  LEU A CB   6  
ATOM 9892  C CG   . LEU A 1 74  ? 9.759   0.742   5.907   1.00 0.00 ? 74  LEU A CG   6  
ATOM 9893  C CD1  . LEU A 1 74  ? 10.533  -0.092  6.929   1.00 0.00 ? 74  LEU A CD1  6  
ATOM 9894  C CD2  . LEU A 1 74  ? 10.424  0.725   4.529   1.00 0.00 ? 74  LEU A CD2  6  
ATOM 9895  H H    . LEU A 1 74  ? 7.365   2.573   7.323   1.00 0.00 ? 74  LEU A H    6  
ATOM 9896  H HA   . LEU A 1 74  ? 7.277   1.653   4.553   1.00 0.00 ? 74  LEU A HA   6  
ATOM 9897  H HB2  . LEU A 1 74  ? 8.053   -0.252  6.732   1.00 0.00 ? 74  LEU A HB2  6  
ATOM 9898  H HB3  . LEU A 1 74  ? 8.214   -0.425  4.996   1.00 0.00 ? 74  LEU A HB3  6  
ATOM 9899  H HG   . LEU A 1 74  ? 9.772   1.774   6.258   1.00 0.00 ? 74  LEU A HG   6  
ATOM 9900  H HD11 . LEU A 1 74  ? 11.031  -0.918  6.420   1.00 0.00 ? 74  LEU A HD11 6  
ATOM 9901  H HD12 . LEU A 1 74  ? 11.278  0.534   7.420   1.00 0.00 ? 74  LEU A HD12 6  
ATOM 9902  H HD13 . LEU A 1 74  ? 9.842   -0.488  7.673   1.00 0.00 ? 74  LEU A HD13 6  
ATOM 9903  H HD21 . LEU A 1 74  ? 9.674   0.518   3.766   1.00 0.00 ? 74  LEU A HD21 6  
ATOM 9904  H HD22 . LEU A 1 74  ? 10.883  1.694   4.335   1.00 0.00 ? 74  LEU A HD22 6  
ATOM 9905  H HD23 . LEU A 1 74  ? 11.190  -0.051  4.506   1.00 0.00 ? 74  LEU A HD23 6  
ATOM 9906  N N    . GLU A 1 75  ? 5.160   1.877   6.684   1.00 0.00 ? 75  GLU A N    6  
ATOM 9907  C CA   . GLU A 1 75  ? 3.796   1.619   7.111   1.00 0.00 ? 75  GLU A CA   6  
ATOM 9908  C C    . GLU A 1 75  ? 2.969   2.905   7.055   1.00 0.00 ? 75  GLU A C    6  
ATOM 9909  O O    . GLU A 1 75  ? 3.507   4.000   7.210   1.00 0.00 ? 75  GLU A O    6  
ATOM 9910  C CB   . GLU A 1 75  ? 3.767   1.009   8.514   1.00 0.00 ? 75  GLU A CB   6  
ATOM 9911  C CG   . GLU A 1 75  ? 4.232   2.022   9.562   1.00 0.00 ? 75  GLU A CG   6  
ATOM 9912  C CD   . GLU A 1 75  ? 5.644   1.696   10.052  1.00 0.00 ? 75  GLU A CD   6  
ATOM 9913  O OE1  . GLU A 1 75  ? 5.791   0.629   10.688  1.00 0.00 ? 75  GLU A OE1  6  
ATOM 9914  O OE2  . GLU A 1 75  ? 6.544   2.519   9.780   1.00 0.00 ? 75  GLU A OE2  6  
ATOM 9915  H H    . GLU A 1 75  ? 5.526   2.768   6.953   1.00 0.00 ? 75  GLU A H    6  
ATOM 9916  H HA   . GLU A 1 75  ? 3.401   0.894   6.399   1.00 0.00 ? 75  GLU A HA   6  
ATOM 9917  H HB2  . GLU A 1 75  ? 2.756   0.675   8.749   1.00 0.00 ? 75  GLU A HB2  6  
ATOM 9918  H HB3  . GLU A 1 75  ? 4.408   0.128   8.545   1.00 0.00 ? 75  GLU A HB3  6  
ATOM 9919  H HG2  . GLU A 1 75  ? 4.214   3.026   9.136   1.00 0.00 ? 75  GLU A HG2  6  
ATOM 9920  H HG3  . GLU A 1 75  ? 3.541   2.022   10.405  1.00 0.00 ? 75  GLU A HG3  6  
ATOM 9921  N N    . TYR A 1 76  ? 1.675   2.730   6.834   1.00 0.00 ? 76  TYR A N    6  
ATOM 9922  C CA   . TYR A 1 76  ? 0.768   3.863   6.756   1.00 0.00 ? 76  TYR A CA   6  
ATOM 9923  C C    . TYR A 1 76  ? -0.671  3.436   7.052   1.00 0.00 ? 76  TYR A C    6  
ATOM 9924  O O    . TYR A 1 76  ? -1.031  2.276   6.854   1.00 0.00 ? 76  TYR A O    6  
ATOM 9925  C CB   . TYR A 1 76  ? 0.851   4.370   5.314   1.00 0.00 ? 76  TYR A CB   6  
ATOM 9926  C CG   . TYR A 1 76  ? -0.043  5.578   5.028   1.00 0.00 ? 76  TYR A CG   6  
ATOM 9927  C CD1  . TYR A 1 76  ? -1.351  5.391   4.630   1.00 0.00 ? 76  TYR A CD1  6  
ATOM 9928  C CD2  . TYR A 1 76  ? 0.460   6.856   5.167   1.00 0.00 ? 76  TYR A CD2  6  
ATOM 9929  C CE1  . TYR A 1 76  ? -2.192  6.528   4.361   1.00 0.00 ? 76  TYR A CE1  6  
ATOM 9930  C CE2  . TYR A 1 76  ? -0.381  7.994   4.897   1.00 0.00 ? 76  TYR A CE2  6  
ATOM 9931  C CZ   . TYR A 1 76  ? -1.665  7.774   4.507   1.00 0.00 ? 76  TYR A CZ   6  
ATOM 9932  O OH   . TYR A 1 76  ? -2.459  8.848   4.253   1.00 0.00 ? 76  TYR A OH   6  
ATOM 9933  H H    . TYR A 1 76  ? 1.245   1.835   6.709   1.00 0.00 ? 76  TYR A H    6  
ATOM 9934  H HA   . TYR A 1 76  ? 1.082   4.596   7.498   1.00 0.00 ? 76  TYR A HA   6  
ATOM 9935  H HB2  . TYR A 1 76  ? 1.884   4.634   5.091   1.00 0.00 ? 76  TYR A HB2  6  
ATOM 9936  H HB3  . TYR A 1 76  ? 0.576   3.560   4.639   1.00 0.00 ? 76  TYR A HB3  6  
ATOM 9937  H HD1  . TYR A 1 76  ? -1.748  4.381   4.520   1.00 0.00 ? 76  TYR A HD1  6  
ATOM 9938  H HD2  . TYR A 1 76  ? 1.493   7.004   5.481   1.00 0.00 ? 76  TYR A HD2  6  
ATOM 9939  H HE1  . TYR A 1 76  ? -3.226  6.394   4.046   1.00 0.00 ? 76  TYR A HE1  6  
ATOM 9940  H HE2  . TYR A 1 76  ? 0.003   9.008   5.003   1.00 0.00 ? 76  TYR A HE2  6  
ATOM 9941  H HH   . TYR A 1 76  ? -1.900  9.627   3.970   1.00 0.00 ? 76  TYR A HH   6  
ATOM 9942  N N    . ARG A 1 77  ? -1.454  4.395   7.522   1.00 0.00 ? 77  ARG A N    6  
ATOM 9943  C CA   . ARG A 1 77  ? -2.845  4.133   7.848   1.00 0.00 ? 77  ARG A CA   6  
ATOM 9944  C C    . ARG A 1 77  ? -3.743  4.477   6.657   1.00 0.00 ? 77  ARG A C    6  
ATOM 9945  O O    . ARG A 1 77  ? -3.704  5.596   6.149   1.00 0.00 ? 77  ARG A O    6  
ATOM 9946  C CB   . ARG A 1 77  ? -3.289  4.948   9.064   1.00 0.00 ? 77  ARG A CB   6  
ATOM 9947  C CG   . ARG A 1 77  ? -4.712  4.573   9.485   1.00 0.00 ? 77  ARG A CG   6  
ATOM 9948  C CD   . ARG A 1 77  ? -4.772  4.240   10.977  1.00 0.00 ? 77  ARG A CD   6  
ATOM 9949  N NE   . ARG A 1 77  ? -4.105  5.303   11.761  1.00 0.00 ? 77  ARG A NE   6  
ATOM 9950  C CZ   . ARG A 1 77  ? -4.635  6.513   11.989  1.00 0.00 ? 77  ARG A CZ   6  
ATOM 9951  N NH1  . ARG A 1 77  ? -5.842  6.820   11.494  1.00 0.00 ? 77  ARG A NH1  6  
ATOM 9952  N NH2  . ARG A 1 77  ? -3.958  7.416   12.712  1.00 0.00 ? 77  ARG A NH2  6  
ATOM 9953  H H    . ARG A 1 77  ? -1.153  5.336   7.680   1.00 0.00 ? 77  ARG A H    6  
ATOM 9954  H HA   . ARG A 1 77  ? -2.883  3.067   8.072   1.00 0.00 ? 77  ARG A HA   6  
ATOM 9955  H HB2  . ARG A 1 77  ? -2.603  4.773   9.893   1.00 0.00 ? 77  ARG A HB2  6  
ATOM 9956  H HB3  . ARG A 1 77  ? -3.243  6.011   8.831   1.00 0.00 ? 77  ARG A HB3  6  
ATOM 9957  H HG2  . ARG A 1 77  ? -5.389  5.399   9.266   1.00 0.00 ? 77  ARG A HG2  6  
ATOM 9958  H HG3  . ARG A 1 77  ? -5.054  3.718   8.904   1.00 0.00 ? 77  ARG A HG3  6  
ATOM 9959  H HD2  . ARG A 1 77  ? -5.810  4.139   11.294  1.00 0.00 ? 77  ARG A HD2  6  
ATOM 9960  H HD3  . ARG A 1 77  ? -4.288  3.281   11.164  1.00 0.00 ? 77  ARG A HD3  6  
ATOM 9961  H HE   . ARG A 1 77  ? -3.203  5.107   12.145  1.00 0.00 ? 77  ARG A HE   6  
ATOM 9962  H HH11 . ARG A 1 77  ? -6.347  6.146   10.954  1.00 0.00 ? 77  ARG A HH11 6  
ATOM 9963  H HH12 . ARG A 1 77  ? -6.237  7.723   11.663  1.00 0.00 ? 77  ARG A HH12 6  
ATOM 9964  H HH21 . ARG A 1 77  ? -3.057  7.187   13.081  1.00 0.00 ? 77  ARG A HH21 6  
ATOM 9965  H HH22 . ARG A 1 77  ? -4.353  8.319   12.881  1.00 0.00 ? 77  ARG A HH22 6  
ATOM 9966  N N    . VAL A 1 78  ? -4.531  3.494   6.248   1.00 0.00 ? 78  VAL A N    6  
ATOM 9967  C CA   . VAL A 1 78  ? -5.437  3.679   5.127   1.00 0.00 ? 78  VAL A CA   6  
ATOM 9968  C C    . VAL A 1 78  ? -6.829  4.030   5.654   1.00 0.00 ? 78  VAL A C    6  
ATOM 9969  O O    . VAL A 1 78  ? -7.228  3.566   6.722   1.00 0.00 ? 78  VAL A O    6  
ATOM 9970  C CB   . VAL A 1 78  ? -5.431  2.433   4.238   1.00 0.00 ? 78  VAL A CB   6  
ATOM 9971  C CG1  . VAL A 1 78  ? -6.429  2.576   3.087   1.00 0.00 ? 78  VAL A CG1  6  
ATOM 9972  C CG2  . VAL A 1 78  ? -4.024  2.142   3.712   1.00 0.00 ? 78  VAL A CG2  6  
ATOM 9973  H H    . VAL A 1 78  ? -4.557  2.587   6.667   1.00 0.00 ? 78  VAL A H    6  
ATOM 9974  H HA   . VAL A 1 78  ? -5.064  4.516   4.537   1.00 0.00 ? 78  VAL A HA   6  
ATOM 9975  H HB   . VAL A 1 78  ? -5.742  1.585   4.848   1.00 0.00 ? 78  VAL A HB   6  
ATOM 9976  H HG11 . VAL A 1 78  ? -6.116  1.945   2.255   1.00 0.00 ? 78  VAL A HG11 6  
ATOM 9977  H HG12 . VAL A 1 78  ? -7.419  2.268   3.424   1.00 0.00 ? 78  VAL A HG12 6  
ATOM 9978  H HG13 . VAL A 1 78  ? -6.462  3.616   2.762   1.00 0.00 ? 78  VAL A HG13 6  
ATOM 9979  H HG21 . VAL A 1 78  ? -3.597  3.053   3.295   1.00 0.00 ? 78  VAL A HG21 6  
ATOM 9980  H HG22 . VAL A 1 78  ? -3.397  1.787   4.529   1.00 0.00 ? 78  VAL A HG22 6  
ATOM 9981  H HG23 . VAL A 1 78  ? -4.078  1.378   2.936   1.00 0.00 ? 78  VAL A HG23 6  
ATOM 9982  N N    . THR A 1 79  ? -7.531  4.847   4.883   1.00 0.00 ? 79  THR A N    6  
ATOM 9983  C CA   . THR A 1 79  ? -8.871  5.266   5.259   1.00 0.00 ? 79  THR A CA   6  
ATOM 9984  C C    . THR A 1 79  ? -9.688  5.620   4.015   1.00 0.00 ? 79  THR A C    6  
ATOM 9985  O O    . THR A 1 79  ? -9.138  6.092   3.021   1.00 0.00 ? 79  THR A O    6  
ATOM 9986  C CB   . THR A 1 79  ? -8.743  6.423   6.252   1.00 0.00 ? 79  THR A CB   6  
ATOM 9987  O OG1  . THR A 1 79  ? -8.024  7.420   5.532   1.00 0.00 ? 79  THR A OG1  6  
ATOM 9988  C CG2  . THR A 1 79  ? -7.829  6.084   7.431   1.00 0.00 ? 79  THR A CG2  6  
ATOM 9989  H H    . THR A 1 79  ? -7.200  5.220   4.016   1.00 0.00 ? 79  THR A H    6  
ATOM 9990  H HA   . THR A 1 79  ? -9.371  4.426   5.741   1.00 0.00 ? 79  THR A HA   6  
ATOM 9991  H HB   . THR A 1 79  ? -9.723  6.747   6.600   1.00 0.00 ? 79  THR A HB   6  
ATOM 9992  H HG1  . THR A 1 79  ? -8.632  7.879   4.884   1.00 0.00 ? 79  THR A HG1  6  
ATOM 9993  H HG21 . THR A 1 79  ? -7.865  6.891   8.163   1.00 0.00 ? 79  THR A HG21 6  
ATOM 9994  H HG22 . THR A 1 79  ? -8.164  5.157   7.896   1.00 0.00 ? 79  THR A HG22 6  
ATOM 9995  H HG23 . THR A 1 79  ? -6.806  5.962   7.075   1.00 0.00 ? 79  THR A HG23 6  
ATOM 9996  N N    . GLY A 1 80  ? -10.987 5.380   4.111   1.00 0.00 ? 80  GLY A N    6  
ATOM 9997  C CA   . GLY A 1 80  ? -11.886 5.668   3.006   1.00 0.00 ? 80  GLY A CA   6  
ATOM 9998  C C    . GLY A 1 80  ? -12.231 4.393   2.234   1.00 0.00 ? 80  GLY A C    6  
ATOM 9999  O O    . GLY A 1 80  ? -12.553 4.449   1.048   1.00 0.00 ? 80  GLY A O    6  
ATOM 10000 H H    . GLY A 1 80  ? -11.426 4.996   4.924   1.00 0.00 ? 80  GLY A H    6  
ATOM 10001 H HA2  . GLY A 1 80  ? -12.799 6.126   3.386   1.00 0.00 ? 80  GLY A HA2  6  
ATOM 10002 H HA3  . GLY A 1 80  ? -11.422 6.390   2.335   1.00 0.00 ? 80  GLY A HA3  6  
ATOM 10003 N N    . LEU A 1 81  ? -12.152 3.273   2.938   1.00 0.00 ? 81  LEU A N    6  
ATOM 10004 C CA   . LEU A 1 81  ? -12.453 1.987   2.333   1.00 0.00 ? 81  LEU A CA   6  
ATOM 10005 C C    . LEU A 1 81  ? -13.942 1.681   2.508   1.00 0.00 ? 81  LEU A C    6  
ATOM 10006 O O    . LEU A 1 81  ? -14.756 2.594   2.630   1.00 0.00 ? 81  LEU A O    6  
ATOM 10007 C CB   . LEU A 1 81  ? -11.532 0.902   2.896   1.00 0.00 ? 81  LEU A CB   6  
ATOM 10008 C CG   . LEU A 1 81  ? -10.104 1.340   3.227   1.00 0.00 ? 81  LEU A CG   6  
ATOM 10009 C CD1  . LEU A 1 81  ? -9.529  0.512   4.378   1.00 0.00 ? 81  LEU A CD1  6  
ATOM 10010 C CD2  . LEU A 1 81  ? -9.213  1.290   1.984   1.00 0.00 ? 81  LEU A CD2  6  
ATOM 10011 H H    . LEU A 1 81  ? -11.890 3.236   3.902   1.00 0.00 ? 81  LEU A H    6  
ATOM 10012 H HA   . LEU A 1 81  ? -12.240 2.069   1.267   1.00 0.00 ? 81  LEU A HA   6  
ATOM 10013 H HB2  . LEU A 1 81  ? -11.987 0.501   3.802   1.00 0.00 ? 81  LEU A HB2  6  
ATOM 10014 H HB3  . LEU A 1 81  ? -11.483 0.085   2.176   1.00 0.00 ? 81  LEU A HB3  6  
ATOM 10015 H HG   . LEU A 1 81  ? -10.133 2.377   3.560   1.00 0.00 ? 81  LEU A HG   6  
ATOM 10016 H HD11 . LEU A 1 81  ? -9.230  1.175   5.189   1.00 0.00 ? 81  LEU A HD11 6  
ATOM 10017 H HD12 . LEU A 1 81  ? -10.286 -0.185  4.738   1.00 0.00 ? 81  LEU A HD12 6  
ATOM 10018 H HD13 . LEU A 1 81  ? -8.661  -0.046  4.026   1.00 0.00 ? 81  LEU A HD13 6  
ATOM 10019 H HD21 . LEU A 1 81  ? -8.823  2.286   1.776   1.00 0.00 ? 81  LEU A HD21 6  
ATOM 10020 H HD22 . LEU A 1 81  ? -8.385  0.603   2.158   1.00 0.00 ? 81  LEU A HD22 6  
ATOM 10021 H HD23 . LEU A 1 81  ? -9.798  0.944   1.131   1.00 0.00 ? 81  LEU A HD23 6  
ATOM 10022 N N    . THR A 1 82  ? -14.252 0.393   2.515   1.00 0.00 ? 82  THR A N    6  
ATOM 10023 C CA   . THR A 1 82  ? -15.628 -0.045  2.673   1.00 0.00 ? 82  THR A CA   6  
ATOM 10024 C C    . THR A 1 82  ? -15.706 -1.220  3.650   1.00 0.00 ? 82  THR A C    6  
ATOM 10025 O O    . THR A 1 82  ? -14.837 -2.091  3.649   1.00 0.00 ? 82  THR A O    6  
ATOM 10026 C CB   . THR A 1 82  ? -16.183 -0.371  1.285   1.00 0.00 ? 82  THR A CB   6  
ATOM 10027 O OG1  . THR A 1 82  ? -15.930 0.807   0.524   1.00 0.00 ? 82  THR A OG1  6  
ATOM 10028 C CG2  . THR A 1 82  ? -17.708 -0.498  1.278   1.00 0.00 ? 82  THR A CG2  6  
ATOM 10029 H H    . THR A 1 82  ? -13.583 -0.344  2.415   1.00 0.00 ? 82  THR A H    6  
ATOM 10030 H HA   . THR A 1 82  ? -16.201 0.773   3.110   1.00 0.00 ? 82  THR A HA   6  
ATOM 10031 H HB   . THR A 1 82  ? -15.715 -1.268  0.880   1.00 0.00 ? 82  THR A HB   6  
ATOM 10032 H HG1  . THR A 1 82  ? -16.505 1.557   0.853   1.00 0.00 ? 82  THR A HG1  6  
ATOM 10033 H HG21 . THR A 1 82  ? -18.054 -0.670  0.259   1.00 0.00 ? 82  THR A HG21 6  
ATOM 10034 H HG22 . THR A 1 82  ? -18.005 -1.336  1.910   1.00 0.00 ? 82  THR A HG22 6  
ATOM 10035 H HG23 . THR A 1 82  ? -18.151 0.421   1.662   1.00 0.00 ? 82  THR A HG23 6  
ATOM 10036 N N    . ALA A 1 83  ? -16.754 -1.206  4.460   1.00 0.00 ? 83  ALA A N    6  
ATOM 10037 C CA   . ALA A 1 83  ? -16.956 -2.260  5.440   1.00 0.00 ? 83  ALA A CA   6  
ATOM 10038 C C    . ALA A 1 83  ? -17.130 -3.596  4.716   1.00 0.00 ? 83  ALA A C    6  
ATOM 10039 O O    . ALA A 1 83  ? -17.745 -3.655  3.653   1.00 0.00 ? 83  ALA A O    6  
ATOM 10040 C CB   . ALA A 1 83  ? -18.158 -1.913  6.322   1.00 0.00 ? 83  ALA A CB   6  
ATOM 10041 H H    . ALA A 1 83  ? -17.456 -0.494  4.454   1.00 0.00 ? 83  ALA A H    6  
ATOM 10042 H HA   . ALA A 1 83  ? -16.064 -2.307  6.065   1.00 0.00 ? 83  ALA A HA   6  
ATOM 10043 H HB1  . ALA A 1 83  ? -18.068 -0.884  6.670   1.00 0.00 ? 83  ALA A HB1  6  
ATOM 10044 H HB2  . ALA A 1 83  ? -19.076 -2.023  5.744   1.00 0.00 ? 83  ALA A HB2  6  
ATOM 10045 H HB3  . ALA A 1 83  ? -18.185 -2.586  7.179   1.00 0.00 ? 83  ALA A HB3  6  
ATOM 10046 N N    . LEU A 1 84  ? -16.577 -4.637  5.322   1.00 0.00 ? 84  LEU A N    6  
ATOM 10047 C CA   . LEU A 1 84  ? -16.664 -5.969  4.749   1.00 0.00 ? 84  LEU A CA   6  
ATOM 10048 C C    . LEU A 1 84  ? -16.519 -5.876  3.229   1.00 0.00 ? 84  LEU A C    6  
ATOM 10049 O O    . LEU A 1 84  ? -17.431 -6.248  2.491   1.00 0.00 ? 84  LEU A O    6  
ATOM 10050 C CB   . LEU A 1 84  ? -17.948 -6.666  5.203   1.00 0.00 ? 84  LEU A CB   6  
ATOM 10051 C CG   . LEU A 1 84  ? -18.160 -6.763  6.715   1.00 0.00 ? 84  LEU A CG   6  
ATOM 10052 C CD1  . LEU A 1 84  ? -19.288 -7.740  7.049   1.00 0.00 ? 84  LEU A CD1  6  
ATOM 10053 C CD2  . LEU A 1 84  ? -16.856 -7.126  7.429   1.00 0.00 ? 84  LEU A CD2  6  
ATOM 10054 H H    . LEU A 1 84  ? -16.079 -4.581  6.187   1.00 0.00 ? 84  LEU A H    6  
ATOM 10055 H HA   . LEU A 1 84  ? -15.827 -6.548  5.140   1.00 0.00 ? 84  LEU A HA   6  
ATOM 10056 H HB2  . LEU A 1 84  ? -18.797 -6.137  4.770   1.00 0.00 ? 84  LEU A HB2  6  
ATOM 10057 H HB3  . LEU A 1 84  ? -17.957 -7.674  4.790   1.00 0.00 ? 84  LEU A HB3  6  
ATOM 10058 H HG   . LEU A 1 84  ? -18.465 -5.782  7.081   1.00 0.00 ? 84  LEU A HG   6  
ATOM 10059 H HD11 . LEU A 1 84  ? -20.065 -7.673  6.288   1.00 0.00 ? 84  LEU A HD11 6  
ATOM 10060 H HD12 . LEU A 1 84  ? -18.893 -8.756  7.077   1.00 0.00 ? 84  LEU A HD12 6  
ATOM 10061 H HD13 . LEU A 1 84  ? -19.711 -7.489  8.022   1.00 0.00 ? 84  LEU A HD13 6  
ATOM 10062 H HD21 . LEU A 1 84  ? -17.069 -7.378  8.468   1.00 0.00 ? 84  LEU A HD21 6  
ATOM 10063 H HD22 . LEU A 1 84  ? -16.397 -7.982  6.934   1.00 0.00 ? 84  LEU A HD22 6  
ATOM 10064 H HD23 . LEU A 1 84  ? -16.174 -6.277  7.394   1.00 0.00 ? 84  LEU A HD23 6  
ATOM 10065 N N    . THR A 1 85  ? -15.367 -5.377  2.805   1.00 0.00 ? 85  THR A N    6  
ATOM 10066 C CA   . THR A 1 85  ? -15.092 -5.230  1.386   1.00 0.00 ? 85  THR A CA   6  
ATOM 10067 C C    . THR A 1 85  ? -13.628 -5.560  1.090   1.00 0.00 ? 85  THR A C    6  
ATOM 10068 O O    . THR A 1 85  ? -12.741 -5.219  1.871   1.00 0.00 ? 85  THR A O    6  
ATOM 10069 C CB   . THR A 1 85  ? -15.492 -3.813  0.971   1.00 0.00 ? 85  THR A CB   6  
ATOM 10070 O OG1  . THR A 1 85  ? -16.913 -3.865  0.881   1.00 0.00 ? 85  THR A OG1  6  
ATOM 10071 C CG2  . THR A 1 85  ? -15.041 -3.470  -0.450  1.00 0.00 ? 85  THR A CG2  6  
ATOM 10072 H H    . THR A 1 85  ? -14.631 -5.077  3.412   1.00 0.00 ? 85  THR A H    6  
ATOM 10073 H HA   . THR A 1 85  ? -15.699 -5.954  0.842   1.00 0.00 ? 85  THR A HA   6  
ATOM 10074 H HB   . THR A 1 85  ? -15.120 -3.079  1.686   1.00 0.00 ? 85  THR A HB   6  
ATOM 10075 H HG1  . THR A 1 85  ? -17.285 -2.940  0.801   1.00 0.00 ? 85  THR A HG1  6  
ATOM 10076 H HG21 . THR A 1 85  ? -14.588 -2.478  -0.459  1.00 0.00 ? 85  THR A HG21 6  
ATOM 10077 H HG22 . THR A 1 85  ? -14.311 -4.205  -0.787  1.00 0.00 ? 85  THR A HG22 6  
ATOM 10078 H HG23 . THR A 1 85  ? -15.903 -3.481  -1.118  1.00 0.00 ? 85  THR A HG23 6  
ATOM 10079 N N    . THR A 1 86  ? -13.420 -6.220  -0.040  1.00 0.00 ? 86  THR A N    6  
ATOM 10080 C CA   . THR A 1 86  ? -12.078 -6.599  -0.449  1.00 0.00 ? 86  THR A CA   6  
ATOM 10081 C C    . THR A 1 86  ? -11.344 -5.399  -1.049  1.00 0.00 ? 86  THR A C    6  
ATOM 10082 O O    . THR A 1 86  ? -11.904 -4.668  -1.864  1.00 0.00 ? 86  THR A O    6  
ATOM 10083 C CB   . THR A 1 86  ? -12.194 -7.783  -1.411  1.00 0.00 ? 86  THR A CB   6  
ATOM 10084 O OG1  . THR A 1 86  ? -12.786 -8.813  -0.624  1.00 0.00 ? 86  THR A OG1  6  
ATOM 10085 C CG2  . THR A 1 86  ? -10.830 -8.353  -1.805  1.00 0.00 ? 86  THR A CG2  6  
ATOM 10086 H H    . THR A 1 86  ? -14.147 -6.494  -0.670  1.00 0.00 ? 86  THR A H    6  
ATOM 10087 H HA   . THR A 1 86  ? -11.522 -6.904  0.438   1.00 0.00 ? 86  THR A HA   6  
ATOM 10088 H HB   . THR A 1 86  ? -12.773 -7.512  -2.294  1.00 0.00 ? 86  THR A HB   6  
ATOM 10089 H HG1  . THR A 1 86  ? -13.713 -8.549  -0.356  1.00 0.00 ? 86  THR A HG1  6  
ATOM 10090 H HG21 . THR A 1 86  ? -10.960 -9.090  -2.598  1.00 0.00 ? 86  THR A HG21 6  
ATOM 10091 H HG22 . THR A 1 86  ? -10.188 -7.547  -2.160  1.00 0.00 ? 86  THR A HG22 6  
ATOM 10092 H HG23 . THR A 1 86  ? -10.371 -8.829  -0.939  1.00 0.00 ? 86  THR A HG23 6  
ATOM 10093 N N    . TYR A 1 87  ? -10.100 -5.233  -0.623  1.00 0.00 ? 87  TYR A N    6  
ATOM 10094 C CA   . TYR A 1 87  ? -9.283  -4.133  -1.108  1.00 0.00 ? 87  TYR A CA   6  
ATOM 10095 C C    . TYR A 1 87  ? -7.861  -4.603  -1.418  1.00 0.00 ? 87  TYR A C    6  
ATOM 10096 O O    . TYR A 1 87  ? -7.446  -5.674  -0.977  1.00 0.00 ? 87  TYR A O    6  
ATOM 10097 C CB   . TYR A 1 87  ? -9.234  -3.111  0.029   1.00 0.00 ? 87  TYR A CB   6  
ATOM 10098 C CG   . TYR A 1 87  ? -10.412 -2.135  0.041   1.00 0.00 ? 87  TYR A CG   6  
ATOM 10099 C CD1  . TYR A 1 87  ? -11.592 -2.486  0.665   1.00 0.00 ? 87  TYR A CD1  6  
ATOM 10100 C CD2  . TYR A 1 87  ? -10.295 -0.905  -0.573  1.00 0.00 ? 87  TYR A CD2  6  
ATOM 10101 C CE1  . TYR A 1 87  ? -12.701 -1.567  0.676   1.00 0.00 ? 87  TYR A CE1  6  
ATOM 10102 C CE2  . TYR A 1 87  ? -11.404 0.013   -0.563  1.00 0.00 ? 87  TYR A CE2  6  
ATOM 10103 C CZ   . TYR A 1 87  ? -12.553 -0.363  0.062   1.00 0.00 ? 87  TYR A CZ   6  
ATOM 10104 O OH   . TYR A 1 87  ? -13.600 0.504   0.072   1.00 0.00 ? 87  TYR A OH   6  
ATOM 10105 H H    . TYR A 1 87  ? -9.652  -5.832  0.040   1.00 0.00 ? 87  TYR A H    6  
ATOM 10106 H HA   . TYR A 1 87  ? -9.740  -3.753  -2.022  1.00 0.00 ? 87  TYR A HA   6  
ATOM 10107 H HB2  . TYR A 1 87  ? -9.206  -3.642  0.981   1.00 0.00 ? 87  TYR A HB2  6  
ATOM 10108 H HB3  . TYR A 1 87  ? -8.306  -2.544  -0.046  1.00 0.00 ? 87  TYR A HB3  6  
ATOM 10109 H HD1  . TYR A 1 87  ? -11.684 -3.457  1.151   1.00 0.00 ? 87  TYR A HD1  6  
ATOM 10110 H HD2  . TYR A 1 87  ? -9.364  -0.629  -1.067  1.00 0.00 ? 87  TYR A HD2  6  
ATOM 10111 H HE1  . TYR A 1 87  ? -13.638 -1.831  1.166   1.00 0.00 ? 87  TYR A HE1  6  
ATOM 10112 H HE2  . TYR A 1 87  ? -11.326 0.988   -1.044  1.00 0.00 ? 87  TYR A HE2  6  
ATOM 10113 H HH   . TYR A 1 87  ? -14.081 0.469   -0.804  1.00 0.00 ? 87  TYR A HH   6  
ATOM 10114 N N    . THR A 1 88  ? -7.151  -3.778  -2.175  1.00 0.00 ? 88  THR A N    6  
ATOM 10115 C CA   . THR A 1 88  ? -5.784  -4.096  -2.549  1.00 0.00 ? 88  THR A CA   6  
ATOM 10116 C C    . THR A 1 88  ? -4.860  -2.914  -2.246  1.00 0.00 ? 88  THR A C    6  
ATOM 10117 O O    . THR A 1 88  ? -5.099  -1.800  -2.709  1.00 0.00 ? 88  THR A O    6  
ATOM 10118 C CB   . THR A 1 88  ? -5.780  -4.507  -4.023  1.00 0.00 ? 88  THR A CB   6  
ATOM 10119 O OG1  . THR A 1 88  ? -5.988  -5.917  -3.990  1.00 0.00 ? 88  THR A OG1  6  
ATOM 10120 C CG2  . THR A 1 88  ? -4.404  -4.348  -4.672  1.00 0.00 ? 88  THR A CG2  6  
ATOM 10121 H H    . THR A 1 88  ? -7.496  -2.909  -2.529  1.00 0.00 ? 88  THR A H    6  
ATOM 10122 H HA   . THR A 1 88  ? -5.445  -4.931  -1.937  1.00 0.00 ? 88  THR A HA   6  
ATOM 10123 H HB   . THR A 1 88  ? -6.540  -3.961  -4.581  1.00 0.00 ? 88  THR A HB   6  
ATOM 10124 H HG1  . THR A 1 88  ? -5.328  -6.345  -3.373  1.00 0.00 ? 88  THR A HG1  6  
ATOM 10125 H HG21 . THR A 1 88  ? -4.402  -4.841  -5.644  1.00 0.00 ? 88  THR A HG21 6  
ATOM 10126 H HG22 . THR A 1 88  ? -4.184  -3.289  -4.801  1.00 0.00 ? 88  THR A HG22 6  
ATOM 10127 H HG23 . THR A 1 88  ? -3.646  -4.801  -4.033  1.00 0.00 ? 88  THR A HG23 6  
ATOM 10128 N N    . ILE A 1 89  ? -3.824  -3.198  -1.471  1.00 0.00 ? 89  ILE A N    6  
ATOM 10129 C CA   . ILE A 1 89  ? -2.863  -2.173  -1.100  1.00 0.00 ? 89  ILE A CA   6  
ATOM 10130 C C    . ILE A 1 89  ? -1.543  -2.431  -1.829  1.00 0.00 ? 89  ILE A C    6  
ATOM 10131 O O    . ILE A 1 89  ? -0.895  -3.452  -1.604  1.00 0.00 ? 89  ILE A O    6  
ATOM 10132 C CB   . ILE A 1 89  ? -2.722  -2.096  0.421   1.00 0.00 ? 89  ILE A CB   6  
ATOM 10133 C CG1  . ILE A 1 89  ? -4.082  -2.236  1.106   1.00 0.00 ? 89  ILE A CG1  6  
ATOM 10134 C CG2  . ILE A 1 89  ? -1.998  -0.815  0.840   1.00 0.00 ? 89  ILE A CG2  6  
ATOM 10135 C CD1  . ILE A 1 89  ? -5.139  -1.378  0.408   1.00 0.00 ? 89  ILE A CD1  6  
ATOM 10136 H H    . ILE A 1 89  ? -3.637  -4.107  -1.098  1.00 0.00 ? 89  ILE A H    6  
ATOM 10137 H HA   . ILE A 1 89  ? -3.262  -1.215  -1.436  1.00 0.00 ? 89  ILE A HA   6  
ATOM 10138 H HB   . ILE A 1 89  ? -2.108  -2.934  0.750   1.00 0.00 ? 89  ILE A HB   6  
ATOM 10139 H HG12 . ILE A 1 89  ? -4.393  -3.281  1.097   1.00 0.00 ? 89  ILE A HG12 6  
ATOM 10140 H HG13 . ILE A 1 89  ? -4.000  -1.938  2.152   1.00 0.00 ? 89  ILE A HG13 6  
ATOM 10141 H HG21 . ILE A 1 89  ? -1.113  -0.677  0.219   1.00 0.00 ? 89  ILE A HG21 6  
ATOM 10142 H HG22 . ILE A 1 89  ? -2.666  0.038   0.714   1.00 0.00 ? 89  ILE A HG22 6  
ATOM 10143 H HG23 . ILE A 1 89  ? -1.700  -0.891  1.886   1.00 0.00 ? 89  ILE A HG23 6  
ATOM 10144 H HD11 . ILE A 1 89  ? -4.647  -0.636  -0.220  1.00 0.00 ? 89  ILE A HD11 6  
ATOM 10145 H HD12 . ILE A 1 89  ? -5.773  -2.014  -0.210  1.00 0.00 ? 89  ILE A HD12 6  
ATOM 10146 H HD13 . ILE A 1 89  ? -5.750  -0.874  1.156   1.00 0.00 ? 89  ILE A HD13 6  
ATOM 10147 N N    . GLU A 1 90  ? -1.183  -1.487  -2.686  1.00 0.00 ? 90  GLU A N    6  
ATOM 10148 C CA   . GLU A 1 90  ? 0.049   -1.599  -3.449  1.00 0.00 ? 90  GLU A CA   6  
ATOM 10149 C C    . GLU A 1 90  ? 1.151   -0.755  -2.805  1.00 0.00 ? 90  GLU A C    6  
ATOM 10150 O O    . GLU A 1 90  ? 1.003   0.458   -2.660  1.00 0.00 ? 90  GLU A O    6  
ATOM 10151 C CB   . GLU A 1 90  ? -0.170  -1.194  -4.908  1.00 0.00 ? 90  GLU A CB   6  
ATOM 10152 C CG   . GLU A 1 90  ? -0.999  -2.245  -5.649  1.00 0.00 ? 90  GLU A CG   6  
ATOM 10153 C CD   . GLU A 1 90  ? -1.505  -1.700  -6.987  1.00 0.00 ? 90  GLU A CD   6  
ATOM 10154 O OE1  . GLU A 1 90  ? -0.745  -0.928  -7.609  1.00 0.00 ? 90  GLU A OE1  6  
ATOM 10155 O OE2  . GLU A 1 90  ? -2.641  -2.069  -7.357  1.00 0.00 ? 90  GLU A OE2  6  
ATOM 10156 H H    . GLU A 1 90  ? -1.715  -0.659  -2.863  1.00 0.00 ? 90  GLU A H    6  
ATOM 10157 H HA   . GLU A 1 90  ? 0.320   -2.654  -3.408  1.00 0.00 ? 90  GLU A HA   6  
ATOM 10158 H HB2  . GLU A 1 90  ? -0.678  -0.230  -4.949  1.00 0.00 ? 90  GLU A HB2  6  
ATOM 10159 H HB3  . GLU A 1 90  ? 0.792   -1.069  -5.403  1.00 0.00 ? 90  GLU A HB3  6  
ATOM 10160 H HG2  . GLU A 1 90  ? -0.395  -3.136  -5.821  1.00 0.00 ? 90  GLU A HG2  6  
ATOM 10161 H HG3  . GLU A 1 90  ? -1.845  -2.548  -5.033  1.00 0.00 ? 90  GLU A HG3  6  
ATOM 10162 N N    . VAL A 1 91  ? 2.230   -1.429  -2.436  1.00 0.00 ? 91  VAL A N    6  
ATOM 10163 C CA   . VAL A 1 91  ? 3.356   -0.755  -1.812  1.00 0.00 ? 91  VAL A CA   6  
ATOM 10164 C C    . VAL A 1 91  ? 4.584   -0.877  -2.717  1.00 0.00 ? 91  VAL A C    6  
ATOM 10165 O O    . VAL A 1 91  ? 5.063   -1.981  -2.974  1.00 0.00 ? 91  VAL A O    6  
ATOM 10166 C CB   . VAL A 1 91  ? 3.589   -1.318  -0.408  1.00 0.00 ? 91  VAL A CB   6  
ATOM 10167 C CG1  . VAL A 1 91  ? 4.854   -0.725  0.217   1.00 0.00 ? 91  VAL A CG1  6  
ATOM 10168 C CG2  . VAL A 1 91  ? 2.372   -1.081  0.487   1.00 0.00 ? 91  VAL A CG2  6  
ATOM 10169 H H    . VAL A 1 91  ? 2.342   -2.415  -2.558  1.00 0.00 ? 91  VAL A H    6  
ATOM 10170 H HA   . VAL A 1 91  ? 3.096   0.299   -1.714  1.00 0.00 ? 91  VAL A HA   6  
ATOM 10171 H HB   . VAL A 1 91  ? 3.734   -2.395  -0.499  1.00 0.00 ? 91  VAL A HB   6  
ATOM 10172 H HG11 . VAL A 1 91  ? 5.401   -1.508  0.742   1.00 0.00 ? 91  VAL A HG11 6  
ATOM 10173 H HG12 . VAL A 1 91  ? 5.484   -0.304  -0.567  1.00 0.00 ? 91  VAL A HG12 6  
ATOM 10174 H HG13 . VAL A 1 91  ? 4.577   0.059   0.921   1.00 0.00 ? 91  VAL A HG13 6  
ATOM 10175 H HG21 . VAL A 1 91  ? 2.189   -0.010  0.576   1.00 0.00 ? 91  VAL A HG21 6  
ATOM 10176 H HG22 . VAL A 1 91  ? 1.499   -1.564  0.048   1.00 0.00 ? 91  VAL A HG22 6  
ATOM 10177 H HG23 . VAL A 1 91  ? 2.560   -1.501  1.475   1.00 0.00 ? 91  VAL A HG23 6  
ATOM 10178 N N    . ALA A 1 92  ? 5.058   0.272   -3.175  1.00 0.00 ? 92  ALA A N    6  
ATOM 10179 C CA   . ALA A 1 92  ? 6.220   0.308   -4.046  1.00 0.00 ? 92  ALA A CA   6  
ATOM 10180 C C    . ALA A 1 92  ? 7.313   1.159   -3.396  1.00 0.00 ? 92  ALA A C    6  
ATOM 10181 O O    . ALA A 1 92  ? 7.020   2.039   -2.588  1.00 0.00 ? 92  ALA A O    6  
ATOM 10182 C CB   . ALA A 1 92  ? 5.811   0.835   -5.423  1.00 0.00 ? 92  ALA A CB   6  
ATOM 10183 H H    . ALA A 1 92  ? 4.662   1.165   -2.962  1.00 0.00 ? 92  ALA A H    6  
ATOM 10184 H HA   . ALA A 1 92  ? 6.584   -0.714  -4.156  1.00 0.00 ? 92  ALA A HA   6  
ATOM 10185 H HB1  . ALA A 1 92  ? 5.795   0.012   -6.137  1.00 0.00 ? 92  ALA A HB1  6  
ATOM 10186 H HB2  . ALA A 1 92  ? 4.819   1.282   -5.361  1.00 0.00 ? 92  ALA A HB2  6  
ATOM 10187 H HB3  . ALA A 1 92  ? 6.528   1.587   -5.752  1.00 0.00 ? 92  ALA A HB3  6  
ATOM 10188 N N    . ALA A 1 93  ? 8.549   0.868   -3.774  1.00 0.00 ? 93  ALA A N    6  
ATOM 10189 C CA   . ALA A 1 93  ? 9.686   1.596   -3.239  1.00 0.00 ? 93  ALA A CA   6  
ATOM 10190 C C    . ALA A 1 93  ? 10.221  2.554   -4.305  1.00 0.00 ? 93  ALA A C    6  
ATOM 10191 O O    . ALA A 1 93  ? 10.433  2.158   -5.450  1.00 0.00 ? 93  ALA A O    6  
ATOM 10192 C CB   . ALA A 1 93  ? 10.748  0.604   -2.760  1.00 0.00 ? 93  ALA A CB   6  
ATOM 10193 H H    . ALA A 1 93  ? 8.778   0.151   -4.432  1.00 0.00 ? 93  ALA A H    6  
ATOM 10194 H HA   . ALA A 1 93  ? 9.337   2.176   -2.384  1.00 0.00 ? 93  ALA A HA   6  
ATOM 10195 H HB1  . ALA A 1 93  ? 11.286  0.205   -3.620  1.00 0.00 ? 93  ALA A HB1  6  
ATOM 10196 H HB2  . ALA A 1 93  ? 11.448  1.113   -2.097  1.00 0.00 ? 93  ALA A HB2  6  
ATOM 10197 H HB3  . ALA A 1 93  ? 10.267  -0.212  -2.222  1.00 0.00 ? 93  ALA A HB3  6  
ATOM 10198 N N    . MET A 1 94  ? 10.425  3.796   -3.891  1.00 0.00 ? 94  MET A N    6  
ATOM 10199 C CA   . MET A 1 94  ? 10.931  4.813   -4.796  1.00 0.00 ? 94  MET A CA   6  
ATOM 10200 C C    . MET A 1 94  ? 12.420  5.072   -4.554  1.00 0.00 ? 94  MET A C    6  
ATOM 10201 O O    . MET A 1 94  ? 12.867  5.116   -3.409  1.00 0.00 ? 94  MET A O    6  
ATOM 10202 C CB   . MET A 1 94  ? 10.148  6.112   -4.595  1.00 0.00 ? 94  MET A CB   6  
ATOM 10203 C CG   . MET A 1 94  ? 8.640   5.850   -4.606  1.00 0.00 ? 94  MET A CG   6  
ATOM 10204 S SD   . MET A 1 94  ? 7.782   7.194   -3.803  1.00 0.00 ? 94  MET A SD   6  
ATOM 10205 C CE   . MET A 1 94  ? 7.721   8.369   -5.146  1.00 0.00 ? 94  MET A CE   6  
ATOM 10206 H H    . MET A 1 94  ? 10.250  4.110   -2.958  1.00 0.00 ? 94  MET A H    6  
ATOM 10207 H HA   . MET A 1 94  ? 10.784  4.412   -5.799  1.00 0.00 ? 94  MET A HA   6  
ATOM 10208 H HB2  . MET A 1 94  ? 10.434  6.570   -3.648  1.00 0.00 ? 94  MET A HB2  6  
ATOM 10209 H HB3  . MET A 1 94  ? 10.403  6.821   -5.383  1.00 0.00 ? 94  MET A HB3  6  
ATOM 10210 H HG2  . MET A 1 94  ? 8.289   5.745   -5.632  1.00 0.00 ? 94  MET A HG2  6  
ATOM 10211 H HG3  . MET A 1 94  ? 8.422   4.912   -4.096  1.00 0.00 ? 94  MET A HG3  6  
ATOM 10212 H HE1  . MET A 1 94  ? 8.258   7.967   -6.005  1.00 0.00 ? 94  MET A HE1  6  
ATOM 10213 H HE2  . MET A 1 94  ? 6.682   8.554   -5.420  1.00 0.00 ? 94  MET A HE2  6  
ATOM 10214 H HE3  . MET A 1 94  ? 8.186   9.303   -4.832  1.00 0.00 ? 94  MET A HE3  6  
ATOM 10215 N N    . THR A 1 95  ? 13.145  5.236   -5.650  1.00 0.00 ? 95  THR A N    6  
ATOM 10216 C CA   . THR A 1 95  ? 14.574  5.489   -5.570  1.00 0.00 ? 95  THR A CA   6  
ATOM 10217 C C    . THR A 1 95  ? 14.915  6.831   -6.220  1.00 0.00 ? 95  THR A C    6  
ATOM 10218 O O    . THR A 1 95  ? 14.025  7.635   -6.497  1.00 0.00 ? 95  THR A O    6  
ATOM 10219 C CB   . THR A 1 95  ? 15.300  4.303   -6.209  1.00 0.00 ? 95  THR A CB   6  
ATOM 10220 O OG1  . THR A 1 95  ? 14.470  3.938   -7.308  1.00 0.00 ? 95  THR A OG1  6  
ATOM 10221 C CG2  . THR A 1 95  ? 15.298  3.063   -5.313  1.00 0.00 ? 95  THR A CG2  6  
ATOM 10222 H H    . THR A 1 95  ? 12.774  5.198   -6.577  1.00 0.00 ? 95  THR A H    6  
ATOM 10223 H HA   . THR A 1 95  ? 14.852  5.562   -4.519  1.00 0.00 ? 95  THR A HA   6  
ATOM 10224 H HB   . THR A 1 95  ? 16.316  4.576   -6.493  1.00 0.00 ? 95  THR A HB   6  
ATOM 10225 H HG1  . THR A 1 95  ? 14.695  4.496   -8.107  1.00 0.00 ? 95  THR A HG1  6  
ATOM 10226 H HG21 . THR A 1 95  ? 16.182  3.074   -4.675  1.00 0.00 ? 95  THR A HG21 6  
ATOM 10227 H HG22 . THR A 1 95  ? 14.402  3.065   -4.692  1.00 0.00 ? 95  THR A HG22 6  
ATOM 10228 H HG23 . THR A 1 95  ? 15.309  2.167   -5.933  1.00 0.00 ? 95  THR A HG23 6  
ATOM 10229 N N    . SER A 1 96  ? 16.205  7.033   -6.444  1.00 0.00 ? 96  SER A N    6  
ATOM 10230 C CA   . SER A 1 96  ? 16.674  8.265   -7.055  1.00 0.00 ? 96  SER A CA   6  
ATOM 10231 C C    . SER A 1 96  ? 16.381  8.249   -8.557  1.00 0.00 ? 96  SER A C    6  
ATOM 10232 O O    . SER A 1 96  ? 16.649  9.225   -9.256  1.00 0.00 ? 96  SER A O    6  
ATOM 10233 C CB   . SER A 1 96  ? 18.171  8.467   -6.809  1.00 0.00 ? 96  SER A CB   6  
ATOM 10234 O OG   . SER A 1 96  ? 18.454  8.752   -5.442  1.00 0.00 ? 96  SER A OG   6  
ATOM 10235 H H    . SER A 1 96  ? 16.922  6.375   -6.215  1.00 0.00 ? 96  SER A H    6  
ATOM 10236 H HA   . SER A 1 96  ? 16.116  9.062   -6.565  1.00 0.00 ? 96  SER A HA   6  
ATOM 10237 H HB2  . SER A 1 96  ? 18.712  7.570   -7.112  1.00 0.00 ? 96  SER A HB2  6  
ATOM 10238 H HB3  . SER A 1 96  ? 18.534  9.283   -7.433  1.00 0.00 ? 96  SER A HB3  6  
ATOM 10239 H HG   . SER A 1 96  ? 18.227  9.704   -5.238  1.00 0.00 ? 96  SER A HG   6  
ATOM 10240 N N    . LYS A 1 97  ? 15.834  7.130   -9.008  1.00 0.00 ? 97  LYS A N    6  
ATOM 10241 C CA   . LYS A 1 97  ? 15.501  6.973   -10.414 1.00 0.00 ? 97  LYS A CA   6  
ATOM 10242 C C    . LYS A 1 97  ? 13.989  7.124   -10.596 1.00 0.00 ? 97  LYS A C    6  
ATOM 10243 O O    . LYS A 1 97  ? 13.536  7.822   -11.501 1.00 0.00 ? 97  LYS A O    6  
ATOM 10244 C CB   . LYS A 1 97  ? 16.057  5.653   -10.953 1.00 0.00 ? 97  LYS A CB   6  
ATOM 10245 C CG   . LYS A 1 97  ? 14.967  4.850   -11.665 1.00 0.00 ? 97  LYS A CG   6  
ATOM 10246 C CD   . LYS A 1 97  ? 14.652  5.448   -13.037 1.00 0.00 ? 97  LYS A CD   6  
ATOM 10247 C CE   . LYS A 1 97  ? 15.773  5.150   -14.035 1.00 0.00 ? 97  LYS A CE   6  
ATOM 10248 N NZ   . LYS A 1 97  ? 15.638  6.004   -15.237 1.00 0.00 ? 97  LYS A NZ   6  
ATOM 10249 H H    . LYS A 1 97  ? 15.619  6.340   -8.433  1.00 0.00 ? 97  LYS A H    6  
ATOM 10250 H HA   . LYS A 1 97  ? 15.996  7.777   -10.958 1.00 0.00 ? 97  LYS A HA   6  
ATOM 10251 H HB2  . LYS A 1 97  ? 16.876  5.854   -11.643 1.00 0.00 ? 97  LYS A HB2  6  
ATOM 10252 H HB3  . LYS A 1 97  ? 16.469  5.066   -10.132 1.00 0.00 ? 97  LYS A HB3  6  
ATOM 10253 H HG2  . LYS A 1 97  ? 15.290  3.815   -11.781 1.00 0.00 ? 97  LYS A HG2  6  
ATOM 10254 H HG3  . LYS A 1 97  ? 14.063  4.835   -11.055 1.00 0.00 ? 97  LYS A HG3  6  
ATOM 10255 H HD2  . LYS A 1 97  ? 13.712  5.041   -13.409 1.00 0.00 ? 97  LYS A HD2  6  
ATOM 10256 H HD3  . LYS A 1 97  ? 14.519  6.526   -12.946 1.00 0.00 ? 97  LYS A HD3  6  
ATOM 10257 H HE2  . LYS A 1 97  ? 16.742  5.323   -13.566 1.00 0.00 ? 97  LYS A HE2  6  
ATOM 10258 H HE3  . LYS A 1 97  ? 15.742  4.099   -14.323 1.00 0.00 ? 97  LYS A HE3  6  
ATOM 10259 H HZ1  . LYS A 1 97  ? 16.133  6.861   -15.094 1.00 0.00 ? 97  LYS A HZ1  6  
ATOM 10260 H HZ2  . LYS A 1 97  ? 16.019  5.527   -16.029 1.00 0.00 ? 97  LYS A HZ2  6  
ATOM 10261 H HZ3  . LYS A 1 97  ? 14.671  6.200   -15.399 1.00 0.00 ? 97  LYS A HZ3  6  
ATOM 10262 N N    . GLY A 1 98  ? 13.251  6.458   -9.720  1.00 0.00 ? 98  GLY A N    6  
ATOM 10263 C CA   . GLY A 1 98  ? 11.800  6.509   -9.772  1.00 0.00 ? 98  GLY A CA   6  
ATOM 10264 C C    . GLY A 1 98  ? 11.181  5.470   -8.836  1.00 0.00 ? 98  GLY A C    6  
ATOM 10265 O O    . GLY A 1 98  ? 11.638  5.294   -7.707  1.00 0.00 ? 98  GLY A O    6  
ATOM 10266 H H    . GLY A 1 98  ? 13.628  5.893   -8.986  1.00 0.00 ? 98  GLY A H    6  
ATOM 10267 H HA2  . GLY A 1 98  ? 11.457  7.506   -9.493  1.00 0.00 ? 98  GLY A HA2  6  
ATOM 10268 H HA3  . GLY A 1 98  ? 11.463  6.331   -10.793 1.00 0.00 ? 98  GLY A HA3  6  
ATOM 10269 N N    . GLN A 1 99  ? 10.149  4.808   -9.338  1.00 0.00 ? 99  GLN A N    6  
ATOM 10270 C CA   . GLN A 1 99  ? 9.462   3.790   -8.561  1.00 0.00 ? 99  GLN A CA   6  
ATOM 10271 C C    . GLN A 1 99  ? 9.695   2.407   -9.172  1.00 0.00 ? 99  GLN A C    6  
ATOM 10272 O O    . GLN A 1 99  ? 9.780   2.270   -10.392 1.00 0.00 ? 99  GLN A O    6  
ATOM 10273 C CB   . GLN A 1 99  ? 7.967   4.098   -8.454  1.00 0.00 ? 99  GLN A CB   6  
ATOM 10274 C CG   . GLN A 1 99  ? 7.247   3.035   -7.622  1.00 0.00 ? 99  GLN A CG   6  
ATOM 10275 C CD   . GLN A 1 99  ? 5.739   3.065   -7.881  1.00 0.00 ? 99  GLN A CD   6  
ATOM 10276 O OE1  . GLN A 1 99  ? 4.995   3.822   -7.281  1.00 0.00 ? 99  GLN A OE1  6  
ATOM 10277 N NE2  . GLN A 1 99  ? 5.332   2.200   -8.806  1.00 0.00 ? 99  GLN A NE2  6  
ATOM 10278 H H    . GLN A 1 99  ? 9.783   4.956   -10.257 1.00 0.00 ? 99  GLN A H    6  
ATOM 10279 H HA   . GLN A 1 99  ? 9.908   3.835   -7.567  1.00 0.00 ? 99  GLN A HA   6  
ATOM 10280 H HB2  . GLN A 1 99  ? 7.826   5.078   -8.000  1.00 0.00 ? 99  GLN A HB2  6  
ATOM 10281 H HB3  . GLN A 1 99  ? 7.529   4.142   -9.451  1.00 0.00 ? 99  GLN A HB3  6  
ATOM 10282 H HG2  . GLN A 1 99  ? 7.642   2.049   -7.864  1.00 0.00 ? 99  GLN A HG2  6  
ATOM 10283 H HG3  . GLN A 1 99  ? 7.441   3.205   -6.563  1.00 0.00 ? 99  GLN A HG3  6  
ATOM 10284 H HE21 . GLN A 1 99  ? 5.996   1.606   -9.262  1.00 0.00 ? 99  GLN A HE21 6  
ATOM 10285 H HE22 . GLN A 1 99  ? 4.363   2.144   -9.046  1.00 0.00 ? 99  GLN A HE22 6  
ATOM 10286 N N    . GLY A 1 100 ? 9.792   1.417   -8.297  1.00 0.00 ? 100 GLY A N    6  
ATOM 10287 C CA   . GLY A 1 100 ? 10.014  0.050   -8.736  1.00 0.00 ? 100 GLY A CA   6  
ATOM 10288 C C    . GLY A 1 100 ? 8.735   -0.781  -8.611  1.00 0.00 ? 100 GLY A C    6  
ATOM 10289 O O    . GLY A 1 100 ? 7.633   -0.234  -8.613  1.00 0.00 ? 100 GLY A O    6  
ATOM 10290 H H    . GLY A 1 100 ? 9.722   1.537   -7.307  1.00 0.00 ? 100 GLY A H    6  
ATOM 10291 H HA2  . GLY A 1 100 ? 10.353  0.047   -9.772  1.00 0.00 ? 100 GLY A HA2  6  
ATOM 10292 H HA3  . GLY A 1 100 ? 10.806  -0.403  -8.140  1.00 0.00 ? 100 GLY A HA3  6  
ATOM 10293 N N    . GLN A 1 101 ? 8.924   -2.088  -8.504  1.00 0.00 ? 101 GLN A N    6  
ATOM 10294 C CA   . GLN A 1 101 ? 7.799   -2.999  -8.378  1.00 0.00 ? 101 GLN A CA   6  
ATOM 10295 C C    . GLN A 1 101 ? 6.876   -2.549  -7.243  1.00 0.00 ? 101 GLN A C    6  
ATOM 10296 O O    . GLN A 1 101 ? 7.204   -1.624  -6.501  1.00 0.00 ? 101 GLN A O    6  
ATOM 10297 C CB   . GLN A 1 101 ? 8.279   -4.435  -8.157  1.00 0.00 ? 101 GLN A CB   6  
ATOM 10298 C CG   . GLN A 1 101 ? 7.604   -5.395  -9.139  1.00 0.00 ? 101 GLN A CG   6  
ATOM 10299 C CD   . GLN A 1 101 ? 8.625   -6.347  -9.764  1.00 0.00 ? 101 GLN A CD   6  
ATOM 10300 O OE1  . GLN A 1 101 ? 9.357   -7.048  -9.084  1.00 0.00 ? 101 GLN A OE1  6  
ATOM 10301 N NE2  . GLN A 1 101 ? 8.635   -6.333  -11.094 1.00 0.00 ? 101 GLN A NE2  6  
ATOM 10302 H H    . GLN A 1 101 ? 9.824   -2.524  -8.503  1.00 0.00 ? 101 GLN A H    6  
ATOM 10303 H HA   . GLN A 1 101 ? 7.271   -2.941  -9.330  1.00 0.00 ? 101 GLN A HA   6  
ATOM 10304 H HB2  . GLN A 1 101 ? 9.361   -4.484  -8.281  1.00 0.00 ? 101 GLN A HB2  6  
ATOM 10305 H HB3  . GLN A 1 101 ? 8.060   -4.742  -7.135  1.00 0.00 ? 101 GLN A HB3  6  
ATOM 10306 H HG2  . GLN A 1 101 ? 6.835   -5.969  -8.622  1.00 0.00 ? 101 GLN A HG2  6  
ATOM 10307 H HG3  . GLN A 1 101 ? 7.104   -4.827  -9.924  1.00 0.00 ? 101 GLN A HG3  6  
ATOM 10308 H HE21 . GLN A 1 101 ? 8.008   -5.734  -11.592 1.00 0.00 ? 101 GLN A HE21 6  
ATOM 10309 H HE22 . GLN A 1 101 ? 9.269   -6.922  -11.596 1.00 0.00 ? 101 GLN A HE22 6  
ATOM 10310 N N    . VAL A 1 102 ? 5.740   -3.224  -7.144  1.00 0.00 ? 102 VAL A N    6  
ATOM 10311 C CA   . VAL A 1 102 ? 4.768   -2.905  -6.113  1.00 0.00 ? 102 VAL A CA   6  
ATOM 10312 C C    . VAL A 1 102 ? 4.138   -4.199  -5.595  1.00 0.00 ? 102 VAL A C    6  
ATOM 10313 O O    . VAL A 1 102 ? 3.797   -5.084  -6.378  1.00 0.00 ? 102 VAL A O    6  
ATOM 10314 C CB   . VAL A 1 102 ? 3.737   -1.913  -6.655  1.00 0.00 ? 102 VAL A CB   6  
ATOM 10315 C CG1  . VAL A 1 102 ? 2.615   -2.640  -7.400  1.00 0.00 ? 102 VAL A CG1  6  
ATOM 10316 C CG2  . VAL A 1 102 ? 3.173   -1.040  -5.532  1.00 0.00 ? 102 VAL A CG2  6  
ATOM 10317 H H    . VAL A 1 102 ? 5.481   -3.975  -7.752  1.00 0.00 ? 102 VAL A H    6  
ATOM 10318 H HA   . VAL A 1 102 ? 5.302   -2.423  -5.295  1.00 0.00 ? 102 VAL A HA   6  
ATOM 10319 H HB   . VAL A 1 102 ? 4.242   -1.259  -7.365  1.00 0.00 ? 102 VAL A HB   6  
ATOM 10320 H HG11 . VAL A 1 102 ? 2.214   -3.433  -6.769  1.00 0.00 ? 102 VAL A HG11 6  
ATOM 10321 H HG12 . VAL A 1 102 ? 1.822   -1.933  -7.643  1.00 0.00 ? 102 VAL A HG12 6  
ATOM 10322 H HG13 . VAL A 1 102 ? 3.011   -3.072  -8.319  1.00 0.00 ? 102 VAL A HG13 6  
ATOM 10323 H HG21 . VAL A 1 102 ? 3.993   -0.565  -4.994  1.00 0.00 ? 102 VAL A HG21 6  
ATOM 10324 H HG22 . VAL A 1 102 ? 2.525   -0.274  -5.958  1.00 0.00 ? 102 VAL A HG22 6  
ATOM 10325 H HG23 . VAL A 1 102 ? 2.598   -1.660  -4.843  1.00 0.00 ? 102 VAL A HG23 6  
ATOM 10326 N N    . SER A 1 103 ? 4.002   -4.268  -4.279  1.00 0.00 ? 103 SER A N    6  
ATOM 10327 C CA   . SER A 1 103 ? 3.419   -5.439  -3.647  1.00 0.00 ? 103 SER A CA   6  
ATOM 10328 C C    . SER A 1 103 ? 1.949   -5.176  -3.312  1.00 0.00 ? 103 SER A C    6  
ATOM 10329 O O    . SER A 1 103 ? 1.644   -4.488  -2.339  1.00 0.00 ? 103 SER A O    6  
ATOM 10330 C CB   . SER A 1 103 ? 4.190   -5.825  -2.383  1.00 0.00 ? 103 SER A CB   6  
ATOM 10331 O OG   . SER A 1 103 ? 5.217   -6.776  -2.653  1.00 0.00 ? 103 SER A OG   6  
ATOM 10332 H H    . SER A 1 103 ? 4.282   -3.543  -3.649  1.00 0.00 ? 103 SER A H    6  
ATOM 10333 H HA   . SER A 1 103 ? 3.506   -6.238  -4.383  1.00 0.00 ? 103 SER A HA   6  
ATOM 10334 H HB2  . SER A 1 103 ? 4.631   -4.932  -1.940  1.00 0.00 ? 103 SER A HB2  6  
ATOM 10335 H HB3  . SER A 1 103 ? 3.499   -6.237  -1.648  1.00 0.00 ? 103 SER A HB3  6  
ATOM 10336 H HG   . SER A 1 103 ? 5.504   -7.219  -1.805  1.00 0.00 ? 103 SER A HG   6  
ATOM 10337 N N    . ALA A 1 104 ? 1.078   -5.737  -4.137  1.00 0.00 ? 104 ALA A N    6  
ATOM 10338 C CA   . ALA A 1 104 ? -0.353  -5.572  -3.941  1.00 0.00 ? 104 ALA A CA   6  
ATOM 10339 C C    . ALA A 1 104 ? -0.907  -6.794  -3.205  1.00 0.00 ? 104 ALA A C    6  
ATOM 10340 O O    . ALA A 1 104 ? -0.852  -7.910  -3.720  1.00 0.00 ? 104 ALA A O    6  
ATOM 10341 C CB   . ALA A 1 104 ? -1.031  -5.348  -5.293  1.00 0.00 ? 104 ALA A CB   6  
ATOM 10342 H H    . ALA A 1 104 ? 1.334   -6.296  -4.926  1.00 0.00 ? 104 ALA A H    6  
ATOM 10343 H HA   . ALA A 1 104 ? -0.502  -4.687  -3.322  1.00 0.00 ? 104 ALA A HA   6  
ATOM 10344 H HB1  . ALA A 1 104 ? -1.710  -4.498  -5.223  1.00 0.00 ? 104 ALA A HB1  6  
ATOM 10345 H HB2  . ALA A 1 104 ? -0.274  -5.147  -6.051  1.00 0.00 ? 104 ALA A HB2  6  
ATOM 10346 H HB3  . ALA A 1 104 ? -1.593  -6.240  -5.570  1.00 0.00 ? 104 ALA A HB3  6  
ATOM 10347 N N    . SER A 1 105 ? -1.428  -6.542  -2.014  1.00 0.00 ? 105 SER A N    6  
ATOM 10348 C CA   . SER A 1 105 ? -1.992  -7.607  -1.203  1.00 0.00 ? 105 SER A CA   6  
ATOM 10349 C C    . SER A 1 105 ? -3.484  -7.359  -0.976  1.00 0.00 ? 105 SER A C    6  
ATOM 10350 O O    . SER A 1 105 ? -3.880  -6.272  -0.557  1.00 0.00 ? 105 SER A O    6  
ATOM 10351 C CB   . SER A 1 105 ? -1.263  -7.723  0.138   1.00 0.00 ? 105 SER A CB   6  
ATOM 10352 O OG   . SER A 1 105 ? -0.365  -8.829  0.163   1.00 0.00 ? 105 SER A OG   6  
ATOM 10353 H H    . SER A 1 105 ? -1.469  -5.631  -1.603  1.00 0.00 ? 105 SER A H    6  
ATOM 10354 H HA   . SER A 1 105 ? -1.839  -8.520  -1.779  1.00 0.00 ? 105 SER A HA   6  
ATOM 10355 H HB2  . SER A 1 105 ? -0.712  -6.803  0.331   1.00 0.00 ? 105 SER A HB2  6  
ATOM 10356 H HB3  . SER A 1 105 ? -1.994  -7.831  0.939   1.00 0.00 ? 105 SER A HB3  6  
ATOM 10357 H HG   . SER A 1 105 ? -0.285  -9.226  -0.751  1.00 0.00 ? 105 SER A HG   6  
ATOM 10358 N N    . THR A 1 106 ? -4.273  -8.384  -1.263  1.00 0.00 ? 106 THR A N    6  
ATOM 10359 C CA   . THR A 1 106 ? -5.713  -8.291  -1.095  1.00 0.00 ? 106 THR A CA   6  
ATOM 10360 C C    . THR A 1 106 ? -6.086  -8.401  0.385   1.00 0.00 ? 106 THR A C    6  
ATOM 10361 O O    . THR A 1 106 ? -5.649  -9.323  1.071   1.00 0.00 ? 106 THR A O    6  
ATOM 10362 C CB   . THR A 1 106 ? -6.361  -9.367  -1.967  1.00 0.00 ? 106 THR A CB   6  
ATOM 10363 O OG1  . THR A 1 106 ? -5.418  -9.581  -3.014  1.00 0.00 ? 106 THR A OG1  6  
ATOM 10364 C CG2  . THR A 1 106 ? -7.611  -8.861  -2.691  1.00 0.00 ? 106 THR A CG2  6  
ATOM 10365 H H    . THR A 1 106 ? -3.943  -9.265  -1.603  1.00 0.00 ? 106 THR A H    6  
ATOM 10366 H HA   . THR A 1 106 ? -6.035  -7.306  -1.433  1.00 0.00 ? 106 THR A HA   6  
ATOM 10367 H HB   . THR A 1 106 ? -6.584  -10.260 -1.383  1.00 0.00 ? 106 THR A HB   6  
ATOM 10368 H HG1  . THR A 1 106 ? -4.989  -10.478 -2.909  1.00 0.00 ? 106 THR A HG1  6  
ATOM 10369 H HG21 . THR A 1 106 ? -7.661  -9.306  -3.684  1.00 0.00 ? 106 THR A HG21 6  
ATOM 10370 H HG22 . THR A 1 106 ? -8.498  -9.140  -2.122  1.00 0.00 ? 106 THR A HG22 6  
ATOM 10371 H HG23 . THR A 1 106 ? -7.564  -7.776  -2.781  1.00 0.00 ? 106 THR A HG23 6  
ATOM 10372 N N    . ILE A 1 107 ? -6.891  -7.448  0.832   1.00 0.00 ? 107 ILE A N    6  
ATOM 10373 C CA   . ILE A 1 107 ? -7.328  -7.427  2.217   1.00 0.00 ? 107 ILE A CA   6  
ATOM 10374 C C    . ILE A 1 107 ? -8.783  -6.960  2.281   1.00 0.00 ? 107 ILE A C    6  
ATOM 10375 O O    . ILE A 1 107 ? -9.148  -5.966  1.657   1.00 0.00 ? 107 ILE A O    6  
ATOM 10376 C CB   . ILE A 1 107 ? -6.374  -6.585  3.067   1.00 0.00 ? 107 ILE A CB   6  
ATOM 10377 C CG1  . ILE A 1 107 ? -6.923  -6.395  4.483   1.00 0.00 ? 107 ILE A CG1  6  
ATOM 10378 C CG2  . ILE A 1 107 ? -6.069  -5.249  2.387   1.00 0.00 ? 107 ILE A CG2  6  
ATOM 10379 C CD1  . ILE A 1 107 ? -6.813  -7.689  5.291   1.00 0.00 ? 107 ILE A CD1  6  
ATOM 10380 H H    . ILE A 1 107 ? -7.242  -6.702  0.266   1.00 0.00 ? 107 ILE A H    6  
ATOM 10381 H HA   . ILE A 1 107 ? -7.276  -8.449  2.592   1.00 0.00 ? 107 ILE A HA   6  
ATOM 10382 H HB   . ILE A 1 107 ? -5.431  -7.123  3.157   1.00 0.00 ? 107 ILE A HB   6  
ATOM 10383 H HG12 . ILE A 1 107 ? -6.374  -5.600  4.986   1.00 0.00 ? 107 ILE A HG12 6  
ATOM 10384 H HG13 . ILE A 1 107 ? -7.965  -6.081  4.433   1.00 0.00 ? 107 ILE A HG13 6  
ATOM 10385 H HG21 . ILE A 1 107 ? -5.227  -5.372  1.705   1.00 0.00 ? 107 ILE A HG21 6  
ATOM 10386 H HG22 . ILE A 1 107 ? -6.944  -4.917  1.828   1.00 0.00 ? 107 ILE A HG22 6  
ATOM 10387 H HG23 . ILE A 1 107 ? -5.817  -4.505  3.144   1.00 0.00 ? 107 ILE A HG23 6  
ATOM 10388 H HD11 . ILE A 1 107 ? -7.709  -8.291  5.139   1.00 0.00 ? 107 ILE A HD11 6  
ATOM 10389 H HD12 . ILE A 1 107 ? -5.938  -8.251  4.962   1.00 0.00 ? 107 ILE A HD12 6  
ATOM 10390 H HD13 . ILE A 1 107 ? -6.712  -7.449  6.350   1.00 0.00 ? 107 ILE A HD13 6  
ATOM 10391 N N    . SER A 1 108 ? -9.576  -7.701  3.042   1.00 0.00 ? 108 SER A N    6  
ATOM 10392 C CA   . SER A 1 108 ? -10.984 -7.376  3.196   1.00 0.00 ? 108 SER A CA   6  
ATOM 10393 C C    . SER A 1 108 ? -11.216 -6.678  4.538   1.00 0.00 ? 108 SER A C    6  
ATOM 10394 O O    . SER A 1 108 ? -10.907 -7.233  5.591   1.00 0.00 ? 108 SER A O    6  
ATOM 10395 C CB   . SER A 1 108 ? -11.853 -8.630  3.092   1.00 0.00 ? 108 SER A CB   6  
ATOM 10396 O OG   . SER A 1 108 ? -13.100 -8.473  3.765   1.00 0.00 ? 108 SER A OG   6  
ATOM 10397 H H    . SER A 1 108 ? -9.271  -8.509  3.547   1.00 0.00 ? 108 SER A H    6  
ATOM 10398 H HA   . SER A 1 108 ? -11.216 -6.704  2.370   1.00 0.00 ? 108 SER A HA   6  
ATOM 10399 H HB2  . SER A 1 108 ? -12.035 -8.860  2.042   1.00 0.00 ? 108 SER A HB2  6  
ATOM 10400 H HB3  . SER A 1 108 ? -11.317 -9.479  3.516   1.00 0.00 ? 108 SER A HB3  6  
ATOM 10401 H HG   . SER A 1 108 ? -13.033 -8.832  4.696   1.00 0.00 ? 108 SER A HG   6  
ATOM 10402 N N    . SER A 1 109 ? -11.758 -5.472  4.455   1.00 0.00 ? 109 SER A N    6  
ATOM 10403 C CA   . SER A 1 109 ? -12.035 -4.693  5.650   1.00 0.00 ? 109 SER A CA   6  
ATOM 10404 C C    . SER A 1 109 ? -12.498 -5.615  6.780   1.00 0.00 ? 109 SER A C    6  
ATOM 10405 O O    . SER A 1 109 ? -13.162 -6.620  6.533   1.00 0.00 ? 109 SER A O    6  
ATOM 10406 C CB   . SER A 1 109 ? -13.090 -3.619  5.375   1.00 0.00 ? 109 SER A CB   6  
ATOM 10407 O OG   . SER A 1 109 ? -14.222 -4.146  4.690   1.00 0.00 ? 109 SER A OG   6  
ATOM 10408 H H    . SER A 1 109 ? -12.006 -5.028  3.594   1.00 0.00 ? 109 SER A H    6  
ATOM 10409 H HA   . SER A 1 109 ? -11.090 -4.215  5.909   1.00 0.00 ? 109 SER A HA   6  
ATOM 10410 H HB2  . SER A 1 109 ? -13.411 -3.176  6.318   1.00 0.00 ? 109 SER A HB2  6  
ATOM 10411 H HB3  . SER A 1 109 ? -12.647 -2.819  4.782   1.00 0.00 ? 109 SER A HB3  6  
ATOM 10412 H HG   . SER A 1 109 ? -14.798 -3.400  4.356   1.00 0.00 ? 109 SER A HG   6  
ATOM 10413 N N    . GLY A 1 110 ? -12.130 -5.238  7.996   1.00 0.00 ? 110 GLY A N    6  
ATOM 10414 C CA   . GLY A 1 110 ? -12.500 -6.019  9.165   1.00 0.00 ? 110 GLY A CA   6  
ATOM 10415 C C    . GLY A 1 110 ? -14.020 -6.070  9.332   1.00 0.00 ? 110 GLY A C    6  
ATOM 10416 O O    . GLY A 1 110 ? -14.674 -6.978  8.821   1.00 0.00 ? 110 GLY A O    6  
ATOM 10417 H H    . GLY A 1 110 ? -11.591 -4.419  8.188   1.00 0.00 ? 110 GLY A H    6  
ATOM 10418 H HA2  . GLY A 1 110 ? -12.106 -7.031  9.070   1.00 0.00 ? 110 GLY A HA2  6  
ATOM 10419 H HA3  . GLY A 1 110 ? -12.047 -5.583  10.055  1.00 0.00 ? 110 GLY A HA3  6  
ATOM 10420 N N    . VAL A 1 111 ? -14.538 -5.084  10.048  1.00 0.00 ? 111 VAL A N    6  
ATOM 10421 C CA   . VAL A 1 111 ? -15.969 -5.005  10.289  1.00 0.00 ? 111 VAL A CA   6  
ATOM 10422 C C    . VAL A 1 111 ? -16.280 -3.732  11.078  1.00 0.00 ? 111 VAL A C    6  
ATOM 10423 O O    . VAL A 1 111 ? -15.507 -3.332  11.948  1.00 0.00 ? 111 VAL A O    6  
ATOM 10424 C CB   . VAL A 1 111 ? -16.452 -6.276  10.990  1.00 0.00 ? 111 VAL A CB   6  
ATOM 10425 C CG1  . VAL A 1 111 ? -15.674 -6.518  12.285  1.00 0.00 ? 111 VAL A CG1  6  
ATOM 10426 C CG2  . VAL A 1 111 ? -17.957 -6.216  11.258  1.00 0.00 ? 111 VAL A CG2  6  
ATOM 10427 H H    . VAL A 1 111 ? -13.999 -4.349  10.460  1.00 0.00 ? 111 VAL A H    6  
ATOM 10428 H HA   . VAL A 1 111 ? -16.463 -4.946  9.319   1.00 0.00 ? 111 VAL A HA   6  
ATOM 10429 H HB   . VAL A 1 111 ? -16.264 -7.118  10.324  1.00 0.00 ? 111 VAL A HB   6  
ATOM 10430 H HG11 . VAL A 1 111 ? -16.019 -7.442  12.749  1.00 0.00 ? 111 VAL A HG11 6  
ATOM 10431 H HG12 . VAL A 1 111 ? -14.611 -6.599  12.060  1.00 0.00 ? 111 VAL A HG12 6  
ATOM 10432 H HG13 . VAL A 1 111 ? -15.838 -5.685  12.968  1.00 0.00 ? 111 VAL A HG13 6  
ATOM 10433 H HG21 . VAL A 1 111 ? -18.499 -6.373  10.325  1.00 0.00 ? 111 VAL A HG21 6  
ATOM 10434 H HG22 . VAL A 1 111 ? -18.231 -6.993  11.971  1.00 0.00 ? 111 VAL A HG22 6  
ATOM 10435 H HG23 . VAL A 1 111 ? -18.215 -5.239  11.668  1.00 0.00 ? 111 VAL A HG23 6  
ATOM 10436 N N    . PRO A 1 112 ? -17.442 -3.114  10.738  1.00 0.00 ? 112 PRO A N    6  
ATOM 10437 C CA   . PRO A 1 112 ? -17.865 -1.894  11.405  1.00 0.00 ? 112 PRO A CA   6  
ATOM 10438 C C    . PRO A 1 112 ? -18.394 -2.193  12.810  1.00 0.00 ? 112 PRO A C    6  
ATOM 10439 O O    . PRO A 1 112 ? -19.283 -3.026  12.978  1.00 0.00 ? 112 PRO A O    6  
ATOM 10440 C CB   . PRO A 1 112 ? -18.917 -1.289  10.490  1.00 0.00 ? 112 PRO A CB   6  
ATOM 10441 C CG   . PRO A 1 112 ? -19.379 -2.418  9.583   1.00 0.00 ? 112 PRO A CG   6  
ATOM 10442 C CD   . PRO A 1 112 ? -18.382 -3.558  9.713   1.00 0.00 ? 112 PRO A CD   6  
ATOM 10443 H HA   . PRO A 1 112 ? -17.086 -1.280  11.532  1.00 0.00 ? 112 PRO A HA   6  
ATOM 10444 H HB2  . PRO A 1 112 ? -19.750 -0.885  11.066  1.00 0.00 ? 112 PRO A HB2  6  
ATOM 10445 H HB3  . PRO A 1 112 ? -18.502 -0.466  9.909   1.00 0.00 ? 112 PRO A HB3  6  
ATOM 10446 H HG2  . PRO A 1 112 ? -20.378 -2.750  9.865   1.00 0.00 ? 112 PRO A HG2  6  
ATOM 10447 H HG3  . PRO A 1 112 ? -19.436 -2.078  8.549   1.00 0.00 ? 112 PRO A HG3  6  
ATOM 10448 H HD2  . PRO A 1 112 ? -18.876 -4.485  10.004  1.00 0.00 ? 112 PRO A HD2  6  
ATOM 10449 H HD3  . PRO A 1 112 ? -17.875 -3.751  8.768   1.00 0.00 ? 112 PRO A HD3  6  
ATOM 10450 N N    . PRO A 1 113 ? -17.811 -1.476  13.808  1.00 0.00 ? 113 PRO A N    6  
ATOM 10451 C CA   . PRO A 1 113 ? -18.214 -1.656  15.192  1.00 0.00 ? 113 PRO A CA   6  
ATOM 10452 C C    . PRO A 1 113 ? -19.567 -0.993  15.459  1.00 0.00 ? 113 PRO A C    6  
ATOM 10453 O O    . PRO A 1 113 ? -19.691 -0.172  16.368  1.00 0.00 ? 113 PRO A O    6  
ATOM 10454 C CB   . PRO A 1 113 ? -17.085 -1.054  16.012  1.00 0.00 ? 113 PRO A CB   6  
ATOM 10455 C CG   . PRO A 1 113 ? -16.316 -0.150  15.063  1.00 0.00 ? 113 PRO A CG   6  
ATOM 10456 C CD   . PRO A 1 113 ? -16.756 -0.480  13.646  1.00 0.00 ? 113 PRO A CD   6  
ATOM 10457 H HA   . PRO A 1 113 ? -18.342 -2.627  15.393  1.00 0.00 ? 113 PRO A HA   6  
ATOM 10458 H HB2  . PRO A 1 113 ? -17.475 -0.490  16.859  1.00 0.00 ? 113 PRO A HB2  6  
ATOM 10459 H HB3  . PRO A 1 113 ? -16.439 -1.833  16.418  1.00 0.00 ? 113 PRO A HB3  6  
ATOM 10460 H HG2  . PRO A 1 113 ? -16.515 0.898   15.289  1.00 0.00 ? 113 PRO A HG2  6  
ATOM 10461 H HG3  . PRO A 1 113 ? -15.243 -0.302  15.175  1.00 0.00 ? 113 PRO A HG3  6  
ATOM 10462 H HD2  . PRO A 1 113 ? -17.123 0.405   13.128  1.00 0.00 ? 113 PRO A HD2  6  
ATOM 10463 H HD3  . PRO A 1 113 ? -15.927 -0.873  13.056  1.00 0.00 ? 113 PRO A HD3  6  
ATOM 10464 N N    . SER A 1 114 ? -20.546 -1.372  14.652  1.00 0.00 ? 114 SER A N    6  
ATOM 10465 C CA   . SER A 1 114 ? -21.885 -0.825  14.790  1.00 0.00 ? 114 SER A CA   6  
ATOM 10466 C C    . SER A 1 114 ? -22.677 -1.632  15.821  1.00 0.00 ? 114 SER A C    6  
ATOM 10467 O O    . SER A 1 114 ? -23.091 -1.097  16.848  1.00 0.00 ? 114 SER A O    6  
ATOM 10468 C CB   . SER A 1 114 ? -22.617 -0.815  13.447  1.00 0.00 ? 114 SER A CB   6  
ATOM 10469 O OG   . SER A 1 114 ? -22.666 0.490   12.876  1.00 0.00 ? 114 SER A OG   6  
ATOM 10470 H H    . SER A 1 114 ? -20.437 -2.040  13.916  1.00 0.00 ? 114 SER A H    6  
ATOM 10471 H HA   . SER A 1 114 ? -21.743 0.200   15.134  1.00 0.00 ? 114 SER A HA   6  
ATOM 10472 H HB2  . SER A 1 114 ? -22.117 -1.494  12.757  1.00 0.00 ? 114 SER A HB2  6  
ATOM 10473 H HB3  . SER A 1 114 ? -23.632 -1.189  13.584  1.00 0.00 ? 114 SER A HB3  6  
ATOM 10474 H HG   . SER A 1 114 ? -21.988 1.080   13.312  1.00 0.00 ? 114 SER A HG   6  
ATOM 10475 N N    . GLY A 1 115 ? -22.864 -2.906  15.510  1.00 0.00 ? 115 GLY A N    6  
ATOM 10476 C CA   . GLY A 1 115 ? -23.599 -3.792  16.396  1.00 0.00 ? 115 GLY A CA   6  
ATOM 10477 C C    . GLY A 1 115 ? -23.589 -5.228  15.867  1.00 0.00 ? 115 GLY A C    6  
ATOM 10478 O O    . GLY A 1 115 ? -24.629 -5.758  15.479  1.00 0.00 ? 115 GLY A O    6  
ATOM 10479 H H    . GLY A 1 115 ? -22.524 -3.333  14.672  1.00 0.00 ? 115 GLY A H    6  
ATOM 10480 H HA2  . GLY A 1 115 ? -23.157 -3.765  17.392  1.00 0.00 ? 115 GLY A HA2  6  
ATOM 10481 H HA3  . GLY A 1 115 ? -24.627 -3.444  16.493  1.00 0.00 ? 115 GLY A HA3  6  
ATOM 10482 N N    . PRO A 1 116 ? -22.371 -5.833  15.869  1.00 0.00 ? 116 PRO A N    6  
ATOM 10483 C CA   . PRO A 1 116 ? -22.212 -7.197  15.395  1.00 0.00 ? 116 PRO A CA   6  
ATOM 10484 C C    . PRO A 1 116 ? -22.750 -8.200  16.418  1.00 0.00 ? 116 PRO A C    6  
ATOM 10485 O O    . PRO A 1 116 ? -23.231 -7.810  17.480  1.00 0.00 ? 116 PRO A O    6  
ATOM 10486 C CB   . PRO A 1 116 ? -20.722 -7.353  15.137  1.00 0.00 ? 116 PRO A CB   6  
ATOM 10487 C CG   . PRO A 1 116 ? -20.046 -6.234  15.912  1.00 0.00 ? 116 PRO A CG   6  
ATOM 10488 C CD   . PRO A 1 116 ? -21.118 -5.236  16.322  1.00 0.00 ? 116 PRO A CD   6  
ATOM 10489 H HA   . PRO A 1 116 ? -22.749 -7.340  14.563  1.00 0.00 ? 116 PRO A HA   6  
ATOM 10490 H HB2  . PRO A 1 116 ? -20.368 -8.328  15.471  1.00 0.00 ? 116 PRO A HB2  6  
ATOM 10491 H HB3  . PRO A 1 116 ? -20.500 -7.280  14.073  1.00 0.00 ? 116 PRO A HB3  6  
ATOM 10492 H HG2  . PRO A 1 116 ? -19.538 -6.631  16.791  1.00 0.00 ? 116 PRO A HG2  6  
ATOM 10493 H HG3  . PRO A 1 116 ? -19.287 -5.748  15.298  1.00 0.00 ? 116 PRO A HG3  6  
ATOM 10494 H HD2  . PRO A 1 116 ? -21.121 -5.079  17.400  1.00 0.00 ? 116 PRO A HD2  6  
ATOM 10495 H HD3  . PRO A 1 116 ? -20.952 -4.264  15.858  1.00 0.00 ? 116 PRO A HD3  6  
ATOM 10496 N N    . SER A 1 117 ? -22.649 -9.472  16.061  1.00 0.00 ? 117 SER A N    6  
ATOM 10497 C CA   . SER A 1 117 ? -23.120 -10.533 16.935  1.00 0.00 ? 117 SER A CA   6  
ATOM 10498 C C    . SER A 1 117 ? -22.554 -11.878 16.475  1.00 0.00 ? 117 SER A C    6  
ATOM 10499 O O    . SER A 1 117 ? -22.811 -12.313 15.353  1.00 0.00 ? 117 SER A O    6  
ATOM 10500 C CB   . SER A 1 117 ? -24.649 -10.583 16.967  1.00 0.00 ? 117 SER A CB   6  
ATOM 10501 O OG   . SER A 1 117 ? -25.207 -10.696 15.660  1.00 0.00 ? 117 SER A OG   6  
ATOM 10502 H H    . SER A 1 117 ? -22.256 -9.780  15.195  1.00 0.00 ? 117 SER A H    6  
ATOM 10503 H HA   . SER A 1 117 ? -22.745 -10.279 17.926  1.00 0.00 ? 117 SER A HA   6  
ATOM 10504 H HB2  . SER A 1 117 ? -24.971 -11.430 17.572  1.00 0.00 ? 117 SER A HB2  6  
ATOM 10505 H HB3  . SER A 1 117 ? -25.031 -9.683  17.448  1.00 0.00 ? 117 SER A HB3  6  
ATOM 10506 H HG   . SER A 1 117 ? -26.199 -10.799 15.720  1.00 0.00 ? 117 SER A HG   6  
ATOM 10507 N N    . SER A 1 118 ? -21.795 -12.500 17.365  1.00 0.00 ? 118 SER A N    6  
ATOM 10508 C CA   . SER A 1 118 ? -21.191 -13.787 17.065  1.00 0.00 ? 118 SER A CA   6  
ATOM 10509 C C    . SER A 1 118 ? -22.252 -14.888 17.118  1.00 0.00 ? 118 SER A C    6  
ATOM 10510 O O    . SER A 1 118 ? -23.380 -14.648 17.545  1.00 0.00 ? 118 SER A O    6  
ATOM 10511 C CB   . SER A 1 118 ? -20.051 -14.101 18.037  1.00 0.00 ? 118 SER A CB   6  
ATOM 10512 O OG   . SER A 1 118 ? -19.151 -13.005 18.175  1.00 0.00 ? 118 SER A OG   6  
ATOM 10513 H H    . SER A 1 118 ? -21.591 -12.140 18.275  1.00 0.00 ? 118 SER A H    6  
ATOM 10514 H HA   . SER A 1 118 ? -20.790 -13.690 16.056  1.00 0.00 ? 118 SER A HA   6  
ATOM 10515 H HB2  . SER A 1 118 ? -20.466 -14.354 19.012  1.00 0.00 ? 118 SER A HB2  6  
ATOM 10516 H HB3  . SER A 1 118 ? -19.506 -14.976 17.685  1.00 0.00 ? 118 SER A HB3  6  
ATOM 10517 H HG   . SER A 1 118 ? -19.213 -12.625 19.098  1.00 0.00 ? 118 SER A HG   6  
ATOM 10518 N N    . GLY A 1 119 ? -21.852 -16.072 16.677  1.00 0.00 ? 119 GLY A N    6  
ATOM 10519 C CA   . GLY A 1 119 ? -22.755 -17.211 16.669  1.00 0.00 ? 119 GLY A CA   6  
ATOM 10520 C C    . GLY A 1 119 ? -24.083 -16.853 15.999  1.00 0.00 ? 119 GLY A C    6  
ATOM 10521 O O    . GLY A 1 119 ? -24.099 -16.272 14.916  1.00 0.00 ? 119 GLY A O    6  
ATOM 10522 H H    . GLY A 1 119 ? -20.933 -16.259 16.331  1.00 0.00 ? 119 GLY A H    6  
ATOM 10523 H HA2  . GLY A 1 119 ? -22.290 -18.044 16.142  1.00 0.00 ? 119 GLY A HA2  6  
ATOM 10524 H HA3  . GLY A 1 119 ? -22.936 -17.543 17.691  1.00 0.00 ? 119 GLY A HA3  6  
ATOM 10525 N N    . GLY A 1 1   ? 2.511   -16.897 13.829  1.00 0.00 ? 1   GLY A N    7  
ATOM 10526 C CA   . GLY A 1 1   ? 1.374   -16.773 12.933  1.00 0.00 ? 1   GLY A CA   7  
ATOM 10527 C C    . GLY A 1 1   ? 1.813   -16.267 11.557  1.00 0.00 ? 1   GLY A C    7  
ATOM 10528 O O    . GLY A 1 1   ? 2.753   -15.481 11.451  1.00 0.00 ? 1   GLY A O    7  
ATOM 10529 H H1   . GLY A 1 1   ? 3.298   -17.384 13.448  1.00 0.00 ? 1   GLY A H1   7  
ATOM 10530 H HA2  . GLY A 1 1   ? 0.881   -17.740 12.829  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10531 H HA3  . GLY A 1 1   ? 0.643   -16.087 13.360  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10532 N N    . SER A 1 2   ? 1.110   -16.739 10.537  1.00 0.00 ? 2   SER A N    7  
ATOM 10533 C CA   . SER A 1 2   ? 1.415   -16.344 9.172   1.00 0.00 ? 2   SER A CA   7  
ATOM 10534 C C    . SER A 1 2   ? 0.349   -16.889 8.220   1.00 0.00 ? 2   SER A C    7  
ATOM 10535 O O    . SER A 1 2   ? -0.138  -18.004 8.399   1.00 0.00 ? 2   SER A O    7  
ATOM 10536 C CB   . SER A 1 2   ? 2.803   -16.836 8.754   1.00 0.00 ? 2   SER A CB   7  
ATOM 10537 O OG   . SER A 1 2   ? 3.174   -16.353 7.466   1.00 0.00 ? 2   SER A OG   7  
ATOM 10538 H H    . SER A 1 2   ? 0.347   -17.378 10.632  1.00 0.00 ? 2   SER A H    7  
ATOM 10539 H HA   . SER A 1 2   ? 1.403   -15.254 9.177   1.00 0.00 ? 2   SER A HA   7  
ATOM 10540 H HB2  . SER A 1 2   ? 3.539   -16.512 9.489   1.00 0.00 ? 2   SER A HB2  7  
ATOM 10541 H HB3  . SER A 1 2   ? 2.815   -17.926 8.750   1.00 0.00 ? 2   SER A HB3  7  
ATOM 10542 H HG   . SER A 1 2   ? 2.942   -15.383 7.384   1.00 0.00 ? 2   SER A HG   7  
ATOM 10543 N N    . SER A 1 3   ? 0.018   -16.077 7.227   1.00 0.00 ? 3   SER A N    7  
ATOM 10544 C CA   . SER A 1 3   ? -0.981  -16.463 6.245   1.00 0.00 ? 3   SER A CA   7  
ATOM 10545 C C    . SER A 1 3   ? -0.393  -16.370 4.836   1.00 0.00 ? 3   SER A C    7  
ATOM 10546 O O    . SER A 1 3   ? 0.108   -15.320 4.436   1.00 0.00 ? 3   SER A O    7  
ATOM 10547 C CB   . SER A 1 3   ? -2.231  -15.588 6.358   1.00 0.00 ? 3   SER A CB   7  
ATOM 10548 O OG   . SER A 1 3   ? -2.976  -15.870 7.539   1.00 0.00 ? 3   SER A OG   7  
ATOM 10549 H H    . SER A 1 3   ? 0.419   -15.171 7.087   1.00 0.00 ? 3   SER A H    7  
ATOM 10550 H HA   . SER A 1 3   ? -1.238  -17.495 6.485   1.00 0.00 ? 3   SER A HA   7  
ATOM 10551 H HB2  . SER A 1 3   ? -1.939  -14.538 6.355   1.00 0.00 ? 3   SER A HB2  7  
ATOM 10552 H HB3  . SER A 1 3   ? -2.864  -15.745 5.484   1.00 0.00 ? 3   SER A HB3  7  
ATOM 10553 H HG   . SER A 1 3   ? -3.953  -15.898 7.329   1.00 0.00 ? 3   SER A HG   7  
ATOM 10554 N N    . GLY A 1 4   ? -0.474  -17.483 4.121   1.00 0.00 ? 4   GLY A N    7  
ATOM 10555 C CA   . GLY A 1 4   ? 0.043   -17.540 2.764   1.00 0.00 ? 4   GLY A CA   7  
ATOM 10556 C C    . GLY A 1 4   ? -1.096  -17.634 1.746   1.00 0.00 ? 4   GLY A C    7  
ATOM 10557 O O    . GLY A 1 4   ? -2.259  -17.431 2.090   1.00 0.00 ? 4   GLY A O    7  
ATOM 10558 H H    . GLY A 1 4   ? -0.884  -18.333 4.453   1.00 0.00 ? 4   GLY A H    7  
ATOM 10559 H HA2  . GLY A 1 4   ? 0.644   -16.653 2.563   1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10560 H HA3  . GLY A 1 4   ? 0.702   -18.402 2.659   1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10561 N N    . SER A 1 5   ? -0.721  -17.943 0.514   1.00 0.00 ? 5   SER A N    7  
ATOM 10562 C CA   . SER A 1 5   ? -1.696  -18.066 -0.556  1.00 0.00 ? 5   SER A CA   7  
ATOM 10563 C C    . SER A 1 5   ? -1.092  -18.845 -1.727  1.00 0.00 ? 5   SER A C    7  
ATOM 10564 O O    . SER A 1 5   ? 0.017   -18.548 -2.169  1.00 0.00 ? 5   SER A O    7  
ATOM 10565 C CB   . SER A 1 5   ? -2.176  -16.691 -1.025  1.00 0.00 ? 5   SER A CB   7  
ATOM 10566 O OG   . SER A 1 5   ? -3.243  -16.790 -1.965  1.00 0.00 ? 5   SER A OG   7  
ATOM 10567 H H    . SER A 1 5   ? 0.228   -18.107 0.242   1.00 0.00 ? 5   SER A H    7  
ATOM 10568 H HA   . SER A 1 5   ? -2.532  -18.614 -0.123  1.00 0.00 ? 5   SER A HA   7  
ATOM 10569 H HB2  . SER A 1 5   ? -2.505  -16.109 -0.164  1.00 0.00 ? 5   SER A HB2  7  
ATOM 10570 H HB3  . SER A 1 5   ? -1.344  -16.151 -1.476  1.00 0.00 ? 5   SER A HB3  7  
ATOM 10571 H HG   . SER A 1 5   ? -3.845  -17.549 -1.719  1.00 0.00 ? 5   SER A HG   7  
ATOM 10572 N N    . SER A 1 6   ? -1.849  -19.826 -2.196  1.00 0.00 ? 6   SER A N    7  
ATOM 10573 C CA   . SER A 1 6   ? -1.403  -20.650 -3.307  1.00 0.00 ? 6   SER A CA   7  
ATOM 10574 C C    . SER A 1 6   ? -1.451  -19.845 -4.607  1.00 0.00 ? 6   SER A C    7  
ATOM 10575 O O    . SER A 1 6   ? -2.528  -19.586 -5.142  1.00 0.00 ? 6   SER A O    7  
ATOM 10576 C CB   . SER A 1 6   ? -2.256  -21.914 -3.433  1.00 0.00 ? 6   SER A CB   7  
ATOM 10577 O OG   . SER A 1 6   ? -1.639  -22.894 -4.263  1.00 0.00 ? 6   SER A OG   7  
ATOM 10578 H H    . SER A 1 6   ? -2.750  -20.061 -1.831  1.00 0.00 ? 6   SER A H    7  
ATOM 10579 H HA   . SER A 1 6   ? -0.377  -20.927 -3.066  1.00 0.00 ? 6   SER A HA   7  
ATOM 10580 H HB2  . SER A 1 6   ? -2.429  -22.335 -2.442  1.00 0.00 ? 6   SER A HB2  7  
ATOM 10581 H HB3  . SER A 1 6   ? -3.231  -21.653 -3.843  1.00 0.00 ? 6   SER A HB3  7  
ATOM 10582 H HG   . SER A 1 6   ? -2.333  -23.500 -4.651  1.00 0.00 ? 6   SER A HG   7  
ATOM 10583 N N    . GLY A 1 7   ? -0.270  -19.472 -5.079  1.00 0.00 ? 7   GLY A N    7  
ATOM 10584 C CA   . GLY A 1 7   ? -0.164  -18.702 -6.306  1.00 0.00 ? 7   GLY A CA   7  
ATOM 10585 C C    . GLY A 1 7   ? 1.299   -18.413 -6.647  1.00 0.00 ? 7   GLY A C    7  
ATOM 10586 O O    . GLY A 1 7   ? 2.186   -19.196 -6.310  1.00 0.00 ? 7   GLY A O    7  
ATOM 10587 H H    . GLY A 1 7   ? 0.601   -19.686 -4.638  1.00 0.00 ? 7   GLY A H    7  
ATOM 10588 H HA2  . GLY A 1 7   ? -0.631  -19.250 -7.125  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10589 H HA3  . GLY A 1 7   ? -0.708  -17.764 -6.200  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10590 N N    . PRO A 1 8   ? 1.513   -17.256 -7.330  1.00 0.00 ? 8   PRO A N    7  
ATOM 10591 C CA   . PRO A 1 8   ? 2.853   -16.854 -7.721  1.00 0.00 ? 8   PRO A CA   7  
ATOM 10592 C C    . PRO A 1 8   ? 3.640   -16.330 -6.519  1.00 0.00 ? 8   PRO A C    7  
ATOM 10593 O O    . PRO A 1 8   ? 3.116   -16.267 -5.408  1.00 0.00 ? 8   PRO A O    7  
ATOM 10594 C CB   . PRO A 1 8   ? 2.650   -15.805 -8.801  1.00 0.00 ? 8   PRO A CB   7  
ATOM 10595 C CG   . PRO A 1 8   ? 1.216   -15.322 -8.650  1.00 0.00 ? 8   PRO A CG   7  
ATOM 10596 C CD   . PRO A 1 8   ? 0.487   -16.304 -7.747  1.00 0.00 ? 8   PRO A CD   7  
ATOM 10597 H HA   . PRO A 1 8   ? 3.366   -17.642 -8.061  1.00 0.00 ? 8   PRO A HA   7  
ATOM 10598 H HB2  . PRO A 1 8   ? 3.354   -14.981 -8.683  1.00 0.00 ? 8   PRO A HB2  7  
ATOM 10599 H HB3  . PRO A 1 8   ? 2.817   -16.227 -9.792  1.00 0.00 ? 8   PRO A HB3  7  
ATOM 10600 H HG2  . PRO A 1 8   ? 1.194   -14.321 -8.220  1.00 0.00 ? 8   PRO A HG2  7  
ATOM 10601 H HG3  . PRO A 1 8   ? 0.728   -15.263 -9.622  1.00 0.00 ? 8   PRO A HG3  7  
ATOM 10602 H HD2  . PRO A 1 8   ? 0.043   -15.800 -6.889  1.00 0.00 ? 8   PRO A HD2  7  
ATOM 10603 H HD3  . PRO A 1 8   ? -0.324  -16.803 -8.279  1.00 0.00 ? 8   PRO A HD3  7  
ATOM 10604 N N    . GLN A 1 9   ? 4.887   -15.967 -6.781  1.00 0.00 ? 9   GLN A N    7  
ATOM 10605 C CA   . GLN A 1 9   ? 5.752   -15.450 -5.734  1.00 0.00 ? 9   GLN A CA   7  
ATOM 10606 C C    . GLN A 1 9   ? 6.377   -14.122 -6.169  1.00 0.00 ? 9   GLN A C    7  
ATOM 10607 O O    . GLN A 1 9   ? 6.003   -13.063 -5.667  1.00 0.00 ? 9   GLN A O    7  
ATOM 10608 C CB   . GLN A 1 9   ? 6.832   -16.468 -5.363  1.00 0.00 ? 9   GLN A CB   7  
ATOM 10609 C CG   . GLN A 1 9   ? 7.080   -16.478 -3.853  1.00 0.00 ? 9   GLN A CG   7  
ATOM 10610 C CD   . GLN A 1 9   ? 7.336   -17.900 -3.349  1.00 0.00 ? 9   GLN A CD   7  
ATOM 10611 O OE1  . GLN A 1 9   ? 6.451   -18.583 -2.861  1.00 0.00 ? 9   GLN A OE1  7  
ATOM 10612 N NE2  . GLN A 1 9   ? 8.595   -18.306 -3.493  1.00 0.00 ? 9   GLN A NE2  7  
ATOM 10613 H H    . GLN A 1 9   ? 5.307   -16.021 -7.687  1.00 0.00 ? 9   GLN A H    7  
ATOM 10614 H HA   . GLN A 1 9   ? 5.102   -15.289 -4.874  1.00 0.00 ? 9   GLN A HA   7  
ATOM 10615 H HB2  . GLN A 1 9   ? 6.529   -17.462 -5.692  1.00 0.00 ? 9   GLN A HB2  7  
ATOM 10616 H HB3  . GLN A 1 9   ? 7.758   -16.228 -5.885  1.00 0.00 ? 9   GLN A HB3  7  
ATOM 10617 H HG2  . GLN A 1 9   ? 7.935   -15.845 -3.617  1.00 0.00 ? 9   GLN A HG2  7  
ATOM 10618 H HG3  . GLN A 1 9   ? 6.218   -16.055 -3.336  1.00 0.00 ? 9   GLN A HG3  7  
ATOM 10619 H HE21 . GLN A 1 9   ? 9.273   -17.696 -3.901  1.00 0.00 ? 9   GLN A HE21 7  
ATOM 10620 H HE22 . GLN A 1 9   ? 8.862   -19.222 -3.193  1.00 0.00 ? 9   GLN A HE22 7  
ATOM 10621 N N    . LEU A 1 10  ? 7.317   -14.223 -7.097  1.00 0.00 ? 10  LEU A N    7  
ATOM 10622 C CA   . LEU A 1 10  ? 7.996   -13.043 -7.605  1.00 0.00 ? 10  LEU A CA   7  
ATOM 10623 C C    . LEU A 1 10  ? 8.653   -13.376 -8.946  1.00 0.00 ? 10  LEU A C    7  
ATOM 10624 O O    . LEU A 1 10  ? 8.837   -14.546 -9.278  1.00 0.00 ? 10  LEU A O    7  
ATOM 10625 C CB   . LEU A 1 10  ? 8.972   -12.496 -6.562  1.00 0.00 ? 10  LEU A CB   7  
ATOM 10626 C CG   . LEU A 1 10  ? 10.086  -13.449 -6.121  1.00 0.00 ? 10  LEU A CG   7  
ATOM 10627 C CD1  . LEU A 1 10  ? 11.348  -12.675 -5.734  1.00 0.00 ? 10  LEU A CD1  7  
ATOM 10628 C CD2  . LEU A 1 10  ? 9.608   -14.366 -4.993  1.00 0.00 ? 10  LEU A CD2  7  
ATOM 10629 H H    . LEU A 1 10  ? 7.614   -15.089 -7.500  1.00 0.00 ? 10  LEU A H    7  
ATOM 10630 H HA   . LEU A 1 10  ? 7.240   -12.277 -7.772  1.00 0.00 ? 10  LEU A HA   7  
ATOM 10631 H HB2  . LEU A 1 10  ? 9.432   -11.592 -6.961  1.00 0.00 ? 10  LEU A HB2  7  
ATOM 10632 H HB3  . LEU A 1 10  ? 8.403   -12.202 -5.680  1.00 0.00 ? 10  LEU A HB3  7  
ATOM 10633 H HG   . LEU A 1 10  ? 10.345  -14.086 -6.966  1.00 0.00 ? 10  LEU A HG   7  
ATOM 10634 H HD11 . LEU A 1 10  ? 11.653  -12.958 -4.727  1.00 0.00 ? 10  LEU A HD11 7  
ATOM 10635 H HD12 . LEU A 1 10  ? 12.148  -12.910 -6.436  1.00 0.00 ? 10  LEU A HD12 7  
ATOM 10636 H HD13 . LEU A 1 10  ? 11.141  -11.605 -5.764  1.00 0.00 ? 10  LEU A HD13 7  
ATOM 10637 H HD21 . LEU A 1 10  ? 8.539   -14.222 -4.836  1.00 0.00 ? 10  LEU A HD21 7  
ATOM 10638 H HD22 . LEU A 1 10  ? 9.799   -15.404 -5.264  1.00 0.00 ? 10  LEU A HD22 7  
ATOM 10639 H HD23 . LEU A 1 10  ? 10.146  -14.125 -4.076  1.00 0.00 ? 10  LEU A HD23 7  
ATOM 10640 N N    . VAL A 1 11  ? 8.988   -12.326 -9.681  1.00 0.00 ? 11  VAL A N    7  
ATOM 10641 C CA   . VAL A 1 11  ? 9.621   -12.493 -10.979 1.00 0.00 ? 11  VAL A CA   7  
ATOM 10642 C C    . VAL A 1 11  ? 10.897  -11.650 -11.032 1.00 0.00 ? 11  VAL A C    7  
ATOM 10643 O O    . VAL A 1 11  ? 10.877  -10.466 -10.698 1.00 0.00 ? 11  VAL A O    7  
ATOM 10644 C CB   . VAL A 1 11  ? 8.630   -12.147 -12.092 1.00 0.00 ? 11  VAL A CB   7  
ATOM 10645 C CG1  . VAL A 1 11  ? 8.193   -10.683 -12.002 1.00 0.00 ? 11  VAL A CG1  7  
ATOM 10646 C CG2  . VAL A 1 11  ? 9.220   -12.459 -13.469 1.00 0.00 ? 11  VAL A CG2  7  
ATOM 10647 H H    . VAL A 1 11  ? 8.835   -11.378 -9.404  1.00 0.00 ? 11  VAL A H    7  
ATOM 10648 H HA   . VAL A 1 11  ? 9.890   -13.544 -11.082 1.00 0.00 ? 11  VAL A HA   7  
ATOM 10649 H HB   . VAL A 1 11  ? 7.745   -12.769 -11.959 1.00 0.00 ? 11  VAL A HB   7  
ATOM 10650 H HG11 . VAL A 1 11  ? 8.502   -10.270 -11.042 1.00 0.00 ? 11  VAL A HG11 7  
ATOM 10651 H HG12 . VAL A 1 11  ? 8.657   -10.115 -12.808 1.00 0.00 ? 11  VAL A HG12 7  
ATOM 10652 H HG13 . VAL A 1 11  ? 7.108   -10.622 -12.091 1.00 0.00 ? 11  VAL A HG13 7  
ATOM 10653 H HG21 . VAL A 1 11  ? 9.408   -13.530 -13.549 1.00 0.00 ? 11  VAL A HG21 7  
ATOM 10654 H HG22 . VAL A 1 11  ? 8.517   -12.154 -14.244 1.00 0.00 ? 11  VAL A HG22 7  
ATOM 10655 H HG23 . VAL A 1 11  ? 10.157  -11.915 -13.594 1.00 0.00 ? 11  VAL A HG23 7  
ATOM 10656 N N    . ARG A 1 12  ? 11.976  -12.293 -11.453 1.00 0.00 ? 12  ARG A N    7  
ATOM 10657 C CA   . ARG A 1 12  ? 13.258  -11.618 -11.553 1.00 0.00 ? 12  ARG A CA   7  
ATOM 10658 C C    . ARG A 1 12  ? 13.346  -10.839 -12.867 1.00 0.00 ? 12  ARG A C    7  
ATOM 10659 O O    . ARG A 1 12  ? 13.534  -11.427 -13.931 1.00 0.00 ? 12  ARG A O    7  
ATOM 10660 C CB   . ARG A 1 12  ? 14.414  -12.618 -11.483 1.00 0.00 ? 12  ARG A CB   7  
ATOM 10661 C CG   . ARG A 1 12  ? 15.748  -11.899 -11.265 1.00 0.00 ? 12  ARG A CG   7  
ATOM 10662 C CD   . ARG A 1 12  ? 16.779  -12.838 -10.635 1.00 0.00 ? 12  ARG A CD   7  
ATOM 10663 N NE   . ARG A 1 12  ? 17.249  -12.281 -9.347  1.00 0.00 ? 12  ARG A NE   7  
ATOM 10664 C CZ   . ARG A 1 12  ? 18.328  -12.724 -8.686  1.00 0.00 ? 12  ARG A CZ   7  
ATOM 10665 N NH1  . ARG A 1 12  ? 19.054  -13.732 -9.189  1.00 0.00 ? 12  ARG A NH1  7  
ATOM 10666 N NH2  . ARG A 1 12  ? 18.680  -12.159 -7.523  1.00 0.00 ? 12  ARG A NH2  7  
ATOM 10667 H H    . ARG A 1 12  ? 11.983  -13.256 -11.722 1.00 0.00 ? 12  ARG A H    7  
ATOM 10668 H HA   . ARG A 1 12  ? 13.287  -10.946 -10.696 1.00 0.00 ? 12  ARG A HA   7  
ATOM 10669 H HB2  . ARG A 1 12  ? 14.240  -13.323 -10.671 1.00 0.00 ? 12  ARG A HB2  7  
ATOM 10670 H HB3  . ARG A 1 12  ? 14.456  -13.197 -12.405 1.00 0.00 ? 12  ARG A HB3  7  
ATOM 10671 H HG2  . ARG A 1 12  ? 16.124  -11.526 -12.217 1.00 0.00 ? 12  ARG A HG2  7  
ATOM 10672 H HG3  . ARG A 1 12  ? 15.597  -11.033 -10.620 1.00 0.00 ? 12  ARG A HG3  7  
ATOM 10673 H HD2  . ARG A 1 12  ? 16.339  -13.822 -10.477 1.00 0.00 ? 12  ARG A HD2  7  
ATOM 10674 H HD3  . ARG A 1 12  ? 17.623  -12.971 -11.312 1.00 0.00 ? 12  ARG A HD3  7  
ATOM 10675 H HE   . ARG A 1 12  ? 16.729  -11.528 -8.944  1.00 0.00 ? 12  ARG A HE   7  
ATOM 10676 H HH11 . ARG A 1 12  ? 18.792  -14.153 -10.057 1.00 0.00 ? 12  ARG A HH11 7  
ATOM 10677 H HH12 . ARG A 1 12  ? 19.859  -14.062 -8.696  1.00 0.00 ? 12  ARG A HH12 7  
ATOM 10678 H HH21 . ARG A 1 12  ? 18.137  -11.407 -7.148  1.00 0.00 ? 12  ARG A HH21 7  
ATOM 10679 H HH22 . ARG A 1 12  ? 19.485  -12.490 -7.030  1.00 0.00 ? 12  ARG A HH22 7  
ATOM 10680 N N    . THR A 1 13  ? 13.206  -9.526  -12.750 1.00 0.00 ? 13  THR A N    7  
ATOM 10681 C CA   . THR A 1 13  ? 13.268  -8.661  -13.916 1.00 0.00 ? 13  THR A CA   7  
ATOM 10682 C C    . THR A 1 13  ? 14.288  -7.542  -13.696 1.00 0.00 ? 13  THR A C    7  
ATOM 10683 O O    . THR A 1 13  ? 14.177  -6.774  -12.742 1.00 0.00 ? 13  THR A O    7  
ATOM 10684 C CB   . THR A 1 13  ? 11.854  -8.146  -14.198 1.00 0.00 ? 13  THR A CB   7  
ATOM 10685 O OG1  . THR A 1 13  ? 11.412  -7.641  -12.941 1.00 0.00 ? 13  THR A OG1  7  
ATOM 10686 C CG2  . THR A 1 13  ? 10.872  -9.276  -14.512 1.00 0.00 ? 13  THR A CG2  7  
ATOM 10687 H H    . THR A 1 13  ? 13.053  -9.055  -11.882 1.00 0.00 ? 13  THR A H    7  
ATOM 10688 H HA   . THR A 1 13  ? 13.616  -9.250  -14.764 1.00 0.00 ? 13  THR A HA   7  
ATOM 10689 H HB   . THR A 1 13  ? 11.862  -7.404  -14.996 1.00 0.00 ? 13  THR A HB   7  
ATOM 10690 H HG1  . THR A 1 13  ? 10.719  -6.933  -13.081 1.00 0.00 ? 13  THR A HG1  7  
ATOM 10691 H HG21 . THR A 1 13  ? 10.927  -10.034 -13.730 1.00 0.00 ? 13  THR A HG21 7  
ATOM 10692 H HG22 . THR A 1 13  ? 9.860   -8.875  -14.559 1.00 0.00 ? 13  THR A HG22 7  
ATOM 10693 H HG23 . THR A 1 13  ? 11.129  -9.725  -15.472 1.00 0.00 ? 13  THR A HG23 7  
ATOM 10694 N N    . HIS A 1 14  ? 15.260  -7.487  -14.595 1.00 0.00 ? 14  HIS A N    7  
ATOM 10695 C CA   . HIS A 1 14  ? 16.300  -6.476  -14.512 1.00 0.00 ? 14  HIS A CA   7  
ATOM 10696 C C    . HIS A 1 14  ? 15.685  -5.089  -14.712 1.00 0.00 ? 14  HIS A C    7  
ATOM 10697 O O    . HIS A 1 14  ? 14.940  -4.869  -15.666 1.00 0.00 ? 14  HIS A O    7  
ATOM 10698 C CB   . HIS A 1 14  ? 17.428  -6.773  -15.502 1.00 0.00 ? 14  HIS A CB   7  
ATOM 10699 C CG   . HIS A 1 14  ? 18.470  -7.730  -14.976 1.00 0.00 ? 14  HIS A CG   7  
ATOM 10700 N ND1  . HIS A 1 14  ? 18.190  -9.051  -14.673 1.00 0.00 ? 14  HIS A ND1  7  
ATOM 10701 C CD2  . HIS A 1 14  ? 19.794  -7.545  -14.704 1.00 0.00 ? 14  HIS A CD2  7  
ATOM 10702 C CE1  . HIS A 1 14  ? 19.302  -9.625  -14.237 1.00 0.00 ? 14  HIS A CE1  7  
ATOM 10703 N NE2  . HIS A 1 14  ? 20.295  -8.690  -14.257 1.00 0.00 ? 14  HIS A NE2  7  
ATOM 10704 H H    . HIS A 1 14  ? 15.343  -8.116  -15.368 1.00 0.00 ? 14  HIS A H    7  
ATOM 10705 H HA   . HIS A 1 14  ? 16.716  -6.537  -13.506 1.00 0.00 ? 14  HIS A HA   7  
ATOM 10706 H HB2  . HIS A 1 14  ? 16.997  -7.186  -16.414 1.00 0.00 ? 14  HIS A HB2  7  
ATOM 10707 H HB3  . HIS A 1 14  ? 17.914  -5.836  -15.775 1.00 0.00 ? 14  HIS A HB3  7  
ATOM 10708 H HD1  . HIS A 1 14  ? 17.300  -9.497  -14.766 1.00 0.00 ? 14  HIS A HD1  7  
ATOM 10709 H HD2  . HIS A 1 14  ? 20.346  -6.614  -14.831 1.00 0.00 ? 14  HIS A HD2  7  
ATOM 10710 H HE1  . HIS A 1 14  ? 19.406  -10.663 -13.920 1.00 0.00 ? 14  HIS A HE1  7  
ATOM 10711 N N    . GLU A 1 15  ? 16.019  -4.191  -13.798 1.00 0.00 ? 15  GLU A N    7  
ATOM 10712 C CA   . GLU A 1 15  ? 15.509  -2.832  -13.863 1.00 0.00 ? 15  GLU A CA   7  
ATOM 10713 C C    . GLU A 1 15  ? 16.213  -1.951  -12.828 1.00 0.00 ? 15  GLU A C    7  
ATOM 10714 O O    . GLU A 1 15  ? 16.512  -2.402  -11.724 1.00 0.00 ? 15  GLU A O    7  
ATOM 10715 C CB   . GLU A 1 15  ? 13.992  -2.805  -13.664 1.00 0.00 ? 15  GLU A CB   7  
ATOM 10716 C CG   . GLU A 1 15  ? 13.264  -2.725  -15.007 1.00 0.00 ? 15  GLU A CG   7  
ATOM 10717 C CD   . GLU A 1 15  ? 12.123  -1.708  -14.953 1.00 0.00 ? 15  GLU A CD   7  
ATOM 10718 O OE1  . GLU A 1 15  ? 11.136  -2.000  -14.244 1.00 0.00 ? 15  GLU A OE1  7  
ATOM 10719 O OE2  . GLU A 1 15  ? 12.263  -0.661  -15.621 1.00 0.00 ? 15  GLU A OE2  7  
ATOM 10720 H H    . GLU A 1 15  ? 16.625  -4.378  -13.025 1.00 0.00 ? 15  GLU A H    7  
ATOM 10721 H HA   . GLU A 1 15  ? 15.744  -2.482  -14.868 1.00 0.00 ? 15  GLU A HA   7  
ATOM 10722 H HB2  . GLU A 1 15  ? 13.676  -3.700  -13.128 1.00 0.00 ? 15  GLU A HB2  7  
ATOM 10723 H HB3  . GLU A 1 15  ? 13.717  -1.951  -13.046 1.00 0.00 ? 15  GLU A HB3  7  
ATOM 10724 H HG2  . GLU A 1 15  ? 13.969  -2.445  -15.790 1.00 0.00 ? 15  GLU A HG2  7  
ATOM 10725 H HG3  . GLU A 1 15  ? 12.869  -3.707  -15.270 1.00 0.00 ? 15  GLU A HG3  7  
ATOM 10726 N N    . ASP A 1 16  ? 16.456  -0.710  -13.223 1.00 0.00 ? 16  ASP A N    7  
ATOM 10727 C CA   . ASP A 1 16  ? 17.119  0.239   -12.344 1.00 0.00 ? 16  ASP A CA   7  
ATOM 10728 C C    . ASP A 1 16  ? 16.363  0.311   -11.016 1.00 0.00 ? 16  ASP A C    7  
ATOM 10729 O O    . ASP A 1 16  ? 16.898  -0.058  -9.971  1.00 0.00 ? 16  ASP A O    7  
ATOM 10730 C CB   . ASP A 1 16  ? 17.134  1.641   -12.956 1.00 0.00 ? 16  ASP A CB   7  
ATOM 10731 C CG   . ASP A 1 16  ? 17.987  2.665   -12.206 1.00 0.00 ? 16  ASP A CG   7  
ATOM 10732 O OD1  . ASP A 1 16  ? 17.715  2.856   -11.001 1.00 0.00 ? 16  ASP A OD1  7  
ATOM 10733 O OD2  . ASP A 1 16  ? 18.891  3.235   -12.855 1.00 0.00 ? 16  ASP A OD2  7  
ATOM 10734 H H    . ASP A 1 16  ? 16.209  -0.350  -14.123 1.00 0.00 ? 16  ASP A H    7  
ATOM 10735 H HA   . ASP A 1 16  ? 18.134  -0.141  -12.226 1.00 0.00 ? 16  ASP A HA   7  
ATOM 10736 H HB2  . ASP A 1 16  ? 17.497  1.569   -13.982 1.00 0.00 ? 16  ASP A HB2  7  
ATOM 10737 H HB3  . ASP A 1 16  ? 16.109  2.010   -13.007 1.00 0.00 ? 16  ASP A HB3  7  
ATOM 10738 N N    . VAL A 1 17  ? 15.130  0.790   -11.099 1.00 0.00 ? 17  VAL A N    7  
ATOM 10739 C CA   . VAL A 1 17  ? 14.295  0.915   -9.916  1.00 0.00 ? 17  VAL A CA   7  
ATOM 10740 C C    . VAL A 1 17  ? 14.383  -0.373  -9.095  1.00 0.00 ? 17  VAL A C    7  
ATOM 10741 O O    . VAL A 1 17  ? 14.845  -1.399  -9.592  1.00 0.00 ? 17  VAL A O    7  
ATOM 10742 C CB   . VAL A 1 17  ? 12.862  1.268   -10.323 1.00 0.00 ? 17  VAL A CB   7  
ATOM 10743 C CG1  . VAL A 1 17  ? 12.712  2.774   -10.548 1.00 0.00 ? 17  VAL A CG1  7  
ATOM 10744 C CG2  . VAL A 1 17  ? 12.435  0.482   -11.564 1.00 0.00 ? 17  VAL A CG2  7  
ATOM 10745 H H    . VAL A 1 17  ? 14.702  1.088   -11.952 1.00 0.00 ? 17  VAL A H    7  
ATOM 10746 H HA   . VAL A 1 17  ? 14.689  1.739   -9.321  1.00 0.00 ? 17  VAL A HA   7  
ATOM 10747 H HB   . VAL A 1 17  ? 12.202  0.985   -9.503  1.00 0.00 ? 17  VAL A HB   7  
ATOM 10748 H HG11 . VAL A 1 17  ? 11.700  2.991   -10.892 1.00 0.00 ? 17  VAL A HG11 7  
ATOM 10749 H HG12 . VAL A 1 17  ? 12.899  3.302   -9.613  1.00 0.00 ? 17  VAL A HG12 7  
ATOM 10750 H HG13 . VAL A 1 17  ? 13.429  3.102   -11.300 1.00 0.00 ? 17  VAL A HG13 7  
ATOM 10751 H HG21 . VAL A 1 17  ? 12.826  0.972   -12.456 1.00 0.00 ? 17  VAL A HG21 7  
ATOM 10752 H HG22 . VAL A 1 17  ? 12.828  -0.533  -11.504 1.00 0.00 ? 17  VAL A HG22 7  
ATOM 10753 H HG23 . VAL A 1 17  ? 11.347  0.448   -11.615 1.00 0.00 ? 17  VAL A HG23 7  
ATOM 10754 N N    . PRO A 1 18  ? 13.922  -0.274  -7.820  1.00 0.00 ? 18  PRO A N    7  
ATOM 10755 C CA   . PRO A 1 18  ? 13.944  -1.419  -6.926  1.00 0.00 ? 18  PRO A CA   7  
ATOM 10756 C C    . PRO A 1 18  ? 12.841  -2.417  -7.285  1.00 0.00 ? 18  PRO A C    7  
ATOM 10757 O O    . PRO A 1 18  ? 12.078  -2.193  -8.223  1.00 0.00 ? 18  PRO A O    7  
ATOM 10758 C CB   . PRO A 1 18  ? 13.784  -0.833  -5.532  1.00 0.00 ? 18  PRO A CB   7  
ATOM 10759 C CG   . PRO A 1 18  ? 13.214  0.562   -5.730  1.00 0.00 ? 18  PRO A CG   7  
ATOM 10760 C CD   . PRO A 1 18  ? 13.368  0.925   -7.198  1.00 0.00 ? 18  PRO A CD   7  
ATOM 10761 H HA   . PRO A 1 18  ? 14.806  -1.918  -7.021  1.00 0.00 ? 18  PRO A HA   7  
ATOM 10762 H HB2  . PRO A 1 18  ? 13.117  -1.445  -4.925  1.00 0.00 ? 18  PRO A HB2  7  
ATOM 10763 H HB3  . PRO A 1 18  ? 14.742  -0.794  -5.013  1.00 0.00 ? 18  PRO A HB3  7  
ATOM 10764 H HG2  . PRO A 1 18  ? 12.164  0.591   -5.438  1.00 0.00 ? 18  PRO A HG2  7  
ATOM 10765 H HG3  . PRO A 1 18  ? 13.740  1.282   -5.102  1.00 0.00 ? 18  PRO A HG3  7  
ATOM 10766 H HD2  . PRO A 1 18  ? 12.410  1.195   -7.642  1.00 0.00 ? 18  PRO A HD2  7  
ATOM 10767 H HD3  . PRO A 1 18  ? 14.031  1.780   -7.327  1.00 0.00 ? 18  PRO A HD3  7  
ATOM 10768 N N    . GLY A 1 19  ? 12.793  -3.498  -6.519  1.00 0.00 ? 19  GLY A N    7  
ATOM 10769 C CA   . GLY A 1 19  ? 11.796  -4.531  -6.745  1.00 0.00 ? 19  GLY A CA   7  
ATOM 10770 C C    . GLY A 1 19  ? 10.621  -4.379  -5.777  1.00 0.00 ? 19  GLY A C    7  
ATOM 10771 O O    . GLY A 1 19  ? 10.351  -3.282  -5.290  1.00 0.00 ? 19  GLY A O    7  
ATOM 10772 H H    . GLY A 1 19  ? 13.418  -3.672  -5.758  1.00 0.00 ? 19  GLY A H    7  
ATOM 10773 H HA2  . GLY A 1 19  ? 11.436  -4.475  -7.772  1.00 0.00 ? 19  GLY A HA2  7  
ATOM 10774 H HA3  . GLY A 1 19  ? 12.251  -5.513  -6.618  1.00 0.00 ? 19  GLY A HA3  7  
ATOM 10775 N N    . PRO A 1 20  ? 9.934   -5.525  -5.523  1.00 0.00 ? 20  PRO A N    7  
ATOM 10776 C CA   . PRO A 1 20  ? 8.793   -5.529  -4.623  1.00 0.00 ? 20  PRO A CA   7  
ATOM 10777 C C    . PRO A 1 20  ? 9.245   -5.435  -3.164  1.00 0.00 ? 20  PRO A C    7  
ATOM 10778 O O    . PRO A 1 20  ? 10.119  -6.185  -2.731  1.00 0.00 ? 20  PRO A O    7  
ATOM 10779 C CB   . PRO A 1 20  ? 8.053   -6.820  -4.933  1.00 0.00 ? 20  PRO A CB   7  
ATOM 10780 C CG   . PRO A 1 20  ? 9.050   -7.708  -5.660  1.00 0.00 ? 20  PRO A CG   7  
ATOM 10781 C CD   . PRO A 1 20  ? 10.225  -6.841  -6.083  1.00 0.00 ? 20  PRO A CD   7  
ATOM 10782 H HA   . PRO A 1 20  ? 8.221   -4.726  -4.784  1.00 0.00 ? 20  PRO A HA   7  
ATOM 10783 H HB2  . PRO A 1 20  ? 7.699   -7.297  -4.019  1.00 0.00 ? 20  PRO A HB2  7  
ATOM 10784 H HB3  . PRO A 1 20  ? 7.177   -6.629  -5.552  1.00 0.00 ? 20  PRO A HB3  7  
ATOM 10785 H HG2  . PRO A 1 20  ? 9.386   -8.516  -5.010  1.00 0.00 ? 20  PRO A HG2  7  
ATOM 10786 H HG3  . PRO A 1 20  ? 8.585   -8.172  -6.529  1.00 0.00 ? 20  PRO A HG3  7  
ATOM 10787 H HD2  . PRO A 1 20  ? 11.166  -7.236  -5.700  1.00 0.00 ? 20  PRO A HD2  7  
ATOM 10788 H HD3  . PRO A 1 20  ? 10.315  -6.799  -7.168  1.00 0.00 ? 20  PRO A HD3  7  
ATOM 10789 N N    . VAL A 1 21  ? 8.630   -4.507  -2.446  1.00 0.00 ? 21  VAL A N    7  
ATOM 10790 C CA   . VAL A 1 21  ? 8.958   -4.305  -1.045  1.00 0.00 ? 21  VAL A CA   7  
ATOM 10791 C C    . VAL A 1 21  ? 8.860   -5.641  -0.305  1.00 0.00 ? 21  VAL A C    7  
ATOM 10792 O O    . VAL A 1 21  ? 8.631   -6.680  -0.921  1.00 0.00 ? 21  VAL A O    7  
ATOM 10793 C CB   . VAL A 1 21  ? 8.057   -3.222  -0.448  1.00 0.00 ? 21  VAL A CB   7  
ATOM 10794 C CG1  . VAL A 1 21  ? 8.538   -1.826  -0.848  1.00 0.00 ? 21  VAL A CG1  7  
ATOM 10795 C CG2  . VAL A 1 21  ? 6.598   -3.438  -0.854  1.00 0.00 ? 21  VAL A CG2  7  
ATOM 10796 H H    . VAL A 1 21  ? 7.920   -3.901  -2.806  1.00 0.00 ? 21  VAL A H    7  
ATOM 10797 H HA   . VAL A 1 21  ? 9.988   -3.952  -0.996  1.00 0.00 ? 21  VAL A HA   7  
ATOM 10798 H HB   . VAL A 1 21  ? 8.116   -3.299  0.638   1.00 0.00 ? 21  VAL A HB   7  
ATOM 10799 H HG11 . VAL A 1 21  ? 8.024   -1.078  -0.244  1.00 0.00 ? 21  VAL A HG11 7  
ATOM 10800 H HG12 . VAL A 1 21  ? 9.613   -1.751  -0.683  1.00 0.00 ? 21  VAL A HG12 7  
ATOM 10801 H HG13 . VAL A 1 21  ? 8.319   -1.655  -1.902  1.00 0.00 ? 21  VAL A HG13 7  
ATOM 10802 H HG21 . VAL A 1 21  ? 6.294   -2.652  -1.547  1.00 0.00 ? 21  VAL A HG21 7  
ATOM 10803 H HG22 . VAL A 1 21  ? 6.495   -4.409  -1.339  1.00 0.00 ? 21  VAL A HG22 7  
ATOM 10804 H HG23 . VAL A 1 21  ? 5.965   -3.405  0.032   1.00 0.00 ? 21  VAL A HG23 7  
ATOM 10805 N N    . GLY A 1 22  ? 9.037   -5.568  1.006   1.00 0.00 ? 22  GLY A N    7  
ATOM 10806 C CA   . GLY A 1 22  ? 8.971   -6.759  1.837   1.00 0.00 ? 22  GLY A CA   7  
ATOM 10807 C C    . GLY A 1 22  ? 7.568   -7.369  1.809   1.00 0.00 ? 22  GLY A C    7  
ATOM 10808 O O    . GLY A 1 22  ? 6.798   -7.124  0.882   1.00 0.00 ? 22  GLY A O    7  
ATOM 10809 H H    . GLY A 1 22  ? 9.222   -4.719  1.499   1.00 0.00 ? 22  GLY A H    7  
ATOM 10810 H HA2  . GLY A 1 22  ? 9.697   -7.492  1.486   1.00 0.00 ? 22  GLY A HA2  7  
ATOM 10811 H HA3  . GLY A 1 22  ? 9.242   -6.507  2.862   1.00 0.00 ? 22  GLY A HA3  7  
ATOM 10812 N N    . HIS A 1 23  ? 7.279   -8.153  2.838   1.00 0.00 ? 23  HIS A N    7  
ATOM 10813 C CA   . HIS A 1 23  ? 5.982   -8.800  2.944   1.00 0.00 ? 23  HIS A CA   7  
ATOM 10814 C C    . HIS A 1 23  ? 4.978   -7.838  3.581   1.00 0.00 ? 23  HIS A C    7  
ATOM 10815 O O    . HIS A 1 23  ? 5.046   -7.568  4.779   1.00 0.00 ? 23  HIS A O    7  
ATOM 10816 C CB   . HIS A 1 23  ? 6.097   -10.125 3.701   1.00 0.00 ? 23  HIS A CB   7  
ATOM 10817 C CG   . HIS A 1 23  ? 5.774   -10.021 5.172   1.00 0.00 ? 23  HIS A CG   7  
ATOM 10818 N ND1  . HIS A 1 23  ? 4.724   -10.704 5.760   1.00 0.00 ? 23  HIS A ND1  7  
ATOM 10819 C CD2  . HIS A 1 23  ? 6.375   -9.308  6.168   1.00 0.00 ? 23  HIS A CD2  7  
ATOM 10820 C CE1  . HIS A 1 23  ? 4.702   -10.407 7.051   1.00 0.00 ? 23  HIS A CE1  7  
ATOM 10821 N NE2  . HIS A 1 23  ? 5.726   -9.541  7.302   1.00 0.00 ? 23  HIS A NE2  7  
ATOM 10822 H H    . HIS A 1 23  ? 7.910   -8.347  3.588   1.00 0.00 ? 23  HIS A H    7  
ATOM 10823 H HA   . HIS A 1 23  ? 5.661   -9.026  1.926   1.00 0.00 ? 23  HIS A HA   7  
ATOM 10824 H HB2  . HIS A 1 23  ? 5.426   -10.852 3.243   1.00 0.00 ? 23  HIS A HB2  7  
ATOM 10825 H HB3  . HIS A 1 23  ? 7.110   -10.510 3.588   1.00 0.00 ? 23  HIS A HB3  7  
ATOM 10826 H HD1  . HIS A 1 23  ? 4.089   -11.317 5.290   1.00 0.00 ? 23  HIS A HD1  7  
ATOM 10827 H HD2  . HIS A 1 23  ? 7.241   -8.656  6.052   1.00 0.00 ? 23  HIS A HD2  7  
ATOM 10828 H HE1  . HIS A 1 23  ? 3.991   -10.788 7.784   1.00 0.00 ? 23  HIS A HE1  7  
ATOM 10829 N N    . LEU A 1 24  ? 4.070   -7.346  2.751   1.00 0.00 ? 24  LEU A N    7  
ATOM 10830 C CA   . LEU A 1 24  ? 3.053   -6.420  3.218   1.00 0.00 ? 24  LEU A CA   7  
ATOM 10831 C C    . LEU A 1 24  ? 2.351   -7.014  4.441   1.00 0.00 ? 24  LEU A C    7  
ATOM 10832 O O    . LEU A 1 24  ? 2.249   -8.232  4.572   1.00 0.00 ? 24  LEU A O    7  
ATOM 10833 C CB   . LEU A 1 24  ? 2.099   -6.052  2.080   1.00 0.00 ? 24  LEU A CB   7  
ATOM 10834 C CG   . LEU A 1 24  ? 2.137   -4.593  1.618   1.00 0.00 ? 24  LEU A CG   7  
ATOM 10835 C CD1  . LEU A 1 24  ? 3.229   -4.379  0.568   1.00 0.00 ? 24  LEU A CD1  7  
ATOM 10836 C CD2  . LEU A 1 24  ? 0.764   -4.141  1.117   1.00 0.00 ? 24  LEU A CD2  7  
ATOM 10837 H H    . LEU A 1 24  ? 4.022   -7.571  1.778   1.00 0.00 ? 24  LEU A H    7  
ATOM 10838 H HA   . LEU A 1 24  ? 3.560   -5.504  3.522   1.00 0.00 ? 24  LEU A HA   7  
ATOM 10839 H HB2  . LEU A 1 24  ? 2.324   -6.689  1.224   1.00 0.00 ? 24  LEU A HB2  7  
ATOM 10840 H HB3  . LEU A 1 24  ? 1.082   -6.286  2.394   1.00 0.00 ? 24  LEU A HB3  7  
ATOM 10841 H HG   . LEU A 1 24  ? 2.388   -3.970  2.476   1.00 0.00 ? 24  LEU A HG   7  
ATOM 10842 H HD11 . LEU A 1 24  ? 3.901   -3.586  0.900   1.00 0.00 ? 24  LEU A HD11 7  
ATOM 10843 H HD12 . LEU A 1 24  ? 3.794   -5.302  0.437   1.00 0.00 ? 24  LEU A HD12 7  
ATOM 10844 H HD13 . LEU A 1 24  ? 2.772   -4.095  -0.379  1.00 0.00 ? 24  LEU A HD13 7  
ATOM 10845 H HD21 . LEU A 1 24  ? 0.484   -4.731  0.244   1.00 0.00 ? 24  LEU A HD21 7  
ATOM 10846 H HD22 . LEU A 1 24  ? 0.024   -4.285  1.905   1.00 0.00 ? 24  LEU A HD22 7  
ATOM 10847 H HD23 . LEU A 1 24  ? 0.805   -3.087  0.845   1.00 0.00 ? 24  LEU A HD23 7  
ATOM 10848 N N    . SER A 1 25  ? 1.884   -6.125  5.305   1.00 0.00 ? 25  SER A N    7  
ATOM 10849 C CA   . SER A 1 25  ? 1.194   -6.546  6.513   1.00 0.00 ? 25  SER A CA   7  
ATOM 10850 C C    . SER A 1 25  ? 0.058   -5.572  6.833   1.00 0.00 ? 25  SER A C    7  
ATOM 10851 O O    . SER A 1 25  ? 0.167   -4.377  6.567   1.00 0.00 ? 25  SER A O    7  
ATOM 10852 C CB   . SER A 1 25  ? 2.161   -6.641  7.695   1.00 0.00 ? 25  SER A CB   7  
ATOM 10853 O OG   . SER A 1 25  ? 3.438   -7.136  7.302   1.00 0.00 ? 25  SER A OG   7  
ATOM 10854 H H    . SER A 1 25  ? 1.970   -5.135  5.192   1.00 0.00 ? 25  SER A H    7  
ATOM 10855 H HA   . SER A 1 25  ? 0.797   -7.536  6.288   1.00 0.00 ? 25  SER A HA   7  
ATOM 10856 H HB2  . SER A 1 25  ? 2.278   -5.656  8.148   1.00 0.00 ? 25  SER A HB2  7  
ATOM 10857 H HB3  . SER A 1 25  ? 1.738   -7.294  8.458   1.00 0.00 ? 25  SER A HB3  7  
ATOM 10858 H HG   . SER A 1 25  ? 3.778   -6.619  6.516   1.00 0.00 ? 25  SER A HG   7  
ATOM 10859 N N    . PHE A 1 26  ? -1.006  -6.121  7.401   1.00 0.00 ? 26  PHE A N    7  
ATOM 10860 C CA   . PHE A 1 26  ? -2.161  -5.316  7.760   1.00 0.00 ? 26  PHE A CA   7  
ATOM 10861 C C    . PHE A 1 26  ? -2.573  -5.565  9.213   1.00 0.00 ? 26  PHE A C    7  
ATOM 10862 O O    . PHE A 1 26  ? -2.645  -6.712  9.653   1.00 0.00 ? 26  PHE A O    7  
ATOM 10863 C CB   . PHE A 1 26  ? -3.306  -5.739  6.838   1.00 0.00 ? 26  PHE A CB   7  
ATOM 10864 C CG   . PHE A 1 26  ? -3.035  -5.489  5.353   1.00 0.00 ? 26  PHE A CG   7  
ATOM 10865 C CD1  . PHE A 1 26  ? -2.250  -4.445  4.972   1.00 0.00 ? 26  PHE A CD1  7  
ATOM 10866 C CD2  . PHE A 1 26  ? -3.578  -6.309  4.415   1.00 0.00 ? 26  PHE A CD2  7  
ATOM 10867 C CE1  . PHE A 1 26  ? -1.998  -4.212  3.594   1.00 0.00 ? 26  PHE A CE1  7  
ATOM 10868 C CE2  . PHE A 1 26  ? -3.326  -6.077  3.037   1.00 0.00 ? 26  PHE A CE2  7  
ATOM 10869 C CZ   . PHE A 1 26  ? -2.541  -5.033  2.656   1.00 0.00 ? 26  PHE A CZ   7  
ATOM 10870 H H    . PHE A 1 26  ? -1.087  -7.094  7.614   1.00 0.00 ? 26  PHE A H    7  
ATOM 10871 H HA   . PHE A 1 26  ? -1.877  -4.270  7.640   1.00 0.00 ? 26  PHE A HA   7  
ATOM 10872 H HB2  . PHE A 1 26  ? -3.505  -6.801  6.986   1.00 0.00 ? 26  PHE A HB2  7  
ATOM 10873 H HB3  . PHE A 1 26  ? -4.210  -5.202  7.127   1.00 0.00 ? 26  PHE A HB3  7  
ATOM 10874 H HD1  . PHE A 1 26  ? -1.815  -3.788  5.725   1.00 0.00 ? 26  PHE A HD1  7  
ATOM 10875 H HD2  . PHE A 1 26  ? -4.207  -7.145  4.720   1.00 0.00 ? 26  PHE A HD2  7  
ATOM 10876 H HE1  . PHE A 1 26  ? -1.369  -3.376  3.289   1.00 0.00 ? 26  PHE A HE1  7  
ATOM 10877 H HE2  . PHE A 1 26  ? -3.761  -6.734  2.285   1.00 0.00 ? 26  PHE A HE2  7  
ATOM 10878 H HZ   . PHE A 1 26  ? -2.348  -4.855  1.598   1.00 0.00 ? 26  PHE A HZ   7  
ATOM 10879 N N    . SER A 1 27  ? -2.832  -4.473  9.917   1.00 0.00 ? 27  SER A N    7  
ATOM 10880 C CA   . SER A 1 27  ? -3.234  -4.559  11.310  1.00 0.00 ? 27  SER A CA   7  
ATOM 10881 C C    . SER A 1 27  ? -4.246  -3.457  11.632  1.00 0.00 ? 27  SER A C    7  
ATOM 10882 O O    . SER A 1 27  ? -4.458  -2.551  10.827  1.00 0.00 ? 27  SER A O    7  
ATOM 10883 C CB   . SER A 1 27  ? -2.024  -4.456  12.240  1.00 0.00 ? 27  SER A CB   7  
ATOM 10884 O OG   . SER A 1 27  ? -1.261  -5.660  12.260  1.00 0.00 ? 27  SER A OG   7  
ATOM 10885 H H    . SER A 1 27  ? -2.770  -3.544  9.551   1.00 0.00 ? 27  SER A H    7  
ATOM 10886 H HA   . SER A 1 27  ? -3.692  -5.542  11.418  1.00 0.00 ? 27  SER A HA   7  
ATOM 10887 H HB2  . SER A 1 27  ? -1.389  -3.630  11.920  1.00 0.00 ? 27  SER A HB2  7  
ATOM 10888 H HB3  . SER A 1 27  ? -2.361  -4.225  13.251  1.00 0.00 ? 27  SER A HB3  7  
ATOM 10889 H HG   . SER A 1 27  ? -1.339  -6.100  13.154  1.00 0.00 ? 27  SER A HG   7  
ATOM 10890 N N    . GLU A 1 28  ? -4.843  -3.571  12.809  1.00 0.00 ? 28  GLU A N    7  
ATOM 10891 C CA   . GLU A 1 28  ? -5.827  -2.596  13.246  1.00 0.00 ? 28  GLU A CA   7  
ATOM 10892 C C    . GLU A 1 28  ? -6.818  -2.300  12.119  1.00 0.00 ? 28  GLU A C    7  
ATOM 10893 O O    . GLU A 1 28  ? -7.014  -1.143  11.748  1.00 0.00 ? 28  GLU A O    7  
ATOM 10894 C CB   . GLU A 1 28  ? -5.149  -1.313  13.732  1.00 0.00 ? 28  GLU A CB   7  
ATOM 10895 C CG   . GLU A 1 28  ? -4.236  -1.594  14.927  1.00 0.00 ? 28  GLU A CG   7  
ATOM 10896 C CD   . GLU A 1 28  ? -5.053  -1.824  16.200  1.00 0.00 ? 28  GLU A CD   7  
ATOM 10897 O OE1  . GLU A 1 28  ? -5.902  -0.955  16.494  1.00 0.00 ? 28  GLU A OE1  7  
ATOM 10898 O OE2  . GLU A 1 28  ? -4.810  -2.864  16.849  1.00 0.00 ? 28  GLU A OE2  7  
ATOM 10899 H H    . GLU A 1 28  ? -4.664  -4.311  13.457  1.00 0.00 ? 28  GLU A H    7  
ATOM 10900 H HA   . GLU A 1 28  ? -6.347  -3.064  14.082  1.00 0.00 ? 28  GLU A HA   7  
ATOM 10901 H HB2  . GLU A 1 28  ? -4.569  -0.875  12.920  1.00 0.00 ? 28  GLU A HB2  7  
ATOM 10902 H HB3  . GLU A 1 28  ? -5.907  -0.581  14.013  1.00 0.00 ? 28  GLU A HB3  7  
ATOM 10903 H HG2  . GLU A 1 28  ? -3.622  -2.471  14.721  1.00 0.00 ? 28  GLU A HG2  7  
ATOM 10904 H HG3  . GLU A 1 28  ? -3.555  -0.755  15.074  1.00 0.00 ? 28  GLU A HG3  7  
ATOM 10905 N N    . ILE A 1 29  ? -7.417  -3.364  11.606  1.00 0.00 ? 29  ILE A N    7  
ATOM 10906 C CA   . ILE A 1 29  ? -8.383  -3.233  10.529  1.00 0.00 ? 29  ILE A CA   7  
ATOM 10907 C C    . ILE A 1 29  ? -9.779  -3.030  11.122  1.00 0.00 ? 29  ILE A C    7  
ATOM 10908 O O    . ILE A 1 29  ? -10.172 -3.737  12.049  1.00 0.00 ? 29  ILE A O    7  
ATOM 10909 C CB   . ILE A 1 29  ? -8.288  -4.426  9.575   1.00 0.00 ? 29  ILE A CB   7  
ATOM 10910 C CG1  . ILE A 1 29  ? -6.830  -4.741  9.236   1.00 0.00 ? 29  ILE A CG1  7  
ATOM 10911 C CG2  . ILE A 1 29  ? -9.132  -4.193  8.320   1.00 0.00 ? 29  ILE A CG2  7  
ATOM 10912 C CD1  . ILE A 1 29  ? -6.723  -5.451  7.884   1.00 0.00 ? 29  ILE A CD1  7  
ATOM 10913 H H    . ILE A 1 29  ? -7.252  -4.301  11.914  1.00 0.00 ? 29  ILE A H    7  
ATOM 10914 H HA   . ILE A 1 29  ? -8.118  -2.343  9.958   1.00 0.00 ? 29  ILE A HA   7  
ATOM 10915 H HB   . ILE A 1 29  ? -8.698  -5.300  10.081  1.00 0.00 ? 29  ILE A HB   7  
ATOM 10916 H HG12 . ILE A 1 29  ? -6.250  -3.819  9.213   1.00 0.00 ? 29  ILE A HG12 7  
ATOM 10917 H HG13 . ILE A 1 29  ? -6.399  -5.369  10.015  1.00 0.00 ? 29  ILE A HG13 7  
ATOM 10918 H HG21 . ILE A 1 29  ? -9.497  -5.149  7.945   1.00 0.00 ? 29  ILE A HG21 7  
ATOM 10919 H HG22 . ILE A 1 29  ? -9.978  -3.551  8.565   1.00 0.00 ? 29  ILE A HG22 7  
ATOM 10920 H HG23 . ILE A 1 29  ? -8.521  -3.713  7.556   1.00 0.00 ? 29  ILE A HG23 7  
ATOM 10921 H HD11 . ILE A 1 29  ? -5.890  -6.153  7.908   1.00 0.00 ? 29  ILE A HD11 7  
ATOM 10922 H HD12 . ILE A 1 29  ? -7.648  -5.991  7.683   1.00 0.00 ? 29  ILE A HD12 7  
ATOM 10923 H HD13 . ILE A 1 29  ? -6.555  -4.714  7.099   1.00 0.00 ? 29  ILE A HD13 7  
ATOM 10924 N N    . LEU A 1 30  ? -10.489 -2.060  10.565  1.00 0.00 ? 30  LEU A N    7  
ATOM 10925 C CA   . LEU A 1 30  ? -11.832 -1.755  11.027  1.00 0.00 ? 30  LEU A CA   7  
ATOM 10926 C C    . LEU A 1 30  ? -12.829 -2.025  9.899   1.00 0.00 ? 30  LEU A C    7  
ATOM 10927 O O    . LEU A 1 30  ? -12.866 -3.124  9.348   1.00 0.00 ? 30  LEU A O    7  
ATOM 10928 C CB   . LEU A 1 30  ? -11.898 -0.330  11.578  1.00 0.00 ? 30  LEU A CB   7  
ATOM 10929 C CG   . LEU A 1 30  ? -11.050 -0.051  12.821  1.00 0.00 ? 30  LEU A CG   7  
ATOM 10930 C CD1  . LEU A 1 30  ? -11.414 -1.006  13.959  1.00 0.00 ? 30  LEU A CD1  7  
ATOM 10931 C CD2  . LEU A 1 30  ? -9.557  -0.099  12.488  1.00 0.00 ? 30  LEU A CD2  7  
ATOM 10932 H H    . LEU A 1 30  ? -10.162 -1.490  9.811   1.00 0.00 ? 30  LEU A H    7  
ATOM 10933 H HA   . LEU A 1 30  ? -12.054 -2.431  11.854  1.00 0.00 ? 30  LEU A HA   7  
ATOM 10934 H HB2  . LEU A 1 30  ? -11.590 0.358   10.791  1.00 0.00 ? 30  LEU A HB2  7  
ATOM 10935 H HB3  . LEU A 1 30  ? -12.937 -0.100  11.813  1.00 0.00 ? 30  LEU A HB3  7  
ATOM 10936 H HG   . LEU A 1 30  ? -11.270 0.960   13.165  1.00 0.00 ? 30  LEU A HG   7  
ATOM 10937 H HD11 . LEU A 1 30  ? -12.476 -1.248  13.904  1.00 0.00 ? 30  LEU A HD11 7  
ATOM 10938 H HD12 . LEU A 1 30  ? -10.827 -1.920  13.869  1.00 0.00 ? 30  LEU A HD12 7  
ATOM 10939 H HD13 . LEU A 1 30  ? -11.200 -0.529  14.916  1.00 0.00 ? 30  LEU A HD13 7  
ATOM 10940 H HD21 . LEU A 1 30  ? -9.000  0.468   13.234  1.00 0.00 ? 30  LEU A HD21 7  
ATOM 10941 H HD22 . LEU A 1 30  ? -9.218  -1.135  12.491  1.00 0.00 ? 30  LEU A HD22 7  
ATOM 10942 H HD23 . LEU A 1 30  ? -9.391  0.335   11.502  1.00 0.00 ? 30  LEU A HD23 7  
ATOM 10943 N N    . ASP A 1 31  ? -13.614 -1.004  9.589   1.00 0.00 ? 31  ASP A N    7  
ATOM 10944 C CA   . ASP A 1 31  ? -14.609 -1.117  8.536   1.00 0.00 ? 31  ASP A CA   7  
ATOM 10945 C C    . ASP A 1 31  ? -14.142 -0.327  7.312   1.00 0.00 ? 31  ASP A C    7  
ATOM 10946 O O    . ASP A 1 31  ? -14.482 -0.671  6.181   1.00 0.00 ? 31  ASP A O    7  
ATOM 10947 C CB   . ASP A 1 31  ? -15.954 -0.542  8.985   1.00 0.00 ? 31  ASP A CB   7  
ATOM 10948 C CG   . ASP A 1 31  ? -15.878 0.828   9.663   1.00 0.00 ? 31  ASP A CG   7  
ATOM 10949 O OD1  . ASP A 1 31  ? -14.897 1.038   10.408  1.00 0.00 ? 31  ASP A OD1  7  
ATOM 10950 O OD2  . ASP A 1 31  ? -16.802 1.633   9.420   1.00 0.00 ? 31  ASP A OD2  7  
ATOM 10951 H H    . ASP A 1 31  ? -13.578 -0.113  10.042  1.00 0.00 ? 31  ASP A H    7  
ATOM 10952 H HA   . ASP A 1 31  ? -14.694 -2.185  8.336   1.00 0.00 ? 31  ASP A HA   7  
ATOM 10953 H HB2  . ASP A 1 31  ? -16.607 -0.465  8.116   1.00 0.00 ? 31  ASP A HB2  7  
ATOM 10954 H HB3  . ASP A 1 31  ? -16.421 -1.246  9.674   1.00 0.00 ? 31  ASP A HB3  7  
ATOM 10955 N N    . THR A 1 32  ? -13.370 0.716   7.580   1.00 0.00 ? 32  THR A N    7  
ATOM 10956 C CA   . THR A 1 32  ? -12.853 1.557   6.514   1.00 0.00 ? 32  THR A CA   7  
ATOM 10957 C C    . THR A 1 32  ? -11.507 2.161   6.917   1.00 0.00 ? 32  THR A C    7  
ATOM 10958 O O    . THR A 1 32  ? -11.114 3.209   6.406   1.00 0.00 ? 32  THR A O    7  
ATOM 10959 C CB   . THR A 1 32  ? -13.916 2.608   6.183   1.00 0.00 ? 32  THR A CB   7  
ATOM 10960 O OG1  . THR A 1 32  ? -13.858 3.517   7.279   1.00 0.00 ? 32  THR A OG1  7  
ATOM 10961 C CG2  . THR A 1 32  ? -15.336 2.043   6.242   1.00 0.00 ? 32  THR A CG2  7  
ATOM 10962 H H    . THR A 1 32  ? -13.099 0.989   8.502   1.00 0.00 ? 32  THR A H    7  
ATOM 10963 H HA   . THR A 1 32  ? -12.675 0.933   5.639   1.00 0.00 ? 32  THR A HA   7  
ATOM 10964 H HB   . THR A 1 32  ? -13.719 3.068   5.215   1.00 0.00 ? 32  THR A HB   7  
ATOM 10965 H HG1  . THR A 1 32  ? -13.337 4.330   7.022   1.00 0.00 ? 32  THR A HG1  7  
ATOM 10966 H HG21 . THR A 1 32  ? -15.544 1.686   7.251   1.00 0.00 ? 32  THR A HG21 7  
ATOM 10967 H HG22 . THR A 1 32  ? -16.049 2.824   5.979   1.00 0.00 ? 32  THR A HG22 7  
ATOM 10968 H HG23 . THR A 1 32  ? -15.428 1.215   5.538   1.00 0.00 ? 32  THR A HG23 7  
ATOM 10969 N N    . SER A 1 33  ? -10.836 1.474   7.829   1.00 0.00 ? 33  SER A N    7  
ATOM 10970 C CA   . SER A 1 33  ? -9.541  1.929   8.307   1.00 0.00 ? 33  SER A CA   7  
ATOM 10971 C C    . SER A 1 33  ? -8.661  0.728   8.659   1.00 0.00 ? 33  SER A C    7  
ATOM 10972 O O    . SER A 1 33  ? -9.090  -0.168  9.385   1.00 0.00 ? 33  SER A O    7  
ATOM 10973 C CB   . SER A 1 33  ? -9.694  2.850   9.520   1.00 0.00 ? 33  SER A CB   7  
ATOM 10974 O OG   . SER A 1 33  ? -10.682 2.374   10.429  1.00 0.00 ? 33  SER A OG   7  
ATOM 10975 H H    . SER A 1 33  ? -11.162 0.623   8.240   1.00 0.00 ? 33  SER A H    7  
ATOM 10976 H HA   . SER A 1 33  ? -9.109  2.490   7.478   1.00 0.00 ? 33  SER A HA   7  
ATOM 10977 H HB2  . SER A 1 33  ? -8.737  2.932   10.035  1.00 0.00 ? 33  SER A HB2  7  
ATOM 10978 H HB3  . SER A 1 33  ? -9.962  3.851   9.183   1.00 0.00 ? 33  SER A HB3  7  
ATOM 10979 H HG   . SER A 1 33  ? -10.704 2.954   11.244  1.00 0.00 ? 33  SER A HG   7  
ATOM 10980 N N    . LEU A 1 34  ? -7.447  0.749   8.129   1.00 0.00 ? 34  LEU A N    7  
ATOM 10981 C CA   . LEU A 1 34  ? -6.503  -0.328  8.379   1.00 0.00 ? 34  LEU A CA   7  
ATOM 10982 C C    . LEU A 1 34  ? -5.078  0.199   8.204   1.00 0.00 ? 34  LEU A C    7  
ATOM 10983 O O    . LEU A 1 34  ? -4.839  1.101   7.402   1.00 0.00 ? 34  LEU A O    7  
ATOM 10984 C CB   . LEU A 1 34  ? -6.824  -1.536  7.497   1.00 0.00 ? 34  LEU A CB   7  
ATOM 10985 C CG   . LEU A 1 34  ? -6.596  -1.351  5.996   1.00 0.00 ? 34  LEU A CG   7  
ATOM 10986 C CD1  . LEU A 1 34  ? -5.102  -1.349  5.665   1.00 0.00 ? 34  LEU A CD1  7  
ATOM 10987 C CD2  . LEU A 1 34  ? -7.360  -2.405  5.191   1.00 0.00 ? 34  LEU A CD2  7  
ATOM 10988 H H    . LEU A 1 34  ? -7.107  1.481   7.540   1.00 0.00 ? 34  LEU A H    7  
ATOM 10989 H HA   . LEU A 1 34  ? -6.632  -0.641  9.415   1.00 0.00 ? 34  LEU A HA   7  
ATOM 10990 H HB2  . LEU A 1 34  ? -6.220  -2.378  7.836   1.00 0.00 ? 34  LEU A HB2  7  
ATOM 10991 H HB3  . LEU A 1 34  ? -7.868  -1.809  7.655   1.00 0.00 ? 34  LEU A HB3  7  
ATOM 10992 H HG   . LEU A 1 34  ? -6.991  -0.377  5.708   1.00 0.00 ? 34  LEU A HG   7  
ATOM 10993 H HD11 . LEU A 1 34  ? -4.573  -1.994  6.366   1.00 0.00 ? 34  LEU A HD11 7  
ATOM 10994 H HD12 . LEU A 1 34  ? -4.954  -1.718  4.649   1.00 0.00 ? 34  LEU A HD12 7  
ATOM 10995 H HD13 . LEU A 1 34  ? -4.714  -0.333  5.742   1.00 0.00 ? 34  LEU A HD13 7  
ATOM 10996 H HD21 . LEU A 1 34  ? -6.675  -3.197  4.888   1.00 0.00 ? 34  LEU A HD21 7  
ATOM 10997 H HD22 . LEU A 1 34  ? -8.154  -2.827  5.807   1.00 0.00 ? 34  LEU A HD22 7  
ATOM 10998 H HD23 . LEU A 1 34  ? -7.794  -1.941  4.305   1.00 0.00 ? 34  LEU A HD23 7  
ATOM 10999 N N    . LYS A 1 35  ? -4.167  -0.385  8.969   1.00 0.00 ? 35  LYS A N    7  
ATOM 11000 C CA   . LYS A 1 35  ? -2.772  0.014   8.909   1.00 0.00 ? 35  LYS A CA   7  
ATOM 11001 C C    . LYS A 1 35  ? -2.022  -0.909  7.946   1.00 0.00 ? 35  LYS A C    7  
ATOM 11002 O O    . LYS A 1 35  ? -2.162  -2.129  8.015   1.00 0.00 ? 35  LYS A O    7  
ATOM 11003 C CB   . LYS A 1 35  ? -2.166  0.059   10.314  1.00 0.00 ? 35  LYS A CB   7  
ATOM 11004 C CG   . LYS A 1 35  ? -0.887  0.898   10.333  1.00 0.00 ? 35  LYS A CG   7  
ATOM 11005 C CD   . LYS A 1 35  ? 0.246   0.154   11.041  1.00 0.00 ? 35  LYS A CD   7  
ATOM 11006 C CE   . LYS A 1 35  ? 0.824   -0.944  10.146  1.00 0.00 ? 35  LYS A CE   7  
ATOM 11007 N NZ   . LYS A 1 35  ? 0.705   -2.265  10.804  1.00 0.00 ? 35  LYS A NZ   7  
ATOM 11008 H H    . LYS A 1 35  ? -4.370  -1.118  9.619   1.00 0.00 ? 35  LYS A H    7  
ATOM 11009 H HA   . LYS A 1 35  ? -2.739  1.028   8.511   1.00 0.00 ? 35  LYS A HA   7  
ATOM 11010 H HB2  . LYS A 1 35  ? -2.891  0.478   11.013  1.00 0.00 ? 35  LYS A HB2  7  
ATOM 11011 H HB3  . LYS A 1 35  ? -1.947  -0.953  10.652  1.00 0.00 ? 35  LYS A HB3  7  
ATOM 11012 H HG2  . LYS A 1 35  ? -0.588  1.136   9.312   1.00 0.00 ? 35  LYS A HG2  7  
ATOM 11013 H HG3  . LYS A 1 35  ? -1.076  1.845   10.838  1.00 0.00 ? 35  LYS A HG3  7  
ATOM 11014 H HD2  . LYS A 1 35  ? 1.033   0.857   11.315  1.00 0.00 ? 35  LYS A HD2  7  
ATOM 11015 H HD3  . LYS A 1 35  ? -0.125  -0.285  11.967  1.00 0.00 ? 35  LYS A HD3  7  
ATOM 11016 H HE2  . LYS A 1 35  ? 0.299   -0.958  9.192   1.00 0.00 ? 35  LYS A HE2  7  
ATOM 11017 H HE3  . LYS A 1 35  ? 1.872   -0.732  9.931   1.00 0.00 ? 35  LYS A HE3  7  
ATOM 11018 H HZ1  . LYS A 1 35  ? 0.011   -2.810  10.334  1.00 0.00 ? 35  LYS A HZ1  7  
ATOM 11019 H HZ2  . LYS A 1 35  ? 1.585   -2.739  10.762  1.00 0.00 ? 35  LYS A HZ2  7  
ATOM 11020 H HZ3  . LYS A 1 35  ? 0.440   -2.139  11.760  1.00 0.00 ? 35  LYS A HZ3  7  
ATOM 11021 N N    . VAL A 1 36  ? -1.243  -0.291  7.071   1.00 0.00 ? 36  VAL A N    7  
ATOM 11022 C CA   . VAL A 1 36  ? -0.471  -1.042  6.095   1.00 0.00 ? 36  VAL A CA   7  
ATOM 11023 C C    . VAL A 1 36  ? 1.011   -0.989  6.473   1.00 0.00 ? 36  VAL A C    7  
ATOM 11024 O O    . VAL A 1 36  ? 1.519   0.062   6.861   1.00 0.00 ? 36  VAL A O    7  
ATOM 11025 C CB   . VAL A 1 36  ? -0.749  -0.511  4.688   1.00 0.00 ? 36  VAL A CB   7  
ATOM 11026 C CG1  . VAL A 1 36  ? 0.224   -1.115  3.672   1.00 0.00 ? 36  VAL A CG1  7  
ATOM 11027 C CG2  . VAL A 1 36  ? -2.200  -0.772  4.279   1.00 0.00 ? 36  VAL A CG2  7  
ATOM 11028 H H    . VAL A 1 36  ? -1.134  0.702   7.022   1.00 0.00 ? 36  VAL A H    7  
ATOM 11029 H HA   . VAL A 1 36  ? -0.807  -2.078  6.137   1.00 0.00 ? 36  VAL A HA   7  
ATOM 11030 H HB   . VAL A 1 36  ? -0.593  0.568   4.700   1.00 0.00 ? 36  VAL A HB   7  
ATOM 11031 H HG11 . VAL A 1 36  ? 0.955   -1.733  4.193   1.00 0.00 ? 36  VAL A HG11 7  
ATOM 11032 H HG12 . VAL A 1 36  ? -0.329  -1.728  2.960   1.00 0.00 ? 36  VAL A HG12 7  
ATOM 11033 H HG13 . VAL A 1 36  ? 0.738   -0.314  3.141   1.00 0.00 ? 36  VAL A HG13 7  
ATOM 11034 H HG21 . VAL A 1 36  ? -2.232  -1.584  3.552   1.00 0.00 ? 36  VAL A HG21 7  
ATOM 11035 H HG22 . VAL A 1 36  ? -2.780  -1.049  5.159   1.00 0.00 ? 36  VAL A HG22 7  
ATOM 11036 H HG23 . VAL A 1 36  ? -2.621  0.130   3.836   1.00 0.00 ? 36  VAL A HG23 7  
ATOM 11037 N N    . SER A 1 37  ? 1.663   -2.135  6.346   1.00 0.00 ? 37  SER A N    7  
ATOM 11038 C CA   . SER A 1 37  ? 3.076   -2.232  6.670   1.00 0.00 ? 37  SER A CA   7  
ATOM 11039 C C    . SER A 1 37  ? 3.810   -3.012  5.577   1.00 0.00 ? 37  SER A C    7  
ATOM 11040 O O    . SER A 1 37  ? 3.199   -3.793  4.850   1.00 0.00 ? 37  SER A O    7  
ATOM 11041 C CB   . SER A 1 37  ? 3.285   -2.900  8.030   1.00 0.00 ? 37  SER A CB   7  
ATOM 11042 O OG   . SER A 1 37  ? 4.035   -4.107  7.923   1.00 0.00 ? 37  SER A OG   7  
ATOM 11043 H H    . SER A 1 37  ? 1.242   -2.986  6.030   1.00 0.00 ? 37  SER A H    7  
ATOM 11044 H HA   . SER A 1 37  ? 3.433   -1.204  6.712   1.00 0.00 ? 37  SER A HA   7  
ATOM 11045 H HB2  . SER A 1 37  ? 3.802   -2.210  8.697   1.00 0.00 ? 37  SER A HB2  7  
ATOM 11046 H HB3  . SER A 1 37  ? 2.316   -3.114  8.482   1.00 0.00 ? 37  SER A HB3  7  
ATOM 11047 H HG   . SER A 1 37  ? 4.258   -4.454  8.834   1.00 0.00 ? 37  SER A HG   7  
ATOM 11048 N N    . TRP A 1 38  ? 5.111   -2.773  5.497   1.00 0.00 ? 38  TRP A N    7  
ATOM 11049 C CA   . TRP A 1 38  ? 5.935   -3.443  4.505   1.00 0.00 ? 38  TRP A CA   7  
ATOM 11050 C C    . TRP A 1 38  ? 7.397   -3.311  4.937   1.00 0.00 ? 38  TRP A C    7  
ATOM 11051 O O    . TRP A 1 38  ? 7.698   -2.635  5.920   1.00 0.00 ? 38  TRP A O    7  
ATOM 11052 C CB   . TRP A 1 38  ? 5.673   -2.884  3.105   1.00 0.00 ? 38  TRP A CB   7  
ATOM 11053 C CG   . TRP A 1 38  ? 6.001   -1.397  2.958   1.00 0.00 ? 38  TRP A CG   7  
ATOM 11054 C CD1  . TRP A 1 38  ? 7.184   -0.837  2.672   1.00 0.00 ? 38  TRP A CD1  7  
ATOM 11055 C CD2  . TRP A 1 38  ? 5.080   -0.295  3.101   1.00 0.00 ? 38  TRP A CD2  7  
ATOM 11056 N NE1  . TRP A 1 38  ? 7.094   0.539   2.621   1.00 0.00 ? 38  TRP A NE1  7  
ATOM 11057 C CE2  . TRP A 1 38  ? 5.774   0.879   2.890   1.00 0.00 ? 38  TRP A CE2  7  
ATOM 11058 C CE3  . TRP A 1 38  ? 3.706   -0.290  3.400   1.00 0.00 ? 38  TRP A CE3  7  
ATOM 11059 C CZ2  . TRP A 1 38  ? 5.178   2.145   2.955   1.00 0.00 ? 38  TRP A CZ2  7  
ATOM 11060 C CZ3  . TRP A 1 38  ? 3.125   0.982   3.461   1.00 0.00 ? 38  TRP A CZ3  7  
ATOM 11061 C CH2  . TRP A 1 38  ? 3.810   2.174   3.251   1.00 0.00 ? 38  TRP A CH2  7  
ATOM 11062 H H    . TRP A 1 38  ? 5.600   -2.136  6.092   1.00 0.00 ? 38  TRP A H    7  
ATOM 11063 H HA   . TRP A 1 38  ? 5.645   -4.494  4.486   1.00 0.00 ? 38  TRP A HA   7  
ATOM 11064 H HB2  . TRP A 1 38  ? 6.262   -3.449  2.383   1.00 0.00 ? 38  TRP A HB2  7  
ATOM 11065 H HB3  . TRP A 1 38  ? 4.624   -3.041  2.853   1.00 0.00 ? 38  TRP A HB3  7  
ATOM 11066 H HD1  . TRP A 1 38  ? 8.103   -1.399  2.501   1.00 0.00 ? 38  TRP A HD1  7  
ATOM 11067 H HE1  . TRP A 1 38  ? 7.909   1.231   2.408   1.00 0.00 ? 38  TRP A HE1  7  
ATOM 11068 H HE3  . TRP A 1 38  ? 3.136   -1.203  3.570   1.00 0.00 ? 38  TRP A HE3  7  
ATOM 11069 H HZ2  . TRP A 1 38  ? 5.748   3.057   2.784   1.00 0.00 ? 38  TRP A HZ2  7  
ATOM 11070 H HZ3  . TRP A 1 38  ? 2.061   1.043   3.689   1.00 0.00 ? 38  TRP A HZ3  7  
ATOM 11071 H HH2  . TRP A 1 38  ? 3.284   3.126   3.316   1.00 0.00 ? 38  TRP A HH2  7  
ATOM 11072 N N    . GLN A 1 39  ? 8.265   -3.967  4.182   1.00 0.00 ? 39  GLN A N    7  
ATOM 11073 C CA   . GLN A 1 39  ? 9.688   -3.931  4.475   1.00 0.00 ? 39  GLN A CA   7  
ATOM 11074 C C    . GLN A 1 39  ? 10.470  -3.447  3.252   1.00 0.00 ? 39  GLN A C    7  
ATOM 11075 O O    . GLN A 1 39  ? 9.881   -3.135  2.218   1.00 0.00 ? 39  GLN A O    7  
ATOM 11076 C CB   . GLN A 1 39  ? 10.187  -5.301  4.938   1.00 0.00 ? 39  GLN A CB   7  
ATOM 11077 C CG   . GLN A 1 39  ? 10.594  -5.267  6.413   1.00 0.00 ? 39  GLN A CG   7  
ATOM 11078 C CD   . GLN A 1 39  ? 11.589  -6.384  6.733   1.00 0.00 ? 39  GLN A CD   7  
ATOM 11079 O OE1  . GLN A 1 39  ? 12.761  -6.321  6.402   1.00 0.00 ? 39  GLN A OE1  7  
ATOM 11080 N NE2  . GLN A 1 39  ? 11.057  -7.409  7.394   1.00 0.00 ? 39  GLN A NE2  7  
ATOM 11081 H H    . GLN A 1 39  ? 8.012   -4.514  3.385   1.00 0.00 ? 39  GLN A H    7  
ATOM 11082 H HA   . GLN A 1 39  ? 9.798   -3.216  5.291   1.00 0.00 ? 39  GLN A HA   7  
ATOM 11083 H HB2  . GLN A 1 39  ? 9.406   -6.046  4.790   1.00 0.00 ? 39  GLN A HB2  7  
ATOM 11084 H HB3  . GLN A 1 39  ? 11.038  -5.607  4.330   1.00 0.00 ? 39  GLN A HB3  7  
ATOM 11085 H HG2  . GLN A 1 39  ? 11.040  -4.300  6.649   1.00 0.00 ? 39  GLN A HG2  7  
ATOM 11086 H HG3  . GLN A 1 39  ? 9.710   -5.371  7.040   1.00 0.00 ? 39  GLN A HG3  7  
ATOM 11087 H HE21 . GLN A 1 39  ? 10.087  -7.398  7.636   1.00 0.00 ? 39  GLN A HE21 7  
ATOM 11088 H HE22 . GLN A 1 39  ? 11.627  -8.189  7.649   1.00 0.00 ? 39  GLN A HE22 7  
ATOM 11089 N N    . GLU A 1 40  ? 11.784  -3.399  3.411   1.00 0.00 ? 40  GLU A N    7  
ATOM 11090 C CA   . GLU A 1 40  ? 12.653  -2.958  2.333   1.00 0.00 ? 40  GLU A CA   7  
ATOM 11091 C C    . GLU A 1 40  ? 12.848  -4.083  1.314   1.00 0.00 ? 40  GLU A C    7  
ATOM 11092 O O    . GLU A 1 40  ? 12.972  -5.249  1.688   1.00 0.00 ? 40  GLU A O    7  
ATOM 11093 C CB   . GLU A 1 40  ? 13.998  -2.471  2.876   1.00 0.00 ? 40  GLU A CB   7  
ATOM 11094 C CG   . GLU A 1 40  ? 14.155  -0.962  2.678   1.00 0.00 ? 40  GLU A CG   7  
ATOM 11095 C CD   . GLU A 1 40  ? 15.290  -0.411  3.544   1.00 0.00 ? 40  GLU A CD   7  
ATOM 11096 O OE1  . GLU A 1 40  ? 15.744  -1.165  4.432   1.00 0.00 ? 40  GLU A OE1  7  
ATOM 11097 O OE2  . GLU A 1 40  ? 15.678  0.751   3.298   1.00 0.00 ? 40  GLU A OE2  7  
ATOM 11098 H H    . GLU A 1 40  ? 12.255  -3.654  4.255   1.00 0.00 ? 40  GLU A H    7  
ATOM 11099 H HA   . GLU A 1 40  ? 12.133  -2.122  1.865   1.00 0.00 ? 40  GLU A HA   7  
ATOM 11100 H HB2  . GLU A 1 40  ? 14.075  -2.713  3.936   1.00 0.00 ? 40  GLU A HB2  7  
ATOM 11101 H HB3  . GLU A 1 40  ? 14.809  -2.994  2.370   1.00 0.00 ? 40  GLU A HB3  7  
ATOM 11102 H HG2  . GLU A 1 40  ? 14.357  -0.748  1.628   1.00 0.00 ? 40  GLU A HG2  7  
ATOM 11103 H HG3  . GLU A 1 40  ? 13.222  -0.459  2.932   1.00 0.00 ? 40  GLU A HG3  7  
ATOM 11104 N N    . PRO A 1 41  ? 12.868  -3.685  0.014   1.00 0.00 ? 41  PRO A N    7  
ATOM 11105 C CA   . PRO A 1 41  ? 13.046  -4.646  -1.061  1.00 0.00 ? 41  PRO A CA   7  
ATOM 11106 C C    . PRO A 1 41  ? 14.501  -5.113  -1.144  1.00 0.00 ? 41  PRO A C    7  
ATOM 11107 O O    . PRO A 1 41  ? 15.415  -4.377  -0.775  1.00 0.00 ? 41  PRO A O    7  
ATOM 11108 C CB   . PRO A 1 41  ? 12.580  -3.925  -2.315  1.00 0.00 ? 41  PRO A CB   7  
ATOM 11109 C CG   . PRO A 1 41  ? 12.599  -2.444  -1.974  1.00 0.00 ? 41  PRO A CG   7  
ATOM 11110 C CD   . PRO A 1 41  ? 12.724  -2.314  -0.465  1.00 0.00 ? 41  PRO A CD   7  
ATOM 11111 H HA   . PRO A 1 41  ? 12.505  -5.469  -0.883  1.00 0.00 ? 41  PRO A HA   7  
ATOM 11112 H HB2  . PRO A 1 41  ? 13.239  -4.140  -3.156  1.00 0.00 ? 41  PRO A HB2  7  
ATOM 11113 H HB3  . PRO A 1 41  ? 11.580  -4.247  -2.602  1.00 0.00 ? 41  PRO A HB3  7  
ATOM 11114 H HG2  . PRO A 1 41  ? 13.433  -1.948  -2.471  1.00 0.00 ? 41  PRO A HG2  7  
ATOM 11115 H HG3  . PRO A 1 41  ? 11.687  -1.960  -2.325  1.00 0.00 ? 41  PRO A HG3  7  
ATOM 11116 H HD2  . PRO A 1 41  ? 13.586  -1.705  -0.190  1.00 0.00 ? 41  PRO A HD2  7  
ATOM 11117 H HD3  . PRO A 1 41  ? 11.845  -1.834  -0.035  1.00 0.00 ? 41  PRO A HD3  7  
ATOM 11118 N N    . GLY A 1 42  ? 14.670  -6.333  -1.631  1.00 0.00 ? 42  GLY A N    7  
ATOM 11119 C CA   . GLY A 1 42  ? 15.998  -6.907  -1.768  1.00 0.00 ? 42  GLY A CA   7  
ATOM 11120 C C    . GLY A 1 42  ? 16.750  -6.275  -2.942  1.00 0.00 ? 42  GLY A C    7  
ATOM 11121 O O    . GLY A 1 42  ? 17.971  -6.132  -2.897  1.00 0.00 ? 42  GLY A O    7  
ATOM 11122 H H    . GLY A 1 42  ? 13.922  -6.926  -1.929  1.00 0.00 ? 42  GLY A H    7  
ATOM 11123 H HA2  . GLY A 1 42  ? 16.561  -6.754  -0.847  1.00 0.00 ? 42  GLY A HA2  7  
ATOM 11124 H HA3  . GLY A 1 42  ? 15.920  -7.983  -1.919  1.00 0.00 ? 42  GLY A HA3  7  
ATOM 11125 N N    . GLU A 1 43  ? 15.989  -5.915  -3.965  1.00 0.00 ? 43  GLU A N    7  
ATOM 11126 C CA   . GLU A 1 43  ? 16.567  -5.302  -5.149  1.00 0.00 ? 43  GLU A CA   7  
ATOM 11127 C C    . GLU A 1 43  ? 16.686  -3.789  -4.959  1.00 0.00 ? 43  GLU A C    7  
ATOM 11128 O O    . GLU A 1 43  ? 16.359  -3.019  -5.861  1.00 0.00 ? 43  GLU A O    7  
ATOM 11129 C CB   . GLU A 1 43  ? 15.746  -5.636  -6.396  1.00 0.00 ? 43  GLU A CB   7  
ATOM 11130 C CG   . GLU A 1 43  ? 16.291  -6.884  -7.093  1.00 0.00 ? 43  GLU A CG   7  
ATOM 11131 C CD   . GLU A 1 43  ? 17.775  -6.721  -7.428  1.00 0.00 ? 43  GLU A CD   7  
ATOM 11132 O OE1  . GLU A 1 43  ? 18.060  -6.006  -8.412  1.00 0.00 ? 43  GLU A OE1  7  
ATOM 11133 O OE2  . GLU A 1 43  ? 18.591  -7.316  -6.691  1.00 0.00 ? 43  GLU A OE2  7  
ATOM 11134 H H    . GLU A 1 43  ? 14.996  -6.035  -3.993  1.00 0.00 ? 43  GLU A H    7  
ATOM 11135 H HA   . GLU A 1 43  ? 17.560  -5.742  -5.247  1.00 0.00 ? 43  GLU A HA   7  
ATOM 11136 H HB2  . GLU A 1 43  ? 14.705  -5.796  -6.118  1.00 0.00 ? 43  GLU A HB2  7  
ATOM 11137 H HB3  . GLU A 1 43  ? 15.766  -4.792  -7.085  1.00 0.00 ? 43  GLU A HB3  7  
ATOM 11138 H HG2  . GLU A 1 43  ? 16.152  -7.754  -6.451  1.00 0.00 ? 43  GLU A HG2  7  
ATOM 11139 H HG3  . GLU A 1 43  ? 15.727  -7.070  -8.007  1.00 0.00 ? 43  GLU A HG3  7  
ATOM 11140 N N    . LYS A 1 44  ? 17.155  -3.407  -3.780  1.00 0.00 ? 44  LYS A N    7  
ATOM 11141 C CA   . LYS A 1 44  ? 17.321  -1.999  -3.461  1.00 0.00 ? 44  LYS A CA   7  
ATOM 11142 C C    . LYS A 1 44  ? 17.883  -1.267  -4.681  1.00 0.00 ? 44  LYS A C    7  
ATOM 11143 O O    . LYS A 1 44  ? 17.561  -0.102  -4.913  1.00 0.00 ? 44  LYS A O    7  
ATOM 11144 C CB   . LYS A 1 44  ? 18.170  -1.833  -2.199  1.00 0.00 ? 44  LYS A CB   7  
ATOM 11145 C CG   . LYS A 1 44  ? 17.409  -2.306  -0.959  1.00 0.00 ? 44  LYS A CG   7  
ATOM 11146 C CD   . LYS A 1 44  ? 18.071  -1.793  0.321   1.00 0.00 ? 44  LYS A CD   7  
ATOM 11147 C CE   . LYS A 1 44  ? 17.079  -1.782  1.485   1.00 0.00 ? 44  LYS A CE   7  
ATOM 11148 N NZ   . LYS A 1 44  ? 17.590  -2.597  2.609   1.00 0.00 ? 44  LYS A NZ   7  
ATOM 11149 H H    . LYS A 1 44  ? 17.419  -4.040  -3.052  1.00 0.00 ? 44  LYS A H    7  
ATOM 11150 H HA   . LYS A 1 44  ? 16.333  -1.596  -3.240  1.00 0.00 ? 44  LYS A HA   7  
ATOM 11151 H HB2  . LYS A 1 44  ? 19.095  -2.400  -2.300  1.00 0.00 ? 44  LYS A HB2  7  
ATOM 11152 H HB3  . LYS A 1 44  ? 18.450  -0.786  -2.080  1.00 0.00 ? 44  LYS A HB3  7  
ATOM 11153 H HG2  . LYS A 1 44  ? 16.378  -1.955  -1.005  1.00 0.00 ? 44  LYS A HG2  7  
ATOM 11154 H HG3  . LYS A 1 44  ? 17.374  -3.395  -0.943  1.00 0.00 ? 44  LYS A HG3  7  
ATOM 11155 H HD2  . LYS A 1 44  ? 18.924  -2.424  0.571   1.00 0.00 ? 44  LYS A HD2  7  
ATOM 11156 H HD3  . LYS A 1 44  ? 18.456  -0.787  0.157   1.00 0.00 ? 44  LYS A HD3  7  
ATOM 11157 H HE2  . LYS A 1 44  ? 16.911  -0.757  1.818   1.00 0.00 ? 44  LYS A HE2  7  
ATOM 11158 H HE3  . LYS A 1 44  ? 16.116  -2.171  1.154   1.00 0.00 ? 44  LYS A HE3  7  
ATOM 11159 H HZ1  . LYS A 1 44  ? 18.257  -2.066  3.131   1.00 0.00 ? 44  LYS A HZ1  7  
ATOM 11160 H HZ2  . LYS A 1 44  ? 16.830  -2.855  3.206   1.00 0.00 ? 44  LYS A HZ2  7  
ATOM 11161 H HZ3  . LYS A 1 44  ? 18.027  -3.422  2.251   1.00 0.00 ? 44  LYS A HZ3  7  
ATOM 11162 N N    . ASN A 1 45  ? 18.713  -1.979  -5.429  1.00 0.00 ? 45  ASN A N    7  
ATOM 11163 C CA   . ASN A 1 45  ? 19.323  -1.411  -6.619  1.00 0.00 ? 45  ASN A CA   7  
ATOM 11164 C C    . ASN A 1 45  ? 19.794  0.012   -6.316  1.00 0.00 ? 45  ASN A C    7  
ATOM 11165 O O    . ASN A 1 45  ? 19.870  0.849   -7.214  1.00 0.00 ? 45  ASN A O    7  
ATOM 11166 C CB   . ASN A 1 45  ? 18.319  -1.341  -7.772  1.00 0.00 ? 45  ASN A CB   7  
ATOM 11167 C CG   . ASN A 1 45  ? 18.654  -2.370  -8.853  1.00 0.00 ? 45  ASN A CG   7  
ATOM 11168 O OD1  . ASN A 1 45  ? 19.680  -2.307  -9.511  1.00 0.00 ? 45  ASN A OD1  7  
ATOM 11169 N ND2  . ASN A 1 45  ? 17.733  -3.319  -9.001  1.00 0.00 ? 45  ASN A ND2  7  
ATOM 11170 H H    . ASN A 1 45  ? 18.970  -2.926  -5.233  1.00 0.00 ? 45  ASN A H    7  
ATOM 11171 H HA   . ASN A 1 45  ? 20.147  -2.080  -6.866  1.00 0.00 ? 45  ASN A HA   7  
ATOM 11172 H HB2  . ASN A 1 45  ? 17.312  -1.520  -7.394  1.00 0.00 ? 45  ASN A HB2  7  
ATOM 11173 H HB3  . ASN A 1 45  ? 18.324  -0.340  -8.203  1.00 0.00 ? 45  ASN A HB3  7  
ATOM 11174 H HD21 . ASN A 1 45  ? 16.913  -3.313  -8.429  1.00 0.00 ? 45  ASN A HD21 7  
ATOM 11175 H HD22 . ASN A 1 45  ? 17.862  -4.038  -9.684  1.00 0.00 ? 45  ASN A HD22 7  
ATOM 11176 N N    . GLY A 1 46  ? 20.098  0.243   -5.047  1.00 0.00 ? 46  GLY A N    7  
ATOM 11177 C CA   . GLY A 1 46  ? 20.560  1.551   -4.614  1.00 0.00 ? 46  GLY A CA   7  
ATOM 11178 C C    . GLY A 1 46  ? 19.952  1.927   -3.262  1.00 0.00 ? 46  GLY A C    7  
ATOM 11179 O O    . GLY A 1 46  ? 20.015  1.149   -2.311  1.00 0.00 ? 46  GLY A O    7  
ATOM 11180 H H    . GLY A 1 46  ? 20.034  -0.443  -4.323  1.00 0.00 ? 46  GLY A H    7  
ATOM 11181 H HA2  . GLY A 1 46  ? 21.648  1.550   -4.541  1.00 0.00 ? 46  GLY A HA2  7  
ATOM 11182 H HA3  . GLY A 1 46  ? 20.292  2.300   -5.359  1.00 0.00 ? 46  GLY A HA3  7  
ATOM 11183 N N    . ILE A 1 47  ? 19.378  3.120   -3.218  1.00 0.00 ? 47  ILE A N    7  
ATOM 11184 C CA   . ILE A 1 47  ? 18.759  3.609   -1.998  1.00 0.00 ? 47  ILE A CA   7  
ATOM 11185 C C    . ILE A 1 47  ? 17.363  4.145   -2.318  1.00 0.00 ? 47  ILE A C    7  
ATOM 11186 O O    . ILE A 1 47  ? 17.159  4.778   -3.353  1.00 0.00 ? 47  ILE A O    7  
ATOM 11187 C CB   . ILE A 1 47  ? 19.667  4.630   -1.309  1.00 0.00 ? 47  ILE A CB   7  
ATOM 11188 C CG1  . ILE A 1 47  ? 20.847  3.940   -0.622  1.00 0.00 ? 47  ILE A CG1  7  
ATOM 11189 C CG2  . ILE A 1 47  ? 18.870  5.505   -0.338  1.00 0.00 ? 47  ILE A CG2  7  
ATOM 11190 C CD1  . ILE A 1 47  ? 20.365  2.821   0.303   1.00 0.00 ? 47  ILE A CD1  7  
ATOM 11191 H H    . ILE A 1 47  ? 19.331  3.747   -3.996  1.00 0.00 ? 47  ILE A H    7  
ATOM 11192 H HA   . ILE A 1 47  ? 18.657  2.761   -1.321  1.00 0.00 ? 47  ILE A HA   7  
ATOM 11193 H HB   . ILE A 1 47  ? 20.079  5.290   -2.072  1.00 0.00 ? 47  ILE A HB   7  
ATOM 11194 H HG12 . ILE A 1 47  ? 21.521  3.530   -1.375  1.00 0.00 ? 47  ILE A HG12 7  
ATOM 11195 H HG13 . ILE A 1 47  ? 21.417  4.671   -0.049  1.00 0.00 ? 47  ILE A HG13 7  
ATOM 11196 H HG21 . ILE A 1 47  ? 18.001  4.952   0.019   1.00 0.00 ? 47  ILE A HG21 7  
ATOM 11197 H HG22 . ILE A 1 47  ? 19.501  5.776   0.508   1.00 0.00 ? 47  ILE A HG22 7  
ATOM 11198 H HG23 . ILE A 1 47  ? 18.541  6.409   -0.850  1.00 0.00 ? 47  ILE A HG23 7  
ATOM 11199 H HD11 . ILE A 1 47  ? 19.455  3.137   0.813   1.00 0.00 ? 47  ILE A HD11 7  
ATOM 11200 H HD12 . ILE A 1 47  ? 20.160  1.926   -0.285  1.00 0.00 ? 47  ILE A HD12 7  
ATOM 11201 H HD13 . ILE A 1 47  ? 21.137  2.602   1.041   1.00 0.00 ? 47  ILE A HD13 7  
ATOM 11202 N N    . LEU A 1 48  ? 16.436  3.871   -1.412  1.00 0.00 ? 48  LEU A N    7  
ATOM 11203 C CA   . LEU A 1 48  ? 15.064  4.318   -1.585  1.00 0.00 ? 48  LEU A CA   7  
ATOM 11204 C C    . LEU A 1 48  ? 14.906  5.712   -0.975  1.00 0.00 ? 48  LEU A C    7  
ATOM 11205 O O    . LEU A 1 48  ? 15.482  6.005   0.071   1.00 0.00 ? 48  LEU A O    7  
ATOM 11206 C CB   . LEU A 1 48  ? 14.089  3.285   -1.019  1.00 0.00 ? 48  LEU A CB   7  
ATOM 11207 C CG   . LEU A 1 48  ? 14.464  1.818   -1.238  1.00 0.00 ? 48  LEU A CG   7  
ATOM 11208 C CD1  . LEU A 1 48  ? 14.919  1.577   -2.678  1.00 0.00 ? 48  LEU A CD1  7  
ATOM 11209 C CD2  . LEU A 1 48  ? 15.513  1.362   -0.221  1.00 0.00 ? 48  LEU A CD2  7  
ATOM 11210 H H    . LEU A 1 48  ? 16.610  3.356   -0.573  1.00 0.00 ? 48  LEU A H    7  
ATOM 11211 H HA   . LEU A 1 48  ? 14.876  4.386   -2.656  1.00 0.00 ? 48  LEU A HA   7  
ATOM 11212 H HB2  . LEU A 1 48  ? 13.989  3.458   0.053   1.00 0.00 ? 48  LEU A HB2  7  
ATOM 11213 H HB3  . LEU A 1 48  ? 13.108  3.459   -1.462  1.00 0.00 ? 48  LEU A HB3  7  
ATOM 11214 H HG   . LEU A 1 48  ? 13.573  1.210   -1.076  1.00 0.00 ? 48  LEU A HG   7  
ATOM 11215 H HD11 . LEU A 1 48  ? 14.896  0.509   -2.893  1.00 0.00 ? 48  LEU A HD11 7  
ATOM 11216 H HD12 . LEU A 1 48  ? 14.251  2.101   -3.363  1.00 0.00 ? 48  LEU A HD12 7  
ATOM 11217 H HD13 . LEU A 1 48  ? 15.935  1.952   -2.805  1.00 0.00 ? 48  LEU A HD13 7  
ATOM 11218 H HD21 . LEU A 1 48  ? 16.472  1.233   -0.722  1.00 0.00 ? 48  LEU A HD21 7  
ATOM 11219 H HD22 . LEU A 1 48  ? 15.610  2.114   0.562   1.00 0.00 ? 48  LEU A HD22 7  
ATOM 11220 H HD23 . LEU A 1 48  ? 15.203  0.415   0.221   1.00 0.00 ? 48  LEU A HD23 7  
ATOM 11221 N N    . THR A 1 49  ? 14.122  6.535   -1.656  1.00 0.00 ? 49  THR A N    7  
ATOM 11222 C CA   . THR A 1 49  ? 13.880  7.892   -1.194  1.00 0.00 ? 49  THR A CA   7  
ATOM 11223 C C    . THR A 1 49  ? 12.435  8.042   -0.714  1.00 0.00 ? 49  THR A C    7  
ATOM 11224 O O    . THR A 1 49  ? 12.022  9.128   -0.309  1.00 0.00 ? 49  THR A O    7  
ATOM 11225 C CB   . THR A 1 49  ? 14.246  8.850   -2.330  1.00 0.00 ? 49  THR A CB   7  
ATOM 11226 O OG1  . THR A 1 49  ? 13.563  8.322   -3.463  1.00 0.00 ? 49  THR A OG1  7  
ATOM 11227 C CG2  . THR A 1 49  ? 15.725  8.766   -2.713  1.00 0.00 ? 49  THR A CG2  7  
ATOM 11228 H H    . THR A 1 49  ? 13.657  6.289   -2.506  1.00 0.00 ? 49  THR A H    7  
ATOM 11229 H HA   . THR A 1 49  ? 14.524  8.082   -0.336  1.00 0.00 ? 49  THR A HA   7  
ATOM 11230 H HB   . THR A 1 49  ? 13.966  9.873   -2.081  1.00 0.00 ? 49  THR A HB   7  
ATOM 11231 H HG1  . THR A 1 49  ? 13.600  8.975   -4.220  1.00 0.00 ? 49  THR A HG1  7  
ATOM 11232 H HG21 . THR A 1 49  ? 16.189  9.744   -2.588  1.00 0.00 ? 49  THR A HG21 7  
ATOM 11233 H HG22 . THR A 1 49  ? 16.226  8.041   -2.072  1.00 0.00 ? 49  THR A HG22 7  
ATOM 11234 H HG23 . THR A 1 49  ? 15.813  8.452   -3.754  1.00 0.00 ? 49  THR A HG23 7  
ATOM 11235 N N    . GLY A 1 50  ? 11.707  6.937   -0.775  1.00 0.00 ? 50  GLY A N    7  
ATOM 11236 C CA   . GLY A 1 50  ? 10.317  6.933   -0.351  1.00 0.00 ? 50  GLY A CA   7  
ATOM 11237 C C    . GLY A 1 50  ? 9.593   5.685   -0.861  1.00 0.00 ? 50  GLY A C    7  
ATOM 11238 O O    . GLY A 1 50  ? 10.192  4.844   -1.530  1.00 0.00 ? 50  GLY A O    7  
ATOM 11239 H H    . GLY A 1 50  ? 12.051  6.059   -1.106  1.00 0.00 ? 50  GLY A H    7  
ATOM 11240 H HA2  . GLY A 1 50  ? 10.265  6.969   0.737   1.00 0.00 ? 50  GLY A HA2  7  
ATOM 11241 H HA3  . GLY A 1 50  ? 9.816   7.826   -0.725  1.00 0.00 ? 50  GLY A HA3  7  
ATOM 11242 N N    . TYR A 1 51  ? 8.314   5.604   -0.525  1.00 0.00 ? 51  TYR A N    7  
ATOM 11243 C CA   . TYR A 1 51  ? 7.501   4.473   -0.940  1.00 0.00 ? 51  TYR A CA   7  
ATOM 11244 C C    . TYR A 1 51  ? 6.096   4.925   -1.341  1.00 0.00 ? 51  TYR A C    7  
ATOM 11245 O O    . TYR A 1 51  ? 5.421   5.617   -0.580  1.00 0.00 ? 51  TYR A O    7  
ATOM 11246 C CB   . TYR A 1 51  ? 7.400   3.556   0.281   1.00 0.00 ? 51  TYR A CB   7  
ATOM 11247 C CG   . TYR A 1 51  ? 8.686   2.788   0.590   1.00 0.00 ? 51  TYR A CG   7  
ATOM 11248 C CD1  . TYR A 1 51  ? 8.992   1.642   -0.115  1.00 0.00 ? 51  TYR A CD1  7  
ATOM 11249 C CD2  . TYR A 1 51  ? 9.541   3.241   1.575   1.00 0.00 ? 51  TYR A CD2  7  
ATOM 11250 C CE1  . TYR A 1 51  ? 10.203  0.918   0.176   1.00 0.00 ? 51  TYR A CE1  7  
ATOM 11251 C CE2  . TYR A 1 51  ? 10.752  2.518   1.866   1.00 0.00 ? 51  TYR A CE2  7  
ATOM 11252 C CZ   . TYR A 1 51  ? 11.023  1.392   1.153   1.00 0.00 ? 51  TYR A CZ   7  
ATOM 11253 O OH   . TYR A 1 51  ? 12.166  0.709   1.428   1.00 0.00 ? 51  TYR A OH   7  
ATOM 11254 H H    . TYR A 1 51  ? 7.834   6.292   0.019   1.00 0.00 ? 51  TYR A H    7  
ATOM 11255 H HA   . TYR A 1 51  ? 7.985   4.009   -1.799  1.00 0.00 ? 51  TYR A HA   7  
ATOM 11256 H HB2  . TYR A 1 51  ? 7.128   4.154   1.150   1.00 0.00 ? 51  TYR A HB2  7  
ATOM 11257 H HB3  . TYR A 1 51  ? 6.592   2.842   0.120   1.00 0.00 ? 51  TYR A HB3  7  
ATOM 11258 H HD1  . TYR A 1 51  ? 8.318   1.284   -0.893  1.00 0.00 ? 51  TYR A HD1  7  
ATOM 11259 H HD2  . TYR A 1 51  ? 9.299   4.146   2.132   1.00 0.00 ? 51  TYR A HD2  7  
ATOM 11260 H HE1  . TYR A 1 51  ? 10.457  0.012   -0.373  1.00 0.00 ? 51  TYR A HE1  7  
ATOM 11261 H HE2  . TYR A 1 51  ? 11.435  2.864   2.641   1.00 0.00 ? 51  TYR A HE2  7  
ATOM 11262 H HH   . TYR A 1 51  ? 12.844  1.325   1.830   1.00 0.00 ? 51  TYR A HH   7  
ATOM 11263 N N    . ARG A 1 52  ? 5.696   4.516   -2.536  1.00 0.00 ? 52  ARG A N    7  
ATOM 11264 C CA   . ARG A 1 52  ? 4.383   4.871   -3.048  1.00 0.00 ? 52  ARG A CA   7  
ATOM 11265 C C    . ARG A 1 52  ? 3.350   3.820   -2.633  1.00 0.00 ? 52  ARG A C    7  
ATOM 11266 O O    . ARG A 1 52  ? 3.540   2.629   -2.875  1.00 0.00 ? 52  ARG A O    7  
ATOM 11267 C CB   . ARG A 1 52  ? 4.399   4.986   -4.573  1.00 0.00 ? 52  ARG A CB   7  
ATOM 11268 C CG   . ARG A 1 52  ? 3.040   5.451   -5.102  1.00 0.00 ? 52  ARG A CG   7  
ATOM 11269 C CD   . ARG A 1 52  ? 3.211   6.421   -6.273  1.00 0.00 ? 52  ARG A CD   7  
ATOM 11270 N NE   . ARG A 1 52  ? 2.984   5.714   -7.553  1.00 0.00 ? 52  ARG A NE   7  
ATOM 11271 C CZ   . ARG A 1 52  ? 1.791   5.256   -7.957  1.00 0.00 ? 52  ARG A CZ   7  
ATOM 11272 N NH1  . ARG A 1 52  ? 0.711   5.427   -7.184  1.00 0.00 ? 52  ARG A NH1  7  
ATOM 11273 N NH2  . ARG A 1 52  ? 1.679   4.626   -9.135  1.00 0.00 ? 52  ARG A NH2  7  
ATOM 11274 H H    . ARG A 1 52  ? 6.251   3.954   -3.149  1.00 0.00 ? 52  ARG A H    7  
ATOM 11275 H HA   . ARG A 1 52  ? 4.160   5.838   -2.598  1.00 0.00 ? 52  ARG A HA   7  
ATOM 11276 H HB2  . ARG A 1 52  ? 5.173   5.690   -4.880  1.00 0.00 ? 52  ARG A HB2  7  
ATOM 11277 H HB3  . ARG A 1 52  ? 4.653   4.021   -5.012  1.00 0.00 ? 52  ARG A HB3  7  
ATOM 11278 H HG2  . ARG A 1 52  ? 2.456   4.588   -5.422  1.00 0.00 ? 52  ARG A HG2  7  
ATOM 11279 H HG3  . ARG A 1 52  ? 2.481   5.935   -4.302  1.00 0.00 ? 52  ARG A HG3  7  
ATOM 11280 H HD2  . ARG A 1 52  ? 2.508   7.248   -6.175  1.00 0.00 ? 52  ARG A HD2  7  
ATOM 11281 H HD3  . ARG A 1 52  ? 4.213   6.850   -6.257  1.00 0.00 ? 52  ARG A HD3  7  
ATOM 11282 H HE   . ARG A 1 52  ? 3.770   5.570   -8.155  1.00 0.00 ? 52  ARG A HE   7  
ATOM 11283 H HH11 . ARG A 1 52  ? 0.794   5.897   -6.305  1.00 0.00 ? 52  ARG A HH11 7  
ATOM 11284 H HH12 . ARG A 1 52  ? -0.179  5.085   -7.485  1.00 0.00 ? 52  ARG A HH12 7  
ATOM 11285 H HH21 . ARG A 1 52  ? 2.486   4.498   -9.712  1.00 0.00 ? 52  ARG A HH21 7  
ATOM 11286 H HH22 . ARG A 1 52  ? 0.789   4.284   -9.436  1.00 0.00 ? 52  ARG A HH22 7  
ATOM 11287 N N    . ILE A 1 53  ? 2.280   4.300   -2.016  1.00 0.00 ? 53  ILE A N    7  
ATOM 11288 C CA   . ILE A 1 53  ? 1.218   3.417   -1.566  1.00 0.00 ? 53  ILE A CA   7  
ATOM 11289 C C    . ILE A 1 53  ? -0.066  3.739   -2.334  1.00 0.00 ? 53  ILE A C    7  
ATOM 11290 O O    . ILE A 1 53  ? -0.306  4.890   -2.695  1.00 0.00 ? 53  ILE A O    7  
ATOM 11291 C CB   . ILE A 1 53  ? 1.062   3.498   -0.046  1.00 0.00 ? 53  ILE A CB   7  
ATOM 11292 C CG1  . ILE A 1 53  ? 0.067   2.451   0.459   1.00 0.00 ? 53  ILE A CG1  7  
ATOM 11293 C CG2  . ILE A 1 53  ? 0.678   4.913   0.391   1.00 0.00 ? 53  ILE A CG2  7  
ATOM 11294 C CD1  . ILE A 1 53  ? 0.020   2.433   1.989   1.00 0.00 ? 53  ILE A CD1  7  
ATOM 11295 H H    . ILE A 1 53  ? 2.134   5.270   -1.824  1.00 0.00 ? 53  ILE A H    7  
ATOM 11296 H HA   . ILE A 1 53  ? 1.517   2.397   -1.806  1.00 0.00 ? 53  ILE A HA   7  
ATOM 11297 H HB   . ILE A 1 53  ? 2.027   3.271   0.408   1.00 0.00 ? 53  ILE A HB   7  
ATOM 11298 H HG12 . ILE A 1 53  ? -0.926  2.668   0.064   1.00 0.00 ? 53  ILE A HG12 7  
ATOM 11299 H HG13 . ILE A 1 53  ? 0.350   1.466   0.089   1.00 0.00 ? 53  ILE A HG13 7  
ATOM 11300 H HG21 . ILE A 1 53  ? -0.343  5.126   0.077   1.00 0.00 ? 53  ILE A HG21 7  
ATOM 11301 H HG22 . ILE A 1 53  ? 0.748   4.989   1.477   1.00 0.00 ? 53  ILE A HG22 7  
ATOM 11302 H HG23 . ILE A 1 53  ? 1.357   5.632   -0.067  1.00 0.00 ? 53  ILE A HG23 7  
ATOM 11303 H HD11 . ILE A 1 53  ? 0.329   1.452   2.350   1.00 0.00 ? 53  ILE A HD11 7  
ATOM 11304 H HD12 . ILE A 1 53  ? 0.694   3.194   2.382   1.00 0.00 ? 53  ILE A HD12 7  
ATOM 11305 H HD13 . ILE A 1 53  ? -0.996  2.641   2.323   1.00 0.00 ? 53  ILE A HD13 7  
ATOM 11306 N N    . SER A 1 54  ? -0.858  2.701   -2.560  1.00 0.00 ? 54  SER A N    7  
ATOM 11307 C CA   . SER A 1 54  ? -2.112  2.859   -3.278  1.00 0.00 ? 54  SER A CA   7  
ATOM 11308 C C    . SER A 1 54  ? -3.102  1.775   -2.846  1.00 0.00 ? 54  SER A C    7  
ATOM 11309 O O    . SER A 1 54  ? -2.889  0.594   -3.113  1.00 0.00 ? 54  SER A O    7  
ATOM 11310 C CB   . SER A 1 54  ? -1.891  2.805   -4.790  1.00 0.00 ? 54  SER A CB   7  
ATOM 11311 O OG   . SER A 1 54  ? -0.661  2.169   -5.128  1.00 0.00 ? 54  SER A OG   7  
ATOM 11312 H H    . SER A 1 54  ? -0.656  1.768   -2.262  1.00 0.00 ? 54  SER A H    7  
ATOM 11313 H HA   . SER A 1 54  ? -2.481  3.847   -3.000  1.00 0.00 ? 54  SER A HA   7  
ATOM 11314 H HB2  . SER A 1 54  ? -2.716  2.268   -5.258  1.00 0.00 ? 54  SER A HB2  7  
ATOM 11315 H HB3  . SER A 1 54  ? -1.898  3.817   -5.195  1.00 0.00 ? 54  SER A HB3  7  
ATOM 11316 H HG   . SER A 1 54  ? -0.034  2.202   -4.349  1.00 0.00 ? 54  SER A HG   7  
ATOM 11317 N N    . TRP A 1 55  ? -4.163  2.217   -2.187  1.00 0.00 ? 55  TRP A N    7  
ATOM 11318 C CA   . TRP A 1 55  ? -5.187  1.299   -1.716  1.00 0.00 ? 55  TRP A CA   7  
ATOM 11319 C C    . TRP A 1 55  ? -6.392  1.415   -2.652  1.00 0.00 ? 55  TRP A C    7  
ATOM 11320 O O    . TRP A 1 55  ? -6.989  2.483   -2.770  1.00 0.00 ? 55  TRP A O    7  
ATOM 11321 C CB   . TRP A 1 55  ? -5.537  1.573   -0.252  1.00 0.00 ? 55  TRP A CB   7  
ATOM 11322 C CG   . TRP A 1 55  ? -6.086  2.978   0.004   1.00 0.00 ? 55  TRP A CG   7  
ATOM 11323 C CD1  . TRP A 1 55  ? -7.279  3.475   -0.352  1.00 0.00 ? 55  TRP A CD1  7  
ATOM 11324 C CD2  . TRP A 1 55  ? -5.411  4.053   0.690   1.00 0.00 ? 55  TRP A CD2  7  
ATOM 11325 N NE1  . TRP A 1 55  ? -7.421  4.786   0.053   1.00 0.00 ? 55  TRP A NE1  7  
ATOM 11326 C CE2  . TRP A 1 55  ? -6.249  5.149   0.707   1.00 0.00 ? 55  TRP A CE2  7  
ATOM 11327 C CE3  . TRP A 1 55  ? -4.135  4.097   1.278   1.00 0.00 ? 55  TRP A CE3  7  
ATOM 11328 C CZ2  . TRP A 1 55  ? -5.903  6.370   1.298   1.00 0.00 ? 55  TRP A CZ2  7  
ATOM 11329 C CZ3  . TRP A 1 55  ? -3.804  5.324   1.865   1.00 0.00 ? 55  TRP A CZ3  7  
ATOM 11330 C CH2  . TRP A 1 55  ? -4.636  6.437   1.890   1.00 0.00 ? 55  TRP A CH2  7  
ATOM 11331 H H    . TRP A 1 55  ? -4.329  3.180   -1.974  1.00 0.00 ? 55  TRP A H    7  
ATOM 11332 H HA   . TRP A 1 55  ? -4.776  0.290   -1.761  1.00 0.00 ? 55  TRP A HA   7  
ATOM 11333 H HB2  . TRP A 1 55  ? -6.274  0.840   0.077   1.00 0.00 ? 55  TRP A HB2  7  
ATOM 11334 H HB3  . TRP A 1 55  ? -4.646  1.425   0.358   1.00 0.00 ? 55  TRP A HB3  7  
ATOM 11335 H HD1  . TRP A 1 55  ? -8.040  2.914   -0.894  1.00 0.00 ? 55  TRP A HD1  7  
ATOM 11336 H HE1  . TRP A 1 55  ? -8.292  5.421   -0.110  1.00 0.00 ? 55  TRP A HE1  7  
ATOM 11337 H HE3  . TRP A 1 55  ? -3.455  3.245   1.278   1.00 0.00 ? 55  TRP A HE3  7  
ATOM 11338 H HZ2  . TRP A 1 55  ? -6.583  7.221   1.298   1.00 0.00 ? 55  TRP A HZ2  7  
ATOM 11339 H HZ3  . TRP A 1 55  ? -2.824  5.413   2.335   1.00 0.00 ? 55  TRP A HZ3  7  
ATOM 11340 H HH2  . TRP A 1 55  ? -4.304  7.359   2.368   1.00 0.00 ? 55  TRP A HH2  7  
ATOM 11341 N N    . GLU A 1 56  ? -6.713  0.300   -3.292  1.00 0.00 ? 56  GLU A N    7  
ATOM 11342 C CA   . GLU A 1 56  ? -7.836  0.263   -4.213  1.00 0.00 ? 56  GLU A CA   7  
ATOM 11343 C C    . GLU A 1 56  ? -8.677  -0.993  -3.974  1.00 0.00 ? 56  GLU A C    7  
ATOM 11344 O O    . GLU A 1 56  ? -8.139  -2.056  -3.670  1.00 0.00 ? 56  GLU A O    7  
ATOM 11345 C CB   . GLU A 1 56  ? -7.358  0.336   -5.664  1.00 0.00 ? 56  GLU A CB   7  
ATOM 11346 C CG   . GLU A 1 56  ? -7.061  -1.061  -6.214  1.00 0.00 ? 56  GLU A CG   7  
ATOM 11347 C CD   . GLU A 1 56  ? -6.553  -0.986  -7.655  1.00 0.00 ? 56  GLU A CD   7  
ATOM 11348 O OE1  . GLU A 1 56  ? -5.659  -0.148  -7.899  1.00 0.00 ? 56  GLU A OE1  7  
ATOM 11349 O OE2  . GLU A 1 56  ? -7.070  -1.770  -8.480  1.00 0.00 ? 56  GLU A OE2  7  
ATOM 11350 H H    . GLU A 1 56  ? -6.222  -0.565  -3.189  1.00 0.00 ? 56  GLU A H    7  
ATOM 11351 H HA   . GLU A 1 56  ? -8.426  1.152   -3.986  1.00 0.00 ? 56  GLU A HA   7  
ATOM 11352 H HB2  . GLU A 1 56  ? -8.119  0.817   -6.278  1.00 0.00 ? 56  GLU A HB2  7  
ATOM 11353 H HB3  . GLU A 1 56  ? -6.461  0.953   -5.725  1.00 0.00 ? 56  GLU A HB3  7  
ATOM 11354 H HG2  . GLU A 1 56  ? -6.316  -1.551  -5.587  1.00 0.00 ? 56  GLU A HG2  7  
ATOM 11355 H HG3  . GLU A 1 56  ? -7.963  -1.671  -6.173  1.00 0.00 ? 56  GLU A HG3  7  
ATOM 11356 N N    . GLU A 1 57  ? -9.984  -0.828  -4.122  1.00 0.00 ? 57  GLU A N    7  
ATOM 11357 C CA   . GLU A 1 57  ? -10.904 -1.935  -3.927  1.00 0.00 ? 57  GLU A CA   7  
ATOM 11358 C C    . GLU A 1 57  ? -10.417 -3.171  -4.687  1.00 0.00 ? 57  GLU A C    7  
ATOM 11359 O O    . GLU A 1 57  ? -9.409  -3.114  -5.390  1.00 0.00 ? 57  GLU A O    7  
ATOM 11360 C CB   . GLU A 1 57  ? -12.322 -1.552  -4.355  1.00 0.00 ? 57  GLU A CB   7  
ATOM 11361 C CG   . GLU A 1 57  ? -13.233 -1.376  -3.138  1.00 0.00 ? 57  GLU A CG   7  
ATOM 11362 C CD   . GLU A 1 57  ? -14.700 -1.275  -3.562  1.00 0.00 ? 57  GLU A CD   7  
ATOM 11363 O OE1  . GLU A 1 57  ? -15.072 -0.193  -4.065  1.00 0.00 ? 57  GLU A OE1  7  
ATOM 11364 O OE2  . GLU A 1 57  ? -15.415 -2.283  -3.373  1.00 0.00 ? 57  GLU A OE2  7  
ATOM 11365 H H    . GLU A 1 57  ? -10.413 0.040   -4.370  1.00 0.00 ? 57  GLU A H    7  
ATOM 11366 H HA   . GLU A 1 57  ? -10.896 -2.133  -2.855  1.00 0.00 ? 57  GLU A HA   7  
ATOM 11367 H HB2  . GLU A 1 57  ? -12.294 -0.626  -4.930  1.00 0.00 ? 57  GLU A HB2  7  
ATOM 11368 H HB3  . GLU A 1 57  ? -12.729 -2.322  -5.010  1.00 0.00 ? 57  GLU A HB3  7  
ATOM 11369 H HG2  . GLU A 1 57  ? -13.104 -2.218  -2.458  1.00 0.00 ? 57  GLU A HG2  7  
ATOM 11370 H HG3  . GLU A 1 57  ? -12.946 -0.477  -2.592  1.00 0.00 ? 57  GLU A HG3  7  
ATOM 11371 N N    . TYR A 1 58  ? -11.156 -4.258  -4.520  1.00 0.00 ? 58  TYR A N    7  
ATOM 11372 C CA   . TYR A 1 58  ? -10.812 -5.505  -5.181  1.00 0.00 ? 58  TYR A CA   7  
ATOM 11373 C C    . TYR A 1 58  ? -10.583 -5.287  -6.678  1.00 0.00 ? 58  TYR A C    7  
ATOM 11374 O O    . TYR A 1 58  ? -9.477  -5.490  -7.177  1.00 0.00 ? 58  TYR A O    7  
ATOM 11375 C CB   . TYR A 1 58  ? -12.016 -6.429  -4.991  1.00 0.00 ? 58  TYR A CB   7  
ATOM 11376 C CG   . TYR A 1 58  ? -11.966 -7.700  -5.842  1.00 0.00 ? 58  TYR A CG   7  
ATOM 11377 C CD1  . TYR A 1 58  ? -11.002 -8.658  -5.596  1.00 0.00 ? 58  TYR A CD1  7  
ATOM 11378 C CD2  . TYR A 1 58  ? -12.883 -7.889  -6.855  1.00 0.00 ? 58  TYR A CD2  7  
ATOM 11379 C CE1  . TYR A 1 58  ? -10.955 -9.854  -6.396  1.00 0.00 ? 58  TYR A CE1  7  
ATOM 11380 C CE2  . TYR A 1 58  ? -12.836 -9.085  -7.656  1.00 0.00 ? 58  TYR A CE2  7  
ATOM 11381 C CZ   . TYR A 1 58  ? -11.874 -10.008 -7.387  1.00 0.00 ? 58  TYR A CZ   7  
ATOM 11382 O OH   . TYR A 1 58  ? -11.829 -11.138 -8.143  1.00 0.00 ? 58  TYR A OH   7  
ATOM 11383 H H    . TYR A 1 58  ? -11.974 -4.296  -3.946  1.00 0.00 ? 58  TYR A H    7  
ATOM 11384 H HA   . TYR A 1 58  ? -9.893  -5.882  -4.732  1.00 0.00 ? 58  TYR A HA   7  
ATOM 11385 H HB2  . TYR A 1 58  ? -12.083 -6.711  -3.940  1.00 0.00 ? 58  TYR A HB2  7  
ATOM 11386 H HB3  . TYR A 1 58  ? -12.925 -5.879  -5.232  1.00 0.00 ? 58  TYR A HB3  7  
ATOM 11387 H HD1  . TYR A 1 58  ? -10.278 -8.508  -4.795  1.00 0.00 ? 58  TYR A HD1  7  
ATOM 11388 H HD2  . TYR A 1 58  ? -13.644 -7.133  -7.050  1.00 0.00 ? 58  TYR A HD2  7  
ATOM 11389 H HE1  . TYR A 1 58  ? -10.199 -10.618 -6.212  1.00 0.00 ? 58  TYR A HE1  7  
ATOM 11390 H HE2  . TYR A 1 58  ? -13.554 -9.247  -8.459  1.00 0.00 ? 58  TYR A HE2  7  
ATOM 11391 H HH   . TYR A 1 58  ? -12.754 -11.485 -8.294  1.00 0.00 ? 58  TYR A HH   7  
ATOM 11392 N N    . ASN A 1 59  ? -11.646 -4.876  -7.353  1.00 0.00 ? 59  ASN A N    7  
ATOM 11393 C CA   . ASN A 1 59  ? -11.575 -4.627  -8.783  1.00 0.00 ? 59  ASN A CA   7  
ATOM 11394 C C    . ASN A 1 59  ? -12.112 -3.226  -9.080  1.00 0.00 ? 59  ASN A C    7  
ATOM 11395 O O    . ASN A 1 59  ? -13.145 -3.078  -9.731  1.00 0.00 ? 59  ASN A O    7  
ATOM 11396 C CB   . ASN A 1 59  ? -12.426 -5.634  -9.560  1.00 0.00 ? 59  ASN A CB   7  
ATOM 11397 C CG   . ASN A 1 59  ? -11.803 -5.943  -10.922 1.00 0.00 ? 59  ASN A CG   7  
ATOM 11398 O OD1  . ASN A 1 59  ? -11.866 -5.160  -11.855 1.00 0.00 ? 59  ASN A OD1  7  
ATOM 11399 N ND2  . ASN A 1 59  ? -11.198 -7.126  -10.984 1.00 0.00 ? 59  ASN A ND2  7  
ATOM 11400 H H    . ASN A 1 59  ? -12.542 -4.713  -6.940  1.00 0.00 ? 59  ASN A H    7  
ATOM 11401 H HA   . ASN A 1 59  ? -10.521 -4.734  -9.040  1.00 0.00 ? 59  ASN A HA   7  
ATOM 11402 H HB2  . ASN A 1 59  ? -12.524 -6.554  -8.983  1.00 0.00 ? 59  ASN A HB2  7  
ATOM 11403 H HB3  . ASN A 1 59  ? -13.431 -5.236  -9.698  1.00 0.00 ? 59  ASN A HB3  7  
ATOM 11404 H HD21 . ASN A 1 59  ? -11.182 -7.723  -10.181 1.00 0.00 ? 59  ASN A HD21 7  
ATOM 11405 H HD22 . ASN A 1 59  ? -10.760 -7.420  -11.834 1.00 0.00 ? 59  ASN A HD22 7  
ATOM 11406 N N    . ARG A 1 60  ? -11.386 -2.232  -8.589  1.00 0.00 ? 60  ARG A N    7  
ATOM 11407 C CA   . ARG A 1 60  ? -11.776 -0.848  -8.794  1.00 0.00 ? 60  ARG A CA   7  
ATOM 11408 C C    . ARG A 1 60  ? -10.566 0.075   -8.628  1.00 0.00 ? 60  ARG A C    7  
ATOM 11409 O O    . ARG A 1 60  ? -10.121 0.325   -7.509  1.00 0.00 ? 60  ARG A O    7  
ATOM 11410 C CB   . ARG A 1 60  ? -12.866 -0.431  -7.804  1.00 0.00 ? 60  ARG A CB   7  
ATOM 11411 C CG   . ARG A 1 60  ? -14.082 -1.354  -7.906  1.00 0.00 ? 60  ARG A CG   7  
ATOM 11412 C CD   . ARG A 1 60  ? -15.180 -0.924  -6.932  1.00 0.00 ? 60  ARG A CD   7  
ATOM 11413 N NE   . ARG A 1 60  ? -16.445 -0.694  -7.666  1.00 0.00 ? 60  ARG A NE   7  
ATOM 11414 C CZ   . ARG A 1 60  ? -17.498 -0.039  -7.159  1.00 0.00 ? 60  ARG A CZ   7  
ATOM 11415 N NH1  . ARG A 1 60  ? -17.445 0.454   -5.914  1.00 0.00 ? 60  ARG A NH1  7  
ATOM 11416 N NH2  . ARG A 1 60  ? -18.605 0.123   -7.897  1.00 0.00 ? 60  ARG A NH2  7  
ATOM 11417 H H    . ARG A 1 60  ? -10.547 -2.361  -8.060  1.00 0.00 ? 60  ARG A H    7  
ATOM 11418 H HA   . ARG A 1 60  ? -12.158 -0.814  -9.814  1.00 0.00 ? 60  ARG A HA   7  
ATOM 11419 H HB2  . ARG A 1 60  ? -12.470 -0.456  -6.789  1.00 0.00 ? 60  ARG A HB2  7  
ATOM 11420 H HB3  . ARG A 1 60  ? -13.168 0.598   -8.003  1.00 0.00 ? 60  ARG A HB3  7  
ATOM 11421 H HG2  . ARG A 1 60  ? -14.468 -1.341  -8.925  1.00 0.00 ? 60  ARG A HG2  7  
ATOM 11422 H HG3  . ARG A 1 60  ? -13.782 -2.380  -7.692  1.00 0.00 ? 60  ARG A HG3  7  
ATOM 11423 H HD2  . ARG A 1 60  ? -15.325 -1.692  -6.173  1.00 0.00 ? 60  ARG A HD2  7  
ATOM 11424 H HD3  . ARG A 1 60  ? -14.881 -0.014  -6.412  1.00 0.00 ? 60  ARG A HD3  7  
ATOM 11425 H HE   . ARG A 1 60  ? -16.518 -1.049  -8.598  1.00 0.00 ? 60  ARG A HE   7  
ATOM 11426 H HH11 . ARG A 1 60  ? -16.619 0.334   -5.363  1.00 0.00 ? 60  ARG A HH11 7  
ATOM 11427 H HH12 . ARG A 1 60  ? -18.232 0.943   -5.536  1.00 0.00 ? 60  ARG A HH12 7  
ATOM 11428 H HH21 . ARG A 1 60  ? -18.645 -0.245  -8.826  1.00 0.00 ? 60  ARG A HH21 7  
ATOM 11429 H HH22 . ARG A 1 60  ? -19.391 0.612   -7.519  1.00 0.00 ? 60  ARG A HH22 7  
ATOM 11430 N N    . THR A 1 61  ? -10.070 0.555   -9.758  1.00 0.00 ? 61  THR A N    7  
ATOM 11431 C CA   . THR A 1 61  ? -8.920  1.444   -9.752  1.00 0.00 ? 61  THR A CA   7  
ATOM 11432 C C    . THR A 1 61  ? -9.349  2.867   -9.387  1.00 0.00 ? 61  THR A C    7  
ATOM 11433 O O    . THR A 1 61  ? -8.544  3.654   -8.892  1.00 0.00 ? 61  THR A O    7  
ATOM 11434 C CB   . THR A 1 61  ? -8.240  1.346   -11.119 1.00 0.00 ? 61  THR A CB   7  
ATOM 11435 O OG1  . THR A 1 61  ? -7.770  0.002   -11.177 1.00 0.00 ? 61  THR A OG1  7  
ATOM 11436 C CG2  . THR A 1 61  ? -6.966  2.190   -11.200 1.00 0.00 ? 61  THR A CG2  7  
ATOM 11437 H H    . THR A 1 61  ? -10.438 0.347   -10.664 1.00 0.00 ? 61  THR A H    7  
ATOM 11438 H HA   . THR A 1 61  ? -8.231  1.110   -8.977  1.00 0.00 ? 61  THR A HA   7  
ATOM 11439 H HB   . THR A 1 61  ? -8.932  1.609   -11.918 1.00 0.00 ? 61  THR A HB   7  
ATOM 11440 H HG1  . THR A 1 61  ? -8.396  -0.555  -11.722 1.00 0.00 ? 61  THR A HG1  7  
ATOM 11441 H HG21 . THR A 1 61  ? -6.620  2.423   -10.194 1.00 0.00 ? 61  THR A HG21 7  
ATOM 11442 H HG22 . THR A 1 61  ? -6.194  1.632   -11.730 1.00 0.00 ? 61  THR A HG22 7  
ATOM 11443 H HG23 . THR A 1 61  ? -7.177  3.116   -11.736 1.00 0.00 ? 61  THR A HG23 7  
ATOM 11444 N N    . ASN A 1 62  ? -10.616 3.154   -9.647  1.00 0.00 ? 62  ASN A N    7  
ATOM 11445 C CA   . ASN A 1 62  ? -11.161 4.468   -9.352  1.00 0.00 ? 62  ASN A CA   7  
ATOM 11446 C C    . ASN A 1 62  ? -11.110 4.710   -7.842  1.00 0.00 ? 62  ASN A C    7  
ATOM 11447 O O    . ASN A 1 62  ? -11.209 5.849   -7.389  1.00 0.00 ? 62  ASN A O    7  
ATOM 11448 C CB   . ASN A 1 62  ? -12.621 4.572   -9.798  1.00 0.00 ? 62  ASN A CB   7  
ATOM 11449 C CG   . ASN A 1 62  ? -13.186 5.963   -9.507  1.00 0.00 ? 62  ASN A CG   7  
ATOM 11450 O OD1  . ASN A 1 62  ? -12.464 6.919   -9.277  1.00 0.00 ? 62  ASN A OD1  7  
ATOM 11451 N ND2  . ASN A 1 62  ? -14.514 6.024   -9.531  1.00 0.00 ? 62  ASN A ND2  7  
ATOM 11452 H H    . ASN A 1 62  ? -11.264 2.509   -10.051 1.00 0.00 ? 62  ASN A H    7  
ATOM 11453 H HA   . ASN A 1 62  ? -10.538 5.168   -9.908  1.00 0.00 ? 62  ASN A HA   7  
ATOM 11454 H HB2  . ASN A 1 62  ? -12.695 4.361   -10.865 1.00 0.00 ? 62  ASN A HB2  7  
ATOM 11455 H HB3  . ASN A 1 62  ? -13.217 3.818   -9.283  1.00 0.00 ? 62  ASN A HB3  7  
ATOM 11456 H HD21 . ASN A 1 62  ? -15.049 5.202   -9.727  1.00 0.00 ? 62  ASN A HD21 7  
ATOM 11457 H HD22 . ASN A 1 62  ? -14.979 6.891   -9.353  1.00 0.00 ? 62  ASN A HD22 7  
ATOM 11458 N N    . THR A 1 63  ? -10.955 3.620   -7.106  1.00 0.00 ? 63  THR A N    7  
ATOM 11459 C CA   . THR A 1 63  ? -10.890 3.699   -5.656  1.00 0.00 ? 63  THR A CA   7  
ATOM 11460 C C    . THR A 1 63  ? -9.439  3.598   -5.182  1.00 0.00 ? 63  THR A C    7  
ATOM 11461 O O    . THR A 1 63  ? -9.180  3.214   -4.043  1.00 0.00 ? 63  THR A O    7  
ATOM 11462 C CB   . THR A 1 63  ? -11.794 2.607   -5.082  1.00 0.00 ? 63  THR A CB   7  
ATOM 11463 O OG1  . THR A 1 63  ? -11.583 1.492   -5.944  1.00 0.00 ? 63  THR A OG1  7  
ATOM 11464 C CG2  . THR A 1 63  ? -13.280 2.930   -5.247  1.00 0.00 ? 63  THR A CG2  7  
ATOM 11465 H H    . THR A 1 63  ? -10.875 2.697   -7.483  1.00 0.00 ? 63  THR A H    7  
ATOM 11466 H HA   . THR A 1 63  ? -11.259 4.677   -5.349  1.00 0.00 ? 63  THR A HA   7  
ATOM 11467 H HB   . THR A 1 63  ? -11.552 2.411   -4.037  1.00 0.00 ? 63  THR A HB   7  
ATOM 11468 H HG1  . THR A 1 63  ? -10.623 1.215   -5.917  1.00 0.00 ? 63  THR A HG1  7  
ATOM 11469 H HG21 . THR A 1 63  ? -13.836 2.008   -5.417  1.00 0.00 ? 63  THR A HG21 7  
ATOM 11470 H HG22 . THR A 1 63  ? -13.649 3.416   -4.344  1.00 0.00 ? 63  THR A HG22 7  
ATOM 11471 H HG23 . THR A 1 63  ? -13.415 3.597   -6.099  1.00 0.00 ? 63  THR A HG23 7  
ATOM 11472 N N    . ARG A 1 64  ? -8.530  3.951   -6.080  1.00 0.00 ? 64  ARG A N    7  
ATOM 11473 C CA   . ARG A 1 64  ? -7.112  3.905   -5.767  1.00 0.00 ? 64  ARG A CA   7  
ATOM 11474 C C    . ARG A 1 64  ? -6.629  5.276   -5.290  1.00 0.00 ? 64  ARG A C    7  
ATOM 11475 O O    . ARG A 1 64  ? -7.120  6.306   -5.750  1.00 0.00 ? 64  ARG A O    7  
ATOM 11476 C CB   . ARG A 1 64  ? -6.293  3.479   -6.987  1.00 0.00 ? 64  ARG A CB   7  
ATOM 11477 C CG   . ARG A 1 64  ? -4.857  3.131   -6.589  1.00 0.00 ? 64  ARG A CG   7  
ATOM 11478 C CD   . ARG A 1 64  ? -3.875  3.493   -7.705  1.00 0.00 ? 64  ARG A CD   7  
ATOM 11479 N NE   . ARG A 1 64  ? -2.938  2.372   -7.939  1.00 0.00 ? 64  ARG A NE   7  
ATOM 11480 C CZ   . ARG A 1 64  ? -2.054  2.329   -8.945  1.00 0.00 ? 64  ARG A CZ   7  
ATOM 11481 N NH1  . ARG A 1 64  ? -1.982  3.343   -9.817  1.00 0.00 ? 64  ARG A NH1  7  
ATOM 11482 N NH2  . ARG A 1 64  ? -1.243  1.270   -9.079  1.00 0.00 ? 64  ARG A NH2  7  
ATOM 11483 H H    . ARG A 1 64  ? -8.749  4.262   -7.004  1.00 0.00 ? 64  ARG A H    7  
ATOM 11484 H HA   . ARG A 1 64  ? -7.025  3.161   -4.975  1.00 0.00 ? 64  ARG A HA   7  
ATOM 11485 H HB2  . ARG A 1 64  ? -6.761  2.617   -7.462  1.00 0.00 ? 64  ARG A HB2  7  
ATOM 11486 H HB3  . ARG A 1 64  ? -6.285  4.283   -7.723  1.00 0.00 ? 64  ARG A HB3  7  
ATOM 11487 H HG2  . ARG A 1 64  ? -4.589  3.664   -5.677  1.00 0.00 ? 64  ARG A HG2  7  
ATOM 11488 H HG3  . ARG A 1 64  ? -4.785  2.066   -6.368  1.00 0.00 ? 64  ARG A HG3  7  
ATOM 11489 H HD2  . ARG A 1 64  ? -4.421  3.719   -8.622  1.00 0.00 ? 64  ARG A HD2  7  
ATOM 11490 H HD3  . ARG A 1 64  ? -3.320  4.392   -7.436  1.00 0.00 ? 64  ARG A HD3  7  
ATOM 11491 H HE   . ARG A 1 64  ? -2.966  1.598   -7.306  1.00 0.00 ? 64  ARG A HE   7  
ATOM 11492 H HH11 . ARG A 1 64  ? -2.587  4.133   -9.717  1.00 0.00 ? 64  ARG A HH11 7  
ATOM 11493 H HH12 . ARG A 1 64  ? -1.322  3.311   -10.568 1.00 0.00 ? 64  ARG A HH12 7  
ATOM 11494 H HH21 . ARG A 1 64  ? -1.297  0.513   -8.428  1.00 0.00 ? 64  ARG A HH21 7  
ATOM 11495 H HH22 . ARG A 1 64  ? -0.583  1.238   -9.830  1.00 0.00 ? 64  ARG A HH22 7  
ATOM 11496 N N    . VAL A 1 65  ? -5.673  5.245   -4.374  1.00 0.00 ? 65  VAL A N    7  
ATOM 11497 C CA   . VAL A 1 65  ? -5.118  6.473   -3.829  1.00 0.00 ? 65  VAL A CA   7  
ATOM 11498 C C    . VAL A 1 65  ? -3.621  6.533   -4.142  1.00 0.00 ? 65  VAL A C    7  
ATOM 11499 O O    . VAL A 1 65  ? -2.999  5.509   -4.418  1.00 0.00 ? 65  VAL A O    7  
ATOM 11500 C CB   . VAL A 1 65  ? -5.420  6.565   -2.332  1.00 0.00 ? 65  VAL A CB   7  
ATOM 11501 C CG1  . VAL A 1 65  ? -4.888  7.874   -1.745  1.00 0.00 ? 65  VAL A CG1  7  
ATOM 11502 C CG2  . VAL A 1 65  ? -6.919  6.413   -2.065  1.00 0.00 ? 65  VAL A CG2  7  
ATOM 11503 H H    . VAL A 1 65  ? -5.279  4.403   -4.005  1.00 0.00 ? 65  VAL A H    7  
ATOM 11504 H HA   . VAL A 1 65  ? -5.614  7.306   -4.326  1.00 0.00 ? 65  VAL A HA   7  
ATOM 11505 H HB   . VAL A 1 65  ? -4.907  5.741   -1.835  1.00 0.00 ? 65  VAL A HB   7  
ATOM 11506 H HG11 . VAL A 1 65  ? -3.806  7.809   -1.635  1.00 0.00 ? 65  VAL A HG11 7  
ATOM 11507 H HG12 . VAL A 1 65  ? -5.136  8.699   -2.413  1.00 0.00 ? 65  VAL A HG12 7  
ATOM 11508 H HG13 . VAL A 1 65  ? -5.343  8.046   -0.770  1.00 0.00 ? 65  VAL A HG13 7  
ATOM 11509 H HG21 . VAL A 1 65  ? -7.199  5.363   -2.153  1.00 0.00 ? 65  VAL A HG21 7  
ATOM 11510 H HG22 . VAL A 1 65  ? -7.146  6.767   -1.060  1.00 0.00 ? 65  VAL A HG22 7  
ATOM 11511 H HG23 . VAL A 1 65  ? -7.479  7.000   -2.793  1.00 0.00 ? 65  VAL A HG23 7  
ATOM 11512 N N    . THR A 1 66  ? -3.087  7.745   -4.088  1.00 0.00 ? 66  THR A N    7  
ATOM 11513 C CA   . THR A 1 66  ? -1.675  7.952   -4.361  1.00 0.00 ? 66  THR A CA   7  
ATOM 11514 C C    . THR A 1 66  ? -1.028  8.765   -3.238  1.00 0.00 ? 66  THR A C    7  
ATOM 11515 O O    . THR A 1 66  ? -1.246  9.971   -3.134  1.00 0.00 ? 66  THR A O    7  
ATOM 11516 C CB   . THR A 1 66  ? -1.552  8.612   -5.737  1.00 0.00 ? 66  THR A CB   7  
ATOM 11517 O OG1  . THR A 1 66  ? -1.934  7.586   -6.649  1.00 0.00 ? 66  THR A OG1  7  
ATOM 11518 C CG2  . THR A 1 66  ? -0.101  8.922   -6.110  1.00 0.00 ? 66  THR A CG2  7  
ATOM 11519 H H    . THR A 1 66  ? -3.600  8.573   -3.862  1.00 0.00 ? 66  THR A H    7  
ATOM 11520 H HA   . THR A 1 66  ? -1.182  6.981   -4.379  1.00 0.00 ? 66  THR A HA   7  
ATOM 11521 H HB   . THR A 1 66  ? -2.169  9.508   -5.795  1.00 0.00 ? 66  THR A HB   7  
ATOM 11522 H HG1  . THR A 1 66  ? -2.894  7.696   -6.906  1.00 0.00 ? 66  THR A HG1  7  
ATOM 11523 H HG21 . THR A 1 66  ? 0.187   8.325   -6.975  1.00 0.00 ? 66  THR A HG21 7  
ATOM 11524 H HG22 . THR A 1 66  ? -0.006  9.981   -6.351  1.00 0.00 ? 66  THR A HG22 7  
ATOM 11525 H HG23 . THR A 1 66  ? 0.550   8.681   -5.269  1.00 0.00 ? 66  THR A HG23 7  
ATOM 11526 N N    . HIS A 1 67  ? -0.244  8.071   -2.426  1.00 0.00 ? 67  HIS A N    7  
ATOM 11527 C CA   . HIS A 1 67  ? 0.436   8.713   -1.314  1.00 0.00 ? 67  HIS A CA   7  
ATOM 11528 C C    . HIS A 1 67  ? 1.949   8.543   -1.471  1.00 0.00 ? 67  HIS A C    7  
ATOM 11529 O O    . HIS A 1 67  ? 2.406   7.657   -2.190  1.00 0.00 ? 67  HIS A O    7  
ATOM 11530 C CB   . HIS A 1 67  ? -0.084  8.180   0.023   1.00 0.00 ? 67  HIS A CB   7  
ATOM 11531 C CG   . HIS A 1 67  ? -1.397  8.788   0.457   1.00 0.00 ? 67  HIS A CG   7  
ATOM 11532 N ND1  . HIS A 1 67  ? -1.760  10.087  0.146   1.00 0.00 ? 67  HIS A ND1  7  
ATOM 11533 C CD2  . HIS A 1 67  ? -2.427  8.262   1.179   1.00 0.00 ? 67  HIS A CD2  7  
ATOM 11534 C CE1  . HIS A 1 67  ? -2.957  10.321  0.664   1.00 0.00 ? 67  HIS A CE1  7  
ATOM 11535 N NE2  . HIS A 1 67  ? -3.368  9.189   1.305   1.00 0.00 ? 67  HIS A NE2  7  
ATOM 11536 H H    . HIS A 1 67  ? -0.072  7.090   -2.517  1.00 0.00 ? 67  HIS A H    7  
ATOM 11537 H HA   . HIS A 1 67  ? 0.191   9.773   -1.367  1.00 0.00 ?