data_1WGP
# 
_entry.id   1WGP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1WGP         pdb_00001wgp 10.2210/pdb1wgp/pdb 
RCSB  RCSB023560   ?            ?                   
WWPDB D_1000023560 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          atr001011378.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WGP 
_pdbx_database_status.recvd_initial_deposition_date   2004-05-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chikayama, E.'                                          1 
'Nameki, N.'                                             2 
'Kigawa, T.'                                             3 
'Koshiba, S.'                                            4 
'Inoue, M.'                                              5 
'Tomizawa, T.'                                           6 
'Kobayashi, N.'                                          7 
'Yokoyama, S.'                                           8 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the cNMP-binding domain from Arabidopsis thaliana cyclic nucleotide-regulated ion channel' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chikayama, E.' 1 ? 
primary 'Nameki, N.'    2 ? 
primary 'Kigawa, T.'    3 ? 
primary 'Koshiba, S.'   4 ? 
primary 'Inoue, M.'     5 ? 
primary 'Tomizawa, T.'  6 ? 
primary 'Kobayashi, N.' 7 ? 
primary 'Yokoyama, S.'  8 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Probable cyclic nucleotide-gated ion channel 6' 
_entity.formula_weight             15088.034 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'cNMP binding domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'cyclic nucleotide-regulated ion channel, AtCNGC6, Cyclic nucleotide- and calmodulin-regulated ion channel 6' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGVRRVPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNRSLLKEGD
FCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRRSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGVRRVPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNRSLLKEGD
FCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRRSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         atr001011378.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   VAL n 
1 9   ARG n 
1 10  ARG n 
1 11  VAL n 
1 12  PRO n 
1 13  LEU n 
1 14  PHE n 
1 15  GLU n 
1 16  ASN n 
1 17  MET n 
1 18  ASP n 
1 19  GLU n 
1 20  ARG n 
1 21  LEU n 
1 22  LEU n 
1 23  ASP n 
1 24  ALA n 
1 25  ILE n 
1 26  CYS n 
1 27  GLU n 
1 28  ARG n 
1 29  LEU n 
1 30  LYS n 
1 31  PRO n 
1 32  CYS n 
1 33  LEU n 
1 34  PHE n 
1 35  THR n 
1 36  GLU n 
1 37  LYS n 
1 38  SER n 
1 39  TYR n 
1 40  LEU n 
1 41  VAL n 
1 42  ARG n 
1 43  GLU n 
1 44  GLY n 
1 45  ASP n 
1 46  PRO n 
1 47  VAL n 
1 48  ASN n 
1 49  GLU n 
1 50  MET n 
1 51  LEU n 
1 52  PHE n 
1 53  ILE n 
1 54  ILE n 
1 55  ARG n 
1 56  GLY n 
1 57  ARG n 
1 58  LEU n 
1 59  GLU n 
1 60  SER n 
1 61  VAL n 
1 62  THR n 
1 63  THR n 
1 64  ASP n 
1 65  GLY n 
1 66  GLY n 
1 67  ARG n 
1 68  SER n 
1 69  GLY n 
1 70  PHE n 
1 71  TYR n 
1 72  ASN n 
1 73  ARG n 
1 74  SER n 
1 75  LEU n 
1 76  LEU n 
1 77  LYS n 
1 78  GLU n 
1 79  GLY n 
1 80  ASP n 
1 81  PHE n 
1 82  CYS n 
1 83  GLY n 
1 84  ASP n 
1 85  GLU n 
1 86  LEU n 
1 87  LEU n 
1 88  THR n 
1 89  TRP n 
1 90  ALA n 
1 91  LEU n 
1 92  ASP n 
1 93  PRO n 
1 94  LYS n 
1 95  SER n 
1 96  GLY n 
1 97  SER n 
1 98  ASN n 
1 99  LEU n 
1 100 PRO n 
1 101 SER n 
1 102 SER n 
1 103 THR n 
1 104 ARG n 
1 105 THR n 
1 106 VAL n 
1 107 LYS n 
1 108 ALA n 
1 109 LEU n 
1 110 THR n 
1 111 GLU n 
1 112 VAL n 
1 113 GLU n 
1 114 ALA n 
1 115 PHE n 
1 116 ALA n 
1 117 LEU n 
1 118 ILE n 
1 119 ALA n 
1 120 ASP n 
1 121 GLU n 
1 122 LEU n 
1 123 LYS n 
1 124 PHE n 
1 125 VAL n 
1 126 ALA n 
1 127 SER n 
1 128 GLN n 
1 129 PHE n 
1 130 ARG n 
1 131 ARG n 
1 132 SER n 
1 133 GLY n 
1 134 PRO n 
1 135 SER n 
1 136 SER n 
1 137 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'thale cress' 
_entity_src_gen.gene_src_genus                     Arabidopsis 
_entity_src_gen.pdbx_gene_src_gene                 'RIKEN RAFL05-10-A11' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arabidopsis thaliana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P021218-34 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CNGC6_ARATH 
_struct_ref.pdbx_db_accession          O82226 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VRRVPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNRSLLKEGDFCGDELL
TWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRR
;
_struct_ref.pdbx_align_begin           509 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WGP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 131 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O82226 
_struct_ref_seq.db_align_beg                  509 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  632 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       131 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WGP GLY A 1   ? UNP O82226 ? ? 'cloning artifact' 1   1  
1 1WGP SER A 2   ? UNP O82226 ? ? 'cloning artifact' 2   2  
1 1WGP SER A 3   ? UNP O82226 ? ? 'cloning artifact' 3   3  
1 1WGP GLY A 4   ? UNP O82226 ? ? 'cloning artifact' 4   4  
1 1WGP SER A 5   ? UNP O82226 ? ? 'cloning artifact' 5   5  
1 1WGP SER A 6   ? UNP O82226 ? ? 'cloning artifact' 6   6  
1 1WGP GLY A 7   ? UNP O82226 ? ? 'cloning artifact' 7   7  
1 1WGP SER A 132 ? UNP O82226 ? ? 'cloning artifact' 132 8  
1 1WGP GLY A 133 ? UNP O82226 ? ? 'cloning artifact' 133 9  
1 1WGP PRO A 134 ? UNP O82226 ? ? 'cloning artifact' 134 10 
1 1WGP SER A 135 ? UNP O82226 ? ? 'cloning artifact' 135 11 
1 1WGP SER A 136 ? UNP O82226 ? ? 'cloning artifact' 136 12 
1 1WGP GLY A 137 ? UNP O82226 ? ? 'cloning artifact' 137 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      220mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'0.66mM cNMP-binding domain U-15N, 13C; 20mM d-Tris-HCl(pH 7.5); 200mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1WGP 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1WGP 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.6      collection           Bruker          1 
NMRPipe 20030801 processing           'Delaglio, F.'  2 
NMRView 5.0.4    'data analysis'      'Johnson, B.A.' 3 
KUJIRA  0.901    'data analysis'      'Kobayashi, N.' 4 
CYANA   2.0.17   'structure solution' 'Guentert, P.'  5 
CYANA   2.0.17   refinement           'Guentert, P.'  6 
# 
_exptl.entry_id          1WGP 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1WGP 
_struct.title                     
'Solution structure of the cNMP-binding domain from Arabidopsis thaliana cyclic nucleotide-regulated ion channel' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WGP 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            
;cyclic nucleotide monophosphate, cNMP, cNMP-binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, MEMBRANE PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 12  ? ASN A 16  ? PRO A 12  ASN A 16  5 ? 5  
HELX_P HELX_P2 2 ASP A 18  ? LEU A 29  ? ASP A 18  LEU A 29  1 ? 12 
HELX_P HELX_P3 3 ASP A 84  ? ASP A 92  ? ASP A 84  ASP A 92  1 ? 9  
HELX_P HELX_P4 4 ALA A 119 ? ARG A 130 ? ALA A 119 ARG A 130 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 38  ? VAL A 41  ? SER A 38  VAL A 41  
A 2 THR A 105 ? ALA A 108 ? THR A 105 ALA A 108 
A 3 LEU A 58  ? THR A 62  ? LEU A 58  THR A 62  
A 4 ASN A 72  ? LEU A 76  ? ASN A 72  LEU A 76  
B 1 PHE A 81  ? CYS A 82  ? PHE A 81  CYS A 82  
B 2 GLU A 49  ? ARG A 55  ? GLU A 49  ARG A 55  
B 3 VAL A 112 ? ILE A 118 ? VAL A 112 ILE A 118 
B 4 LYS A 30  ? PHE A 34  ? LYS A 30  PHE A 34  
# 
_database_PDB_matrix.entry_id          1WGP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WGP 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 0.076   13.951  -8.876  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -0.544  14.609  -7.739  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 0.270   15.828  -7.300  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 0.087   16.923  -7.828  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -0.563  13.547  -9.531  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -1.556  14.917  -8.000  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -0.628  13.906  -6.910  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 1.151   15.596  -6.338  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 1.994   16.662  -5.823  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 3.327   16.088  -5.341  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 4.388   16.486  -5.820  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 1.298   17.413  -4.686  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 1.857   18.708  -4.481  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 1.294   14.702  -5.914  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 2.150   17.338  -6.663  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 0.235   17.509  -4.913  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 1.376   16.834  -3.767  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 2.402   18.975  -5.275  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 3.231   15.162  -4.398  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 4.416   14.529  -3.846  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 5.232   15.550  -3.050  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 6.010   16.311  -3.624  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 5.274   13.908  -4.950  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 6.113   12.868  -4.453  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 2.364   14.844  -4.013  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 4.044   13.742  -3.190  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 4.627   13.510  -5.731  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 5.889   14.682  -5.409  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 6.946   13.258  -4.062  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 5.027   15.534  -1.742  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 5.733   16.449  -0.862  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 6.133   15.757  0.443   1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 7.182   15.120  0.515   1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 4.392   14.912  -1.283  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 6.624   16.828  -1.364  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 5.101   17.310  -0.642  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 5.275   15.906  1.441   1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 5.525   15.303  2.739   1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 4.726   14.005  2.876   1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 3.500   14.014  2.781   1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 5.169   16.268  3.873   1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 6.304   16.599  4.668   1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 4.423   16.426  1.374   1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 6.595   15.098  2.761   1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 4.742   17.178  3.453   1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 4.403   15.818  4.504   1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 6.200   16.220  5.587   1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 5.454   12.921  3.098   1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 4.829   11.618  3.249   1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 4.282   11.461  4.669   1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 4.847   12.003  5.619   1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 5.816   10.493  2.933   1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 5.246   9.507   2.076   1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 6.451   12.922  3.174   1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 4.016   11.602  2.523   1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 6.705   10.913  2.462   1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 6.139   10.023  3.862   1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 4.379   9.185   2.454   1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 3.191   10.717  4.771   1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 2.562   10.482  6.059   1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 3.517   9.760   7.012   1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 4.648   10.200  7.215   1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 2.738   10.280  3.994   1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 2.256   11.433  6.497   1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 1.659   9.888   5.924   1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . VAL A 1 8   ? 3.027   8.663   7.571   1.00 0.00 ? 8   VAL A N    1  
ATOM 67    C CA   . VAL A 1 8   ? 3.823   7.876   8.497   1.00 0.00 ? 8   VAL A CA   1  
ATOM 68    C C    . VAL A 1 8   ? 4.734   8.807   9.299   1.00 0.00 ? 8   VAL A C    1  
ATOM 69    O O    . VAL A 1 8   ? 5.912   8.512   9.495   1.00 0.00 ? 8   VAL A O    1  
ATOM 70    C CB   . VAL A 1 8   ? 4.593   6.795   7.737   1.00 0.00 ? 8   VAL A CB   1  
ATOM 71    C CG1  . VAL A 1 8   ? 3.740   6.201   6.614   1.00 0.00 ? 8   VAL A CG1  1  
ATOM 72    C CG2  . VAL A 1 8   ? 5.913   7.343   7.191   1.00 0.00 ? 8   VAL A CG2  1  
ATOM 73    H H    . VAL A 1 8   ? 2.106   8.312   7.401   1.00 0.00 ? 8   VAL A H    1  
ATOM 74    H HA   . VAL A 1 8   ? 3.135   7.381   9.183   1.00 0.00 ? 8   VAL A HA   1  
ATOM 75    H HB   . VAL A 1 8   ? 4.828   5.994   8.438   1.00 0.00 ? 8   VAL A HB   1  
ATOM 76    H HG11 . VAL A 1 8   ? 4.201   5.280   6.256   1.00 0.00 ? 8   VAL A HG11 1  
ATOM 77    H HG12 . VAL A 1 8   ? 2.741   5.984   6.993   1.00 0.00 ? 8   VAL A HG12 1  
ATOM 78    H HG13 . VAL A 1 8   ? 3.671   6.915   5.794   1.00 0.00 ? 8   VAL A HG13 1  
ATOM 79    H HG21 . VAL A 1 8   ? 5.804   8.406   6.978   1.00 0.00 ? 8   VAL A HG21 1  
ATOM 80    H HG22 . VAL A 1 8   ? 6.700   7.200   7.932   1.00 0.00 ? 8   VAL A HG22 1  
ATOM 81    H HG23 . VAL A 1 8   ? 6.176   6.813   6.275   1.00 0.00 ? 8   VAL A HG23 1  
ATOM 82    N N    . ARG A 1 9   ? 4.154   9.913   9.742   1.00 0.00 ? 9   ARG A N    1  
ATOM 83    C CA   . ARG A 1 9   ? 4.899   10.889  10.519  1.00 0.00 ? 9   ARG A CA   1  
ATOM 84    C C    . ARG A 1 9   ? 5.351   10.278  11.847  1.00 0.00 ? 9   ARG A C    1  
ATOM 85    O O    . ARG A 1 9   ? 6.548   10.164  12.106  1.00 0.00 ? 9   ARG A O    1  
ATOM 86    C CB   . ARG A 1 9   ? 4.052   12.132  10.799  1.00 0.00 ? 9   ARG A CB   1  
ATOM 87    C CG   . ARG A 1 9   ? 4.933   13.376  10.936  1.00 0.00 ? 9   ARG A CG   1  
ATOM 88    C CD   . ARG A 1 9   ? 4.277   14.415  11.847  1.00 0.00 ? 9   ARG A CD   1  
ATOM 89    N NE   . ARG A 1 9   ? 5.290   15.382  12.324  1.00 0.00 ? 9   ARG A NE   1  
ATOM 90    C CZ   . ARG A 1 9   ? 5.065   16.300  13.274  1.00 0.00 ? 9   ARG A CZ   1  
ATOM 91    N NH1  . ARG A 1 9   ? 3.860   16.380  13.856  1.00 0.00 ? 9   ARG A NH1  1  
ATOM 92    N NH2  . ARG A 1 9   ? 6.044   17.137  13.643  1.00 0.00 ? 9   ARG A NH2  1  
ATOM 93    H H    . ARG A 1 9   ? 3.195   10.146  9.579   1.00 0.00 ? 9   ARG A H    1  
ATOM 94    H HA   . ARG A 1 9   ? 5.755   11.147  9.895   1.00 0.00 ? 9   ARG A HA   1  
ATOM 95    H HB2  . ARG A 1 9   ? 3.334   12.277  9.992   1.00 0.00 ? 9   ARG A HB2  1  
ATOM 96    H HB3  . ARG A 1 9   ? 3.478   11.986  11.714  1.00 0.00 ? 9   ARG A HB3  1  
ATOM 97    H HG2  . ARG A 1 9   ? 5.905   13.095  11.340  1.00 0.00 ? 9   ARG A HG2  1  
ATOM 98    H HG3  . ARG A 1 9   ? 5.110   13.810  9.952   1.00 0.00 ? 9   ARG A HG3  1  
ATOM 99    H HD2  . ARG A 1 9   ? 3.488   14.938  11.308  1.00 0.00 ? 9   ARG A HD2  1  
ATOM 100   H HD3  . ARG A 1 9   ? 3.807   13.920  12.698  1.00 0.00 ? 9   ARG A HD3  1  
ATOM 101   H HE   . ARG A 1 9   ? 6.200   15.350  11.910  1.00 0.00 ? 9   ARG A HE   1  
ATOM 102   H HH11 . ARG A 1 9   ? 3.130   15.755  13.580  1.00 0.00 ? 9   ARG A HH11 1  
ATOM 103   H HH12 . ARG A 1 9   ? 3.692   17.065  14.565  1.00 0.00 ? 9   ARG A HH12 1  
ATOM 104   H HH21 . ARG A 1 9   ? 6.943   17.077  13.209  1.00 0.00 ? 9   ARG A HH21 1  
ATOM 105   H HH22 . ARG A 1 9   ? 5.876   17.821  14.352  1.00 0.00 ? 9   ARG A HH22 1  
ATOM 106   N N    . ARG A 1 10  ? 4.369   9.901   12.653  1.00 0.00 ? 10  ARG A N    1  
ATOM 107   C CA   . ARG A 1 10  ? 4.651   9.305   13.947  1.00 0.00 ? 10  ARG A CA   1  
ATOM 108   C C    . ARG A 1 10  ? 3.836   8.022   14.130  1.00 0.00 ? 10  ARG A C    1  
ATOM 109   O O    . ARG A 1 10  ? 3.259   7.795   15.192  1.00 0.00 ? 10  ARG A O    1  
ATOM 110   C CB   . ARG A 1 10  ? 4.323   10.275  15.084  1.00 0.00 ? 10  ARG A CB   1  
ATOM 111   C CG   . ARG A 1 10  ? 5.515   10.435  16.029  1.00 0.00 ? 10  ARG A CG   1  
ATOM 112   C CD   . ARG A 1 10  ? 5.926   11.905  16.149  1.00 0.00 ? 10  ARG A CD   1  
ATOM 113   N NE   . ARG A 1 10  ? 7.092   12.032  17.052  1.00 0.00 ? 10  ARG A NE   1  
ATOM 114   C CZ   . ARG A 1 10  ? 7.412   13.154  17.711  1.00 0.00 ? 10  ARG A CZ   1  
ATOM 115   N NH1  . ARG A 1 10  ? 6.656   14.252  17.572  1.00 0.00 ? 10  ARG A NH1  1  
ATOM 116   N NH2  . ARG A 1 10  ? 8.488   13.178  18.509  1.00 0.00 ? 10  ARG A NH2  1  
ATOM 117   H H    . ARG A 1 10  ? 3.398   9.998   12.434  1.00 0.00 ? 10  ARG A H    1  
ATOM 118   H HA   . ARG A 1 10  ? 5.719   9.091   13.929  1.00 0.00 ? 10  ARG A HA   1  
ATOM 119   H HB2  . ARG A 1 10  ? 4.048   11.245  14.671  1.00 0.00 ? 10  ARG A HB2  1  
ATOM 120   H HB3  . ARG A 1 10  ? 3.460   9.910   15.641  1.00 0.00 ? 10  ARG A HB3  1  
ATOM 121   H HG2  . ARG A 1 10  ? 5.259   10.044  17.013  1.00 0.00 ? 10  ARG A HG2  1  
ATOM 122   H HG3  . ARG A 1 10  ? 6.357   9.848   15.661  1.00 0.00 ? 10  ARG A HG3  1  
ATOM 123   H HD2  . ARG A 1 10  ? 6.172   12.304  15.165  1.00 0.00 ? 10  ARG A HD2  1  
ATOM 124   H HD3  . ARG A 1 10  ? 5.092   12.493  16.533  1.00 0.00 ? 10  ARG A HD3  1  
ATOM 125   H HE   . ARG A 1 10  ? 7.677   11.231  17.177  1.00 0.00 ? 10  ARG A HE   1  
ATOM 126   H HH11 . ARG A 1 10  ? 5.853   14.234  16.977  1.00 0.00 ? 10  ARG A HH11 1  
ATOM 127   H HH12 . ARG A 1 10  ? 6.895   15.089  18.064  1.00 0.00 ? 10  ARG A HH12 1  
ATOM 128   H HH21 . ARG A 1 10  ? 9.053   12.359  18.612  1.00 0.00 ? 10  ARG A HH21 1  
ATOM 129   H HH22 . ARG A 1 10  ? 8.728   14.015  19.001  1.00 0.00 ? 10  ARG A HH22 1  
ATOM 130   N N    . VAL A 1 11  ? 3.815   7.218   13.077  1.00 0.00 ? 11  VAL A N    1  
ATOM 131   C CA   . VAL A 1 11  ? 3.081   5.964   13.108  1.00 0.00 ? 11  VAL A CA   1  
ATOM 132   C C    . VAL A 1 11  ? 3.900   4.917   13.864  1.00 0.00 ? 11  VAL A C    1  
ATOM 133   O O    . VAL A 1 11  ? 5.118   4.845   13.709  1.00 0.00 ? 11  VAL A O    1  
ATOM 134   C CB   . VAL A 1 11  ? 2.726   5.531   11.684  1.00 0.00 ? 11  VAL A CB   1  
ATOM 135   C CG1  . VAL A 1 11  ? 2.712   4.006   11.562  1.00 0.00 ? 11  VAL A CG1  1  
ATOM 136   C CG2  . VAL A 1 11  ? 1.387   6.128   11.247  1.00 0.00 ? 11  VAL A CG2  1  
ATOM 137   H H    . VAL A 1 11  ? 4.288   7.410   12.217  1.00 0.00 ? 11  VAL A H    1  
ATOM 138   H HA   . VAL A 1 11  ? 2.151   6.141   13.648  1.00 0.00 ? 11  VAL A HA   1  
ATOM 139   H HB   . VAL A 1 11  ? 3.497   5.914   11.015  1.00 0.00 ? 11  VAL A HB   1  
ATOM 140   H HG11 . VAL A 1 11  ? 2.557   3.726   10.520  1.00 0.00 ? 11  VAL A HG11 1  
ATOM 141   H HG12 . VAL A 1 11  ? 3.665   3.605   11.908  1.00 0.00 ? 11  VAL A HG12 1  
ATOM 142   H HG13 . VAL A 1 11  ? 1.904   3.600   12.171  1.00 0.00 ? 11  VAL A HG13 1  
ATOM 143   H HG21 . VAL A 1 11  ? 1.166   5.818   10.226  1.00 0.00 ? 11  VAL A HG21 1  
ATOM 144   H HG22 . VAL A 1 11  ? 0.598   5.777   11.912  1.00 0.00 ? 11  VAL A HG22 1  
ATOM 145   H HG23 . VAL A 1 11  ? 1.442   7.216   11.292  1.00 0.00 ? 11  VAL A HG23 1  
ATOM 146   N N    . PRO A 1 12  ? 3.179   4.109   14.688  1.00 0.00 ? 12  PRO A N    1  
ATOM 147   C CA   . PRO A 1 12  ? 3.826   3.069   15.470  1.00 0.00 ? 12  PRO A CA   1  
ATOM 148   C C    . PRO A 1 12  ? 4.213   1.881   14.587  1.00 0.00 ? 12  PRO A C    1  
ATOM 149   O O    . PRO A 1 12  ? 5.224   1.224   14.832  1.00 0.00 ? 12  PRO A O    1  
ATOM 150   C CB   . PRO A 1 12  ? 2.820   2.704   16.549  1.00 0.00 ? 12  PRO A CB   1  
ATOM 151   C CG   . PRO A 1 12  ? 1.476   3.216   16.056  1.00 0.00 ? 12  PRO A CG   1  
ATOM 152   C CD   . PRO A 1 12  ? 1.736   4.165   14.897  1.00 0.00 ? 12  PRO A CD   1  
ATOM 153   H HA   . PRO A 1 12  ? 4.682   3.409   15.860  1.00 0.00 ? 12  PRO A HA   1  
ATOM 154   H HB2  . PRO A 1 12  ? 2.792   1.627   16.709  1.00 0.00 ? 12  PRO A HB2  1  
ATOM 155   H HB3  . PRO A 1 12  ? 3.086   3.161   17.502  1.00 0.00 ? 12  PRO A HB3  1  
ATOM 156   H HG2  . PRO A 1 12  ? 0.845   2.387   15.736  1.00 0.00 ? 12  PRO A HG2  1  
ATOM 157   H HG3  . PRO A 1 12  ? 0.945   3.729   16.858  1.00 0.00 ? 12  PRO A HG3  1  
ATOM 158   H HD2  . PRO A 1 12  ? 1.194   3.857   14.003  1.00 0.00 ? 12  PRO A HD2  1  
ATOM 159   H HD3  . PRO A 1 12  ? 1.409   5.178   15.134  1.00 0.00 ? 12  PRO A HD3  1  
ATOM 160   N N    . LEU A 1 13  ? 3.388   1.641   13.578  1.00 0.00 ? 13  LEU A N    1  
ATOM 161   C CA   . LEU A 1 13  ? 3.631   0.543   12.658  1.00 0.00 ? 13  LEU A CA   1  
ATOM 162   C C    . LEU A 1 13  ? 5.123   0.483   12.325  1.00 0.00 ? 13  LEU A C    1  
ATOM 163   O O    . LEU A 1 13  ? 5.783   -0.521  12.592  1.00 0.00 ? 13  LEU A O    1  
ATOM 164   C CB   . LEU A 1 13  ? 2.731   0.667   11.426  1.00 0.00 ? 13  LEU A CB   1  
ATOM 165   C CG   . LEU A 1 13  ? 1.248   0.364   11.647  1.00 0.00 ? 13  LEU A CG   1  
ATOM 166   C CD1  . LEU A 1 13  ? 0.372   1.218   10.728  1.00 0.00 ? 13  LEU A CD1  1  
ATOM 167   C CD2  . LEU A 1 13  ? 0.963   -1.130  11.485  1.00 0.00 ? 13  LEU A CD2  1  
ATOM 168   H H    . LEU A 1 13  ? 2.568   2.180   13.386  1.00 0.00 ? 13  LEU A H    1  
ATOM 169   H HA   . LEU A 1 13  ? 3.354   -0.379  13.168  1.00 0.00 ? 13  LEU A HA   1  
ATOM 170   H HB2  . LEU A 1 13  ? 2.821   1.681   11.036  1.00 0.00 ? 13  LEU A HB2  1  
ATOM 171   H HB3  . LEU A 1 13  ? 3.108   -0.006  10.656  1.00 0.00 ? 13  LEU A HB3  1  
ATOM 172   H HG   . LEU A 1 13  ? 0.993   0.631   12.673  1.00 0.00 ? 13  LEU A HG   1  
ATOM 173   H HD11 . LEU A 1 13  ? 0.645   2.267   10.837  1.00 0.00 ? 13  LEU A HD11 1  
ATOM 174   H HD12 . LEU A 1 13  ? 0.522   0.909   9.693   1.00 0.00 ? 13  LEU A HD12 1  
ATOM 175   H HD13 . LEU A 1 13  ? -0.676  1.085   10.998  1.00 0.00 ? 13  LEU A HD13 1  
ATOM 176   H HD21 . LEU A 1 13  ? 1.768   -1.705  11.944  1.00 0.00 ? 13  LEU A HD21 1  
ATOM 177   H HD22 . LEU A 1 13  ? 0.019   -1.375  11.971  1.00 0.00 ? 13  LEU A HD22 1  
ATOM 178   H HD23 . LEU A 1 13  ? 0.900   -1.375  10.425  1.00 0.00 ? 13  LEU A HD23 1  
ATOM 179   N N    . PHE A 1 14  ? 5.613   1.571   11.747  1.00 0.00 ? 14  PHE A N    1  
ATOM 180   C CA   . PHE A 1 14  ? 7.015   1.654   11.376  1.00 0.00 ? 14  PHE A CA   1  
ATOM 181   C C    . PHE A 1 14  ? 7.881   2.017   12.583  1.00 0.00 ? 14  PHE A C    1  
ATOM 182   O O    . PHE A 1 14  ? 8.594   3.020   12.561  1.00 0.00 ? 14  PHE A O    1  
ATOM 183   C CB   . PHE A 1 14  ? 7.134   2.761   10.326  1.00 0.00 ? 14  PHE A CB   1  
ATOM 184   C CG   . PHE A 1 14  ? 6.017   2.750   9.280   1.00 0.00 ? 14  PHE A CG   1  
ATOM 185   C CD1  . PHE A 1 14  ? 5.960   1.753   8.357   1.00 0.00 ? 14  PHE A CD1  1  
ATOM 186   C CD2  . PHE A 1 14  ? 5.081   3.737   9.274   1.00 0.00 ? 14  PHE A CD2  1  
ATOM 187   C CE1  . PHE A 1 14  ? 4.924   1.743   7.386   1.00 0.00 ? 14  PHE A CE1  1  
ATOM 188   C CE2  . PHE A 1 14  ? 4.045   3.726   8.304   1.00 0.00 ? 14  PHE A CE2  1  
ATOM 189   C CZ   . PHE A 1 14  ? 3.988   2.730   7.380   1.00 0.00 ? 14  PHE A CZ   1  
ATOM 190   H H    . PHE A 1 14  ? 5.070   2.383   11.534  1.00 0.00 ? 14  PHE A H    1  
ATOM 191   H HA   . PHE A 1 14  ? 7.309   0.674   11.001  1.00 0.00 ? 14  PHE A HA   1  
ATOM 192   H HB2  . PHE A 1 14  ? 7.136   3.727   10.830  1.00 0.00 ? 14  PHE A HB2  1  
ATOM 193   H HB3  . PHE A 1 14  ? 8.094   2.665   9.818   1.00 0.00 ? 14  PHE A HB3  1  
ATOM 194   H HD1  . PHE A 1 14  ? 6.710   0.962   8.362   1.00 0.00 ? 14  PHE A HD1  1  
ATOM 195   H HD2  . PHE A 1 14  ? 5.127   4.536   10.015  1.00 0.00 ? 14  PHE A HD2  1  
ATOM 196   H HE1  . PHE A 1 14  ? 4.878   0.944   6.646   1.00 0.00 ? 14  PHE A HE1  1  
ATOM 197   H HE2  . PHE A 1 14  ? 3.295   4.517   8.299   1.00 0.00 ? 14  PHE A HE2  1  
ATOM 198   H HZ   . PHE A 1 14  ? 3.192   2.722   6.635   1.00 0.00 ? 14  PHE A HZ   1  
ATOM 199   N N    . GLU A 1 15  ? 7.792   1.182   13.608  1.00 0.00 ? 15  GLU A N    1  
ATOM 200   C CA   . GLU A 1 15  ? 8.559   1.403   14.822  1.00 0.00 ? 15  GLU A CA   1  
ATOM 201   C C    . GLU A 1 15  ? 9.885   0.641   14.758  1.00 0.00 ? 15  GLU A C    1  
ATOM 202   O O    . GLU A 1 15  ? 10.941  1.200   15.049  1.00 0.00 ? 15  GLU A O    1  
ATOM 203   C CB   . GLU A 1 15  ? 7.755   1.000   16.060  1.00 0.00 ? 15  GLU A CB   1  
ATOM 204   C CG   . GLU A 1 15  ? 7.119   2.224   16.723  1.00 0.00 ? 15  GLU A CG   1  
ATOM 205   C CD   . GLU A 1 15  ? 7.520   2.319   18.196  1.00 0.00 ? 15  GLU A CD   1  
ATOM 206   O OE1  . GLU A 1 15  ? 8.709   2.057   18.479  1.00 0.00 ? 15  GLU A OE1  1  
ATOM 207   O OE2  . GLU A 1 15  ? 6.627   2.651   19.006  1.00 0.00 ? 15  GLU A OE2  1  
ATOM 208   H H    . GLU A 1 15  ? 7.210   0.369   13.617  1.00 0.00 ? 15  GLU A H    1  
ATOM 209   H HA   . GLU A 1 15  ? 8.750   2.475   14.853  1.00 0.00 ? 15  GLU A HA   1  
ATOM 210   H HB2  . GLU A 1 15  ? 6.977   0.291   15.777  1.00 0.00 ? 15  GLU A HB2  1  
ATOM 211   H HB3  . GLU A 1 15  ? 8.405   0.493   16.772  1.00 0.00 ? 15  GLU A HB3  1  
ATOM 212   H HG2  . GLU A 1 15  ? 7.430   3.128   16.199  1.00 0.00 ? 15  GLU A HG2  1  
ATOM 213   H HG3  . GLU A 1 15  ? 6.034   2.165   16.640  1.00 0.00 ? 15  GLU A HG3  1  
ATOM 214   N N    . ASN A 1 16  ? 9.786   -0.624  14.375  1.00 0.00 ? 16  ASN A N    1  
ATOM 215   C CA   . ASN A 1 16  ? 10.964  -1.468  14.270  1.00 0.00 ? 16  ASN A CA   1  
ATOM 216   C C    . ASN A 1 16  ? 11.632  -1.236  12.913  1.00 0.00 ? 16  ASN A C    1  
ATOM 217   O O    . ASN A 1 16  ? 12.853  -1.319  12.796  1.00 0.00 ? 16  ASN A O    1  
ATOM 218   C CB   . ASN A 1 16  ? 10.591  -2.948  14.366  1.00 0.00 ? 16  ASN A CB   1  
ATOM 219   C CG   . ASN A 1 16  ? 9.608   -3.340  13.261  1.00 0.00 ? 16  ASN A CG   1  
ATOM 220   O OD1  . ASN A 1 16  ? 8.469   -2.904  13.224  1.00 0.00 ? 16  ASN A OD1  1  
ATOM 221   N ND2  . ASN A 1 16  ? 10.111  -4.184  12.365  1.00 0.00 ? 16  ASN A ND2  1  
ATOM 222   H H    . ASN A 1 16  ? 8.923   -1.071  14.140  1.00 0.00 ? 16  ASN A H    1  
ATOM 223   H HA   . ASN A 1 16  ? 11.602  -1.175  15.104  1.00 0.00 ? 16  ASN A HA   1  
ATOM 224   H HB2  . ASN A 1 16  ? 11.491  -3.559  14.291  1.00 0.00 ? 16  ASN A HB2  1  
ATOM 225   H HB3  . ASN A 1 16  ? 10.148  -3.152  15.341  1.00 0.00 ? 16  ASN A HB3  1  
ATOM 226   H HD21 . ASN A 1 16  ? 11.054  -4.504  12.453  1.00 0.00 ? 16  ASN A HD21 1  
ATOM 227   H HD22 . ASN A 1 16  ? 9.545   -4.499  11.603  1.00 0.00 ? 16  ASN A HD22 1  
ATOM 228   N N    . MET A 1 17  ? 10.801  -0.950  11.921  1.00 0.00 ? 17  MET A N    1  
ATOM 229   C CA   . MET A 1 17  ? 11.295  -0.706  10.577  1.00 0.00 ? 17  MET A CA   1  
ATOM 230   C C    . MET A 1 17  ? 12.411  0.342   10.585  1.00 0.00 ? 17  MET A C    1  
ATOM 231   O O    . MET A 1 17  ? 12.455  1.199   11.466  1.00 0.00 ? 17  MET A O    1  
ATOM 232   C CB   . MET A 1 17  ? 10.147  -0.222  9.690   1.00 0.00 ? 17  MET A CB   1  
ATOM 233   C CG   . MET A 1 17  ? 10.017  -1.091  8.437   1.00 0.00 ? 17  MET A CG   1  
ATOM 234   S SD   . MET A 1 17  ? 8.571   -0.610  7.507   1.00 0.00 ? 17  MET A SD   1  
ATOM 235   C CE   . MET A 1 17  ? 7.478   -1.962  7.913   1.00 0.00 ? 17  MET A CE   1  
ATOM 236   H H    . MET A 1 17  ? 9.808   -0.885  12.025  1.00 0.00 ? 17  MET A H    1  
ATOM 237   H HA   . MET A 1 17  ? 11.688  -1.662  10.231  1.00 0.00 ? 17  MET A HA   1  
ATOM 238   H HB2  . MET A 1 17  ? 9.213   -0.247  10.252  1.00 0.00 ? 17  MET A HB2  1  
ATOM 239   H HB3  . MET A 1 17  ? 10.317  0.815   9.401   1.00 0.00 ? 17  MET A HB3  1  
ATOM 240   H HG2  . MET A 1 17  ? 10.909  -0.987  7.819   1.00 0.00 ? 17  MET A HG2  1  
ATOM 241   H HG3  . MET A 1 17  ? 9.946   -2.142  8.720   1.00 0.00 ? 17  MET A HG3  1  
ATOM 242   H HE1  . MET A 1 17  ? 7.899   -2.534  8.739   1.00 0.00 ? 17  MET A HE1  1  
ATOM 243   H HE2  . MET A 1 17  ? 6.505   -1.568  8.203   1.00 0.00 ? 17  MET A HE2  1  
ATOM 244   H HE3  . MET A 1 17  ? 7.364   -2.610  7.044   1.00 0.00 ? 17  MET A HE3  1  
ATOM 245   N N    . ASP A 1 18  ? 13.284  0.238   9.594   1.00 0.00 ? 18  ASP A N    1  
ATOM 246   C CA   . ASP A 1 18  ? 14.396  1.165   9.476   1.00 0.00 ? 18  ASP A CA   1  
ATOM 247   C C    . ASP A 1 18  ? 14.168  2.076   8.268   1.00 0.00 ? 18  ASP A C    1  
ATOM 248   O O    . ASP A 1 18  ? 13.416  1.730   7.358   1.00 0.00 ? 18  ASP A O    1  
ATOM 249   C CB   . ASP A 1 18  ? 15.715  0.420   9.264   1.00 0.00 ? 18  ASP A CB   1  
ATOM 250   C CG   . ASP A 1 18  ? 16.765  0.641   10.354  1.00 0.00 ? 18  ASP A CG   1  
ATOM 251   O OD1  . ASP A 1 18  ? 16.350  0.758   11.527  1.00 0.00 ? 18  ASP A OD1  1  
ATOM 252   O OD2  . ASP A 1 18  ? 17.960  0.688   9.990   1.00 0.00 ? 18  ASP A OD2  1  
ATOM 253   H H    . ASP A 1 18  ? 13.240  -0.463  8.881   1.00 0.00 ? 18  ASP A H    1  
ATOM 254   H HA   . ASP A 1 18  ? 14.411  1.716   10.416  1.00 0.00 ? 18  ASP A HA   1  
ATOM 255   H HB2  . ASP A 1 18  ? 15.504  -0.648  9.194   1.00 0.00 ? 18  ASP A HB2  1  
ATOM 256   H HB3  . ASP A 1 18  ? 16.137  0.724   8.306   1.00 0.00 ? 18  ASP A HB3  1  
ATOM 257   N N    . GLU A 1 19  ? 14.832  3.223   8.298   1.00 0.00 ? 19  GLU A N    1  
ATOM 258   C CA   . GLU A 1 19  ? 14.711  4.186   7.217   1.00 0.00 ? 19  GLU A CA   1  
ATOM 259   C C    . GLU A 1 19  ? 14.880  3.490   5.865   1.00 0.00 ? 19  GLU A C    1  
ATOM 260   O O    . GLU A 1 19  ? 14.015  3.595   4.997   1.00 0.00 ? 19  GLU A O    1  
ATOM 261   C CB   . GLU A 1 19  ? 15.723  5.322   7.380   1.00 0.00 ? 19  GLU A CB   1  
ATOM 262   C CG   . GLU A 1 19  ? 15.429  6.143   8.636   1.00 0.00 ? 19  GLU A CG   1  
ATOM 263   C CD   . GLU A 1 19  ? 15.460  7.642   8.332   1.00 0.00 ? 19  GLU A CD   1  
ATOM 264   O OE1  . GLU A 1 19  ? 14.633  8.070   7.497   1.00 0.00 ? 19  GLU A OE1  1  
ATOM 265   O OE2  . GLU A 1 19  ? 16.311  8.327   8.940   1.00 0.00 ? 19  GLU A OE2  1  
ATOM 266   H H    . GLU A 1 19  ? 15.441  3.497   9.042   1.00 0.00 ? 19  GLU A H    1  
ATOM 267   H HA   . GLU A 1 19  ? 13.703  4.591   7.301   1.00 0.00 ? 19  GLU A HA   1  
ATOM 268   H HB2  . GLU A 1 19  ? 16.731  4.911   7.438   1.00 0.00 ? 19  GLU A HB2  1  
ATOM 269   H HB3  . GLU A 1 19  ? 15.693  5.969   6.503   1.00 0.00 ? 19  GLU A HB3  1  
ATOM 270   H HG2  . GLU A 1 19  ? 14.451  5.870   9.033   1.00 0.00 ? 19  GLU A HG2  1  
ATOM 271   H HG3  . GLU A 1 19  ? 16.162  5.910   9.408   1.00 0.00 ? 19  GLU A HG3  1  
ATOM 272   N N    . ARG A 1 20  ? 16.000  2.795   5.729   1.00 0.00 ? 20  ARG A N    1  
ATOM 273   C CA   . ARG A 1 20  ? 16.293  2.082   4.497   1.00 0.00 ? 20  ARG A CA   1  
ATOM 274   C C    . ARG A 1 20  ? 15.094  1.229   4.080   1.00 0.00 ? 20  ARG A C    1  
ATOM 275   O O    . ARG A 1 20  ? 14.823  1.073   2.890   1.00 0.00 ? 20  ARG A O    1  
ATOM 276   C CB   . ARG A 1 20  ? 17.520  1.182   4.661   1.00 0.00 ? 20  ARG A CB   1  
ATOM 277   C CG   . ARG A 1 20  ? 18.773  2.011   4.949   1.00 0.00 ? 20  ARG A CG   1  
ATOM 278   C CD   . ARG A 1 20  ? 19.415  2.505   3.651   1.00 0.00 ? 20  ARG A CD   1  
ATOM 279   N NE   . ARG A 1 20  ? 20.875  2.267   3.686   1.00 0.00 ? 20  ARG A NE   1  
ATOM 280   C CZ   . ARG A 1 20  ? 21.700  2.509   2.658   1.00 0.00 ? 20  ARG A CZ   1  
ATOM 281   N NH1  . ARG A 1 20  ? 21.214  2.996   1.509   1.00 0.00 ? 20  ARG A NH1  1  
ATOM 282   N NH2  . ARG A 1 20  ? 23.012  2.263   2.780   1.00 0.00 ? 20  ARG A NH2  1  
ATOM 283   H H    . ARG A 1 20  ? 16.698  2.715   6.440   1.00 0.00 ? 20  ARG A H    1  
ATOM 284   H HA   . ARG A 1 20  ? 16.493  2.864   3.764   1.00 0.00 ? 20  ARG A HA   1  
ATOM 285   H HB2  . ARG A 1 20  ? 17.351  0.476   5.473   1.00 0.00 ? 20  ARG A HB2  1  
ATOM 286   H HB3  . ARG A 1 20  ? 17.668  0.596   3.754   1.00 0.00 ? 20  ARG A HB3  1  
ATOM 287   H HG2  . ARG A 1 20  ? 18.514  2.863   5.578   1.00 0.00 ? 20  ARG A HG2  1  
ATOM 288   H HG3  . ARG A 1 20  ? 19.490  1.409   5.508   1.00 0.00 ? 20  ARG A HG3  1  
ATOM 289   H HD2  . ARG A 1 20  ? 18.974  1.988   2.798   1.00 0.00 ? 20  ARG A HD2  1  
ATOM 290   H HD3  . ARG A 1 20  ? 19.214  3.568   3.518   1.00 0.00 ? 20  ARG A HD3  1  
ATOM 291   H HE   . ARG A 1 20  ? 21.271  1.904   4.529   1.00 0.00 ? 20  ARG A HE   1  
ATOM 292   H HH11 . ARG A 1 20  ? 20.235  3.179   1.418   1.00 0.00 ? 20  ARG A HH11 1  
ATOM 293   H HH12 . ARG A 1 20  ? 21.830  3.176   0.741   1.00 0.00 ? 20  ARG A HH12 1  
ATOM 294   H HH21 . ARG A 1 20  ? 23.375  1.899   3.638   1.00 0.00 ? 20  ARG A HH21 1  
ATOM 295   H HH22 . ARG A 1 20  ? 23.628  2.443   2.013   1.00 0.00 ? 20  ARG A HH22 1  
ATOM 296   N N    . LEU A 1 21  ? 14.409  0.698   5.082   1.00 0.00 ? 21  LEU A N    1  
ATOM 297   C CA   . LEU A 1 21  ? 13.245  -0.136  4.833   1.00 0.00 ? 21  LEU A CA   1  
ATOM 298   C C    . LEU A 1 21  ? 12.073  0.747   4.403   1.00 0.00 ? 21  LEU A C    1  
ATOM 299   O O    . LEU A 1 21  ? 11.206  0.309   3.647   1.00 0.00 ? 21  LEU A O    1  
ATOM 300   C CB   . LEU A 1 21  ? 12.942  -1.010  6.053   1.00 0.00 ? 21  LEU A CB   1  
ATOM 301   C CG   . LEU A 1 21  ? 11.987  -2.181  5.817   1.00 0.00 ? 21  LEU A CG   1  
ATOM 302   C CD1  . LEU A 1 21  ? 12.409  -2.995  4.592   1.00 0.00 ? 21  LEU A CD1  1  
ATOM 303   C CD2  . LEU A 1 21  ? 11.867  -3.051  7.070   1.00 0.00 ? 21  LEU A CD2  1  
ATOM 304   H H    . LEU A 1 21  ? 14.636  0.829   6.047   1.00 0.00 ? 21  LEU A H    1  
ATOM 305   H HA   . LEU A 1 21  ? 13.493  -0.807  4.010   1.00 0.00 ? 21  LEU A HA   1  
ATOM 306   H HB2  . LEU A 1 21  ? 13.883  -1.405  6.435   1.00 0.00 ? 21  LEU A HB2  1  
ATOM 307   H HB3  . LEU A 1 21  ? 12.522  -0.376  6.833   1.00 0.00 ? 21  LEU A HB3  1  
ATOM 308   H HG   . LEU A 1 21  ? 10.996  -1.778  5.610   1.00 0.00 ? 21  LEU A HG   1  
ATOM 309   H HD11 . LEU A 1 21  ? 12.194  -4.050  4.765   1.00 0.00 ? 21  LEU A HD11 1  
ATOM 310   H HD12 . LEU A 1 21  ? 11.855  -2.650  3.719   1.00 0.00 ? 21  LEU A HD12 1  
ATOM 311   H HD13 . LEU A 1 21  ? 13.477  -2.866  4.420   1.00 0.00 ? 21  LEU A HD13 1  
ATOM 312   H HD21 . LEU A 1 21  ? 10.821  -3.308  7.236   1.00 0.00 ? 21  LEU A HD21 1  
ATOM 313   H HD22 . LEU A 1 21  ? 12.448  -3.964  6.936   1.00 0.00 ? 21  LEU A HD22 1  
ATOM 314   H HD23 . LEU A 1 21  ? 12.247  -2.502  7.932   1.00 0.00 ? 21  LEU A HD23 1  
ATOM 315   N N    . LEU A 1 22  ? 12.083  1.974   4.902   1.00 0.00 ? 22  LEU A N    1  
ATOM 316   C CA   . LEU A 1 22  ? 11.031  2.922   4.578   1.00 0.00 ? 22  LEU A CA   1  
ATOM 317   C C    . LEU A 1 22  ? 11.144  3.321   3.105   1.00 0.00 ? 22  LEU A C    1  
ATOM 318   O O    . LEU A 1 22  ? 10.224  3.089   2.323   1.00 0.00 ? 22  LEU A O    1  
ATOM 319   C CB   . LEU A 1 22  ? 11.066  4.111   5.541   1.00 0.00 ? 22  LEU A CB   1  
ATOM 320   C CG   . LEU A 1 22  ? 10.257  3.954   6.830   1.00 0.00 ? 22  LEU A CG   1  
ATOM 321   C CD1  . LEU A 1 22  ? 8.755   3.945   6.538   1.00 0.00 ? 22  LEU A CD1  1  
ATOM 322   C CD2  . LEU A 1 22  ? 10.697  2.710   7.606   1.00 0.00 ? 22  LEU A CD2  1  
ATOM 323   H H    . LEU A 1 22  ? 12.791  2.322   5.516   1.00 0.00 ? 22  LEU A H    1  
ATOM 324   H HA   . LEU A 1 22  ? 10.077  2.416   4.727   1.00 0.00 ? 22  LEU A HA   1  
ATOM 325   H HB2  . LEU A 1 22  ? 12.104  4.306   5.809   1.00 0.00 ? 22  LEU A HB2  1  
ATOM 326   H HB3  . LEU A 1 22  ? 10.702  4.992   5.013   1.00 0.00 ? 22  LEU A HB3  1  
ATOM 327   H HG   . LEU A 1 22  ? 10.457  4.817   7.466   1.00 0.00 ? 22  LEU A HG   1  
ATOM 328   H HD11 . LEU A 1 22  ? 8.234   4.523   7.301   1.00 0.00 ? 22  LEU A HD11 1  
ATOM 329   H HD12 . LEU A 1 22  ? 8.573   4.389   5.559   1.00 0.00 ? 22  LEU A HD12 1  
ATOM 330   H HD13 . LEU A 1 22  ? 8.389   2.919   6.546   1.00 0.00 ? 22  LEU A HD13 1  
ATOM 331   H HD21 . LEU A 1 22  ? 11.565  2.953   8.219   1.00 0.00 ? 22  LEU A HD21 1  
ATOM 332   H HD22 . LEU A 1 22  ? 9.882   2.374   8.246   1.00 0.00 ? 22  LEU A HD22 1  
ATOM 333   H HD23 . LEU A 1 22  ? 10.958  1.918   6.904   1.00 0.00 ? 22  LEU A HD23 1  
ATOM 334   N N    . ASP A 1 23  ? 12.281  3.913   2.772   1.00 0.00 ? 23  ASP A N    1  
ATOM 335   C CA   . ASP A 1 23  ? 12.527  4.346   1.407   1.00 0.00 ? 23  ASP A CA   1  
ATOM 336   C C    . ASP A 1 23  ? 12.194  3.203   0.446   1.00 0.00 ? 23  ASP A C    1  
ATOM 337   O O    . ASP A 1 23  ? 11.468  3.397   -0.527  1.00 0.00 ? 23  ASP A O    1  
ATOM 338   C CB   . ASP A 1 23  ? 13.997  4.721   1.204   1.00 0.00 ? 23  ASP A CB   1  
ATOM 339   C CG   . ASP A 1 23  ? 14.303  5.453   -0.104  1.00 0.00 ? 23  ASP A CG   1  
ATOM 340   O OD1  . ASP A 1 23  ? 13.666  6.505   -0.328  1.00 0.00 ? 23  ASP A OD1  1  
ATOM 341   O OD2  . ASP A 1 23  ? 15.167  4.944   -0.850  1.00 0.00 ? 23  ASP A OD2  1  
ATOM 342   H H    . ASP A 1 23  ? 13.025  4.099   3.414   1.00 0.00 ? 23  ASP A H    1  
ATOM 343   H HA   . ASP A 1 23  ? 11.884  5.214   1.261   1.00 0.00 ? 23  ASP A HA   1  
ATOM 344   H HB2  . ASP A 1 23  ? 14.315  5.348   2.037   1.00 0.00 ? 23  ASP A HB2  1  
ATOM 345   H HB3  . ASP A 1 23  ? 14.597  3.812   1.243   1.00 0.00 ? 23  ASP A HB3  1  
ATOM 346   N N    . ALA A 1 24  ? 12.741  2.036   0.753   1.00 0.00 ? 24  ALA A N    1  
ATOM 347   C CA   . ALA A 1 24  ? 12.511  0.861   -0.071  1.00 0.00 ? 24  ALA A CA   1  
ATOM 348   C C    . ALA A 1 24  ? 11.005  0.654   -0.247  1.00 0.00 ? 24  ALA A C    1  
ATOM 349   O O    . ALA A 1 24  ? 10.519  0.531   -1.370  1.00 0.00 ? 24  ALA A O    1  
ATOM 350   C CB   . ALA A 1 24  ? 13.196  -0.350  0.565   1.00 0.00 ? 24  ALA A CB   1  
ATOM 351   H H    . ALA A 1 24  ? 13.331  1.886   1.547   1.00 0.00 ? 24  ALA A H    1  
ATOM 352   H HA   . ALA A 1 24  ? 12.960  1.047   -1.046  1.00 0.00 ? 24  ALA A HA   1  
ATOM 353   H HB1  . ALA A 1 24  ? 12.492  -1.181  0.613   1.00 0.00 ? 24  ALA A HB1  1  
ATOM 354   H HB2  . ALA A 1 24  ? 14.057  -0.638  -0.038  1.00 0.00 ? 24  ALA A HB2  1  
ATOM 355   H HB3  . ALA A 1 24  ? 13.526  -0.095  1.571   1.00 0.00 ? 24  ALA A HB3  1  
ATOM 356   N N    . ILE A 1 25  ? 10.309  0.622   0.880   1.00 0.00 ? 25  ILE A N    1  
ATOM 357   C CA   . ILE A 1 25  ? 8.869   0.432   0.865   1.00 0.00 ? 25  ILE A CA   1  
ATOM 358   C C    . ILE A 1 25  ? 8.213   1.596   0.119   1.00 0.00 ? 25  ILE A C    1  
ATOM 359   O O    . ILE A 1 25  ? 7.226   1.406   -0.591  1.00 0.00 ? 25  ILE A O    1  
ATOM 360   C CB   . ILE A 1 25  ? 8.339   0.236   2.287   1.00 0.00 ? 25  ILE A CB   1  
ATOM 361   C CG1  . ILE A 1 25  ? 8.753   -1.128  2.843   1.00 0.00 ? 25  ILE A CG1  1  
ATOM 362   C CG2  . ILE A 1 25  ? 6.823   0.441   2.340   1.00 0.00 ? 25  ILE A CG2  1  
ATOM 363   C CD1  . ILE A 1 25  ? 8.462   -1.219  4.343   1.00 0.00 ? 25  ILE A CD1  1  
ATOM 364   H H    . ILE A 1 25  ? 10.712  0.722   1.790   1.00 0.00 ? 25  ILE A H    1  
ATOM 365   H HA   . ILE A 1 25  ? 8.666   -0.488  0.316   1.00 0.00 ? 25  ILE A HA   1  
ATOM 366   H HB   . ILE A 1 25  ? 8.789   0.995   2.926   1.00 0.00 ? 25  ILE A HB   1  
ATOM 367   H HG12 . ILE A 1 25  ? 8.217   -1.917  2.317   1.00 0.00 ? 25  ILE A HG12 1  
ATOM 368   H HG13 . ILE A 1 25  ? 9.816   -1.289  2.665   1.00 0.00 ? 25  ILE A HG13 1  
ATOM 369   H HG21 . ILE A 1 25  ? 6.572   1.410   1.910   1.00 0.00 ? 25  ILE A HG21 1  
ATOM 370   H HG22 . ILE A 1 25  ? 6.330   -0.347  1.771   1.00 0.00 ? 25  ILE A HG22 1  
ATOM 371   H HG23 . ILE A 1 25  ? 6.488   0.404   3.376   1.00 0.00 ? 25  ILE A HG23 1  
ATOM 372   H HD11 . ILE A 1 25  ? 7.428   -0.931  4.531   1.00 0.00 ? 25  ILE A HD11 1  
ATOM 373   H HD12 . ILE A 1 25  ? 8.622   -2.242  4.682   1.00 0.00 ? 25  ILE A HD12 1  
ATOM 374   H HD13 . ILE A 1 25  ? 9.130   -0.548  4.884   1.00 0.00 ? 25  ILE A HD13 1  
ATOM 375   N N    . CYS A 1 26  ? 8.788   2.775   0.305   1.00 0.00 ? 26  CYS A N    1  
ATOM 376   C CA   . CYS A 1 26  ? 8.272   3.969   -0.342  1.00 0.00 ? 26  CYS A CA   1  
ATOM 377   C C    . CYS A 1 26  ? 8.439   3.807   -1.854  1.00 0.00 ? 26  CYS A C    1  
ATOM 378   O O    . CYS A 1 26  ? 7.497   4.031   -2.614  1.00 0.00 ? 26  CYS A O    1  
ATOM 379   C CB   . CYS A 1 26  ? 8.958   5.234   0.176   1.00 0.00 ? 26  CYS A CB   1  
ATOM 380   S SG   . CYS A 1 26  ? 8.253   5.711   1.796   1.00 0.00 ? 26  CYS A SG   1  
ATOM 381   H H    . CYS A 1 26  ? 9.590   2.921   0.883   1.00 0.00 ? 26  CYS A H    1  
ATOM 382   H HA   . CYS A 1 26  ? 7.217   4.039   -0.074  1.00 0.00 ? 26  CYS A HA   1  
ATOM 383   H HB2  . CYS A 1 26  ? 10.030  5.062   0.273   1.00 0.00 ? 26  CYS A HB2  1  
ATOM 384   H HB3  . CYS A 1 26  ? 8.830   6.047   -0.539  1.00 0.00 ? 26  CYS A HB3  1  
ATOM 385   H HG   . CYS A 1 26  ? 7.653   4.548   2.034   1.00 0.00 ? 26  CYS A HG   1  
ATOM 386   N N    . GLU A 1 27  ? 9.644   3.420   -2.246  1.00 0.00 ? 27  GLU A N    1  
ATOM 387   C CA   . GLU A 1 27  ? 9.946   3.225   -3.654  1.00 0.00 ? 27  GLU A CA   1  
ATOM 388   C C    . GLU A 1 27  ? 8.952   2.245   -4.280  1.00 0.00 ? 27  GLU A C    1  
ATOM 389   O O    . GLU A 1 27  ? 8.766   2.236   -5.496  1.00 0.00 ? 27  GLU A O    1  
ATOM 390   C CB   . GLU A 1 27  ? 11.385  2.743   -3.844  1.00 0.00 ? 27  GLU A CB   1  
ATOM 391   C CG   . GLU A 1 27  ? 12.382  3.876   -3.590  1.00 0.00 ? 27  GLU A CG   1  
ATOM 392   C CD   . GLU A 1 27  ? 12.523  4.768   -4.825  1.00 0.00 ? 27  GLU A CD   1  
ATOM 393   O OE1  . GLU A 1 27  ? 11.483  5.004   -5.477  1.00 0.00 ? 27  GLU A OE1  1  
ATOM 394   O OE2  . GLU A 1 27  ? 13.668  5.194   -5.089  1.00 0.00 ? 27  GLU A OE2  1  
ATOM 395   H H    . GLU A 1 27  ? 10.404  3.240   -1.622  1.00 0.00 ? 27  GLU A H    1  
ATOM 396   H HA   . GLU A 1 27  ? 9.835   4.208   -4.112  1.00 0.00 ? 27  GLU A HA   1  
ATOM 397   H HB2  . GLU A 1 27  ? 11.588  1.916   -3.163  1.00 0.00 ? 27  GLU A HB2  1  
ATOM 398   H HB3  . GLU A 1 27  ? 11.514  2.360   -4.856  1.00 0.00 ? 27  GLU A HB3  1  
ATOM 399   H HG2  . GLU A 1 27  ? 12.050  4.474   -2.741  1.00 0.00 ? 27  GLU A HG2  1  
ATOM 400   H HG3  . GLU A 1 27  ? 13.353  3.458   -3.325  1.00 0.00 ? 27  GLU A HG3  1  
ATOM 401   N N    . ARG A 1 28  ? 8.339   1.444   -3.421  1.00 0.00 ? 28  ARG A N    1  
ATOM 402   C CA   . ARG A 1 28  ? 7.369   0.462   -3.874  1.00 0.00 ? 28  ARG A CA   1  
ATOM 403   C C    . ARG A 1 28  ? 6.029   1.139   -4.174  1.00 0.00 ? 28  ARG A C    1  
ATOM 404   O O    . ARG A 1 28  ? 5.303   0.715   -5.071  1.00 0.00 ? 28  ARG A O    1  
ATOM 405   C CB   . ARG A 1 28  ? 7.157   -0.629  -2.824  1.00 0.00 ? 28  ARG A CB   1  
ATOM 406   C CG   . ARG A 1 28  ? 7.767   -1.956  -3.281  1.00 0.00 ? 28  ARG A CG   1  
ATOM 407   C CD   . ARG A 1 28  ? 9.019   -2.293  -2.470  1.00 0.00 ? 28  ARG A CD   1  
ATOM 408   N NE   . ARG A 1 28  ? 9.903   -3.187  -3.250  1.00 0.00 ? 28  ARG A NE   1  
ATOM 409   C CZ   . ARG A 1 28  ? 10.718  -2.771  -4.229  1.00 0.00 ? 28  ARG A CZ   1  
ATOM 410   N NH1  . ARG A 1 28  ? 10.767  -1.472  -4.553  1.00 0.00 ? 28  ARG A NH1  1  
ATOM 411   N NH2  . ARG A 1 28  ? 11.484  -3.655  -4.884  1.00 0.00 ? 28  ARG A NH2  1  
ATOM 412   H H    . ARG A 1 28  ? 8.496   1.458   -2.433  1.00 0.00 ? 28  ARG A H    1  
ATOM 413   H HA   . ARG A 1 28  ? 7.804   0.037   -4.779  1.00 0.00 ? 28  ARG A HA   1  
ATOM 414   H HB2  . ARG A 1 28  ? 7.609   -0.324  -1.880  1.00 0.00 ? 28  ARG A HB2  1  
ATOM 415   H HB3  . ARG A 1 28  ? 6.091   -0.760  -2.639  1.00 0.00 ? 28  ARG A HB3  1  
ATOM 416   H HG2  . ARG A 1 28  ? 7.033   -2.755  -3.172  1.00 0.00 ? 28  ARG A HG2  1  
ATOM 417   H HG3  . ARG A 1 28  ? 8.019   -1.898  -4.340  1.00 0.00 ? 28  ARG A HG3  1  
ATOM 418   H HD2  . ARG A 1 28  ? 9.552   -1.377  -2.211  1.00 0.00 ? 28  ARG A HD2  1  
ATOM 419   H HD3  . ARG A 1 28  ? 8.738   -2.773  -1.533  1.00 0.00 ? 28  ARG A HD3  1  
ATOM 420   H HE   . ARG A 1 28  ? 9.891   -4.164  -3.034  1.00 0.00 ? 28  ARG A HE   1  
ATOM 421   H HH11 . ARG A 1 28  ? 10.195  -0.813  -4.065  1.00 0.00 ? 28  ARG A HH11 1  
ATOM 422   H HH12 . ARG A 1 28  ? 11.375  -1.162  -5.284  1.00 0.00 ? 28  ARG A HH12 1  
ATOM 423   H HH21 . ARG A 1 28  ? 11.448  -4.624  -4.642  1.00 0.00 ? 28  ARG A HH21 1  
ATOM 424   H HH22 . ARG A 1 28  ? 12.092  -3.344  -5.614  1.00 0.00 ? 28  ARG A HH22 1  
ATOM 425   N N    . LEU A 1 29  ? 5.743   2.179   -3.404  1.00 0.00 ? 29  LEU A N    1  
ATOM 426   C CA   . LEU A 1 29  ? 4.504   2.918   -3.576  1.00 0.00 ? 29  LEU A CA   1  
ATOM 427   C C    . LEU A 1 29  ? 4.227   3.102   -5.069  1.00 0.00 ? 29  LEU A C    1  
ATOM 428   O O    . LEU A 1 29  ? 5.089   3.571   -5.811  1.00 0.00 ? 29  LEU A O    1  
ATOM 429   C CB   . LEU A 1 29  ? 4.551   4.232   -2.793  1.00 0.00 ? 29  LEU A CB   1  
ATOM 430   C CG   . LEU A 1 29  ? 4.837   4.111   -1.295  1.00 0.00 ? 29  LEU A CG   1  
ATOM 431   C CD1  . LEU A 1 29  ? 5.362   5.431   -0.728  1.00 0.00 ? 29  LEU A CD1  1  
ATOM 432   C CD2  . LEU A 1 29  ? 3.604   3.612   -0.540  1.00 0.00 ? 29  LEU A CD2  1  
ATOM 433   H H    . LEU A 1 29  ? 6.340   2.517   -2.677  1.00 0.00 ? 29  LEU A H    1  
ATOM 434   H HA   . LEU A 1 29  ? 3.703   2.317   -3.147  1.00 0.00 ? 29  LEU A HA   1  
ATOM 435   H HB2  . LEU A 1 29  ? 5.315   4.870   -3.238  1.00 0.00 ? 29  LEU A HB2  1  
ATOM 436   H HB3  . LEU A 1 29  ? 3.596   4.742   -2.920  1.00 0.00 ? 29  LEU A HB3  1  
ATOM 437   H HG   . LEU A 1 29  ? 5.622   3.367   -1.156  1.00 0.00 ? 29  LEU A HG   1  
ATOM 438   H HD11 . LEU A 1 29  ? 5.405   5.369   0.359   1.00 0.00 ? 29  LEU A HD11 1  
ATOM 439   H HD12 . LEU A 1 29  ? 6.361   5.624   -1.121  1.00 0.00 ? 29  LEU A HD12 1  
ATOM 440   H HD13 . LEU A 1 29  ? 4.694   6.242   -1.020  1.00 0.00 ? 29  LEU A HD13 1  
ATOM 441   H HD21 . LEU A 1 29  ? 3.844   3.507   0.518   1.00 0.00 ? 29  LEU A HD21 1  
ATOM 442   H HD22 . LEU A 1 29  ? 2.791   4.329   -0.658  1.00 0.00 ? 29  LEU A HD22 1  
ATOM 443   H HD23 . LEU A 1 29  ? 3.298   2.646   -0.941  1.00 0.00 ? 29  LEU A HD23 1  
ATOM 444   N N    . LYS A 1 30  ? 3.021   2.722   -5.466  1.00 0.00 ? 30  LYS A N    1  
ATOM 445   C CA   . LYS A 1 30  ? 2.620   2.839   -6.858  1.00 0.00 ? 30  LYS A CA   1  
ATOM 446   C C    . LYS A 1 30  ? 1.520   3.895   -6.980  1.00 0.00 ? 30  LYS A C    1  
ATOM 447   O O    . LYS A 1 30  ? 0.773   4.132   -6.031  1.00 0.00 ? 30  LYS A O    1  
ATOM 448   C CB   . LYS A 1 30  ? 2.224   1.471   -7.418  1.00 0.00 ? 30  LYS A CB   1  
ATOM 449   C CG   . LYS A 1 30  ? 3.399   0.817   -8.149  1.00 0.00 ? 30  LYS A CG   1  
ATOM 450   C CD   . LYS A 1 30  ? 2.947   0.209   -9.478  1.00 0.00 ? 30  LYS A CD   1  
ATOM 451   C CE   . LYS A 1 30  ? 4.093   0.194   -10.492 1.00 0.00 ? 30  LYS A CE   1  
ATOM 452   N NZ   . LYS A 1 30  ? 3.840   -0.814  -11.545 1.00 0.00 ? 30  LYS A NZ   1  
ATOM 453   H H    . LYS A 1 30  ? 2.326   2.341   -4.856  1.00 0.00 ? 30  LYS A H    1  
ATOM 454   H HA   . LYS A 1 30  ? 3.489   3.179   -7.421  1.00 0.00 ? 30  LYS A HA   1  
ATOM 455   H HB2  . LYS A 1 30  ? 1.891   0.824   -6.607  1.00 0.00 ? 30  LYS A HB2  1  
ATOM 456   H HB3  . LYS A 1 30  ? 1.383   1.584   -8.101  1.00 0.00 ? 30  LYS A HB3  1  
ATOM 457   H HG2  . LYS A 1 30  ? 4.177   1.559   -8.330  1.00 0.00 ? 30  LYS A HG2  1  
ATOM 458   H HG3  . LYS A 1 30  ? 3.837   0.042   -7.520  1.00 0.00 ? 30  LYS A HG3  1  
ATOM 459   H HD2  . LYS A 1 30  ? 2.589   -0.807  -9.314  1.00 0.00 ? 30  LYS A HD2  1  
ATOM 460   H HD3  . LYS A 1 30  ? 2.110   0.782   -9.878  1.00 0.00 ? 30  LYS A HD3  1  
ATOM 461   H HE2  . LYS A 1 30  ? 4.201   1.181   -10.943 1.00 0.00 ? 30  LYS A HE2  1  
ATOM 462   H HE3  . LYS A 1 30  ? 5.032   -0.029  -9.985  1.00 0.00 ? 30  LYS A HE3  1  
ATOM 463   H HZ1  . LYS A 1 30  ? 4.056   -0.423  -12.440 1.00 0.00 ? 30  LYS A HZ1  1  
ATOM 464   H HZ2  . LYS A 1 30  ? 4.415   -1.616  -11.384 1.00 0.00 ? 30  LYS A HZ2  1  
ATOM 465   H HZ3  . LYS A 1 30  ? 2.877   -1.084  -11.524 1.00 0.00 ? 30  LYS A HZ3  1  
ATOM 466   N N    . PRO A 1 31  ? 1.453   4.518   -8.187  1.00 0.00 ? 31  PRO A N    1  
ATOM 467   C CA   . PRO A 1 31  ? 0.456   5.543   -8.446  1.00 0.00 ? 31  PRO A CA   1  
ATOM 468   C C    . PRO A 1 31  ? -0.928  4.924   -8.649  1.00 0.00 ? 31  PRO A C    1  
ATOM 469   O O    . PRO A 1 31  ? -1.179  4.276   -9.664  1.00 0.00 ? 31  PRO A O    1  
ATOM 470   C CB   . PRO A 1 31  ? 0.962   6.283   -9.673  1.00 0.00 ? 31  PRO A CB   1  
ATOM 471   C CG   . PRO A 1 31  ? 1.974   5.358   -10.330 1.00 0.00 ? 31  PRO A CG   1  
ATOM 472   C CD   . PRO A 1 31  ? 2.320   4.263   -9.333  1.00 0.00 ? 31  PRO A CD   1  
ATOM 473   H HA   . PRO A 1 31  ? 0.370   6.151   -7.656  1.00 0.00 ? 31  PRO A HA   1  
ATOM 474   H HB2  . PRO A 1 31  ? 0.144   6.514   -10.355 1.00 0.00 ? 31  PRO A HB2  1  
ATOM 475   H HB3  . PRO A 1 31  ? 1.423   7.231   -9.396  1.00 0.00 ? 31  PRO A HB3  1  
ATOM 476   H HG2  . PRO A 1 31  ? 1.561   4.927   -11.242 1.00 0.00 ? 31  PRO A HG2  1  
ATOM 477   H HG3  . PRO A 1 31  ? 2.868   5.911   -10.615 1.00 0.00 ? 31  PRO A HG3  1  
ATOM 478   H HD2  . PRO A 1 31  ? 2.141   3.274   -9.754  1.00 0.00 ? 31  PRO A HD2  1  
ATOM 479   H HD3  . PRO A 1 31  ? 3.372   4.304   -9.051  1.00 0.00 ? 31  PRO A HD3  1  
ATOM 480   N N    . CYS A 1 32  ? -1.790  5.145   -7.668  1.00 0.00 ? 32  CYS A N    1  
ATOM 481   C CA   . CYS A 1 32  ? -3.142  4.616   -7.727  1.00 0.00 ? 32  CYS A CA   1  
ATOM 482   C C    . CYS A 1 32  ? -4.038  5.490   -6.846  1.00 0.00 ? 32  CYS A C    1  
ATOM 483   O O    . CYS A 1 32  ? -3.559  6.141   -5.919  1.00 0.00 ? 32  CYS A O    1  
ATOM 484   C CB   . CYS A 1 32  ? -3.193  3.145   -7.310  1.00 0.00 ? 32  CYS A CB   1  
ATOM 485   S SG   . CYS A 1 32  ? -2.027  2.843   -5.933  1.00 0.00 ? 32  CYS A SG   1  
ATOM 486   H H    . CYS A 1 32  ? -1.578  5.673   -6.846  1.00 0.00 ? 32  CYS A H    1  
ATOM 487   H HA   . CYS A 1 32  ? -3.454  4.670   -8.770  1.00 0.00 ? 32  CYS A HA   1  
ATOM 488   H HB2  . CYS A 1 32  ? -4.206  2.880   -7.006  1.00 0.00 ? 32  CYS A HB2  1  
ATOM 489   H HB3  . CYS A 1 32  ? -2.939  2.510   -8.159  1.00 0.00 ? 32  CYS A HB3  1  
ATOM 490   H HG   . CYS A 1 32  ? -1.466  1.759   -6.460  1.00 0.00 ? 32  CYS A HG   1  
ATOM 491   N N    . LEU A 1 33  ? -5.324  5.476   -7.167  1.00 0.00 ? 33  LEU A N    1  
ATOM 492   C CA   . LEU A 1 33  ? -6.291  6.259   -6.417  1.00 0.00 ? 33  LEU A CA   1  
ATOM 493   C C    . LEU A 1 33  ? -7.586  5.457   -6.270  1.00 0.00 ? 33  LEU A C    1  
ATOM 494   O O    . LEU A 1 33  ? -7.886  4.600   -7.099  1.00 0.00 ? 33  LEU A O    1  
ATOM 495   C CB   . LEU A 1 33  ? -6.487  7.631   -7.064  1.00 0.00 ? 33  LEU A CB   1  
ATOM 496   C CG   . LEU A 1 33  ? -7.313  8.639   -6.262  1.00 0.00 ? 33  LEU A CG   1  
ATOM 497   C CD1  . LEU A 1 33  ? -6.496  9.896   -5.954  1.00 0.00 ? 33  LEU A CD1  1  
ATOM 498   C CD2  . LEU A 1 33  ? -8.623  8.969   -6.980  1.00 0.00 ? 33  LEU A CD2  1  
ATOM 499   H H    . LEU A 1 33  ? -5.706  4.944   -7.923  1.00 0.00 ? 33  LEU A H    1  
ATOM 500   H HA   . LEU A 1 33  ? -5.874  6.428   -5.424  1.00 0.00 ? 33  LEU A HA   1  
ATOM 501   H HB2  . LEU A 1 33  ? -5.505  8.065   -7.254  1.00 0.00 ? 33  LEU A HB2  1  
ATOM 502   H HB3  . LEU A 1 33  ? -6.966  7.489   -8.033  1.00 0.00 ? 33  LEU A HB3  1  
ATOM 503   H HG   . LEU A 1 33  ? -7.575  8.184   -5.307  1.00 0.00 ? 33  LEU A HG   1  
ATOM 504   H HD11 . LEU A 1 33  ? -5.541  9.609   -5.515  1.00 0.00 ? 33  LEU A HD11 1  
ATOM 505   H HD12 . LEU A 1 33  ? -6.321  10.450  -6.876  1.00 0.00 ? 33  LEU A HD12 1  
ATOM 506   H HD13 . LEU A 1 33  ? -7.046  10.523  -5.252  1.00 0.00 ? 33  LEU A HD13 1  
ATOM 507   H HD21 . LEU A 1 33  ? -8.636  10.026  -7.246  1.00 0.00 ? 33  LEU A HD21 1  
ATOM 508   H HD22 . LEU A 1 33  ? -8.704  8.366   -7.884  1.00 0.00 ? 33  LEU A HD22 1  
ATOM 509   H HD23 . LEU A 1 33  ? -9.464  8.750   -6.321  1.00 0.00 ? 33  LEU A HD23 1  
ATOM 510   N N    . PHE A 1 34  ? -8.318  5.765   -5.209  1.00 0.00 ? 34  PHE A N    1  
ATOM 511   C CA   . PHE A 1 34  ? -9.573  5.084   -4.943  1.00 0.00 ? 34  PHE A CA   1  
ATOM 512   C C    . PHE A 1 34  ? -10.766 5.982   -5.279  1.00 0.00 ? 34  PHE A C    1  
ATOM 513   O O    . PHE A 1 34  ? -10.747 7.178   -4.992  1.00 0.00 ? 34  PHE A O    1  
ATOM 514   C CB   . PHE A 1 34  ? -9.598  4.760   -3.448  1.00 0.00 ? 34  PHE A CB   1  
ATOM 515   C CG   . PHE A 1 34  ? -8.316  4.104   -2.932  1.00 0.00 ? 34  PHE A CG   1  
ATOM 516   C CD1  . PHE A 1 34  ? -7.897  2.922   -3.459  1.00 0.00 ? 34  PHE A CD1  1  
ATOM 517   C CD2  . PHE A 1 34  ? -7.596  4.702   -1.946  1.00 0.00 ? 34  PHE A CD2  1  
ATOM 518   C CE1  . PHE A 1 34  ? -6.707  2.313   -2.980  1.00 0.00 ? 34  PHE A CE1  1  
ATOM 519   C CE2  . PHE A 1 34  ? -6.406  4.093   -1.467  1.00 0.00 ? 34  PHE A CE2  1  
ATOM 520   C CZ   . PHE A 1 34  ? -5.987  2.911   -1.994  1.00 0.00 ? 34  PHE A CZ   1  
ATOM 521   H H    . PHE A 1 34  ? -8.066  6.464   -4.540  1.00 0.00 ? 34  PHE A H    1  
ATOM 522   H HA   . PHE A 1 34  ? -9.600  4.196   -5.575  1.00 0.00 ? 34  PHE A HA   1  
ATOM 523   H HB2  . PHE A 1 34  ? -9.774  5.680   -2.890  1.00 0.00 ? 34  PHE A HB2  1  
ATOM 524   H HB3  . PHE A 1 34  ? -10.440 4.098   -3.244  1.00 0.00 ? 34  PHE A HB3  1  
ATOM 525   H HD1  . PHE A 1 34  ? -8.475  2.442   -4.249  1.00 0.00 ? 34  PHE A HD1  1  
ATOM 526   H HD2  . PHE A 1 34  ? -7.931  5.649   -1.524  1.00 0.00 ? 34  PHE A HD2  1  
ATOM 527   H HE1  . PHE A 1 34  ? -6.372  1.366   -3.402  1.00 0.00 ? 34  PHE A HE1  1  
ATOM 528   H HE2  . PHE A 1 34  ? -5.828  4.573   -0.677  1.00 0.00 ? 34  PHE A HE2  1  
ATOM 529   H HZ   . PHE A 1 34  ? -5.073  2.444   -1.626  1.00 0.00 ? 34  PHE A HZ   1  
ATOM 530   N N    . THR A 1 35  ? -11.775 5.370   -5.881  1.00 0.00 ? 35  THR A N    1  
ATOM 531   C CA   . THR A 1 35  ? -12.974 6.099   -6.259  1.00 0.00 ? 35  THR A CA   1  
ATOM 532   C C    . THR A 1 35  ? -14.187 5.563   -5.495  1.00 0.00 ? 35  THR A C    1  
ATOM 533   O O    . THR A 1 35  ? -14.041 4.749   -4.584  1.00 0.00 ? 35  THR A O    1  
ATOM 534   C CB   . THR A 1 35  ? -13.124 6.008   -7.779  1.00 0.00 ? 35  THR A CB   1  
ATOM 535   O OG1  . THR A 1 35  ? -12.644 4.705   -8.097  1.00 0.00 ? 35  THR A OG1  1  
ATOM 536   C CG2  . THR A 1 35  ? -12.169 6.948   -8.518  1.00 0.00 ? 35  THR A CG2  1  
ATOM 537   H H    . THR A 1 35  ? -11.782 4.397   -6.111  1.00 0.00 ? 35  THR A H    1  
ATOM 538   H HA   . THR A 1 35  ? -12.848 7.142   -5.967  1.00 0.00 ? 35  THR A HA   1  
ATOM 539   H HB   . THR A 1 35  ? -14.156 6.186   -8.079  1.00 0.00 ? 35  THR A HB   1  
ATOM 540   H HG1  . THR A 1 35  ? -13.023 4.406   -8.973  1.00 0.00 ? 35  THR A HG1  1  
ATOM 541   H HG21 . THR A 1 35  ? -12.537 7.971   -8.445  1.00 0.00 ? 35  THR A HG21 1  
ATOM 542   H HG22 . THR A 1 35  ? -11.177 6.884   -8.070  1.00 0.00 ? 35  THR A HG22 1  
ATOM 543   H HG23 . THR A 1 35  ? -12.113 6.656   -9.567  1.00 0.00 ? 35  THR A HG23 1  
ATOM 544   N N    . GLU A 1 36  ? -15.356 6.040   -5.896  1.00 0.00 ? 36  GLU A N    1  
ATOM 545   C CA   . GLU A 1 36  ? -16.593 5.619   -5.261  1.00 0.00 ? 36  GLU A CA   1  
ATOM 546   C C    . GLU A 1 36  ? -16.804 4.116   -5.454  1.00 0.00 ? 36  GLU A C    1  
ATOM 547   O O    . GLU A 1 36  ? -16.599 3.592   -6.548  1.00 0.00 ? 36  GLU A O    1  
ATOM 548   C CB   . GLU A 1 36  ? -17.784 6.413   -5.800  1.00 0.00 ? 36  GLU A CB   1  
ATOM 549   C CG   . GLU A 1 36  ? -18.305 5.803   -7.103  1.00 0.00 ? 36  GLU A CG   1  
ATOM 550   C CD   . GLU A 1 36  ? -19.345 6.715   -7.758  1.00 0.00 ? 36  GLU A CD   1  
ATOM 551   O OE1  . GLU A 1 36  ? -20.473 6.766   -7.221  1.00 0.00 ? 36  GLU A OE1  1  
ATOM 552   O OE2  . GLU A 1 36  ? -18.989 7.339   -8.781  1.00 0.00 ? 36  GLU A OE2  1  
ATOM 553   H H    . GLU A 1 36  ? -15.466 6.702   -6.638  1.00 0.00 ? 36  GLU A H    1  
ATOM 554   H HA   . GLU A 1 36  ? -16.466 5.842   -4.201  1.00 0.00 ? 36  GLU A HA   1  
ATOM 555   H HB2  . GLU A 1 36  ? -18.582 6.429   -5.058  1.00 0.00 ? 36  GLU A HB2  1  
ATOM 556   H HB3  . GLU A 1 36  ? -17.489 7.448   -5.972  1.00 0.00 ? 36  GLU A HB3  1  
ATOM 557   H HG2  . GLU A 1 36  ? -17.475 5.641   -7.790  1.00 0.00 ? 36  GLU A HG2  1  
ATOM 558   H HG3  . GLU A 1 36  ? -18.747 4.828   -6.901  1.00 0.00 ? 36  GLU A HG3  1  
ATOM 559   N N    . LYS A 1 37  ? -17.210 3.464   -4.374  1.00 0.00 ? 37  LYS A N    1  
ATOM 560   C CA   . LYS A 1 37  ? -17.451 2.032   -4.411  1.00 0.00 ? 37  LYS A CA   1  
ATOM 561   C C    . LYS A 1 37  ? -16.114 1.298   -4.535  1.00 0.00 ? 37  LYS A C    1  
ATOM 562   O O    . LYS A 1 37  ? -16.031 0.261   -5.192  1.00 0.00 ? 37  LYS A O    1  
ATOM 563   C CB   . LYS A 1 37  ? -18.449 1.684   -5.517  1.00 0.00 ? 37  LYS A CB   1  
ATOM 564   C CG   . LYS A 1 37  ? -19.758 2.455   -5.336  1.00 0.00 ? 37  LYS A CG   1  
ATOM 565   C CD   . LYS A 1 37  ? -20.937 1.680   -5.928  1.00 0.00 ? 37  LYS A CD   1  
ATOM 566   C CE   . LYS A 1 37  ? -20.922 1.741   -7.457  1.00 0.00 ? 37  LYS A CE   1  
ATOM 567   N NZ   . LYS A 1 37  ? -22.240 1.351   -8.004  1.00 0.00 ? 37  LYS A NZ   1  
ATOM 568   H H    . LYS A 1 37  ? -17.375 3.898   -3.488  1.00 0.00 ? 37  LYS A H    1  
ATOM 569   H HA   . LYS A 1 37  ? -17.911 1.753   -3.463  1.00 0.00 ? 37  LYS A HA   1  
ATOM 570   H HB2  . LYS A 1 37  ? -18.016 1.918   -6.490  1.00 0.00 ? 37  LYS A HB2  1  
ATOM 571   H HB3  . LYS A 1 37  ? -18.649 0.613   -5.508  1.00 0.00 ? 37  LYS A HB3  1  
ATOM 572   H HG2  . LYS A 1 37  ? -19.934 2.638   -4.276  1.00 0.00 ? 37  LYS A HG2  1  
ATOM 573   H HG3  . LYS A 1 37  ? -19.680 3.429   -5.819  1.00 0.00 ? 37  LYS A HG3  1  
ATOM 574   H HD2  . LYS A 1 37  ? -20.894 0.641   -5.602  1.00 0.00 ? 37  LYS A HD2  1  
ATOM 575   H HD3  . LYS A 1 37  ? -21.874 2.093   -5.553  1.00 0.00 ? 37  LYS A HD3  1  
ATOM 576   H HE2  . LYS A 1 37  ? -20.670 2.750   -7.783  1.00 0.00 ? 37  LYS A HE2  1  
ATOM 577   H HE3  . LYS A 1 37  ? -20.149 1.078   -7.846  1.00 0.00 ? 37  LYS A HE3  1  
ATOM 578   H HZ1  . LYS A 1 37  ? -22.960 1.616   -7.362  1.00 0.00 ? 37  LYS A HZ1  1  
ATOM 579   H HZ2  . LYS A 1 37  ? -22.388 1.812   -8.879  1.00 0.00 ? 37  LYS A HZ2  1  
ATOM 580   H HZ3  . LYS A 1 37  ? -22.264 0.361   -8.141  1.00 0.00 ? 37  LYS A HZ3  1  
ATOM 581   N N    . SER A 1 38  ? -15.102 1.864   -3.895  1.00 0.00 ? 38  SER A N    1  
ATOM 582   C CA   . SER A 1 38  ? -13.774 1.277   -3.926  1.00 0.00 ? 38  SER A CA   1  
ATOM 583   C C    . SER A 1 38  ? -13.463 0.614   -2.582  1.00 0.00 ? 38  SER A C    1  
ATOM 584   O O    . SER A 1 38  ? -13.369 1.291   -1.560  1.00 0.00 ? 38  SER A O    1  
ATOM 585   C CB   . SER A 1 38  ? -12.714 2.329   -4.257  1.00 0.00 ? 38  SER A CB   1  
ATOM 586   O OG   . SER A 1 38  ? -12.804 2.771   -5.608  1.00 0.00 ? 38  SER A OG   1  
ATOM 587   H H    . SER A 1 38  ? -15.179 2.708   -3.363  1.00 0.00 ? 38  SER A H    1  
ATOM 588   H HA   . SER A 1 38  ? -13.806 0.532   -4.721  1.00 0.00 ? 38  SER A HA   1  
ATOM 589   H HB2  . SER A 1 38  ? -12.828 3.182   -3.588  1.00 0.00 ? 38  SER A HB2  1  
ATOM 590   H HB3  . SER A 1 38  ? -11.722 1.914   -4.076  1.00 0.00 ? 38  SER A HB3  1  
ATOM 591   H HG   . SER A 1 38  ? -13.763 2.847   -5.880  1.00 0.00 ? 38  SER A HG   1  
ATOM 592   N N    . TYR A 1 39  ? -13.313 -0.701  -2.628  1.00 0.00 ? 39  TYR A N    1  
ATOM 593   C CA   . TYR A 1 39  ? -13.015 -1.463  -1.427  1.00 0.00 ? 39  TYR A CA   1  
ATOM 594   C C    . TYR A 1 39  ? -11.505 -1.619  -1.237  1.00 0.00 ? 39  TYR A C    1  
ATOM 595   O O    . TYR A 1 39  ? -10.822 -2.179  -2.094  1.00 0.00 ? 39  TYR A O    1  
ATOM 596   C CB   . TYR A 1 39  ? -13.636 -2.845  -1.639  1.00 0.00 ? 39  TYR A CB   1  
ATOM 597   C CG   . TYR A 1 39  ? -15.110 -2.933  -1.240  1.00 0.00 ? 39  TYR A CG   1  
ATOM 598   C CD1  . TYR A 1 39  ? -15.499 -2.598  0.041   1.00 0.00 ? 39  TYR A CD1  1  
ATOM 599   C CD2  . TYR A 1 39  ? -16.051 -3.347  -2.161  1.00 0.00 ? 39  TYR A CD2  1  
ATOM 600   C CE1  . TYR A 1 39  ? -16.887 -2.681  0.417   1.00 0.00 ? 39  TYR A CE1  1  
ATOM 601   C CE2  . TYR A 1 39  ? -17.439 -3.430  -1.785  1.00 0.00 ? 39  TYR A CE2  1  
ATOM 602   C CZ   . TYR A 1 39  ? -17.788 -3.092  -0.515  1.00 0.00 ? 39  TYR A CZ   1  
ATOM 603   O OH   . TYR A 1 39  ? -19.099 -3.170  -0.160  1.00 0.00 ? 39  TYR A OH   1  
ATOM 604   H H    . TYR A 1 39  ? -13.391 -1.245  -3.464  1.00 0.00 ? 39  TYR A H    1  
ATOM 605   H HA   . TYR A 1 39  ? -13.427 -0.922  -0.575  1.00 0.00 ? 39  TYR A HA   1  
ATOM 606   H HB2  . TYR A 1 39  ? -13.537 -3.119  -2.689  1.00 0.00 ? 39  TYR A HB2  1  
ATOM 607   H HB3  . TYR A 1 39  ? -13.070 -3.578  -1.064  1.00 0.00 ? 39  TYR A HB3  1  
ATOM 608   H HD1  . TYR A 1 39  ? -14.756 -2.271  0.769   1.00 0.00 ? 39  TYR A HD1  1  
ATOM 609   H HD2  . TYR A 1 39  ? -15.743 -3.611  -3.172  1.00 0.00 ? 39  TYR A HD2  1  
ATOM 610   H HE1  . TYR A 1 39  ? -17.208 -2.419  1.425   1.00 0.00 ? 39  TYR A HE1  1  
ATOM 611   H HE2  . TYR A 1 39  ? -18.192 -3.755  -2.503  1.00 0.00 ? 39  TYR A HE2  1  
ATOM 612   H HH   . TYR A 1 39  ? -19.181 -3.224  0.835   1.00 0.00 ? 39  TYR A HH   1  
ATOM 613   N N    . LEU A 1 40  ? -11.027 -1.113  -0.109  1.00 0.00 ? 40  LEU A N    1  
ATOM 614   C CA   . LEU A 1 40  ? -9.610  -1.189  0.204   1.00 0.00 ? 40  LEU A CA   1  
ATOM 615   C C    . LEU A 1 40  ? -9.311  -2.533  0.871   1.00 0.00 ? 40  LEU A C    1  
ATOM 616   O O    . LEU A 1 40  ? -8.485  -3.303  0.383   1.00 0.00 ? 40  LEU A O    1  
ATOM 617   C CB   . LEU A 1 40  ? -9.179  0.020   1.036   1.00 0.00 ? 40  LEU A CB   1  
ATOM 618   C CG   . LEU A 1 40  ? -9.047  1.343   0.279   1.00 0.00 ? 40  LEU A CG   1  
ATOM 619   C CD1  . LEU A 1 40  ? -10.382 1.751   -0.348  1.00 0.00 ? 40  LEU A CD1  1  
ATOM 620   C CD2  . LEU A 1 40  ? -8.480  2.438   1.184   1.00 0.00 ? 40  LEU A CD2  1  
ATOM 621   H H    . LEU A 1 40  ? -11.589 -0.659  0.582   1.00 0.00 ? 40  LEU A H    1  
ATOM 622   H HA   . LEU A 1 40  ? -9.064  -1.143  -0.739  1.00 0.00 ? 40  LEU A HA   1  
ATOM 623   H HB2  . LEU A 1 40  ? -9.900  0.156   1.842   1.00 0.00 ? 40  LEU A HB2  1  
ATOM 624   H HB3  . LEU A 1 40  ? -8.220  -0.207  1.501   1.00 0.00 ? 40  LEU A HB3  1  
ATOM 625   H HG   . LEU A 1 40  ? -8.339  1.200   -0.537  1.00 0.00 ? 40  LEU A HG   1  
ATOM 626   H HD11 . LEU A 1 40  ? -11.198 1.270   0.190   1.00 0.00 ? 40  LEU A HD11 1  
ATOM 627   H HD12 . LEU A 1 40  ? -10.495 2.834   -0.289  1.00 0.00 ? 40  LEU A HD12 1  
ATOM 628   H HD13 . LEU A 1 40  ? -10.402 1.440   -1.393  1.00 0.00 ? 40  LEU A HD13 1  
ATOM 629   H HD21 . LEU A 1 40  ? -7.521  2.115   1.589   1.00 0.00 ? 40  LEU A HD21 1  
ATOM 630   H HD22 . LEU A 1 40  ? -8.341  3.351   0.605   1.00 0.00 ? 40  LEU A HD22 1  
ATOM 631   H HD23 . LEU A 1 40  ? -9.175  2.629   2.002   1.00 0.00 ? 40  LEU A HD23 1  
ATOM 632   N N    . VAL A 1 41  ? -10.000 -2.775  1.977   1.00 0.00 ? 41  VAL A N    1  
ATOM 633   C CA   . VAL A 1 41  ? -9.819  -4.012  2.716   1.00 0.00 ? 41  VAL A CA   1  
ATOM 634   C C    . VAL A 1 41  ? -11.186 -4.639  2.997   1.00 0.00 ? 41  VAL A C    1  
ATOM 635   O O    . VAL A 1 41  ? -12.182 -3.930  3.129   1.00 0.00 ? 41  VAL A O    1  
ATOM 636   C CB   . VAL A 1 41  ? -9.009  -3.749  3.988   1.00 0.00 ? 41  VAL A CB   1  
ATOM 637   C CG1  . VAL A 1 41  ? -7.699  -3.028  3.664   1.00 0.00 ? 41  VAL A CG1  1  
ATOM 638   C CG2  . VAL A 1 41  ? -9.832  -2.958  5.007   1.00 0.00 ? 41  VAL A CG2  1  
ATOM 639   H H    . VAL A 1 41  ? -10.670 -2.144  2.367   1.00 0.00 ? 41  VAL A H    1  
ATOM 640   H HA   . VAL A 1 41  ? -9.244  -4.691  2.086   1.00 0.00 ? 41  VAL A HA   1  
ATOM 641   H HB   . VAL A 1 41  ? -8.761  -4.712  4.433   1.00 0.00 ? 41  VAL A HB   1  
ATOM 642   H HG11 . VAL A 1 41  ? -7.516  -3.072  2.590   1.00 0.00 ? 41  VAL A HG11 1  
ATOM 643   H HG12 . VAL A 1 41  ? -7.769  -1.987  3.979   1.00 0.00 ? 41  VAL A HG12 1  
ATOM 644   H HG13 . VAL A 1 41  ? -6.878  -3.513  4.192   1.00 0.00 ? 41  VAL A HG13 1  
ATOM 645   H HG21 . VAL A 1 41  ? -10.802 -3.437  5.140   1.00 0.00 ? 41  VAL A HG21 1  
ATOM 646   H HG22 . VAL A 1 41  ? -9.304  -2.936  5.961   1.00 0.00 ? 41  VAL A HG22 1  
ATOM 647   H HG23 . VAL A 1 41  ? -9.976  -1.940  4.647   1.00 0.00 ? 41  VAL A HG23 1  
ATOM 648   N N    . ARG A 1 42  ? -11.190 -5.961  3.081   1.00 0.00 ? 42  ARG A N    1  
ATOM 649   C CA   . ARG A 1 42  ? -12.418 -6.691  3.343   1.00 0.00 ? 42  ARG A CA   1  
ATOM 650   C C    . ARG A 1 42  ? -12.212 -7.681  4.491   1.00 0.00 ? 42  ARG A C    1  
ATOM 651   O O    . ARG A 1 42  ? -11.269 -8.470  4.473   1.00 0.00 ? 42  ARG A O    1  
ATOM 652   C CB   . ARG A 1 42  ? -12.884 -7.452  2.100   1.00 0.00 ? 42  ARG A CB   1  
ATOM 653   C CG   . ARG A 1 42  ? -13.954 -6.662  1.343   1.00 0.00 ? 42  ARG A CG   1  
ATOM 654   C CD   . ARG A 1 42  ? -13.328 -5.519  0.542   1.00 0.00 ? 42  ARG A CD   1  
ATOM 655   N NE   . ARG A 1 42  ? -13.322 -5.855  -0.899  1.00 0.00 ? 42  ARG A NE   1  
ATOM 656   C CZ   . ARG A 1 42  ? -12.296 -6.444  -1.529  1.00 0.00 ? 42  ARG A CZ   1  
ATOM 657   N NH1  . ARG A 1 42  ? -11.188 -6.765  -0.849  1.00 0.00 ? 42  ARG A NH1  1  
ATOM 658   N NH2  . ARG A 1 42  ? -12.379 -6.711  -2.840  1.00 0.00 ? 42  ARG A NH2  1  
ATOM 659   H H    . ARG A 1 42  ? -10.375 -6.531  2.972   1.00 0.00 ? 42  ARG A H    1  
ATOM 660   H HA   . ARG A 1 42  ? -13.145 -5.925  3.612   1.00 0.00 ? 42  ARG A HA   1  
ATOM 661   H HB2  . ARG A 1 42  ? -12.033 -7.639  1.444   1.00 0.00 ? 42  ARG A HB2  1  
ATOM 662   H HB3  . ARG A 1 42  ? -13.282 -8.423  2.392   1.00 0.00 ? 42  ARG A HB3  1  
ATOM 663   H HG2  . ARG A 1 42  ? -14.495 -7.329  0.671   1.00 0.00 ? 42  ARG A HG2  1  
ATOM 664   H HG3  . ARG A 1 42  ? -14.682 -6.261  2.048   1.00 0.00 ? 42  ARG A HG3  1  
ATOM 665   H HD2  . ARG A 1 42  ? -13.888 -4.599  0.707   1.00 0.00 ? 42  ARG A HD2  1  
ATOM 666   H HD3  . ARG A 1 42  ? -12.310 -5.338  0.886   1.00 0.00 ? 42  ARG A HD3  1  
ATOM 667   H HE   . ARG A 1 42  ? -14.134 -5.628  -1.437  1.00 0.00 ? 42  ARG A HE   1  
ATOM 668   H HH11 . ARG A 1 42  ? -11.126 -6.566  0.129   1.00 0.00 ? 42  ARG A HH11 1  
ATOM 669   H HH12 . ARG A 1 42  ? -10.422 -7.205  -1.319  1.00 0.00 ? 42  ARG A HH12 1  
ATOM 670   H HH21 . ARG A 1 42  ? -13.207 -6.470  -3.348  1.00 0.00 ? 42  ARG A HH21 1  
ATOM 671   H HH22 . ARG A 1 42  ? -11.614 -7.150  -3.310  1.00 0.00 ? 42  ARG A HH22 1  
ATOM 672   N N    . GLU A 1 43  ? -13.111 -7.608  5.462   1.00 0.00 ? 43  GLU A N    1  
ATOM 673   C CA   . GLU A 1 43  ? -13.039 -8.488  6.616   1.00 0.00 ? 43  GLU A CA   1  
ATOM 674   C C    . GLU A 1 43  ? -13.392 -9.921  6.213   1.00 0.00 ? 43  GLU A C    1  
ATOM 675   O O    . GLU A 1 43  ? -14.451 -10.165 5.637   1.00 0.00 ? 43  GLU A O    1  
ATOM 676   C CB   . GLU A 1 43  ? -13.952 -7.994  7.740   1.00 0.00 ? 43  GLU A CB   1  
ATOM 677   C CG   . GLU A 1 43  ? -13.739 -8.808  9.018   1.00 0.00 ? 43  GLU A CG   1  
ATOM 678   C CD   . GLU A 1 43  ? -14.650 -10.037 9.044   1.00 0.00 ? 43  GLU A CD   1  
ATOM 679   O OE1  . GLU A 1 43  ? -15.865 -9.838  9.264   1.00 0.00 ? 43  GLU A OE1  1  
ATOM 680   O OE2  . GLU A 1 43  ? -14.112 -11.147 8.842   1.00 0.00 ? 43  GLU A OE2  1  
ATOM 681   H H    . GLU A 1 43  ? -13.875 -6.963  5.469   1.00 0.00 ? 43  GLU A H    1  
ATOM 682   H HA   . GLU A 1 43  ? -12.003 -8.442  6.952   1.00 0.00 ? 43  GLU A HA   1  
ATOM 683   H HB2  . GLU A 1 43  ? -13.754 -6.941  7.938   1.00 0.00 ? 43  GLU A HB2  1  
ATOM 684   H HB3  . GLU A 1 43  ? -14.994 -8.068  7.427   1.00 0.00 ? 43  GLU A HB3  1  
ATOM 685   H HG2  . GLU A 1 43  ? -12.697 -9.122  9.083   1.00 0.00 ? 43  GLU A HG2  1  
ATOM 686   H HG3  . GLU A 1 43  ? -13.939 -8.184  9.889   1.00 0.00 ? 43  GLU A HG3  1  
ATOM 687   N N    . GLY A 1 44  ? -12.484 -10.832 6.532   1.00 0.00 ? 44  GLY A N    1  
ATOM 688   C CA   . GLY A 1 44  ? -12.685 -12.234 6.210   1.00 0.00 ? 44  GLY A CA   1  
ATOM 689   C C    . GLY A 1 44  ? -11.927 -12.620 4.938   1.00 0.00 ? 44  GLY A C    1  
ATOM 690   O O    . GLY A 1 44  ? -11.493 -13.761 4.792   1.00 0.00 ? 44  GLY A O    1  
ATOM 691   H H    . GLY A 1 44  ? -11.625 -10.625 7.000   1.00 0.00 ? 44  GLY A H    1  
ATOM 692   H HA2  . GLY A 1 44  ? -12.348 -12.854 7.041   1.00 0.00 ? 44  GLY A HA2  1  
ATOM 693   H HA3  . GLY A 1 44  ? -13.749 -12.431 6.077   1.00 0.00 ? 44  GLY A HA3  1  
ATOM 694   N N    . ASP A 1 45  ? -11.791 -11.646 4.051   1.00 0.00 ? 45  ASP A N    1  
ATOM 695   C CA   . ASP A 1 45  ? -11.092 -11.868 2.796   1.00 0.00 ? 45  ASP A CA   1  
ATOM 696   C C    . ASP A 1 45  ? -9.599  -11.603 2.995   1.00 0.00 ? 45  ASP A C    1  
ATOM 697   O O    . ASP A 1 45  ? -9.207  -10.907 3.931   1.00 0.00 ? 45  ASP A O    1  
ATOM 698   C CB   . ASP A 1 45  ? -11.600 -10.921 1.707   1.00 0.00 ? 45  ASP A CB   1  
ATOM 699   C CG   . ASP A 1 45  ? -13.115 -10.708 1.691   1.00 0.00 ? 45  ASP A CG   1  
ATOM 700   O OD1  . ASP A 1 45  ? -13.769 -11.213 2.629   1.00 0.00 ? 45  ASP A OD1  1  
ATOM 701   O OD2  . ASP A 1 45  ? -13.585 -10.045 0.741   1.00 0.00 ? 45  ASP A OD2  1  
ATOM 702   H H    . ASP A 1 45  ? -12.147 -10.720 4.177   1.00 0.00 ? 45  ASP A H    1  
ATOM 703   H HA   . ASP A 1 45  ? -11.300 -12.906 2.533   1.00 0.00 ? 45  ASP A HA   1  
ATOM 704   H HB2  . ASP A 1 45  ? -11.113 -9.954  1.832   1.00 0.00 ? 45  ASP A HB2  1  
ATOM 705   H HB3  . ASP A 1 45  ? -11.293 -11.310 0.736   1.00 0.00 ? 45  ASP A HB3  1  
ATOM 706   N N    . PRO A 1 46  ? -8.784  -12.186 2.075   1.00 0.00 ? 46  PRO A N    1  
ATOM 707   C CA   . PRO A 1 46  ? -7.342  -12.019 2.140   1.00 0.00 ? 46  PRO A CA   1  
ATOM 708   C C    . PRO A 1 46  ? -6.930  -10.622 1.671   1.00 0.00 ? 46  PRO A C    1  
ATOM 709   O O    . PRO A 1 46  ? -7.735  -9.896  1.090   1.00 0.00 ? 46  PRO A O    1  
ATOM 710   C CB   . PRO A 1 46  ? -6.778  -13.129 1.268   1.00 0.00 ? 46  PRO A CB   1  
ATOM 711   C CG   . PRO A 1 46  ? -7.924  -13.585 0.381   1.00 0.00 ? 46  PRO A CG   1  
ATOM 712   C CD   . PRO A 1 46  ? -9.212  -13.016 0.953   1.00 0.00 ? 46  PRO A CD   1  
ATOM 713   H HA   . PRO A 1 46  ? -7.026  -12.094 3.086   1.00 0.00 ? 46  PRO A HA   1  
ATOM 714   H HB2  . PRO A 1 46  ? -5.940  -12.769 0.671   1.00 0.00 ? 46  PRO A HB2  1  
ATOM 715   H HB3  . PRO A 1 46  ? -6.404  -13.952 1.877   1.00 0.00 ? 46  PRO A HB3  1  
ATOM 716   H HG2  . PRO A 1 46  ? -7.776  -13.240 -0.642  1.00 0.00 ? 46  PRO A HG2  1  
ATOM 717   H HG3  . PRO A 1 46  ? -7.970  -14.674 0.346   1.00 0.00 ? 46  PRO A HG3  1  
ATOM 718   H HD2  . PRO A 1 46  ? -9.751  -12.429 0.209   1.00 0.00 ? 46  PRO A HD2  1  
ATOM 719   H HD3  . PRO A 1 46  ? -9.884  -13.809 1.281   1.00 0.00 ? 46  PRO A HD3  1  
ATOM 720   N N    . VAL A 1 47  ? -5.676  -10.288 1.940   1.00 0.00 ? 47  VAL A N    1  
ATOM 721   C CA   . VAL A 1 47  ? -5.147  -8.992  1.552   1.00 0.00 ? 47  VAL A CA   1  
ATOM 722   C C    . VAL A 1 47  ? -4.016  -9.189  0.541   1.00 0.00 ? 47  VAL A C    1  
ATOM 723   O O    . VAL A 1 47  ? -3.022  -9.849  0.837   1.00 0.00 ? 47  VAL A O    1  
ATOM 724   C CB   . VAL A 1 47  ? -4.710  -8.213  2.794   1.00 0.00 ? 47  VAL A CB   1  
ATOM 725   C CG1  . VAL A 1 47  ? -4.316  -6.779  2.432   1.00 0.00 ? 47  VAL A CG1  1  
ATOM 726   C CG2  . VAL A 1 47  ? -5.804  -8.227  3.864   1.00 0.00 ? 47  VAL A CG2  1  
ATOM 727   H H    . VAL A 1 47  ? -5.028  -10.885 2.412   1.00 0.00 ? 47  VAL A H    1  
ATOM 728   H HA   . VAL A 1 47  ? -5.954  -8.438  1.073   1.00 0.00 ? 47  VAL A HA   1  
ATOM 729   H HB   . VAL A 1 47  ? -3.831  -8.707  3.208   1.00 0.00 ? 47  VAL A HB   1  
ATOM 730   H HG11 . VAL A 1 47  ? -4.754  -6.515  1.469   1.00 0.00 ? 47  VAL A HG11 1  
ATOM 731   H HG12 . VAL A 1 47  ? -4.684  -6.097  3.198   1.00 0.00 ? 47  VAL A HG12 1  
ATOM 732   H HG13 . VAL A 1 47  ? -3.231  -6.705  2.370   1.00 0.00 ? 47  VAL A HG13 1  
ATOM 733   H HG21 . VAL A 1 47  ? -5.370  -7.970  4.830   1.00 0.00 ? 47  VAL A HG21 1  
ATOM 734   H HG22 . VAL A 1 47  ? -6.574  -7.499  3.606   1.00 0.00 ? 47  VAL A HG22 1  
ATOM 735   H HG23 . VAL A 1 47  ? -6.247  -9.221  3.917   1.00 0.00 ? 47  VAL A HG23 1  
ATOM 736   N N    . ASN A 1 48  ? -4.206  -8.603  -0.632  1.00 0.00 ? 48  ASN A N    1  
ATOM 737   C CA   . ASN A 1 48  ? -3.214  -8.706  -1.689  1.00 0.00 ? 48  ASN A CA   1  
ATOM 738   C C    . ASN A 1 48  ? -2.208  -7.562  -1.551  1.00 0.00 ? 48  ASN A C    1  
ATOM 739   O O    . ASN A 1 48  ? -1.004  -7.768  -1.697  1.00 0.00 ? 48  ASN A O    1  
ATOM 740   C CB   . ASN A 1 48  ? -3.866  -8.598  -3.069  1.00 0.00 ? 48  ASN A CB   1  
ATOM 741   C CG   . ASN A 1 48  ? -3.161  -9.504  -4.081  1.00 0.00 ? 48  ASN A CG   1  
ATOM 742   O OD1  . ASN A 1 48  ? -1.998  -9.845  -3.942  1.00 0.00 ? 48  ASN A OD1  1  
ATOM 743   N ND2  . ASN A 1 48  ? -3.928  -9.872  -5.103  1.00 0.00 ? 48  ASN A ND2  1  
ATOM 744   H H    . ASN A 1 48  ? -5.018  -8.067  -0.865  1.00 0.00 ? 48  ASN A H    1  
ATOM 745   H HA   . ASN A 1 48  ? -2.754  -9.685  -1.555  1.00 0.00 ? 48  ASN A HA   1  
ATOM 746   H HB2  . ASN A 1 48  ? -4.918  -8.873  -3.000  1.00 0.00 ? 48  ASN A HB2  1  
ATOM 747   H HB3  . ASN A 1 48  ? -3.829  -7.564  -3.413  1.00 0.00 ? 48  ASN A HB3  1  
ATOM 748   H HD21 . ASN A 1 48  ? -4.875  -9.557  -5.157  1.00 0.00 ? 48  ASN A HD21 1  
ATOM 749   H HD22 . ASN A 1 48  ? -3.557  -10.465 -5.818  1.00 0.00 ? 48  ASN A HD22 1  
ATOM 750   N N    . GLU A 1 49  ? -2.738  -6.380  -1.271  1.00 0.00 ? 49  GLU A N    1  
ATOM 751   C CA   . GLU A 1 49  ? -1.901  -5.203  -1.112  1.00 0.00 ? 49  GLU A CA   1  
ATOM 752   C C    . GLU A 1 49  ? -2.478  -4.284  -0.033  1.00 0.00 ? 49  GLU A C    1  
ATOM 753   O O    . GLU A 1 49  ? -3.681  -4.298  0.221   1.00 0.00 ? 49  GLU A O    1  
ATOM 754   C CB   . GLU A 1 49  ? -1.743  -4.459  -2.439  1.00 0.00 ? 49  GLU A CB   1  
ATOM 755   C CG   . GLU A 1 49  ? -3.099  -3.987  -2.968  1.00 0.00 ? 49  GLU A CG   1  
ATOM 756   C CD   . GLU A 1 49  ? -3.941  -5.169  -3.453  1.00 0.00 ? 49  GLU A CD   1  
ATOM 757   O OE1  . GLU A 1 49  ? -3.636  -5.666  -4.558  1.00 0.00 ? 49  GLU A OE1  1  
ATOM 758   O OE2  . GLU A 1 49  ? -4.869  -5.549  -2.707  1.00 0.00 ? 49  GLU A OE2  1  
ATOM 759   H H    . GLU A 1 49  ? -3.718  -6.221  -1.154  1.00 0.00 ? 49  GLU A H    1  
ATOM 760   H HA   . GLU A 1 49  ? -0.929  -5.580  -0.796  1.00 0.00 ? 49  GLU A HA   1  
ATOM 761   H HB2  . GLU A 1 49  ? -1.084  -3.602  -2.304  1.00 0.00 ? 49  GLU A HB2  1  
ATOM 762   H HB3  . GLU A 1 49  ? -1.271  -5.112  -3.173  1.00 0.00 ? 49  GLU A HB3  1  
ATOM 763   H HG2  . GLU A 1 49  ? -3.634  -3.453  -2.182  1.00 0.00 ? 49  GLU A HG2  1  
ATOM 764   H HG3  . GLU A 1 49  ? -2.950  -3.282  -3.786  1.00 0.00 ? 49  GLU A HG3  1  
ATOM 765   N N    . MET A 1 50  ? -1.592  -3.506  0.572   1.00 0.00 ? 50  MET A N    1  
ATOM 766   C CA   . MET A 1 50  ? -1.998  -2.583  1.618   1.00 0.00 ? 50  MET A CA   1  
ATOM 767   C C    . MET A 1 50  ? -2.136  -1.161  1.070   1.00 0.00 ? 50  MET A C    1  
ATOM 768   O O    . MET A 1 50  ? -1.441  -0.785  0.127   1.00 0.00 ? 50  MET A O    1  
ATOM 769   C CB   . MET A 1 50  ? -0.962  -2.598  2.743   1.00 0.00 ? 50  MET A CB   1  
ATOM 770   C CG   . MET A 1 50  ? -1.364  -1.646  3.872   1.00 0.00 ? 50  MET A CG   1  
ATOM 771   S SD   . MET A 1 50  ? -0.928  -2.354  5.451   1.00 0.00 ? 50  MET A SD   1  
ATOM 772   C CE   . MET A 1 50  ? -0.482  -0.872  6.342   1.00 0.00 ? 50  MET A CE   1  
ATOM 773   H H    . MET A 1 50  ? -0.615  -3.501  0.359   1.00 0.00 ? 50  MET A H    1  
ATOM 774   H HA   . MET A 1 50  ? -2.967  -2.941  1.965   1.00 0.00 ? 50  MET A HA   1  
ATOM 775   H HB2  . MET A 1 50  ? -0.861  -3.610  3.135   1.00 0.00 ? 50  MET A HB2  1  
ATOM 776   H HB3  . MET A 1 50  ? 0.013   -2.310  2.349   1.00 0.00 ? 50  MET A HB3  1  
ATOM 777   H HG2  . MET A 1 50  ? -0.865  -0.686  3.744   1.00 0.00 ? 50  MET A HG2  1  
ATOM 778   H HG3  . MET A 1 50  ? -2.437  -1.455  3.833   1.00 0.00 ? 50  MET A HG3  1  
ATOM 779   H HE1  . MET A 1 50  ? -0.759  -0.981  7.391   1.00 0.00 ? 50  MET A HE1  1  
ATOM 780   H HE2  . MET A 1 50  ? 0.593   -0.711  6.265   1.00 0.00 ? 50  MET A HE2  1  
ATOM 781   H HE3  . MET A 1 50  ? -1.009  -0.019  5.914   1.00 0.00 ? 50  MET A HE3  1  
ATOM 782   N N    . LEU A 1 51  ? -3.037  -0.409  1.684   1.00 0.00 ? 51  LEU A N    1  
ATOM 783   C CA   . LEU A 1 51  ? -3.275  0.963   1.270   1.00 0.00 ? 51  LEU A CA   1  
ATOM 784   C C    . LEU A 1 51  ? -2.966  1.904   2.436   1.00 0.00 ? 51  LEU A C    1  
ATOM 785   O O    . LEU A 1 51  ? -3.587  1.812   3.494   1.00 0.00 ? 51  LEU A O    1  
ATOM 786   C CB   . LEU A 1 51  ? -4.692  1.117   0.714   1.00 0.00 ? 51  LEU A CB   1  
ATOM 787   C CG   . LEU A 1 51  ? -5.011  0.308   -0.544  1.00 0.00 ? 51  LEU A CG   1  
ATOM 788   C CD1  . LEU A 1 51  ? -3.854  0.370   -1.544  1.00 0.00 ? 51  LEU A CD1  1  
ATOM 789   C CD2  . LEU A 1 51  ? -5.384  -1.133  -0.189  1.00 0.00 ? 51  LEU A CD2  1  
ATOM 790   H H    . LEU A 1 51  ? -3.598  -0.722  2.451   1.00 0.00 ? 51  LEU A H    1  
ATOM 791   H HA   . LEU A 1 51  ? -2.584  1.183   0.456   1.00 0.00 ? 51  LEU A HA   1  
ATOM 792   H HB2  . LEU A 1 51  ? -5.399  0.834   1.494   1.00 0.00 ? 51  LEU A HB2  1  
ATOM 793   H HB3  . LEU A 1 51  ? -4.863  2.172   0.497   1.00 0.00 ? 51  LEU A HB3  1  
ATOM 794   H HG   . LEU A 1 51  ? -5.879  0.755   -1.028  1.00 0.00 ? 51  LEU A HG   1  
ATOM 795   H HD11 . LEU A 1 51  ? -4.241  0.245   -2.555  1.00 0.00 ? 51  LEU A HD11 1  
ATOM 796   H HD12 . LEU A 1 51  ? -3.356  1.337   -1.463  1.00 0.00 ? 51  LEU A HD12 1  
ATOM 797   H HD13 . LEU A 1 51  ? -3.142  -0.425  -1.326  1.00 0.00 ? 51  LEU A HD13 1  
ATOM 798   H HD21 . LEU A 1 51  ? -4.999  -1.807  -0.955  1.00 0.00 ? 51  LEU A HD21 1  
ATOM 799   H HD22 . LEU A 1 51  ? -4.950  -1.394  0.776   1.00 0.00 ? 51  LEU A HD22 1  
ATOM 800   H HD23 . LEU A 1 51  ? -6.469  -1.225  -0.136  1.00 0.00 ? 51  LEU A HD23 1  
ATOM 801   N N    . PHE A 1 52  ? -2.007  2.788   2.204   1.00 0.00 ? 52  PHE A N    1  
ATOM 802   C CA   . PHE A 1 52  ? -1.608  3.745   3.222   1.00 0.00 ? 52  PHE A CA   1  
ATOM 803   C C    . PHE A 1 52  ? -2.301  5.093   3.009   1.00 0.00 ? 52  PHE A C    1  
ATOM 804   O O    . PHE A 1 52  ? -1.932  5.850   2.112   1.00 0.00 ? 52  PHE A O    1  
ATOM 805   C CB   . PHE A 1 52  ? -0.096  3.936   3.089   1.00 0.00 ? 52  PHE A CB   1  
ATOM 806   C CG   . PHE A 1 52  ? 0.723   2.699   3.465   1.00 0.00 ? 52  PHE A CG   1  
ATOM 807   C CD1  . PHE A 1 52  ? 0.891   2.367   4.773   1.00 0.00 ? 52  PHE A CD1  1  
ATOM 808   C CD2  . PHE A 1 52  ? 1.283   1.932   2.492   1.00 0.00 ? 52  PHE A CD2  1  
ATOM 809   C CE1  . PHE A 1 52  ? 1.651   1.220   5.123   1.00 0.00 ? 52  PHE A CE1  1  
ATOM 810   C CE2  . PHE A 1 52  ? 2.042   0.785   2.841   1.00 0.00 ? 52  PHE A CE2  1  
ATOM 811   C CZ   . PHE A 1 52  ? 2.210   0.453   4.149   1.00 0.00 ? 52  PHE A CZ   1  
ATOM 812   H H    . PHE A 1 52  ? -1.506  2.856   1.341   1.00 0.00 ? 52  PHE A H    1  
ATOM 813   H HA   . PHE A 1 52  ? -1.906  3.334   4.186   1.00 0.00 ? 52  PHE A HA   1  
ATOM 814   H HB2  . PHE A 1 52  ? 0.136   4.213   2.060   1.00 0.00 ? 52  PHE A HB2  1  
ATOM 815   H HB3  . PHE A 1 52  ? 0.212   4.769   3.721   1.00 0.00 ? 52  PHE A HB3  1  
ATOM 816   H HD1  . PHE A 1 52  ? 0.442   2.982   5.554   1.00 0.00 ? 52  PHE A HD1  1  
ATOM 817   H HD2  . PHE A 1 52  ? 1.148   2.198   1.443   1.00 0.00 ? 52  PHE A HD2  1  
ATOM 818   H HE1  . PHE A 1 52  ? 1.785   0.954   6.171   1.00 0.00 ? 52  PHE A HE1  1  
ATOM 819   H HE2  . PHE A 1 52  ? 2.491   0.170   2.061   1.00 0.00 ? 52  PHE A HE2  1  
ATOM 820   H HZ   . PHE A 1 52  ? 2.794   -0.428  4.417   1.00 0.00 ? 52  PHE A HZ   1  
ATOM 821   N N    . ILE A 1 53  ? -3.292  5.351   3.848   1.00 0.00 ? 53  ILE A N    1  
ATOM 822   C CA   . ILE A 1 53  ? -4.040  6.594   3.763   1.00 0.00 ? 53  ILE A CA   1  
ATOM 823   C C    . ILE A 1 53  ? -3.079  7.774   3.919   1.00 0.00 ? 53  ILE A C    1  
ATOM 824   O O    . ILE A 1 53  ? -2.428  7.917   4.953   1.00 0.00 ? 53  ILE A O    1  
ATOM 825   C CB   . ILE A 1 53  ? -5.188  6.599   4.775   1.00 0.00 ? 53  ILE A CB   1  
ATOM 826   C CG1  . ILE A 1 53  ? -6.203  5.499   4.457   1.00 0.00 ? 53  ILE A CG1  1  
ATOM 827   C CG2  . ILE A 1 53  ? -5.844  7.979   4.853   1.00 0.00 ? 53  ILE A CG2  1  
ATOM 828   C CD1  . ILE A 1 53  ? -6.535  5.473   2.963   1.00 0.00 ? 53  ILE A CD1  1  
ATOM 829   H H    . ILE A 1 53  ? -3.586  4.730   4.575   1.00 0.00 ? 53  ILE A H    1  
ATOM 830   H HA   . ILE A 1 53  ? -4.486  6.640   2.770   1.00 0.00 ? 53  ILE A HA   1  
ATOM 831   H HB   . ILE A 1 53  ? -4.776  6.382   5.760   1.00 0.00 ? 53  ILE A HB   1  
ATOM 832   H HG12 . ILE A 1 53  ? -5.804  4.532   4.761   1.00 0.00 ? 53  ILE A HG12 1  
ATOM 833   H HG13 . ILE A 1 53  ? -7.114  5.663   5.032   1.00 0.00 ? 53  ILE A HG13 1  
ATOM 834   H HG21 . ILE A 1 53  ? -5.265  8.691   4.264   1.00 0.00 ? 53  ILE A HG21 1  
ATOM 835   H HG22 . ILE A 1 53  ? -6.859  7.922   4.458   1.00 0.00 ? 53  ILE A HG22 1  
ATOM 836   H HG23 . ILE A 1 53  ? -5.877  8.308   5.891   1.00 0.00 ? 53  ILE A HG23 1  
ATOM 837   H HD11 . ILE A 1 53  ? -6.629  6.494   2.595   1.00 0.00 ? 53  ILE A HD11 1  
ATOM 838   H HD12 . ILE A 1 53  ? -5.737  4.964   2.423   1.00 0.00 ? 53  ILE A HD12 1  
ATOM 839   H HD13 . ILE A 1 53  ? -7.474  4.943   2.809   1.00 0.00 ? 53  ILE A HD13 1  
ATOM 840   N N    . ILE A 1 54  ? -3.020  8.590   2.877   1.00 0.00 ? 54  ILE A N    1  
ATOM 841   C CA   . ILE A 1 54  ? -2.149  9.753   2.885   1.00 0.00 ? 54  ILE A CA   1  
ATOM 842   C C    . ILE A 1 54  ? -2.959  10.988  3.286   1.00 0.00 ? 54  ILE A C    1  
ATOM 843   O O    . ILE A 1 54  ? -2.543  11.751  4.156   1.00 0.00 ? 54  ILE A O    1  
ATOM 844   C CB   . ILE A 1 54  ? -1.435  9.897   1.539   1.00 0.00 ? 54  ILE A CB   1  
ATOM 845   C CG1  . ILE A 1 54  ? -0.752  8.587   1.139   1.00 0.00 ? 54  ILE A CG1  1  
ATOM 846   C CG2  . ILE A 1 54  ? -0.454  11.070  1.562   1.00 0.00 ? 54  ILE A CG2  1  
ATOM 847   C CD1  . ILE A 1 54  ? 0.419   8.272   2.070   1.00 0.00 ? 54  ILE A CD1  1  
ATOM 848   H H    . ILE A 1 54  ? -3.553  8.467   2.040   1.00 0.00 ? 54  ILE A H    1  
ATOM 849   H HA   . ILE A 1 54  ? -1.383  9.582   3.640   1.00 0.00 ? 54  ILE A HA   1  
ATOM 850   H HB   . ILE A 1 54  ? -2.182  10.116  0.777   1.00 0.00 ? 54  ILE A HB   1  
ATOM 851   H HG12 . ILE A 1 54  ? -1.475  7.772   1.169   1.00 0.00 ? 54  ILE A HG12 1  
ATOM 852   H HG13 . ILE A 1 54  ? -0.396  8.658   0.111   1.00 0.00 ? 54  ILE A HG13 1  
ATOM 853   H HG21 . ILE A 1 54  ? -0.687  11.723  2.404   1.00 0.00 ? 54  ILE A HG21 1  
ATOM 854   H HG22 . ILE A 1 54  ? 0.563   10.692  1.666   1.00 0.00 ? 54  ILE A HG22 1  
ATOM 855   H HG23 . ILE A 1 54  ? -0.539  11.633  0.632   1.00 0.00 ? 54  ILE A HG23 1  
ATOM 856   H HD11 . ILE A 1 54  ? 0.493   9.044   2.836   1.00 0.00 ? 54  ILE A HD11 1  
ATOM 857   H HD12 . ILE A 1 54  ? 0.256   7.304   2.545   1.00 0.00 ? 54  ILE A HD12 1  
ATOM 858   H HD13 . ILE A 1 54  ? 1.344   8.242   1.494   1.00 0.00 ? 54  ILE A HD13 1  
ATOM 859   N N    . ARG A 1 55  ? -4.100  11.147  2.632   1.00 0.00 ? 55  ARG A N    1  
ATOM 860   C CA   . ARG A 1 55  ? -4.971  12.276  2.909   1.00 0.00 ? 55  ARG A CA   1  
ATOM 861   C C    . ARG A 1 55  ? -6.321  12.087  2.215   1.00 0.00 ? 55  ARG A C    1  
ATOM 862   O O    . ARG A 1 55  ? -6.413  12.180  0.992   1.00 0.00 ? 55  ARG A O    1  
ATOM 863   C CB   . ARG A 1 55  ? -4.341  13.587  2.436   1.00 0.00 ? 55  ARG A CB   1  
ATOM 864   C CG   . ARG A 1 55  ? -4.026  14.503  3.620   1.00 0.00 ? 55  ARG A CG   1  
ATOM 865   C CD   . ARG A 1 55  ? -4.079  15.975  3.205   1.00 0.00 ? 55  ARG A CD   1  
ATOM 866   N NE   . ARG A 1 55  ? -4.921  16.738  4.153   1.00 0.00 ? 55  ARG A NE   1  
ATOM 867   C CZ   . ARG A 1 55  ? -4.842  18.065  4.327   1.00 0.00 ? 55  ARG A CZ   1  
ATOM 868   N NH1  . ARG A 1 55  ? -3.959  18.782  3.620   1.00 0.00 ? 55  ARG A NH1  1  
ATOM 869   N NH2  . ARG A 1 55  ? -5.645  18.673  5.210   1.00 0.00 ? 55  ARG A NH2  1  
ATOM 870   H H    . ARG A 1 55  ? -4.431  10.521  1.925   1.00 0.00 ? 55  ARG A H    1  
ATOM 871   H HA   . ARG A 1 55  ? -5.084  12.280  3.993   1.00 0.00 ? 55  ARG A HA   1  
ATOM 872   H HB2  . ARG A 1 55  ? -3.426  13.376  1.882   1.00 0.00 ? 55  ARG A HB2  1  
ATOM 873   H HB3  . ARG A 1 55  ? -5.019  14.094  1.749   1.00 0.00 ? 55  ARG A HB3  1  
ATOM 874   H HG2  . ARG A 1 55  ? -4.740  14.323  4.424   1.00 0.00 ? 55  ARG A HG2  1  
ATOM 875   H HG3  . ARG A 1 55  ? -3.037  14.268  4.014   1.00 0.00 ? 55  ARG A HG3  1  
ATOM 876   H HD2  . ARG A 1 55  ? -3.073  16.391  3.182   1.00 0.00 ? 55  ARG A HD2  1  
ATOM 877   H HD3  . ARG A 1 55  ? -4.483  16.062  2.196   1.00 0.00 ? 55  ARG A HD3  1  
ATOM 878   H HE   . ARG A 1 55  ? -5.590  16.233  4.697   1.00 0.00 ? 55  ARG A HE   1  
ATOM 879   H HH11 . ARG A 1 55  ? -3.359  18.328  2.961   1.00 0.00 ? 55  ARG A HH11 1  
ATOM 880   H HH12 . ARG A 1 55  ? -3.899  19.772  3.750   1.00 0.00 ? 55  ARG A HH12 1  
ATOM 881   H HH21 . ARG A 1 55  ? -6.304  18.138  5.739   1.00 0.00 ? 55  ARG A HH21 1  
ATOM 882   H HH22 . ARG A 1 55  ? -5.586  19.663  5.341   1.00 0.00 ? 55  ARG A HH22 1  
ATOM 883   N N    . GLY A 1 56  ? -7.336  11.827  3.026   1.00 0.00 ? 56  GLY A N    1  
ATOM 884   C CA   . GLY A 1 56  ? -8.678  11.625  2.506   1.00 0.00 ? 56  GLY A CA   1  
ATOM 885   C C    . GLY A 1 56  ? -9.634  11.177  3.613   1.00 0.00 ? 56  GLY A C    1  
ATOM 886   O O    . GLY A 1 56  ? -9.389  11.434  4.791   1.00 0.00 ? 56  GLY A O    1  
ATOM 887   H H    . GLY A 1 56  ? -7.253  11.753  4.020   1.00 0.00 ? 56  GLY A H    1  
ATOM 888   H HA2  . GLY A 1 56  ? -9.041  12.550  2.058   1.00 0.00 ? 56  GLY A HA2  1  
ATOM 889   H HA3  . GLY A 1 56  ? -8.655  10.875  1.714   1.00 0.00 ? 56  GLY A HA3  1  
ATOM 890   N N    . ARG A 1 57  ? -10.703 10.514  3.195   1.00 0.00 ? 57  ARG A N    1  
ATOM 891   C CA   . ARG A 1 57  ? -11.697 10.028  4.137   1.00 0.00 ? 57  ARG A CA   1  
ATOM 892   C C    . ARG A 1 57  ? -12.170 8.630   3.735   1.00 0.00 ? 57  ARG A C    1  
ATOM 893   O O    . ARG A 1 57  ? -12.004 8.221   2.587   1.00 0.00 ? 57  ARG A O    1  
ATOM 894   C CB   . ARG A 1 57  ? -12.902 10.969  4.200   1.00 0.00 ? 57  ARG A CB   1  
ATOM 895   C CG   . ARG A 1 57  ? -12.692 12.060  5.252   1.00 0.00 ? 57  ARG A CG   1  
ATOM 896   C CD   . ARG A 1 57  ? -13.705 11.927  6.390   1.00 0.00 ? 57  ARG A CD   1  
ATOM 897   N NE   . ARG A 1 57  ? -14.528 13.153  6.481   1.00 0.00 ? 57  ARG A NE   1  
ATOM 898   C CZ   . ARG A 1 57  ? -14.129 14.283  7.082   1.00 0.00 ? 57  ARG A CZ   1  
ATOM 899   N NH1  . ARG A 1 57  ? -12.916 14.348  7.649   1.00 0.00 ? 57  ARG A NH1  1  
ATOM 900   N NH2  . ARG A 1 57  ? -14.943 15.347  7.117   1.00 0.00 ? 57  ARG A NH2  1  
ATOM 901   H H    . ARG A 1 57  ? -10.894 10.309  2.236   1.00 0.00 ? 57  ARG A H    1  
ATOM 902   H HA   . ARG A 1 57  ? -11.183 10.007  5.098   1.00 0.00 ? 57  ARG A HA   1  
ATOM 903   H HB2  . ARG A 1 57  ? -13.063 11.426  3.223   1.00 0.00 ? 57  ARG A HB2  1  
ATOM 904   H HB3  . ARG A 1 57  ? -13.801 10.399  4.436   1.00 0.00 ? 57  ARG A HB3  1  
ATOM 905   H HG2  . ARG A 1 57  ? -11.680 11.995  5.651   1.00 0.00 ? 57  ARG A HG2  1  
ATOM 906   H HG3  . ARG A 1 57  ? -12.789 13.041  4.787   1.00 0.00 ? 57  ARG A HG3  1  
ATOM 907   H HD2  . ARG A 1 57  ? -14.346 11.061  6.219   1.00 0.00 ? 57  ARG A HD2  1  
ATOM 908   H HD3  . ARG A 1 57  ? -13.186 11.757  7.333   1.00 0.00 ? 57  ARG A HD3  1  
ATOM 909   H HE   . ARG A 1 57  ? -15.439 13.139  6.069   1.00 0.00 ? 57  ARG A HE   1  
ATOM 910   H HH11 . ARG A 1 57  ? -12.309 13.553  7.623   1.00 0.00 ? 57  ARG A HH11 1  
ATOM 911   H HH12 . ARG A 1 57  ? -12.619 15.190  8.097   1.00 0.00 ? 57  ARG A HH12 1  
ATOM 912   H HH21 . ARG A 1 57  ? -15.848 15.298  6.694   1.00 0.00 ? 57  ARG A HH21 1  
ATOM 913   H HH22 . ARG A 1 57  ? -14.645 16.190  7.566   1.00 0.00 ? 57  ARG A HH22 1  
ATOM 914   N N    . LEU A 1 58  ? -12.750 7.935   4.703   1.00 0.00 ? 58  LEU A N    1  
ATOM 915   C CA   . LEU A 1 58  ? -13.248 6.591   4.464   1.00 0.00 ? 58  LEU A CA   1  
ATOM 916   C C    . LEU A 1 58  ? -14.258 6.225   5.553   1.00 0.00 ? 58  LEU A C    1  
ATOM 917   O O    . LEU A 1 58  ? -14.413 6.955   6.532   1.00 0.00 ? 58  LEU A O    1  
ATOM 918   C CB   . LEU A 1 58  ? -12.087 5.603   4.344   1.00 0.00 ? 58  LEU A CB   1  
ATOM 919   C CG   . LEU A 1 58  ? -11.321 5.624   3.020   1.00 0.00 ? 58  LEU A CG   1  
ATOM 920   C CD1  . LEU A 1 58  ? -10.077 6.510   3.121   1.00 0.00 ? 58  LEU A CD1  1  
ATOM 921   C CD2  . LEU A 1 58  ? -10.978 4.205   2.562   1.00 0.00 ? 58  LEU A CD2  1  
ATOM 922   H H    . LEU A 1 58  ? -12.881 8.275   5.634   1.00 0.00 ? 58  LEU A H    1  
ATOM 923   H HA   . LEU A 1 58  ? -13.764 6.600   3.503   1.00 0.00 ? 58  LEU A HA   1  
ATOM 924   H HB2  . LEU A 1 58  ? -11.382 5.801   5.152   1.00 0.00 ? 58  LEU A HB2  1  
ATOM 925   H HB3  . LEU A 1 58  ? -12.475 4.596   4.500   1.00 0.00 ? 58  LEU A HB3  1  
ATOM 926   H HG   . LEU A 1 58  ? -11.967 6.062   2.259   1.00 0.00 ? 58  LEU A HG   1  
ATOM 927   H HD11 . LEU A 1 58  ? -10.161 7.156   3.995   1.00 0.00 ? 58  LEU A HD11 1  
ATOM 928   H HD12 . LEU A 1 58  ? -9.191  5.882   3.216   1.00 0.00 ? 58  LEU A HD12 1  
ATOM 929   H HD13 . LEU A 1 58  ? -9.994  7.122   2.223   1.00 0.00 ? 58  LEU A HD13 1  
ATOM 930   H HD21 . LEU A 1 58  ? -10.454 4.249   1.607   1.00 0.00 ? 58  LEU A HD21 1  
ATOM 931   H HD22 . LEU A 1 58  ? -10.341 3.727   3.305   1.00 0.00 ? 58  LEU A HD22 1  
ATOM 932   H HD23 . LEU A 1 58  ? -11.897 3.630   2.445   1.00 0.00 ? 58  LEU A HD23 1  
ATOM 933   N N    . GLU A 1 59  ? -14.919 5.096   5.347   1.00 0.00 ? 59  GLU A N    1  
ATOM 934   C CA   . GLU A 1 59  ? -15.910 4.624   6.300   1.00 0.00 ? 59  GLU A CA   1  
ATOM 935   C C    . GLU A 1 59  ? -15.615 3.177   6.700   1.00 0.00 ? 59  GLU A C    1  
ATOM 936   O O    . GLU A 1 59  ? -15.395 2.325   5.841   1.00 0.00 ? 59  GLU A O    1  
ATOM 937   C CB   . GLU A 1 59  ? -17.324 4.759   5.732   1.00 0.00 ? 59  GLU A CB   1  
ATOM 938   C CG   . GLU A 1 59  ? -17.661 3.583   4.814   1.00 0.00 ? 59  GLU A CG   1  
ATOM 939   C CD   . GLU A 1 59  ? -19.110 3.663   4.329   1.00 0.00 ? 59  GLU A CD   1  
ATOM 940   O OE1  . GLU A 1 59  ? -19.901 4.344   5.016   1.00 0.00 ? 59  GLU A OE1  1  
ATOM 941   O OE2  . GLU A 1 59  ? -19.393 3.041   3.282   1.00 0.00 ? 59  GLU A OE2  1  
ATOM 942   H H    . GLU A 1 59  ? -14.788 4.508   4.549   1.00 0.00 ? 59  GLU A H    1  
ATOM 943   H HA   . GLU A 1 59  ? -15.810 5.276   7.168   1.00 0.00 ? 59  GLU A HA   1  
ATOM 944   H HB2  . GLU A 1 59  ? -18.045 4.805   6.549   1.00 0.00 ? 59  GLU A HB2  1  
ATOM 945   H HB3  . GLU A 1 59  ? -17.410 5.694   5.178   1.00 0.00 ? 59  GLU A HB3  1  
ATOM 946   H HG2  . GLU A 1 59  ? -16.987 3.581   3.957   1.00 0.00 ? 59  GLU A HG2  1  
ATOM 947   H HG3  . GLU A 1 59  ? -17.503 2.645   5.346   1.00 0.00 ? 59  GLU A HG3  1  
ATOM 948   N N    . SER A 1 60  ? -15.621 2.944   8.004   1.00 0.00 ? 60  SER A N    1  
ATOM 949   C CA   . SER A 1 60  ? -15.357 1.615   8.528   1.00 0.00 ? 60  SER A CA   1  
ATOM 950   C C    . SER A 1 60  ? -16.674 0.920   8.879   1.00 0.00 ? 60  SER A C    1  
ATOM 951   O O    . SER A 1 60  ? -17.524 1.497   9.554   1.00 0.00 ? 60  SER A O    1  
ATOM 952   C CB   . SER A 1 60  ? -14.447 1.678   9.756   1.00 0.00 ? 60  SER A CB   1  
ATOM 953   O OG   . SER A 1 60  ? -14.952 0.898   10.836  1.00 0.00 ? 60  SER A OG   1  
ATOM 954   H H    . SER A 1 60  ? -15.801 3.643   8.696   1.00 0.00 ? 60  SER A H    1  
ATOM 955   H HA   . SER A 1 60  ? -14.846 1.084   7.725   1.00 0.00 ? 60  SER A HA   1  
ATOM 956   H HB2  . SER A 1 60  ? -13.451 1.323   9.488   1.00 0.00 ? 60  SER A HB2  1  
ATOM 957   H HB3  . SER A 1 60  ? -14.340 2.714   10.076  1.00 0.00 ? 60  SER A HB3  1  
ATOM 958   H HG   . SER A 1 60  ? -15.146 -0.033  10.525  1.00 0.00 ? 60  SER A HG   1  
ATOM 959   N N    . VAL A 1 61  ? -16.802 -0.311  8.403   1.00 0.00 ? 61  VAL A N    1  
ATOM 960   C CA   . VAL A 1 61  ? -18.001 -1.091  8.658   1.00 0.00 ? 61  VAL A CA   1  
ATOM 961   C C    . VAL A 1 61  ? -17.604 -2.520  9.032   1.00 0.00 ? 61  VAL A C    1  
ATOM 962   O O    . VAL A 1 61  ? -16.629 -3.055  8.507   1.00 0.00 ? 61  VAL A O    1  
ATOM 963   C CB   . VAL A 1 61  ? -18.934 -1.027  7.447   1.00 0.00 ? 61  VAL A CB   1  
ATOM 964   C CG1  . VAL A 1 61  ? -19.819 -2.273  7.371   1.00 0.00 ? 61  VAL A CG1  1  
ATOM 965   C CG2  . VAL A 1 61  ? -19.781 0.247   7.474   1.00 0.00 ? 61  VAL A CG2  1  
ATOM 966   H H    . VAL A 1 61  ? -16.105 -0.773  7.854   1.00 0.00 ? 61  VAL A H    1  
ATOM 967   H HA   . VAL A 1 61  ? -18.515 -0.636  9.505   1.00 0.00 ? 61  VAL A HA   1  
ATOM 968   H HB   . VAL A 1 61  ? -18.316 -0.999  6.549   1.00 0.00 ? 61  VAL A HB   1  
ATOM 969   H HG11 . VAL A 1 61  ? -20.470 -2.203  6.499   1.00 0.00 ? 61  VAL A HG11 1  
ATOM 970   H HG12 . VAL A 1 61  ? -19.191 -3.160  7.285   1.00 0.00 ? 61  VAL A HG12 1  
ATOM 971   H HG13 . VAL A 1 61  ? -20.426 -2.343  8.273   1.00 0.00 ? 61  VAL A HG13 1  
ATOM 972   H HG21 . VAL A 1 61  ? -20.188 0.433   6.481   1.00 0.00 ? 61  VAL A HG21 1  
ATOM 973   H HG22 . VAL A 1 61  ? -20.598 0.124   8.185   1.00 0.00 ? 61  VAL A HG22 1  
ATOM 974   H HG23 . VAL A 1 61  ? -19.160 1.090   7.777   1.00 0.00 ? 61  VAL A HG23 1  
ATOM 975   N N    . THR A 1 62  ? -18.380 -3.098  9.937   1.00 0.00 ? 62  THR A N    1  
ATOM 976   C CA   . THR A 1 62  ? -18.122 -4.455  10.388  1.00 0.00 ? 62  THR A CA   1  
ATOM 977   C C    . THR A 1 62  ? -19.342 -5.343  10.134  1.00 0.00 ? 62  THR A C    1  
ATOM 978   O O    . THR A 1 62  ? -20.448 -4.842  9.939   1.00 0.00 ? 62  THR A O    1  
ATOM 979   C CB   . THR A 1 62  ? -17.711 -4.394  11.860  1.00 0.00 ? 62  THR A CB   1  
ATOM 980   O OG1  . THR A 1 62  ? -17.397 -5.745  12.189  1.00 0.00 ? 62  THR A OG1  1  
ATOM 981   C CG2  . THR A 1 62  ? -18.882 -4.049  12.782  1.00 0.00 ? 62  THR A CG2  1  
ATOM 982   H H    . THR A 1 62  ? -19.171 -2.656  10.360  1.00 0.00 ? 62  THR A H    1  
ATOM 983   H HA   . THR A 1 62  ? -17.301 -4.863  9.797   1.00 0.00 ? 62  THR A HA   1  
ATOM 984   H HB   . THR A 1 62  ? -16.883 -3.699  12.005  1.00 0.00 ? 62  THR A HB   1  
ATOM 985   H HG1  . THR A 1 62  ? -18.223 -6.307  12.149  1.00 0.00 ? 62  THR A HG1  1  
ATOM 986   H HG21 . THR A 1 62  ? -19.814 -4.094  12.217  1.00 0.00 ? 62  THR A HG21 1  
ATOM 987   H HG22 . THR A 1 62  ? -18.920 -4.763  13.604  1.00 0.00 ? 62  THR A HG22 1  
ATOM 988   H HG23 . THR A 1 62  ? -18.747 -3.043  13.180  1.00 0.00 ? 62  THR A HG23 1  
ATOM 989   N N    . THR A 1 63  ? -19.099 -6.645  10.144  1.00 0.00 ? 63  THR A N    1  
ATOM 990   C CA   . THR A 1 63  ? -20.164 -7.607  9.918   1.00 0.00 ? 63  THR A CA   1  
ATOM 991   C C    . THR A 1 63  ? -20.273 -8.571  11.101  1.00 0.00 ? 63  THR A C    1  
ATOM 992   O O    . THR A 1 63  ? -21.358 -8.770  11.646  1.00 0.00 ? 63  THR A O    1  
ATOM 993   C CB   . THR A 1 63  ? -19.892 -8.309  8.586   1.00 0.00 ? 63  THR A CB   1  
ATOM 994   O OG1  . THR A 1 63  ? -18.597 -8.880  8.752   1.00 0.00 ? 63  THR A OG1  1  
ATOM 995   C CG2  . THR A 1 63  ? -19.718 -7.322  7.429   1.00 0.00 ? 63  THR A CG2  1  
ATOM 996   H H    . THR A 1 63  ? -18.196 -7.044  10.304  1.00 0.00 ? 63  THR A H    1  
ATOM 997   H HA   . THR A 1 63  ? -21.108 -7.066  9.858   1.00 0.00 ? 63  THR A HA   1  
ATOM 998   H HB   . THR A 1 63  ? -20.671 -9.037  8.363   1.00 0.00 ? 63  THR A HB   1  
ATOM 999   H HG1  . THR A 1 63  ? -17.900 -8.162  8.723   1.00 0.00 ? 63  THR A HG1  1  
ATOM 1000  H HG21 . THR A 1 63  ? -18.862 -7.620  6.823   1.00 0.00 ? 63  THR A HG21 1  
ATOM 1001  H HG22 . THR A 1 63  ? -20.617 -7.323  6.812   1.00 0.00 ? 63  THR A HG22 1  
ATOM 1002  H HG23 . THR A 1 63  ? -19.551 -6.321  7.827   1.00 0.00 ? 63  THR A HG23 1  
ATOM 1003  N N    . ASP A 1 64  ? -19.135 -9.143  11.464  1.00 0.00 ? 64  ASP A N    1  
ATOM 1004  C CA   . ASP A 1 64  ? -19.088 -10.081 12.573  1.00 0.00 ? 64  ASP A CA   1  
ATOM 1005  C C    . ASP A 1 64  ? -19.224 -9.314  13.890  1.00 0.00 ? 64  ASP A C    1  
ATOM 1006  O O    . ASP A 1 64  ? -18.644 -8.241  14.050  1.00 0.00 ? 64  ASP A O    1  
ATOM 1007  C CB   . ASP A 1 64  ? -17.758 -10.836 12.600  1.00 0.00 ? 64  ASP A CB   1  
ATOM 1008  C CG   . ASP A 1 64  ? -17.685 -11.980 13.613  1.00 0.00 ? 64  ASP A CG   1  
ATOM 1009  O OD1  . ASP A 1 64  ? -18.457 -12.947 13.434  1.00 0.00 ? 64  ASP A OD1  1  
ATOM 1010  O OD2  . ASP A 1 64  ? -16.859 -11.862 14.544  1.00 0.00 ? 64  ASP A OD2  1  
ATOM 1011  H H    . ASP A 1 64  ? -18.257 -8.975  11.015  1.00 0.00 ? 64  ASP A H    1  
ATOM 1012  H HA   . ASP A 1 64  ? -19.918 -10.767 12.402  1.00 0.00 ? 64  ASP A HA   1  
ATOM 1013  H HB2  . ASP A 1 64  ? -17.565 -11.238 11.606  1.00 0.00 ? 64  ASP A HB2  1  
ATOM 1014  H HB3  . ASP A 1 64  ? -16.959 -10.127 12.818  1.00 0.00 ? 64  ASP A HB3  1  
ATOM 1015  N N    . GLY A 1 65  ? -19.994 -9.894  14.798  1.00 0.00 ? 65  GLY A N    1  
ATOM 1016  C CA   . GLY A 1 65  ? -20.214 -9.279  16.096  1.00 0.00 ? 65  GLY A CA   1  
ATOM 1017  C C    . GLY A 1 65  ? -21.200 -8.114  15.991  1.00 0.00 ? 65  GLY A C    1  
ATOM 1018  O O    . GLY A 1 65  ? -22.296 -8.271  15.453  1.00 0.00 ? 65  GLY A O    1  
ATOM 1019  H H    . GLY A 1 65  ? -20.463 -10.767 14.660  1.00 0.00 ? 65  GLY A H    1  
ATOM 1020  H HA2  . GLY A 1 65  ? -20.596 -10.023 16.795  1.00 0.00 ? 65  GLY A HA2  1  
ATOM 1021  H HA3  . GLY A 1 65  ? -19.266 -8.922  16.498  1.00 0.00 ? 65  GLY A HA3  1  
ATOM 1022  N N    . GLY A 1 66  ? -20.777 -6.973  16.514  1.00 0.00 ? 66  GLY A N    1  
ATOM 1023  C CA   . GLY A 1 66  ? -21.610 -5.782  16.485  1.00 0.00 ? 66  GLY A CA   1  
ATOM 1024  C C    . GLY A 1 66  ? -22.391 -5.628  17.792  1.00 0.00 ? 66  GLY A C    1  
ATOM 1025  O O    . GLY A 1 66  ? -22.203 -6.406  18.727  1.00 0.00 ? 66  GLY A O    1  
ATOM 1026  H H    . GLY A 1 66  ? -19.885 -6.854  16.950  1.00 0.00 ? 66  GLY A H    1  
ATOM 1027  H HA2  . GLY A 1 66  ? -20.987 -4.902  16.324  1.00 0.00 ? 66  GLY A HA2  1  
ATOM 1028  H HA3  . GLY A 1 66  ? -22.304 -5.840  15.647  1.00 0.00 ? 66  GLY A HA3  1  
ATOM 1029  N N    . ARG A 1 67  ? -23.249 -4.620  17.816  1.00 0.00 ? 67  ARG A N    1  
ATOM 1030  C CA   . ARG A 1 67  ? -24.059 -4.353  18.992  1.00 0.00 ? 67  ARG A CA   1  
ATOM 1031  C C    . ARG A 1 67  ? -25.152 -3.334  18.665  1.00 0.00 ? 67  ARG A C    1  
ATOM 1032  O O    . ARG A 1 67  ? -24.900 -2.351  17.970  1.00 0.00 ? 67  ARG A O    1  
ATOM 1033  C CB   . ARG A 1 67  ? -23.202 -3.821  20.142  1.00 0.00 ? 67  ARG A CB   1  
ATOM 1034  C CG   . ARG A 1 67  ? -23.987 -3.816  21.455  1.00 0.00 ? 67  ARG A CG   1  
ATOM 1035  C CD   . ARG A 1 67  ? -23.456 -2.743  22.408  1.00 0.00 ? 67  ARG A CD   1  
ATOM 1036  N NE   . ARG A 1 67  ? -23.915 -3.019  23.787  1.00 0.00 ? 67  ARG A NE   1  
ATOM 1037  C CZ   . ARG A 1 67  ? -25.168 -2.818  24.217  1.00 0.00 ? 67  ARG A CZ   1  
ATOM 1038  N NH1  . ARG A 1 67  ? -26.095 -2.337  23.377  1.00 0.00 ? 67  ARG A NH1  1  
ATOM 1039  N NH2  . ARG A 1 67  ? -25.494 -3.096  25.486  1.00 0.00 ? 67  ARG A NH2  1  
ATOM 1040  H H    . ARG A 1 67  ? -23.396 -3.992  17.051  1.00 0.00 ? 67  ARG A H    1  
ATOM 1041  H HA   . ARG A 1 67  ? -24.491 -5.319  19.258  1.00 0.00 ? 67  ARG A HA   1  
ATOM 1042  H HB2  . ARG A 1 67  ? -22.309 -4.437  20.251  1.00 0.00 ? 67  ARG A HB2  1  
ATOM 1043  H HB3  . ARG A 1 67  ? -22.865 -2.810  19.912  1.00 0.00 ? 67  ARG A HB3  1  
ATOM 1044  H HG2  . ARG A 1 67  ? -25.043 -3.636  21.251  1.00 0.00 ? 67  ARG A HG2  1  
ATOM 1045  H HG3  . ARG A 1 67  ? -23.917 -4.795  21.929  1.00 0.00 ? 67  ARG A HG3  1  
ATOM 1046  H HD2  . ARG A 1 67  ? -22.367 -2.722  22.375  1.00 0.00 ? 67  ARG A HD2  1  
ATOM 1047  H HD3  . ARG A 1 67  ? -23.803 -1.759  22.090  1.00 0.00 ? 67  ARG A HD3  1  
ATOM 1048  H HE   . ARG A 1 67  ? -23.248 -3.378  24.440  1.00 0.00 ? 67  ARG A HE   1  
ATOM 1049  H HH11 . ARG A 1 67  ? -25.852 -2.129  22.430  1.00 0.00 ? 67  ARG A HH11 1  
ATOM 1050  H HH12 . ARG A 1 67  ? -27.030 -2.187  23.698  1.00 0.00 ? 67  ARG A HH12 1  
ATOM 1051  H HH21 . ARG A 1 67  ? -24.802 -3.455  26.113  1.00 0.00 ? 67  ARG A HH21 1  
ATOM 1052  H HH22 . ARG A 1 67  ? -26.429 -2.946  25.807  1.00 0.00 ? 67  ARG A HH22 1  
ATOM 1053  N N    . SER A 1 68  ? -26.342 -3.603  19.182  1.00 0.00 ? 68  SER A N    1  
ATOM 1054  C CA   . SER A 1 68  ? -27.474 -2.721  18.953  1.00 0.00 ? 68  SER A CA   1  
ATOM 1055  C C    . SER A 1 68  ? -27.660 -2.486  17.453  1.00 0.00 ? 68  SER A C    1  
ATOM 1056  O O    . SER A 1 68  ? -27.036 -1.595  16.879  1.00 0.00 ? 68  SER A O    1  
ATOM 1057  C CB   . SER A 1 68  ? -27.289 -1.387  19.680  1.00 0.00 ? 68  SER A CB   1  
ATOM 1058  O OG   . SER A 1 68  ? -27.826 -1.419  21.000  1.00 0.00 ? 68  SER A OG   1  
ATOM 1059  H H    . SER A 1 68  ? -26.538 -4.404  19.746  1.00 0.00 ? 68  SER A H    1  
ATOM 1060  H HA   . SER A 1 68  ? -28.335 -3.243  19.369  1.00 0.00 ? 68  SER A HA   1  
ATOM 1061  H HB2  . SER A 1 68  ? -26.227 -1.144  19.727  1.00 0.00 ? 68  SER A HB2  1  
ATOM 1062  H HB3  . SER A 1 68  ? -27.772 -0.594  19.111  1.00 0.00 ? 68  SER A HB3  1  
ATOM 1063  H HG   . SER A 1 68  ? -28.493 -2.160  21.079  1.00 0.00 ? 68  SER A HG   1  
ATOM 1064  N N    . GLY A 1 69  ? -28.520 -3.301  16.861  1.00 0.00 ? 69  GLY A N    1  
ATOM 1065  C CA   . GLY A 1 69  ? -28.796 -3.193  15.439  1.00 0.00 ? 69  GLY A CA   1  
ATOM 1066  C C    . GLY A 1 69  ? -27.912 -4.149  14.635  1.00 0.00 ? 69  GLY A C    1  
ATOM 1067  O O    . GLY A 1 69  ? -27.741 -5.307  15.011  1.00 0.00 ? 69  GLY A O    1  
ATOM 1068  H H    . GLY A 1 69  ? -29.023 -4.023  17.336  1.00 0.00 ? 69  GLY A H    1  
ATOM 1069  H HA2  . GLY A 1 69  ? -29.846 -3.418  15.250  1.00 0.00 ? 69  GLY A HA2  1  
ATOM 1070  H HA3  . GLY A 1 69  ? -28.625 -2.169  15.108  1.00 0.00 ? 69  GLY A HA3  1  
ATOM 1071  N N    . PHE A 1 70  ? -27.373 -3.628  13.542  1.00 0.00 ? 70  PHE A N    1  
ATOM 1072  C CA   . PHE A 1 70  ? -26.511 -4.420  12.682  1.00 0.00 ? 70  PHE A CA   1  
ATOM 1073  C C    . PHE A 1 70  ? -25.490 -3.535  11.964  1.00 0.00 ? 70  PHE A C    1  
ATOM 1074  O O    . PHE A 1 70  ? -25.738 -2.351  11.740  1.00 0.00 ? 70  PHE A O    1  
ATOM 1075  C CB   . PHE A 1 70  ? -27.411 -5.088  11.640  1.00 0.00 ? 70  PHE A CB   1  
ATOM 1076  C CG   . PHE A 1 70  ? -27.612 -6.589  11.862  1.00 0.00 ? 70  PHE A CG   1  
ATOM 1077  C CD1  . PHE A 1 70  ? -26.669 -7.472  11.436  1.00 0.00 ? 70  PHE A CD1  1  
ATOM 1078  C CD2  . PHE A 1 70  ? -28.733 -7.039  12.486  1.00 0.00 ? 70  PHE A CD2  1  
ATOM 1079  C CE1  . PHE A 1 70  ? -26.856 -8.864  11.642  1.00 0.00 ? 70  PHE A CE1  1  
ATOM 1080  C CE2  . PHE A 1 70  ? -28.920 -8.432  12.693  1.00 0.00 ? 70  PHE A CE2  1  
ATOM 1081  C CZ   . PHE A 1 70  ? -27.977 -9.315  12.266  1.00 0.00 ? 70  PHE A CZ   1  
ATOM 1082  H H    . PHE A 1 70  ? -27.517 -2.685  13.243  1.00 0.00 ? 70  PHE A H    1  
ATOM 1083  H HA   . PHE A 1 70  ? -25.987 -5.134  13.318  1.00 0.00 ? 70  PHE A HA   1  
ATOM 1084  H HB2  . PHE A 1 70  ? -28.383 -4.597  11.646  1.00 0.00 ? 70  PHE A HB2  1  
ATOM 1085  H HB3  . PHE A 1 70  ? -26.981 -4.932  10.651  1.00 0.00 ? 70  PHE A HB3  1  
ATOM 1086  H HD1  . PHE A 1 70  ? -25.771 -7.110  10.936  1.00 0.00 ? 70  PHE A HD1  1  
ATOM 1087  H HD2  . PHE A 1 70  ? -29.488 -6.332  12.828  1.00 0.00 ? 70  PHE A HD2  1  
ATOM 1088  H HE1  . PHE A 1 70  ? -26.101 -9.572  11.300  1.00 0.00 ? 70  PHE A HE1  1  
ATOM 1089  H HE2  . PHE A 1 70  ? -29.818 -8.793  13.193  1.00 0.00 ? 70  PHE A HE2  1  
ATOM 1090  H HZ   . PHE A 1 70  ? -28.120 -10.384 12.424  1.00 0.00 ? 70  PHE A HZ   1  
ATOM 1091  N N    . TYR A 1 71  ? -24.363 -4.144  11.623  1.00 0.00 ? 71  TYR A N    1  
ATOM 1092  C CA   . TYR A 1 71  ? -23.304 -3.426  10.936  1.00 0.00 ? 71  TYR A CA   1  
ATOM 1093  C C    . TYR A 1 71  ? -23.002 -2.096  11.630  1.00 0.00 ? 71  TYR A C    1  
ATOM 1094  O O    . TYR A 1 71  ? -23.703 -1.108  11.419  1.00 0.00 ? 71  TYR A O    1  
ATOM 1095  C CB   . TYR A 1 71  ? -23.831 -3.143  9.527   1.00 0.00 ? 71  TYR A CB   1  
ATOM 1096  C CG   . TYR A 1 71  ? -23.727 -4.335  8.574   1.00 0.00 ? 71  TYR A CG   1  
ATOM 1097  C CD1  . TYR A 1 71  ? -24.713 -5.301  8.566   1.00 0.00 ? 71  TYR A CD1  1  
ATOM 1098  C CD2  . TYR A 1 71  ? -22.647 -4.445  7.721   1.00 0.00 ? 71  TYR A CD2  1  
ATOM 1099  C CE1  . TYR A 1 71  ? -24.616 -6.423  7.668   1.00 0.00 ? 71  TYR A CE1  1  
ATOM 1100  C CE2  . TYR A 1 71  ? -22.550 -5.567  6.823   1.00 0.00 ? 71  TYR A CE2  1  
ATOM 1101  C CZ   . TYR A 1 71  ? -23.539 -6.500  6.841   1.00 0.00 ? 71  TYR A CZ   1  
ATOM 1102  O OH   . TYR A 1 71  ? -23.447 -7.560  5.994   1.00 0.00 ? 71  TYR A OH   1  
ATOM 1103  H H    . TYR A 1 71  ? -24.170 -5.107  11.809  1.00 0.00 ? 71  TYR A H    1  
ATOM 1104  H HA   . TYR A 1 71  ? -22.409 -4.048  10.954  1.00 0.00 ? 71  TYR A HA   1  
ATOM 1105  H HB2  . TYR A 1 71  ? -24.874 -2.836  9.596   1.00 0.00 ? 71  TYR A HB2  1  
ATOM 1106  H HB3  . TYR A 1 71  ? -23.278 -2.304  9.105   1.00 0.00 ? 71  TYR A HB3  1  
ATOM 1107  H HD1  . TYR A 1 71  ? -25.566 -5.214  9.239   1.00 0.00 ? 71  TYR A HD1  1  
ATOM 1108  H HD2  . TYR A 1 71  ? -21.868 -3.683  7.727   1.00 0.00 ? 71  TYR A HD2  1  
ATOM 1109  H HE1  . TYR A 1 71  ? -25.388 -7.192  7.652   1.00 0.00 ? 71  TYR A HE1  1  
ATOM 1110  H HE2  . TYR A 1 71  ? -21.702 -5.666  6.145   1.00 0.00 ? 71  TYR A HE2  1  
ATOM 1111  H HH   . TYR A 1 71  ? -23.962 -8.335  6.358   1.00 0.00 ? 71  TYR A HH   1  
ATOM 1112  N N    . ASN A 1 72  ? -21.957 -2.115  12.445  1.00 0.00 ? 72  ASN A N    1  
ATOM 1113  C CA   . ASN A 1 72  ? -21.554 -0.923  13.172  1.00 0.00 ? 72  ASN A CA   1  
ATOM 1114  C C    . ASN A 1 72  ? -20.736 -0.020  12.247  1.00 0.00 ? 72  ASN A C    1  
ATOM 1115  O O    . ASN A 1 72  ? -19.586 -0.324  11.934  1.00 0.00 ? 72  ASN A O    1  
ATOM 1116  C CB   . ASN A 1 72  ? -20.681 -1.282  14.376  1.00 0.00 ? 72  ASN A CB   1  
ATOM 1117  C CG   . ASN A 1 72  ? -20.810 -0.230  15.480  1.00 0.00 ? 72  ASN A CG   1  
ATOM 1118  O OD1  . ASN A 1 72  ? -21.585 0.708   15.391  1.00 0.00 ? 72  ASN A OD1  1  
ATOM 1119  N ND2  . ASN A 1 72  ? -20.009 -0.438  16.521  1.00 0.00 ? 72  ASN A ND2  1  
ATOM 1120  H H    . ASN A 1 72  ? -21.392 -2.923  12.612  1.00 0.00 ? 72  ASN A H    1  
ATOM 1121  H HA   . ASN A 1 72  ? -22.484 -0.457  13.496  1.00 0.00 ? 72  ASN A HA   1  
ATOM 1122  H HB2  . ASN A 1 72  ? -20.972 -2.258  14.764  1.00 0.00 ? 72  ASN A HB2  1  
ATOM 1123  H HB3  . ASN A 1 72  ? -19.639 -1.361  14.064  1.00 0.00 ? 72  ASN A HB3  1  
ATOM 1124  H HD21 . ASN A 1 72  ? -19.396 -1.228  16.531  1.00 0.00 ? 72  ASN A HD21 1  
ATOM 1125  H HD22 . ASN A 1 72  ? -20.021 0.196   17.295  1.00 0.00 ? 72  ASN A HD22 1  
ATOM 1126  N N    . ARG A 1 73  ? -21.361 1.074   11.836  1.00 0.00 ? 73  ARG A N    1  
ATOM 1127  C CA   . ARG A 1 73  ? -20.705 2.024   10.954  1.00 0.00 ? 73  ARG A CA   1  
ATOM 1128  C C    . ARG A 1 73  ? -19.848 2.997   11.765  1.00 0.00 ? 73  ARG A C    1  
ATOM 1129  O O    . ARG A 1 73  ? -20.212 3.370   12.880  1.00 0.00 ? 73  ARG A O    1  
ATOM 1130  C CB   . ARG A 1 73  ? -21.730 2.815   10.137  1.00 0.00 ? 73  ARG A CB   1  
ATOM 1131  C CG   . ARG A 1 73  ? -21.659 2.438   8.656   1.00 0.00 ? 73  ARG A CG   1  
ATOM 1132  C CD   . ARG A 1 73  ? -22.315 3.511   7.786   1.00 0.00 ? 73  ARG A CD   1  
ATOM 1133  N NE   . ARG A 1 73  ? -23.774 3.273   7.702   1.00 0.00 ? 73  ARG A NE   1  
ATOM 1134  C CZ   . ARG A 1 73  ? -24.662 3.730   8.594   1.00 0.00 ? 73  ARG A CZ   1  
ATOM 1135  N NH1  . ARG A 1 73  ? -24.247 4.452   9.644   1.00 0.00 ? 73  ARG A NH1  1  
ATOM 1136  N NH2  . ARG A 1 73  ? -25.966 3.464   8.438   1.00 0.00 ? 73  ARG A NH2  1  
ATOM 1137  H H    . ARG A 1 73  ? -22.297 1.314   12.095  1.00 0.00 ? 73  ARG A H    1  
ATOM 1138  H HA   . ARG A 1 73  ? -20.088 1.412   10.295  1.00 0.00 ? 73  ARG A HA   1  
ATOM 1139  H HB2  . ARG A 1 73  ? -22.732 2.620   10.518  1.00 0.00 ? 73  ARG A HB2  1  
ATOM 1140  H HB3  . ARG A 1 73  ? -21.546 3.883   10.254  1.00 0.00 ? 73  ARG A HB3  1  
ATOM 1141  H HG2  . ARG A 1 73  ? -20.618 2.310   8.359   1.00 0.00 ? 73  ARG A HG2  1  
ATOM 1142  H HG3  . ARG A 1 73  ? -22.156 1.481   8.496   1.00 0.00 ? 73  ARG A HG3  1  
ATOM 1143  H HD2  . ARG A 1 73  ? -22.124 4.499   8.205   1.00 0.00 ? 73  ARG A HD2  1  
ATOM 1144  H HD3  . ARG A 1 73  ? -21.878 3.499   6.787   1.00 0.00 ? 73  ARG A HD3  1  
ATOM 1145  H HE   . ARG A 1 73  ? -24.117 2.737   6.930   1.00 0.00 ? 73  ARG A HE   1  
ATOM 1146  H HH11 . ARG A 1 73  ? -23.274 4.650   9.761   1.00 0.00 ? 73  ARG A HH11 1  
ATOM 1147  H HH12 . ARG A 1 73  ? -24.910 4.793   10.310  1.00 0.00 ? 73  ARG A HH12 1  
ATOM 1148  H HH21 . ARG A 1 73  ? -26.276 2.925   7.655   1.00 0.00 ? 73  ARG A HH21 1  
ATOM 1149  H HH22 . ARG A 1 73  ? -26.629 3.805   9.104   1.00 0.00 ? 73  ARG A HH22 1  
ATOM 1150  N N    . SER A 1 74  ? -18.726 3.382   11.174  1.00 0.00 ? 74  SER A N    1  
ATOM 1151  C CA   . SER A 1 74  ? -17.815 4.305   11.828  1.00 0.00 ? 74  SER A CA   1  
ATOM 1152  C C    . SER A 1 74  ? -16.935 4.999   10.785  1.00 0.00 ? 74  SER A C    1  
ATOM 1153  O O    . SER A 1 74  ? -16.957 4.637   9.610   1.00 0.00 ? 74  SER A O    1  
ATOM 1154  C CB   . SER A 1 74  ? -16.946 3.583   12.859  1.00 0.00 ? 74  SER A CB   1  
ATOM 1155  O OG   . SER A 1 74  ? -17.724 3.015   13.909  1.00 0.00 ? 74  SER A OG   1  
ATOM 1156  H H    . SER A 1 74  ? -18.438 3.075   10.267  1.00 0.00 ? 74  SER A H    1  
ATOM 1157  H HA   . SER A 1 74  ? -18.452 5.030   12.334  1.00 0.00 ? 74  SER A HA   1  
ATOM 1158  H HB2  . SER A 1 74  ? -16.374 2.797   12.365  1.00 0.00 ? 74  SER A HB2  1  
ATOM 1159  H HB3  . SER A 1 74  ? -16.225 4.284   13.281  1.00 0.00 ? 74  SER A HB3  1  
ATOM 1160  H HG   . SER A 1 74  ? -18.411 3.672   14.219  1.00 0.00 ? 74  SER A HG   1  
ATOM 1161  N N    . LEU A 1 75  ? -16.183 5.984   11.253  1.00 0.00 ? 75  LEU A N    1  
ATOM 1162  C CA   . LEU A 1 75  ? -15.298 6.731   10.376  1.00 0.00 ? 75  LEU A CA   1  
ATOM 1163  C C    . LEU A 1 75  ? -13.868 6.654   10.915  1.00 0.00 ? 75  LEU A C    1  
ATOM 1164  O O    . LEU A 1 75  ? -13.661 6.471   12.114  1.00 0.00 ? 75  LEU A O    1  
ATOM 1165  C CB   . LEU A 1 75  ? -15.809 8.162   10.192  1.00 0.00 ? 75  LEU A CB   1  
ATOM 1166  C CG   . LEU A 1 75  ? -15.547 8.797   8.825   1.00 0.00 ? 75  LEU A CG   1  
ATOM 1167  C CD1  . LEU A 1 75  ? -16.547 8.288   7.784   1.00 0.00 ? 75  LEU A CD1  1  
ATOM 1168  C CD2  . LEU A 1 75  ? -15.546 10.324  8.921   1.00 0.00 ? 75  LEU A CD2  1  
ATOM 1169  H H    . LEU A 1 75  ? -16.171 6.272   12.211  1.00 0.00 ? 75  LEU A H    1  
ATOM 1170  H HA   . LEU A 1 75  ? -15.325 6.251   9.398   1.00 0.00 ? 75  LEU A HA   1  
ATOM 1171  H HB2  . LEU A 1 75  ? -16.884 8.169   10.374  1.00 0.00 ? 75  LEU A HB2  1  
ATOM 1172  H HB3  . LEU A 1 75  ? -15.352 8.791   10.956  1.00 0.00 ? 75  LEU A HB3  1  
ATOM 1173  H HG   . LEU A 1 75  ? -14.554 8.494   8.492   1.00 0.00 ? 75  LEU A HG   1  
ATOM 1174  H HD11 . LEU A 1 75  ? -16.369 7.230   7.596   1.00 0.00 ? 75  LEU A HD11 1  
ATOM 1175  H HD12 . LEU A 1 75  ? -17.562 8.426   8.158   1.00 0.00 ? 75  LEU A HD12 1  
ATOM 1176  H HD13 . LEU A 1 75  ? -16.422 8.848   6.857   1.00 0.00 ? 75  LEU A HD13 1  
ATOM 1177  H HD21 . LEU A 1 75  ? -14.712 10.648  9.543   1.00 0.00 ? 75  LEU A HD21 1  
ATOM 1178  H HD22 . LEU A 1 75  ? -15.443 10.750  7.923   1.00 0.00 ? 75  LEU A HD22 1  
ATOM 1179  H HD23 . LEU A 1 75  ? -16.483 10.660  9.365   1.00 0.00 ? 75  LEU A HD23 1  
ATOM 1180  N N    . LEU A 1 76  ? -12.918 6.796   10.003  1.00 0.00 ? 76  LEU A N    1  
ATOM 1181  C CA   . LEU A 1 76  ? -11.513 6.744   10.371  1.00 0.00 ? 76  LEU A CA   1  
ATOM 1182  C C    . LEU A 1 76  ? -10.915 8.150   10.285  1.00 0.00 ? 76  LEU A C    1  
ATOM 1183  O O    . LEU A 1 76  ? -11.345 8.962   9.467   1.00 0.00 ? 76  LEU A O    1  
ATOM 1184  C CB   . LEU A 1 76  ? -10.774 5.709   9.521   1.00 0.00 ? 76  LEU A CB   1  
ATOM 1185  C CG   . LEU A 1 76  ? -11.431 4.330   9.423   1.00 0.00 ? 76  LEU A CG   1  
ATOM 1186  C CD1  . LEU A 1 76  ? -10.755 3.477   8.347   1.00 0.00 ? 76  LEU A CD1  1  
ATOM 1187  C CD2  . LEU A 1 76  ? -11.445 3.631   10.784  1.00 0.00 ? 76  LEU A CD2  1  
ATOM 1188  H H    . LEU A 1 76  ? -13.094 6.945   9.030   1.00 0.00 ? 76  LEU A H    1  
ATOM 1189  H HA   . LEU A 1 76  ? -11.459 6.409   11.407  1.00 0.00 ? 76  LEU A HA   1  
ATOM 1190  H HB2  . LEU A 1 76  ? -10.661 6.109   8.514   1.00 0.00 ? 76  LEU A HB2  1  
ATOM 1191  H HB3  . LEU A 1 76  ? -9.771  5.583   9.928   1.00 0.00 ? 76  LEU A HB3  1  
ATOM 1192  H HG   . LEU A 1 76  ? -12.469 4.467   9.120   1.00 0.00 ? 76  LEU A HG   1  
ATOM 1193  H HD11 . LEU A 1 76  ? -9.683  3.432   8.539   1.00 0.00 ? 76  LEU A HD11 1  
ATOM 1194  H HD12 . LEU A 1 76  ? -11.171 2.470   8.369   1.00 0.00 ? 76  LEU A HD12 1  
ATOM 1195  H HD13 . LEU A 1 76  ? -10.931 3.921   7.368   1.00 0.00 ? 76  LEU A HD13 1  
ATOM 1196  H HD21 . LEU A 1 76  ? -12.278 4.009   11.377  1.00 0.00 ? 76  LEU A HD21 1  
ATOM 1197  H HD22 . LEU A 1 76  ? -11.560 2.557   10.639  1.00 0.00 ? 76  LEU A HD22 1  
ATOM 1198  H HD23 . LEU A 1 76  ? -10.509 3.830   11.304  1.00 0.00 ? 76  LEU A HD23 1  
ATOM 1199  N N    . LYS A 1 77  ? -9.933  8.395   11.140  1.00 0.00 ? 77  LYS A N    1  
ATOM 1200  C CA   . LYS A 1 77  ? -9.272  9.688   11.170  1.00 0.00 ? 77  LYS A CA   1  
ATOM 1201  C C    . LYS A 1 77  ? -8.180  9.724   10.100  1.00 0.00 ? 77  LYS A C    1  
ATOM 1202  O O    . LYS A 1 77  ? -8.074  8.807   9.286   1.00 0.00 ? 77  LYS A O    1  
ATOM 1203  C CB   . LYS A 1 77  ? -8.762  9.996   12.580  1.00 0.00 ? 77  LYS A CB   1  
ATOM 1204  C CG   . LYS A 1 77  ? -7.389  9.365   12.816  1.00 0.00 ? 77  LYS A CG   1  
ATOM 1205  C CD   . LYS A 1 77  ? -6.656  10.059  13.965  1.00 0.00 ? 77  LYS A CD   1  
ATOM 1206  C CE   . LYS A 1 77  ? -6.606  11.573  13.749  1.00 0.00 ? 77  LYS A CE   1  
ATOM 1207  N NZ   . LYS A 1 77  ? -5.367  12.139  14.327  1.00 0.00 ? 77  LYS A NZ   1  
ATOM 1208  H H    . LYS A 1 77  ? -9.590  7.729   11.802  1.00 0.00 ? 77  LYS A H    1  
ATOM 1209  H HA   . LYS A 1 77  ? -10.020 10.443  10.926  1.00 0.00 ? 77  LYS A HA   1  
ATOM 1210  H HB2  . LYS A 1 77  ? -8.699  11.075  12.720  1.00 0.00 ? 77  LYS A HB2  1  
ATOM 1211  H HB3  . LYS A 1 77  ? -9.471  9.620   13.317  1.00 0.00 ? 77  LYS A HB3  1  
ATOM 1212  H HG2  . LYS A 1 77  ? -7.506  8.305   13.042  1.00 0.00 ? 77  LYS A HG2  1  
ATOM 1213  H HG3  . LYS A 1 77  ? -6.792  9.432   11.906  1.00 0.00 ? 77  LYS A HG3  1  
ATOM 1214  H HD2  . LYS A 1 77  ? -7.159  9.840   14.907  1.00 0.00 ? 77  LYS A HD2  1  
ATOM 1215  H HD3  . LYS A 1 77  ? -5.643  9.666   14.046  1.00 0.00 ? 77  LYS A HD3  1  
ATOM 1216  H HE2  . LYS A 1 77  ? -6.652  11.795  12.682  1.00 0.00 ? 77  LYS A HE2  1  
ATOM 1217  H HE3  . LYS A 1 77  ? -7.476  12.041  14.209  1.00 0.00 ? 77  LYS A HE3  1  
ATOM 1218  H HZ1  . LYS A 1 77  ? -4.574  11.666  13.944  1.00 0.00 ? 77  LYS A HZ1  1  
ATOM 1219  H HZ2  . LYS A 1 77  ? -5.312  13.113  14.108  1.00 0.00 ? 77  LYS A HZ2  1  
ATOM 1220  H HZ3  . LYS A 1 77  ? -5.378  12.021  15.320  1.00 0.00 ? 77  LYS A HZ3  1  
ATOM 1221  N N    . GLU A 1 78  ? -7.396  10.791  10.135  1.00 0.00 ? 78  GLU A N    1  
ATOM 1222  C CA   . GLU A 1 78  ? -6.316  10.958  9.177   1.00 0.00 ? 78  GLU A CA   1  
ATOM 1223  C C    . GLU A 1 78  ? -5.107  10.114  9.588   1.00 0.00 ? 78  GLU A C    1  
ATOM 1224  O O    . GLU A 1 78  ? -4.740  10.080  10.762  1.00 0.00 ? 78  GLU A O    1  
ATOM 1225  C CB   . GLU A 1 78  ? -5.932  12.432  9.034   1.00 0.00 ? 78  GLU A CB   1  
ATOM 1226  C CG   . GLU A 1 78  ? -4.540  12.579  8.417   1.00 0.00 ? 78  GLU A CG   1  
ATOM 1227  C CD   . GLU A 1 78  ? -4.516  12.039  6.985   1.00 0.00 ? 78  GLU A CD   1  
ATOM 1228  O OE1  . GLU A 1 78  ? -5.284  12.582  6.161   1.00 0.00 ? 78  GLU A OE1  1  
ATOM 1229  O OE2  . GLU A 1 78  ? -3.729  11.097  6.747   1.00 0.00 ? 78  GLU A OE2  1  
ATOM 1230  H H    . GLU A 1 78  ? -7.489  11.532  10.800  1.00 0.00 ? 78  GLU A H    1  
ATOM 1231  H HA   . GLU A 1 78  ? -6.712  10.598  8.228   1.00 0.00 ? 78  GLU A HA   1  
ATOM 1232  H HB2  . GLU A 1 78  ? -6.666  12.944  8.412   1.00 0.00 ? 78  GLU A HB2  1  
ATOM 1233  H HB3  . GLU A 1 78  ? -5.953  12.913  10.012  1.00 0.00 ? 78  GLU A HB3  1  
ATOM 1234  H HG2  . GLU A 1 78  ? -4.246  13.628  8.419   1.00 0.00 ? 78  GLU A HG2  1  
ATOM 1235  H HG3  . GLU A 1 78  ? -3.810  12.043  9.024   1.00 0.00 ? 78  GLU A HG3  1  
ATOM 1236  N N    . GLY A 1 79  ? -4.523  9.453   8.600   1.00 0.00 ? 79  GLY A N    1  
ATOM 1237  C CA   . GLY A 1 79  ? -3.364  8.612   8.844   1.00 0.00 ? 79  GLY A CA   1  
ATOM 1238  C C    . GLY A 1 79  ? -3.787  7.201   9.256   1.00 0.00 ? 79  GLY A C    1  
ATOM 1239  O O    . GLY A 1 79  ? -2.955  6.394   9.668   1.00 0.00 ? 79  GLY A O    1  
ATOM 1240  H H    . GLY A 1 79  ? -4.828  9.486   7.648   1.00 0.00 ? 79  GLY A H    1  
ATOM 1241  H HA2  . GLY A 1 79  ? -2.749  8.563   7.945   1.00 0.00 ? 79  GLY A HA2  1  
ATOM 1242  H HA3  . GLY A 1 79  ? -2.748  9.054   9.627   1.00 0.00 ? 79  GLY A HA3  1  
ATOM 1243  N N    . ASP A 1 80  ? -5.081  6.946   9.130   1.00 0.00 ? 80  ASP A N    1  
ATOM 1244  C CA   . ASP A 1 80  ? -5.626  5.646   9.484   1.00 0.00 ? 80  ASP A CA   1  
ATOM 1245  C C    . ASP A 1 80  ? -5.231  4.624   8.415   1.00 0.00 ? 80  ASP A C    1  
ATOM 1246  O O    . ASP A 1 80  ? -5.412  4.866   7.223   1.00 0.00 ? 80  ASP A O    1  
ATOM 1247  C CB   . ASP A 1 80  ? -7.153  5.689   9.555   1.00 0.00 ? 80  ASP A CB   1  
ATOM 1248  C CG   . ASP A 1 80  ? -7.866  5.642   8.202   1.00 0.00 ? 80  ASP A CG   1  
ATOM 1249  O OD1  . ASP A 1 80  ? -7.934  4.530   7.635   1.00 0.00 ? 80  ASP A OD1  1  
ATOM 1250  O OD2  . ASP A 1 80  ? -8.326  6.719   7.765   1.00 0.00 ? 80  ASP A OD2  1  
ATOM 1251  H H    . ASP A 1 80  ? -5.752  7.607   8.794   1.00 0.00 ? 80  ASP A H    1  
ATOM 1252  H HA   . ASP A 1 80  ? -5.200  5.413   10.460  1.00 0.00 ? 80  ASP A HA   1  
ATOM 1253  H HB2  . ASP A 1 80  ? -7.498  4.850   10.160  1.00 0.00 ? 80  ASP A HB2  1  
ATOM 1254  H HB3  . ASP A 1 80  ? -7.452  6.600   10.075  1.00 0.00 ? 80  ASP A HB3  1  
ATOM 1255  N N    . PHE A 1 81  ? -4.699  3.504   8.881   1.00 0.00 ? 81  PHE A N    1  
ATOM 1256  C CA   . PHE A 1 81  ? -4.278  2.445   7.980   1.00 0.00 ? 81  PHE A CA   1  
ATOM 1257  C C    . PHE A 1 81  ? -5.167  1.209   8.132   1.00 0.00 ? 81  PHE A C    1  
ATOM 1258  O O    . PHE A 1 81  ? -5.614  0.893   9.234   1.00 0.00 ? 81  PHE A O    1  
ATOM 1259  C CB   . PHE A 1 81  ? -2.843  2.075   8.364   1.00 0.00 ? 81  PHE A CB   1  
ATOM 1260  C CG   . PHE A 1 81  ? -2.584  2.069   9.872   1.00 0.00 ? 81  PHE A CG   1  
ATOM 1261  C CD1  . PHE A 1 81  ? -3.025  1.032   10.633  1.00 0.00 ? 81  PHE A CD1  1  
ATOM 1262  C CD2  . PHE A 1 81  ? -1.914  3.102   10.451  1.00 0.00 ? 81  PHE A CD2  1  
ATOM 1263  C CE1  . PHE A 1 81  ? -2.784  1.026   12.033  1.00 0.00 ? 81  PHE A CE1  1  
ATOM 1264  C CE2  . PHE A 1 81  ? -1.674  3.096   11.851  1.00 0.00 ? 81  PHE A CE2  1  
ATOM 1265  C CZ   . PHE A 1 81  ? -2.114  2.058   12.612  1.00 0.00 ? 81  PHE A CZ   1  
ATOM 1266  H H    . PHE A 1 81  ? -4.555  3.315   9.852   1.00 0.00 ? 81  PHE A H    1  
ATOM 1267  H HA   . PHE A 1 81  ? -4.365  2.830   6.964   1.00 0.00 ? 81  PHE A HA   1  
ATOM 1268  H HB2  . PHE A 1 81  ? -2.613  1.089   7.962   1.00 0.00 ? 81  PHE A HB2  1  
ATOM 1269  H HB3  . PHE A 1 81  ? -2.159  2.780   7.891   1.00 0.00 ? 81  PHE A HB3  1  
ATOM 1270  H HD1  . PHE A 1 81  ? -3.562  0.205   10.169  1.00 0.00 ? 81  PHE A HD1  1  
ATOM 1271  H HD2  . PHE A 1 81  ? -1.562  3.933   9.841   1.00 0.00 ? 81  PHE A HD2  1  
ATOM 1272  H HE1  . PHE A 1 81  ? -3.137  0.195   12.643  1.00 0.00 ? 81  PHE A HE1  1  
ATOM 1273  H HE2  . PHE A 1 81  ? -1.137  3.923   12.315  1.00 0.00 ? 81  PHE A HE2  1  
ATOM 1274  H HZ   . PHE A 1 81  ? -1.930  2.054   13.686  1.00 0.00 ? 81  PHE A HZ   1  
ATOM 1275  N N    . CYS A 1 82  ? -5.398  0.544   7.010   1.00 0.00 ? 82  CYS A N    1  
ATOM 1276  C CA   . CYS A 1 82  ? -6.227  -0.650  7.004   1.00 0.00 ? 82  CYS A CA   1  
ATOM 1277  C C    . CYS A 1 82  ? -5.340  -1.848  6.659   1.00 0.00 ? 82  CYS A C    1  
ATOM 1278  O O    . CYS A 1 82  ? -4.198  -1.678  6.235   1.00 0.00 ? 82  CYS A O    1  
ATOM 1279  C CB   . CYS A 1 82  ? -7.406  -0.515  6.038   1.00 0.00 ? 82  CYS A CB   1  
ATOM 1280  S SG   . CYS A 1 82  ? -8.479  0.875   6.551   1.00 0.00 ? 82  CYS A SG   1  
ATOM 1281  H H    . CYS A 1 82  ? -5.031  0.808   6.118   1.00 0.00 ? 82  CYS A H    1  
ATOM 1282  H HA   . CYS A 1 82  ? -6.639  -0.749  8.008   1.00 0.00 ? 82  CYS A HA   1  
ATOM 1283  H HB2  . CYS A 1 82  ? -7.040  -0.349  5.025   1.00 0.00 ? 82  CYS A HB2  1  
ATOM 1284  H HB3  . CYS A 1 82  ? -7.980  -1.442  6.021   1.00 0.00 ? 82  CYS A HB3  1  
ATOM 1285  H HG   . CYS A 1 82  ? -8.816  0.363   7.731   1.00 0.00 ? 82  CYS A HG   1  
ATOM 1286  N N    . GLY A 1 83  ? -5.900  -3.033  6.854   1.00 0.00 ? 83  GLY A N    1  
ATOM 1287  C CA   . GLY A 1 83  ? -5.174  -4.259  6.569   1.00 0.00 ? 83  GLY A CA   1  
ATOM 1288  C C    . GLY A 1 83  ? -3.720  -4.156  7.032   1.00 0.00 ? 83  GLY A C    1  
ATOM 1289  O O    . GLY A 1 83  ? -2.825  -4.727  6.411   1.00 0.00 ? 83  GLY A O    1  
ATOM 1290  H H    . GLY A 1 83  ? -6.829  -3.162  7.199   1.00 0.00 ? 83  GLY A H    1  
ATOM 1291  H HA2  . GLY A 1 83  ? -5.660  -5.098  7.067   1.00 0.00 ? 83  GLY A HA2  1  
ATOM 1292  H HA3  . GLY A 1 83  ? -5.205  -4.464  5.498   1.00 0.00 ? 83  GLY A HA3  1  
ATOM 1293  N N    . ASP A 1 84  ? -3.529  -3.424  8.120   1.00 0.00 ? 84  ASP A N    1  
ATOM 1294  C CA   . ASP A 1 84  ? -2.199  -3.239  8.674   1.00 0.00 ? 84  ASP A CA   1  
ATOM 1295  C C    . ASP A 1 84  ? -1.583  -4.606  8.977   1.00 0.00 ? 84  ASP A C    1  
ATOM 1296  O O    . ASP A 1 84  ? -0.361  -4.742  9.033   1.00 0.00 ? 84  ASP A O    1  
ATOM 1297  C CB   . ASP A 1 84  ? -2.252  -2.444  9.980   1.00 0.00 ? 84  ASP A CB   1  
ATOM 1298  C CG   . ASP A 1 84  ? -2.472  -3.283  11.239  1.00 0.00 ? 84  ASP A CG   1  
ATOM 1299  O OD1  . ASP A 1 84  ? -1.541  -4.041  11.587  1.00 0.00 ? 84  ASP A OD1  1  
ATOM 1300  O OD2  . ASP A 1 84  ? -3.568  -3.148  11.827  1.00 0.00 ? 84  ASP A OD2  1  
ATOM 1301  H H    . ASP A 1 84  ? -4.263  -2.963  8.619   1.00 0.00 ? 84  ASP A H    1  
ATOM 1302  H HA   . ASP A 1 84  ? -1.645  -2.692  7.911   1.00 0.00 ? 84  ASP A HA   1  
ATOM 1303  H HB2  . ASP A 1 84  ? -1.319  -1.890  10.089  1.00 0.00 ? 84  ASP A HB2  1  
ATOM 1304  H HB3  . ASP A 1 84  ? -3.052  -1.707  9.907   1.00 0.00 ? 84  ASP A HB3  1  
ATOM 1305  N N    . GLU A 1 85  ? -2.456  -5.584  9.166   1.00 0.00 ? 85  GLU A N    1  
ATOM 1306  C CA   . GLU A 1 85  ? -2.013  -6.936  9.462   1.00 0.00 ? 85  GLU A CA   1  
ATOM 1307  C C    . GLU A 1 85  ? -0.981  -7.395  8.430   1.00 0.00 ? 85  GLU A C    1  
ATOM 1308  O O    . GLU A 1 85  ? -0.096  -8.189  8.742   1.00 0.00 ? 85  GLU A O    1  
ATOM 1309  C CB   . GLU A 1 85  ? -3.198  -7.901  9.519   1.00 0.00 ? 85  GLU A CB   1  
ATOM 1310  C CG   . GLU A 1 85  ? -4.055  -7.645  10.761  1.00 0.00 ? 85  GLU A CG   1  
ATOM 1311  C CD   . GLU A 1 85  ? -3.704  -8.626  11.881  1.00 0.00 ? 85  GLU A CD   1  
ATOM 1312  O OE1  . GLU A 1 85  ? -2.767  -8.305  12.644  1.00 0.00 ? 85  GLU A OE1  1  
ATOM 1313  O OE2  . GLU A 1 85  ? -4.380  -9.675  11.949  1.00 0.00 ? 85  GLU A OE2  1  
ATOM 1314  H H    . GLU A 1 85  ? -3.448  -5.465  9.119   1.00 0.00 ? 85  GLU A H    1  
ATOM 1315  H HA   . GLU A 1 85  ? -1.550  -6.880  10.448  1.00 0.00 ? 85  GLU A HA   1  
ATOM 1316  H HB2  . GLU A 1 85  ? -3.808  -7.788  8.622   1.00 0.00 ? 85  GLU A HB2  1  
ATOM 1317  H HB3  . GLU A 1 85  ? -2.835  -8.929  9.529   1.00 0.00 ? 85  GLU A HB3  1  
ATOM 1318  H HG2  . GLU A 1 85  ? -3.903  -6.623  11.107  1.00 0.00 ? 85  GLU A HG2  1  
ATOM 1319  H HG3  . GLU A 1 85  ? -5.110  -7.742  10.505  1.00 0.00 ? 85  GLU A HG3  1  
ATOM 1320  N N    . LEU A 1 86  ? -1.130  -6.875  7.220   1.00 0.00 ? 86  LEU A N    1  
ATOM 1321  C CA   . LEU A 1 86  ? -0.222  -7.221  6.140   1.00 0.00 ? 86  LEU A CA   1  
ATOM 1322  C C    . LEU A 1 86  ? 1.206   -6.845  6.539   1.00 0.00 ? 86  LEU A C    1  
ATOM 1323  O O    . LEU A 1 86  ? 2.128   -7.646  6.389   1.00 0.00 ? 86  LEU A O    1  
ATOM 1324  C CB   . LEU A 1 86  ? -0.682  -6.582  4.828   1.00 0.00 ? 86  LEU A CB   1  
ATOM 1325  C CG   . LEU A 1 86  ? 0.170   -6.894  3.596   1.00 0.00 ? 86  LEU A CG   1  
ATOM 1326  C CD1  . LEU A 1 86  ? -0.063  -8.327  3.116   1.00 0.00 ? 86  LEU A CD1  1  
ATOM 1327  C CD2  . LEU A 1 86  ? -0.077  -5.870  2.486   1.00 0.00 ? 86  LEU A CD2  1  
ATOM 1328  H H    . LEU A 1 86  ? -1.853  -6.229  6.974   1.00 0.00 ? 86  LEU A H    1  
ATOM 1329  H HA   . LEU A 1 86  ? -0.270  -8.302  6.006   1.00 0.00 ? 86  LEU A HA   1  
ATOM 1330  H HB2  . LEU A 1 86  ? -1.704  -6.904  4.629   1.00 0.00 ? 86  LEU A HB2  1  
ATOM 1331  H HB3  . LEU A 1 86  ? -0.708  -5.501  4.963   1.00 0.00 ? 86  LEU A HB3  1  
ATOM 1332  H HG   . LEU A 1 86  ? 1.220   -6.816  3.877   1.00 0.00 ? 86  LEU A HG   1  
ATOM 1333  H HD11 . LEU A 1 86  ? 0.680   -8.986  3.564   1.00 0.00 ? 86  LEU A HD11 1  
ATOM 1334  H HD12 . LEU A 1 86  ? -1.061  -8.651  3.411   1.00 0.00 ? 86  LEU A HD12 1  
ATOM 1335  H HD13 . LEU A 1 86  ? 0.024   -8.366  2.030   1.00 0.00 ? 86  LEU A HD13 1  
ATOM 1336  H HD21 . LEU A 1 86  ? -1.102  -5.504  2.550   1.00 0.00 ? 86  LEU A HD21 1  
ATOM 1337  H HD22 . LEU A 1 86  ? 0.615   -5.036  2.600   1.00 0.00 ? 86  LEU A HD22 1  
ATOM 1338  H HD23 . LEU A 1 86  ? 0.080   -6.341  1.515   1.00 0.00 ? 86  LEU A HD23 1  
ATOM 1339  N N    . LEU A 1 87  ? 1.345   -5.627  7.041   1.00 0.00 ? 87  LEU A N    1  
ATOM 1340  C CA   . LEU A 1 87  ? 2.646   -5.135  7.463   1.00 0.00 ? 87  LEU A CA   1  
ATOM 1341  C C    . LEU A 1 87  ? 3.331   -6.195  8.328   1.00 0.00 ? 87  LEU A C    1  
ATOM 1342  O O    . LEU A 1 87  ? 4.478   -6.560  8.077   1.00 0.00 ? 87  LEU A O    1  
ATOM 1343  C CB   . LEU A 1 87  ? 2.507   -3.775  8.151   1.00 0.00 ? 87  LEU A CB   1  
ATOM 1344  C CG   . LEU A 1 87  ? 3.624   -2.767  7.875   1.00 0.00 ? 87  LEU A CG   1  
ATOM 1345  C CD1  . LEU A 1 87  ? 3.678   -2.402  6.390   1.00 0.00 ? 87  LEU A CD1  1  
ATOM 1346  C CD2  . LEU A 1 87  ? 3.478   -1.531  8.764   1.00 0.00 ? 87  LEU A CD2  1  
ATOM 1347  H H    . LEU A 1 87  ? 0.591   -4.982  7.159   1.00 0.00 ? 87  LEU A H    1  
ATOM 1348  H HA   . LEU A 1 87  ? 3.245   -4.982  6.565   1.00 0.00 ? 87  LEU A HA   1  
ATOM 1349  H HB2  . LEU A 1 87  ? 1.560   -3.331  7.845   1.00 0.00 ? 87  LEU A HB2  1  
ATOM 1350  H HB3  . LEU A 1 87  ? 2.450   -3.939  9.227   1.00 0.00 ? 87  LEU A HB3  1  
ATOM 1351  H HG   . LEU A 1 87  ? 4.576   -3.234  8.126   1.00 0.00 ? 87  LEU A HG   1  
ATOM 1352  H HD11 . LEU A 1 87  ? 4.364   -1.566  6.246   1.00 0.00 ? 87  LEU A HD11 1  
ATOM 1353  H HD12 . LEU A 1 87  ? 4.027   -3.261  5.817   1.00 0.00 ? 87  LEU A HD12 1  
ATOM 1354  H HD13 . LEU A 1 87  ? 2.683   -2.117  6.049   1.00 0.00 ? 87  LEU A HD13 1  
ATOM 1355  H HD21 . LEU A 1 87  ? 3.611   -1.816  9.808   1.00 0.00 ? 87  LEU A HD21 1  
ATOM 1356  H HD22 . LEU A 1 87  ? 4.234   -0.795  8.490   1.00 0.00 ? 87  LEU A HD22 1  
ATOM 1357  H HD23 . LEU A 1 87  ? 2.486   -1.100  8.629   1.00 0.00 ? 87  LEU A HD23 1  
ATOM 1358  N N    . THR A 1 88  ? 2.598   -6.660  9.329   1.00 0.00 ? 88  THR A N    1  
ATOM 1359  C CA   . THR A 1 88  ? 3.120   -7.670  10.233  1.00 0.00 ? 88  THR A CA   1  
ATOM 1360  C C    . THR A 1 88  ? 3.328   -8.992  9.492   1.00 0.00 ? 88  THR A C    1  
ATOM 1361  O O    . THR A 1 88  ? 4.344   -9.660  9.679   1.00 0.00 ? 88  THR A O    1  
ATOM 1362  C CB   . THR A 1 88  ? 2.162   -7.784  11.420  1.00 0.00 ? 88  THR A CB   1  
ATOM 1363  O OG1  . THR A 1 88  ? 2.832   -7.097  12.474  1.00 0.00 ? 88  THR A OG1  1  
ATOM 1364  C CG2  . THR A 1 88  ? 2.033   -9.219  11.934  1.00 0.00 ? 88  THR A CG2  1  
ATOM 1365  H H    . THR A 1 88  ? 1.665   -6.358  9.527   1.00 0.00 ? 88  THR A H    1  
ATOM 1366  H HA   . THR A 1 88  ? 4.099   -7.344  10.585  1.00 0.00 ? 88  THR A HA   1  
ATOM 1367  H HB   . THR A 1 88  ? 1.185   -7.369  11.173  1.00 0.00 ? 88  THR A HB   1  
ATOM 1368  H HG1  . THR A 1 88  ? 3.039   -6.160  12.194  1.00 0.00 ? 88  THR A HG1  1  
ATOM 1369  H HG21 . THR A 1 88  ? 1.455   -9.224  12.858  1.00 0.00 ? 88  THR A HG21 1  
ATOM 1370  H HG22 . THR A 1 88  ? 1.527   -9.829  11.185  1.00 0.00 ? 88  THR A HG22 1  
ATOM 1371  H HG23 . THR A 1 88  ? 3.025   -9.627  12.124  1.00 0.00 ? 88  THR A HG23 1  
ATOM 1372  N N    . TRP A 1 89  ? 2.349   -9.331  8.665   1.00 0.00 ? 89  TRP A N    1  
ATOM 1373  C CA   . TRP A 1 89  ? 2.412   -10.561 7.894   1.00 0.00 ? 89  TRP A CA   1  
ATOM 1374  C C    . TRP A 1 89  ? 3.805   -10.656 7.269   1.00 0.00 ? 89  TRP A C    1  
ATOM 1375  O O    . TRP A 1 89  ? 4.531   -11.621 7.506   1.00 0.00 ? 89  TRP A O    1  
ATOM 1376  C CB   . TRP A 1 89  ? 1.287   -10.618 6.859   1.00 0.00 ? 89  TRP A CB   1  
ATOM 1377  C CG   . TRP A 1 89  ? 1.454   -11.726 5.818   1.00 0.00 ? 89  TRP A CG   1  
ATOM 1378  C CD1  . TRP A 1 89  ? 1.056   -13.003 5.902   1.00 0.00 ? 89  TRP A CD1  1  
ATOM 1379  C CD2  . TRP A 1 89  ? 2.085   -11.604 4.526   1.00 0.00 ? 89  TRP A CD2  1  
ATOM 1380  N NE1  . TRP A 1 89  ? 1.382   -13.710 4.762   1.00 0.00 ? 89  TRP A NE1  1  
ATOM 1381  C CE2  . TRP A 1 89  ? 2.028   -12.832 3.899   1.00 0.00 ? 89  TRP A CE2  1  
ATOM 1382  C CE3  . TRP A 1 89  ? 2.684   -10.493 3.907   1.00 0.00 ? 89  TRP A CE3  1  
ATOM 1383  C CZ2  . TRP A 1 89  ? 2.551   -13.066 2.622   1.00 0.00 ? 89  TRP A CZ2  1  
ATOM 1384  C CZ3  . TRP A 1 89  ? 3.202   -10.743 2.631   1.00 0.00 ? 89  TRP A CZ3  1  
ATOM 1385  C CH2  . TRP A 1 89  ? 3.152   -11.974 1.986   1.00 0.00 ? 89  TRP A CH2  1  
ATOM 1386  H H    . TRP A 1 89  ? 1.527   -8.781  8.518   1.00 0.00 ? 89  TRP A H    1  
ATOM 1387  H HA   . TRP A 1 89  ? 2.254   -11.392 8.581   1.00 0.00 ? 89  TRP A HA   1  
ATOM 1388  H HB2  . TRP A 1 89  ? 0.338   -10.759 7.376   1.00 0.00 ? 89  TRP A HB2  1  
ATOM 1389  H HB3  . TRP A 1 89  ? 1.230   -9.658  6.346   1.00 0.00 ? 89  TRP A HB3  1  
ATOM 1390  H HD1  . TRP A 1 89  ? 0.539   -13.430 6.761   1.00 0.00 ? 89  TRP A HD1  1  
ATOM 1391  H HE1  . TRP A 1 89  ? 1.172   -14.763 4.574   1.00 0.00 ? 89  TRP A HE1  1  
ATOM 1392  H HE3  . TRP A 1 89  ? 2.742   -9.513  4.381   1.00 0.00 ? 89  TRP A HE3  1  
ATOM 1393  H HZ2  . TRP A 1 89  ? 2.493   -14.046 2.148   1.00 0.00 ? 89  TRP A HZ2  1  
ATOM 1394  H HZ3  . TRP A 1 89  ? 3.678   -9.915  2.106   1.00 0.00 ? 89  TRP A HZ3  1  
ATOM 1395  H HH2  . TRP A 1 89  ? 3.580   -12.087 0.990   1.00 0.00 ? 89  TRP A HH2  1  
ATOM 1396  N N    . ALA A 1 90  ? 4.137   -9.643  6.483   1.00 0.00 ? 90  ALA A N    1  
ATOM 1397  C CA   . ALA A 1 90  ? 5.430   -9.600  5.821   1.00 0.00 ? 90  ALA A CA   1  
ATOM 1398  C C    . ALA A 1 90  ? 6.538   -9.679  6.873   1.00 0.00 ? 90  ALA A C    1  
ATOM 1399  O O    . ALA A 1 90  ? 7.545   -10.357 6.669   1.00 0.00 ? 90  ALA A O    1  
ATOM 1400  C CB   . ALA A 1 90  ? 5.526   -8.334  4.967   1.00 0.00 ? 90  ALA A CB   1  
ATOM 1401  H H    . ALA A 1 90  ? 3.541   -8.862  6.295   1.00 0.00 ? 90  ALA A H    1  
ATOM 1402  H HA   . ALA A 1 90  ? 5.497   -10.470 5.168   1.00 0.00 ? 90  ALA A HA   1  
ATOM 1403  H HB1  . ALA A 1 90  ? 4.527   -7.930  4.803   1.00 0.00 ? 90  ALA A HB1  1  
ATOM 1404  H HB2  . ALA A 1 90  ? 6.137   -7.594  5.483   1.00 0.00 ? 90  ALA A HB2  1  
ATOM 1405  H HB3  . ALA A 1 90  ? 5.982   -8.577  4.008   1.00 0.00 ? 90  ALA A HB3  1  
ATOM 1406  N N    . LEU A 1 91  ? 6.316   -8.978  7.975   1.00 0.00 ? 91  LEU A N    1  
ATOM 1407  C CA   . LEU A 1 91  ? 7.284   -8.960  9.059   1.00 0.00 ? 91  LEU A CA   1  
ATOM 1408  C C    . LEU A 1 91  ? 7.331   -10.340 9.717   1.00 0.00 ? 91  LEU A C    1  
ATOM 1409  O O    . LEU A 1 91  ? 8.251   -10.638 10.477  1.00 0.00 ? 91  LEU A O    1  
ATOM 1410  C CB   . LEU A 1 91  ? 6.974   -7.823  10.034  1.00 0.00 ? 91  LEU A CB   1  
ATOM 1411  C CG   . LEU A 1 91  ? 7.889   -6.599  9.951   1.00 0.00 ? 91  LEU A CG   1  
ATOM 1412  C CD1  . LEU A 1 91  ? 8.351   -6.358  8.512   1.00 0.00 ? 91  LEU A CD1  1  
ATOM 1413  C CD2  . LEU A 1 91  ? 7.211   -5.366  10.550  1.00 0.00 ? 91  LEU A CD2  1  
ATOM 1414  H H    . LEU A 1 91  ? 5.495   -8.429  8.132   1.00 0.00 ? 91  LEU A H    1  
ATOM 1415  H HA   . LEU A 1 91  ? 8.260   -8.752  8.621   1.00 0.00 ? 91  LEU A HA   1  
ATOM 1416  H HB2  . LEU A 1 91  ? 5.948   -7.497  9.868   1.00 0.00 ? 91  LEU A HB2  1  
ATOM 1417  H HB3  . LEU A 1 91  ? 7.022   -8.219  11.049  1.00 0.00 ? 91  LEU A HB3  1  
ATOM 1418  H HG   . LEU A 1 91  ? 8.780   -6.798  10.546  1.00 0.00 ? 91  LEU A HG   1  
ATOM 1419  H HD11 . LEU A 1 91  ? 8.336   -5.288  8.301   1.00 0.00 ? 91  LEU A HD11 1  
ATOM 1420  H HD12 . LEU A 1 91  ? 9.364   -6.739  8.387   1.00 0.00 ? 91  LEU A HD12 1  
ATOM 1421  H HD13 . LEU A 1 91  ? 7.681   -6.874  7.824   1.00 0.00 ? 91  LEU A HD13 1  
ATOM 1422  H HD21 . LEU A 1 91  ? 7.442   -5.305  11.614  1.00 0.00 ? 91  LEU A HD21 1  
ATOM 1423  H HD22 . LEU A 1 91  ? 7.576   -4.470  10.047  1.00 0.00 ? 91  LEU A HD22 1  
ATOM 1424  H HD23 . LEU A 1 91  ? 6.132   -5.444  10.416  1.00 0.00 ? 91  LEU A HD23 1  
ATOM 1425  N N    . ASP A 1 92  ? 6.327   -11.146 9.401   1.00 0.00 ? 92  ASP A N    1  
ATOM 1426  C CA   . ASP A 1 92  ? 6.242   -12.487 9.953   1.00 0.00 ? 92  ASP A CA   1  
ATOM 1427  C C    . ASP A 1 92  ? 6.291   -13.507 8.813   1.00 0.00 ? 92  ASP A C    1  
ATOM 1428  O O    . ASP A 1 92  ? 5.272   -13.791 8.186   1.00 0.00 ? 92  ASP A O    1  
ATOM 1429  C CB   . ASP A 1 92  ? 4.929   -12.689 10.712  1.00 0.00 ? 92  ASP A CB   1  
ATOM 1430  C CG   . ASP A 1 92  ? 5.081   -12.928 12.215  1.00 0.00 ? 92  ASP A CG   1  
ATOM 1431  O OD1  . ASP A 1 92  ? 5.967   -12.275 12.807  1.00 0.00 ? 92  ASP A OD1  1  
ATOM 1432  O OD2  . ASP A 1 92  ? 4.308   -13.760 12.738  1.00 0.00 ? 92  ASP A OD2  1  
ATOM 1433  H H    . ASP A 1 92  ? 5.583   -10.895 8.782   1.00 0.00 ? 92  ASP A H    1  
ATOM 1434  H HA   . ASP A 1 92  ? 7.094   -12.574 10.627  1.00 0.00 ? 92  ASP A HA   1  
ATOM 1435  H HB2  . ASP A 1 92  ? 4.301   -11.811 10.561  1.00 0.00 ? 92  ASP A HB2  1  
ATOM 1436  H HB3  . ASP A 1 92  ? 4.401   -13.537 10.275  1.00 0.00 ? 92  ASP A HB3  1  
ATOM 1437  N N    . PRO A 1 93  ? 7.518   -14.043 8.574   1.00 0.00 ? 93  PRO A N    1  
ATOM 1438  C CA   . PRO A 1 93  ? 7.713   -15.025 7.521   1.00 0.00 ? 93  PRO A CA   1  
ATOM 1439  C C    . PRO A 1 93  ? 7.158   -16.390 7.934   1.00 0.00 ? 93  PRO A C    1  
ATOM 1440  O O    . PRO A 1 93  ? 6.664   -17.142 7.096   1.00 0.00 ? 93  PRO A O    1  
ATOM 1441  C CB   . PRO A 1 93  ? 9.212   -15.043 7.273   1.00 0.00 ? 93  PRO A CB   1  
ATOM 1442  C CG   . PRO A 1 93  ? 9.846   -14.420 8.506   1.00 0.00 ? 93  PRO A CG   1  
ATOM 1443  C CD   . PRO A 1 93  ? 8.747   -13.730 9.297   1.00 0.00 ? 93  PRO A CD   1  
ATOM 1444  H HA   . PRO A 1 93  ? 7.205   -14.760 6.701   1.00 0.00 ? 93  PRO A HA   1  
ATOM 1445  H HB2  . PRO A 1 93  ? 9.571   -16.062 7.122   1.00 0.00 ? 93  PRO A HB2  1  
ATOM 1446  H HB3  . PRO A 1 93  ? 9.467   -14.480 6.375   1.00 0.00 ? 93  PRO A HB3  1  
ATOM 1447  H HG2  . PRO A 1 93  ? 10.332  -15.184 9.113   1.00 0.00 ? 93  PRO A HG2  1  
ATOM 1448  H HG3  . PRO A 1 93  ? 10.616  -13.704 8.218   1.00 0.00 ? 93  PRO A HG3  1  
ATOM 1449  H HD2  . PRO A 1 93  ? 8.707   -14.097 10.323  1.00 0.00 ? 93  PRO A HD2  1  
ATOM 1450  H HD3  . PRO A 1 93  ? 8.912   -12.654 9.350   1.00 0.00 ? 93  PRO A HD3  1  
ATOM 1451  N N    . LYS A 1 94  ? 7.259   -16.667 9.225   1.00 0.00 ? 94  LYS A N    1  
ATOM 1452  C CA   . LYS A 1 94  ? 6.774   -17.928 9.760   1.00 0.00 ? 94  LYS A CA   1  
ATOM 1453  C C    . LYS A 1 94  ? 5.310   -18.118 9.358   1.00 0.00 ? 94  LYS A C    1  
ATOM 1454  O O    . LYS A 1 94  ? 4.880   -19.236 9.077   1.00 0.00 ? 94  LYS A O    1  
ATOM 1455  C CB   . LYS A 1 94  ? 7.010   -17.997 11.270  1.00 0.00 ? 94  LYS A CB   1  
ATOM 1456  C CG   . LYS A 1 94  ? 8.491   -17.801 11.603  1.00 0.00 ? 94  LYS A CG   1  
ATOM 1457  C CD   . LYS A 1 94  ? 9.364   -18.779 10.814  1.00 0.00 ? 94  LYS A CD   1  
ATOM 1458  C CE   . LYS A 1 94  ? 10.497  -19.327 11.684  1.00 0.00 ? 94  LYS A CE   1  
ATOM 1459  N NZ   . LYS A 1 94  ? 11.397  -18.233 12.113  1.00 0.00 ? 94  LYS A NZ   1  
ATOM 1460  H H    . LYS A 1 94  ? 7.663   -16.050 9.900   1.00 0.00 ? 94  LYS A H    1  
ATOM 1461  H HA   . LYS A 1 94  ? 7.363   -18.724 9.305   1.00 0.00 ? 94  LYS A HA   1  
ATOM 1462  H HB2  . LYS A 1 94  ? 6.417   -17.231 11.770  1.00 0.00 ? 94  LYS A HB2  1  
ATOM 1463  H HB3  . LYS A 1 94  ? 6.673   -18.960 11.651  1.00 0.00 ? 94  LYS A HB3  1  
ATOM 1464  H HG2  . LYS A 1 94  ? 8.787   -16.777 11.373  1.00 0.00 ? 94  LYS A HG2  1  
ATOM 1465  H HG3  . LYS A 1 94  ? 8.650   -17.946 12.671  1.00 0.00 ? 94  LYS A HG3  1  
ATOM 1466  H HD2  . LYS A 1 94  ? 8.752   -19.602 10.445  1.00 0.00 ? 94  LYS A HD2  1  
ATOM 1467  H HD3  . LYS A 1 94  ? 9.782   -18.277 9.941   1.00 0.00 ? 94  LYS A HD3  1  
ATOM 1468  H HE2  . LYS A 1 94  ? 10.082  -19.829 12.558  1.00 0.00 ? 94  LYS A HE2  1  
ATOM 1469  H HE3  . LYS A 1 94  ? 11.063  -20.074 11.127  1.00 0.00 ? 94  LYS A HE3  1  
ATOM 1470  H HZ1  . LYS A 1 94  ? 11.928  -18.531 12.907  1.00 0.00 ? 94  LYS A HZ1  1  
ATOM 1471  H HZ2  . LYS A 1 94  ? 12.017  -17.999 11.365  1.00 0.00 ? 94  LYS A HZ2  1  
ATOM 1472  H HZ3  . LYS A 1 94  ? 10.853  -17.431 12.358  1.00 0.00 ? 94  LYS A HZ3  1  
ATOM 1473  N N    . SER A 1 95  ? 4.585   -17.009 9.343   1.00 0.00 ? 95  SER A N    1  
ATOM 1474  C CA   . SER A 1 95  ? 3.178   -17.040 8.979   1.00 0.00 ? 95  SER A CA   1  
ATOM 1475  C C    . SER A 1 95  ? 3.032   -17.227 7.468   1.00 0.00 ? 95  SER A C    1  
ATOM 1476  O O    . SER A 1 95  ? 3.020   -16.253 6.717   1.00 0.00 ? 95  SER A O    1  
ATOM 1477  C CB   . SER A 1 95  ? 2.466   -15.762 9.427   1.00 0.00 ? 95  SER A CB   1  
ATOM 1478  O OG   . SER A 1 95  ? 1.446   -16.027 10.386  1.00 0.00 ? 95  SER A OG   1  
ATOM 1479  H H    . SER A 1 95  ? 4.943   -16.104 9.573   1.00 0.00 ? 95  SER A H    1  
ATOM 1480  H HA   . SER A 1 95  ? 2.761   -17.894 9.513   1.00 0.00 ? 95  SER A HA   1  
ATOM 1481  H HB2  . SER A 1 95  ? 3.194   -15.072 9.854   1.00 0.00 ? 95  SER A HB2  1  
ATOM 1482  H HB3  . SER A 1 95  ? 2.029   -15.267 8.560   1.00 0.00 ? 95  SER A HB3  1  
ATOM 1483  H HG   . SER A 1 95  ? 0.552   -15.779 10.012  1.00 0.00 ? 95  SER A HG   1  
ATOM 1484  N N    . GLY A 1 96  ? 2.925   -18.486 7.068   1.00 0.00 ? 96  GLY A N    1  
ATOM 1485  C CA   . GLY A 1 96  ? 2.781   -18.813 5.659   1.00 0.00 ? 96  GLY A CA   1  
ATOM 1486  C C    . GLY A 1 96  ? 1.446   -19.512 5.393   1.00 0.00 ? 96  GLY A C    1  
ATOM 1487  O O    . GLY A 1 96  ? 1.404   -20.549 4.734   1.00 0.00 ? 96  GLY A O    1  
ATOM 1488  H H    . GLY A 1 96  ? 2.936   -19.272 7.685   1.00 0.00 ? 96  GLY A H    1  
ATOM 1489  H HA2  . GLY A 1 96  ? 2.844   -17.903 5.062   1.00 0.00 ? 96  GLY A HA2  1  
ATOM 1490  H HA3  . GLY A 1 96  ? 3.601   -19.458 5.346   1.00 0.00 ? 96  GLY A HA3  1  
ATOM 1491  N N    . SER A 1 97  ? 0.387   -18.915 5.920   1.00 0.00 ? 97  SER A N    1  
ATOM 1492  C CA   . SER A 1 97  ? -0.947  -19.466 5.748   1.00 0.00 ? 97  SER A CA   1  
ATOM 1493  C C    . SER A 1 97  ? -1.792  -18.531 4.880   1.00 0.00 ? 97  SER A C    1  
ATOM 1494  O O    . SER A 1 97  ? -2.771  -17.956 5.354   1.00 0.00 ? 97  SER A O    1  
ATOM 1495  C CB   . SER A 1 97  ? -1.626  -19.696 7.099   1.00 0.00 ? 97  SER A CB   1  
ATOM 1496  O OG   . SER A 1 97  ? -1.664  -21.077 7.450   1.00 0.00 ? 97  SER A OG   1  
ATOM 1497  H H    . SER A 1 97  ? 0.429   -18.071 6.455   1.00 0.00 ? 97  SER A H    1  
ATOM 1498  H HA   . SER A 1 97  ? -0.800  -20.424 5.248   1.00 0.00 ? 97  SER A HA   1  
ATOM 1499  H HB2  . SER A 1 97  ? -1.095  -19.140 7.871   1.00 0.00 ? 97  SER A HB2  1  
ATOM 1500  H HB3  . SER A 1 97  ? -2.642  -19.303 7.065   1.00 0.00 ? 97  SER A HB3  1  
ATOM 1501  H HG   . SER A 1 97  ? -2.549  -21.470 7.199   1.00 0.00 ? 97  SER A HG   1  
ATOM 1502  N N    . ASN A 1 98  ? -1.383  -18.409 3.626   1.00 0.00 ? 98  ASN A N    1  
ATOM 1503  C CA   . ASN A 1 98  ? -2.091  -17.554 2.689   1.00 0.00 ? 98  ASN A CA   1  
ATOM 1504  C C    . ASN A 1 98  ? -2.040  -16.108 3.186   1.00 0.00 ? 98  ASN A C    1  
ATOM 1505  O O    . ASN A 1 98  ? -1.628  -15.850 4.316   1.00 0.00 ? 98  ASN A O    1  
ATOM 1506  C CB   . ASN A 1 98  ? -3.561  -17.962 2.572   1.00 0.00 ? 98  ASN A CB   1  
ATOM 1507  C CG   . ASN A 1 98  ? -4.036  -17.890 1.119   1.00 0.00 ? 98  ASN A CG   1  
ATOM 1508  O OD1  . ASN A 1 98  ? -4.800  -17.022 0.731   1.00 0.00 ? 98  ASN A OD1  1  
ATOM 1509  N ND2  . ASN A 1 98  ? -3.543  -18.849 0.341   1.00 0.00 ? 98  ASN A ND2  1  
ATOM 1510  H H    . ASN A 1 98  ? -0.586  -18.881 3.249   1.00 0.00 ? 98  ASN A H    1  
ATOM 1511  H HA   . ASN A 1 98  ? -1.577  -17.686 1.736   1.00 0.00 ? 98  ASN A HA   1  
ATOM 1512  H HB2  . ASN A 1 98  ? -3.692  -18.975 2.951   1.00 0.00 ? 98  ASN A HB2  1  
ATOM 1513  H HB3  . ASN A 1 98  ? -4.174  -17.308 3.192   1.00 0.00 ? 98  ASN A HB3  1  
ATOM 1514  H HD21 . ASN A 1 98  ? -2.919  -19.532 0.722   1.00 0.00 ? 98  ASN A HD21 1  
ATOM 1515  H HD22 . ASN A 1 98  ? -3.795  -18.887 -0.626  1.00 0.00 ? 98  ASN A HD22 1  
ATOM 1516  N N    . LEU A 1 99  ? -2.466  -15.202 2.318   1.00 0.00 ? 99  LEU A N    1  
ATOM 1517  C CA   . LEU A 1 99  ? -2.474  -13.788 2.654   1.00 0.00 ? 99  LEU A CA   1  
ATOM 1518  C C    . LEU A 1 99  ? -3.221  -13.587 3.974   1.00 0.00 ? 99  LEU A C    1  
ATOM 1519  O O    . LEU A 1 99  ? -4.033  -14.424 4.366   1.00 0.00 ? 99  LEU A O    1  
ATOM 1520  C CB   . LEU A 1 99  ? -3.040  -12.965 1.496   1.00 0.00 ? 99  LEU A CB   1  
ATOM 1521  C CG   . LEU A 1 99  ? -2.288  -13.070 0.168   1.00 0.00 ? 99  LEU A CG   1  
ATOM 1522  C CD1  . LEU A 1 99  ? -3.168  -12.616 -0.998  1.00 0.00 ? 99  LEU A CD1  1  
ATOM 1523  C CD2  . LEU A 1 99  ? -0.967  -12.299 0.223   1.00 0.00 ? 99  LEU A CD2  1  
ATOM 1524  H H    . LEU A 1 99  ? -2.800  -15.419 1.401   1.00 0.00 ? 99  LEU A H    1  
ATOM 1525  H HA   . LEU A 1 99  ? -1.438  -13.479 2.793   1.00 0.00 ? 99  LEU A HA   1  
ATOM 1526  H HB2  . LEU A 1 99  ? -4.073  -13.269 1.330   1.00 0.00 ? 99  LEU A HB2  1  
ATOM 1527  H HB3  . LEU A 1 99  ? -3.061  -11.917 1.797   1.00 0.00 ? 99  LEU A HB3  1  
ATOM 1528  H HG   . LEU A 1 99  ? -2.042  -14.118 -0.004  1.00 0.00 ? 99  LEU A HG   1  
ATOM 1529  H HD11 . LEU A 1 99  ? -3.258  -11.530 -0.984  1.00 0.00 ? 99  LEU A HD11 1  
ATOM 1530  H HD12 . LEU A 1 99  ? -2.716  -12.931 -1.939  1.00 0.00 ? 99  LEU A HD12 1  
ATOM 1531  H HD13 . LEU A 1 99  ? -4.157  -13.064 -0.903  1.00 0.00 ? 99  LEU A HD13 1  
ATOM 1532  H HD21 . LEU A 1 99  ? -0.301  -12.771 0.945   1.00 0.00 ? 99  LEU A HD21 1  
ATOM 1533  H HD22 . LEU A 1 99  ? -0.500  -12.309 -0.762  1.00 0.00 ? 99  LEU A HD22 1  
ATOM 1534  H HD23 . LEU A 1 99  ? -1.160  -11.270 0.524   1.00 0.00 ? 99  LEU A HD23 1  
ATOM 1535  N N    . PRO A 1 100 ? -2.912  -12.443 4.641   1.00 0.00 ? 100 PRO A N    1  
ATOM 1536  C CA   . PRO A 1 100 ? -3.545  -12.121 5.909   1.00 0.00 ? 100 PRO A CA   1  
ATOM 1537  C C    . PRO A 1 100 ? -4.986  -11.651 5.699   1.00 0.00 ? 100 PRO A C    1  
ATOM 1538  O O    . PRO A 1 100 ? -5.479  -11.635 4.572   1.00 0.00 ? 100 PRO A O    1  
ATOM 1539  C CB   . PRO A 1 100 ? -2.658  -11.056 6.533   1.00 0.00 ? 100 PRO A CB   1  
ATOM 1540  C CG   . PRO A 1 100 ? -1.825  -10.488 5.395   1.00 0.00 ? 100 PRO A CG   1  
ATOM 1541  C CD   . PRO A 1 100 ? -1.956  -11.429 4.207   1.00 0.00 ? 100 PRO A CD   1  
ATOM 1542  H HA   . PRO A 1 100 ? -3.605  -12.937 6.484   1.00 0.00 ? 100 PRO A HA   1  
ATOM 1543  H HB2  . PRO A 1 100 ? -3.256  -10.277 7.006   1.00 0.00 ? 100 PRO A HB2  1  
ATOM 1544  H HB3  . PRO A 1 100 ? -2.021  -11.483 7.307   1.00 0.00 ? 100 PRO A HB3  1  
ATOM 1545  H HG2  . PRO A 1 100 ? -2.171  -9.489  5.130   1.00 0.00 ? 100 PRO A HG2  1  
ATOM 1546  H HG3  . PRO A 1 100 ? -0.781  -10.395 5.695   1.00 0.00 ? 100 PRO A HG3  1  
ATOM 1547  H HD2  . PRO A 1 100 ? -2.312  -10.901 3.322   1.00 0.00 ? 100 PRO A HD2  1  
ATOM 1548  H HD3  . PRO A 1 100 ? -0.996  -11.875 3.948   1.00 0.00 ? 100 PRO A HD3  1  
ATOM 1549  N N    . SER A 1 101 ? -5.620  -11.279 6.801   1.00 0.00 ? 101 SER A N    1  
ATOM 1550  C CA   . SER A 1 101 ? -6.994  -10.809 6.752   1.00 0.00 ? 101 SER A CA   1  
ATOM 1551  C C    . SER A 1 101 ? -7.082  -9.389  7.313   1.00 0.00 ? 101 SER A C    1  
ATOM 1552  O O    . SER A 1 101 ? -6.205  -8.957  8.060   1.00 0.00 ? 101 SER A O    1  
ATOM 1553  C CB   . SER A 1 101 ? -7.924  -11.745 7.527   1.00 0.00 ? 101 SER A CB   1  
ATOM 1554  O OG   . SER A 1 101 ? -9.295  -11.401 7.350   1.00 0.00 ? 101 SER A OG   1  
ATOM 1555  H H    . SER A 1 101 ? -5.211  -11.294 7.713   1.00 0.00 ? 101 SER A H    1  
ATOM 1556  H HA   . SER A 1 101 ? -7.265  -10.821 5.696   1.00 0.00 ? 101 SER A HA   1  
ATOM 1557  H HB2  . SER A 1 101 ? -7.762  -12.771 7.197   1.00 0.00 ? 101 SER A HB2  1  
ATOM 1558  H HB3  . SER A 1 101 ? -7.674  -11.708 8.587   1.00 0.00 ? 101 SER A HB3  1  
ATOM 1559  H HG   . SER A 1 101 ? -9.808  -12.196 7.025   1.00 0.00 ? 101 SER A HG   1  
ATOM 1560  N N    . SER A 1 102 ? -8.149  -8.701  6.933   1.00 0.00 ? 102 SER A N    1  
ATOM 1561  C CA   . SER A 1 102 ? -8.363  -7.339  7.389   1.00 0.00 ? 102 SER A CA   1  
ATOM 1562  C C    . SER A 1 102 ? -9.064  -7.346  8.749   1.00 0.00 ? 102 SER A C    1  
ATOM 1563  O O    . SER A 1 102 ? -9.634  -8.359  9.152   1.00 0.00 ? 102 SER A O    1  
ATOM 1564  C CB   . SER A 1 102 ? -9.182  -6.540  6.374   1.00 0.00 ? 102 SER A CB   1  
ATOM 1565  O OG   . SER A 1 102 ? -9.322  -5.174  6.756   1.00 0.00 ? 102 SER A OG   1  
ATOM 1566  H H    . SER A 1 102 ? -8.858  -9.060  6.326   1.00 0.00 ? 102 SER A H    1  
ATOM 1567  H HA   . SER A 1 102 ? -7.367  -6.903  7.475   1.00 0.00 ? 102 SER A HA   1  
ATOM 1568  H HB2  . SER A 1 102 ? -8.702  -6.595  5.397   1.00 0.00 ? 102 SER A HB2  1  
ATOM 1569  H HB3  . SER A 1 102 ? -10.170 -6.990  6.270   1.00 0.00 ? 102 SER A HB3  1  
ATOM 1570  H HG   . SER A 1 102 ? -8.422  -4.747  6.835   1.00 0.00 ? 102 SER A HG   1  
ATOM 1571  N N    . THR A 1 103 ? -9.000  -6.205  9.419   1.00 0.00 ? 103 THR A N    1  
ATOM 1572  C CA   . THR A 1 103 ? -9.622  -6.067  10.725  1.00 0.00 ? 103 THR A CA   1  
ATOM 1573  C C    . THR A 1 103 ? -11.078 -5.621  10.578  1.00 0.00 ? 103 THR A C    1  
ATOM 1574  O O    . THR A 1 103 ? -11.917 -5.940  11.419  1.00 0.00 ? 103 THR A O    1  
ATOM 1575  C CB   . THR A 1 103 ? -8.772  -5.103  11.554  1.00 0.00 ? 103 THR A CB   1  
ATOM 1576  O OG1  . THR A 1 103 ? -8.549  -3.998  10.682  1.00 0.00 ? 103 THR A OG1  1  
ATOM 1577  C CG2  . THR A 1 103 ? -7.369  -5.648  11.830  1.00 0.00 ? 103 THR A CG2  1  
ATOM 1578  H H    . THR A 1 103 ? -8.535  -5.385  9.084   1.00 0.00 ? 103 THR A H    1  
ATOM 1579  H HA   . THR A 1 103 ? -9.634  -7.046  11.204  1.00 0.00 ? 103 THR A HA   1  
ATOM 1580  H HB   . THR A 1 103 ? -9.277  -4.839  12.483  1.00 0.00 ? 103 THR A HB   1  
ATOM 1581  H HG1  . THR A 1 103 ? -7.937  -3.337  11.116  1.00 0.00 ? 103 THR A HG1  1  
ATOM 1582  H HG21 . THR A 1 103 ? -7.430  -6.457  12.558  1.00 0.00 ? 103 THR A HG21 1  
ATOM 1583  H HG22 . THR A 1 103 ? -6.937  -6.025  10.903  1.00 0.00 ? 103 THR A HG22 1  
ATOM 1584  H HG23 . THR A 1 103 ? -6.740  -4.850  12.226  1.00 0.00 ? 103 THR A HG23 1  
ATOM 1585  N N    . ARG A 1 104 ? -11.334 -4.890  9.502   1.00 0.00 ? 104 ARG A N    1  
ATOM 1586  C CA   . ARG A 1 104 ? -12.674 -4.397  9.234   1.00 0.00 ? 104 ARG A CA   1  
ATOM 1587  C C    . ARG A 1 104 ? -12.847 -4.116  7.740   1.00 0.00 ? 104 ARG A C    1  
ATOM 1588  O O    . ARG A 1 104 ? -11.892 -4.215  6.972   1.00 0.00 ? 104 ARG A O    1  
ATOM 1589  C CB   . ARG A 1 104 ? -12.958 -3.118  10.024  1.00 0.00 ? 104 ARG A CB   1  
ATOM 1590  C CG   . ARG A 1 104 ? -12.093 -1.960  9.522   1.00 0.00 ? 104 ARG A CG   1  
ATOM 1591  C CD   . ARG A 1 104 ? -10.657 -2.086  10.036  1.00 0.00 ? 104 ARG A CD   1  
ATOM 1592  N NE   . ARG A 1 104 ? -10.663 -2.362  11.490  1.00 0.00 ? 104 ARG A NE   1  
ATOM 1593  C CZ   . ARG A 1 104 ? -10.905 -1.437  12.430  1.00 0.00 ? 104 ARG A CZ   1  
ATOM 1594  N NH1  . ARG A 1 104 ? -11.162 -0.171  12.073  1.00 0.00 ? 104 ARG A NH1  1  
ATOM 1595  N NH2  . ARG A 1 104 ? -10.890 -1.779  13.725  1.00 0.00 ? 104 ARG A NH2  1  
ATOM 1596  H H    . ARG A 1 104 ? -10.646 -4.636  8.823   1.00 0.00 ? 104 ARG A H    1  
ATOM 1597  H HA   . ARG A 1 104 ? -13.337 -5.199  9.562   1.00 0.00 ? 104 ARG A HA   1  
ATOM 1598  H HB2  . ARG A 1 104 ? -14.012 -2.856  9.931   1.00 0.00 ? 104 ARG A HB2  1  
ATOM 1599  H HB3  . ARG A 1 104 ? -12.765 -3.289  11.082  1.00 0.00 ? 104 ARG A HB3  1  
ATOM 1600  H HG2  . ARG A 1 104 ? -12.092 -1.948  8.432   1.00 0.00 ? 104 ARG A HG2  1  
ATOM 1601  H HG3  . ARG A 1 104 ? -12.520 -1.013  9.851   1.00 0.00 ? 104 ARG A HG3  1  
ATOM 1602  H HD2  . ARG A 1 104 ? -10.141 -2.887  9.508   1.00 0.00 ? 104 ARG A HD2  1  
ATOM 1603  H HD3  . ARG A 1 104 ? -10.108 -1.166  9.835   1.00 0.00 ? 104 ARG A HD3  1  
ATOM 1604  H HE   . ARG A 1 104 ? -10.475 -3.297  11.790  1.00 0.00 ? 104 ARG A HE   1  
ATOM 1605  H HH11 . ARG A 1 104 ? -11.173 0.083   11.106  1.00 0.00 ? 104 ARG A HH11 1  
ATOM 1606  H HH12 . ARG A 1 104 ? -11.342 0.518   12.774  1.00 0.00 ? 104 ARG A HH12 1  
ATOM 1607  H HH21 . ARG A 1 104 ? -10.698 -2.724  13.991  1.00 0.00 ? 104 ARG A HH21 1  
ATOM 1608  H HH22 . ARG A 1 104 ? -11.070 -1.089  14.426  1.00 0.00 ? 104 ARG A HH22 1  
ATOM 1609  N N    . THR A 1 105 ? -14.072 -3.770  7.374   1.00 0.00 ? 105 THR A N    1  
ATOM 1610  C CA   . THR A 1 105 ? -14.383 -3.473  5.986   1.00 0.00 ? 105 THR A CA   1  
ATOM 1611  C C    . THR A 1 105 ? -14.482 -1.961  5.773   1.00 0.00 ? 105 THR A C    1  
ATOM 1612  O O    . THR A 1 105 ? -15.384 -1.314  6.302   1.00 0.00 ? 105 THR A O    1  
ATOM 1613  C CB   . THR A 1 105 ? -15.664 -4.224  5.617   1.00 0.00 ? 105 THR A CB   1  
ATOM 1614  O OG1  . THR A 1 105 ? -15.325 -5.597  5.796   1.00 0.00 ? 105 THR A OG1  1  
ATOM 1615  C CG2  . THR A 1 105 ? -15.999 -4.114  4.128   1.00 0.00 ? 105 THR A CG2  1  
ATOM 1616  H H    . THR A 1 105 ? -14.844 -3.691  8.005   1.00 0.00 ? 105 THR A H    1  
ATOM 1617  H HA   . THR A 1 105 ? -13.560 -3.830  5.366   1.00 0.00 ? 105 THR A HA   1  
ATOM 1618  H HB   . THR A 1 105 ? -16.501 -3.891  6.230   1.00 0.00 ? 105 THR A HB   1  
ATOM 1619  H HG1  . THR A 1 105 ? -15.994 -6.039  6.393   1.00 0.00 ? 105 THR A HG1  1  
ATOM 1620  H HG21 . THR A 1 105 ? -16.856 -3.453  3.996   1.00 0.00 ? 105 THR A HG21 1  
ATOM 1621  H HG22 . THR A 1 105 ? -15.141 -3.707  3.592   1.00 0.00 ? 105 THR A HG22 1  
ATOM 1622  H HG23 . THR A 1 105 ? -16.238 -5.102  3.735   1.00 0.00 ? 105 THR A HG23 1  
ATOM 1623  N N    . VAL A 1 106 ? -13.542 -1.442  4.996   1.00 0.00 ? 106 VAL A N    1  
ATOM 1624  C CA   . VAL A 1 106 ? -13.512 -0.019  4.707   1.00 0.00 ? 106 VAL A CA   1  
ATOM 1625  C C    . VAL A 1 106 ? -13.834 0.203   3.228   1.00 0.00 ? 106 VAL A C    1  
ATOM 1626  O O    . VAL A 1 106 ? -13.533 -0.645  2.389   1.00 0.00 ? 106 VAL A O    1  
ATOM 1627  C CB   . VAL A 1 106 ? -12.163 0.571   5.120   1.00 0.00 ? 106 VAL A CB   1  
ATOM 1628  C CG1  . VAL A 1 106 ? -11.967 1.965   4.521   1.00 0.00 ? 106 VAL A CG1  1  
ATOM 1629  C CG2  . VAL A 1 106 ? -12.022 0.605   6.643   1.00 0.00 ? 106 VAL A CG2  1  
ATOM 1630  H H    . VAL A 1 106 ? -12.812 -1.976  4.569   1.00 0.00 ? 106 VAL A H    1  
ATOM 1631  H HA   . VAL A 1 106 ? -14.287 0.456   5.309   1.00 0.00 ? 106 VAL A HA   1  
ATOM 1632  H HB   . VAL A 1 106 ? -11.379 -0.076  4.726   1.00 0.00 ? 106 VAL A HB   1  
ATOM 1633  H HG11 . VAL A 1 106 ? -11.350 2.565   5.190   1.00 0.00 ? 106 VAL A HG11 1  
ATOM 1634  H HG12 . VAL A 1 106 ? -11.474 1.878   3.552   1.00 0.00 ? 106 VAL A HG12 1  
ATOM 1635  H HG13 . VAL A 1 106 ? -12.937 2.445   4.393   1.00 0.00 ? 106 VAL A HG13 1  
ATOM 1636  H HG21 . VAL A 1 106 ? -11.092 1.105   6.912   1.00 0.00 ? 106 VAL A HG21 1  
ATOM 1637  H HG22 . VAL A 1 106 ? -12.864 1.148   7.074   1.00 0.00 ? 106 VAL A HG22 1  
ATOM 1638  H HG23 . VAL A 1 106 ? -12.012 -0.414  7.030   1.00 0.00 ? 106 VAL A HG23 1  
ATOM 1639  N N    . LYS A 1 107 ? -14.441 1.348   2.952   1.00 0.00 ? 107 LYS A N    1  
ATOM 1640  C CA   . LYS A 1 107 ? -14.807 1.693   1.589   1.00 0.00 ? 107 LYS A CA   1  
ATOM 1641  C C    . LYS A 1 107 ? -14.473 3.163   1.332   1.00 0.00 ? 107 LYS A C    1  
ATOM 1642  O O    . LYS A 1 107 ? -14.116 3.893   2.255   1.00 0.00 ? 107 LYS A O    1  
ATOM 1643  C CB   . LYS A 1 107 ? -16.271 1.338   1.321   1.00 0.00 ? 107 LYS A CB   1  
ATOM 1644  C CG   . LYS A 1 107 ? -16.436 0.694   -0.057  1.00 0.00 ? 107 LYS A CG   1  
ATOM 1645  C CD   . LYS A 1 107 ? -17.904 0.691   -0.489  1.00 0.00 ? 107 LYS A CD   1  
ATOM 1646  C CE   . LYS A 1 107 ? -18.405 2.116   -0.735  1.00 0.00 ? 107 LYS A CE   1  
ATOM 1647  N NZ   . LYS A 1 107 ? -19.733 2.091   -1.388  1.00 0.00 ? 107 LYS A NZ   1  
ATOM 1648  H H    . LYS A 1 107 ? -14.682 2.033   3.640   1.00 0.00 ? 107 LYS A H    1  
ATOM 1649  H HA   . LYS A 1 107 ? -14.200 1.079   0.923   1.00 0.00 ? 107 LYS A HA   1  
ATOM 1650  H HB2  . LYS A 1 107 ? -16.631 0.656   2.091   1.00 0.00 ? 107 LYS A HB2  1  
ATOM 1651  H HB3  . LYS A 1 107 ? -16.883 2.238   1.382   1.00 0.00 ? 107 LYS A HB3  1  
ATOM 1652  H HG2  . LYS A 1 107 ? -15.839 1.237   -0.790  1.00 0.00 ? 107 LYS A HG2  1  
ATOM 1653  H HG3  . LYS A 1 107 ? -16.058 -0.328  -0.032  1.00 0.00 ? 107 LYS A HG3  1  
ATOM 1654  H HD2  . LYS A 1 107 ? -18.018 0.099   -1.396  1.00 0.00 ? 107 LYS A HD2  1  
ATOM 1655  H HD3  . LYS A 1 107 ? -18.512 0.216   0.281   1.00 0.00 ? 107 LYS A HD3  1  
ATOM 1656  H HE2  . LYS A 1 107 ? -18.468 2.654   0.210   1.00 0.00 ? 107 LYS A HE2  1  
ATOM 1657  H HE3  . LYS A 1 107 ? -17.695 2.654   -1.363  1.00 0.00 ? 107 LYS A HE3  1  
ATOM 1658  H HZ1  . LYS A 1 107 ? -20.007 3.024   -1.622  1.00 0.00 ? 107 LYS A HZ1  1  
ATOM 1659  H HZ2  . LYS A 1 107 ? -19.686 1.539   -2.220  1.00 0.00 ? 107 LYS A HZ2  1  
ATOM 1660  H HZ3  . LYS A 1 107 ? -20.405 1.694   -0.763  1.00 0.00 ? 107 LYS A HZ3  1  
ATOM 1661  N N    . ALA A 1 108 ? -14.600 3.555   0.072   1.00 0.00 ? 108 ALA A N    1  
ATOM 1662  C CA   . ALA A 1 108 ? -14.316 4.925   -0.318  1.00 0.00 ? 108 ALA A CA   1  
ATOM 1663  C C    . ALA A 1 108 ? -15.622 5.619   -0.713  1.00 0.00 ? 108 ALA A C    1  
ATOM 1664  O O    . ALA A 1 108 ? -16.227 5.278   -1.729  1.00 0.00 ? 108 ALA A O    1  
ATOM 1665  C CB   . ALA A 1 108 ? -13.287 4.931   -1.449  1.00 0.00 ? 108 ALA A CB   1  
ATOM 1666  H H    . ALA A 1 108 ? -14.891 2.955   -0.673  1.00 0.00 ? 108 ALA A H    1  
ATOM 1667  H HA   . ALA A 1 108 ? -13.891 5.435   0.547   1.00 0.00 ? 108 ALA A HA   1  
ATOM 1668  H HB1  . ALA A 1 108 ? -12.627 5.792   -1.336  1.00 0.00 ? 108 ALA A HB1  1  
ATOM 1669  H HB2  . ALA A 1 108 ? -12.698 4.015   -1.410  1.00 0.00 ? 108 ALA A HB2  1  
ATOM 1670  H HB3  . ALA A 1 108 ? -13.801 4.992   -2.409  1.00 0.00 ? 108 ALA A HB3  1  
ATOM 1671  N N    . LEU A 1 109 ? -16.017 6.579   0.109   1.00 0.00 ? 109 LEU A N    1  
ATOM 1672  C CA   . LEU A 1 109 ? -17.239 7.324   -0.142  1.00 0.00 ? 109 LEU A CA   1  
ATOM 1673  C C    . LEU A 1 109 ? -16.900 8.614   -0.891  1.00 0.00 ? 109 LEU A C    1  
ATOM 1674  O O    . LEU A 1 109 ? -17.742 9.165   -1.599  1.00 0.00 ? 109 LEU A O    1  
ATOM 1675  C CB   . LEU A 1 109 ? -18.005 7.553   1.163   1.00 0.00 ? 109 LEU A CB   1  
ATOM 1676  C CG   . LEU A 1 109 ? -17.805 6.497   2.252   1.00 0.00 ? 109 LEU A CG   1  
ATOM 1677  C CD1  . LEU A 1 109 ? -16.745 6.944   3.261   1.00 0.00 ? 109 LEU A CD1  1  
ATOM 1678  C CD2  . LEU A 1 109 ? -19.132 6.151   2.930   1.00 0.00 ? 109 LEU A CD2  1  
ATOM 1679  H H    . LEU A 1 109 ? -15.519 6.850   0.933   1.00 0.00 ? 109 LEU A H    1  
ATOM 1680  H HA   . LEU A 1 109 ? -17.870 6.709   -0.783  1.00 0.00 ? 109 LEU A HA   1  
ATOM 1681  H HB2  . LEU A 1 109 ? -17.713 8.523   1.566   1.00 0.00 ? 109 LEU A HB2  1  
ATOM 1682  H HB3  . LEU A 1 109 ? -19.068 7.611   0.931   1.00 0.00 ? 109 LEU A HB3  1  
ATOM 1683  H HG   . LEU A 1 109 ? -17.436 5.586   1.781   1.00 0.00 ? 109 LEU A HG   1  
ATOM 1684  H HD11 . LEU A 1 109 ? -16.045 7.625   2.775   1.00 0.00 ? 109 LEU A HD11 1  
ATOM 1685  H HD12 . LEU A 1 109 ? -17.229 7.454   4.094   1.00 0.00 ? 109 LEU A HD12 1  
ATOM 1686  H HD13 . LEU A 1 109 ? -16.205 6.073   3.631   1.00 0.00 ? 109 LEU A HD13 1  
ATOM 1687  H HD21 . LEU A 1 109 ? -18.978 6.063   4.006   1.00 0.00 ? 109 LEU A HD21 1  
ATOM 1688  H HD22 . LEU A 1 109 ? -19.858 6.938   2.730   1.00 0.00 ? 109 LEU A HD22 1  
ATOM 1689  H HD23 . LEU A 1 109 ? -19.504 5.205   2.538   1.00 0.00 ? 109 LEU A HD23 1  
ATOM 1690  N N    . THR A 1 110 ? -15.666 9.060   -0.709  1.00 0.00 ? 110 THR A N    1  
ATOM 1691  C CA   . THR A 1 110 ? -15.205 10.275  -1.358  1.00 0.00 ? 110 THR A CA   1  
ATOM 1692  C C    . THR A 1 110 ? -13.811 10.067  -1.952  1.00 0.00 ? 110 THR A C    1  
ATOM 1693  O O    . THR A 1 110 ? -13.128 9.099   -1.619  1.00 0.00 ? 110 THR A O    1  
ATOM 1694  C CB   . THR A 1 110 ? -15.266 11.411  -0.334  1.00 0.00 ? 110 THR A CB   1  
ATOM 1695  O OG1  . THR A 1 110 ? -14.531 12.468  -0.944  1.00 0.00 ? 110 THR A OG1  1  
ATOM 1696  C CG2  . THR A 1 110 ? -14.477 11.094  0.938   1.00 0.00 ? 110 THR A CG2  1  
ATOM 1697  H H    . THR A 1 110 ? -14.987 8.606   -0.131  1.00 0.00 ? 110 THR A H    1  
ATOM 1698  H HA   . THR A 1 110 ? -15.876 10.497  -2.188  1.00 0.00 ? 110 THR A HA   1  
ATOM 1699  H HB   . THR A 1 110 ? -16.299 11.668  -0.099  1.00 0.00 ? 110 THR A HB   1  
ATOM 1700  H HG1  . THR A 1 110 ? -13.556 12.246  -0.954  1.00 0.00 ? 110 THR A HG1  1  
ATOM 1701  H HG21 . THR A 1 110 ? -14.609 11.902  1.658   1.00 0.00 ? 110 THR A HG21 1  
ATOM 1702  H HG22 . THR A 1 110 ? -14.841 10.162  1.369   1.00 0.00 ? 110 THR A HG22 1  
ATOM 1703  H HG23 . THR A 1 110 ? -13.419 10.994  0.695   1.00 0.00 ? 110 THR A HG23 1  
ATOM 1704  N N    . GLU A 1 111 ? -13.429 10.991  -2.822  1.00 0.00 ? 111 GLU A N    1  
ATOM 1705  C CA   . GLU A 1 111 ? -12.128 10.921  -3.466  1.00 0.00 ? 111 GLU A CA   1  
ATOM 1706  C C    . GLU A 1 111 ? -11.022 10.798  -2.416  1.00 0.00 ? 111 GLU A C    1  
ATOM 1707  O O    . GLU A 1 111 ? -10.796 11.723  -1.636  1.00 0.00 ? 111 GLU A O    1  
ATOM 1708  C CB   . GLU A 1 111 ? -11.897 12.135  -4.367  1.00 0.00 ? 111 GLU A CB   1  
ATOM 1709  C CG   . GLU A 1 111 ? -11.334 11.710  -5.725  1.00 0.00 ? 111 GLU A CG   1  
ATOM 1710  C CD   . GLU A 1 111 ? -11.248 12.902  -6.680  1.00 0.00 ? 111 GLU A CD   1  
ATOM 1711  O OE1  . GLU A 1 111 ? -12.326 13.356  -7.120  1.00 0.00 ? 111 GLU A OE1  1  
ATOM 1712  O OE2  . GLU A 1 111 ? -10.106 13.334  -6.949  1.00 0.00 ? 111 GLU A OE2  1  
ATOM 1713  H H    . GLU A 1 111 ? -13.990 11.775  -3.087  1.00 0.00 ? 111 GLU A H    1  
ATOM 1714  H HA   . GLU A 1 111 ? -12.157 10.020  -4.080  1.00 0.00 ? 111 GLU A HA   1  
ATOM 1715  H HB2  . GLU A 1 111 ? -12.835 12.671  -4.510  1.00 0.00 ? 111 GLU A HB2  1  
ATOM 1716  H HB3  . GLU A 1 111 ? -11.206 12.825  -3.883  1.00 0.00 ? 111 GLU A HB3  1  
ATOM 1717  H HG2  . GLU A 1 111 ? -10.343 11.274  -5.592  1.00 0.00 ? 111 GLU A HG2  1  
ATOM 1718  H HG3  . GLU A 1 111 ? -11.967 10.937  -6.159  1.00 0.00 ? 111 GLU A HG3  1  
ATOM 1719  N N    . VAL A 1 112 ? -10.362 9.650   -2.429  1.00 0.00 ? 112 VAL A N    1  
ATOM 1720  C CA   . VAL A 1 112 ? -9.285  9.395   -1.488  1.00 0.00 ? 112 VAL A CA   1  
ATOM 1721  C C    . VAL A 1 112 ? -7.942  9.504   -2.214  1.00 0.00 ? 112 VAL A C    1  
ATOM 1722  O O    . VAL A 1 112 ? -7.863  9.271   -3.419  1.00 0.00 ? 112 VAL A O    1  
ATOM 1723  C CB   . VAL A 1 112 ? -9.491  8.037   -0.813  1.00 0.00 ? 112 VAL A CB   1  
ATOM 1724  C CG1  . VAL A 1 112 ? -8.528  7.858   0.363   1.00 0.00 ? 112 VAL A CG1  1  
ATOM 1725  C CG2  . VAL A 1 112 ? -10.943 7.862   -0.364  1.00 0.00 ? 112 VAL A CG2  1  
ATOM 1726  H H    . VAL A 1 112 ? -10.552 8.903   -3.067  1.00 0.00 ? 112 VAL A H    1  
ATOM 1727  H HA   . VAL A 1 112 ? -9.332  10.165  -0.718  1.00 0.00 ? 112 VAL A HA   1  
ATOM 1728  H HB   . VAL A 1 112 ? -9.271  7.261   -1.547  1.00 0.00 ? 112 VAL A HB   1  
ATOM 1729  H HG11 . VAL A 1 112 ? -7.514  8.096   0.041   1.00 0.00 ? 112 VAL A HG11 1  
ATOM 1730  H HG12 . VAL A 1 112 ? -8.818  8.524   1.175   1.00 0.00 ? 112 VAL A HG12 1  
ATOM 1731  H HG13 . VAL A 1 112 ? -8.565  6.825   0.709   1.00 0.00 ? 112 VAL A HG13 1  
ATOM 1732  H HG21 . VAL A 1 112 ? -11.350 8.829   -0.068  1.00 0.00 ? 112 VAL A HG21 1  
ATOM 1733  H HG22 . VAL A 1 112 ? -11.531 7.457   -1.187  1.00 0.00 ? 112 VAL A HG22 1  
ATOM 1734  H HG23 . VAL A 1 112 ? -10.981 7.177   0.483   1.00 0.00 ? 112 VAL A HG23 1  
ATOM 1735  N N    . GLU A 1 113 ? -6.920  9.860   -1.449  1.00 0.00 ? 113 GLU A N    1  
ATOM 1736  C CA   . GLU A 1 113 ? -5.585  10.003  -2.004  1.00 0.00 ? 113 GLU A CA   1  
ATOM 1737  C C    . GLU A 1 113 ? -4.575  9.215   -1.168  1.00 0.00 ? 113 GLU A C    1  
ATOM 1738  O O    . GLU A 1 113 ? -4.238  9.617   -0.055  1.00 0.00 ? 113 GLU A O    1  
ATOM 1739  C CB   . GLU A 1 113 ? -5.187  11.477  -2.100  1.00 0.00 ? 113 GLU A CB   1  
ATOM 1740  C CG   . GLU A 1 113 ? -5.774  12.123  -3.357  1.00 0.00 ? 113 GLU A CG   1  
ATOM 1741  C CD   . GLU A 1 113 ? -7.291  12.280  -3.234  1.00 0.00 ? 113 GLU A CD   1  
ATOM 1742  O OE1  . GLU A 1 113 ? -7.769  12.292  -2.080  1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1743  O OE2  . GLU A 1 113 ? -7.938  12.385  -4.299  1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1744  H H    . GLU A 1 113 ? -6.993  10.048  -0.470  1.00 0.00 ? 113 GLU A H    1  
ATOM 1745  H HA   . GLU A 1 113 ? -5.642  9.582   -3.008  1.00 0.00 ? 113 GLU A HA   1  
ATOM 1746  H HB2  . GLU A 1 113 ? -5.535  12.010  -1.216  1.00 0.00 ? 113 GLU A HB2  1  
ATOM 1747  H HB3  . GLU A 1 113 ? -4.100  11.564  -2.117  1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1748  H HG2  . GLU A 1 113 ? -5.315  13.099  -3.516  1.00 0.00 ? 113 GLU A HG2  1  
ATOM 1749  H HG3  . GLU A 1 113 ? -5.537  11.513  -4.228  1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1750  N N    . ALA A 1 114 ? -4.120  8.108   -1.735  1.00 0.00 ? 114 ALA A N    1  
ATOM 1751  C CA   . ALA A 1 114 ? -3.155  7.261   -1.056  1.00 0.00 ? 114 ALA A CA   1  
ATOM 1752  C C    . ALA A 1 114 ? -2.456  6.367   -2.082  1.00 0.00 ? 114 ALA A C    1  
ATOM 1753  O O    . ALA A 1 114 ? -2.811  6.372   -3.260  1.00 0.00 ? 114 ALA A O    1  
ATOM 1754  C CB   . ALA A 1 114 ? -3.863  6.454   0.034   1.00 0.00 ? 114 ALA A CB   1  
ATOM 1755  H H    . ALA A 1 114 ? -4.399  7.789   -2.641  1.00 0.00 ? 114 ALA A H    1  
ATOM 1756  H HA   . ALA A 1 114 ? -2.415  7.910   -0.588  1.00 0.00 ? 114 ALA A HA   1  
ATOM 1757  H HB1  . ALA A 1 114 ? -3.583  5.403   -0.051  1.00 0.00 ? 114 ALA A HB1  1  
ATOM 1758  H HB2  . ALA A 1 114 ? -3.567  6.829   1.014   1.00 0.00 ? 114 ALA A HB2  1  
ATOM 1759  H HB3  . ALA A 1 114 ? -4.942  6.553   -0.083  1.00 0.00 ? 114 ALA A HB3  1  
ATOM 1760  N N    . PHE A 1 115 ? -1.475  5.620   -1.597  1.00 0.00 ? 115 PHE A N    1  
ATOM 1761  C CA   . PHE A 1 115 ? -0.723  4.722   -2.458  1.00 0.00 ? 115 PHE A CA   1  
ATOM 1762  C C    . PHE A 1 115 ? -1.025  3.260   -2.123  1.00 0.00 ? 115 PHE A C    1  
ATOM 1763  O O    . PHE A 1 115 ? -1.713  2.973   -1.144  1.00 0.00 ? 115 PHE A O    1  
ATOM 1764  C CB   . PHE A 1 115 ? 0.761   4.995   -2.202  1.00 0.00 ? 115 PHE A CB   1  
ATOM 1765  C CG   . PHE A 1 115 ? 1.241   6.354   -2.715  1.00 0.00 ? 115 PHE A CG   1  
ATOM 1766  C CD1  . PHE A 1 115 ? 1.656   6.487   -4.003  1.00 0.00 ? 115 PHE A CD1  1  
ATOM 1767  C CD2  . PHE A 1 115 ? 1.253   7.430   -1.883  1.00 0.00 ? 115 PHE A CD2  1  
ATOM 1768  C CE1  . PHE A 1 115 ? 2.102   7.748   -4.480  1.00 0.00 ? 115 PHE A CE1  1  
ATOM 1769  C CE2  . PHE A 1 115 ? 1.699   8.691   -2.359  1.00 0.00 ? 115 PHE A CE2  1  
ATOM 1770  C CZ   . PHE A 1 115 ? 2.114   8.824   -3.648  1.00 0.00 ? 115 PHE A CZ   1  
ATOM 1771  H H    . PHE A 1 115 ? -1.192  5.621   -0.638  1.00 0.00 ? 115 PHE A H    1  
ATOM 1772  H HA   . PHE A 1 115 ? -1.026  4.928   -3.484  1.00 0.00 ? 115 PHE A HA   1  
ATOM 1773  H HB2  . PHE A 1 115 ? 0.951   4.935   -1.130  1.00 0.00 ? 115 PHE A HB2  1  
ATOM 1774  H HB3  . PHE A 1 115 ? 1.351   4.211   -2.675  1.00 0.00 ? 115 PHE A HB3  1  
ATOM 1775  H HD1  . PHE A 1 115 ? 1.646   5.625   -4.670  1.00 0.00 ? 115 PHE A HD1  1  
ATOM 1776  H HD2  . PHE A 1 115 ? 0.921   7.324   -0.850  1.00 0.00 ? 115 PHE A HD2  1  
ATOM 1777  H HE1  . PHE A 1 115 ? 2.434   7.854   -5.512  1.00 0.00 ? 115 PHE A HE1  1  
ATOM 1778  H HE2  . PHE A 1 115 ? 1.708   9.553   -1.692  1.00 0.00 ? 115 PHE A HE2  1  
ATOM 1779  H HZ   . PHE A 1 115 ? 2.456   9.792   -4.013  1.00 0.00 ? 115 PHE A HZ   1  
ATOM 1780  N N    . ALA A 1 116 ? -0.496  2.375   -2.955  1.00 0.00 ? 116 ALA A N    1  
ATOM 1781  C CA   . ALA A 1 116 ? -0.701  0.949   -2.759  1.00 0.00 ? 116 ALA A CA   1  
ATOM 1782  C C    . ALA A 1 116 ? 0.628   0.295   -2.377  1.00 0.00 ? 116 ALA A C    1  
ATOM 1783  O O    . ALA A 1 116 ? 1.695   0.835   -2.666  1.00 0.00 ? 116 ALA A O    1  
ATOM 1784  C CB   . ALA A 1 116 ? -1.307  0.342   -4.026  1.00 0.00 ? 116 ALA A CB   1  
ATOM 1785  H H    . ALA A 1 116 ? 0.062   2.616   -3.749  1.00 0.00 ? 116 ALA A H    1  
ATOM 1786  H HA   . ALA A 1 116 ? -1.407  0.825   -1.938  1.00 0.00 ? 116 ALA A HA   1  
ATOM 1787  H HB1  . ALA A 1 116 ? -2.236  0.858   -4.269  1.00 0.00 ? 116 ALA A HB1  1  
ATOM 1788  H HB2  . ALA A 1 116 ? -0.604  0.451   -4.853  1.00 0.00 ? 116 ALA A HB2  1  
ATOM 1789  H HB3  . ALA A 1 116 ? -1.511  -0.716  -3.860  1.00 0.00 ? 116 ALA A HB3  1  
ATOM 1790  N N    . LEU A 1 117 ? 0.520   -0.858  -1.733  1.00 0.00 ? 117 LEU A N    1  
ATOM 1791  C CA   . LEU A 1 117 ? 1.700   -1.591  -1.308  1.00 0.00 ? 117 LEU A CA   1  
ATOM 1792  C C    . LEU A 1 117 ? 1.422   -3.093  -1.397  1.00 0.00 ? 117 LEU A C    1  
ATOM 1793  O O    . LEU A 1 117 ? 0.487   -3.592  -0.773  1.00 0.00 ? 117 LEU A O    1  
ATOM 1794  C CB   . LEU A 1 117 ? 2.146   -1.129  0.081   1.00 0.00 ? 117 LEU A CB   1  
ATOM 1795  C CG   . LEU A 1 117 ? 3.653   -1.160  0.346   1.00 0.00 ? 117 LEU A CG   1  
ATOM 1796  C CD1  . LEU A 1 117 ? 4.283   -2.435  -0.218  1.00 0.00 ? 117 LEU A CD1  1  
ATOM 1797  C CD2  . LEU A 1 117 ? 4.331   0.101   -0.193  1.00 0.00 ? 117 LEU A CD2  1  
ATOM 1798  H H    . LEU A 1 117 ? -0.352  -1.289  -1.502  1.00 0.00 ? 117 LEU A H    1  
ATOM 1799  H HA   . LEU A 1 117 ? 2.504   -1.347  -2.002  1.00 0.00 ? 117 LEU A HA   1  
ATOM 1800  H HB2  . LEU A 1 117 ? 1.791   -0.111  0.235   1.00 0.00 ? 117 LEU A HB2  1  
ATOM 1801  H HB3  . LEU A 1 117 ? 1.654   -1.755  0.825   1.00 0.00 ? 117 LEU A HB3  1  
ATOM 1802  H HG   . LEU A 1 117 ? 3.810   -1.174  1.425   1.00 0.00 ? 117 LEU A HG   1  
ATOM 1803  H HD11 . LEU A 1 117 ? 4.676   -2.235  -1.215  1.00 0.00 ? 117 LEU A HD11 1  
ATOM 1804  H HD12 . LEU A 1 117 ? 5.094   -2.759  0.434   1.00 0.00 ? 117 LEU A HD12 1  
ATOM 1805  H HD13 . LEU A 1 117 ? 3.528   -3.219  -0.276  1.00 0.00 ? 117 LEU A HD13 1  
ATOM 1806  H HD21 . LEU A 1 117 ? 4.003   0.965   0.386   1.00 0.00 ? 117 LEU A HD21 1  
ATOM 1807  H HD22 . LEU A 1 117 ? 5.412   -0.004  -0.110  1.00 0.00 ? 117 LEU A HD22 1  
ATOM 1808  H HD23 . LEU A 1 117 ? 4.059   0.241   -1.239  1.00 0.00 ? 117 LEU A HD23 1  
ATOM 1809  N N    . ILE A 1 118 ? 2.251   -3.770  -2.178  1.00 0.00 ? 118 ILE A N    1  
ATOM 1810  C CA   . ILE A 1 118 ? 2.105   -5.205  -2.357  1.00 0.00 ? 118 ILE A CA   1  
ATOM 1811  C C    . ILE A 1 118 ? 2.881   -5.933  -1.256  1.00 0.00 ? 118 ILE A C    1  
ATOM 1812  O O    . ILE A 1 118 ? 3.956   -5.492  -0.854  1.00 0.00 ? 118 ILE A O    1  
ATOM 1813  C CB   . ILE A 1 118 ? 2.518   -5.613  -3.772  1.00 0.00 ? 118 ILE A CB   1  
ATOM 1814  C CG1  . ILE A 1 118 ? 2.600   -7.135  -3.902  1.00 0.00 ? 118 ILE A CG1  1  
ATOM 1815  C CG2  . ILE A 1 118 ? 3.826   -4.931  -4.180  1.00 0.00 ? 118 ILE A CG2  1  
ATOM 1816  C CD1  . ILE A 1 118 ? 2.693   -7.556  -5.370  1.00 0.00 ? 118 ILE A CD1  1  
ATOM 1817  H H    . ILE A 1 118 ? 3.009   -3.356  -2.682  1.00 0.00 ? 118 ILE A H    1  
ATOM 1818  H HA   . ILE A 1 118 ? 1.047   -5.442  -2.248  1.00 0.00 ? 118 ILE A HA   1  
ATOM 1819  H HB   . ILE A 1 118 ? 1.748   -5.272  -4.464  1.00 0.00 ? 118 ILE A HB   1  
ATOM 1820  H HG12 . ILE A 1 118 ? 3.471   -7.504  -3.359  1.00 0.00 ? 118 ILE A HG12 1  
ATOM 1821  H HG13 . ILE A 1 118 ? 1.722   -7.591  -3.444  1.00 0.00 ? 118 ILE A HG13 1  
ATOM 1822  H HG21 . ILE A 1 118 ? 4.368   -4.621  -3.287  1.00 0.00 ? 118 ILE A HG21 1  
ATOM 1823  H HG22 . ILE A 1 118 ? 4.437   -5.630  -4.752  1.00 0.00 ? 118 ILE A HG22 1  
ATOM 1824  H HG23 . ILE A 1 118 ? 3.604   -4.057  -4.792  1.00 0.00 ? 118 ILE A HG23 1  
ATOM 1825  H HD11 . ILE A 1 118 ? 2.864   -8.631  -5.430  1.00 0.00 ? 118 ILE A HD11 1  
ATOM 1826  H HD12 . ILE A 1 118 ? 1.762   -7.307  -5.879  1.00 0.00 ? 118 ILE A HD12 1  
ATOM 1827  H HD13 . ILE A 1 118 ? 3.520   -7.029  -5.847  1.00 0.00 ? 118 ILE A HD13 1  
ATOM 1828  N N    . ALA A 1 119 ? 2.304   -7.035  -0.801  1.00 0.00 ? 119 ALA A N    1  
ATOM 1829  C CA   . ALA A 1 119 ? 2.928   -7.828  0.245   1.00 0.00 ? 119 ALA A CA   1  
ATOM 1830  C C    . ALA A 1 119 ? 4.252   -8.395  -0.271  1.00 0.00 ? 119 ALA A C    1  
ATOM 1831  O O    . ALA A 1 119 ? 5.283   -8.272  0.388   1.00 0.00 ? 119 ALA A O    1  
ATOM 1832  C CB   . ALA A 1 119 ? 1.962   -8.925  0.698   1.00 0.00 ? 119 ALA A CB   1  
ATOM 1833  H H    . ALA A 1 119 ? 1.429   -7.387  -1.134  1.00 0.00 ? 119 ALA A H    1  
ATOM 1834  H HA   . ALA A 1 119 ? 3.128   -7.167  1.088   1.00 0.00 ? 119 ALA A HA   1  
ATOM 1835  H HB1  . ALA A 1 119 ? 2.306   -9.890  0.325   1.00 0.00 ? 119 ALA A HB1  1  
ATOM 1836  H HB2  . ALA A 1 119 ? 1.925   -8.949  1.787   1.00 0.00 ? 119 ALA A HB2  1  
ATOM 1837  H HB3  . ALA A 1 119 ? 0.966   -8.718  0.305   1.00 0.00 ? 119 ALA A HB3  1  
ATOM 1838  N N    . ASP A 1 120 ? 4.181   -9.003  -1.446  1.00 0.00 ? 120 ASP A N    1  
ATOM 1839  C CA   . ASP A 1 120 ? 5.361   -9.589  -2.058  1.00 0.00 ? 120 ASP A CA   1  
ATOM 1840  C C    . ASP A 1 120 ? 6.554   -8.653  -1.853  1.00 0.00 ? 120 ASP A C    1  
ATOM 1841  O O    . ASP A 1 120 ? 7.473   -8.969  -1.099  1.00 0.00 ? 120 ASP A O    1  
ATOM 1842  C CB   . ASP A 1 120 ? 5.164   -9.780  -3.563  1.00 0.00 ? 120 ASP A CB   1  
ATOM 1843  C CG   . ASP A 1 120 ? 5.172   -11.235 -4.037  1.00 0.00 ? 120 ASP A CG   1  
ATOM 1844  O OD1  . ASP A 1 120 ? 5.711   -12.074 -3.284  1.00 0.00 ? 120 ASP A OD1  1  
ATOM 1845  O OD2  . ASP A 1 120 ? 4.638   -11.475 -5.141  1.00 0.00 ? 120 ASP A OD2  1  
ATOM 1846  H H    . ASP A 1 120 ? 3.338   -9.099  -1.976  1.00 0.00 ? 120 ASP A H    1  
ATOM 1847  H HA   . ASP A 1 120 ? 5.495   -10.550 -1.562  1.00 0.00 ? 120 ASP A HA   1  
ATOM 1848  H HB2  . ASP A 1 120 ? 4.216   -9.325  -3.851  1.00 0.00 ? 120 ASP A HB2  1  
ATOM 1849  H HB3  . ASP A 1 120 ? 5.950   -9.238  -4.090  1.00 0.00 ? 120 ASP A HB3  1  
ATOM 1850  N N    . GLU A 1 121 ? 6.501   -7.519  -2.537  1.00 0.00 ? 121 GLU A N    1  
ATOM 1851  C CA   . GLU A 1 121 ? 7.566   -6.536  -2.440  1.00 0.00 ? 121 GLU A CA   1  
ATOM 1852  C C    . GLU A 1 121 ? 7.889   -6.248  -0.972  1.00 0.00 ? 121 GLU A C    1  
ATOM 1853  O O    . GLU A 1 121 ? 9.051   -6.054  -0.615  1.00 0.00 ? 121 GLU A O    1  
ATOM 1854  C CB   . GLU A 1 121 ? 7.194   -5.250  -3.181  1.00 0.00 ? 121 GLU A CB   1  
ATOM 1855  C CG   . GLU A 1 121 ? 6.992   -5.517  -4.674  1.00 0.00 ? 121 GLU A CG   1  
ATOM 1856  C CD   . GLU A 1 121 ? 8.304   -5.348  -5.444  1.00 0.00 ? 121 GLU A CD   1  
ATOM 1857  O OE1  . GLU A 1 121 ? 9.176   -6.229  -5.280  1.00 0.00 ? 121 GLU A OE1  1  
ATOM 1858  O OE2  . GLU A 1 121 ? 8.406   -4.342  -6.178  1.00 0.00 ? 121 GLU A OE2  1  
ATOM 1859  H H    . GLU A 1 121 ? 5.750   -7.270  -3.148  1.00 0.00 ? 121 GLU A H    1  
ATOM 1860  H HA   . GLU A 1 121 ? 8.428   -6.992  -2.926  1.00 0.00 ? 121 GLU A HA   1  
ATOM 1861  H HB2  . GLU A 1 121 ? 6.282   -4.832  -2.757  1.00 0.00 ? 121 GLU A HB2  1  
ATOM 1862  H HB3  . GLU A 1 121 ? 7.980   -4.507  -3.044  1.00 0.00 ? 121 GLU A HB3  1  
ATOM 1863  H HG2  . GLU A 1 121 ? 6.610   -6.528  -4.818  1.00 0.00 ? 121 GLU A HG2  1  
ATOM 1864  H HG3  . GLU A 1 121 ? 6.243   -4.833  -5.072  1.00 0.00 ? 121 GLU A HG3  1  
ATOM 1865  N N    . LEU A 1 122 ? 6.842   -6.228  -0.161  1.00 0.00 ? 122 LEU A N    1  
ATOM 1866  C CA   . LEU A 1 122 ? 7.000   -5.967  1.259   1.00 0.00 ? 122 LEU A CA   1  
ATOM 1867  C C    . LEU A 1 122 ? 7.837   -7.083  1.888   1.00 0.00 ? 122 LEU A C    1  
ATOM 1868  O O    . LEU A 1 122 ? 8.979   -6.859  2.286   1.00 0.00 ? 122 LEU A O    1  
ATOM 1869  C CB   . LEU A 1 122 ? 5.636   -5.773  1.924   1.00 0.00 ? 122 LEU A CB   1  
ATOM 1870  C CG   . LEU A 1 122 ? 5.551   -4.657  2.967   1.00 0.00 ? 122 LEU A CG   1  
ATOM 1871  C CD1  . LEU A 1 122 ? 4.101   -4.410  3.389   1.00 0.00 ? 122 LEU A CD1  1  
ATOM 1872  C CD2  . LEU A 1 122 ? 6.453   -4.957  4.166   1.00 0.00 ? 122 LEU A CD2  1  
ATOM 1873  H H    . LEU A 1 122 ? 5.901   -6.387  -0.459  1.00 0.00 ? 122 LEU A H    1  
ATOM 1874  H HA   . LEU A 1 122 ? 7.545   -5.029  1.360   1.00 0.00 ? 122 LEU A HA   1  
ATOM 1875  H HB2  . LEU A 1 122 ? 4.900   -5.572  1.145   1.00 0.00 ? 122 LEU A HB2  1  
ATOM 1876  H HB3  . LEU A 1 122 ? 5.348   -6.711  2.399   1.00 0.00 ? 122 LEU A HB3  1  
ATOM 1877  H HG   . LEU A 1 122 ? 5.915   -3.736  2.512   1.00 0.00 ? 122 LEU A HG   1  
ATOM 1878  H HD11 . LEU A 1 122 ? 4.013   -3.414  3.822   1.00 0.00 ? 122 LEU A HD11 1  
ATOM 1879  H HD12 . LEU A 1 122 ? 3.451   -4.486  2.517   1.00 0.00 ? 122 LEU A HD12 1  
ATOM 1880  H HD13 . LEU A 1 122 ? 3.806   -5.155  4.128   1.00 0.00 ? 122 LEU A HD13 1  
ATOM 1881  H HD21 . LEU A 1 122 ? 7.314   -5.539  3.836   1.00 0.00 ? 122 LEU A HD21 1  
ATOM 1882  H HD22 . LEU A 1 122 ? 6.796   -4.020  4.606   1.00 0.00 ? 122 LEU A HD22 1  
ATOM 1883  H HD23 . LEU A 1 122 ? 5.893   -5.525  4.909   1.00 0.00 ? 122 LEU A HD23 1  
ATOM 1884  N N    . LYS A 1 123 ? 7.236   -8.262  1.959   1.00 0.00 ? 123 LYS A N    1  
ATOM 1885  C CA   . LYS A 1 123 ? 7.911   -9.413  2.533   1.00 0.00 ? 123 LYS A CA   1  
ATOM 1886  C C    . LYS A 1 123 ? 9.358   -9.450  2.037   1.00 0.00 ? 123 LYS A C    1  
ATOM 1887  O O    . LYS A 1 123 ? 10.285  -9.615  2.828   1.00 0.00 ? 123 LYS A O    1  
ATOM 1888  C CB   . LYS A 1 123 ? 7.128   -10.695 2.241   1.00 0.00 ? 123 LYS A CB   1  
ATOM 1889  C CG   . LYS A 1 123 ? 7.408   -11.762 3.300   1.00 0.00 ? 123 LYS A CG   1  
ATOM 1890  C CD   . LYS A 1 123 ? 6.105   -12.358 3.836   1.00 0.00 ? 123 LYS A CD   1  
ATOM 1891  C CE   . LYS A 1 123 ? 5.834   -13.731 3.217   1.00 0.00 ? 123 LYS A CE   1  
ATOM 1892  N NZ   . LYS A 1 123 ? 6.367   -14.805 4.084   1.00 0.00 ? 123 LYS A NZ   1  
ATOM 1893  H H    . LYS A 1 123 ? 6.307   -8.436  1.633   1.00 0.00 ? 123 LYS A H    1  
ATOM 1894  H HA   . LYS A 1 123 ? 7.920   -9.281  3.615   1.00 0.00 ? 123 LYS A HA   1  
ATOM 1895  H HB2  . LYS A 1 123 ? 6.061   -10.475 2.214   1.00 0.00 ? 123 LYS A HB2  1  
ATOM 1896  H HB3  . LYS A 1 123 ? 7.400   -11.075 1.256   1.00 0.00 ? 123 LYS A HB3  1  
ATOM 1897  H HG2  . LYS A 1 123 ? 8.024   -12.553 2.872   1.00 0.00 ? 123 LYS A HG2  1  
ATOM 1898  H HG3  . LYS A 1 123 ? 7.977   -11.325 4.121   1.00 0.00 ? 123 LYS A HG3  1  
ATOM 1899  H HD2  . LYS A 1 123 ? 6.161   -12.450 4.921   1.00 0.00 ? 123 LYS A HD2  1  
ATOM 1900  H HD3  . LYS A 1 123 ? 5.276   -11.686 3.616   1.00 0.00 ? 123 LYS A HD3  1  
ATOM 1901  H HE2  . LYS A 1 123 ? 4.762   -13.867 3.075   1.00 0.00 ? 123 LYS A HE2  1  
ATOM 1902  H HE3  . LYS A 1 123 ? 6.295   -13.789 2.231   1.00 0.00 ? 123 LYS A HE3  1  
ATOM 1903  H HZ1  . LYS A 1 123 ? 5.976   -15.683 3.806   1.00 0.00 ? 123 LYS A HZ1  1  
ATOM 1904  H HZ2  . LYS A 1 123 ? 7.363   -14.841 3.996   1.00 0.00 ? 123 LYS A HZ2  1  
ATOM 1905  H HZ3  . LYS A 1 123 ? 6.122   -14.618 5.035   1.00 0.00 ? 123 LYS A HZ3  1  
ATOM 1906  N N    . PHE A 1 124 ? 9.505   -9.295  0.729   1.00 0.00 ? 124 PHE A N    1  
ATOM 1907  C CA   . PHE A 1 124 ? 10.824  -9.308  0.118   1.00 0.00 ? 124 PHE A CA   1  
ATOM 1908  C C    . PHE A 1 124 ? 11.778  -8.365  0.852   1.00 0.00 ? 124 PHE A C    1  
ATOM 1909  O O    . PHE A 1 124 ? 12.792  -8.801  1.396   1.00 0.00 ? 124 PHE A O    1  
ATOM 1910  C CB   . PHE A 1 124 ? 10.653  -8.822  -1.323  1.00 0.00 ? 124 PHE A CB   1  
ATOM 1911  C CG   . PHE A 1 124 ? 11.973  -8.589  -2.061  1.00 0.00 ? 124 PHE A CG   1  
ATOM 1912  C CD1  . PHE A 1 124 ? 12.622  -7.401  -1.934  1.00 0.00 ? 124 PHE A CD1  1  
ATOM 1913  C CD2  . PHE A 1 124 ? 12.497  -9.570  -2.844  1.00 0.00 ? 124 PHE A CD2  1  
ATOM 1914  C CE1  . PHE A 1 124 ? 13.847  -7.184  -2.619  1.00 0.00 ? 124 PHE A CE1  1  
ATOM 1915  C CE2  . PHE A 1 124 ? 13.722  -9.353  -3.529  1.00 0.00 ? 124 PHE A CE2  1  
ATOM 1916  C CZ   . PHE A 1 124 ? 14.371  -8.165  -3.402  1.00 0.00 ? 124 PHE A CZ   1  
ATOM 1917  H H    . PHE A 1 124 ? 8.746   -9.161  0.092   1.00 0.00 ? 124 PHE A H    1  
ATOM 1918  H HA   . PHE A 1 124 ? 11.201  -10.328 0.185   1.00 0.00 ? 124 PHE A HA   1  
ATOM 1919  H HB2  . PHE A 1 124 ? 10.065  -9.554  -1.875  1.00 0.00 ? 124 PHE A HB2  1  
ATOM 1920  H HB3  . PHE A 1 124 ? 10.083  -7.893  -1.317  1.00 0.00 ? 124 PHE A HB3  1  
ATOM 1921  H HD1  . PHE A 1 124 ? 12.203  -6.615  -1.306  1.00 0.00 ? 124 PHE A HD1  1  
ATOM 1922  H HD2  . PHE A 1 124 ? 11.977  -10.522 -2.946  1.00 0.00 ? 124 PHE A HD2  1  
ATOM 1923  H HE1  . PHE A 1 124 ? 14.368  -6.232  -2.517  1.00 0.00 ? 124 PHE A HE1  1  
ATOM 1924  H HE2  . PHE A 1 124 ? 14.142  -10.139 -4.157  1.00 0.00 ? 124 PHE A HE2  1  
ATOM 1925  H HZ   . PHE A 1 124 ? 15.311  -7.999  -3.928  1.00 0.00 ? 124 PHE A HZ   1  
ATOM 1926  N N    . VAL A 1 125 ? 11.421  -7.089  0.845   1.00 0.00 ? 125 VAL A N    1  
ATOM 1927  C CA   . VAL A 1 125 ? 12.233  -6.080  1.503   1.00 0.00 ? 125 VAL A CA   1  
ATOM 1928  C C    . VAL A 1 125 ? 12.261  -6.357  3.008   1.00 0.00 ? 125 VAL A C    1  
ATOM 1929  O O    . VAL A 1 125 ? 13.218  -5.996  3.691   1.00 0.00 ? 125 VAL A O    1  
ATOM 1930  C CB   . VAL A 1 125 ? 11.710  -4.683  1.162   1.00 0.00 ? 125 VAL A CB   1  
ATOM 1931  C CG1  . VAL A 1 125 ? 10.638  -4.240  2.160   1.00 0.00 ? 125 VAL A CG1  1  
ATOM 1932  C CG2  . VAL A 1 125 ? 12.854  -3.669  1.102   1.00 0.00 ? 125 VAL A CG2  1  
ATOM 1933  H H    . VAL A 1 125 ? 10.595  -6.742  0.400   1.00 0.00 ? 125 VAL A H    1  
ATOM 1934  H HA   . VAL A 1 125 ? 13.246  -6.166  1.111   1.00 0.00 ? 125 VAL A HA   1  
ATOM 1935  H HB   . VAL A 1 125 ? 11.251  -4.729  0.175   1.00 0.00 ? 125 VAL A HB   1  
ATOM 1936  H HG11 . VAL A 1 125 ? 9.740   -4.842  2.019   1.00 0.00 ? 125 VAL A HG11 1  
ATOM 1937  H HG12 . VAL A 1 125 ? 11.009  -4.374  3.176   1.00 0.00 ? 125 VAL A HG12 1  
ATOM 1938  H HG13 . VAL A 1 125 ? 10.400  -3.190  1.995   1.00 0.00 ? 125 VAL A HG13 1  
ATOM 1939  H HG21 . VAL A 1 125 ? 12.666  -2.866  1.814   1.00 0.00 ? 125 VAL A HG21 1  
ATOM 1940  H HG22 . VAL A 1 125 ? 13.792  -4.165  1.352   1.00 0.00 ? 125 VAL A HG22 1  
ATOM 1941  H HG23 . VAL A 1 125 ? 12.920  -3.255  0.096   1.00 0.00 ? 125 VAL A HG23 1  
ATOM 1942  N N    . ALA A 1 126 ? 11.201  -6.996  3.480   1.00 0.00 ? 126 ALA A N    1  
ATOM 1943  C CA   . ALA A 1 126 ? 11.092  -7.325  4.891   1.00 0.00 ? 126 ALA A CA   1  
ATOM 1944  C C    . ALA A 1 126 ? 12.151  -8.370  5.249   1.00 0.00 ? 126 ALA A C    1  
ATOM 1945  O O    . ALA A 1 126 ? 13.009  -8.126  6.095   1.00 0.00 ? 126 ALA A O    1  
ATOM 1946  C CB   . ALA A 1 126 ? 9.672   -7.805  5.195   1.00 0.00 ? 126 ALA A CB   1  
ATOM 1947  H H    . ALA A 1 126 ? 10.427  -7.286  2.917   1.00 0.00 ? 126 ALA A H    1  
ATOM 1948  H HA   . ALA A 1 126 ? 11.285  -6.416  5.460   1.00 0.00 ? 126 ALA A HA   1  
ATOM 1949  H HB1  . ALA A 1 126 ? 9.060   -7.723  4.297   1.00 0.00 ? 126 ALA A HB1  1  
ATOM 1950  H HB2  . ALA A 1 126 ? 9.702   -8.845  5.521   1.00 0.00 ? 126 ALA A HB2  1  
ATOM 1951  H HB3  . ALA A 1 126 ? 9.242   -7.190  5.985   1.00 0.00 ? 126 ALA A HB3  1  
ATOM 1952  N N    . SER A 1 127 ? 12.055  -9.514  4.586   1.00 0.00 ? 127 SER A N    1  
ATOM 1953  C CA   . SER A 1 127 ? 12.993  -10.597 4.824   1.00 0.00 ? 127 SER A CA   1  
ATOM 1954  C C    . SER A 1 127 ? 14.421  -10.124 4.543   1.00 0.00 ? 127 SER A C    1  
ATOM 1955  O O    . SER A 1 127 ? 15.303  -10.267 5.388   1.00 0.00 ? 127 SER A O    1  
ATOM 1956  C CB   . SER A 1 127 ? 12.658  -11.815 3.960   1.00 0.00 ? 127 SER A CB   1  
ATOM 1957  O OG   . SER A 1 127 ? 12.979  -13.039 4.616   1.00 0.00 ? 127 SER A OG   1  
ATOM 1958  H H    . SER A 1 127 ? 11.354  -9.705  3.899   1.00 0.00 ? 127 SER A H    1  
ATOM 1959  H HA   . SER A 1 127 ? 12.875  -10.856 5.876   1.00 0.00 ? 127 SER A HA   1  
ATOM 1960  H HB2  . SER A 1 127 ? 11.597  -11.804 3.713   1.00 0.00 ? 127 SER A HB2  1  
ATOM 1961  H HB3  . SER A 1 127 ? 13.205  -11.754 3.019   1.00 0.00 ? 127 SER A HB3  1  
ATOM 1962  H HG   . SER A 1 127 ? 13.673  -13.535 4.095   1.00 0.00 ? 127 SER A HG   1  
ATOM 1963  N N    . GLN A 1 128 ? 14.604  -9.570  3.354   1.00 0.00 ? 128 GLN A N    1  
ATOM 1964  C CA   . GLN A 1 128 ? 15.909  -9.075  2.951   1.00 0.00 ? 128 GLN A CA   1  
ATOM 1965  C C    . GLN A 1 128 ? 16.611  -8.407  4.135   1.00 0.00 ? 128 GLN A C    1  
ATOM 1966  O O    . GLN A 1 128 ? 17.786  -8.668  4.392   1.00 0.00 ? 128 GLN A O    1  
ATOM 1967  C CB   . GLN A 1 128 ? 15.790  -8.111  1.769   1.00 0.00 ? 128 GLN A CB   1  
ATOM 1968  C CG   . GLN A 1 128 ? 15.972  -8.848  0.441   1.00 0.00 ? 128 GLN A CG   1  
ATOM 1969  C CD   . GLN A 1 128 ? 16.736  -7.984  -0.565  1.00 0.00 ? 128 GLN A CD   1  
ATOM 1970  O OE1  . GLN A 1 128 ? 16.619  -6.770  -0.595  1.00 0.00 ? 128 GLN A OE1  1  
ATOM 1971  N NE2  . GLN A 1 128 ? 17.524  -8.675  -1.383  1.00 0.00 ? 128 GLN A NE2  1  
ATOM 1972  H H    . GLN A 1 128 ? 13.881  -9.458  2.672   1.00 0.00 ? 128 GLN A H    1  
ATOM 1973  H HA   . GLN A 1 128 ? 16.469  -9.957  2.638   1.00 0.00 ? 128 GLN A HA   1  
ATOM 1974  H HB2  . GLN A 1 128 ? 14.814  -7.625  1.789   1.00 0.00 ? 128 GLN A HB2  1  
ATOM 1975  H HB3  . GLN A 1 128 ? 16.539  -7.325  1.859   1.00 0.00 ? 128 GLN A HB3  1  
ATOM 1976  H HG2  . GLN A 1 128 ? 16.511  -9.780  0.608   1.00 0.00 ? 128 GLN A HG2  1  
ATOM 1977  H HG3  . GLN A 1 128 ? 14.997  -9.112  0.031   1.00 0.00 ? 128 GLN A HG3  1  
ATOM 1978  H HE21 . GLN A 1 128 ? 17.575  -9.671  -1.306  1.00 0.00 ? 128 GLN A HE21 1  
ATOM 1979  H HE22 . GLN A 1 128 ? 18.065  -8.199  -2.077  1.00 0.00 ? 128 GLN A HE22 1  
ATOM 1980  N N    . PHE A 1 129 ? 15.863  -7.559  4.824   1.00 0.00 ? 129 PHE A N    1  
ATOM 1981  C CA   . PHE A 1 129 ? 16.399  -6.852  5.975   1.00 0.00 ? 129 PHE A CA   1  
ATOM 1982  C C    . PHE A 1 129 ? 16.519  -7.782  7.183   1.00 0.00 ? 129 PHE A C    1  
ATOM 1983  O O    . PHE A 1 129 ? 17.598  -7.925  7.756   1.00 0.00 ? 129 PHE A O    1  
ATOM 1984  C CB   . PHE A 1 129 ? 15.415  -5.728  6.307   1.00 0.00 ? 129 PHE A CB   1  
ATOM 1985  C CG   . PHE A 1 129 ? 16.080  -4.374  6.562   1.00 0.00 ? 129 PHE A CG   1  
ATOM 1986  C CD1  . PHE A 1 129 ? 16.551  -3.640  5.518   1.00 0.00 ? 129 PHE A CD1  1  
ATOM 1987  C CD2  . PHE A 1 129 ? 16.201  -3.904  7.833   1.00 0.00 ? 129 PHE A CD2  1  
ATOM 1988  C CE1  . PHE A 1 129 ? 17.168  -2.383  5.755   1.00 0.00 ? 129 PHE A CE1  1  
ATOM 1989  C CE2  . PHE A 1 129 ? 16.819  -2.648  8.070   1.00 0.00 ? 129 PHE A CE2  1  
ATOM 1990  C CZ   . PHE A 1 129 ? 17.289  -1.914  7.026   1.00 0.00 ? 129 PHE A CZ   1  
ATOM 1991  H H    . PHE A 1 129 ? 14.908  -7.353  4.608   1.00 0.00 ? 129 PHE A H    1  
ATOM 1992  H HA   . PHE A 1 129 ? 17.388  -6.488  5.699   1.00 0.00 ? 129 PHE A HA   1  
ATOM 1993  H HB2  . PHE A 1 129 ? 14.707  -5.624  5.485   1.00 0.00 ? 129 PHE A HB2  1  
ATOM 1994  H HB3  . PHE A 1 129 ? 14.840  -6.011  7.189   1.00 0.00 ? 129 PHE A HB3  1  
ATOM 1995  H HD1  . PHE A 1 129 ? 16.454  -4.016  4.500   1.00 0.00 ? 129 PHE A HD1  1  
ATOM 1996  H HD2  . PHE A 1 129 ? 15.824  -4.493  8.669   1.00 0.00 ? 129 PHE A HD2  1  
ATOM 1997  H HE1  . PHE A 1 129 ? 17.546  -1.795  4.919   1.00 0.00 ? 129 PHE A HE1  1  
ATOM 1998  H HE2  . PHE A 1 129 ? 16.915  -2.271  9.088   1.00 0.00 ? 129 PHE A HE2  1  
ATOM 1999  H HZ   . PHE A 1 129 ? 17.763  -0.949  7.208   1.00 0.00 ? 129 PHE A HZ   1  
ATOM 2000  N N    . ARG A 1 130 ? 15.395  -8.390  7.536   1.00 0.00 ? 130 ARG A N    1  
ATOM 2001  C CA   . ARG A 1 130 ? 15.361  -9.303  8.666   1.00 0.00 ? 130 ARG A CA   1  
ATOM 2002  C C    . ARG A 1 130 ? 16.197  -8.748  9.821   1.00 0.00 ? 130 ARG A C    1  
ATOM 2003  O O    . ARG A 1 130 ? 17.374  -9.077  9.954   1.00 0.00 ? 130 ARG A O    1  
ATOM 2004  C CB   . ARG A 1 130 ? 15.895  -10.682 8.276   1.00 0.00 ? 130 ARG A CB   1  
ATOM 2005  C CG   . ARG A 1 130 ? 14.762  -11.709 8.208   1.00 0.00 ? 130 ARG A CG   1  
ATOM 2006  C CD   . ARG A 1 130 ? 15.317  -13.131 8.098   1.00 0.00 ? 130 ARG A CD   1  
ATOM 2007  N NE   . ARG A 1 130 ? 14.569  -13.888 7.069   1.00 0.00 ? 130 ARG A NE   1  
ATOM 2008  C CZ   . ARG A 1 130 ? 14.615  -15.220 6.936   1.00 0.00 ? 130 ARG A CZ   1  
ATOM 2009  N NH1  . ARG A 1 130 ? 15.372  -15.951 7.766   1.00 0.00 ? 130 ARG A NH1  1  
ATOM 2010  N NH2  . ARG A 1 130 ? 13.903  -15.822 5.974   1.00 0.00 ? 130 ARG A NH2  1  
ATOM 2011  H H    . ARG A 1 130 ? 14.522  -8.268  7.064   1.00 0.00 ? 130 ARG A H    1  
ATOM 2012  H HA   . ARG A 1 130 ? 14.308  -9.368  8.939   1.00 0.00 ? 130 ARG A HA   1  
ATOM 2013  H HB2  . ARG A 1 130 ? 16.395  -10.623 7.309   1.00 0.00 ? 130 ARG A HB2  1  
ATOM 2014  H HB3  . ARG A 1 130 ? 16.641  -11.006 9.002   1.00 0.00 ? 130 ARG A HB3  1  
ATOM 2015  H HG2  . ARG A 1 130 ? 14.137  -11.626 9.097   1.00 0.00 ? 130 ARG A HG2  1  
ATOM 2016  H HG3  . ARG A 1 130 ? 14.125  -11.496 7.349   1.00 0.00 ? 130 ARG A HG3  1  
ATOM 2017  H HD2  . ARG A 1 130 ? 16.375  -13.098 7.840   1.00 0.00 ? 130 ARG A HD2  1  
ATOM 2018  H HD3  . ARG A 1 130 ? 15.239  -13.636 9.061   1.00 0.00 ? 130 ARG A HD3  1  
ATOM 2019  H HE   . ARG A 1 130 ? 13.995  -13.373 6.434   1.00 0.00 ? 130 ARG A HE   1  
ATOM 2020  H HH11 . ARG A 1 130 ? 15.903  -15.502 8.484   1.00 0.00 ? 130 ARG A HH11 1  
ATOM 2021  H HH12 . ARG A 1 130 ? 15.405  -16.946 7.667   1.00 0.00 ? 130 ARG A HH12 1  
ATOM 2022  H HH21 . ARG A 1 130 ? 13.338  -15.277 5.354   1.00 0.00 ? 130 ARG A HH21 1  
ATOM 2023  H HH22 . ARG A 1 130 ? 13.937  -16.817 5.874   1.00 0.00 ? 130 ARG A HH22 1  
ATOM 2024  N N    . ARG A 1 131 ? 15.554  -7.916  10.628  1.00 0.00 ? 131 ARG A N    1  
ATOM 2025  C CA   . ARG A 1 131 ? 16.224  -7.313  11.768  1.00 0.00 ? 131 ARG A CA   1  
ATOM 2026  C C    . ARG A 1 131 ? 15.368  -7.465  13.027  1.00 0.00 ? 131 ARG A C    1  
ATOM 2027  O O    . ARG A 1 131 ? 14.478  -6.654  13.279  1.00 0.00 ? 131 ARG A O    1  
ATOM 2028  C CB   . ARG A 1 131 ? 16.499  -5.828  11.523  1.00 0.00 ? 131 ARG A CB   1  
ATOM 2029  C CG   . ARG A 1 131 ? 18.001  -5.539  11.533  1.00 0.00 ? 131 ARG A CG   1  
ATOM 2030  C CD   . ARG A 1 131 ? 18.566  -5.622  12.952  1.00 0.00 ? 131 ARG A CD   1  
ATOM 2031  N NE   . ARG A 1 131 ? 19.516  -4.511  13.184  1.00 0.00 ? 131 ARG A NE   1  
ATOM 2032  C CZ   . ARG A 1 131 ? 19.917  -4.106  14.397  1.00 0.00 ? 131 ARG A CZ   1  
ATOM 2033  N NH1  . ARG A 1 131 ? 19.452  -4.716  15.495  1.00 0.00 ? 131 ARG A NH1  1  
ATOM 2034  N NH2  . ARG A 1 131 ? 20.782  -3.089  14.511  1.00 0.00 ? 131 ARG A NH2  1  
ATOM 2035  H H    . ARG A 1 131 ? 14.596  -7.654  10.513  1.00 0.00 ? 131 ARG A H    1  
ATOM 2036  H HA   . ARG A 1 131 ? 17.161  -7.860  11.862  1.00 0.00 ? 131 ARG A HA   1  
ATOM 2037  H HB2  . ARG A 1 131 ? 16.074  -5.529  10.564  1.00 0.00 ? 131 ARG A HB2  1  
ATOM 2038  H HB3  . ARG A 1 131 ? 16.005  -5.231  12.290  1.00 0.00 ? 131 ARG A HB3  1  
ATOM 2039  H HG2  . ARG A 1 131 ? 18.516  -6.254  10.891  1.00 0.00 ? 131 ARG A HG2  1  
ATOM 2040  H HG3  . ARG A 1 131 ? 18.187  -4.548  11.120  1.00 0.00 ? 131 ARG A HG3  1  
ATOM 2041  H HD2  . ARG A 1 131 ? 17.754  -5.574  13.679  1.00 0.00 ? 131 ARG A HD2  1  
ATOM 2042  H HD3  . ARG A 1 131 ? 19.068  -6.578  13.098  1.00 0.00 ? 131 ARG A HD3  1  
ATOM 2043  H HE   . ARG A 1 131 ? 19.883  -4.033  12.385  1.00 0.00 ? 131 ARG A HE   1  
ATOM 2044  H HH11 . ARG A 1 131 ? 18.806  -5.475  15.409  1.00 0.00 ? 131 ARG A HH11 1  
ATOM 2045  H HH12 . ARG A 1 131 ? 19.750  -4.414  16.400  1.00 0.00 ? 131 ARG A HH12 1  
ATOM 2046  H HH21 . ARG A 1 131 ? 21.130  -2.633  13.692  1.00 0.00 ? 131 ARG A HH21 1  
ATOM 2047  H HH22 . ARG A 1 131 ? 21.081  -2.786  15.416  1.00 0.00 ? 131 ARG A HH22 1  
ATOM 2048  N N    . SER A 1 132 ? 15.668  -8.510  13.785  1.00 0.00 ? 132 SER A N    1  
ATOM 2049  C CA   . SER A 1 132 ? 14.937  -8.779  15.012  1.00 0.00 ? 132 SER A CA   1  
ATOM 2050  C C    . SER A 1 132 ? 15.897  -9.279  16.093  1.00 0.00 ? 132 SER A C    1  
ATOM 2051  O O    . SER A 1 132 ? 15.977  -8.699  17.175  1.00 0.00 ? 132 SER A O    1  
ATOM 2052  C CB   . SER A 1 132 ? 13.823  -9.800  14.777  1.00 0.00 ? 132 SER A CB   1  
ATOM 2053  O OG   . SER A 1 132 ? 13.289  -10.298 16.000  1.00 0.00 ? 132 SER A OG   1  
ATOM 2054  H H    . SER A 1 132 ? 16.393  -9.165  13.573  1.00 0.00 ? 132 SER A H    1  
ATOM 2055  H HA   . SER A 1 132 ? 14.499  -7.824  15.302  1.00 0.00 ? 132 SER A HA   1  
ATOM 2056  H HB2  . SER A 1 132 ? 13.025  -9.339  14.194  1.00 0.00 ? 132 SER A HB2  1  
ATOM 2057  H HB3  . SER A 1 132 ? 14.210  -10.630 14.186  1.00 0.00 ? 132 SER A HB3  1  
ATOM 2058  H HG   . SER A 1 132 ? 13.042  -11.262 15.899  1.00 0.00 ? 132 SER A HG   1  
ATOM 2059  N N    . GLY A 1 133 ? 16.601  -10.352 15.764  1.00 0.00 ? 133 GLY A N    1  
ATOM 2060  C CA   . GLY A 1 133 ? 17.552  -10.937 16.693  1.00 0.00 ? 133 GLY A CA   1  
ATOM 2061  C C    . GLY A 1 133 ? 16.835  -11.751 17.772  1.00 0.00 ? 133 GLY A C    1  
ATOM 2062  O O    . GLY A 1 133 ? 15.619  -11.927 17.716  1.00 0.00 ? 133 GLY A O    1  
ATOM 2063  H H    . GLY A 1 133 ? 16.531  -10.818 14.882  1.00 0.00 ? 133 GLY A H    1  
ATOM 2064  H HA2  . GLY A 1 133 ? 18.248  -11.578 16.152  1.00 0.00 ? 133 GLY A HA2  1  
ATOM 2065  H HA3  . GLY A 1 133 ? 18.143  -10.149 17.160  1.00 0.00 ? 133 GLY A HA3  1  
ATOM 2066  N N    . PRO A 1 134 ? 17.639  -12.238 18.755  1.00 0.00 ? 134 PRO A N    1  
ATOM 2067  C CA   . PRO A 1 134 ? 17.094  -13.029 19.845  1.00 0.00 ? 134 PRO A CA   1  
ATOM 2068  C C    . PRO A 1 134 ? 16.349  -12.143 20.846  1.00 0.00 ? 134 PRO A C    1  
ATOM 2069  O O    . PRO A 1 134 ? 16.674  -12.132 22.032  1.00 0.00 ? 134 PRO A O    1  
ATOM 2070  C CB   . PRO A 1 134 ? 18.292  -13.737 20.455  1.00 0.00 ? 134 PRO A CB   1  
ATOM 2071  C CG   . PRO A 1 134 ? 19.515  -12.964 19.988  1.00 0.00 ? 134 PRO A CG   1  
ATOM 2072  C CD   . PRO A 1 134 ? 19.083  -12.050 18.854  1.00 0.00 ? 134 PRO A CD   1  
ATOM 2073  H HA   . PRO A 1 134 ? 16.417  -13.678 19.498  1.00 0.00 ? 134 PRO A HA   1  
ATOM 2074  H HB2  . PRO A 1 134 ? 18.228  -13.746 21.543  1.00 0.00 ? 134 PRO A HB2  1  
ATOM 2075  H HB3  . PRO A 1 134 ? 18.339  -14.776 20.130  1.00 0.00 ? 134 PRO A HB3  1  
ATOM 2076  H HG2  . PRO A 1 134 ? 19.935  -12.382 20.809  1.00 0.00 ? 134 PRO A HG2  1  
ATOM 2077  H HG3  . PRO A 1 134 ? 20.294  -13.649 19.652  1.00 0.00 ? 134 PRO A HG3  1  
ATOM 2078  H HD2  . PRO A 1 134 ? 19.334  -11.010 19.065  1.00 0.00 ? 134 PRO A HD2  1  
ATOM 2079  H HD3  . PRO A 1 134 ? 19.582  -12.314 17.921  1.00 0.00 ? 134 PRO A HD3  1  
ATOM 2080  N N    . SER A 1 135 ? 15.364  -11.422 20.331  1.00 0.00 ? 135 SER A N    1  
ATOM 2081  C CA   . SER A 1 135 ? 14.571  -10.535 21.165  1.00 0.00 ? 135 SER A CA   1  
ATOM 2082  C C    . SER A 1 135 ? 15.468  -9.838  22.189  1.00 0.00 ? 135 SER A C    1  
ATOM 2083  O O    . SER A 1 135 ? 15.628  -10.319 23.309  1.00 0.00 ? 135 SER A O    1  
ATOM 2084  C CB   . SER A 1 135 ? 13.452  -11.300 21.874  1.00 0.00 ? 135 SER A CB   1  
ATOM 2085  O OG   . SER A 1 135 ? 12.161  -10.839 21.486  1.00 0.00 ? 135 SER A OG   1  
ATOM 2086  H H    . SER A 1 135 ? 15.106  -11.437 19.365  1.00 0.00 ? 135 SER A H    1  
ATOM 2087  H HA   . SER A 1 135 ? 14.135  -9.808  20.480  1.00 0.00 ? 135 SER A HA   1  
ATOM 2088  H HB2  . SER A 1 135 ? 13.540  -12.363 21.648  1.00 0.00 ? 135 SER A HB2  1  
ATOM 2089  H HB3  . SER A 1 135 ? 13.566  -11.193 22.952  1.00 0.00 ? 135 SER A HB3  1  
ATOM 2090  H HG   . SER A 1 135 ? 11.539  -11.614 21.375  1.00 0.00 ? 135 SER A HG   1  
ATOM 2091  N N    . SER A 1 136 ? 16.031  -8.714  21.768  1.00 0.00 ? 136 SER A N    1  
ATOM 2092  C CA   . SER A 1 136 ? 16.908  -7.946  22.634  1.00 0.00 ? 136 SER A CA   1  
ATOM 2093  C C    . SER A 1 136 ? 16.209  -6.661  23.080  1.00 0.00 ? 136 SER A C    1  
ATOM 2094  O O    . SER A 1 136 ? 15.626  -5.951  22.262  1.00 0.00 ? 136 SER A O    1  
ATOM 2095  C CB   . SER A 1 136 ? 18.226  -7.616  21.930  1.00 0.00 ? 136 SER A CB   1  
ATOM 2096  O OG   . SER A 1 136 ? 18.082  -6.545  21.001  1.00 0.00 ? 136 SER A OG   1  
ATOM 2097  H H    . SER A 1 136 ? 15.896  -8.330  20.855  1.00 0.00 ? 136 SER A H    1  
ATOM 2098  H HA   . SER A 1 136 ? 17.106  -8.591  23.490  1.00 0.00 ? 136 SER A HA   1  
ATOM 2099  H HB2  . SER A 1 136 ? 18.978  -7.352  22.674  1.00 0.00 ? 136 SER A HB2  1  
ATOM 2100  H HB3  . SER A 1 136 ? 18.591  -8.501  21.410  1.00 0.00 ? 136 SER A HB3  1  
ATOM 2101  H HG   . SER A 1 136 ? 17.896  -6.908  20.088  1.00 0.00 ? 136 SER A HG   1  
ATOM 2102  N N    . GLY A 1 137 ? 16.289  -6.400  24.377  1.00 0.00 ? 137 GLY A N    1  
ATOM 2103  C CA   . GLY A 1 137 ? 15.671  -5.213  24.942  1.00 0.00 ? 137 GLY A CA   1  
ATOM 2104  C C    . GLY A 1 137 ? 15.115  -5.496  26.339  1.00 0.00 ? 137 GLY A C    1  
ATOM 2105  O O    . GLY A 1 137 ? 14.020  -6.039  26.476  1.00 0.00 ? 137 GLY A O    1  
ATOM 2106  H H    . GLY A 1 137 ? 16.765  -6.983  25.036  1.00 0.00 ? 137 GLY A H    1  
ATOM 2107  H HA2  . GLY A 1 137 ? 16.403  -4.407  24.994  1.00 0.00 ? 137 GLY A HA2  1  
ATOM 2108  H HA3  . GLY A 1 137 ? 14.868  -4.872  24.289  1.00 0.00 ? 137 GLY A HA3  1  
ATOM 2109  N N    . GLY A 1 1   ? 6.107   15.318  -6.831  1.00 0.00 ? 1   GLY A N    2  
ATOM 2110  C CA   . GLY A 1 1   ? 5.911   15.568  -5.413  1.00 0.00 ? 1   GLY A CA   2  
ATOM 2111  C C    . GLY A 1 1   ? 7.169   15.219  -4.616  1.00 0.00 ? 1   GLY A C    2  
ATOM 2112  O O    . GLY A 1 1   ? 7.670   14.098  -4.698  1.00 0.00 ? 1   GLY A O    2  
ATOM 2113  H H1   . GLY A 1 1   ? 5.980   14.368  -7.115  1.00 0.00 ? 1   GLY A H1   2  
ATOM 2114  H HA2  . GLY A 1 1   ? 5.656   16.616  -5.257  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 2115  H HA3  . GLY A 1 1   ? 5.070   14.978  -5.049  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 2116  N N    . SER A 1 2   ? 7.645   16.200  -3.862  1.00 0.00 ? 2   SER A N    2  
ATOM 2117  C CA   . SER A 1 2   ? 8.835   16.010  -3.051  1.00 0.00 ? 2   SER A CA   2  
ATOM 2118  C C    . SER A 1 2   ? 9.056   17.230  -2.154  1.00 0.00 ? 2   SER A C    2  
ATOM 2119  O O    . SER A 1 2   ? 9.879   18.090  -2.461  1.00 0.00 ? 2   SER A O    2  
ATOM 2120  C CB   . SER A 1 2   ? 10.065  15.766  -3.927  1.00 0.00 ? 2   SER A CB   2  
ATOM 2121  O OG   . SER A 1 2   ? 10.324  16.860  -4.801  1.00 0.00 ? 2   SER A OG   2  
ATOM 2122  H H    . SER A 1 2   ? 7.232   17.108  -3.801  1.00 0.00 ? 2   SER A H    2  
ATOM 2123  H HA   . SER A 1 2   ? 8.636   15.124  -2.449  1.00 0.00 ? 2   SER A HA   2  
ATOM 2124  H HB2  . SER A 1 2   ? 10.935  15.596  -3.291  1.00 0.00 ? 2   SER A HB2  2  
ATOM 2125  H HB3  . SER A 1 2   ? 9.918   14.859  -4.514  1.00 0.00 ? 2   SER A HB3  2  
ATOM 2126  H HG   . SER A 1 2   ? 11.310  16.976  -4.922  1.00 0.00 ? 2   SER A HG   2  
ATOM 2127  N N    . SER A 1 3   ? 8.306   17.265  -1.062  1.00 0.00 ? 3   SER A N    2  
ATOM 2128  C CA   . SER A 1 3   ? 8.409   18.365  -0.118  1.00 0.00 ? 3   SER A CA   2  
ATOM 2129  C C    . SER A 1 3   ? 7.877   17.933  1.249   1.00 0.00 ? 3   SER A C    2  
ATOM 2130  O O    . SER A 1 3   ? 8.599   17.981  2.244   1.00 0.00 ? 3   SER A O    2  
ATOM 2131  C CB   . SER A 1 3   ? 7.649   19.595  -0.619  1.00 0.00 ? 3   SER A CB   2  
ATOM 2132  O OG   . SER A 1 3   ? 8.258   20.810  -0.192  1.00 0.00 ? 3   SER A OG   2  
ATOM 2133  H H    . SER A 1 3   ? 7.638   16.561  -0.819  1.00 0.00 ? 3   SER A H    2  
ATOM 2134  H HA   . SER A 1 3   ? 9.473   18.596  -0.059  1.00 0.00 ? 3   SER A HA   2  
ATOM 2135  H HB2  . SER A 1 3   ? 7.604   19.574  -1.708  1.00 0.00 ? 3   SER A HB2  2  
ATOM 2136  H HB3  . SER A 1 3   ? 6.621   19.558  -0.258  1.00 0.00 ? 3   SER A HB3  2  
ATOM 2137  H HG   . SER A 1 3   ? 8.424   21.404  -0.979  1.00 0.00 ? 3   SER A HG   2  
ATOM 2138  N N    . GLY A 1 4   ? 6.618   17.520  1.255   1.00 0.00 ? 4   GLY A N    2  
ATOM 2139  C CA   . GLY A 1 4   ? 5.981   17.079  2.484   1.00 0.00 ? 4   GLY A CA   2  
ATOM 2140  C C    . GLY A 1 4   ? 4.818   16.129  2.189   1.00 0.00 ? 4   GLY A C    2  
ATOM 2141  O O    . GLY A 1 4   ? 4.075   16.331  1.229   1.00 0.00 ? 4   GLY A O    2  
ATOM 2142  H H    . GLY A 1 4   ? 6.038   17.483  0.442   1.00 0.00 ? 4   GLY A H    2  
ATOM 2143  H HA2  . GLY A 1 4   ? 6.712   16.578  3.118   1.00 0.00 ? 4   GLY A HA2  2  
ATOM 2144  H HA3  . GLY A 1 4   ? 5.617   17.943  3.040   1.00 0.00 ? 4   GLY A HA3  2  
ATOM 2145  N N    . SER A 1 5   ? 4.696   15.114  3.032   1.00 0.00 ? 5   SER A N    2  
ATOM 2146  C CA   . SER A 1 5   ? 3.636   14.133  2.874   1.00 0.00 ? 5   SER A CA   2  
ATOM 2147  C C    . SER A 1 5   ? 2.634   14.255  4.024   1.00 0.00 ? 5   SER A C    2  
ATOM 2148  O O    . SER A 1 5   ? 1.450   14.499  3.796   1.00 0.00 ? 5   SER A O    2  
ATOM 2149  C CB   . SER A 1 5   ? 4.204   12.714  2.813   1.00 0.00 ? 5   SER A CB   2  
ATOM 2150  O OG   . SER A 1 5   ? 5.269   12.605  1.872   1.00 0.00 ? 5   SER A OG   2  
ATOM 2151  H H    . SER A 1 5   ? 5.304   14.958  3.810   1.00 0.00 ? 5   SER A H    2  
ATOM 2152  H HA   . SER A 1 5   ? 3.159   14.374  1.924   1.00 0.00 ? 5   SER A HA   2  
ATOM 2153  H HB2  . SER A 1 5   ? 4.562   12.424  3.801   1.00 0.00 ? 5   SER A HB2  2  
ATOM 2154  H HB3  . SER A 1 5   ? 3.411   12.017  2.544   1.00 0.00 ? 5   SER A HB3  2  
ATOM 2155  H HG   . SER A 1 5   ? 5.396   11.649  1.608   1.00 0.00 ? 5   SER A HG   2  
ATOM 2156  N N    . SER A 1 6   ? 3.146   14.079  5.233   1.00 0.00 ? 6   SER A N    2  
ATOM 2157  C CA   . SER A 1 6   ? 2.310   14.166  6.419   1.00 0.00 ? 6   SER A CA   2  
ATOM 2158  C C    . SER A 1 6   ? 1.330   12.992  6.456   1.00 0.00 ? 6   SER A C    2  
ATOM 2159  O O    . SER A 1 6   ? 0.770   12.614  5.428   1.00 0.00 ? 6   SER A O    2  
ATOM 2160  C CB   . SER A 1 6   ? 1.550   15.493  6.461   1.00 0.00 ? 6   SER A CB   2  
ATOM 2161  O OG   . SER A 1 6   ? 1.829   16.231  7.647   1.00 0.00 ? 6   SER A OG   2  
ATOM 2162  H H    . SER A 1 6   ? 4.110   13.881  5.409   1.00 0.00 ? 6   SER A H    2  
ATOM 2163  H HA   . SER A 1 6   ? 2.999   14.116  7.262   1.00 0.00 ? 6   SER A HA   2  
ATOM 2164  H HB2  . SER A 1 6   ? 1.818   16.092  5.590   1.00 0.00 ? 6   SER A HB2  2  
ATOM 2165  H HB3  . SER A 1 6   ? 0.479   15.300  6.397   1.00 0.00 ? 6   SER A HB3  2  
ATOM 2166  H HG   . SER A 1 6   ? 2.173   15.618  8.358   1.00 0.00 ? 6   SER A HG   2  
ATOM 2167  N N    . GLY A 1 7   ? 1.154   12.447  7.651   1.00 0.00 ? 7   GLY A N    2  
ATOM 2168  C CA   . GLY A 1 7   ? 0.252   11.323  7.835   1.00 0.00 ? 7   GLY A CA   2  
ATOM 2169  C C    . GLY A 1 7   ? 0.805   10.340  8.868   1.00 0.00 ? 7   GLY A C    2  
ATOM 2170  O O    . GLY A 1 7   ? 0.219   10.159  9.935   1.00 0.00 ? 7   GLY A O    2  
ATOM 2171  H H    . GLY A 1 7   ? 1.614   12.761  8.482   1.00 0.00 ? 7   GLY A H    2  
ATOM 2172  H HA2  . GLY A 1 7   ? -0.724  11.685  8.159   1.00 0.00 ? 7   GLY A HA2  2  
ATOM 2173  H HA3  . GLY A 1 7   ? 0.103   10.812  6.884   1.00 0.00 ? 7   GLY A HA3  2  
ATOM 2174  N N    . VAL A 1 8   ? 1.927   9.729   8.516   1.00 0.00 ? 8   VAL A N    2  
ATOM 2175  C CA   . VAL A 1 8   ? 2.566   8.769   9.399   1.00 0.00 ? 8   VAL A CA   2  
ATOM 2176  C C    . VAL A 1 8   ? 3.203   9.510   10.576  1.00 0.00 ? 8   VAL A C    2  
ATOM 2177  O O    . VAL A 1 8   ? 4.412   9.737   10.590  1.00 0.00 ? 8   VAL A O    2  
ATOM 2178  C CB   . VAL A 1 8   ? 3.568   7.921   8.613   1.00 0.00 ? 8   VAL A CB   2  
ATOM 2179  C CG1  . VAL A 1 8   ? 4.023   6.711   9.431   1.00 0.00 ? 8   VAL A CG1  2  
ATOM 2180  C CG2  . VAL A 1 8   ? 2.981   7.485   7.269   1.00 0.00 ? 8   VAL A CG2  2  
ATOM 2181  H H    . VAL A 1 8   ? 2.397   9.882   7.646   1.00 0.00 ? 8   VAL A H    2  
ATOM 2182  H HA   . VAL A 1 8   ? 1.789   8.106   9.781   1.00 0.00 ? 8   VAL A HA   2  
ATOM 2183  H HB   . VAL A 1 8   ? 4.443   8.538   8.412   1.00 0.00 ? 8   VAL A HB   2  
ATOM 2184  H HG11 . VAL A 1 8   ? 3.202   5.999   9.515   1.00 0.00 ? 8   VAL A HG11 2  
ATOM 2185  H HG12 . VAL A 1 8   ? 4.868   6.234   8.935   1.00 0.00 ? 8   VAL A HG12 2  
ATOM 2186  H HG13 . VAL A 1 8   ? 4.323   7.038   10.427  1.00 0.00 ? 8   VAL A HG13 2  
ATOM 2187  H HG21 . VAL A 1 8   ? 1.898   7.604   7.289   1.00 0.00 ? 8   VAL A HG21 2  
ATOM 2188  H HG22 . VAL A 1 8   ? 3.400   8.100   6.473   1.00 0.00 ? 8   VAL A HG22 2  
ATOM 2189  H HG23 . VAL A 1 8   ? 3.228   6.439   7.087   1.00 0.00 ? 8   VAL A HG23 2  
ATOM 2190  N N    . ARG A 1 9   ? 2.362   9.867   11.535  1.00 0.00 ? 9   ARG A N    2  
ATOM 2191  C CA   . ARG A 1 9   ? 2.828   10.578  12.713  1.00 0.00 ? 9   ARG A CA   2  
ATOM 2192  C C    . ARG A 1 9   ? 3.364   9.590   13.752  1.00 0.00 ? 9   ARG A C    2  
ATOM 2193  O O    . ARG A 1 9   ? 2.722   9.348   14.772  1.00 0.00 ? 9   ARG A O    2  
ATOM 2194  C CB   . ARG A 1 9   ? 1.703   11.405  13.339  1.00 0.00 ? 9   ARG A CB   2  
ATOM 2195  C CG   . ARG A 1 9   ? 1.825   12.880  12.951  1.00 0.00 ? 9   ARG A CG   2  
ATOM 2196  C CD   . ARG A 1 9   ? 1.727   13.781  14.183  1.00 0.00 ? 9   ARG A CD   2  
ATOM 2197  N NE   . ARG A 1 9   ? 0.557   14.680  14.061  1.00 0.00 ? 9   ARG A NE   2  
ATOM 2198  C CZ   . ARG A 1 9   ? -0.716  14.265  14.100  1.00 0.00 ? 9   ARG A CZ   2  
ATOM 2199  N NH1  . ARG A 1 9   ? -0.993  12.964  14.259  1.00 0.00 ? 9   ARG A NH1  2  
ATOM 2200  N NH2  . ARG A 1 9   ? -1.714  15.152  13.981  1.00 0.00 ? 9   ARG A NH2  2  
ATOM 2201  H H    . ARG A 1 9   ? 1.380   9.679   11.516  1.00 0.00 ? 9   ARG A H    2  
ATOM 2202  H HA   . ARG A 1 9   ? 3.620   11.232  12.349  1.00 0.00 ? 9   ARG A HA   2  
ATOM 2203  H HB2  . ARG A 1 9   ? 0.738   11.018  13.012  1.00 0.00 ? 9   ARG A HB2  2  
ATOM 2204  H HB3  . ARG A 1 9   ? 1.735   11.306  14.424  1.00 0.00 ? 9   ARG A HB3  2  
ATOM 2205  H HG2  . ARG A 1 9   ? 2.777   13.049  12.447  1.00 0.00 ? 9   ARG A HG2  2  
ATOM 2206  H HG3  . ARG A 1 9   ? 1.039   13.139  12.242  1.00 0.00 ? 9   ARG A HG3  2  
ATOM 2207  H HD2  . ARG A 1 9   ? 1.635   13.172  15.083  1.00 0.00 ? 9   ARG A HD2  2  
ATOM 2208  H HD3  . ARG A 1 9   ? 2.638   14.369  14.288  1.00 0.00 ? 9   ARG A HD3  2  
ATOM 2209  H HE   . ARG A 1 9   ? 0.728   15.658  13.941  1.00 0.00 ? 9   ARG A HE   2  
ATOM 2210  H HH11 . ARG A 1 9   ? -0.248  12.302  14.348  1.00 0.00 ? 9   ARG A HH11 2  
ATOM 2211  H HH12 . ARG A 1 9   ? -1.943  12.654  14.288  1.00 0.00 ? 9   ARG A HH12 2  
ATOM 2212  H HH21 . ARG A 1 9   ? -1.507  16.124  13.863  1.00 0.00 ? 9   ARG A HH21 2  
ATOM 2213  H HH22 . ARG A 1 9   ? -2.664  14.843  14.010  1.00 0.00 ? 9   ARG A HH22 2  
ATOM 2214  N N    . ARG A 1 10  ? 4.535   9.047   13.455  1.00 0.00 ? 10  ARG A N    2  
ATOM 2215  C CA   . ARG A 1 10  ? 5.165   8.091   14.350  1.00 0.00 ? 10  ARG A CA   2  
ATOM 2216  C C    . ARG A 1 10  ? 4.179   6.981   14.720  1.00 0.00 ? 10  ARG A C    2  
ATOM 2217  O O    . ARG A 1 10  ? 3.825   6.824   15.888  1.00 0.00 ? 10  ARG A O    2  
ATOM 2218  C CB   . ARG A 1 10  ? 5.656   8.774   15.628  1.00 0.00 ? 10  ARG A CB   2  
ATOM 2219  C CG   . ARG A 1 10  ? 7.173   8.976   15.593  1.00 0.00 ? 10  ARG A CG   2  
ATOM 2220  C CD   . ARG A 1 10  ? 7.842   8.319   16.801  1.00 0.00 ? 10  ARG A CD   2  
ATOM 2221  N NE   . ARG A 1 10  ? 9.236   7.951   16.470  1.00 0.00 ? 10  ARG A NE   2  
ATOM 2222  C CZ   . ARG A 1 10  ? 10.058  7.296   17.301  1.00 0.00 ? 10  ARG A CZ   2  
ATOM 2223  N NH1  . ARG A 1 10  ? 9.631   6.933   18.518  1.00 0.00 ? 10  ARG A NH1  2  
ATOM 2224  N NH2  . ARG A 1 10  ? 11.308  7.005   16.916  1.00 0.00 ? 10  ARG A NH2  2  
ATOM 2225  H H    . ARG A 1 10  ? 5.051   9.249   12.622  1.00 0.00 ? 10  ARG A H    2  
ATOM 2226  H HA   . ARG A 1 10  ? 6.008   7.694   13.785  1.00 0.00 ? 10  ARG A HA   2  
ATOM 2227  H HB2  . ARG A 1 10  ? 5.160   9.737   15.744  1.00 0.00 ? 10  ARG A HB2  2  
ATOM 2228  H HB3  . ARG A 1 10  ? 5.387   8.170   16.494  1.00 0.00 ? 10  ARG A HB3  2  
ATOM 2229  H HG2  . ARG A 1 10  ? 7.578   8.554   14.673  1.00 0.00 ? 10  ARG A HG2  2  
ATOM 2230  H HG3  . ARG A 1 10  ? 7.401   10.042  15.581  1.00 0.00 ? 10  ARG A HG3  2  
ATOM 2231  H HD2  . ARG A 1 10  ? 7.829   9.002   17.651  1.00 0.00 ? 10  ARG A HD2  2  
ATOM 2232  H HD3  . ARG A 1 10  ? 7.284   7.431   17.098  1.00 0.00 ? 10  ARG A HD3  2  
ATOM 2233  H HE   . ARG A 1 10  ? 9.588   8.208   15.569  1.00 0.00 ? 10  ARG A HE   2  
ATOM 2234  H HH11 . ARG A 1 10  ? 8.698   7.151   18.806  1.00 0.00 ? 10  ARG A HH11 2  
ATOM 2235  H HH12 . ARG A 1 10  ? 10.244  6.444   19.138  1.00 0.00 ? 10  ARG A HH12 2  
ATOM 2236  H HH21 . ARG A 1 10  ? 11.628  7.276   16.008  1.00 0.00 ? 10  ARG A HH21 2  
ATOM 2237  H HH22 . ARG A 1 10  ? 11.922  6.516   17.536  1.00 0.00 ? 10  ARG A HH22 2  
ATOM 2238  N N    . VAL A 1 11  ? 3.763   6.239   13.704  1.00 0.00 ? 11  VAL A N    2  
ATOM 2239  C CA   . VAL A 1 11  ? 2.824   5.149   13.908  1.00 0.00 ? 11  VAL A CA   2  
ATOM 2240  C C    . VAL A 1 11  ? 3.559   3.959   14.529  1.00 0.00 ? 11  VAL A C    2  
ATOM 2241  O O    . VAL A 1 11  ? 4.781   3.860   14.431  1.00 0.00 ? 11  VAL A O    2  
ATOM 2242  C CB   . VAL A 1 11  ? 2.131   4.802   12.589  1.00 0.00 ? 11  VAL A CB   2  
ATOM 2243  C CG1  . VAL A 1 11  ? 1.500   6.045   11.958  1.00 0.00 ? 11  VAL A CG1  2  
ATOM 2244  C CG2  . VAL A 1 11  ? 3.103   4.127   11.619  1.00 0.00 ? 11  VAL A CG2  2  
ATOM 2245  H H    . VAL A 1 11  ? 4.055   6.374   12.757  1.00 0.00 ? 11  VAL A H    2  
ATOM 2246  H HA   . VAL A 1 11  ? 2.064   5.496   14.608  1.00 0.00 ? 11  VAL A HA   2  
ATOM 2247  H HB   . VAL A 1 11  ? 1.331   4.094   12.808  1.00 0.00 ? 11  VAL A HB   2  
ATOM 2248  H HG11 . VAL A 1 11  ? 2.281   6.667   11.522  1.00 0.00 ? 11  VAL A HG11 2  
ATOM 2249  H HG12 . VAL A 1 11  ? 0.800   5.741   11.179  1.00 0.00 ? 11  VAL A HG12 2  
ATOM 2250  H HG13 . VAL A 1 11  ? 0.969   6.611   12.723  1.00 0.00 ? 11  VAL A HG13 2  
ATOM 2251  H HG21 . VAL A 1 11  ? 3.651   3.343   12.141  1.00 0.00 ? 11  VAL A HG21 2  
ATOM 2252  H HG22 . VAL A 1 11  ? 2.545   3.691   10.790  1.00 0.00 ? 11  VAL A HG22 2  
ATOM 2253  H HG23 . VAL A 1 11  ? 3.805   4.867   11.236  1.00 0.00 ? 11  VAL A HG23 2  
ATOM 2254  N N    . PRO A 1 12  ? 2.762   3.062   15.170  1.00 0.00 ? 12  PRO A N    2  
ATOM 2255  C CA   . PRO A 1 12  ? 3.324   1.883   15.806  1.00 0.00 ? 12  PRO A CA   2  
ATOM 2256  C C    . PRO A 1 12  ? 3.724   0.836   14.764  1.00 0.00 ? 12  PRO A C    2  
ATOM 2257  O O    . PRO A 1 12  ? 4.354   -0.167  15.097  1.00 0.00 ? 12  PRO A O    2  
ATOM 2258  C CB   . PRO A 1 12  ? 2.242   1.395   16.754  1.00 0.00 ? 12  PRO A CB   2  
ATOM 2259  C CG   . PRO A 1 12  ? 0.949   2.037   16.278  1.00 0.00 ? 12  PRO A CG   2  
ATOM 2260  C CD   . PRO A 1 12  ? 1.311   3.147   15.305  1.00 0.00 ? 12  PRO A CD   2  
ATOM 2261  H HA   . PRO A 1 12  ? 4.165   2.119   16.293  1.00 0.00 ? 12  PRO A HA   2  
ATOM 2262  H HB2  . PRO A 1 12  ? 2.167   0.307   16.736  1.00 0.00 ? 12  PRO A HB2  2  
ATOM 2263  H HB3  . PRO A 1 12  ? 2.465   1.681   17.782  1.00 0.00 ? 12  PRO A HB3  2  
ATOM 2264  H HG2  . PRO A 1 12  ? 0.311   1.298   15.794  1.00 0.00 ? 12  PRO A HG2  2  
ATOM 2265  H HG3  . PRO A 1 12  ? 0.388   2.438   17.123  1.00 0.00 ? 12  PRO A HG3  2  
ATOM 2266  H HD2  . PRO A 1 12  ? 0.815   3.009   14.344  1.00 0.00 ? 12  PRO A HD2  2  
ATOM 2267  H HD3  . PRO A 1 12  ? 1.005   4.122   15.685  1.00 0.00 ? 12  PRO A HD3  2  
ATOM 2268  N N    . LEU A 1 13  ? 3.340   1.104   13.525  1.00 0.00 ? 13  LEU A N    2  
ATOM 2269  C CA   . LEU A 1 13  ? 3.650   0.198   12.432  1.00 0.00 ? 13  LEU A CA   2  
ATOM 2270  C C    . LEU A 1 13  ? 5.161   0.192   12.193  1.00 0.00 ? 13  LEU A C    2  
ATOM 2271  O O    . LEU A 1 13  ? 5.814   -0.839  12.349  1.00 0.00 ? 13  LEU A O    2  
ATOM 2272  C CB   . LEU A 1 13  ? 2.832   0.556   11.190  1.00 0.00 ? 13  LEU A CB   2  
ATOM 2273  C CG   . LEU A 1 13  ? 1.317   0.382   11.311  1.00 0.00 ? 13  LEU A CG   2  
ATOM 2274  C CD1  . LEU A 1 13  ? 0.602   0.924   10.072  1.00 0.00 ? 13  LEU A CD1  2  
ATOM 2275  C CD2  . LEU A 1 13  ? 0.954   -1.078  11.589  1.00 0.00 ? 13  LEU A CD2  2  
ATOM 2276  H H    . LEU A 1 13  ? 2.827   1.922   13.263  1.00 0.00 ? 13  LEU A H    2  
ATOM 2277  H HA   . LEU A 1 13  ? 3.345   -0.802  12.741  1.00 0.00 ? 13  LEU A HA   2  
ATOM 2278  H HB2  . LEU A 1 13  ? 3.039   1.594   10.930  1.00 0.00 ? 13  LEU A HB2  2  
ATOM 2279  H HB3  . LEU A 1 13  ? 3.183   -0.056  10.359  1.00 0.00 ? 13  LEU A HB3  2  
ATOM 2280  H HG   . LEU A 1 13  ? 0.973   0.967   12.164  1.00 0.00 ? 13  LEU A HG   2  
ATOM 2281  H HD11 . LEU A 1 13  ? 0.640   2.014   10.079  1.00 0.00 ? 13  LEU A HD11 2  
ATOM 2282  H HD12 . LEU A 1 13  ? 1.094   0.549   9.175   1.00 0.00 ? 13  LEU A HD12 2  
ATOM 2283  H HD13 . LEU A 1 13  ? -0.438  0.597   10.080  1.00 0.00 ? 13  LEU A HD13 2  
ATOM 2284  H HD21 . LEU A 1 13  ? 1.271   -1.698  10.751  1.00 0.00 ? 13  LEU A HD21 2  
ATOM 2285  H HD22 . LEU A 1 13  ? 1.456   -1.411  12.498  1.00 0.00 ? 13  LEU A HD22 2  
ATOM 2286  H HD23 . LEU A 1 13  ? -0.125  -1.166  11.718  1.00 0.00 ? 13  LEU A HD23 2  
ATOM 2287  N N    . PHE A 1 14  ? 5.673   1.356   11.820  1.00 0.00 ? 14  PHE A N    2  
ATOM 2288  C CA   . PHE A 1 14  ? 7.095   1.498   11.558  1.00 0.00 ? 14  PHE A CA   2  
ATOM 2289  C C    . PHE A 1 14  ? 7.871   1.733   12.855  1.00 0.00 ? 14  PHE A C    2  
ATOM 2290  O O    . PHE A 1 14  ? 8.605   2.713   12.975  1.00 0.00 ? 14  PHE A O    2  
ATOM 2291  C CB   . PHE A 1 14  ? 7.263   2.717   10.649  1.00 0.00 ? 14  PHE A CB   2  
ATOM 2292  C CG   . PHE A 1 14  ? 6.284   2.757   9.474   1.00 0.00 ? 14  PHE A CG   2  
ATOM 2293  C CD1  . PHE A 1 14  ? 6.283   1.754   8.555   1.00 0.00 ? 14  PHE A CD1  2  
ATOM 2294  C CD2  . PHE A 1 14  ? 5.414   3.795   9.349   1.00 0.00 ? 14  PHE A CD2  2  
ATOM 2295  C CE1  . PHE A 1 14  ? 5.374   1.791   7.465   1.00 0.00 ? 14  PHE A CE1  2  
ATOM 2296  C CE2  . PHE A 1 14  ? 4.505   3.832   8.258   1.00 0.00 ? 14  PHE A CE2  2  
ATOM 2297  C CZ   . PHE A 1 14  ? 4.504   2.830   7.340   1.00 0.00 ? 14  PHE A CZ   2  
ATOM 2298  H H    . PHE A 1 14  ? 5.135   2.189   11.696  1.00 0.00 ? 14  PHE A H    2  
ATOM 2299  H HA   . PHE A 1 14  ? 7.434   0.570   11.098  1.00 0.00 ? 14  PHE A HA   2  
ATOM 2300  H HB2  . PHE A 1 14  ? 7.137   3.621   11.244  1.00 0.00 ? 14  PHE A HB2  2  
ATOM 2301  H HB3  . PHE A 1 14  ? 8.281   2.731   10.260  1.00 0.00 ? 14  PHE A HB3  2  
ATOM 2302  H HD1  . PHE A 1 14  ? 6.979   0.922   8.656   1.00 0.00 ? 14  PHE A HD1  2  
ATOM 2303  H HD2  . PHE A 1 14  ? 5.415   4.599   10.085  1.00 0.00 ? 14  PHE A HD2  2  
ATOM 2304  H HE1  . PHE A 1 14  ? 5.373   0.988   6.729   1.00 0.00 ? 14  PHE A HE1  2  
ATOM 2305  H HE2  . PHE A 1 14  ? 3.808   4.664   8.158   1.00 0.00 ? 14  PHE A HE2  2  
ATOM 2306  H HZ   . PHE A 1 14  ? 3.806   2.858   6.503   1.00 0.00 ? 14  PHE A HZ   2  
ATOM 2307  N N    . GLU A 1 15  ? 7.681   0.818   13.795  1.00 0.00 ? 15  GLU A N    2  
ATOM 2308  C CA   . GLU A 1 15  ? 8.354   0.914   15.079  1.00 0.00 ? 15  GLU A CA   2  
ATOM 2309  C C    . GLU A 1 15  ? 9.824   0.512   14.940  1.00 0.00 ? 15  GLU A C    2  
ATOM 2310  O O    . GLU A 1 15  ? 10.716  1.257   15.345  1.00 0.00 ? 15  GLU A O    2  
ATOM 2311  C CB   . GLU A 1 15  ? 7.649   0.057   16.133  1.00 0.00 ? 15  GLU A CB   2  
ATOM 2312  C CG   . GLU A 1 15  ? 6.845   0.928   17.099  1.00 0.00 ? 15  GLU A CG   2  
ATOM 2313  C CD   . GLU A 1 15  ? 7.035   0.463   18.545  1.00 0.00 ? 15  GLU A CD   2  
ATOM 2314  O OE1  . GLU A 1 15  ? 8.171   0.613   19.044  1.00 0.00 ? 15  GLU A OE1  2  
ATOM 2315  O OE2  . GLU A 1 15  ? 6.040   -0.032  19.117  1.00 0.00 ? 15  GLU A OE2  2  
ATOM 2316  H H    . GLU A 1 15  ? 7.082   0.025   13.690  1.00 0.00 ? 15  GLU A H    2  
ATOM 2317  H HA   . GLU A 1 15  ? 8.283   1.963   15.366  1.00 0.00 ? 15  GLU A HA   2  
ATOM 2318  H HB2  . GLU A 1 15  ? 6.986   -0.656  15.642  1.00 0.00 ? 15  GLU A HB2  2  
ATOM 2319  H HB3  . GLU A 1 15  ? 8.386   -0.523  16.688  1.00 0.00 ? 15  GLU A HB3  2  
ATOM 2320  H HG2  . GLU A 1 15  ? 7.158   1.968   17.004  1.00 0.00 ? 15  GLU A HG2  2  
ATOM 2321  H HG3  . GLU A 1 15  ? 5.788   0.889   16.837  1.00 0.00 ? 15  GLU A HG3  2  
ATOM 2322  N N    . ASN A 1 16  ? 10.031  -0.663  14.365  1.00 0.00 ? 16  ASN A N    2  
ATOM 2323  C CA   . ASN A 1 16  ? 11.377  -1.173  14.167  1.00 0.00 ? 16  ASN A CA   2  
ATOM 2324  C C    . ASN A 1 16  ? 11.787  -0.965  12.708  1.00 0.00 ? 16  ASN A C    2  
ATOM 2325  O O    . ASN A 1 16  ? 12.735  -1.587  12.231  1.00 0.00 ? 16  ASN A O    2  
ATOM 2326  C CB   . ASN A 1 16  ? 11.450  -2.671  14.470  1.00 0.00 ? 16  ASN A CB   2  
ATOM 2327  C CG   . ASN A 1 16  ? 10.246  -3.408  13.879  1.00 0.00 ? 16  ASN A CG   2  
ATOM 2328  O OD1  . ASN A 1 16  ? 9.224   -3.593  14.518  1.00 0.00 ? 16  ASN A OD1  2  
ATOM 2329  N ND2  . ASN A 1 16  ? 10.424  -3.818  12.627  1.00 0.00 ? 16  ASN A ND2  2  
ATOM 2330  H H    . ASN A 1 16  ? 9.300   -1.263  14.039  1.00 0.00 ? 16  ASN A H    2  
ATOM 2331  H HA   . ASN A 1 16  ? 12.002  -0.609  14.860  1.00 0.00 ? 16  ASN A HA   2  
ATOM 2332  H HB2  . ASN A 1 16  ? 12.371  -3.084  14.060  1.00 0.00 ? 16  ASN A HB2  2  
ATOM 2333  H HB3  . ASN A 1 16  ? 11.482  -2.826  15.548  1.00 0.00 ? 16  ASN A HB3  2  
ATOM 2334  H HD21 . ASN A 1 16  ? 11.289  -3.634  12.159  1.00 0.00 ? 16  ASN A HD21 2  
ATOM 2335  H HD22 . ASN A 1 16  ? 9.694   -4.310  12.153  1.00 0.00 ? 16  ASN A HD22 2  
ATOM 2336  N N    . MET A 1 17  ? 11.053  -0.088  12.040  1.00 0.00 ? 17  MET A N    2  
ATOM 2337  C CA   . MET A 1 17  ? 11.328  0.209   10.644  1.00 0.00 ? 17  MET A CA   2  
ATOM 2338  C C    . MET A 1 17  ? 12.523  1.156   10.511  1.00 0.00 ? 17  MET A C    2  
ATOM 2339  O O    . MET A 1 17  ? 12.668  2.092   11.296  1.00 0.00 ? 17  MET A O    2  
ATOM 2340  C CB   . MET A 1 17  ? 10.094  0.851   10.006  1.00 0.00 ? 17  MET A CB   2  
ATOM 2341  C CG   . MET A 1 17  ? 9.501   -0.058  8.927   1.00 0.00 ? 17  MET A CG   2  
ATOM 2342  S SD   . MET A 1 17  ? 8.506   -1.333  9.683   1.00 0.00 ? 17  MET A SD   2  
ATOM 2343  C CE   . MET A 1 17  ? 7.873   -2.139  8.222   1.00 0.00 ? 17  MET A CE   2  
ATOM 2344  H H    . MET A 1 17  ? 10.284  0.414   12.435  1.00 0.00 ? 17  MET A H    2  
ATOM 2345  H HA   . MET A 1 17  ? 11.562  -0.749  10.181  1.00 0.00 ? 17  MET A HA   2  
ATOM 2346  H HB2  . MET A 1 17  ? 9.345   1.049   10.772  1.00 0.00 ? 17  MET A HB2  2  
ATOM 2347  H HB3  . MET A 1 17  ? 10.365  1.812   9.568   1.00 0.00 ? 17  MET A HB3  2  
ATOM 2348  H HG2  . MET A 1 17  ? 8.892   0.530   8.240   1.00 0.00 ? 17  MET A HG2  2  
ATOM 2349  H HG3  . MET A 1 17  ? 10.300  -0.509  8.339   1.00 0.00 ? 17  MET A HG3  2  
ATOM 2350  H HE1  . MET A 1 17  ? 7.148   -1.488  7.733   1.00 0.00 ? 17  MET A HE1  2  
ATOM 2351  H HE2  . MET A 1 17  ? 8.695   -2.346  7.536   1.00 0.00 ? 17  MET A HE2  2  
ATOM 2352  H HE3  . MET A 1 17  ? 7.390   -3.075  8.503   1.00 0.00 ? 17  MET A HE3  2  
ATOM 2353  N N    . ASP A 1 18  ? 13.347  0.880   9.511   1.00 0.00 ? 18  ASP A N    2  
ATOM 2354  C CA   . ASP A 1 18  ? 14.524  1.695   9.265   1.00 0.00 ? 18  ASP A CA   2  
ATOM 2355  C C    . ASP A 1 18  ? 14.322  2.500   7.979   1.00 0.00 ? 18  ASP A C    2  
ATOM 2356  O O    . ASP A 1 18  ? 13.604  2.068   7.079   1.00 0.00 ? 18  ASP A O    2  
ATOM 2357  C CB   . ASP A 1 18  ? 15.770  0.825   9.086   1.00 0.00 ? 18  ASP A CB   2  
ATOM 2358  C CG   . ASP A 1 18  ? 16.647  0.688   10.332  1.00 0.00 ? 18  ASP A CG   2  
ATOM 2359  O OD1  . ASP A 1 18  ? 16.813  1.715   11.025  1.00 0.00 ? 18  ASP A OD1  2  
ATOM 2360  O OD2  . ASP A 1 18  ? 17.131  -0.441  10.565  1.00 0.00 ? 18  ASP A OD2  2  
ATOM 2361  H H    . ASP A 1 18  ? 13.221  0.117   8.877   1.00 0.00 ? 18  ASP A H    2  
ATOM 2362  H HA   . ASP A 1 18  ? 14.621  2.332   10.144  1.00 0.00 ? 18  ASP A HA   2  
ATOM 2363  H HB2  . ASP A 1 18  ? 15.457  -0.170  8.769   1.00 0.00 ? 18  ASP A HB2  2  
ATOM 2364  H HB3  . ASP A 1 18  ? 16.373  1.241   8.280   1.00 0.00 ? 18  ASP A HB3  2  
ATOM 2365  N N    . GLU A 1 19  ? 14.968  3.656   7.935   1.00 0.00 ? 19  GLU A N    2  
ATOM 2366  C CA   . GLU A 1 19  ? 14.868  4.525   6.774   1.00 0.00 ? 19  GLU A CA   2  
ATOM 2367  C C    . GLU A 1 19  ? 15.034  3.714   5.488   1.00 0.00 ? 19  GLU A C    2  
ATOM 2368  O O    . GLU A 1 19  ? 14.273  3.888   4.537   1.00 0.00 ? 19  GLU A O    2  
ATOM 2369  C CB   . GLU A 1 19  ? 15.897  5.655   6.846   1.00 0.00 ? 19  GLU A CB   2  
ATOM 2370  C CG   . GLU A 1 19  ? 15.489  6.703   7.884   1.00 0.00 ? 19  GLU A CG   2  
ATOM 2371  C CD   . GLU A 1 19  ? 16.664  7.054   8.799   1.00 0.00 ? 19  GLU A CD   2  
ATOM 2372  O OE1  . GLU A 1 19  ? 17.182  6.116   9.442   1.00 0.00 ? 19  GLU A OE1  2  
ATOM 2373  O OE2  . GLU A 1 19  ? 17.016  8.253   8.835   1.00 0.00 ? 19  GLU A OE2  2  
ATOM 2374  H H    . GLU A 1 19  ? 15.550  4.000   8.671   1.00 0.00 ? 19  GLU A H    2  
ATOM 2375  H HA   . GLU A 1 19  ? 13.866  4.951   6.817   1.00 0.00 ? 19  GLU A HA   2  
ATOM 2376  H HB2  . GLU A 1 19  ? 16.875  5.247   7.101   1.00 0.00 ? 19  GLU A HB2  2  
ATOM 2377  H HB3  . GLU A 1 19  ? 15.993  6.126   5.868   1.00 0.00 ? 19  GLU A HB3  2  
ATOM 2378  H HG2  . GLU A 1 19  ? 15.135  7.602   7.379   1.00 0.00 ? 19  GLU A HG2  2  
ATOM 2379  H HG3  . GLU A 1 19  ? 14.659  6.324   8.481   1.00 0.00 ? 19  GLU A HG3  2  
ATOM 2380  N N    . ARG A 1 20  ? 16.033  2.844   5.499   1.00 0.00 ? 20  ARG A N    2  
ATOM 2381  C CA   . ARG A 1 20  ? 16.309  2.005   4.345   1.00 0.00 ? 20  ARG A CA   2  
ATOM 2382  C C    . ARG A 1 20  ? 15.056  1.222   3.947   1.00 0.00 ? 20  ARG A C    2  
ATOM 2383  O O    . ARG A 1 20  ? 14.828  0.968   2.765   1.00 0.00 ? 20  ARG A O    2  
ATOM 2384  C CB   . ARG A 1 20  ? 17.445  1.023   4.636   1.00 0.00 ? 20  ARG A CB   2  
ATOM 2385  C CG   . ARG A 1 20  ? 18.732  1.766   5.002   1.00 0.00 ? 20  ARG A CG   2  
ATOM 2386  C CD   . ARG A 1 20  ? 19.420  2.319   3.752   1.00 0.00 ? 20  ARG A CD   2  
ATOM 2387  N NE   . ARG A 1 20  ? 20.819  1.841   3.691   1.00 0.00 ? 20  ARG A NE   2  
ATOM 2388  C CZ   . ARG A 1 20  ? 21.753  2.352   2.877   1.00 0.00 ? 20  ARG A CZ   2  
ATOM 2389  N NH1  . ARG A 1 20  ? 21.442  3.359   2.050   1.00 0.00 ? 20  ARG A NH1  2  
ATOM 2390  N NH2  . ARG A 1 20  ? 22.997  1.855   2.890   1.00 0.00 ? 20  ARG A NH2  2  
ATOM 2391  H H    . ARG A 1 20  ? 16.648  2.708   6.276   1.00 0.00 ? 20  ARG A H    2  
ATOM 2392  H HA   . ARG A 1 20  ? 16.602  2.701   3.559   1.00 0.00 ? 20  ARG A HA   2  
ATOM 2393  H HB2  . ARG A 1 20  ? 17.158  0.361   5.453   1.00 0.00 ? 20  ARG A HB2  2  
ATOM 2394  H HB3  . ARG A 1 20  ? 17.620  0.394   3.763   1.00 0.00 ? 20  ARG A HB3  2  
ATOM 2395  H HG2  . ARG A 1 20  ? 18.502  2.583   5.686   1.00 0.00 ? 20  ARG A HG2  2  
ATOM 2396  H HG3  . ARG A 1 20  ? 19.409  1.092   5.526   1.00 0.00 ? 20  ARG A HG3  2  
ATOM 2397  H HD2  . ARG A 1 20  ? 18.880  2.003   2.859   1.00 0.00 ? 20  ARG A HD2  2  
ATOM 2398  H HD3  . ARG A 1 20  ? 19.400  3.409   3.767   1.00 0.00 ? 20  ARG A HD3  2  
ATOM 2399  H HE   . ARG A 1 20  ? 21.084  1.090   4.295   1.00 0.00 ? 20  ARG A HE   2  
ATOM 2400  H HH11 . ARG A 1 20  ? 20.514  3.730   2.040   1.00 0.00 ? 20  ARG A HH11 2  
ATOM 2401  H HH12 . ARG A 1 20  ? 22.139  3.740   1.442   1.00 0.00 ? 20  ARG A HH12 2  
ATOM 2402  H HH21 . ARG A 1 20  ? 23.229  1.103   3.507   1.00 0.00 ? 20  ARG A HH21 2  
ATOM 2403  H HH22 . ARG A 1 20  ? 23.694  2.236   2.282   1.00 0.00 ? 20  ARG A HH22 2  
ATOM 2404  N N    . LEU A 1 21  ? 14.278  0.860   4.957   1.00 0.00 ? 21  LEU A N    2  
ATOM 2405  C CA   . LEU A 1 21  ? 13.054  0.111   4.727   1.00 0.00 ? 21  LEU A CA   2  
ATOM 2406  C C    . LEU A 1 21  ? 11.949  1.071   4.284   1.00 0.00 ? 21  LEU A C    2  
ATOM 2407  O O    . LEU A 1 21  ? 11.036  0.680   3.558   1.00 0.00 ? 21  LEU A O    2  
ATOM 2408  C CB   . LEU A 1 21  ? 12.692  -0.715  5.963   1.00 0.00 ? 21  LEU A CB   2  
ATOM 2409  C CG   . LEU A 1 21  ? 12.032  -2.069  5.695   1.00 0.00 ? 21  LEU A CG   2  
ATOM 2410  C CD1  . LEU A 1 21  ? 12.828  -2.873  4.665   1.00 0.00 ? 21  LEU A CD1  2  
ATOM 2411  C CD2  . LEU A 1 21  ? 11.828  -2.847  6.997   1.00 0.00 ? 21  LEU A CD2  2  
ATOM 2412  H H    . LEU A 1 21  ? 14.471  1.071   5.915   1.00 0.00 ? 21  LEU A H    2  
ATOM 2413  H HA   . LEU A 1 21  ? 13.248  -0.591  3.916   1.00 0.00 ? 21  LEU A HA   2  
ATOM 2414  H HB2  . LEU A 1 21  ? 13.600  -0.884  6.541   1.00 0.00 ? 21  LEU A HB2  2  
ATOM 2415  H HB3  . LEU A 1 21  ? 12.022  -0.124  6.587   1.00 0.00 ? 21  LEU A HB3  2  
ATOM 2416  H HG   . LEU A 1 21  ? 11.044  -1.889  5.269   1.00 0.00 ? 21  LEU A HG   2  
ATOM 2417  H HD11 . LEU A 1 21  ? 13.881  -2.599  4.726   1.00 0.00 ? 21  LEU A HD11 2  
ATOM 2418  H HD12 . LEU A 1 21  ? 12.717  -3.938  4.871   1.00 0.00 ? 21  LEU A HD12 2  
ATOM 2419  H HD13 . LEU A 1 21  ? 12.452  -2.655  3.665   1.00 0.00 ? 21  LEU A HD13 2  
ATOM 2420  H HD21 . LEU A 1 21  ? 12.183  -3.869  6.868   1.00 0.00 ? 21  LEU A HD21 2  
ATOM 2421  H HD22 . LEU A 1 21  ? 12.388  -2.366  7.799   1.00 0.00 ? 21  LEU A HD22 2  
ATOM 2422  H HD23 . LEU A 1 21  ? 10.768  -2.859  7.250   1.00 0.00 ? 21  LEU A HD23 2  
ATOM 2423  N N    . LEU A 1 22  ? 12.067  2.310   4.738   1.00 0.00 ? 22  LEU A N    2  
ATOM 2424  C CA   . LEU A 1 22  ? 11.089  3.329   4.397   1.00 0.00 ? 22  LEU A CA   2  
ATOM 2425  C C    . LEU A 1 22  ? 11.202  3.660   2.908   1.00 0.00 ? 22  LEU A C    2  
ATOM 2426  O O    . LEU A 1 22  ? 10.227  3.542   2.167   1.00 0.00 ? 22  LEU A O    2  
ATOM 2427  C CB   . LEU A 1 22  ? 11.244  4.547   5.311   1.00 0.00 ? 22  LEU A CB   2  
ATOM 2428  C CG   . LEU A 1 22  ? 10.430  4.521   6.606   1.00 0.00 ? 22  LEU A CG   2  
ATOM 2429  C CD1  . LEU A 1 22  ? 8.940   4.726   6.322   1.00 0.00 ? 22  LEU A CD1  2  
ATOM 2430  C CD2  . LEU A 1 22  ? 10.691  3.235   7.392   1.00 0.00 ? 22  LEU A CD2  2  
ATOM 2431  H H    . LEU A 1 22  ? 12.813  2.620   5.328   1.00 0.00 ? 22  LEU A H    2  
ATOM 2432  H HA   . LEU A 1 22  ? 10.101  2.909   4.584   1.00 0.00 ? 22  LEU A HA   2  
ATOM 2433  H HB2  . LEU A 1 22  ? 12.298  4.651   5.569   1.00 0.00 ? 22  LEU A HB2  2  
ATOM 2434  H HB3  . LEU A 1 22  ? 10.964  5.437   4.747   1.00 0.00 ? 22  LEU A HB3  2  
ATOM 2435  H HG   . LEU A 1 22  ? 10.756  5.352   7.231   1.00 0.00 ? 22  LEU A HG   2  
ATOM 2436  H HD11 . LEU A 1 22  ? 8.817   5.526   5.591   1.00 0.00 ? 22  LEU A HD11 2  
ATOM 2437  H HD12 . LEU A 1 22  ? 8.515   3.804   5.927   1.00 0.00 ? 22  LEU A HD12 2  
ATOM 2438  H HD13 . LEU A 1 22  ? 8.428   4.996   7.245   1.00 0.00 ? 22  LEU A HD13 2  
ATOM 2439  H HD21 . LEU A 1 22  ? 9.870   3.061   8.088   1.00 0.00 ? 22  LEU A HD21 2  
ATOM 2440  H HD22 . LEU A 1 22  ? 10.765  2.395   6.701   1.00 0.00 ? 22  LEU A HD22 2  
ATOM 2441  H HD23 . LEU A 1 22  ? 11.624  3.332   7.948   1.00 0.00 ? 22  LEU A HD23 2  
ATOM 2442  N N    . ASP A 1 23  ? 12.399  4.068   2.513   1.00 0.00 ? 23  ASP A N    2  
ATOM 2443  C CA   . ASP A 1 23  ? 12.652  4.416   1.126   1.00 0.00 ? 23  ASP A CA   2  
ATOM 2444  C C    . ASP A 1 23  ? 12.255  3.242   0.229   1.00 0.00 ? 23  ASP A C    2  
ATOM 2445  O O    . ASP A 1 23  ? 11.478  3.407   -0.710  1.00 0.00 ? 23  ASP A O    2  
ATOM 2446  C CB   . ASP A 1 23  ? 14.135  4.709   0.892   1.00 0.00 ? 23  ASP A CB   2  
ATOM 2447  C CG   . ASP A 1 23  ? 14.444  5.520   -0.368  1.00 0.00 ? 23  ASP A CG   2  
ATOM 2448  O OD1  . ASP A 1 23  ? 14.036  6.701   -0.397  1.00 0.00 ? 23  ASP A OD1  2  
ATOM 2449  O OD2  . ASP A 1 23  ? 15.080  4.939   -1.274  1.00 0.00 ? 23  ASP A OD2  2  
ATOM 2450  H H    . ASP A 1 23  ? 13.187  4.161   3.123   1.00 0.00 ? 23  ASP A H    2  
ATOM 2451  H HA   . ASP A 1 23  ? 12.049  5.305   0.939   1.00 0.00 ? 23  ASP A HA   2  
ATOM 2452  H HB2  . ASP A 1 23  ? 14.524  5.248   1.757   1.00 0.00 ? 23  ASP A HB2  2  
ATOM 2453  H HB3  . ASP A 1 23  ? 14.673  3.763   0.838   1.00 0.00 ? 23  ASP A HB3  2  
ATOM 2454  N N    . ALA A 1 24  ? 12.808  2.081   0.550   1.00 0.00 ? 24  ALA A N    2  
ATOM 2455  C CA   . ALA A 1 24  ? 12.521  0.879   -0.215  1.00 0.00 ? 24  ALA A CA   2  
ATOM 2456  C C    . ALA A 1 24  ? 11.006  0.704   -0.334  1.00 0.00 ? 24  ALA A C    2  
ATOM 2457  O O    . ALA A 1 24  ? 10.459  0.732   -1.435  1.00 0.00 ? 24  ALA A O    2  
ATOM 2458  C CB   . ALA A 1 24  ? 13.197  -0.322  0.450   1.00 0.00 ? 24  ALA A CB   2  
ATOM 2459  H H    . ALA A 1 24  ? 13.439  1.955   1.315   1.00 0.00 ? 24  ALA A H    2  
ATOM 2460  H HA   . ALA A 1 24  ? 12.943  1.011   -1.212  1.00 0.00 ? 24  ALA A HA   2  
ATOM 2461  H HB1  . ALA A 1 24  ? 12.901  -0.371  1.498   1.00 0.00 ? 24  ALA A HB1  2  
ATOM 2462  H HB2  . ALA A 1 24  ? 12.890  -1.237  -0.057  1.00 0.00 ? 24  ALA A HB2  2  
ATOM 2463  H HB3  . ALA A 1 24  ? 14.279  -0.214  0.382   1.00 0.00 ? 24  ALA A HB3  2  
ATOM 2464  N N    . ILE A 1 25  ? 10.371  0.528   0.815   1.00 0.00 ? 25  ILE A N    2  
ATOM 2465  C CA   . ILE A 1 25  ? 8.930   0.349   0.854   1.00 0.00 ? 25  ILE A CA   2  
ATOM 2466  C C    . ILE A 1 25  ? 8.256   1.512   0.124   1.00 0.00 ? 25  ILE A C    2  
ATOM 2467  O O    . ILE A 1 25  ? 7.232   1.328   -0.533  1.00 0.00 ? 25  ILE A O    2  
ATOM 2468  C CB   . ILE A 1 25  ? 8.451   0.168   2.296   1.00 0.00 ? 25  ILE A CB   2  
ATOM 2469  C CG1  . ILE A 1 25  ? 8.976   -1.142  2.887   1.00 0.00 ? 25  ILE A CG1  2  
ATOM 2470  C CG2  . ILE A 1 25  ? 6.926   0.266   2.384   1.00 0.00 ? 25  ILE A CG2  2  
ATOM 2471  C CD1  . ILE A 1 25  ? 8.615   -1.257  4.370   1.00 0.00 ? 25  ILE A CD1  2  
ATOM 2472  H H    . ILE A 1 25  ? 10.823  0.507   1.707   1.00 0.00 ? 25  ILE A H    2  
ATOM 2473  H HA   . ILE A 1 25  ? 8.701   -0.573  0.320   1.00 0.00 ? 25  ILE A HA   2  
ATOM 2474  H HB   . ILE A 1 25  ? 8.861   0.979   2.896   1.00 0.00 ? 25  ILE A HB   2  
ATOM 2475  H HG12 . ILE A 1 25  ? 8.556   -1.986  2.341   1.00 0.00 ? 25  ILE A HG12 2  
ATOM 2476  H HG13 . ILE A 1 25  ? 10.058  -1.191  2.768   1.00 0.00 ? 25  ILE A HG13 2  
ATOM 2477  H HG21 . ILE A 1 25  ? 6.582   1.113   1.791   1.00 0.00 ? 25  ILE A HG21 2  
ATOM 2478  H HG22 . ILE A 1 25  ? 6.480   -0.652  1.999   1.00 0.00 ? 25  ILE A HG22 2  
ATOM 2479  H HG23 . ILE A 1 25  ? 6.631   0.406   3.423   1.00 0.00 ? 25  ILE A HG23 2  
ATOM 2480  H HD11 . ILE A 1 25  ? 7.537   -1.373  4.474   1.00 0.00 ? 25  ILE A HD11 2  
ATOM 2481  H HD12 . ILE A 1 25  ? 9.117   -2.124  4.799   1.00 0.00 ? 25  ILE A HD12 2  
ATOM 2482  H HD13 . ILE A 1 25  ? 8.936   -0.356  4.893   1.00 0.00 ? 25  ILE A HD13 2  
ATOM 2483  N N    . CYS A 1 26  ? 8.857   2.685   0.263   1.00 0.00 ? 26  CYS A N    2  
ATOM 2484  C CA   . CYS A 1 26  ? 8.327   3.878   -0.375  1.00 0.00 ? 26  CYS A CA   2  
ATOM 2485  C C    . CYS A 1 26  ? 8.431   3.698   -1.891  1.00 0.00 ? 26  CYS A C    2  
ATOM 2486  O O    . CYS A 1 26  ? 7.489   4.002   -2.621  1.00 0.00 ? 26  CYS A O    2  
ATOM 2487  C CB   . CYS A 1 26  ? 9.049   5.141   0.100   1.00 0.00 ? 26  CYS A CB   2  
ATOM 2488  S SG   . CYS A 1 26  ? 8.136   5.895   1.495   1.00 0.00 ? 26  CYS A SG   2  
ATOM 2489  H H    . CYS A 1 26  ? 9.689   2.826   0.799   1.00 0.00 ? 26  CYS A H    2  
ATOM 2490  H HA   . CYS A 1 26  ? 7.286   3.963   -0.065  1.00 0.00 ? 26  CYS A HA   2  
ATOM 2491  H HB2  . CYS A 1 26  ? 10.064  4.895   0.409   1.00 0.00 ? 26  CYS A HB2  2  
ATOM 2492  H HB3  . CYS A 1 26  ? 9.129   5.854   -0.721  1.00 0.00 ? 26  CYS A HB3  2  
ATOM 2493  H HG   . CYS A 1 26  ? 9.212   6.328   2.147   1.00 0.00 ? 26  CYS A HG   2  
ATOM 2494  N N    . GLU A 1 27  ? 9.583   3.203   -2.319  1.00 0.00 ? 27  GLU A N    2  
ATOM 2495  C CA   . GLU A 1 27  ? 9.821   2.979   -3.735  1.00 0.00 ? 27  GLU A CA   2  
ATOM 2496  C C    . GLU A 1 27  ? 8.788   2.002   -4.298  1.00 0.00 ? 27  GLU A C    2  
ATOM 2497  O O    . GLU A 1 27  ? 8.588   1.935   -5.510  1.00 0.00 ? 27  GLU A O    2  
ATOM 2498  C CB   . GLU A 1 27  ? 11.245  2.473   -3.977  1.00 0.00 ? 27  GLU A CB   2  
ATOM 2499  C CG   . GLU A 1 27  ? 12.247  3.629   -3.970  1.00 0.00 ? 27  GLU A CG   2  
ATOM 2500  C CD   . GLU A 1 27  ? 13.550  3.229   -4.664  1.00 0.00 ? 27  GLU A CD   2  
ATOM 2501  O OE1  . GLU A 1 27  ? 13.565  3.275   -5.914  1.00 0.00 ? 27  GLU A OE1  2  
ATOM 2502  O OE2  . GLU A 1 27  ? 14.502  2.887   -3.931  1.00 0.00 ? 27  GLU A OE2  2  
ATOM 2503  H H    . GLU A 1 27  ? 10.344  2.958   -1.718  1.00 0.00 ? 27  GLU A H    2  
ATOM 2504  H HA   . GLU A 1 27  ? 9.704   3.955   -4.206  1.00 0.00 ? 27  GLU A HA   2  
ATOM 2505  H HB2  . GLU A 1 27  ? 11.513  1.749   -3.208  1.00 0.00 ? 27  GLU A HB2  2  
ATOM 2506  H HB3  . GLU A 1 27  ? 11.291  1.952   -4.934  1.00 0.00 ? 27  GLU A HB3  2  
ATOM 2507  H HG2  . GLU A 1 27  ? 11.813  4.494   -4.473  1.00 0.00 ? 27  GLU A HG2  2  
ATOM 2508  H HG3  . GLU A 1 27  ? 12.455  3.928   -2.943  1.00 0.00 ? 27  GLU A HG3  2  
ATOM 2509  N N    . ARG A 1 28  ? 8.159   1.268   -3.393  1.00 0.00 ? 28  ARG A N    2  
ATOM 2510  C CA   . ARG A 1 28  ? 7.151   0.297   -3.785  1.00 0.00 ? 28  ARG A CA   2  
ATOM 2511  C C    . ARG A 1 28  ? 5.805   0.990   -4.008  1.00 0.00 ? 28  ARG A C    2  
ATOM 2512  O O    . ARG A 1 28  ? 5.039   0.597   -4.886  1.00 0.00 ? 28  ARG A O    2  
ATOM 2513  C CB   . ARG A 1 28  ? 6.988   -0.788  -2.719  1.00 0.00 ? 28  ARG A CB   2  
ATOM 2514  C CG   . ARG A 1 28  ? 7.641   -2.098  -3.165  1.00 0.00 ? 28  ARG A CG   2  
ATOM 2515  C CD   . ARG A 1 28  ? 8.968   -2.324  -2.437  1.00 0.00 ? 28  ARG A CD   2  
ATOM 2516  N NE   . ARG A 1 28  ? 9.848   -3.195  -3.247  1.00 0.00 ? 28  ARG A NE   2  
ATOM 2517  C CZ   . ARG A 1 28  ? 11.101  -3.525  -2.905  1.00 0.00 ? 28  ARG A CZ   2  
ATOM 2518  N NH1  . ARG A 1 28  ? 11.629  -3.057  -1.765  1.00 0.00 ? 28  ARG A NH1  2  
ATOM 2519  N NH2  . ARG A 1 28  ? 11.826  -4.321  -3.702  1.00 0.00 ? 28  ARG A NH2  2  
ATOM 2520  H H    . ARG A 1 28  ? 8.327   1.328   -2.409  1.00 0.00 ? 28  ARG A H    2  
ATOM 2521  H HA   . ARG A 1 28  ? 7.527   -0.137  -4.711  1.00 0.00 ? 28  ARG A HA   2  
ATOM 2522  H HB2  . ARG A 1 28  ? 7.436   -0.454  -1.783  1.00 0.00 ? 28  ARG A HB2  2  
ATOM 2523  H HB3  . ARG A 1 28  ? 5.928   -0.955  -2.523  1.00 0.00 ? 28  ARG A HB3  2  
ATOM 2524  H HG2  . ARG A 1 28  ? 6.967   -2.931  -2.967  1.00 0.00 ? 28  ARG A HG2  2  
ATOM 2525  H HG3  . ARG A 1 28  ? 7.812   -2.075  -4.241  1.00 0.00 ? 28  ARG A HG3  2  
ATOM 2526  H HD2  . ARG A 1 28  ? 9.458   -1.369  -2.252  1.00 0.00 ? 28  ARG A HD2  2  
ATOM 2527  H HD3  . ARG A 1 28  ? 8.785   -2.782  -1.464  1.00 0.00 ? 28  ARG A HD3  2  
ATOM 2528  H HE   . ARG A 1 28  ? 9.485   -3.561  -4.104  1.00 0.00 ? 28  ARG A HE   2  
ATOM 2529  H HH11 . ARG A 1 28  ? 11.087  -2.463  -1.170  1.00 0.00 ? 28  ARG A HH11 2  
ATOM 2530  H HH12 . ARG A 1 28  ? 12.564  -3.303  -1.510  1.00 0.00 ? 28  ARG A HH12 2  
ATOM 2531  H HH21 . ARG A 1 28  ? 11.432  -4.670  -4.552  1.00 0.00 ? 28  ARG A HH21 2  
ATOM 2532  H HH22 . ARG A 1 28  ? 12.761  -4.567  -3.446  1.00 0.00 ? 28  ARG A HH22 2  
ATOM 2533  N N    . LEU A 1 29  ? 5.559   2.009   -3.198  1.00 0.00 ? 29  LEU A N    2  
ATOM 2534  C CA   . LEU A 1 29  ? 4.319   2.760   -3.296  1.00 0.00 ? 29  LEU A CA   2  
ATOM 2535  C C    . LEU A 1 29  ? 4.001   3.022   -4.769  1.00 0.00 ? 29  LEU A C    2  
ATOM 2536  O O    . LEU A 1 29  ? 4.801   3.626   -5.483  1.00 0.00 ? 29  LEU A O    2  
ATOM 2537  C CB   . LEU A 1 29  ? 4.394   4.031   -2.448  1.00 0.00 ? 29  LEU A CB   2  
ATOM 2538  C CG   . LEU A 1 29  ? 4.716   3.830   -0.965  1.00 0.00 ? 29  LEU A CG   2  
ATOM 2539  C CD1  . LEU A 1 29  ? 5.221   5.129   -0.333  1.00 0.00 ? 29  LEU A CD1  2  
ATOM 2540  C CD2  . LEU A 1 29  ? 3.510   3.259   -0.215  1.00 0.00 ? 29  LEU A CD2  2  
ATOM 2541  H H    . LEU A 1 29  ? 6.187   2.322   -2.486  1.00 0.00 ? 29  LEU A H    2  
ATOM 2542  H HA   . LEU A 1 29  ? 3.527   2.139   -2.877  1.00 0.00 ? 29  LEU A HA   2  
ATOM 2543  H HB2  . LEU A 1 29  ? 5.151   4.687   -2.878  1.00 0.00 ? 29  LEU A HB2  2  
ATOM 2544  H HB3  . LEU A 1 29  ? 3.440   4.552   -2.525  1.00 0.00 ? 29  LEU A HB3  2  
ATOM 2545  H HG   . LEU A 1 29  ? 5.520   3.099   -0.886  1.00 0.00 ? 29  LEU A HG   2  
ATOM 2546  H HD11 . LEU A 1 29  ? 4.444   5.891   -0.397  1.00 0.00 ? 29  LEU A HD11 2  
ATOM 2547  H HD12 . LEU A 1 29  ? 5.470   4.951   0.713   1.00 0.00 ? 29  LEU A HD12 2  
ATOM 2548  H HD13 . LEU A 1 29  ? 6.109   5.470   -0.865  1.00 0.00 ? 29  LEU A HD13 2  
ATOM 2549  H HD21 . LEU A 1 29  ? 3.198   2.327   -0.686  1.00 0.00 ? 29  LEU A HD21 2  
ATOM 2550  H HD22 . LEU A 1 29  ? 3.785   3.068   0.822   1.00 0.00 ? 29  LEU A HD22 2  
ATOM 2551  H HD23 . LEU A 1 29  ? 2.690   3.976   -0.247  1.00 0.00 ? 29  LEU A HD23 2  
ATOM 2552  N N    . LYS A 1 30  ? 2.832   2.555   -5.182  1.00 0.00 ? 30  LYS A N    2  
ATOM 2553  C CA   . LYS A 1 30  ? 2.399   2.731   -6.558  1.00 0.00 ? 30  LYS A CA   2  
ATOM 2554  C C    . LYS A 1 30  ? 1.312   3.805   -6.612  1.00 0.00 ? 30  LYS A C    2  
ATOM 2555  O O    . LYS A 1 30  ? 0.606   4.030   -5.629  1.00 0.00 ? 30  LYS A O    2  
ATOM 2556  C CB   . LYS A 1 30  ? 1.971   1.391   -7.160  1.00 0.00 ? 30  LYS A CB   2  
ATOM 2557  C CG   . LYS A 1 30  ? 3.084   0.798   -8.026  1.00 0.00 ? 30  LYS A CG   2  
ATOM 2558  C CD   . LYS A 1 30  ? 2.652   0.712   -9.491  1.00 0.00 ? 30  LYS A CD   2  
ATOM 2559  C CE   . LYS A 1 30  ? 3.006   -0.651  -10.088 1.00 0.00 ? 30  LYS A CE   2  
ATOM 2560  N NZ   . LYS A 1 30  ? 2.655   -0.695  -11.526 1.00 0.00 ? 30  LYS A NZ   2  
ATOM 2561  H H    . LYS A 1 30  ? 2.187   2.064   -4.595  1.00 0.00 ? 30  LYS A H    2  
ATOM 2562  H HA   . LYS A 1 30  ? 3.259   3.080   -7.129  1.00 0.00 ? 30  LYS A HA   2  
ATOM 2563  H HB2  . LYS A 1 30  ? 1.715   0.694   -6.362  1.00 0.00 ? 30  LYS A HB2  2  
ATOM 2564  H HB3  . LYS A 1 30  ? 1.072   1.529   -7.761  1.00 0.00 ? 30  LYS A HB3  2  
ATOM 2565  H HG2  . LYS A 1 30  ? 3.980   1.413   -7.943  1.00 0.00 ? 30  LYS A HG2  2  
ATOM 2566  H HG3  . LYS A 1 30  ? 3.344   -0.195  -7.661  1.00 0.00 ? 30  LYS A HG3  2  
ATOM 2567  H HD2  . LYS A 1 30  ? 1.577   0.878   -9.568  1.00 0.00 ? 30  LYS A HD2  2  
ATOM 2568  H HD3  . LYS A 1 30  ? 3.138   1.501   -10.065 1.00 0.00 ? 30  LYS A HD3  2  
ATOM 2569  H HE2  . LYS A 1 30  ? 4.071   -0.845  -9.961  1.00 0.00 ? 30  LYS A HE2  2  
ATOM 2570  H HE3  . LYS A 1 30  ? 2.473   -1.438  -9.554  1.00 0.00 ? 30  LYS A HE3  2  
ATOM 2571  H HZ1  . LYS A 1 30  ? 2.756   -1.630  -11.865 1.00 0.00 ? 30  LYS A HZ1  2  
ATOM 2572  H HZ2  . LYS A 1 30  ? 1.709   -0.396  -11.647 1.00 0.00 ? 30  LYS A HZ2  2  
ATOM 2573  H HZ3  . LYS A 1 30  ? 3.265   -0.087  -12.036 1.00 0.00 ? 30  LYS A HZ3  2  
ATOM 2574  N N    . PRO A 1 31  ? 1.207   4.458   -7.801  1.00 0.00 ? 31  PRO A N    2  
ATOM 2575  C CA   . PRO A 1 31  ? 0.217   5.504   -7.996  1.00 0.00 ? 31  PRO A CA   2  
ATOM 2576  C C    . PRO A 1 31  ? -1.183  4.909   -8.159  1.00 0.00 ? 31  PRO A C    2  
ATOM 2577  O O    . PRO A 1 31  ? -1.481  4.284   -9.175  1.00 0.00 ? 31  PRO A O    2  
ATOM 2578  C CB   . PRO A 1 31  ? 0.687   6.265   -9.225  1.00 0.00 ? 31  PRO A CB   2  
ATOM 2579  C CG   . PRO A 1 31  ? 1.657   5.341   -9.942  1.00 0.00 ? 31  PRO A CG   2  
ATOM 2580  C CD   . PRO A 1 31  ? 2.025   4.218   -8.986  1.00 0.00 ? 31  PRO A CD   2  
ATOM 2581  H HA   . PRO A 1 31  ? 0.172   6.093   -7.189  1.00 0.00 ? 31  PRO A HA   2  
ATOM 2582  H HB2  . PRO A 1 31  ? -0.154  6.524   -9.868  1.00 0.00 ? 31  PRO A HB2  2  
ATOM 2583  H HB3  . PRO A 1 31  ? 1.172   7.199   -8.943  1.00 0.00 ? 31  PRO A HB3  2  
ATOM 2584  H HG2  . PRO A 1 31  ? 1.203   4.938   -10.847 1.00 0.00 ? 31  PRO A HG2  2  
ATOM 2585  H HG3  . PRO A 1 31  ? 2.549   5.888   -10.249 1.00 0.00 ? 31  PRO A HG3  2  
ATOM 2586  H HD2  . PRO A 1 31  ? 1.814   3.242   -9.422  1.00 0.00 ? 31  PRO A HD2  2  
ATOM 2587  H HD3  . PRO A 1 31  ? 3.088   4.237   -8.744  1.00 0.00 ? 31  PRO A HD3  2  
ATOM 2588  N N    . CYS A 1 32  ? -2.005  5.126   -7.143  1.00 0.00 ? 32  CYS A N    2  
ATOM 2589  C CA   . CYS A 1 32  ? -3.367  4.620   -7.161  1.00 0.00 ? 32  CYS A CA   2  
ATOM 2590  C C    . CYS A 1 32  ? -4.250  5.587   -6.370  1.00 0.00 ? 32  CYS A C    2  
ATOM 2591  O O    . CYS A 1 32  ? -3.756  6.336   -5.528  1.00 0.00 ? 32  CYS A O    2  
ATOM 2592  C CB   . CYS A 1 32  ? -3.448  3.194   -6.613  1.00 0.00 ? 32  CYS A CB   2  
ATOM 2593  S SG   . CYS A 1 32  ? -2.297  2.105   -7.528  1.00 0.00 ? 32  CYS A SG   2  
ATOM 2594  H H    . CYS A 1 32  ? -1.755  5.636   -6.320  1.00 0.00 ? 32  CYS A H    2  
ATOM 2595  H HA   . CYS A 1 32  ? -3.674  4.584   -8.207  1.00 0.00 ? 32  CYS A HA   2  
ATOM 2596  H HB2  . CYS A 1 32  ? -3.200  3.189   -5.552  1.00 0.00 ? 32  CYS A HB2  2  
ATOM 2597  H HB3  . CYS A 1 32  ? -4.467  2.818   -6.704  1.00 0.00 ? 32  CYS A HB3  2  
ATOM 2598  H HG   . CYS A 1 32  ? -2.384  1.075   -6.691  1.00 0.00 ? 32  CYS A HG   2  
ATOM 2599  N N    . LEU A 1 33  ? -5.540  5.539   -6.668  1.00 0.00 ? 33  LEU A N    2  
ATOM 2600  C CA   . LEU A 1 33  ? -6.496  6.402   -5.994  1.00 0.00 ? 33  LEU A CA   2  
ATOM 2601  C C    . LEU A 1 33  ? -7.775  5.612   -5.708  1.00 0.00 ? 33  LEU A C    2  
ATOM 2602  O O    . LEU A 1 33  ? -8.087  4.653   -6.412  1.00 0.00 ? 33  LEU A O    2  
ATOM 2603  C CB   . LEU A 1 33  ? -6.729  7.678   -6.805  1.00 0.00 ? 33  LEU A CB   2  
ATOM 2604  C CG   . LEU A 1 33  ? -7.415  8.827   -6.063  1.00 0.00 ? 33  LEU A CG   2  
ATOM 2605  C CD1  . LEU A 1 33  ? -6.396  9.877   -5.616  1.00 0.00 ? 33  LEU A CD1  2  
ATOM 2606  C CD2  . LEU A 1 33  ? -8.533  9.438   -6.912  1.00 0.00 ? 33  LEU A CD2  2  
ATOM 2607  H H    . LEU A 1 33  ? -5.933  4.927   -7.354  1.00 0.00 ? 33  LEU A H    2  
ATOM 2608  H HA   . LEU A 1 33  ? -6.054  6.700   -5.044  1.00 0.00 ? 33  LEU A HA   2  
ATOM 2609  H HB2  . LEU A 1 33  ? -5.766  8.033   -7.172  1.00 0.00 ? 33  LEU A HB2  2  
ATOM 2610  H HB3  . LEU A 1 33  ? -7.330  7.426   -7.678  1.00 0.00 ? 33  LEU A HB3  2  
ATOM 2611  H HG   . LEU A 1 33  ? -7.879  8.425   -5.163  1.00 0.00 ? 33  LEU A HG   2  
ATOM 2612  H HD11 . LEU A 1 33  ? -6.100  10.484  -6.472  1.00 0.00 ? 33  LEU A HD11 2  
ATOM 2613  H HD12 . LEU A 1 33  ? -6.844  10.517  -4.855  1.00 0.00 ? 33  LEU A HD12 2  
ATOM 2614  H HD13 . LEU A 1 33  ? -5.519  9.379   -5.203  1.00 0.00 ? 33  LEU A HD13 2  
ATOM 2615  H HD21 . LEU A 1 33  ? -8.207  9.502   -7.950  1.00 0.00 ? 33  LEU A HD21 2  
ATOM 2616  H HD22 . LEU A 1 33  ? -9.422  8.810   -6.848  1.00 0.00 ? 33  LEU A HD22 2  
ATOM 2617  H HD23 . LEU A 1 33  ? -8.766  10.436  -6.541  1.00 0.00 ? 33  LEU A HD23 2  
ATOM 2618  N N    . PHE A 1 34  ? -8.481  6.046   -4.674  1.00 0.00 ? 34  PHE A N    2  
ATOM 2619  C CA   . PHE A 1 34  ? -9.719  5.392   -4.287  1.00 0.00 ? 34  PHE A CA   2  
ATOM 2620  C C    . PHE A 1 34  ? -10.932 6.246   -4.664  1.00 0.00 ? 34  PHE A C    2  
ATOM 2621  O O    . PHE A 1 34  ? -11.149 7.310   -4.087  1.00 0.00 ? 34  PHE A O    2  
ATOM 2622  C CB   . PHE A 1 34  ? -9.680  5.226   -2.766  1.00 0.00 ? 34  PHE A CB   2  
ATOM 2623  C CG   . PHE A 1 34  ? -8.446  4.481   -2.253  1.00 0.00 ? 34  PHE A CG   2  
ATOM 2624  C CD1  . PHE A 1 34  ? -8.046  3.330   -2.857  1.00 0.00 ? 34  PHE A CD1  2  
ATOM 2625  C CD2  . PHE A 1 34  ? -7.750  4.970   -1.192  1.00 0.00 ? 34  PHE A CD2  2  
ATOM 2626  C CE1  . PHE A 1 34  ? -6.901  2.639   -2.381  1.00 0.00 ? 34  PHE A CE1  2  
ATOM 2627  C CE2  . PHE A 1 34  ? -6.604  4.278   -0.716  1.00 0.00 ? 34  PHE A CE2  2  
ATOM 2628  C CZ   . PHE A 1 34  ? -6.204  3.128   -1.320  1.00 0.00 ? 34  PHE A CZ   2  
ATOM 2629  H H    . PHE A 1 34  ? -8.220  6.827   -4.107  1.00 0.00 ? 34  PHE A H    2  
ATOM 2630  H HA   . PHE A 1 34  ? -9.765  4.443   -4.821  1.00 0.00 ? 34  PHE A HA   2  
ATOM 2631  H HB2  . PHE A 1 34  ? -9.716  6.212   -2.302  1.00 0.00 ? 34  PHE A HB2  2  
ATOM 2632  H HB3  . PHE A 1 34  ? -10.574 4.690   -2.446  1.00 0.00 ? 34  PHE A HB3  2  
ATOM 2633  H HD1  . PHE A 1 34  ? -8.605  2.939   -3.708  1.00 0.00 ? 34  PHE A HD1  2  
ATOM 2634  H HD2  . PHE A 1 34  ? -8.070  5.892   -0.707  1.00 0.00 ? 34  PHE A HD2  2  
ATOM 2635  H HE1  . PHE A 1 34  ? -6.580  1.717   -2.865  1.00 0.00 ? 34  PHE A HE1  2  
ATOM 2636  H HE2  . PHE A 1 34  ? -6.046  4.670   0.135   1.00 0.00 ? 34  PHE A HE2  2  
ATOM 2637  H HZ   . PHE A 1 34  ? -5.325  2.597   -0.954  1.00 0.00 ? 34  PHE A HZ   2  
ATOM 2638  N N    . THR A 1 35  ? -11.689 5.747   -5.629  1.00 0.00 ? 35  THR A N    2  
ATOM 2639  C CA   . THR A 1 35  ? -12.874 6.450   -6.090  1.00 0.00 ? 35  THR A CA   2  
ATOM 2640  C C    . THR A 1 35  ? -14.106 5.989   -5.309  1.00 0.00 ? 35  THR A C    2  
ATOM 2641  O O    . THR A 1 35  ? -13.982 5.299   -4.298  1.00 0.00 ? 35  THR A O    2  
ATOM 2642  C CB   . THR A 1 35  ? -12.996 6.233   -7.600  1.00 0.00 ? 35  THR A CB   2  
ATOM 2643  O OG1  . THR A 1 35  ? -12.517 4.906   -7.799  1.00 0.00 ? 35  THR A OG1  2  
ATOM 2644  C CG2  . THR A 1 35  ? -12.022 7.104   -8.397  1.00 0.00 ? 35  THR A CG2  2  
ATOM 2645  H H    . THR A 1 35  ? -11.505 4.880   -6.093  1.00 0.00 ? 35  THR A H    2  
ATOM 2646  H HA   . THR A 1 35  ? -12.745 7.513   -5.885  1.00 0.00 ? 35  THR A HA   2  
ATOM 2647  H HB   . THR A 1 35  ? -14.021 6.389   -7.934  1.00 0.00 ? 35  THR A HB   2  
ATOM 2648  H HG1  . THR A 1 35  ? -13.287 4.276   -7.901  1.00 0.00 ? 35  THR A HG1  2  
ATOM 2649  H HG21 . THR A 1 35  ? -11.985 6.756   -9.429  1.00 0.00 ? 35  THR A HG21 2  
ATOM 2650  H HG22 . THR A 1 35  ? -12.360 8.140   -8.374  1.00 0.00 ? 35  THR A HG22 2  
ATOM 2651  H HG23 . THR A 1 35  ? -11.028 7.036   -7.955  1.00 0.00 ? 35  THR A HG23 2  
ATOM 2652  N N    . GLU A 1 36  ? -15.267 6.388   -5.807  1.00 0.00 ? 36  GLU A N    2  
ATOM 2653  C CA   . GLU A 1 36  ? -16.520 6.024   -5.168  1.00 0.00 ? 36  GLU A CA   2  
ATOM 2654  C C    . GLU A 1 36  ? -16.825 4.543   -5.402  1.00 0.00 ? 36  GLU A C    2  
ATOM 2655  O O    . GLU A 1 36  ? -16.611 4.027   -6.498  1.00 0.00 ? 36  GLU A O    2  
ATOM 2656  C CB   . GLU A 1 36  ? -17.667 6.905   -5.669  1.00 0.00 ? 36  GLU A CB   2  
ATOM 2657  C CG   . GLU A 1 36  ? -18.293 6.322   -6.937  1.00 0.00 ? 36  GLU A CG   2  
ATOM 2658  C CD   . GLU A 1 36  ? -19.193 7.349   -7.627  1.00 0.00 ? 36  GLU A CD   2  
ATOM 2659  O OE1  . GLU A 1 36  ? -20.249 7.664   -7.037  1.00 0.00 ? 36  GLU A OE1  2  
ATOM 2660  O OE2  . GLU A 1 36  ? -18.805 7.796   -8.728  1.00 0.00 ? 36  GLU A OE2  2  
ATOM 2661  H H    . GLU A 1 36  ? -15.359 6.949   -6.630  1.00 0.00 ? 36  GLU A H    2  
ATOM 2662  H HA   . GLU A 1 36  ? -16.367 6.208   -4.105  1.00 0.00 ? 36  GLU A HA   2  
ATOM 2663  H HB2  . GLU A 1 36  ? -18.426 6.996   -4.893  1.00 0.00 ? 36  GLU A HB2  2  
ATOM 2664  H HB3  . GLU A 1 36  ? -17.296 7.910   -5.871  1.00 0.00 ? 36  GLU A HB3  2  
ATOM 2665  H HG2  . GLU A 1 36  ? -17.507 6.004   -7.622  1.00 0.00 ? 36  GLU A HG2  2  
ATOM 2666  H HG3  . GLU A 1 36  ? -18.874 5.435   -6.685  1.00 0.00 ? 36  GLU A HG3  2  
ATOM 2667  N N    . LYS A 1 37  ? -17.319 3.901   -4.354  1.00 0.00 ? 37  LYS A N    2  
ATOM 2668  C CA   . LYS A 1 37  ? -17.655 2.490   -4.431  1.00 0.00 ? 37  LYS A CA   2  
ATOM 2669  C C    . LYS A 1 37  ? -16.369 1.670   -4.559  1.00 0.00 ? 37  LYS A C    2  
ATOM 2670  O O    . LYS A 1 37  ? -16.381 0.572   -5.113  1.00 0.00 ? 37  LYS A O    2  
ATOM 2671  C CB   . LYS A 1 37  ? -18.659 2.238   -5.558  1.00 0.00 ? 37  LYS A CB   2  
ATOM 2672  C CG   . LYS A 1 37  ? -19.962 3.000   -5.311  1.00 0.00 ? 37  LYS A CG   2  
ATOM 2673  C CD   . LYS A 1 37  ? -21.147 2.287   -5.967  1.00 0.00 ? 37  LYS A CD   2  
ATOM 2674  C CE   . LYS A 1 37  ? -21.115 2.457   -7.487  1.00 0.00 ? 37  LYS A CE   2  
ATOM 2675  N NZ   . LYS A 1 37  ? -22.488 2.438   -8.039  1.00 0.00 ? 37  LYS A NZ   2  
ATOM 2676  H H    . LYS A 1 37  ? -17.490 4.328   -3.466  1.00 0.00 ? 37  LYS A H    2  
ATOM 2677  H HA   . LYS A 1 37  ? -18.145 2.219   -3.496  1.00 0.00 ? 37  LYS A HA   2  
ATOM 2678  H HB2  . LYS A 1 37  ? -18.227 2.548   -6.510  1.00 0.00 ? 37  LYS A HB2  2  
ATOM 2679  H HB3  . LYS A 1 37  ? -18.866 1.171   -5.634  1.00 0.00 ? 37  LYS A HB3  2  
ATOM 2680  H HG2  . LYS A 1 37  ? -20.137 3.091   -4.239  1.00 0.00 ? 37  LYS A HG2  2  
ATOM 2681  H HG3  . LYS A 1 37  ? -19.877 4.012   -5.707  1.00 0.00 ? 37  LYS A HG3  2  
ATOM 2682  H HD2  . LYS A 1 37  ? -21.122 1.227   -5.714  1.00 0.00 ? 37  LYS A HD2  2  
ATOM 2683  H HD3  . LYS A 1 37  ? -22.081 2.687   -5.572  1.00 0.00 ? 37  LYS A HD3  2  
ATOM 2684  H HE2  . LYS A 1 37  ? -20.626 3.396   -7.744  1.00 0.00 ? 37  LYS A HE2  2  
ATOM 2685  H HE3  . LYS A 1 37  ? -20.525 1.657   -7.935  1.00 0.00 ? 37  LYS A HE3  2  
ATOM 2686  H HZ1  . LYS A 1 37  ? -22.980 3.254   -7.735  1.00 0.00 ? 37  LYS A HZ1  2  
ATOM 2687  H HZ2  . LYS A 1 37  ? -22.445 2.427   -9.038  1.00 0.00 ? 37  LYS A HZ2  2  
ATOM 2688  H HZ3  . LYS A 1 37  ? -22.966 1.621   -7.717  1.00 0.00 ? 37  LYS A HZ3  2  
ATOM 2689  N N    . SER A 1 38  ? -15.290 2.235   -4.036  1.00 0.00 ? 38  SER A N    2  
ATOM 2690  C CA   . SER A 1 38  ? -13.999 1.571   -4.085  1.00 0.00 ? 38  SER A CA   2  
ATOM 2691  C C    . SER A 1 38  ? -13.677 0.953   -2.723  1.00 0.00 ? 38  SER A C    2  
ATOM 2692  O O    . SER A 1 38  ? -13.553 1.666   -1.728  1.00 0.00 ? 38  SER A O    2  
ATOM 2693  C CB   . SER A 1 38  ? -12.894 2.544   -4.502  1.00 0.00 ? 38  SER A CB   2  
ATOM 2694  O OG   . SER A 1 38  ? -12.301 3.191   -3.379  1.00 0.00 ? 38  SER A OG   2  
ATOM 2695  H H    . SER A 1 38  ? -15.289 3.129   -3.587  1.00 0.00 ? 38  SER A H    2  
ATOM 2696  H HA   . SER A 1 38  ? -14.103 0.794   -4.842  1.00 0.00 ? 38  SER A HA   2  
ATOM 2697  H HB2  . SER A 1 38  ? -12.127 2.004   -5.057  1.00 0.00 ? 38  SER A HB2  2  
ATOM 2698  H HB3  . SER A 1 38  ? -13.307 3.294   -5.176  1.00 0.00 ? 38  SER A HB3  2  
ATOM 2699  H HG   . SER A 1 38  ? -11.364 2.867   -3.253  1.00 0.00 ? 38  SER A HG   2  
ATOM 2700  N N    . TYR A 1 39  ? -13.550 -0.365  -2.722  1.00 0.00 ? 39  TYR A N    2  
ATOM 2701  C CA   . TYR A 1 39  ? -13.244 -1.087  -1.498  1.00 0.00 ? 39  TYR A CA   2  
ATOM 2702  C C    . TYR A 1 39  ? -11.734 -1.272  -1.334  1.00 0.00 ? 39  TYR A C    2  
ATOM 2703  O O    . TYR A 1 39  ? -11.066 -1.779  -2.233  1.00 0.00 ? 39  TYR A O    2  
ATOM 2704  C CB   . TYR A 1 39  ? -13.902 -2.460  -1.643  1.00 0.00 ? 39  TYR A CB   2  
ATOM 2705  C CG   . TYR A 1 39  ? -15.349 -2.513  -1.149  1.00 0.00 ? 39  TYR A CG   2  
ATOM 2706  C CD1  . TYR A 1 39  ? -15.623 -2.389  0.197   1.00 0.00 ? 39  TYR A CD1  2  
ATOM 2707  C CD2  . TYR A 1 39  ? -16.380 -2.683  -2.051  1.00 0.00 ? 39  TYR A CD2  2  
ATOM 2708  C CE1  . TYR A 1 39  ? -16.986 -2.438  0.662   1.00 0.00 ? 39  TYR A CE1  2  
ATOM 2709  C CE2  . TYR A 1 39  ? -17.742 -2.733  -1.587  1.00 0.00 ? 39  TYR A CE2  2  
ATOM 2710  C CZ   . TYR A 1 39  ? -17.978 -2.608  -0.253  1.00 0.00 ? 39  TYR A CZ   2  
ATOM 2711  O OH   . TYR A 1 39  ? -19.264 -2.654  0.186   1.00 0.00 ? 39  TYR A OH   2  
ATOM 2712  H H    . TYR A 1 39  ? -13.652 -0.938  -3.535  1.00 0.00 ? 39  TYR A H    2  
ATOM 2713  H HA   . TYR A 1 39  ? -13.624 -0.503  -0.660  1.00 0.00 ? 39  TYR A HA   2  
ATOM 2714  H HB2  . TYR A 1 39  ? -13.875 -2.756  -2.692  1.00 0.00 ? 39  TYR A HB2  2  
ATOM 2715  H HB3  . TYR A 1 39  ? -13.313 -3.194  -1.091  1.00 0.00 ? 39  TYR A HB3  2  
ATOM 2716  H HD1  . TYR A 1 39  ? -14.809 -2.255  0.910   1.00 0.00 ? 39  TYR A HD1  2  
ATOM 2717  H HD2  . TYR A 1 39  ? -16.163 -2.781  -3.115  1.00 0.00 ? 39  TYR A HD2  2  
ATOM 2718  H HE1  . TYR A 1 39  ? -17.216 -2.342  1.723   1.00 0.00 ? 39  TYR A HE1  2  
ATOM 2719  H HE2  . TYR A 1 39  ? -18.565 -2.867  -2.288  1.00 0.00 ? 39  TYR A HE2  2  
ATOM 2720  H HH   . TYR A 1 39  ? -19.534 -3.602  0.353   1.00 0.00 ? 39  TYR A HH   2  
ATOM 2721  N N    . LEU A 1 40  ? -11.241 -0.851  -0.178  1.00 0.00 ? 40  LEU A N    2  
ATOM 2722  C CA   . LEU A 1 40  ? -9.822  -0.964  0.116   1.00 0.00 ? 40  LEU A CA   2  
ATOM 2723  C C    . LEU A 1 40  ? -9.543  -2.331  0.742   1.00 0.00 ? 40  LEU A C    2  
ATOM 2724  O O    . LEU A 1 40  ? -8.658  -3.056  0.291   1.00 0.00 ? 40  LEU A O    2  
ATOM 2725  C CB   . LEU A 1 40  ? -9.358  0.213   0.976   1.00 0.00 ? 40  LEU A CB   2  
ATOM 2726  C CG   . LEU A 1 40  ? -9.228  1.558   0.258   1.00 0.00 ? 40  LEU A CG   2  
ATOM 2727  C CD1  . LEU A 1 40  ? -10.538 1.938   -0.436  1.00 0.00 ? 40  LEU A CD1  2  
ATOM 2728  C CD2  . LEU A 1 40  ? -8.751  2.649   1.219   1.00 0.00 ? 40  LEU A CD2  2  
ATOM 2729  H H    . LEU A 1 40  ? -11.791 -0.439  0.548   1.00 0.00 ? 40  LEU A H    2  
ATOM 2730  H HA   . LEU A 1 40  ? -9.287  -0.902  -0.832  1.00 0.00 ? 40  LEU A HA   2  
ATOM 2731  H HB2  . LEU A 1 40  ? -10.057 0.331   1.803   1.00 0.00 ? 40  LEU A HB2  2  
ATOM 2732  H HB3  . LEU A 1 40  ? -8.391  -0.039  1.410   1.00 0.00 ? 40  LEU A HB3  2  
ATOM 2733  H HG   . LEU A 1 40  ? -8.470  1.459   -0.519  1.00 0.00 ? 40  LEU A HG   2  
ATOM 2734  H HD11 . LEU A 1 40  ? -10.663 3.021   -0.407  1.00 0.00 ? 40  LEU A HD11 2  
ATOM 2735  H HD12 . LEU A 1 40  ? -10.511 1.603   -1.472  1.00 0.00 ? 40  LEU A HD12 2  
ATOM 2736  H HD13 . LEU A 1 40  ? -11.373 1.462   0.079   1.00 0.00 ? 40  LEU A HD13 2  
ATOM 2737  H HD21 . LEU A 1 40  ? -9.414  2.686   2.084   1.00 0.00 ? 40  LEU A HD21 2  
ATOM 2738  H HD22 . LEU A 1 40  ? -7.736  2.425   1.548   1.00 0.00 ? 40  LEU A HD22 2  
ATOM 2739  H HD23 . LEU A 1 40  ? -8.764  3.612   0.710   1.00 0.00 ? 40  LEU A HD23 2  
ATOM 2740  N N    . VAL A 1 41  ? -10.316 -2.643  1.773   1.00 0.00 ? 41  VAL A N    2  
ATOM 2741  C CA   . VAL A 1 41  ? -10.163 -3.911  2.466   1.00 0.00 ? 41  VAL A CA   2  
ATOM 2742  C C    . VAL A 1 41  ? -11.545 -4.513  2.731   1.00 0.00 ? 41  VAL A C    2  
ATOM 2743  O O    . VAL A 1 41  ? -12.543 -3.795  2.757   1.00 0.00 ? 41  VAL A O    2  
ATOM 2744  C CB   . VAL A 1 41  ? -9.343  -3.714  3.743   1.00 0.00 ? 41  VAL A CB   2  
ATOM 2745  C CG1  . VAL A 1 41  ? -7.932  -3.218  3.417   1.00 0.00 ? 41  VAL A CG1  2  
ATOM 2746  C CG2  . VAL A 1 41  ? -10.050 -2.759  4.707   1.00 0.00 ? 41  VAL A CG2  2  
ATOM 2747  H H    . VAL A 1 41  ? -11.034 -2.048  2.134   1.00 0.00 ? 41  VAL A H    2  
ATOM 2748  H HA   . VAL A 1 41  ? -9.608  -4.581  1.809   1.00 0.00 ? 41  VAL A HA   2  
ATOM 2749  H HB   . VAL A 1 41  ? -9.252  -4.681  4.236   1.00 0.00 ? 41  VAL A HB   2  
ATOM 2750  H HG11 . VAL A 1 41  ? -7.202  -3.952  3.757   1.00 0.00 ? 41  VAL A HG11 2  
ATOM 2751  H HG12 . VAL A 1 41  ? -7.835  -3.081  2.340   1.00 0.00 ? 41  VAL A HG12 2  
ATOM 2752  H HG13 . VAL A 1 41  ? -7.755  -2.268  3.921   1.00 0.00 ? 41  VAL A HG13 2  
ATOM 2753  H HG21 . VAL A 1 41  ? -9.463  -2.666  5.621   1.00 0.00 ? 41  VAL A HG21 2  
ATOM 2754  H HG22 . VAL A 1 41  ? -10.153 -1.780  4.239   1.00 0.00 ? 41  VAL A HG22 2  
ATOM 2755  H HG23 . VAL A 1 41  ? -11.038 -3.153  4.948   1.00 0.00 ? 41  VAL A HG23 2  
ATOM 2756  N N    . ARG A 1 42  ? -11.557 -5.824  2.919   1.00 0.00 ? 42  ARG A N    2  
ATOM 2757  C CA   . ARG A 1 42  ? -12.800 -6.530  3.181   1.00 0.00 ? 42  ARG A CA   2  
ATOM 2758  C C    . ARG A 1 42  ? -12.632 -7.479  4.369   1.00 0.00 ? 42  ARG A C    2  
ATOM 2759  O O    . ARG A 1 42  ? -11.518 -7.898  4.680   1.00 0.00 ? 42  ARG A O    2  
ATOM 2760  C CB   . ARG A 1 42  ? -13.246 -7.332  1.956   1.00 0.00 ? 42  ARG A CB   2  
ATOM 2761  C CG   . ARG A 1 42  ? -14.630 -6.884  1.482   1.00 0.00 ? 42  ARG A CG   2  
ATOM 2762  C CD   . ARG A 1 42  ? -14.545 -6.189  0.121   1.00 0.00 ? 42  ARG A CD   2  
ATOM 2763  N NE   . ARG A 1 42  ? -14.659 -7.187  -0.965  1.00 0.00 ? 42  ARG A NE   2  
ATOM 2764  C CZ   . ARG A 1 42  ? -15.805 -7.784  -1.320  1.00 0.00 ? 42  ARG A CZ   2  
ATOM 2765  N NH1  . ARG A 1 42  ? -16.942 -7.487  -0.676  1.00 0.00 ? 42  ARG A NH1  2  
ATOM 2766  N NH2  . ARG A 1 42  ? -15.814 -8.678  -2.318  1.00 0.00 ? 42  ARG A NH2  2  
ATOM 2767  H H    . ARG A 1 42  ? -10.741 -6.400  2.896   1.00 0.00 ? 42  ARG A H    2  
ATOM 2768  H HA   . ARG A 1 42  ? -13.524 -5.747  3.404   1.00 0.00 ? 42  ARG A HA   2  
ATOM 2769  H HB2  . ARG A 1 42  ? -12.523 -7.205  1.151   1.00 0.00 ? 42  ARG A HB2  2  
ATOM 2770  H HB3  . ARG A 1 42  ? -13.267 -8.394  2.201   1.00 0.00 ? 42  ARG A HB3  2  
ATOM 2771  H HG2  . ARG A 1 42  ? -15.292 -7.747  1.412   1.00 0.00 ? 42  ARG A HG2  2  
ATOM 2772  H HG3  . ARG A 1 42  ? -15.067 -6.205  2.214   1.00 0.00 ? 42  ARG A HG3  2  
ATOM 2773  H HD2  . ARG A 1 42  ? -15.340 -5.449  0.031   1.00 0.00 ? 42  ARG A HD2  2  
ATOM 2774  H HD3  . ARG A 1 42  ? -13.599 -5.653  0.036   1.00 0.00 ? 42  ARG A HD3  2  
ATOM 2775  H HE   . ARG A 1 42  ? -13.828 -7.432  -1.466  1.00 0.00 ? 42  ARG A HE   2  
ATOM 2776  H HH11 . ARG A 1 42  ? -16.935 -6.820  0.069   1.00 0.00 ? 42  ARG A HH11 2  
ATOM 2777  H HH12 . ARG A 1 42  ? -17.797 -7.933  -0.940  1.00 0.00 ? 42  ARG A HH12 2  
ATOM 2778  H HH21 . ARG A 1 42  ? -14.965 -8.900  -2.798  1.00 0.00 ? 42  ARG A HH21 2  
ATOM 2779  H HH22 . ARG A 1 42  ? -16.669 -9.124  -2.582  1.00 0.00 ? 42  ARG A HH22 2  
ATOM 2780  N N    . GLU A 1 43  ? -13.754 -7.789  5.001   1.00 0.00 ? 43  GLU A N    2  
ATOM 2781  C CA   . GLU A 1 43  ? -13.744 -8.680  6.149   1.00 0.00 ? 43  GLU A CA   2  
ATOM 2782  C C    . GLU A 1 43  ? -14.033 -10.117 5.708   1.00 0.00 ? 43  GLU A C    2  
ATOM 2783  O O    . GLU A 1 43  ? -15.176 -10.461 5.409   1.00 0.00 ? 43  GLU A O    2  
ATOM 2784  C CB   . GLU A 1 43  ? -14.748 -8.220  7.209   1.00 0.00 ? 43  GLU A CB   2  
ATOM 2785  C CG   . GLU A 1 43  ? -14.118 -8.238  8.603   1.00 0.00 ? 43  GLU A CG   2  
ATOM 2786  C CD   . GLU A 1 43  ? -14.946 -9.091  9.568   1.00 0.00 ? 43  GLU A CD   2  
ATOM 2787  O OE1  . GLU A 1 43  ? -15.874 -8.518  10.178  1.00 0.00 ? 43  GLU A OE1  2  
ATOM 2788  O OE2  . GLU A 1 43  ? -14.631 -10.296 9.672   1.00 0.00 ? 43  GLU A OE2  2  
ATOM 2789  H H    . GLU A 1 43  ? -14.656 -7.444  4.742   1.00 0.00 ? 43  GLU A H    2  
ATOM 2790  H HA   . GLU A 1 43  ? -12.737 -8.615  6.559   1.00 0.00 ? 43  GLU A HA   2  
ATOM 2791  H HB2  . GLU A 1 43  ? -15.094 -7.214  6.975   1.00 0.00 ? 43  GLU A HB2  2  
ATOM 2792  H HB3  . GLU A 1 43  ? -15.623 -8.870  7.193   1.00 0.00 ? 43  GLU A HB3  2  
ATOM 2793  H HG2  . GLU A 1 43  ? -13.104 -8.631  8.544   1.00 0.00 ? 43  GLU A HG2  2  
ATOM 2794  H HG3  . GLU A 1 43  ? -14.044 -7.220  8.985   1.00 0.00 ? 43  GLU A HG3  2  
ATOM 2795  N N    . GLY A 1 44  ? -12.977 -10.917 5.681   1.00 0.00 ? 44  GLY A N    2  
ATOM 2796  C CA   . GLY A 1 44  ? -13.103 -12.308 5.281   1.00 0.00 ? 44  GLY A CA   2  
ATOM 2797  C C    . GLY A 1 44  ? -12.201 -12.618 4.085   1.00 0.00 ? 44  GLY A C    2  
ATOM 2798  O O    . GLY A 1 44  ? -11.775 -13.758 3.903   1.00 0.00 ? 44  GLY A O    2  
ATOM 2799  H H    . GLY A 1 44  ? -12.051 -10.629 5.926   1.00 0.00 ? 44  GLY A H    2  
ATOM 2800  H HA2  . GLY A 1 44  ? -12.839 -12.956 6.117   1.00 0.00 ? 44  GLY A HA2  2  
ATOM 2801  H HA3  . GLY A 1 44  ? -14.140 -12.525 5.025   1.00 0.00 ? 44  GLY A HA3  2  
ATOM 2802  N N    . ASP A 1 45  ? -11.937 -11.584 3.300   1.00 0.00 ? 45  ASP A N    2  
ATOM 2803  C CA   . ASP A 1 45  ? -11.094 -11.732 2.126   1.00 0.00 ? 45  ASP A CA   2  
ATOM 2804  C C    . ASP A 1 45  ? -9.636  -11.480 2.515   1.00 0.00 ? 45  ASP A C    2  
ATOM 2805  O O    . ASP A 1 45  ? -9.362  -10.803 3.505   1.00 0.00 ? 45  ASP A O    2  
ATOM 2806  C CB   . ASP A 1 45  ? -11.475 -10.721 1.043   1.00 0.00 ? 45  ASP A CB   2  
ATOM 2807  C CG   . ASP A 1 45  ? -11.126 -9.266  1.364   1.00 0.00 ? 45  ASP A CG   2  
ATOM 2808  O OD1  . ASP A 1 45  ? -11.079 -8.948  2.572   1.00 0.00 ? 45  ASP A OD1  2  
ATOM 2809  O OD2  . ASP A 1 45  ? -10.913 -8.506  0.395   1.00 0.00 ? 45  ASP A OD2  2  
ATOM 2810  H H    . ASP A 1 45  ? -12.287 -10.661 3.455   1.00 0.00 ? 45  ASP A H    2  
ATOM 2811  H HA   . ASP A 1 45  ? -11.262 -12.751 1.778   1.00 0.00 ? 45  ASP A HA   2  
ATOM 2812  H HB2  . ASP A 1 45  ? -10.978 -11.001 0.114   1.00 0.00 ? 45  ASP A HB2  2  
ATOM 2813  H HB3  . ASP A 1 45  ? -12.548 -10.790 0.864   1.00 0.00 ? 45  ASP A HB3  2  
ATOM 2814  N N    . PRO A 1 46  ? -8.714  -12.054 1.696   1.00 0.00 ? 46  PRO A N    2  
ATOM 2815  C CA   . PRO A 1 46  ? -7.291  -11.899 1.945   1.00 0.00 ? 46  PRO A CA   2  
ATOM 2816  C C    . PRO A 1 46  ? -6.816  -10.498 1.555   1.00 0.00 ? 46  PRO A C    2  
ATOM 2817  O O    . PRO A 1 46  ? -7.542  -9.753  0.898   1.00 0.00 ? 46  PRO A O    2  
ATOM 2818  C CB   . PRO A 1 46  ? -6.627  -12.999 1.133   1.00 0.00 ? 46  PRO A CB   2  
ATOM 2819  C CG   . PRO A 1 46  ? -7.655  -13.433 0.100   1.00 0.00 ? 46  PRO A CG   2  
ATOM 2820  C CD   . PRO A 1 46  ? -9.002  -12.864 0.515   1.00 0.00 ? 46  PRO A CD   2  
ATOM 2821  H HA   . PRO A 1 46  ? -7.098  -11.991 2.922   1.00 0.00 ? 46  PRO A HA   2  
ATOM 2822  H HB2  . PRO A 1 46  ? -5.720  -12.635 0.651   1.00 0.00 ? 46  PRO A HB2  2  
ATOM 2823  H HB3  . PRO A 1 46  ? -6.338  -13.834 1.770   1.00 0.00 ? 46  PRO A HB3  2  
ATOM 2824  H HG2  . PRO A 1 46  ? -7.377  -13.072 -0.890  1.00 0.00 ? 46  PRO A HG2  2  
ATOM 2825  H HG3  . PRO A 1 46  ? -7.702  -14.520 0.042   1.00 0.00 ? 46  PRO A HG3  2  
ATOM 2826  H HD2  . PRO A 1 46  ? -9.440  -12.261 -0.281  1.00 0.00 ? 46  PRO A HD2  2  
ATOM 2827  H HD3  . PRO A 1 46  ? -9.714  -13.657 0.743   1.00 0.00 ? 46  PRO A HD3  2  
ATOM 2828  N N    . VAL A 1 47  ? -5.600  -10.182 1.976   1.00 0.00 ? 47  VAL A N    2  
ATOM 2829  C CA   . VAL A 1 47  ? -5.020  -8.883  1.678   1.00 0.00 ? 47  VAL A CA   2  
ATOM 2830  C C    . VAL A 1 47  ? -3.858  -9.061  0.699   1.00 0.00 ? 47  VAL A C    2  
ATOM 2831  O O    . VAL A 1 47  ? -2.774  -9.493  1.087   1.00 0.00 ? 47  VAL A O    2  
ATOM 2832  C CB   . VAL A 1 47  ? -4.606  -8.185  2.976   1.00 0.00 ? 47  VAL A CB   2  
ATOM 2833  C CG1  . VAL A 1 47  ? -4.076  -6.777  2.696   1.00 0.00 ? 47  VAL A CG1  2  
ATOM 2834  C CG2  . VAL A 1 47  ? -5.767  -8.147  3.972   1.00 0.00 ? 47  VAL A CG2  2  
ATOM 2835  H H    . VAL A 1 47  ? -5.017  -10.793 2.509   1.00 0.00 ? 47  VAL A H    2  
ATOM 2836  H HA   . VAL A 1 47  ? -5.792  -8.279  1.202   1.00 0.00 ? 47  VAL A HA   2  
ATOM 2837  H HB   . VAL A 1 47  ? -3.799  -8.764  3.425   1.00 0.00 ? 47  VAL A HB   2  
ATOM 2838  H HG11 . VAL A 1 47  ? -4.619  -6.057  3.308   1.00 0.00 ? 47  VAL A HG11 2  
ATOM 2839  H HG12 . VAL A 1 47  ? -3.015  -6.734  2.939   1.00 0.00 ? 47  VAL A HG12 2  
ATOM 2840  H HG13 . VAL A 1 47  ? -4.218  -6.538  1.642   1.00 0.00 ? 47  VAL A HG13 2  
ATOM 2841  H HG21 . VAL A 1 47  ? -6.452  -7.344  3.700   1.00 0.00 ? 47  VAL A HG21 2  
ATOM 2842  H HG22 . VAL A 1 47  ? -6.296  -9.100  3.950   1.00 0.00 ? 47  VAL A HG22 2  
ATOM 2843  H HG23 . VAL A 1 47  ? -5.379  -7.970  4.975   1.00 0.00 ? 47  VAL A HG23 2  
ATOM 2844  N N    . ASN A 1 48  ? -4.125  -8.719  -0.554  1.00 0.00 ? 48  ASN A N    2  
ATOM 2845  C CA   . ASN A 1 48  ? -3.115  -8.835  -1.592  1.00 0.00 ? 48  ASN A CA   2  
ATOM 2846  C C    . ASN A 1 48  ? -2.097  -7.703  -1.437  1.00 0.00 ? 48  ASN A C    2  
ATOM 2847  O O    . ASN A 1 48  ? -0.892  -7.932  -1.516  1.00 0.00 ? 48  ASN A O    2  
ATOM 2848  C CB   . ASN A 1 48  ? -3.741  -8.722  -2.984  1.00 0.00 ? 48  ASN A CB   2  
ATOM 2849  C CG   . ASN A 1 48  ? -2.951  -9.539  -4.008  1.00 0.00 ? 48  ASN A CG   2  
ATOM 2850  O OD1  . ASN A 1 48  ? -2.419  -10.598 -3.719  1.00 0.00 ? 48  ASN A OD1  2  
ATOM 2851  N ND2  . ASN A 1 48  ? -2.904  -8.989  -5.218  1.00 0.00 ? 48  ASN A ND2  2  
ATOM 2852  H H    . ASN A 1 48  ? -5.009  -8.368  -0.861  1.00 0.00 ? 48  ASN A H    2  
ATOM 2853  H HA   . ASN A 1 48  ? -2.669  -9.819  -1.449  1.00 0.00 ? 48  ASN A HA   2  
ATOM 2854  H HB2  . ASN A 1 48  ? -4.773  -9.071  -2.952  1.00 0.00 ? 48  ASN A HB2  2  
ATOM 2855  H HB3  . ASN A 1 48  ? -3.767  -7.676  -3.290  1.00 0.00 ? 48  ASN A HB3  2  
ATOM 2856  H HD21 . ASN A 1 48  ? -3.362  -8.117  -5.389  1.00 0.00 ? 48  ASN A HD21 2  
ATOM 2857  H HD22 . ASN A 1 48  ? -2.411  -9.448  -5.957  1.00 0.00 ? 48  ASN A HD22 2  
ATOM 2858  N N    . GLU A 1 49  ? -2.621  -6.506  -1.220  1.00 0.00 ? 49  GLU A N    2  
ATOM 2859  C CA   . GLU A 1 49  ? -1.773  -5.337  -1.053  1.00 0.00 ? 49  GLU A CA   2  
ATOM 2860  C C    . GLU A 1 49  ? -2.323  -4.436  0.054   1.00 0.00 ? 49  GLU A C    2  
ATOM 2861  O O    . GLU A 1 49  ? -3.530  -4.402  0.290   1.00 0.00 ? 49  GLU A O    2  
ATOM 2862  C CB   . GLU A 1 49  ? -1.635  -4.568  -2.368  1.00 0.00 ? 49  GLU A CB   2  
ATOM 2863  C CG   . GLU A 1 49  ? -2.998  -4.081  -2.864  1.00 0.00 ? 49  GLU A CG   2  
ATOM 2864  C CD   . GLU A 1 49  ? -3.779  -5.219  -3.526  1.00 0.00 ? 49  GLU A CD   2  
ATOM 2865  O OE1  . GLU A 1 49  ? -3.435  -5.546  -4.682  1.00 0.00 ? 49  GLU A OE1  2  
ATOM 2866  O OE2  . GLU A 1 49  ? -4.703  -5.735  -2.861  1.00 0.00 ? 49  GLU A OE2  2  
ATOM 2867  H H    . GLU A 1 49  ? -3.603  -6.328  -1.157  1.00 0.00 ? 49  GLU A H    2  
ATOM 2868  H HA   . GLU A 1 49  ? -0.797  -5.727  -0.763  1.00 0.00 ? 49  GLU A HA   2  
ATOM 2869  H HB2  . GLU A 1 49  ? -0.970  -3.716  -2.227  1.00 0.00 ? 49  GLU A HB2  2  
ATOM 2870  H HB3  . GLU A 1 49  ? -1.177  -5.208  -3.122  1.00 0.00 ? 49  GLU A HB3  2  
ATOM 2871  H HG2  . GLU A 1 49  ? -3.572  -3.680  -2.028  1.00 0.00 ? 49  GLU A HG2  2  
ATOM 2872  H HG3  . GLU A 1 49  ? -2.861  -3.268  -3.576  1.00 0.00 ? 49  GLU A HG3  2  
ATOM 2873  N N    . MET A 1 50  ? -1.411  -3.728  0.705   1.00 0.00 ? 50  MET A N    2  
ATOM 2874  C CA   . MET A 1 50  ? -1.790  -2.829  1.781   1.00 0.00 ? 50  MET A CA   2  
ATOM 2875  C C    . MET A 1 50  ? -1.959  -1.398  1.267   1.00 0.00 ? 50  MET A C    2  
ATOM 2876  O O    . MET A 1 50  ? -1.198  -0.948  0.412   1.00 0.00 ? 50  MET A O    2  
ATOM 2877  C CB   . MET A 1 50  ? -0.716  -2.857  2.871   1.00 0.00 ? 50  MET A CB   2  
ATOM 2878  C CG   . MET A 1 50  ? -1.108  -1.963  4.050   1.00 0.00 ? 50  MET A CG   2  
ATOM 2879  S SD   . MET A 1 50  ? -0.292  -2.521  5.536   1.00 0.00 ? 50  MET A SD   2  
ATOM 2880  C CE   . MET A 1 50  ? -0.365  -1.026  6.509   1.00 0.00 ? 50  MET A CE   2  
ATOM 2881  H H    . MET A 1 50  ? -0.432  -3.762  0.507   1.00 0.00 ? 50  MET A H    2  
ATOM 2882  H HA   . MET A 1 50  ? -2.743  -3.204  2.154   1.00 0.00 ? 50  MET A HA   2  
ATOM 2883  H HB2  . MET A 1 50  ? -0.571  -3.880  3.218   1.00 0.00 ? 50  MET A HB2  2  
ATOM 2884  H HB3  . MET A 1 50  ? 0.235   -2.522  2.457   1.00 0.00 ? 50  MET A HB3  2  
ATOM 2885  H HG2  . MET A 1 50  ? -0.834  -0.929  3.840   1.00 0.00 ? 50  MET A HG2  2  
ATOM 2886  H HG3  . MET A 1 50  ? -2.189  -1.984  4.189   1.00 0.00 ? 50  MET A HG3  2  
ATOM 2887  H HE1  . MET A 1 50  ? 0.392   -0.326  6.156   1.00 0.00 ? 50  MET A HE1  2  
ATOM 2888  H HE2  . MET A 1 50  ? -1.352  -0.575  6.409   1.00 0.00 ? 50  MET A HE2  2  
ATOM 2889  H HE3  . MET A 1 50  ? -0.179  -1.265  7.556   1.00 0.00 ? 50  MET A HE3  2  
ATOM 2890  N N    . LEU A 1 51  ? -2.962  -0.723  1.810   1.00 0.00 ? 51  LEU A N    2  
ATOM 2891  C CA   . LEU A 1 51  ? -3.240  0.648   1.416   1.00 0.00 ? 51  LEU A CA   2  
ATOM 2892  C C    . LEU A 1 51  ? -2.875  1.588   2.566   1.00 0.00 ? 51  LEU A C    2  
ATOM 2893  O O    . LEU A 1 51  ? -3.258  1.353   3.711   1.00 0.00 ? 51  LEU A O    2  
ATOM 2894  C CB   . LEU A 1 51  ? -4.690  0.786   0.946   1.00 0.00 ? 51  LEU A CB   2  
ATOM 2895  C CG   . LEU A 1 51  ? -5.044  0.063   -0.355  1.00 0.00 ? 51  LEU A CG   2  
ATOM 2896  C CD1  . LEU A 1 51  ? -3.805  -0.127  -1.232  1.00 0.00 ? 51  LEU A CD1  2  
ATOM 2897  C CD2  . LEU A 1 51  ? -5.754  -1.262  -0.070  1.00 0.00 ? 51  LEU A CD2  2  
ATOM 2898  H H    . LEU A 1 51  ? -3.576  -1.096  2.504   1.00 0.00 ? 51  LEU A H    2  
ATOM 2899  H HA   . LEU A 1 51  ? -2.601  0.880   0.564   1.00 0.00 ? 51  LEU A HA   2  
ATOM 2900  H HB2  . LEU A 1 51  ? -5.344  0.415   1.734   1.00 0.00 ? 51  LEU A HB2  2  
ATOM 2901  H HB3  . LEU A 1 51  ? -4.911  1.846   0.821   1.00 0.00 ? 51  LEU A HB3  2  
ATOM 2902  H HG   . LEU A 1 51  ? -5.741  0.687   -0.914  1.00 0.00 ? 51  LEU A HG   2  
ATOM 2903  H HD11 . LEU A 1 51  ? -4.103  -0.532  -2.199  1.00 0.00 ? 51  LEU A HD11 2  
ATOM 2904  H HD12 . LEU A 1 51  ? -3.311  0.834   -1.377  1.00 0.00 ? 51  LEU A HD12 2  
ATOM 2905  H HD13 . LEU A 1 51  ? -3.118  -0.819  -0.745  1.00 0.00 ? 51  LEU A HD13 2  
ATOM 2906  H HD21 . LEU A 1 51  ? -5.431  -1.646  0.897   1.00 0.00 ? 51  LEU A HD21 2  
ATOM 2907  H HD22 . LEU A 1 51  ? -6.832  -1.102  -0.056  1.00 0.00 ? 51  LEU A HD22 2  
ATOM 2908  H HD23 . LEU A 1 51  ? -5.504  -1.983  -0.849  1.00 0.00 ? 51  LEU A HD23 2  
ATOM 2909  N N    . PHE A 1 52  ? -2.138  2.634   2.222   1.00 0.00 ? 52  PHE A N    2  
ATOM 2910  C CA   . PHE A 1 52  ? -1.716  3.611   3.211   1.00 0.00 ? 52  PHE A CA   2  
ATOM 2911  C C    . PHE A 1 52  ? -2.410  4.956   2.984   1.00 0.00 ? 52  PHE A C    2  
ATOM 2912  O O    . PHE A 1 52  ? -2.017  5.720   2.104   1.00 0.00 ? 52  PHE A O    2  
ATOM 2913  C CB   . PHE A 1 52  ? -0.207  3.795   3.044   1.00 0.00 ? 52  PHE A CB   2  
ATOM 2914  C CG   . PHE A 1 52  ? 0.615   2.557   3.411   1.00 0.00 ? 52  PHE A CG   2  
ATOM 2915  C CD1  . PHE A 1 52  ? 0.642   1.486   2.573   1.00 0.00 ? 52  PHE A CD1  2  
ATOM 2916  C CD2  . PHE A 1 52  ? 1.318   2.528   4.575   1.00 0.00 ? 52  PHE A CD2  2  
ATOM 2917  C CE1  . PHE A 1 52  ? 1.405   0.338   2.913   1.00 0.00 ? 52  PHE A CE1  2  
ATOM 2918  C CE2  . PHE A 1 52  ? 2.080   1.379   4.915   1.00 0.00 ? 52  PHE A CE2  2  
ATOM 2919  C CZ   . PHE A 1 52  ? 2.108   0.308   4.077   1.00 0.00 ? 52  PHE A CZ   2  
ATOM 2920  H H    . PHE A 1 52  ? -1.830  2.818   1.288   1.00 0.00 ? 52  PHE A H    2  
ATOM 2921  H HA   . PHE A 1 52  ? -1.996  3.221   4.190   1.00 0.00 ? 52  PHE A HA   2  
ATOM 2922  H HB2  . PHE A 1 52  ? 0.004   4.064   2.009   1.00 0.00 ? 52  PHE A HB2  2  
ATOM 2923  H HB3  . PHE A 1 52  ? 0.118   4.630   3.664   1.00 0.00 ? 52  PHE A HB3  2  
ATOM 2924  H HD1  . PHE A 1 52  ? 0.079   1.510   1.640   1.00 0.00 ? 52  PHE A HD1  2  
ATOM 2925  H HD2  . PHE A 1 52  ? 1.295   3.386   5.247   1.00 0.00 ? 52  PHE A HD2  2  
ATOM 2926  H HE1  . PHE A 1 52  ? 1.427   -0.521  2.242   1.00 0.00 ? 52  PHE A HE1  2  
ATOM 2927  H HE2  . PHE A 1 52  ? 2.643   1.356   5.848   1.00 0.00 ? 52  PHE A HE2  2  
ATOM 2928  H HZ   . PHE A 1 52  ? 2.693   -0.573  4.339   1.00 0.00 ? 52  PHE A HZ   2  
ATOM 2929  N N    . ILE A 1 53  ? -3.429  5.204   3.793   1.00 0.00 ? 53  ILE A N    2  
ATOM 2930  C CA   . ILE A 1 53  ? -4.181  6.443   3.691   1.00 0.00 ? 53  ILE A CA   2  
ATOM 2931  C C    . ILE A 1 53  ? -3.241  7.626   3.929   1.00 0.00 ? 53  ILE A C    2  
ATOM 2932  O O    . ILE A 1 53  ? -2.701  7.785   5.023   1.00 0.00 ? 53  ILE A O    2  
ATOM 2933  C CB   . ILE A 1 53  ? -5.387  6.417   4.633   1.00 0.00 ? 53  ILE A CB   2  
ATOM 2934  C CG1  . ILE A 1 53  ? -6.423  5.391   4.169   1.00 0.00 ? 53  ILE A CG1  2  
ATOM 2935  C CG2  . ILE A 1 53  ? -5.993  7.814   4.787   1.00 0.00 ? 53  ILE A CG2  2  
ATOM 2936  C CD1  . ILE A 1 53  ? -6.939  5.728   2.769   1.00 0.00 ? 53  ILE A CD1  2  
ATOM 2937  H H    . ILE A 1 53  ? -3.743  4.577   4.506   1.00 0.00 ? 53  ILE A H    2  
ATOM 2938  H HA   . ILE A 1 53  ? -4.568  6.508   2.674   1.00 0.00 ? 53  ILE A HA   2  
ATOM 2939  H HB   . ILE A 1 53  ? -5.043  6.105   5.619   1.00 0.00 ? 53  ILE A HB   2  
ATOM 2940  H HG12 . ILE A 1 53  ? -5.978  4.396   4.167   1.00 0.00 ? 53  ILE A HG12 2  
ATOM 2941  H HG13 . ILE A 1 53  ? -7.256  5.367   4.872   1.00 0.00 ? 53  ILE A HG13 2  
ATOM 2942  H HG21 . ILE A 1 53  ? -6.007  8.312   3.818   1.00 0.00 ? 53  ILE A HG21 2  
ATOM 2943  H HG22 . ILE A 1 53  ? -7.010  7.729   5.167   1.00 0.00 ? 53  ILE A HG22 2  
ATOM 2944  H HG23 . ILE A 1 53  ? -5.391  8.396   5.486   1.00 0.00 ? 53  ILE A HG23 2  
ATOM 2945  H HD11 . ILE A 1 53  ? -7.189  6.788   2.719   1.00 0.00 ? 53  ILE A HD11 2  
ATOM 2946  H HD12 . ILE A 1 53  ? -6.168  5.501   2.033   1.00 0.00 ? 53  ILE A HD12 2  
ATOM 2947  H HD13 . ILE A 1 53  ? -7.829  5.135   2.557   1.00 0.00 ? 53  ILE A HD13 2  
ATOM 2948  N N    . ILE A 1 54  ? -3.073  8.427   2.887   1.00 0.00 ? 54  ILE A N    2  
ATOM 2949  C CA   . ILE A 1 54  ? -2.207  9.591   2.968   1.00 0.00 ? 54  ILE A CA   2  
ATOM 2950  C C    . ILE A 1 54  ? -3.026  10.799  3.426   1.00 0.00 ? 54  ILE A C    2  
ATOM 2951  O O    . ILE A 1 54  ? -2.580  11.571  4.273   1.00 0.00 ? 54  ILE A O    2  
ATOM 2952  C CB   . ILE A 1 54  ? -1.477  9.809   1.642   1.00 0.00 ? 54  ILE A CB   2  
ATOM 2953  C CG1  . ILE A 1 54  ? -0.859  8.504   1.135   1.00 0.00 ? 54  ILE A CG1  2  
ATOM 2954  C CG2  . ILE A 1 54  ? -0.438  10.925  1.765   1.00 0.00 ? 54  ILE A CG2  2  
ATOM 2955  C CD1  . ILE A 1 54  ? 0.389   8.139   1.941   1.00 0.00 ? 54  ILE A CD1  2  
ATOM 2956  H H    . ILE A 1 54  ? -3.516  8.291   2.000   1.00 0.00 ? 54  ILE A H    2  
ATOM 2957  H HA   . ILE A 1 54  ? -1.449  9.381   3.723   1.00 0.00 ? 54  ILE A HA   2  
ATOM 2958  H HB   . ILE A 1 54  ? -2.207  10.130  0.899   1.00 0.00 ? 54  ILE A HB   2  
ATOM 2959  H HG12 . ILE A 1 54  ? -1.591  7.700   1.206   1.00 0.00 ? 54  ILE A HG12 2  
ATOM 2960  H HG13 . ILE A 1 54  ? -0.599  8.606   0.081   1.00 0.00 ? 54  ILE A HG13 2  
ATOM 2961  H HG21 . ILE A 1 54  ? 0.272   10.854  0.941   1.00 0.00 ? 54  ILE A HG21 2  
ATOM 2962  H HG22 . ILE A 1 54  ? -0.938  11.893  1.731   1.00 0.00 ? 54  ILE A HG22 2  
ATOM 2963  H HG23 . ILE A 1 54  ? 0.093   10.824  2.712   1.00 0.00 ? 54  ILE A HG23 2  
ATOM 2964  H HD11 . ILE A 1 54  ? 0.281   7.131   2.340   1.00 0.00 ? 54  ILE A HD11 2  
ATOM 2965  H HD12 . ILE A 1 54  ? 1.265   8.181   1.293   1.00 0.00 ? 54  ILE A HD12 2  
ATOM 2966  H HD13 . ILE A 1 54  ? 0.510   8.845   2.763   1.00 0.00 ? 54  ILE A HD13 2  
ATOM 2967  N N    . ARG A 1 55  ? -4.210  10.926  2.844   1.00 0.00 ? 55  ARG A N    2  
ATOM 2968  C CA   . ARG A 1 55  ? -5.095  12.028  3.181   1.00 0.00 ? 55  ARG A CA   2  
ATOM 2969  C C    . ARG A 1 55  ? -6.430  11.880  2.447   1.00 0.00 ? 55  ARG A C    2  
ATOM 2970  O O    . ARG A 1 55  ? -6.468  11.868  1.218   1.00 0.00 ? 55  ARG A O    2  
ATOM 2971  C CB   . ARG A 1 55  ? -4.465  13.373  2.815   1.00 0.00 ? 55  ARG A CB   2  
ATOM 2972  C CG   . ARG A 1 55  ? -4.385  14.292  4.035   1.00 0.00 ? 55  ARG A CG   2  
ATOM 2973  C CD   . ARG A 1 55  ? -2.939  14.453  4.506   1.00 0.00 ? 55  ARG A CD   2  
ATOM 2974  N NE   . ARG A 1 55  ? -2.546  15.879  4.457   1.00 0.00 ? 55  ARG A NE   2  
ATOM 2975  C CZ   . ARG A 1 55  ? -2.271  16.543  3.326   1.00 0.00 ? 55  ARG A CZ   2  
ATOM 2976  N NH1  . ARG A 1 55  ? -2.345  15.915  2.145   1.00 0.00 ? 55  ARG A NH1  2  
ATOM 2977  N NH2  . ARG A 1 55  ? -1.923  17.836  3.376   1.00 0.00 ? 55  ARG A NH2  2  
ATOM 2978  H H    . ARG A 1 55  ? -4.565  10.294  2.155   1.00 0.00 ? 55  ARG A H    2  
ATOM 2979  H HA   . ARG A 1 55  ? -5.231  11.956  4.260   1.00 0.00 ? 55  ARG A HA   2  
ATOM 2980  H HB2  . ARG A 1 55  ? -3.466  13.212  2.410   1.00 0.00 ? 55  ARG A HB2  2  
ATOM 2981  H HB3  . ARG A 1 55  ? -5.053  13.852  2.032   1.00 0.00 ? 55  ARG A HB3  2  
ATOM 2982  H HG2  . ARG A 1 55  ? -4.802  15.268  3.788   1.00 0.00 ? 55  ARG A HG2  2  
ATOM 2983  H HG3  . ARG A 1 55  ? -4.991  13.882  4.843   1.00 0.00 ? 55  ARG A HG3  2  
ATOM 2984  H HD2  . ARG A 1 55  ? -2.834  14.073  5.523   1.00 0.00 ? 55  ARG A HD2  2  
ATOM 2985  H HD3  . ARG A 1 55  ? -2.274  13.862  3.876   1.00 0.00 ? 55  ARG A HD3  2  
ATOM 2986  H HE   . ARG A 1 55  ? -2.481  16.377  5.321   1.00 0.00 ? 55  ARG A HE   2  
ATOM 2987  H HH11 . ARG A 1 55  ? -2.604  14.950  2.107   1.00 0.00 ? 55  ARG A HH11 2  
ATOM 2988  H HH12 . ARG A 1 55  ? -2.139  16.410  1.301   1.00 0.00 ? 55  ARG A HH12 2  
ATOM 2989  H HH21 . ARG A 1 55  ? -1.867  18.305  4.258   1.00 0.00 ? 55  ARG A HH21 2  
ATOM 2990  H HH22 . ARG A 1 55  ? -1.717  18.332  2.532   1.00 0.00 ? 55  ARG A HH22 2  
ATOM 2991  N N    . GLY A 1 56  ? -7.492  11.771  3.232   1.00 0.00 ? 56  GLY A N    2  
ATOM 2992  C CA   . GLY A 1 56  ? -8.824  11.625  2.672   1.00 0.00 ? 56  GLY A CA   2  
ATOM 2993  C C    . GLY A 1 56  ? -9.820  11.165  3.738   1.00 0.00 ? 56  GLY A C    2  
ATOM 2994  O O    . GLY A 1 56  ? -9.551  11.278  4.933   1.00 0.00 ? 56  GLY A O    2  
ATOM 2995  H H    . GLY A 1 56  ? -7.452  11.782  4.231   1.00 0.00 ? 56  GLY A H    2  
ATOM 2996  H HA2  . GLY A 1 56  ? -9.151  12.575  2.249   1.00 0.00 ? 56  GLY A HA2  2  
ATOM 2997  H HA3  . GLY A 1 56  ? -8.802  10.904  1.855   1.00 0.00 ? 56  GLY A HA3  2  
ATOM 2998  N N    . ARG A 1 57  ? -10.949 10.657  3.268   1.00 0.00 ? 57  ARG A N    2  
ATOM 2999  C CA   . ARG A 1 57  ? -11.987 10.179  4.167   1.00 0.00 ? 57  ARG A CA   2  
ATOM 3000  C C    . ARG A 1 57  ? -12.456 8.786   3.743   1.00 0.00 ? 57  ARG A C    2  
ATOM 3001  O O    . ARG A 1 57  ? -12.330 8.412   2.578   1.00 0.00 ? 57  ARG A O    2  
ATOM 3002  C CB   . ARG A 1 57  ? -13.185 11.131  4.180   1.00 0.00 ? 57  ARG A CB   2  
ATOM 3003  C CG   . ARG A 1 57  ? -12.916 12.338  5.081   1.00 0.00 ? 57  ARG A CG   2  
ATOM 3004  C CD   . ARG A 1 57  ? -13.846 12.333  6.296   1.00 0.00 ? 57  ARG A CD   2  
ATOM 3005  N NE   . ARG A 1 57  ? -14.599 13.605  6.362   1.00 0.00 ? 57  ARG A NE   2  
ATOM 3006  C CZ   . ARG A 1 57  ? -15.528 13.976  5.470   1.00 0.00 ? 57  ARG A CZ   2  
ATOM 3007  N NH1  . ARG A 1 57  ? -15.824 13.174  4.438   1.00 0.00 ? 57  ARG A NH1  2  
ATOM 3008  N NH2  . ARG A 1 57  ? -16.161 15.149  5.610   1.00 0.00 ? 57  ARG A NH2  2  
ATOM 3009  H H    . ARG A 1 57  ? -11.160 10.568  2.294   1.00 0.00 ? 57  ARG A H    2  
ATOM 3010  H HA   . ARG A 1 57  ? -11.514 10.153  5.149   1.00 0.00 ? 57  ARG A HA   2  
ATOM 3011  H HB2  . ARG A 1 57  ? -13.396 11.469  3.166   1.00 0.00 ? 57  ARG A HB2  2  
ATOM 3012  H HB3  . ARG A 1 57  ? -14.071 10.601  4.530   1.00 0.00 ? 57  ARG A HB3  2  
ATOM 3013  H HG2  . ARG A 1 57  ? -11.878 12.325  5.413   1.00 0.00 ? 57  ARG A HG2  2  
ATOM 3014  H HG3  . ARG A 1 57  ? -13.058 13.258  4.514   1.00 0.00 ? 57  ARG A HG3  2  
ATOM 3015  H HD2  . ARG A 1 57  ? -14.539 11.494  6.230   1.00 0.00 ? 57  ARG A HD2  2  
ATOM 3016  H HD3  . ARG A 1 57  ? -13.266 12.196  7.208   1.00 0.00 ? 57  ARG A HD3  2  
ATOM 3017  H HE   . ARG A 1 57  ? -14.403 14.227  7.120   1.00 0.00 ? 57  ARG A HE   2  
ATOM 3018  H HH11 . ARG A 1 57  ? -15.352 12.298  4.334   1.00 0.00 ? 57  ARG A HH11 2  
ATOM 3019  H HH12 . ARG A 1 57  ? -16.517 13.450  3.773   1.00 0.00 ? 57  ARG A HH12 2  
ATOM 3020  H HH21 . ARG A 1 57  ? -15.940 15.747  6.380   1.00 0.00 ? 57  ARG A HH21 2  
ATOM 3021  H HH22 . ARG A 1 57  ? -16.854 15.425  4.944   1.00 0.00 ? 57  ARG A HH22 2  
ATOM 3022  N N    . LEU A 1 58  ? -12.986 8.055   4.713   1.00 0.00 ? 58  LEU A N    2  
ATOM 3023  C CA   . LEU A 1 58  ? -13.475 6.711   4.455   1.00 0.00 ? 58  LEU A CA   2  
ATOM 3024  C C    . LEU A 1 58  ? -14.481 6.322   5.540   1.00 0.00 ? 58  LEU A C    2  
ATOM 3025  O O    . LEU A 1 58  ? -14.639 7.035   6.530   1.00 0.00 ? 58  LEU A O    2  
ATOM 3026  C CB   . LEU A 1 58  ? -12.306 5.733   4.321   1.00 0.00 ? 58  LEU A CB   2  
ATOM 3027  C CG   . LEU A 1 58  ? -11.525 5.797   3.007   1.00 0.00 ? 58  LEU A CG   2  
ATOM 3028  C CD1  . LEU A 1 58  ? -10.295 6.697   3.143   1.00 0.00 ? 58  LEU A CD1  2  
ATOM 3029  C CD2  . LEU A 1 58  ? -11.157 4.394   2.519   1.00 0.00 ? 58  LEU A CD2  2  
ATOM 3030  H H    . LEU A 1 58  ? -13.085 8.367   5.658   1.00 0.00 ? 58  LEU A H    2  
ATOM 3031  H HA   . LEU A 1 58  ? -13.991 6.729   3.495   1.00 0.00 ? 58  LEU A HA   2  
ATOM 3032  H HB2  . LEU A 1 58  ? -11.612 5.912   5.142   1.00 0.00 ? 58  LEU A HB2  2  
ATOM 3033  H HB3  . LEU A 1 58  ? -12.690 4.720   4.444   1.00 0.00 ? 58  LEU A HB3  2  
ATOM 3034  H HG   . LEU A 1 58  ? -12.168 6.243   2.249   1.00 0.00 ? 58  LEU A HG   2  
ATOM 3035  H HD11 . LEU A 1 58  ? -10.452 7.405   3.957   1.00 0.00 ? 58  LEU A HD11 2  
ATOM 3036  H HD12 . LEU A 1 58  ? -9.419  6.085   3.357   1.00 0.00 ? 58  LEU A HD12 2  
ATOM 3037  H HD13 . LEU A 1 58  ? -10.139 7.242   2.212   1.00 0.00 ? 58  LEU A HD13 2  
ATOM 3038  H HD21 . LEU A 1 58  ? -10.509 3.913   3.252   1.00 0.00 ? 58  LEU A HD21 2  
ATOM 3039  H HD22 . LEU A 1 58  ? -12.065 3.803   2.393   1.00 0.00 ? 58  LEU A HD22 2  
ATOM 3040  H HD23 . LEU A 1 58  ? -10.635 4.466   1.565   1.00 0.00 ? 58  LEU A HD23 2  
ATOM 3041  N N    . GLU A 1 59  ? -15.135 5.192   5.317   1.00 0.00 ? 59  GLU A N    2  
ATOM 3042  C CA   . GLU A 1 59  ? -16.122 4.699   6.264   1.00 0.00 ? 59  GLU A CA   2  
ATOM 3043  C C    . GLU A 1 59  ? -15.782 3.270   6.690   1.00 0.00 ? 59  GLU A C    2  
ATOM 3044  O O    . GLU A 1 59  ? -15.551 2.405   5.846   1.00 0.00 ? 59  GLU A O    2  
ATOM 3045  C CB   . GLU A 1 59  ? -17.532 4.775   5.675   1.00 0.00 ? 59  GLU A CB   2  
ATOM 3046  C CG   . GLU A 1 59  ? -17.830 3.551   4.806   1.00 0.00 ? 59  GLU A CG   2  
ATOM 3047  C CD   . GLU A 1 59  ? -19.253 3.609   4.248   1.00 0.00 ? 59  GLU A CD   2  
ATOM 3048  O OE1  . GLU A 1 59  ? -20.167 3.893   5.052   1.00 0.00 ? 59  GLU A OE1  2  
ATOM 3049  O OE2  . GLU A 1 59  ? -19.395 3.368   3.029   1.00 0.00 ? 59  GLU A OE2  2  
ATOM 3050  H H    . GLU A 1 59  ? -15.001 4.617   4.510   1.00 0.00 ? 59  GLU A H    2  
ATOM 3051  H HA   . GLU A 1 59  ? -16.057 5.367   7.123   1.00 0.00 ? 59  GLU A HA   2  
ATOM 3052  H HB2  . GLU A 1 59  ? -18.263 4.841   6.480   1.00 0.00 ? 59  GLU A HB2  2  
ATOM 3053  H HB3  . GLU A 1 59  ? -17.633 5.682   5.078   1.00 0.00 ? 59  GLU A HB3  2  
ATOM 3054  H HG2  . GLU A 1 59  ? -17.115 3.501   3.985   1.00 0.00 ? 59  GLU A HG2  2  
ATOM 3055  H HG3  . GLU A 1 59  ? -17.703 2.643   5.396   1.00 0.00 ? 59  GLU A HG3  2  
ATOM 3056  N N    . SER A 1 60  ? -15.761 3.065   7.998   1.00 0.00 ? 60  SER A N    2  
ATOM 3057  C CA   . SER A 1 60  ? -15.453 1.755   8.546   1.00 0.00 ? 60  SER A CA   2  
ATOM 3058  C C    . SER A 1 60  ? -16.747 0.994   8.841   1.00 0.00 ? 60  SER A C    2  
ATOM 3059  O O    . SER A 1 60  ? -17.617 1.494   9.552   1.00 0.00 ? 60  SER A O    2  
ATOM 3060  C CB   . SER A 1 60  ? -14.607 1.874   9.815   1.00 0.00 ? 60  SER A CB   2  
ATOM 3061  O OG   . SER A 1 60  ? -14.971 0.904   10.793  1.00 0.00 ? 60  SER A OG   2  
ATOM 3062  H H    . SER A 1 60  ? -15.950 3.774   8.678   1.00 0.00 ? 60  SER A H    2  
ATOM 3063  H HA   . SER A 1 60  ? -14.878 1.247   7.773   1.00 0.00 ? 60  SER A HA   2  
ATOM 3064  H HB2  . SER A 1 60  ? -13.553 1.754   9.561   1.00 0.00 ? 60  SER A HB2  2  
ATOM 3065  H HB3  . SER A 1 60  ? -14.721 2.873   10.235  1.00 0.00 ? 60  SER A HB3  2  
ATOM 3066  H HG   . SER A 1 60  ? -14.979 -0.008  10.384  1.00 0.00 ? 60  SER A HG   2  
ATOM 3067  N N    . VAL A 1 61  ? -16.833 -0.203  8.280   1.00 0.00 ? 61  VAL A N    2  
ATOM 3068  C CA   . VAL A 1 61  ? -18.006 -1.039  8.474   1.00 0.00 ? 61  VAL A CA   2  
ATOM 3069  C C    . VAL A 1 61  ? -17.562 -2.463  8.814   1.00 0.00 ? 61  VAL A C    2  
ATOM 3070  O O    . VAL A 1 61  ? -16.563 -2.949  8.284   1.00 0.00 ? 61  VAL A O    2  
ATOM 3071  C CB   . VAL A 1 61  ? -18.905 -0.972  7.238   1.00 0.00 ? 61  VAL A CB   2  
ATOM 3072  C CG1  . VAL A 1 61  ? -19.687 -2.275  7.058   1.00 0.00 ? 61  VAL A CG1  2  
ATOM 3073  C CG2  . VAL A 1 61  ? -19.851 0.229   7.312   1.00 0.00 ? 61  VAL A CG2  2  
ATOM 3074  H H    . VAL A 1 61  ? -16.120 -0.603  7.703   1.00 0.00 ? 61  VAL A H    2  
ATOM 3075  H HA   . VAL A 1 61  ? -18.562 -0.633  9.319   1.00 0.00 ? 61  VAL A HA   2  
ATOM 3076  H HB   . VAL A 1 61  ? -18.266 -0.841  6.365   1.00 0.00 ? 61  VAL A HB   2  
ATOM 3077  H HG11 . VAL A 1 61  ? -20.345 -2.187  6.194   1.00 0.00 ? 61  VAL A HG11 2  
ATOM 3078  H HG12 . VAL A 1 61  ? -18.990 -3.098  6.901   1.00 0.00 ? 61  VAL A HG12 2  
ATOM 3079  H HG13 . VAL A 1 61  ? -20.282 -2.468  7.950   1.00 0.00 ? 61  VAL A HG13 2  
ATOM 3080  H HG21 . VAL A 1 61  ? -20.046 0.600   6.306   1.00 0.00 ? 61  VAL A HG21 2  
ATOM 3081  H HG22 . VAL A 1 61  ? -20.789 -0.076  7.775   1.00 0.00 ? 61  VAL A HG22 2  
ATOM 3082  H HG23 . VAL A 1 61  ? -19.391 1.017   7.908   1.00 0.00 ? 61  VAL A HG23 2  
ATOM 3083  N N    . THR A 1 62  ? -18.325 -3.092  9.695   1.00 0.00 ? 62  THR A N    2  
ATOM 3084  C CA   . THR A 1 62  ? -18.023 -4.450  10.112  1.00 0.00 ? 62  THR A CA   2  
ATOM 3085  C C    . THR A 1 62  ? -19.304 -5.180  10.523  1.00 0.00 ? 62  THR A C    2  
ATOM 3086  O O    . THR A 1 62  ? -20.245 -4.559  11.014  1.00 0.00 ? 62  THR A O    2  
ATOM 3087  C CB   . THR A 1 62  ? -16.979 -4.381  11.228  1.00 0.00 ? 62  THR A CB   2  
ATOM 3088  O OG1  . THR A 1 62  ? -16.381 -5.675  11.225  1.00 0.00 ? 62  THR A OG1  2  
ATOM 3089  C CG2  . THR A 1 62  ? -17.612 -4.267  12.616  1.00 0.00 ? 62  THR A CG2  2  
ATOM 3090  H H    . THR A 1 62  ? -19.135 -2.689  10.121  1.00 0.00 ? 62  THR A H    2  
ATOM 3091  H HA   . THR A 1 62  ? -17.609 -4.988  9.259   1.00 0.00 ? 62  THR A HA   2  
ATOM 3092  H HB   . THR A 1 62  ? -16.275 -3.568  11.053  1.00 0.00 ? 62  THR A HB   2  
ATOM 3093  H HG1  . THR A 1 62  ? -17.045 -6.360  11.524  1.00 0.00 ? 62  THR A HG1  2  
ATOM 3094  H HG21 . THR A 1 62  ? -17.002 -3.613  13.241  1.00 0.00 ? 62  THR A HG21 2  
ATOM 3095  H HG22 . THR A 1 62  ? -18.615 -3.850  12.525  1.00 0.00 ? 62  THR A HG22 2  
ATOM 3096  H HG23 . THR A 1 62  ? -17.669 -5.255  13.072  1.00 0.00 ? 62  THR A HG23 2  
ATOM 3097  N N    . THR A 1 63  ? -19.298 -6.487  10.306  1.00 0.00 ? 63  THR A N    2  
ATOM 3098  C CA   . THR A 1 63  ? -20.447 -7.307  10.648  1.00 0.00 ? 63  THR A CA   2  
ATOM 3099  C C    . THR A 1 63  ? -20.006 -8.737  10.966  1.00 0.00 ? 63  THR A C    2  
ATOM 3100  O O    . THR A 1 63  ? -19.872 -9.564  10.066  1.00 0.00 ? 63  THR A O    2  
ATOM 3101  C CB   . THR A 1 63  ? -21.448 -7.223  9.494   1.00 0.00 ? 63  THR A CB   2  
ATOM 3102  O OG1  . THR A 1 63  ? -20.633 -7.023  8.342   1.00 0.00 ? 63  THR A OG1  2  
ATOM 3103  C CG2  . THR A 1 63  ? -22.314 -5.963  9.561   1.00 0.00 ? 63  THR A CG2  2  
ATOM 3104  H H    . THR A 1 63  ? -18.528 -6.984  9.906   1.00 0.00 ? 63  THR A H    2  
ATOM 3105  H HA   . THR A 1 63  ? -20.901 -6.903  11.553  1.00 0.00 ? 63  THR A HA   2  
ATOM 3106  H HB   . THR A 1 63  ? -22.067 -8.119  9.449   1.00 0.00 ? 63  THR A HB   2  
ATOM 3107  H HG1  . THR A 1 63  ? -20.161 -6.143  8.405   1.00 0.00 ? 63  THR A HG1  2  
ATOM 3108  H HG21 . THR A 1 63  ? -22.425 -5.653  10.600  1.00 0.00 ? 63  THR A HG21 2  
ATOM 3109  H HG22 . THR A 1 63  ? -21.838 -5.164  8.992   1.00 0.00 ? 63  THR A HG22 2  
ATOM 3110  H HG23 . THR A 1 63  ? -23.297 -6.175  9.138   1.00 0.00 ? 63  THR A HG23 2  
ATOM 3111  N N    . ASP A 1 64  ? -19.793 -8.984  12.250  1.00 0.00 ? 64  ASP A N    2  
ATOM 3112  C CA   . ASP A 1 64  ? -19.370 -10.300 12.699  1.00 0.00 ? 64  ASP A CA   2  
ATOM 3113  C C    . ASP A 1 64  ? -20.556 -11.265 12.626  1.00 0.00 ? 64  ASP A C    2  
ATOM 3114  O O    . ASP A 1 64  ? -21.688 -10.885 12.919  1.00 0.00 ? 64  ASP A O    2  
ATOM 3115  C CB   . ASP A 1 64  ? -18.884 -10.258 14.149  1.00 0.00 ? 64  ASP A CB   2  
ATOM 3116  C CG   . ASP A 1 64  ? -17.894 -9.135  14.466  1.00 0.00 ? 64  ASP A CG   2  
ATOM 3117  O OD1  . ASP A 1 64  ? -17.160 -8.745  13.532  1.00 0.00 ? 64  ASP A OD1  2  
ATOM 3118  O OD2  . ASP A 1 64  ? -17.894 -8.692  15.635  1.00 0.00 ? 64  ASP A OD2  2  
ATOM 3119  H H    . ASP A 1 64  ? -19.905 -8.306  12.977  1.00 0.00 ? 64  ASP A H    2  
ATOM 3120  H HA   . ASP A 1 64  ? -18.560 -10.584 12.028  1.00 0.00 ? 64  ASP A HA   2  
ATOM 3121  H HB2  . ASP A 1 64  ? -19.749 -10.155 14.804  1.00 0.00 ? 64  ASP A HB2  2  
ATOM 3122  H HB3  . ASP A 1 64  ? -18.415 -11.213 14.387  1.00 0.00 ? 64  ASP A HB3  2  
ATOM 3123  N N    . GLY A 1 65  ? -20.255 -12.494 12.234  1.00 0.00 ? 65  GLY A N    2  
ATOM 3124  C CA   . GLY A 1 65  ? -21.281 -13.515 12.119  1.00 0.00 ? 65  GLY A CA   2  
ATOM 3125  C C    . GLY A 1 65  ? -21.944 -13.781 13.472  1.00 0.00 ? 65  GLY A C    2  
ATOM 3126  O O    . GLY A 1 65  ? -21.750 -13.024 14.422  1.00 0.00 ? 65  GLY A O    2  
ATOM 3127  H H    . GLY A 1 65  ? -19.331 -12.794 11.997  1.00 0.00 ? 65  GLY A H    2  
ATOM 3128  H HA2  . GLY A 1 65  ? -22.034 -13.200 11.396  1.00 0.00 ? 65  GLY A HA2  2  
ATOM 3129  H HA3  . GLY A 1 65  ? -20.841 -14.437 11.738  1.00 0.00 ? 65  GLY A HA3  2  
ATOM 3130  N N    . GLY A 1 66  ? -22.714 -14.859 13.516  1.00 0.00 ? 66  GLY A N    2  
ATOM 3131  C CA   . GLY A 1 66  ? -23.407 -15.234 14.737  1.00 0.00 ? 66  GLY A CA   2  
ATOM 3132  C C    . GLY A 1 66  ? -24.855 -14.739 14.720  1.00 0.00 ? 66  GLY A C    2  
ATOM 3133  O O    . GLY A 1 66  ? -25.786 -15.538 14.635  1.00 0.00 ? 66  GLY A O    2  
ATOM 3134  H H    . GLY A 1 66  ? -22.867 -15.469 12.739  1.00 0.00 ? 66  GLY A H    2  
ATOM 3135  H HA2  . GLY A 1 66  ? -23.390 -16.317 14.851  1.00 0.00 ? 66  GLY A HA2  2  
ATOM 3136  H HA3  . GLY A 1 66  ? -22.886 -14.815 15.598  1.00 0.00 ? 66  GLY A HA3  2  
ATOM 3137  N N    . ARG A 1 67  ? -24.999 -13.425 14.801  1.00 0.00 ? 67  ARG A N    2  
ATOM 3138  C CA   . ARG A 1 67  ? -26.317 -12.814 14.796  1.00 0.00 ? 67  ARG A CA   2  
ATOM 3139  C C    . ARG A 1 67  ? -26.322 -11.568 13.908  1.00 0.00 ? 67  ARG A C    2  
ATOM 3140  O O    . ARG A 1 67  ? -26.135 -10.454 14.395  1.00 0.00 ? 67  ARG A O    2  
ATOM 3141  C CB   . ARG A 1 67  ? -26.750 -12.425 16.211  1.00 0.00 ? 67  ARG A CB   2  
ATOM 3142  C CG   . ARG A 1 67  ? -28.167 -12.919 16.506  1.00 0.00 ? 67  ARG A CG   2  
ATOM 3143  C CD   . ARG A 1 67  ? -28.924 -11.920 17.385  1.00 0.00 ? 67  ARG A CD   2  
ATOM 3144  N NE   . ARG A 1 67  ? -28.950 -12.396 18.786  1.00 0.00 ? 67  ARG A NE   2  
ATOM 3145  C CZ   . ARG A 1 67  ? -29.718 -13.404 19.222  1.00 0.00 ? 67  ARG A CZ   2  
ATOM 3146  N NH1  . ARG A 1 67  ? -30.527 -14.048 18.370  1.00 0.00 ? 67  ARG A NH1  2  
ATOM 3147  N NH2  . ARG A 1 67  ? -29.676 -13.768 20.511  1.00 0.00 ? 67  ARG A NH2  2  
ATOM 3148  H H    . ARG A 1 67  ? -24.236 -12.782 14.870  1.00 0.00 ? 67  ARG A H    2  
ATOM 3149  H HA   . ARG A 1 67  ? -26.979 -13.583 14.397  1.00 0.00 ? 67  ARG A HA   2  
ATOM 3150  H HB2  . ARG A 1 67  ? -26.055 -12.848 16.937  1.00 0.00 ? 67  ARG A HB2  2  
ATOM 3151  H HB3  . ARG A 1 67  ? -26.707 -11.342 16.323  1.00 0.00 ? 67  ARG A HB3  2  
ATOM 3152  H HG2  . ARG A 1 67  ? -28.707 -13.068 15.571  1.00 0.00 ? 67  ARG A HG2  2  
ATOM 3153  H HG3  . ARG A 1 67  ? -28.123 -13.887 17.006  1.00 0.00 ? 67  ARG A HG3  2  
ATOM 3154  H HD2  . ARG A 1 67  ? -28.445 -10.942 17.333  1.00 0.00 ? 67  ARG A HD2  2  
ATOM 3155  H HD3  . ARG A 1 67  ? -29.942 -11.797 17.015  1.00 0.00 ? 67  ARG A HD3  2  
ATOM 3156  H HE   . ARG A 1 67  ? -28.358 -11.937 19.448  1.00 0.00 ? 67  ARG A HE   2  
ATOM 3157  H HH11 . ARG A 1 67  ? -30.558 -13.776 17.408  1.00 0.00 ? 67  ARG A HH11 2  
ATOM 3158  H HH12 . ARG A 1 67  ? -31.100 -14.800 18.696  1.00 0.00 ? 67  ARG A HH12 2  
ATOM 3159  H HH21 . ARG A 1 67  ? -29.072 -13.287 21.147  1.00 0.00 ? 67  ARG A HH21 2  
ATOM 3160  H HH22 . ARG A 1 67  ? -30.249 -14.520 20.837  1.00 0.00 ? 67  ARG A HH22 2  
ATOM 3161  N N    . SER A 1 68  ? -26.538 -11.799 12.621  1.00 0.00 ? 68  SER A N    2  
ATOM 3162  C CA   . SER A 1 68  ? -26.569 -10.709 11.661  1.00 0.00 ? 68  SER A CA   2  
ATOM 3163  C C    . SER A 1 68  ? -27.654 -9.701  12.048  1.00 0.00 ? 68  SER A C    2  
ATOM 3164  O O    . SER A 1 68  ? -28.747 -10.088 12.459  1.00 0.00 ? 68  SER A O    2  
ATOM 3165  C CB   . SER A 1 68  ? -26.811 -11.231 10.243  1.00 0.00 ? 68  SER A CB   2  
ATOM 3166  O OG   . SER A 1 68  ? -26.294 -10.346 9.253   1.00 0.00 ? 68  SER A OG   2  
ATOM 3167  H H    . SER A 1 68  ? -26.689 -12.708 12.234  1.00 0.00 ? 68  SER A H    2  
ATOM 3168  H HA   . SER A 1 68  ? -25.583 -10.248 11.714  1.00 0.00 ? 68  SER A HA   2  
ATOM 3169  H HB2  . SER A 1 68  ? -26.346 -12.210 10.133  1.00 0.00 ? 68  SER A HB2  2  
ATOM 3170  H HB3  . SER A 1 68  ? -27.881 -11.367 10.085  1.00 0.00 ? 68  SER A HB3  2  
ATOM 3171  H HG   . SER A 1 68  ? -25.329 -10.547 9.086   1.00 0.00 ? 68  SER A HG   2  
ATOM 3172  N N    . GLY A 1 69  ? -27.314 -8.429  11.903  1.00 0.00 ? 69  GLY A N    2  
ATOM 3173  C CA   . GLY A 1 69  ? -28.245 -7.363  12.232  1.00 0.00 ? 69  GLY A CA   2  
ATOM 3174  C C    . GLY A 1 69  ? -27.508 -6.143  12.786  1.00 0.00 ? 69  GLY A C    2  
ATOM 3175  O O    . GLY A 1 69  ? -26.479 -6.282  13.446  1.00 0.00 ? 69  GLY A O    2  
ATOM 3176  H H    . GLY A 1 69  ? -26.423 -8.123  11.568  1.00 0.00 ? 69  GLY A H    2  
ATOM 3177  H HA2  . GLY A 1 69  ? -28.808 -7.080  11.343  1.00 0.00 ? 69  GLY A HA2  2  
ATOM 3178  H HA3  . GLY A 1 69  ? -28.967 -7.721  12.966  1.00 0.00 ? 69  GLY A HA3  2  
ATOM 3179  N N    . PHE A 1 70  ? -28.063 -4.975  12.499  1.00 0.00 ? 70  PHE A N    2  
ATOM 3180  C CA   . PHE A 1 70  ? -27.471 -3.731  12.960  1.00 0.00 ? 70  PHE A CA   2  
ATOM 3181  C C    . PHE A 1 70  ? -25.976 -3.681  12.636  1.00 0.00 ? 70  PHE A C    2  
ATOM 3182  O O    . PHE A 1 70  ? -25.163 -4.268  13.348  1.00 0.00 ? 70  PHE A O    2  
ATOM 3183  C CB   . PHE A 1 70  ? -27.652 -3.685  14.479  1.00 0.00 ? 70  PHE A CB   2  
ATOM 3184  C CG   . PHE A 1 70  ? -28.927 -2.971  14.932  1.00 0.00 ? 70  PHE A CG   2  
ATOM 3185  C CD1  . PHE A 1 70  ? -29.110 -1.656  14.639  1.00 0.00 ? 70  PHE A CD1  2  
ATOM 3186  C CD2  . PHE A 1 70  ? -29.878 -3.652  15.627  1.00 0.00 ? 70  PHE A CD2  2  
ATOM 3187  C CE1  . PHE A 1 70  ? -30.294 -0.993  15.060  1.00 0.00 ? 70  PHE A CE1  2  
ATOM 3188  C CE2  . PHE A 1 70  ? -31.061 -2.989  16.047  1.00 0.00 ? 70  PHE A CE2  2  
ATOM 3189  C CZ   . PHE A 1 70  ? -31.244 -1.673  15.755  1.00 0.00 ? 70  PHE A CZ   2  
ATOM 3190  H H    . PHE A 1 70  ? -28.900 -4.871  11.961  1.00 0.00 ? 70  PHE A H    2  
ATOM 3191  H HA   . PHE A 1 70  ? -27.980 -2.918  12.442  1.00 0.00 ? 70  PHE A HA   2  
ATOM 3192  H HB2  . PHE A 1 70  ? -27.663 -4.705  14.864  1.00 0.00 ? 70  PHE A HB2  2  
ATOM 3193  H HB3  . PHE A 1 70  ? -26.791 -3.186  14.923  1.00 0.00 ? 70  PHE A HB3  2  
ATOM 3194  H HD1  . PHE A 1 70  ? -28.349 -1.110  14.082  1.00 0.00 ? 70  PHE A HD1  2  
ATOM 3195  H HD2  . PHE A 1 70  ? -29.731 -4.706  15.861  1.00 0.00 ? 70  PHE A HD2  2  
ATOM 3196  H HE1  . PHE A 1 70  ? -30.440 0.062   14.826  1.00 0.00 ? 70  PHE A HE1  2  
ATOM 3197  H HE2  . PHE A 1 70  ? -31.823 -3.535  16.604  1.00 0.00 ? 70  PHE A HE2  2  
ATOM 3198  H HZ   . PHE A 1 70  ? -32.152 -1.165  16.078  1.00 0.00 ? 70  PHE A HZ   2  
ATOM 3199  N N    . TYR A 1 71  ? -25.660 -2.975  11.560  1.00 0.00 ? 71  TYR A N    2  
ATOM 3200  C CA   . TYR A 1 71  ? -24.278 -2.842  11.132  1.00 0.00 ? 71  TYR A CA   2  
ATOM 3201  C C    . TYR A 1 71  ? -23.567 -1.735  11.914  1.00 0.00 ? 71  TYR A C    2  
ATOM 3202  O O    . TYR A 1 71  ? -24.146 -0.681  12.171  1.00 0.00 ? 71  TYR A O    2  
ATOM 3203  C CB   . TYR A 1 71  ? -24.330 -2.452  9.653   1.00 0.00 ? 71  TYR A CB   2  
ATOM 3204  C CG   . TYR A 1 71  ? -24.441 -3.643  8.700   1.00 0.00 ? 71  TYR A CG   2  
ATOM 3205  C CD1  . TYR A 1 71  ? -25.473 -4.549  8.845   1.00 0.00 ? 71  TYR A CD1  2  
ATOM 3206  C CD2  . TYR A 1 71  ? -23.511 -3.812  7.694   1.00 0.00 ? 71  TYR A CD2  2  
ATOM 3207  C CE1  . TYR A 1 71  ? -25.578 -5.670  7.947   1.00 0.00 ? 71  TYR A CE1  2  
ATOM 3208  C CE2  . TYR A 1 71  ? -23.616 -4.933  6.797   1.00 0.00 ? 71  TYR A CE2  2  
ATOM 3209  C CZ   . TYR A 1 71  ? -24.644 -5.807  6.967   1.00 0.00 ? 71  TYR A CZ   2  
ATOM 3210  O OH   . TYR A 1 71  ? -24.744 -6.866  6.120   1.00 0.00 ? 71  TYR A OH   2  
ATOM 3211  H H    . TYR A 1 71  ? -26.328 -2.501  10.986  1.00 0.00 ? 71  TYR A H    2  
ATOM 3212  H HA   . TYR A 1 71  ? -23.774 -3.790  11.319  1.00 0.00 ? 71  TYR A HA   2  
ATOM 3213  H HB2  . TYR A 1 71  ? -25.180 -1.790  9.492   1.00 0.00 ? 71  TYR A HB2  2  
ATOM 3214  H HB3  . TYR A 1 71  ? -23.433 -1.885  9.406   1.00 0.00 ? 71  TYR A HB3  2  
ATOM 3215  H HD1  . TYR A 1 71  ? -26.207 -4.416  9.639   1.00 0.00 ? 71  TYR A HD1  2  
ATOM 3216  H HD2  . TYR A 1 71  ? -22.697 -3.097  7.580   1.00 0.00 ? 71  TYR A HD2  2  
ATOM 3217  H HE1  . TYR A 1 71  ? -26.387 -6.393  8.050   1.00 0.00 ? 71  TYR A HE1  2  
ATOM 3218  H HE2  . TYR A 1 71  ? -22.888 -5.078  5.999   1.00 0.00 ? 71  TYR A HE2  2  
ATOM 3219  H HH   . TYR A 1 71  ? -24.054 -6.793  5.399   1.00 0.00 ? 71  TYR A HH   2  
ATOM 3220  N N    . ASN A 1 72  ? -22.321 -2.013  12.270  1.00 0.00 ? 72  ASN A N    2  
ATOM 3221  C CA   . ASN A 1 72  ? -21.525 -1.055  13.018  1.00 0.00 ? 72  ASN A CA   2  
ATOM 3222  C C    . ASN A 1 72  ? -20.703 -0.211  12.042  1.00 0.00 ? 72  ASN A C    2  
ATOM 3223  O O    . ASN A 1 72  ? -19.671 -0.660  11.545  1.00 0.00 ? 72  ASN A O    2  
ATOM 3224  C CB   . ASN A 1 72  ? -20.554 -1.764  13.964  1.00 0.00 ? 72  ASN A CB   2  
ATOM 3225  C CG   . ASN A 1 72  ? -20.796 -1.342  15.415  1.00 0.00 ? 72  ASN A CG   2  
ATOM 3226  O OD1  . ASN A 1 72  ? -21.627 -0.500  15.713  1.00 0.00 ? 72  ASN A OD1  2  
ATOM 3227  N ND2  . ASN A 1 72  ? -20.025 -1.972  16.297  1.00 0.00 ? 72  ASN A ND2  2  
ATOM 3228  H H    . ASN A 1 72  ? -21.858 -2.874  12.058  1.00 0.00 ? 72  ASN A H    2  
ATOM 3229  H HA   . ASN A 1 72  ? -22.245 -0.460  13.579  1.00 0.00 ? 72  ASN A HA   2  
ATOM 3230  H HB2  . ASN A 1 72  ? -20.673 -2.844  13.871  1.00 0.00 ? 72  ASN A HB2  2  
ATOM 3231  H HB3  . ASN A 1 72  ? -19.528 -1.531  13.680  1.00 0.00 ? 72  ASN A HB3  2  
ATOM 3232  H HD21 . ASN A 1 72  ? -19.362 -2.653  15.985  1.00 0.00 ? 72  ASN A HD21 2  
ATOM 3233  H HD22 . ASN A 1 72  ? -20.108 -1.765  17.271  1.00 0.00 ? 72  ASN A HD22 2  
ATOM 3234  N N    . ARG A 1 73  ? -21.190 0.996   11.797  1.00 0.00 ? 73  ARG A N    2  
ATOM 3235  C CA   . ARG A 1 73  ? -20.513 1.907   10.890  1.00 0.00 ? 73  ARG A CA   2  
ATOM 3236  C C    . ARG A 1 73  ? -19.616 2.867   11.674  1.00 0.00 ? 73  ARG A C    2  
ATOM 3237  O O    . ARG A 1 73  ? -19.882 3.161   12.838  1.00 0.00 ? 73  ARG A O    2  
ATOM 3238  C CB   . ARG A 1 73  ? -21.519 2.716   10.069  1.00 0.00 ? 73  ARG A CB   2  
ATOM 3239  C CG   . ARG A 1 73  ? -22.101 1.875   8.931   1.00 0.00 ? 73  ARG A CG   2  
ATOM 3240  C CD   . ARG A 1 73  ? -23.566 2.235   8.676   1.00 0.00 ? 73  ARG A CD   2  
ATOM 3241  N NE   . ARG A 1 73  ? -23.654 3.305   7.657   1.00 0.00 ? 73  ARG A NE   2  
ATOM 3242  C CZ   . ARG A 1 73  ? -24.798 3.890   7.278   1.00 0.00 ? 73  ARG A CZ   2  
ATOM 3243  N NH1  . ARG A 1 73  ? -25.959 3.512   7.832   1.00 0.00 ? 73  ARG A NH1  2  
ATOM 3244  N NH2  . ARG A 1 73  ? -24.782 4.852   6.346   1.00 0.00 ? 73  ARG A NH2  2  
ATOM 3245  H H    . ARG A 1 73  ? -22.030 1.354   12.206  1.00 0.00 ? 73  ARG A H    2  
ATOM 3246  H HA   . ARG A 1 73  ? -19.923 1.263   10.238  1.00 0.00 ? 73  ARG A HA   2  
ATOM 3247  H HB2  . ARG A 1 73  ? -22.324 3.066   10.716  1.00 0.00 ? 73  ARG A HB2  2  
ATOM 3248  H HB3  . ARG A 1 73  ? -21.032 3.601   9.659   1.00 0.00 ? 73  ARG A HB3  2  
ATOM 3249  H HG2  . ARG A 1 73  ? -21.520 2.034   8.023   1.00 0.00 ? 73  ARG A HG2  2  
ATOM 3250  H HG3  . ARG A 1 73  ? -22.021 0.816   9.179   1.00 0.00 ? 73  ARG A HG3  2  
ATOM 3251  H HD2  . ARG A 1 73  ? -24.112 1.355   8.339   1.00 0.00 ? 73  ARG A HD2  2  
ATOM 3252  H HD3  . ARG A 1 73  ? -24.034 2.565   9.603   1.00 0.00 ? 73  ARG A HD3  2  
ATOM 3253  H HE   . ARG A 1 73  ? -22.806 3.610   7.224   1.00 0.00 ? 73  ARG A HE   2  
ATOM 3254  H HH11 . ARG A 1 73  ? -25.970 2.794   8.528   1.00 0.00 ? 73  ARG A HH11 2  
ATOM 3255  H HH12 . ARG A 1 73  ? -26.813 3.949   7.549   1.00 0.00 ? 73  ARG A HH12 2  
ATOM 3256  H HH21 . ARG A 1 73  ? -23.917 5.134   5.933   1.00 0.00 ? 73  ARG A HH21 2  
ATOM 3257  H HH22 . ARG A 1 73  ? -25.637 5.289   6.064   1.00 0.00 ? 73  ARG A HH22 2  
ATOM 3258  N N    . SER A 1 74  ? -18.570 3.330   11.003  1.00 0.00 ? 74  SER A N    2  
ATOM 3259  C CA   . SER A 1 74  ? -17.632 4.250   11.622  1.00 0.00 ? 74  SER A CA   2  
ATOM 3260  C C    . SER A 1 74  ? -16.899 5.052   10.545  1.00 0.00 ? 74  SER A C    2  
ATOM 3261  O O    . SER A 1 74  ? -17.045 4.779   9.355   1.00 0.00 ? 74  SER A O    2  
ATOM 3262  C CB   . SER A 1 74  ? -16.629 3.504   12.504  1.00 0.00 ? 74  SER A CB   2  
ATOM 3263  O OG   . SER A 1 74  ? -17.175 3.184   13.781  1.00 0.00 ? 74  SER A OG   2  
ATOM 3264  H H    . SER A 1 74  ? -18.361 3.085   10.056  1.00 0.00 ? 74  SER A H    2  
ATOM 3265  H HA   . SER A 1 74  ? -18.240 4.909   12.242  1.00 0.00 ? 74  SER A HA   2  
ATOM 3266  H HB2  . SER A 1 74  ? -16.317 2.588   12.003  1.00 0.00 ? 74  SER A HB2  2  
ATOM 3267  H HB3  . SER A 1 74  ? -15.736 4.116   12.635  1.00 0.00 ? 74  SER A HB3  2  
ATOM 3268  H HG   . SER A 1 74  ? -17.624 3.987   14.172  1.00 0.00 ? 74  SER A HG   2  
ATOM 3269  N N    . LEU A 1 75  ? -16.126 6.027   11.002  1.00 0.00 ? 75  LEU A N    2  
ATOM 3270  C CA   . LEU A 1 75  ? -15.369 6.871   10.093  1.00 0.00 ? 75  LEU A CA   2  
ATOM 3271  C C    . LEU A 1 75  ? -13.909 6.921   10.546  1.00 0.00 ? 75  LEU A C    2  
ATOM 3272  O O    . LEU A 1 75  ? -13.609 6.671   11.713  1.00 0.00 ? 75  LEU A O    2  
ATOM 3273  C CB   . LEU A 1 75  ? -16.023 8.248   9.971   1.00 0.00 ? 75  LEU A CB   2  
ATOM 3274  C CG   . LEU A 1 75  ? -15.759 9.003   8.667   1.00 0.00 ? 75  LEU A CG   2  
ATOM 3275  C CD1  . LEU A 1 75  ? -16.718 8.548   7.565   1.00 0.00 ? 75  LEU A CD1  2  
ATOM 3276  C CD2  . LEU A 1 75  ? -15.817 10.516  8.887   1.00 0.00 ? 75  LEU A CD2  2  
ATOM 3277  H H    . LEU A 1 75  ? -16.013 6.243   11.972  1.00 0.00 ? 75  LEU A H    2  
ATOM 3278  H HA   . LEU A 1 75  ? -15.409 6.407   9.107   1.00 0.00 ? 75  LEU A HA   2  
ATOM 3279  H HB2  . LEU A 1 75  ? -17.101 8.129   10.086  1.00 0.00 ? 75  LEU A HB2  2  
ATOM 3280  H HB3  . LEU A 1 75  ? -15.681 8.866   10.801  1.00 0.00 ? 75  LEU A HB3  2  
ATOM 3281  H HG   . LEU A 1 75  ? -14.749 8.766   8.333   1.00 0.00 ? 75  LEU A HG   2  
ATOM 3282  H HD11 . LEU A 1 75  ? -16.483 9.073   6.639   1.00 0.00 ? 75  LEU A HD11 2  
ATOM 3283  H HD12 . LEU A 1 75  ? -16.610 7.474   7.411   1.00 0.00 ? 75  LEU A HD12 2  
ATOM 3284  H HD13 . LEU A 1 75  ? -17.743 8.771   7.860   1.00 0.00 ? 75  LEU A HD13 2  
ATOM 3285  H HD21 . LEU A 1 75  ? -16.792 10.787  9.294   1.00 0.00 ? 75  LEU A HD21 2  
ATOM 3286  H HD22 . LEU A 1 75  ? -15.037 10.812  9.589   1.00 0.00 ? 75  LEU A HD22 2  
ATOM 3287  H HD23 . LEU A 1 75  ? -15.665 11.028  7.937   1.00 0.00 ? 75  LEU A HD23 2  
ATOM 3288  N N    . LEU A 1 76  ? -13.040 7.246   9.601   1.00 0.00 ? 76  LEU A N    2  
ATOM 3289  C CA   . LEU A 1 76  ? -11.618 7.333   9.889   1.00 0.00 ? 76  LEU A CA   2  
ATOM 3290  C C    . LEU A 1 76  ? -11.110 8.726   9.514   1.00 0.00 ? 76  LEU A C    2  
ATOM 3291  O O    . LEU A 1 76  ? -11.792 9.471   8.811   1.00 0.00 ? 76  LEU A O    2  
ATOM 3292  C CB   . LEU A 1 76  ? -10.862 6.196   9.199   1.00 0.00 ? 76  LEU A CB   2  
ATOM 3293  C CG   . LEU A 1 76  ? -11.536 4.823   9.234   1.00 0.00 ? 76  LEU A CG   2  
ATOM 3294  C CD1  . LEU A 1 76  ? -10.988 3.915   8.132   1.00 0.00 ? 76  LEU A CD1  2  
ATOM 3295  C CD2  . LEU A 1 76  ? -11.409 4.185   10.619  1.00 0.00 ? 76  LEU A CD2  2  
ATOM 3296  H H    . LEU A 1 76  ? -13.292 7.449   8.655   1.00 0.00 ? 76  LEU A H    2  
ATOM 3297  H HA   . LEU A 1 76  ? -11.494 7.197   10.963  1.00 0.00 ? 76  LEU A HA   2  
ATOM 3298  H HB2  . LEU A 1 76  ? -10.701 6.473   8.157   1.00 0.00 ? 76  LEU A HB2  2  
ATOM 3299  H HB3  . LEU A 1 76  ? -9.878  6.108   9.660   1.00 0.00 ? 76  LEU A HB3  2  
ATOM 3300  H HG   . LEU A 1 76  ? -12.600 4.960   9.039   1.00 0.00 ? 76  LEU A HG   2  
ATOM 3301  H HD11 . LEU A 1 76  ? -11.448 2.930   8.210   1.00 0.00 ? 76  LEU A HD11 2  
ATOM 3302  H HD12 . LEU A 1 76  ? -11.217 4.346   7.157   1.00 0.00 ? 76  LEU A HD12 2  
ATOM 3303  H HD13 . LEU A 1 76  ? -9.908  3.821   8.242   1.00 0.00 ? 76  LEU A HD13 2  
ATOM 3304  H HD21 . LEU A 1 76  ? -12.131 4.641   11.296  1.00 0.00 ? 76  LEU A HD21 2  
ATOM 3305  H HD22 . LEU A 1 76  ? -11.605 3.115   10.545  1.00 0.00 ? 76  LEU A HD22 2  
ATOM 3306  H HD23 . LEU A 1 76  ? -10.401 4.344   11.001  1.00 0.00 ? 76  LEU A HD23 2  
ATOM 3307  N N    . LYS A 1 77  ? -9.917  9.037   9.999   1.00 0.00 ? 77  LYS A N    2  
ATOM 3308  C CA   . LYS A 1 77  ? -9.310  10.328  9.723   1.00 0.00 ? 77  LYS A CA   2  
ATOM 3309  C C    . LYS A 1 77  ? -7.935  10.114  9.086   1.00 0.00 ? 77  LYS A C    2  
ATOM 3310  O O    . LYS A 1 77  ? -7.567  8.987   8.760   1.00 0.00 ? 77  LYS A O    2  
ATOM 3311  C CB   . LYS A 1 77  ? -9.274  11.185  10.991  1.00 0.00 ? 77  LYS A CB   2  
ATOM 3312  C CG   . LYS A 1 77  ? -8.043  10.857  11.839  1.00 0.00 ? 77  LYS A CG   2  
ATOM 3313  C CD   . LYS A 1 77  ? -7.744  11.984  12.829  1.00 0.00 ? 77  LYS A CD   2  
ATOM 3314  C CE   . LYS A 1 77  ? -7.688  13.338  12.119  1.00 0.00 ? 77  LYS A CE   2  
ATOM 3315  N NZ   . LYS A 1 77  ? -8.976  14.053  12.261  1.00 0.00 ? 77  LYS A NZ   2  
ATOM 3316  H H    . LYS A 1 77  ? -9.369  8.426   10.570  1.00 0.00 ? 77  LYS A H    2  
ATOM 3317  H HA   . LYS A 1 77  ? -9.948  10.842  9.005   1.00 0.00 ? 77  LYS A HA   2  
ATOM 3318  H HB2  . LYS A 1 77  ? -9.263  12.240  10.721  1.00 0.00 ? 77  LYS A HB2  2  
ATOM 3319  H HB3  . LYS A 1 77  ? -10.178 11.015  11.575  1.00 0.00 ? 77  LYS A HB3  2  
ATOM 3320  H HG2  . LYS A 1 77  ? -8.208  9.926   12.381  1.00 0.00 ? 77  LYS A HG2  2  
ATOM 3321  H HG3  . LYS A 1 77  ? -7.181  10.700  11.190  1.00 0.00 ? 77  LYS A HG3  2  
ATOM 3322  H HD2  . LYS A 1 77  ? -8.513  12.007  13.602  1.00 0.00 ? 77  LYS A HD2  2  
ATOM 3323  H HD3  . LYS A 1 77  ? -6.795  11.792  13.329  1.00 0.00 ? 77  LYS A HD3  2  
ATOM 3324  H HE2  . LYS A 1 77  ? -6.882  13.942  12.537  1.00 0.00 ? 77  LYS A HE2  2  
ATOM 3325  H HE3  . LYS A 1 77  ? -7.461  13.192  11.063  1.00 0.00 ? 77  LYS A HE3  2  
ATOM 3326  H HZ1  . LYS A 1 77  ? -8.828  14.913  12.750  1.00 0.00 ? 77  LYS A HZ1  2  
ATOM 3327  H HZ2  . LYS A 1 77  ? -9.353  14.245  11.355  1.00 0.00 ? 77  LYS A HZ2  2  
ATOM 3328  H HZ3  . LYS A 1 77  ? -9.618  13.484  12.776  1.00 0.00 ? 77  LYS A HZ3  2  
ATOM 3329  N N    . GLU A 1 78  ? -7.215  11.215  8.928   1.00 0.00 ? 78  GLU A N    2  
ATOM 3330  C CA   . GLU A 1 78  ? -5.889  11.162  8.335   1.00 0.00 ? 78  GLU A CA   2  
ATOM 3331  C C    . GLU A 1 78  ? -4.882  10.595  9.338   1.00 0.00 ? 78  GLU A C    2  
ATOM 3332  O O    . GLU A 1 78  ? -4.658  11.180  10.396  1.00 0.00 ? 78  GLU A O    2  
ATOM 3333  C CB   . GLU A 1 78  ? -5.454  12.544  7.842   1.00 0.00 ? 78  GLU A CB   2  
ATOM 3334  C CG   . GLU A 1 78  ? -4.882  13.380  8.989   1.00 0.00 ? 78  GLU A CG   2  
ATOM 3335  C CD   . GLU A 1 78  ? -4.688  14.836  8.562   1.00 0.00 ? 78  GLU A CD   2  
ATOM 3336  O OE1  . GLU A 1 78  ? -5.662  15.605  8.706   1.00 0.00 ? 78  GLU A OE1  2  
ATOM 3337  O OE2  . GLU A 1 78  ? -3.568  15.148  8.100   1.00 0.00 ? 78  GLU A OE2  2  
ATOM 3338  H H    . GLU A 1 78  ? -7.522  12.128  9.196   1.00 0.00 ? 78  GLU A H    2  
ATOM 3339  H HA   . GLU A 1 78  ? -5.980  10.491  7.481   1.00 0.00 ? 78  GLU A HA   2  
ATOM 3340  H HB2  . GLU A 1 78  ? -4.704  12.435  7.059   1.00 0.00 ? 78  GLU A HB2  2  
ATOM 3341  H HB3  . GLU A 1 78  ? -6.305  13.061  7.399   1.00 0.00 ? 78  GLU A HB3  2  
ATOM 3342  H HG2  . GLU A 1 78  ? -5.554  13.336  9.846   1.00 0.00 ? 78  GLU A HG2  2  
ATOM 3343  H HG3  . GLU A 1 78  ? -3.929  12.961  9.310   1.00 0.00 ? 78  GLU A HG3  2  
ATOM 3344  N N    . GLY A 1 79  ? -4.301  9.463   8.968   1.00 0.00 ? 79  GLY A N    2  
ATOM 3345  C CA   . GLY A 1 79  ? -3.323  8.811   9.822   1.00 0.00 ? 79  GLY A CA   2  
ATOM 3346  C C    . GLY A 1 79  ? -3.697  7.347   10.065  1.00 0.00 ? 79  GLY A C    2  
ATOM 3347  O O    . GLY A 1 79  ? -2.851  6.542   10.450  1.00 0.00 ? 79  GLY A O    2  
ATOM 3348  H H    . GLY A 1 79  ? -4.489  8.994   8.105   1.00 0.00 ? 79  GLY A H    2  
ATOM 3349  H HA2  . GLY A 1 79  ? -2.337  8.865   9.359   1.00 0.00 ? 79  GLY A HA2  2  
ATOM 3350  H HA3  . GLY A 1 79  ? -3.258  9.336   10.774  1.00 0.00 ? 79  GLY A HA3  2  
ATOM 3351  N N    . ASP A 1 80  ? -4.966  7.047   9.831   1.00 0.00 ? 80  ASP A N    2  
ATOM 3352  C CA   . ASP A 1 80  ? -5.463  5.695   10.020  1.00 0.00 ? 80  ASP A CA   2  
ATOM 3353  C C    . ASP A 1 80  ? -5.193  4.876   8.757   1.00 0.00 ? 80  ASP A C    2  
ATOM 3354  O O    . ASP A 1 80  ? -5.430  5.346   7.645   1.00 0.00 ? 80  ASP A O    2  
ATOM 3355  C CB   . ASP A 1 80  ? -6.972  5.693   10.272  1.00 0.00 ? 80  ASP A CB   2  
ATOM 3356  C CG   . ASP A 1 80  ? -7.398  5.178   11.648  1.00 0.00 ? 80  ASP A CG   2  
ATOM 3357  O OD1  . ASP A 1 80  ? -6.800  5.650   12.640  1.00 0.00 ? 80  ASP A OD1  2  
ATOM 3358  O OD2  . ASP A 1 80  ? -8.311  4.325   11.678  1.00 0.00 ? 80  ASP A OD2  2  
ATOM 3359  H H    . ASP A 1 80  ? -5.648  7.708   9.518   1.00 0.00 ? 80  ASP A H    2  
ATOM 3360  H HA   . ASP A 1 80  ? -4.927  5.312   10.888  1.00 0.00 ? 80  ASP A HA   2  
ATOM 3361  H HB2  . ASP A 1 80  ? -7.348  6.709   10.148  1.00 0.00 ? 80  ASP A HB2  2  
ATOM 3362  H HB3  . ASP A 1 80  ? -7.452  5.081   9.507   1.00 0.00 ? 80  ASP A HB3  2  
ATOM 3363  N N    . PHE A 1 81  ? -4.701  3.664   8.969   1.00 0.00 ? 81  PHE A N    2  
ATOM 3364  C CA   . PHE A 1 81  ? -4.396  2.775   7.861   1.00 0.00 ? 81  PHE A CA   2  
ATOM 3365  C C    . PHE A 1 81  ? -5.320  1.555   7.867   1.00 0.00 ? 81  PHE A C    2  
ATOM 3366  O O    . PHE A 1 81  ? -6.053  1.332   8.829   1.00 0.00 ? 81  PHE A O    2  
ATOM 3367  C CB   . PHE A 1 81  ? -2.952  2.307   8.047   1.00 0.00 ? 81  PHE A CB   2  
ATOM 3368  C CG   . PHE A 1 81  ? -2.546  2.108   9.509   1.00 0.00 ? 81  PHE A CG   2  
ATOM 3369  C CD1  . PHE A 1 81  ? -2.933  0.987   10.176  1.00 0.00 ? 81  PHE A CD1  2  
ATOM 3370  C CD2  . PHE A 1 81  ? -1.798  3.051   10.142  1.00 0.00 ? 81  PHE A CD2  2  
ATOM 3371  C CE1  . PHE A 1 81  ? -2.556  0.802   11.532  1.00 0.00 ? 81  PHE A CE1  2  
ATOM 3372  C CE2  . PHE A 1 81  ? -1.421  2.866   11.498  1.00 0.00 ? 81  PHE A CE2  2  
ATOM 3373  C CZ   . PHE A 1 81  ? -1.808  1.746   12.165  1.00 0.00 ? 81  PHE A CZ   2  
ATOM 3374  H H    . PHE A 1 81  ? -4.511  3.289   9.877   1.00 0.00 ? 81  PHE A H    2  
ATOM 3375  H HA   . PHE A 1 81  ? -4.550  3.340   6.942   1.00 0.00 ? 81  PHE A HA   2  
ATOM 3376  H HB2  . PHE A 1 81  ? -2.813  1.368   7.511   1.00 0.00 ? 81  PHE A HB2  2  
ATOM 3377  H HB3  . PHE A 1 81  ? -2.283  3.037   7.592   1.00 0.00 ? 81  PHE A HB3  2  
ATOM 3378  H HD1  . PHE A 1 81  ? -3.532  0.231   9.669   1.00 0.00 ? 81  PHE A HD1  2  
ATOM 3379  H HD2  . PHE A 1 81  ? -1.488  3.949   9.608   1.00 0.00 ? 81  PHE A HD2  2  
ATOM 3380  H HE1  . PHE A 1 81  ? -2.866  -0.096  12.066  1.00 0.00 ? 81  PHE A HE1  2  
ATOM 3381  H HE2  . PHE A 1 81  ? -0.822  3.622   12.006  1.00 0.00 ? 81  PHE A HE2  2  
ATOM 3382  H HZ   . PHE A 1 81  ? -1.519  1.604   13.206  1.00 0.00 ? 81  PHE A HZ   2  
ATOM 3383  N N    . CYS A 1 82  ? -5.254  0.798   6.782   1.00 0.00 ? 82  CYS A N    2  
ATOM 3384  C CA   . CYS A 1 82  ? -6.075  -0.393  6.650   1.00 0.00 ? 82  CYS A CA   2  
ATOM 3385  C C    . CYS A 1 82  ? -5.164  -1.568  6.289   1.00 0.00 ? 82  CYS A C    2  
ATOM 3386  O O    . CYS A 1 82  ? -4.018  -1.368  5.888   1.00 0.00 ? 82  CYS A O    2  
ATOM 3387  C CB   . CYS A 1 82  ? -7.191  -0.200  5.621   1.00 0.00 ? 82  CYS A CB   2  
ATOM 3388  S SG   . CYS A 1 82  ? -8.255  1.207   6.108   1.00 0.00 ? 82  CYS A SG   2  
ATOM 3389  H H    . CYS A 1 82  ? -4.655  0.987   6.004   1.00 0.00 ? 82  CYS A H    2  
ATOM 3390  H HA   . CYS A 1 82  ? -6.550  -0.555  7.617   1.00 0.00 ? 82  CYS A HA   2  
ATOM 3391  H HB2  . CYS A 1 82  ? -6.762  -0.018  4.636   1.00 0.00 ? 82  CYS A HB2  2  
ATOM 3392  H HB3  . CYS A 1 82  ? -7.789  -1.109  5.545   1.00 0.00 ? 82  CYS A HB3  2  
ATOM 3393  H HG   . CYS A 1 82  ? -9.168  0.478   6.743   1.00 0.00 ? 82  CYS A HG   2  
ATOM 3394  N N    . GLY A 1 83  ? -5.706  -2.766  6.444   1.00 0.00 ? 83  GLY A N    2  
ATOM 3395  C CA   . GLY A 1 83  ? -4.956  -3.973  6.140   1.00 0.00 ? 83  GLY A CA   2  
ATOM 3396  C C    . GLY A 1 83  ? -3.515  -3.864  6.644   1.00 0.00 ? 83  GLY A C    2  
ATOM 3397  O O    . GLY A 1 83  ? -2.571  -4.110  5.894   1.00 0.00 ? 83  GLY A O    2  
ATOM 3398  H H    . GLY A 1 83  ? -6.639  -2.920  6.771   1.00 0.00 ? 83  GLY A H    2  
ATOM 3399  H HA2  . GLY A 1 83  ? -5.442  -4.833  6.599   1.00 0.00 ? 83  GLY A HA2  2  
ATOM 3400  H HA3  . GLY A 1 83  ? -4.956  -4.144  5.063   1.00 0.00 ? 83  GLY A HA3  2  
ATOM 3401  N N    . ASP A 1 84  ? -3.392  -3.497  7.911   1.00 0.00 ? 84  ASP A N    2  
ATOM 3402  C CA   . ASP A 1 84  ? -2.082  -3.353  8.524   1.00 0.00 ? 84  ASP A CA   2  
ATOM 3403  C C    . ASP A 1 84  ? -1.476  -4.739  8.752   1.00 0.00 ? 84  ASP A C    2  
ATOM 3404  O O    . ASP A 1 84  ? -0.270  -4.926  8.596   1.00 0.00 ? 84  ASP A O    2  
ATOM 3405  C CB   . ASP A 1 84  ? -2.183  -2.652  9.880   1.00 0.00 ? 84  ASP A CB   2  
ATOM 3406  C CG   . ASP A 1 84  ? -2.547  -3.564  11.054  1.00 0.00 ? 84  ASP A CG   2  
ATOM 3407  O OD1  . ASP A 1 84  ? -3.764  -3.734  11.285  1.00 0.00 ? 84  ASP A OD1  2  
ATOM 3408  O OD2  . ASP A 1 84  ? -1.600  -4.071  11.694  1.00 0.00 ? 84  ASP A OD2  2  
ATOM 3409  H H    . ASP A 1 84  ? -4.165  -3.299  8.514   1.00 0.00 ? 84  ASP A H    2  
ATOM 3410  H HA   . ASP A 1 84  ? -1.502  -2.754  7.823   1.00 0.00 ? 84  ASP A HA   2  
ATOM 3411  H HB2  . ASP A 1 84  ? -1.229  -2.171  10.096  1.00 0.00 ? 84  ASP A HB2  2  
ATOM 3412  H HB3  . ASP A 1 84  ? -2.930  -1.861  9.809   1.00 0.00 ? 84  ASP A HB3  2  
ATOM 3413  N N    . GLU A 1 85  ? -2.339  -5.675  9.118   1.00 0.00 ? 85  GLU A N    2  
ATOM 3414  C CA   . GLU A 1 85  ? -1.903  -7.038  9.369   1.00 0.00 ? 85  GLU A CA   2  
ATOM 3415  C C    . GLU A 1 85  ? -0.880  -7.470  8.317   1.00 0.00 ? 85  GLU A C    2  
ATOM 3416  O O    . GLU A 1 85  ? 0.051   -8.215  8.621   1.00 0.00 ? 85  GLU A O    2  
ATOM 3417  C CB   . GLU A 1 85  ? -3.095  -7.998  9.401   1.00 0.00 ? 85  GLU A CB   2  
ATOM 3418  C CG   . GLU A 1 85  ? -3.623  -8.169  10.827  1.00 0.00 ? 85  GLU A CG   2  
ATOM 3419  C CD   . GLU A 1 85  ? -2.758  -9.153  11.617  1.00 0.00 ? 85  GLU A CD   2  
ATOM 3420  O OE1  . GLU A 1 85  ? -2.588  -10.287 11.118  1.00 0.00 ? 85  GLU A OE1  2  
ATOM 3421  O OE2  . GLU A 1 85  ? -2.287  -8.750  12.702  1.00 0.00 ? 85  GLU A OE2  2  
ATOM 3422  H H    . GLU A 1 85  ? -3.318  -5.514  9.243   1.00 0.00 ? 85  GLU A H    2  
ATOM 3423  H HA   . GLU A 1 85  ? -1.436  -7.016  10.353  1.00 0.00 ? 85  GLU A HA   2  
ATOM 3424  H HB2  . GLU A 1 85  ? -3.889  -7.618  8.758   1.00 0.00 ? 85  GLU A HB2  2  
ATOM 3425  H HB3  . GLU A 1 85  ? -2.797  -8.967  9.001   1.00 0.00 ? 85  GLU A HB3  2  
ATOM 3426  H HG2  . GLU A 1 85  ? -3.635  -7.203  11.332  1.00 0.00 ? 85  GLU A HG2  2  
ATOM 3427  H HG3  . GLU A 1 85  ? -4.652  -8.526  10.797  1.00 0.00 ? 85  GLU A HG3  2  
ATOM 3428  N N    . LEU A 1 86  ? -1.086  -6.984  7.102   1.00 0.00 ? 86  LEU A N    2  
ATOM 3429  C CA   . LEU A 1 86  ? -0.192  -7.311  6.004   1.00 0.00 ? 86  LEU A CA   2  
ATOM 3430  C C    . LEU A 1 86  ? 1.246   -6.977  6.405   1.00 0.00 ? 86  LEU A C    2  
ATOM 3431  O O    . LEU A 1 86  ? 2.150   -7.791  6.223   1.00 0.00 ? 86  LEU A O    2  
ATOM 3432  C CB   . LEU A 1 86  ? -0.648  -6.618  4.718   1.00 0.00 ? 86  LEU A CB   2  
ATOM 3433  C CG   . LEU A 1 86  ? 0.137   -6.968  3.453   1.00 0.00 ? 86  LEU A CG   2  
ATOM 3434  C CD1  . LEU A 1 86  ? -0.014  -8.451  3.106   1.00 0.00 ? 86  LEU A CD1  2  
ATOM 3435  C CD2  . LEU A 1 86  ? -0.268  -6.063  2.288   1.00 0.00 ? 86  LEU A CD2  2  
ATOM 3436  H H    . LEU A 1 86  ? -1.845  -6.379  6.863   1.00 0.00 ? 86  LEU A H    2  
ATOM 3437  H HA   . LEU A 1 86  ? -0.263  -8.385  5.833   1.00 0.00 ? 86  LEU A HA   2  
ATOM 3438  H HB2  . LEU A 1 86  ? -1.697  -6.861  4.550   1.00 0.00 ? 86  LEU A HB2  2  
ATOM 3439  H HB3  . LEU A 1 86  ? -0.591  -5.540  4.870   1.00 0.00 ? 86  LEU A HB3  2  
ATOM 3440  H HG   . LEU A 1 86  ? 1.195   -6.789  3.646   1.00 0.00 ? 86  LEU A HG   2  
ATOM 3441  H HD11 . LEU A 1 86  ? -0.038  -8.570  2.023   1.00 0.00 ? 86  LEU A HD11 2  
ATOM 3442  H HD12 . LEU A 1 86  ? 0.830   -9.007  3.514   1.00 0.00 ? 86  LEU A HD12 2  
ATOM 3443  H HD13 . LEU A 1 86  ? -0.941  -8.831  3.534   1.00 0.00 ? 86  LEU A HD13 2  
ATOM 3444  H HD21 . LEU A 1 86  ? 0.459   -5.258  2.183   1.00 0.00 ? 86  LEU A HD21 2  
ATOM 3445  H HD22 . LEU A 1 86  ? -0.298  -6.646  1.367   1.00 0.00 ? 86  LEU A HD22 2  
ATOM 3446  H HD23 . LEU A 1 86  ? -1.253  -5.640  2.482   1.00 0.00 ? 86  LEU A HD23 2  
ATOM 3447  N N    . LEU A 1 87  ? 1.413   -5.779  6.946   1.00 0.00 ? 87  LEU A N    2  
ATOM 3448  C CA   . LEU A 1 87  ? 2.726   -5.328  7.375   1.00 0.00 ? 87  LEU A CA   2  
ATOM 3449  C C    . LEU A 1 87  ? 3.373   -6.409  8.242   1.00 0.00 ? 87  LEU A C    2  
ATOM 3450  O O    . LEU A 1 87  ? 4.485   -6.854  7.959   1.00 0.00 ? 87  LEU A O    2  
ATOM 3451  C CB   . LEU A 1 87  ? 2.626   -3.966  8.063   1.00 0.00 ? 87  LEU A CB   2  
ATOM 3452  C CG   . LEU A 1 87  ? 3.567   -2.879  7.540   1.00 0.00 ? 87  LEU A CG   2  
ATOM 3453  C CD1  . LEU A 1 87  ? 3.204   -2.482  6.107   1.00 0.00 ? 87  LEU A CD1  2  
ATOM 3454  C CD2  . LEU A 1 87  ? 3.588   -1.672  8.481   1.00 0.00 ? 87  LEU A CD2  2  
ATOM 3455  H H    . LEU A 1 87  ? 0.672   -5.123  7.091   1.00 0.00 ? 87  LEU A H    2  
ATOM 3456  H HA   . LEU A 1 87  ? 3.333   -5.193  6.480   1.00 0.00 ? 87  LEU A HA   2  
ATOM 3457  H HB2  . LEU A 1 87  ? 1.600   -3.607  7.969   1.00 0.00 ? 87  LEU A HB2  2  
ATOM 3458  H HB3  . LEU A 1 87  ? 2.818   -4.103  9.127   1.00 0.00 ? 87  LEU A HB3  2  
ATOM 3459  H HG   . LEU A 1 87  ? 4.578   -3.285  7.515   1.00 0.00 ? 87  LEU A HG   2  
ATOM 3460  H HD11 . LEU A 1 87  ? 2.509   -3.213  5.693   1.00 0.00 ? 87  LEU A HD11 2  
ATOM 3461  H HD12 . LEU A 1 87  ? 2.737   -1.497  6.110   1.00 0.00 ? 87  LEU A HD12 2  
ATOM 3462  H HD13 . LEU A 1 87  ? 4.107   -2.454  5.498   1.00 0.00 ? 87  LEU A HD13 2  
ATOM 3463  H HD21 . LEU A 1 87  ? 2.894   -1.841  9.304   1.00 0.00 ? 87  LEU A HD21 2  
ATOM 3464  H HD22 . LEU A 1 87  ? 4.595   -1.538  8.876   1.00 0.00 ? 87  LEU A HD22 2  
ATOM 3465  H HD23 . LEU A 1 87  ? 3.291   -0.779  7.932   1.00 0.00 ? 87  LEU A HD23 2  
ATOM 3466  N N    . THR A 1 88  ? 2.650   -6.802  9.281   1.00 0.00 ? 88  THR A N    2  
ATOM 3467  C CA   . THR A 1 88  ? 3.140   -7.822  10.191  1.00 0.00 ? 88  THR A CA   2  
ATOM 3468  C C    . THR A 1 88  ? 3.296   -9.158  9.461   1.00 0.00 ? 88  THR A C    2  
ATOM 3469  O O    . THR A 1 88  ? 4.276   -9.872  9.668   1.00 0.00 ? 88  THR A O    2  
ATOM 3470  C CB   . THR A 1 88  ? 2.185   -7.890  11.384  1.00 0.00 ? 88  THR A CB   2  
ATOM 3471  O OG1  . THR A 1 88  ? 2.885   -7.218  12.428  1.00 0.00 ? 88  THR A OG1  2  
ATOM 3472  C CG2  . THR A 1 88  ? 2.008   -9.315  11.913  1.00 0.00 ? 88  THR A CG2  2  
ATOM 3473  H H    . THR A 1 88  ? 1.747   -6.435  9.503   1.00 0.00 ? 88  THR A H    2  
ATOM 3474  H HA   . THR A 1 88  ? 4.132   -7.529  10.535  1.00 0.00 ? 88  THR A HA   2  
ATOM 3475  H HB   . THR A 1 88  ? 1.222   -7.443  11.138  1.00 0.00 ? 88  THR A HB   2  
ATOM 3476  H HG1  . THR A 1 88  ? 3.753   -7.679  12.610  1.00 0.00 ? 88  THR A HG1  2  
ATOM 3477  H HG21 . THR A 1 88  ? 1.521   -9.926  11.153  1.00 0.00 ? 88  THR A HG21 2  
ATOM 3478  H HG22 . THR A 1 88  ? 2.984   -9.738  12.150  1.00 0.00 ? 88  THR A HG22 2  
ATOM 3479  H HG23 . THR A 1 88  ? 1.392   -9.295  12.812  1.00 0.00 ? 88  THR A HG23 2  
ATOM 3480  N N    . TRP A 1 89  ? 2.314   -9.455  8.622   1.00 0.00 ? 89  TRP A N    2  
ATOM 3481  C CA   . TRP A 1 89  ? 2.329   -10.692 7.860   1.00 0.00 ? 89  TRP A CA   2  
ATOM 3482  C C    . TRP A 1 89  ? 3.711   -10.835 7.219   1.00 0.00 ? 89  TRP A C    2  
ATOM 3483  O O    . TRP A 1 89  ? 4.383   -11.849 7.404   1.00 0.00 ? 89  TRP A O    2  
ATOM 3484  C CB   . TRP A 1 89  ? 1.190   -10.722 6.840   1.00 0.00 ? 89  TRP A CB   2  
ATOM 3485  C CG   . TRP A 1 89  ? 1.355   -11.787 5.753   1.00 0.00 ? 89  TRP A CG   2  
ATOM 3486  C CD1  . TRP A 1 89  ? 0.893   -13.045 5.754   1.00 0.00 ? 89  TRP A CD1  2  
ATOM 3487  C CD2  . TRP A 1 89  ? 2.053   -11.635 4.499   1.00 0.00 ? 89  TRP A CD2  2  
ATOM 3488  N NE1  . TRP A 1 89  ? 1.240   -13.712 4.597   1.00 0.00 ? 89  TRP A NE1  2  
ATOM 3489  C CE2  . TRP A 1 89  ? 1.968   -12.827 3.810   1.00 0.00 ? 89  TRP A CE2  2  
ATOM 3490  C CE3  . TRP A 1 89  ? 2.733   -10.526 3.965   1.00 0.00 ? 89  TRP A CE3  2  
ATOM 3491  C CZ2  . TRP A 1 89  ? 2.541   -13.025 2.548   1.00 0.00 ? 89  TRP A CZ2  2  
ATOM 3492  C CZ3  . TRP A 1 89  ? 3.301   -10.740 2.703   1.00 0.00 ? 89  TRP A CZ3  2  
ATOM 3493  C CH2  . TRP A 1 89  ? 3.224   -11.935 1.996   1.00 0.00 ? 89  TRP A CH2  2  
ATOM 3494  H H    . TRP A 1 89  ? 1.521   -8.869  8.460   1.00 0.00 ? 89  TRP A H    2  
ATOM 3495  H HA   . TRP A 1 89  ? 2.154   -11.514 8.555   1.00 0.00 ? 89  TRP A HA   2  
ATOM 3496  H HB2  . TRP A 1 89  ? 0.251   -10.895 7.364   1.00 0.00 ? 89  TRP A HB2  2  
ATOM 3497  H HB3  . TRP A 1 89  ? 1.115   -9.743  6.366   1.00 0.00 ? 89  TRP A HB3  2  
ATOM 3498  H HD1  . TRP A 1 89  ? 0.315   -13.485 6.567   1.00 0.00 ? 89  TRP A HD1  2  
ATOM 3499  H HE1  . TRP A 1 89  ? 0.990   -14.742 4.347   1.00 0.00 ? 89  TRP A HE1  2  
ATOM 3500  H HE3  . TRP A 1 89  ? 2.814   -9.574  4.490   1.00 0.00 ? 89  TRP A HE3  2  
ATOM 3501  H HZ2  . TRP A 1 89  ? 2.460   -13.977 2.023   1.00 0.00 ? 89  TRP A HZ2  2  
ATOM 3502  H HZ3  . TRP A 1 89  ? 3.840   -9.913  2.243   1.00 0.00 ? 89  TRP A HZ3  2  
ATOM 3503  H HH2  . TRP A 1 89  ? 3.694   -12.022 1.016   1.00 0.00 ? 89  TRP A HH2  2  
ATOM 3504  N N    . ALA A 1 90  ? 4.094   -9.806  6.478   1.00 0.00 ? 90  ALA A N    2  
ATOM 3505  C CA   . ALA A 1 90  ? 5.383   -9.804  5.808   1.00 0.00 ? 90  ALA A CA   2  
ATOM 3506  C C    . ALA A 1 90  ? 6.497   -9.888  6.854   1.00 0.00 ? 90  ALA A C    2  
ATOM 3507  O O    . ALA A 1 90  ? 7.503   -10.562 6.641   1.00 0.00 ? 90  ALA A O    2  
ATOM 3508  C CB   . ALA A 1 90  ? 5.501   -8.556  4.930   1.00 0.00 ? 90  ALA A CB   2  
ATOM 3509  H H    . ALA A 1 90  ? 3.541   -8.985  6.333   1.00 0.00 ? 90  ALA A H    2  
ATOM 3510  H HA   . ALA A 1 90  ? 5.427   -10.687 5.170   1.00 0.00 ? 90  ALA A HA   2  
ATOM 3511  H HB1  . ALA A 1 90  ? 4.527   -8.073  4.853   1.00 0.00 ? 90  ALA A HB1  2  
ATOM 3512  H HB2  . ALA A 1 90  ? 6.215   -7.865  5.376   1.00 0.00 ? 90  ALA A HB2  2  
ATOM 3513  H HB3  . ALA A 1 90  ? 5.844   -8.843  3.936   1.00 0.00 ? 90  ALA A HB3  2  
ATOM 3514  N N    . LEU A 1 91  ? 6.278   -9.195  7.961   1.00 0.00 ? 91  LEU A N    2  
ATOM 3515  C CA   . LEU A 1 91  ? 7.251   -9.183  9.041   1.00 0.00 ? 91  LEU A CA   2  
ATOM 3516  C C    . LEU A 1 91  ? 7.204   -10.523 9.778   1.00 0.00 ? 91  LEU A C    2  
ATOM 3517  O O    . LEU A 1 91  ? 8.006   -10.768 10.678  1.00 0.00 ? 91  LEU A O    2  
ATOM 3518  C CB   . LEU A 1 91  ? 7.027   -7.972  9.950   1.00 0.00 ? 91  LEU A CB   2  
ATOM 3519  C CG   . LEU A 1 91  ? 7.943   -6.772  9.705   1.00 0.00 ? 91  LEU A CG   2  
ATOM 3520  C CD1  . LEU A 1 91  ? 8.230   -6.596  8.212   1.00 0.00 ? 91  LEU A CD1  2  
ATOM 3521  C CD2  . LEU A 1 91  ? 7.362   -5.502  10.330  1.00 0.00 ? 91  LEU A CD2  2  
ATOM 3522  H H    . LEU A 1 91  ? 5.456   -8.649  8.127   1.00 0.00 ? 91  LEU A H    2  
ATOM 3523  H HA   . LEU A 1 91  ? 8.237   -9.070  8.591   1.00 0.00 ? 91  LEU A HA   2  
ATOM 3524  H HB2  . LEU A 1 91  ? 5.994   -7.645  9.838   1.00 0.00 ? 91  LEU A HB2  2  
ATOM 3525  H HB3  . LEU A 1 91  ? 7.150   -8.293  10.984  1.00 0.00 ? 91  LEU A HB3  2  
ATOM 3526  H HG   . LEU A 1 91  ? 8.898   -6.964  10.195  1.00 0.00 ? 91  LEU A HG   2  
ATOM 3527  H HD11 . LEU A 1 91  ? 8.066   -5.556  7.931   1.00 0.00 ? 91  LEU A HD11 2  
ATOM 3528  H HD12 . LEU A 1 91  ? 9.265   -6.869  8.006   1.00 0.00 ? 91  LEU A HD12 2  
ATOM 3529  H HD13 . LEU A 1 91  ? 7.563   -7.238  7.636   1.00 0.00 ? 91  LEU A HD13 2  
ATOM 3530  H HD21 . LEU A 1 91  ? 6.299   -5.437  10.099  1.00 0.00 ? 91  LEU A HD21 2  
ATOM 3531  H HD22 . LEU A 1 91  ? 7.498   -5.534  11.411  1.00 0.00 ? 91  LEU A HD22 2  
ATOM 3532  H HD23 . LEU A 1 91  ? 7.875   -4.630  9.925   1.00 0.00 ? 91  LEU A HD23 2  
ATOM 3533  N N    . ASP A 1 92  ? 6.257   -11.354 9.369   1.00 0.00 ? 92  ASP A N    2  
ATOM 3534  C CA   . ASP A 1 92  ? 6.096   -12.663 9.980   1.00 0.00 ? 92  ASP A CA   2  
ATOM 3535  C C    . ASP A 1 92  ? 6.061   -13.731 8.885   1.00 0.00 ? 92  ASP A C    2  
ATOM 3536  O O    . ASP A 1 92  ? 4.992   -14.082 8.389   1.00 0.00 ? 92  ASP A O    2  
ATOM 3537  C CB   . ASP A 1 92  ? 4.785   -12.747 10.764  1.00 0.00 ? 92  ASP A CB   2  
ATOM 3538  C CG   . ASP A 1 92  ? 4.939   -12.724 12.286  1.00 0.00 ? 92  ASP A CG   2  
ATOM 3539  O OD1  . ASP A 1 92  ? 5.588   -11.775 12.777  1.00 0.00 ? 92  ASP A OD1  2  
ATOM 3540  O OD2  . ASP A 1 92  ? 4.404   -13.656 12.925  1.00 0.00 ? 92  ASP A OD2  2  
ATOM 3541  H H    . ASP A 1 92  ? 5.609   -11.147 8.637   1.00 0.00 ? 92  ASP A H    2  
ATOM 3542  H HA   . ASP A 1 92  ? 6.951   -12.776 10.646  1.00 0.00 ? 92  ASP A HA   2  
ATOM 3543  H HB2  . ASP A 1 92  ? 4.147   -11.914 10.466  1.00 0.00 ? 92  ASP A HB2  2  
ATOM 3544  H HB3  . ASP A 1 92  ? 4.267   -13.663 10.480  1.00 0.00 ? 92  ASP A HB3  2  
ATOM 3545  N N    . PRO A 1 93  ? 7.275   -14.231 8.532   1.00 0.00 ? 93  PRO A N    2  
ATOM 3546  C CA   . PRO A 1 93  ? 7.394   -15.253 7.505   1.00 0.00 ? 93  PRO A CA   2  
ATOM 3547  C C    . PRO A 1 93  ? 6.947   -16.617 8.034   1.00 0.00 ? 93  PRO A C    2  
ATOM 3548  O O    . PRO A 1 93  ? 6.479   -17.460 7.270   1.00 0.00 ? 93  PRO A O    2  
ATOM 3549  C CB   . PRO A 1 93  ? 8.856   -15.226 7.091   1.00 0.00 ? 93  PRO A CB   2  
ATOM 3550  C CG   . PRO A 1 93  ? 9.596   -14.523 8.217   1.00 0.00 ? 93  PRO A CG   2  
ATOM 3551  C CD   . PRO A 1 93  ? 8.563   -13.840 9.098   1.00 0.00 ? 93  PRO A CD   2  
ATOM 3552  H HA   . PRO A 1 93  ? 6.787   -15.045 6.738   1.00 0.00 ? 93  PRO A HA   2  
ATOM 3553  H HB2  . PRO A 1 93  ? 9.238   -16.236 6.943   1.00 0.00 ? 93  PRO A HB2  2  
ATOM 3554  H HB3  . PRO A 1 93  ? 8.985   -14.695 6.148   1.00 0.00 ? 93  PRO A HB3  2  
ATOM 3555  H HG2  . PRO A 1 93  ? 10.178  -15.240 8.797   1.00 0.00 ? 93  PRO A HG2  2  
ATOM 3556  H HG3  . PRO A 1 93  ? 10.298  -13.793 7.816   1.00 0.00 ? 93  PRO A HG3  2  
ATOM 3557  H HD2  . PRO A 1 93  ? 8.653   -14.161 10.136  1.00 0.00 ? 93  PRO A HD2  2  
ATOM 3558  H HD3  . PRO A 1 93  ? 8.687   -12.757 9.088   1.00 0.00 ? 93  PRO A HD3  2  
ATOM 3559  N N    . LYS A 1 94  ? 7.106   -16.791 9.338   1.00 0.00 ? 94  LYS A N    2  
ATOM 3560  C CA   . LYS A 1 94  ? 6.725   -18.038 9.978   1.00 0.00 ? 94  LYS A CA   2  
ATOM 3561  C C    . LYS A 1 94  ? 5.252   -18.329 9.683   1.00 0.00 ? 94  LYS A C    2  
ATOM 3562  O O    . LYS A 1 94  ? 4.860   -19.487 9.544   1.00 0.00 ? 94  LYS A O    2  
ATOM 3563  C CB   . LYS A 1 94  ? 7.056   -17.997 11.471  1.00 0.00 ? 94  LYS A CB   2  
ATOM 3564  C CG   . LYS A 1 94  ? 8.539   -17.694 11.696  1.00 0.00 ? 94  LYS A CG   2  
ATOM 3565  C CD   . LYS A 1 94  ? 9.422   -18.667 10.913  1.00 0.00 ? 94  LYS A CD   2  
ATOM 3566  C CE   . LYS A 1 94  ? 10.651  -19.071 11.729  1.00 0.00 ? 94  LYS A CE   2  
ATOM 3567  N NZ   . LYS A 1 94  ? 11.893  -18.666 11.032  1.00 0.00 ? 94  LYS A NZ   2  
ATOM 3568  H H    . LYS A 1 94  ? 7.487   -16.100 9.952   1.00 0.00 ? 94  LYS A H    2  
ATOM 3569  H HA   . LYS A 1 94  ? 7.329   -18.831 9.536   1.00 0.00 ? 94  LYS A HA   2  
ATOM 3570  H HB2  . LYS A 1 94  ? 6.448   -17.238 11.962  1.00 0.00 ? 94  LYS A HB2  2  
ATOM 3571  H HB3  . LYS A 1 94  ? 6.803   -18.953 11.930  1.00 0.00 ? 94  LYS A HB3  2  
ATOM 3572  H HG2  . LYS A 1 94  ? 8.755   -16.672 11.388  1.00 0.00 ? 94  LYS A HG2  2  
ATOM 3573  H HG3  . LYS A 1 94  ? 8.770   -17.762 12.759  1.00 0.00 ? 94  LYS A HG3  2  
ATOM 3574  H HD2  . LYS A 1 94  ? 8.847   -19.555 10.651  1.00 0.00 ? 94  LYS A HD2  2  
ATOM 3575  H HD3  . LYS A 1 94  ? 9.738   -18.205 9.977   1.00 0.00 ? 94  LYS A HD3  2  
ATOM 3576  H HE2  . LYS A 1 94  ? 10.611  -18.603 12.713  1.00 0.00 ? 94  LYS A HE2  2  
ATOM 3577  H HE3  . LYS A 1 94  ? 10.652  -20.149 11.888  1.00 0.00 ? 94  LYS A HE3  2  
ATOM 3578  H HZ1  . LYS A 1 94  ? 12.485  -18.170 11.666  1.00 0.00 ? 94  LYS A HZ1  2  
ATOM 3579  H HZ2  . LYS A 1 94  ? 12.369  -19.481 10.699  1.00 0.00 ? 94  LYS A HZ2  2  
ATOM 3580  H HZ3  . LYS A 1 94  ? 11.663  -18.076 10.258  1.00 0.00 ? 94  LYS A HZ3  2  
ATOM 3581  N N    . SER A 1 95  ? 4.477   -17.258 9.595   1.00 0.00 ? 95  SER A N    2  
ATOM 3582  C CA   . SER A 1 95  ? 3.056   -17.384 9.319   1.00 0.00 ? 95  SER A CA   2  
ATOM 3583  C C    . SER A 1 95  ? 2.820   -18.486 8.284   1.00 0.00 ? 95  SER A C    2  
ATOM 3584  O O    . SER A 1 95  ? 2.282   -19.543 8.609   1.00 0.00 ? 95  SER A O    2  
ATOM 3585  C CB   . SER A 1 95  ? 2.471   -16.059 8.826   1.00 0.00 ? 95  SER A CB   2  
ATOM 3586  O OG   . SER A 1 95  ? 1.914   -15.293 9.890   1.00 0.00 ? 95  SER A OG   2  
ATOM 3587  H H    . SER A 1 95  ? 4.804   -16.320 9.709   1.00 0.00 ? 95  SER A H    2  
ATOM 3588  H HA   . SER A 1 95  ? 2.599   -17.650 10.272  1.00 0.00 ? 95  SER A HA   2  
ATOM 3589  H HB2  . SER A 1 95  ? 3.252   -15.480 8.332   1.00 0.00 ? 95  SER A HB2  2  
ATOM 3590  H HB3  . SER A 1 95  ? 1.702   -16.257 8.080   1.00 0.00 ? 95  SER A HB3  2  
ATOM 3591  H HG   . SER A 1 95  ? 1.832   -15.857 10.711  1.00 0.00 ? 95  SER A HG   2  
ATOM 3592  N N    . GLY A 1 96  ? 3.233   -18.201 7.058   1.00 0.00 ? 96  GLY A N    2  
ATOM 3593  C CA   . GLY A 1 96  ? 3.073   -19.154 5.973   1.00 0.00 ? 96  GLY A CA   2  
ATOM 3594  C C    . GLY A 1 96  ? 1.661   -19.087 5.388   1.00 0.00 ? 96  GLY A C    2  
ATOM 3595  O O    . GLY A 1 96  ? 1.493   -18.983 4.174   1.00 0.00 ? 96  GLY A O    2  
ATOM 3596  H H    . GLY A 1 96  ? 3.669   -17.338 6.801   1.00 0.00 ? 96  GLY A H    2  
ATOM 3597  H HA2  . GLY A 1 96  ? 3.805   -18.948 5.192   1.00 0.00 ? 96  GLY A HA2  2  
ATOM 3598  H HA3  . GLY A 1 96  ? 3.272   -20.162 6.338   1.00 0.00 ? 96  GLY A HA3  2  
ATOM 3599  N N    . SER A 1 97  ? 0.682   -19.149 6.278   1.00 0.00 ? 97  SER A N    2  
ATOM 3600  C CA   . SER A 1 97  ? -0.710  -19.096 5.865   1.00 0.00 ? 97  SER A CA   2  
ATOM 3601  C C    . SER A 1 97  ? -0.881  -18.082 4.732   1.00 0.00 ? 97  SER A C    2  
ATOM 3602  O O    . SER A 1 97  ? -0.062  -17.178 4.574   1.00 0.00 ? 97  SER A O    2  
ATOM 3603  C CB   . SER A 1 97  ? -1.620  -18.737 7.041   1.00 0.00 ? 97  SER A CB   2  
ATOM 3604  O OG   . SER A 1 97  ? -2.420  -19.842 7.454   1.00 0.00 ? 97  SER A OG   2  
ATOM 3605  H H    . SER A 1 97  ? 0.827   -19.233 7.264   1.00 0.00 ? 97  SER A H    2  
ATOM 3606  H HA   . SER A 1 97  ? -0.946  -20.102 5.517   1.00 0.00 ? 97  SER A HA   2  
ATOM 3607  H HB2  . SER A 1 97  ? -1.013  -18.396 7.879   1.00 0.00 ? 97  SER A HB2  2  
ATOM 3608  H HB3  . SER A 1 97  ? -2.268  -17.907 6.758   1.00 0.00 ? 97  SER A HB3  2  
ATOM 3609  H HG   . SER A 1 97  ? -3.335  -19.528 7.704   1.00 0.00 ? 97  SER A HG   2  
ATOM 3610  N N    . ASN A 1 98  ? -1.951  -18.266 3.973   1.00 0.00 ? 98  ASN A N    2  
ATOM 3611  C CA   . ASN A 1 98  ? -2.241  -17.378 2.859   1.00 0.00 ? 98  ASN A CA   2  
ATOM 3612  C C    . ASN A 1 98  ? -2.241  -15.931 3.354   1.00 0.00 ? 98  ASN A C    2  
ATOM 3613  O O    . ASN A 1 98  ? -2.103  -15.679 4.550   1.00 0.00 ? 98  ASN A O    2  
ATOM 3614  C CB   . ASN A 1 98  ? -3.618  -17.675 2.262   1.00 0.00 ? 98  ASN A CB   2  
ATOM 3615  C CG   . ASN A 1 98  ? -3.496  -18.160 0.817   1.00 0.00 ? 98  ASN A CG   2  
ATOM 3616  O OD1  . ASN A 1 98  ? -3.275  -19.328 0.543   1.00 0.00 ? 98  ASN A OD1  2  
ATOM 3617  N ND2  . ASN A 1 98  ? -3.652  -17.201 -0.091  1.00 0.00 ? 98  ASN A ND2  2  
ATOM 3618  H H    . ASN A 1 98  ? -2.613  -19.004 4.108   1.00 0.00 ? 98  ASN A H    2  
ATOM 3619  H HA   . ASN A 1 98  ? -1.455  -17.569 2.129   1.00 0.00 ? 98  ASN A HA   2  
ATOM 3620  H HB2  . ASN A 1 98  ? -4.123  -18.431 2.862   1.00 0.00 ? 98  ASN A HB2  2  
ATOM 3621  H HB3  . ASN A 1 98  ? -4.234  -16.776 2.297   1.00 0.00 ? 98  ASN A HB3  2  
ATOM 3622  H HD21 . ASN A 1 98  ? -3.831  -16.261 0.200   1.00 0.00 ? 98  ASN A HD21 2  
ATOM 3623  H HD22 . ASN A 1 98  ? -3.590  -17.419 -1.065  1.00 0.00 ? 98  ASN A HD22 2  
ATOM 3624  N N    . LEU A 1 99  ? -2.399  -15.016 2.408   1.00 0.00 ? 99  LEU A N    2  
ATOM 3625  C CA   . LEU A 1 99  ? -2.420  -13.600 2.733   1.00 0.00 ? 99  LEU A CA   2  
ATOM 3626  C C    . LEU A 1 99  ? -3.316  -13.373 3.952   1.00 0.00 ? 99  LEU A C    2  
ATOM 3627  O O    . LEU A 1 99  ? -4.193  -14.185 4.241   1.00 0.00 ? 99  LEU A O    2  
ATOM 3628  C CB   . LEU A 1 99  ? -2.825  -12.776 1.509   1.00 0.00 ? 99  LEU A CB   2  
ATOM 3629  C CG   . LEU A 1 99  ? -1.972  -12.973 0.255   1.00 0.00 ? 99  LEU A CG   2  
ATOM 3630  C CD1  . LEU A 1 99  ? -2.813  -12.802 -1.012  1.00 0.00 ? 99  LEU A CD1  2  
ATOM 3631  C CD2  . LEU A 1 99  ? -0.757  -12.043 0.266   1.00 0.00 ? 99  LEU A CD2  2  
ATOM 3632  H H    . LEU A 1 99  ? -2.511  -15.229 1.438   1.00 0.00 ? 99  LEU A H    2  
ATOM 3633  H HA   . LEU A 1 99  ? -1.402  -13.310 2.994   1.00 0.00 ? 99  LEU A HA   2  
ATOM 3634  H HB2  . LEU A 1 99  ? -3.860  -13.014 1.262   1.00 0.00 ? 99  LEU A HB2  2  
ATOM 3635  H HB3  . LEU A 1 99  ? -2.798  -11.721 1.781   1.00 0.00 ? 99  LEU A HB3  2  
ATOM 3636  H HG   . LEU A 1 99  ? -1.595  -13.995 0.255   1.00 0.00 ? 99  LEU A HG   2  
ATOM 3637  H HD11 . LEU A 1 99  ? -3.646  -13.504 -0.993  1.00 0.00 ? 99  LEU A HD11 2  
ATOM 3638  H HD12 . LEU A 1 99  ? -3.197  -11.783 -1.058  1.00 0.00 ? 99  LEU A HD12 2  
ATOM 3639  H HD13 . LEU A 1 99  ? -2.193  -12.996 -1.888  1.00 0.00 ? 99  LEU A HD13 2  
ATOM 3640  H HD21 . LEU A 1 99  ? -0.287  -12.047 -0.717  1.00 0.00 ? 99  LEU A HD21 2  
ATOM 3641  H HD22 . LEU A 1 99  ? -1.076  -11.031 0.513   1.00 0.00 ? 99  LEU A HD22 2  
ATOM 3642  H HD23 . LEU A 1 99  ? -0.042  -12.390 1.012   1.00 0.00 ? 99  LEU A HD23 2  
ATOM 3643  N N    . PRO A 1 100 ? -3.057  -12.236 4.652   1.00 0.00 ? 100 PRO A N    2  
ATOM 3644  C CA   . PRO A 1 100 ? -3.831  -11.893 5.833   1.00 0.00 ? 100 PRO A CA   2  
ATOM 3645  C C    . PRO A 1 100 ? -5.221  -11.381 5.449   1.00 0.00 ? 100 PRO A C    2  
ATOM 3646  O O    . PRO A 1 100 ? -5.499  -11.153 4.273   1.00 0.00 ? 100 PRO A O    2  
ATOM 3647  C CB   . PRO A 1 100 ? -2.995  -10.852 6.561   1.00 0.00 ? 100 PRO A CB   2  
ATOM 3648  C CG   . PRO A 1 100 ? -2.014  -10.312 5.534   1.00 0.00 ? 100 PRO A CG   2  
ATOM 3649  C CD   . PRO A 1 100 ? -2.026  -11.252 4.339   1.00 0.00 ? 100 PRO A CD   2  
ATOM 3650  H HA   . PRO A 1 100 ? -3.984  -12.705 6.396   1.00 0.00 ? 100 PRO A HA   2  
ATOM 3651  H HB2  . PRO A 1 100 ? -3.624  -10.055 6.958   1.00 0.00 ? 100 PRO A HB2  2  
ATOM 3652  H HB3  . PRO A 1 100 ? -2.470  -11.295 7.407   1.00 0.00 ? 100 PRO A HB3  2  
ATOM 3653  H HG2  . PRO A 1 100 ? -2.296  -9.304  5.230   1.00 0.00 ? 100 PRO A HG2  2  
ATOM 3654  H HG3  . PRO A 1 100 ? -1.012  -10.248 5.959   1.00 0.00 ? 100 PRO A HG3  2  
ATOM 3655  H HD2  . PRO A 1 100 ? -2.256  -10.717 3.417   1.00 0.00 ? 100 PRO A HD2  2  
ATOM 3656  H HD3  . PRO A 1 100 ? -1.055  -11.726 4.198   1.00 0.00 ? 100 PRO A HD3  2  
ATOM 3657  N N    . SER A 1 101 ? -6.057  -11.217 6.463   1.00 0.00 ? 101 SER A N    2  
ATOM 3658  C CA   . SER A 1 101 ? -7.411  -10.736 6.247   1.00 0.00 ? 101 SER A CA   2  
ATOM 3659  C C    . SER A 1 101 ? -7.641  -9.446  7.035   1.00 0.00 ? 101 SER A C    2  
ATOM 3660  O O    . SER A 1 101 ? -7.145  -9.299  8.151   1.00 0.00 ? 101 SER A O    2  
ATOM 3661  C CB   . SER A 1 101 ? -8.441  -11.794 6.648   1.00 0.00 ? 101 SER A CB   2  
ATOM 3662  O OG   . SER A 1 101 ? -9.770  -11.279 6.630   1.00 0.00 ? 101 SER A OG   2  
ATOM 3663  H H    . SER A 1 101 ? -5.823  -11.405 7.417   1.00 0.00 ? 101 SER A H    2  
ATOM 3664  H HA   . SER A 1 101 ? -7.482  -10.548 5.175   1.00 0.00 ? 101 SER A HA   2  
ATOM 3665  H HB2  . SER A 1 101 ? -8.372  -12.643 5.968   1.00 0.00 ? 101 SER A HB2  2  
ATOM 3666  H HB3  . SER A 1 101 ? -8.210  -12.165 7.646   1.00 0.00 ? 101 SER A HB3  2  
ATOM 3667  H HG   . SER A 1 101 ? -9.974  -10.892 5.731   1.00 0.00 ? 101 SER A HG   2  
ATOM 3668  N N    . SER A 1 102 ? -8.393  -8.542  6.423   1.00 0.00 ? 102 SER A N    2  
ATOM 3669  C CA   . SER A 1 102 ? -8.694  -7.268  7.054   1.00 0.00 ? 102 SER A CA   2  
ATOM 3670  C C    . SER A 1 102 ? -9.493  -7.497  8.339   1.00 0.00 ? 102 SER A C    2  
ATOM 3671  O O    . SER A 1 102 ? -10.071 -8.565  8.533   1.00 0.00 ? 102 SER A O    2  
ATOM 3672  C CB   . SER A 1 102 ? -9.468  -6.353  6.103   1.00 0.00 ? 102 SER A CB   2  
ATOM 3673  O OG   . SER A 1 102 ? -9.282  -4.976  6.419   1.00 0.00 ? 102 SER A OG   2  
ATOM 3674  H H    . SER A 1 102 ? -8.792  -8.669  5.515   1.00 0.00 ? 102 SER A H    2  
ATOM 3675  H HA   . SER A 1 102 ? -7.726  -6.822  7.280   1.00 0.00 ? 102 SER A HA   2  
ATOM 3676  H HB2  . SER A 1 102 ? -9.144  -6.536  5.079   1.00 0.00 ? 102 SER A HB2  2  
ATOM 3677  H HB3  . SER A 1 102 ? -10.530 -6.595  6.150   1.00 0.00 ? 102 SER A HB3  2  
ATOM 3678  H HG   . SER A 1 102 ? -10.156 -4.492  6.368   1.00 0.00 ? 102 SER A HG   2  
ATOM 3679  N N    . THR A 1 103 ? -9.500  -6.475  9.183   1.00 0.00 ? 103 THR A N    2  
ATOM 3680  C CA   . THR A 1 103 ? -10.219 -6.551  10.443  1.00 0.00 ? 103 THR A CA   2  
ATOM 3681  C C    . THR A 1 103 ? -11.583 -5.869  10.322  1.00 0.00 ? 103 THR A C    2  
ATOM 3682  O O    . THR A 1 103 ? -12.443 -6.034  11.186  1.00 0.00 ? 103 THR A O    2  
ATOM 3683  C CB   . THR A 1 103 ? -9.330  -5.945  11.531  1.00 0.00 ? 103 THR A CB   2  
ATOM 3684  O OG1  . THR A 1 103 ? -8.915  -4.696  10.984  1.00 0.00 ? 103 THR A OG1  2  
ATOM 3685  C CG2  . THR A 1 103 ? -8.026  -6.721  11.722  1.00 0.00 ? 103 THR A CG2  2  
ATOM 3686  H H    . THR A 1 103 ? -9.028  -5.610  9.017   1.00 0.00 ? 103 THR A H    2  
ATOM 3687  H HA   . THR A 1 103 ? -10.406 -7.601  10.669  1.00 0.00 ? 103 THR A HA   2  
ATOM 3688  H HB   . THR A 1 103 ? -9.873  -5.857  12.472  1.00 0.00 ? 103 THR A HB   2  
ATOM 3689  H HG1  . THR A 1 103 ? -9.542  -3.972  11.269  1.00 0.00 ? 103 THR A HG1  2  
ATOM 3690  H HG21 . THR A 1 103 ? -7.189  -6.023  11.754  1.00 0.00 ? 103 THR A HG21 2  
ATOM 3691  H HG22 . THR A 1 103 ? -8.069  -7.280  12.657  1.00 0.00 ? 103 THR A HG22 2  
ATOM 3692  H HG23 . THR A 1 103 ? -7.890  -7.413  10.891  1.00 0.00 ? 103 THR A HG23 2  
ATOM 3693  N N    . ARG A 1 104 ? -11.738 -5.116  9.242   1.00 0.00 ? 104 ARG A N    2  
ATOM 3694  C CA   . ARG A 1 104 ? -12.983 -4.408  8.997   1.00 0.00 ? 104 ARG A CA   2  
ATOM 3695  C C    . ARG A 1 104 ? -13.162 -4.155  7.498   1.00 0.00 ? 104 ARG A C    2  
ATOM 3696  O O    . ARG A 1 104 ? -12.243 -4.378  6.713   1.00 0.00 ? 104 ARG A O    2  
ATOM 3697  C CB   . ARG A 1 104 ? -13.011 -3.071  9.740   1.00 0.00 ? 104 ARG A CB   2  
ATOM 3698  C CG   . ARG A 1 104 ? -12.212 -2.006  8.984   1.00 0.00 ? 104 ARG A CG   2  
ATOM 3699  C CD   . ARG A 1 104 ? -10.709 -2.200  9.191   1.00 0.00 ? 104 ARG A CD   2  
ATOM 3700  N NE   . ARG A 1 104 ? -10.327 -1.779  10.557  1.00 0.00 ? 104 ARG A NE   2  
ATOM 3701  C CZ   . ARG A 1 104 ? -9.061  -1.650  10.978  1.00 0.00 ? 104 ARG A CZ   2  
ATOM 3702  N NH1  . ARG A 1 104 ? -8.048  -1.908  10.140  1.00 0.00 ? 104 ARG A NH1  2  
ATOM 3703  N NH2  . ARG A 1 104 ? -8.809  -1.263  12.235  1.00 0.00 ? 104 ARG A NH2  2  
ATOM 3704  H H    . ARG A 1 104 ? -11.033 -4.987  8.544   1.00 0.00 ? 104 ARG A H    2  
ATOM 3705  H HA   . ARG A 1 104 ? -13.760 -5.069  9.379   1.00 0.00 ? 104 ARG A HA   2  
ATOM 3706  H HB2  . ARG A 1 104 ? -14.043 -2.739  9.860   1.00 0.00 ? 104 ARG A HB2  2  
ATOM 3707  H HB3  . ARG A 1 104 ? -12.599 -3.198  10.741  1.00 0.00 ? 104 ARG A HB3  2  
ATOM 3708  H HG2  . ARG A 1 104 ? -12.447 -2.057  7.921   1.00 0.00 ? 104 ARG A HG2  2  
ATOM 3709  H HG3  . ARG A 1 104 ? -12.505 -1.014  9.328   1.00 0.00 ? 104 ARG A HG3  2  
ATOM 3710  H HD2  . ARG A 1 104 ? -10.444 -3.246  9.036   1.00 0.00 ? 104 ARG A HD2  2  
ATOM 3711  H HD3  . ARG A 1 104 ? -10.154 -1.619  8.454   1.00 0.00 ? 104 ARG A HD3  2  
ATOM 3712  H HE   . ARG A 1 104 ? -11.060 -1.579  11.208  1.00 0.00 ? 104 ARG A HE   2  
ATOM 3713  H HH11 . ARG A 1 104 ? -8.236  -2.198  9.202   1.00 0.00 ? 104 ARG A HH11 2  
ATOM 3714  H HH12 . ARG A 1 104 ? -7.103  -1.812  10.454  1.00 0.00 ? 104 ARG A HH12 2  
ATOM 3715  H HH21 . ARG A 1 104 ? -9.566  -1.070  12.860  1.00 0.00 ? 104 ARG A HH21 2  
ATOM 3716  H HH22 . ARG A 1 104 ? -7.865  -1.166  12.549  1.00 0.00 ? 104 ARG A HH22 2  
ATOM 3717  N N    . THR A 1 105 ? -14.354 -3.692  7.148   1.00 0.00 ? 105 THR A N    2  
ATOM 3718  C CA   . THR A 1 105 ? -14.666 -3.407  5.758   1.00 0.00 ? 105 THR A CA   2  
ATOM 3719  C C    . THR A 1 105 ? -14.788 -1.898  5.538   1.00 0.00 ? 105 THR A C    2  
ATOM 3720  O O    . THR A 1 105 ? -15.789 -1.291  5.917   1.00 0.00 ? 105 THR A O    2  
ATOM 3721  C CB   . THR A 1 105 ? -15.934 -4.179  5.389   1.00 0.00 ? 105 THR A CB   2  
ATOM 3722  O OG1  . THR A 1 105 ? -15.498 -5.532  5.282   1.00 0.00 ? 105 THR A OG1  2  
ATOM 3723  C CG2  . THR A 1 105 ? -16.440 -3.839  3.986   1.00 0.00 ? 105 THR A CG2  2  
ATOM 3724  H H    . THR A 1 105 ? -15.096 -3.514  7.793   1.00 0.00 ? 105 THR A H    2  
ATOM 3725  H HA   . THR A 1 105 ? -13.836 -3.753  5.141   1.00 0.00 ? 105 THR A HA   2  
ATOM 3726  H HB   . THR A 1 105 ? -16.715 -4.023  6.134   1.00 0.00 ? 105 THR A HB   2  
ATOM 3727  H HG1  . THR A 1 105 ? -16.247 -6.152  5.512   1.00 0.00 ? 105 THR A HG1  2  
ATOM 3728  H HG21 . THR A 1 105 ? -17.280 -3.148  4.061   1.00 0.00 ? 105 THR A HG21 2  
ATOM 3729  H HG22 . THR A 1 105 ? -15.638 -3.375  3.413   1.00 0.00 ? 105 THR A HG22 2  
ATOM 3730  H HG23 . THR A 1 105 ? -16.764 -4.751  3.486   1.00 0.00 ? 105 THR A HG23 2  
ATOM 3731  N N    . VAL A 1 106 ? -13.756 -1.335  4.927   1.00 0.00 ? 106 VAL A N    2  
ATOM 3732  C CA   . VAL A 1 106 ? -13.736 0.092   4.652   1.00 0.00 ? 106 VAL A CA   2  
ATOM 3733  C C    . VAL A 1 106 ? -14.101 0.330   3.185   1.00 0.00 ? 106 VAL A C    2  
ATOM 3734  O O    . VAL A 1 106 ? -13.882 -0.536  2.339   1.00 0.00 ? 106 VAL A O    2  
ATOM 3735  C CB   . VAL A 1 106 ? -12.374 0.678   5.031   1.00 0.00 ? 106 VAL A CB   2  
ATOM 3736  C CG1  . VAL A 1 106 ? -12.208 2.090   4.465   1.00 0.00 ? 106 VAL A CG1  2  
ATOM 3737  C CG2  . VAL A 1 106 ? -12.177 0.669   6.549   1.00 0.00 ? 106 VAL A CG2  2  
ATOM 3738  H H    . VAL A 1 106 ? -12.946 -1.836  4.622   1.00 0.00 ? 106 VAL A H    2  
ATOM 3739  H HA   . VAL A 1 106 ? -14.492 0.559   5.282   1.00 0.00 ? 106 VAL A HA   2  
ATOM 3740  H HB   . VAL A 1 106 ? -11.603 0.047   4.590   1.00 0.00 ? 106 VAL A HB   2  
ATOM 3741  H HG11 . VAL A 1 106 ? -13.157 2.622   4.532   1.00 0.00 ? 106 VAL A HG11 2  
ATOM 3742  H HG12 . VAL A 1 106 ? -11.451 2.624   5.038   1.00 0.00 ? 106 VAL A HG12 2  
ATOM 3743  H HG13 . VAL A 1 106 ? -11.899 2.029   3.422   1.00 0.00 ? 106 VAL A HG13 2  
ATOM 3744  H HG21 . VAL A 1 106 ? -11.262 1.205   6.799   1.00 0.00 ? 106 VAL A HG21 2  
ATOM 3745  H HG22 . VAL A 1 106 ? -13.026 1.156   7.028   1.00 0.00 ? 106 VAL A HG22 2  
ATOM 3746  H HG23 . VAL A 1 106 ? -12.102 -0.360  6.899   1.00 0.00 ? 106 VAL A HG23 2  
ATOM 3747  N N    . LYS A 1 107 ? -14.652 1.507   2.930   1.00 0.00 ? 107 LYS A N    2  
ATOM 3748  C CA   . LYS A 1 107 ? -15.050 1.870   1.580   1.00 0.00 ? 107 LYS A CA   2  
ATOM 3749  C C    . LYS A 1 107 ? -14.641 3.318   1.304   1.00 0.00 ? 107 LYS A C    2  
ATOM 3750  O O    . LYS A 1 107 ? -14.239 4.038   2.217   1.00 0.00 ? 107 LYS A O    2  
ATOM 3751  C CB   . LYS A 1 107 ? -16.542 1.601   1.371   1.00 0.00 ? 107 LYS A CB   2  
ATOM 3752  C CG   . LYS A 1 107 ? -16.879 1.507   -0.118  1.00 0.00 ? 107 LYS A CG   2  
ATOM 3753  C CD   . LYS A 1 107 ? -18.175 0.724   -0.339  1.00 0.00 ? 107 LYS A CD   2  
ATOM 3754  C CE   . LYS A 1 107 ? -19.309 1.653   -0.776  1.00 0.00 ? 107 LYS A CE   2  
ATOM 3755  N NZ   . LYS A 1 107 ? -20.318 0.907   -1.559  1.00 0.00 ? 107 LYS A NZ   2  
ATOM 3756  H H    . LYS A 1 107 ? -14.827 2.205   3.624   1.00 0.00 ? 107 LYS A H    2  
ATOM 3757  H HA   . LYS A 1 107 ? -14.507 1.221   0.894   1.00 0.00 ? 107 LYS A HA   2  
ATOM 3758  H HB2  . LYS A 1 107 ? -16.822 0.674   1.870   1.00 0.00 ? 107 LYS A HB2  2  
ATOM 3759  H HB3  . LYS A 1 107 ? -17.126 2.399   1.830   1.00 0.00 ? 107 LYS A HB3  2  
ATOM 3760  H HG2  . LYS A 1 107 ? -16.979 2.508   -0.536  1.00 0.00 ? 107 LYS A HG2  2  
ATOM 3761  H HG3  . LYS A 1 107 ? -16.061 1.020   -0.650  1.00 0.00 ? 107 LYS A HG3  2  
ATOM 3762  H HD2  . LYS A 1 107 ? -18.016 -0.043  -1.097  1.00 0.00 ? 107 LYS A HD2  2  
ATOM 3763  H HD3  . LYS A 1 107 ? -18.454 0.210   0.581   1.00 0.00 ? 107 LYS A HD3  2  
ATOM 3764  H HE2  . LYS A 1 107 ? -19.778 2.101   0.100   1.00 0.00 ? 107 LYS A HE2  2  
ATOM 3765  H HE3  . LYS A 1 107 ? -18.907 2.471   -1.375  1.00 0.00 ? 107 LYS A HE3  2  
ATOM 3766  H HZ1  . LYS A 1 107 ? -21.235 1.196   -1.283  1.00 0.00 ? 107 LYS A HZ1  2  
ATOM 3767  H HZ2  . LYS A 1 107 ? -20.189 1.093   -2.533  1.00 0.00 ? 107 LYS A HZ2  2  
ATOM 3768  H HZ3  . LYS A 1 107 ? -20.213 -0.074  -1.390  1.00 0.00 ? 107 LYS A HZ3  2  
ATOM 3769  N N    . ALA A 1 108 ? -14.759 3.702   0.042   1.00 0.00 ? 108 ALA A N    2  
ATOM 3770  C CA   . ALA A 1 108 ? -14.407 5.052   -0.366  1.00 0.00 ? 108 ALA A CA   2  
ATOM 3771  C C    . ALA A 1 108 ? -15.681 5.823   -0.715  1.00 0.00 ? 108 ALA A C    2  
ATOM 3772  O O    . ALA A 1 108 ? -16.353 5.507   -1.695  1.00 0.00 ? 108 ALA A O    2  
ATOM 3773  C CB   . ALA A 1 108 ? -13.423 4.991   -1.536  1.00 0.00 ? 108 ALA A CB   2  
ATOM 3774  H H    . ALA A 1 108 ? -15.087 3.110   -0.695  1.00 0.00 ? 108 ALA A H    2  
ATOM 3775  H HA   . ALA A 1 108 ? -13.918 5.537   0.479   1.00 0.00 ? 108 ALA A HA   2  
ATOM 3776  H HB1  . ALA A 1 108 ? -13.829 4.353   -2.320  1.00 0.00 ? 108 ALA A HB1  2  
ATOM 3777  H HB2  . ALA A 1 108 ? -13.265 5.995   -1.930  1.00 0.00 ? 108 ALA A HB2  2  
ATOM 3778  H HB3  . ALA A 1 108 ? -12.473 4.583   -1.191  1.00 0.00 ? 108 ALA A HB3  2  
ATOM 3779  N N    . LEU A 1 109 ? -15.974 6.821   0.107   1.00 0.00 ? 109 LEU A N    2  
ATOM 3780  C CA   . LEU A 1 109 ? -17.156 7.640   -0.103  1.00 0.00 ? 109 LEU A CA   2  
ATOM 3781  C C    . LEU A 1 109 ? -16.765 8.902   -0.874  1.00 0.00 ? 109 LEU A C    2  
ATOM 3782  O O    . LEU A 1 109 ? -17.588 9.480   -1.584  1.00 0.00 ? 109 LEU A O    2  
ATOM 3783  C CB   . LEU A 1 109 ? -17.854 7.924   1.229   1.00 0.00 ? 109 LEU A CB   2  
ATOM 3784  C CG   . LEU A 1 109 ? -17.829 6.788   2.254   1.00 0.00 ? 109 LEU A CG   2  
ATOM 3785  C CD1  . LEU A 1 109 ? -16.736 7.018   3.300   1.00 0.00 ? 109 LEU A CD1  2  
ATOM 3786  C CD2  . LEU A 1 109 ? -19.205 6.599   2.895   1.00 0.00 ? 109 LEU A CD2  2  
ATOM 3787  H H    . LEU A 1 109 ? -15.422 7.071   0.902   1.00 0.00 ? 109 LEU A H    2  
ATOM 3788  H HA   . LEU A 1 109 ? -17.849 7.062   -0.714  1.00 0.00 ? 109 LEU A HA   2  
ATOM 3789  H HB2  . LEU A 1 109 ? -17.393 8.803   1.678   1.00 0.00 ? 109 LEU A HB2  2  
ATOM 3790  H HB3  . LEU A 1 109 ? -18.894 8.179   1.024   1.00 0.00 ? 109 LEU A HB3  2  
ATOM 3791  H HG   . LEU A 1 109 ? -17.586 5.863   1.733   1.00 0.00 ? 109 LEU A HG   2  
ATOM 3792  H HD11 . LEU A 1 109 ? -17.183 7.419   4.210   1.00 0.00 ? 109 LEU A HD11 2  
ATOM 3793  H HD12 . LEU A 1 109 ? -16.243 6.073   3.524   1.00 0.00 ? 109 LEU A HD12 2  
ATOM 3794  H HD13 . LEU A 1 109 ? -16.005 7.727   2.912   1.00 0.00 ? 109 LEU A HD13 2  
ATOM 3795  H HD21 . LEU A 1 109 ? -19.608 7.569   3.185   1.00 0.00 ? 109 LEU A HD21 2  
ATOM 3796  H HD22 . LEU A 1 109 ? -19.877 6.125   2.180   1.00 0.00 ? 109 LEU A HD22 2  
ATOM 3797  H HD23 . LEU A 1 109 ? -19.111 5.967   3.779   1.00 0.00 ? 109 LEU A HD23 2  
ATOM 3798  N N    . THR A 1 110 ? -15.511 9.294   -0.708  1.00 0.00 ? 110 THR A N    2  
ATOM 3799  C CA   . THR A 1 110 ? -15.001 10.478  -1.380  1.00 0.00 ? 110 THR A CA   2  
ATOM 3800  C C    . THR A 1 110 ? -13.603 10.213  -1.941  1.00 0.00 ? 110 THR A C    2  
ATOM 3801  O O    . THR A 1 110 ? -12.988 9.193   -1.630  1.00 0.00 ? 110 THR A O    2  
ATOM 3802  C CB   . THR A 1 110 ? -15.047 11.641  -0.387  1.00 0.00 ? 110 THR A CB   2  
ATOM 3803  O OG1  . THR A 1 110 ? -14.188 12.622  -0.962  1.00 0.00 ? 110 THR A OG1  2  
ATOM 3804  C CG2  . THR A 1 110 ? -14.382 11.299  0.948   1.00 0.00 ? 110 THR A CG2  2  
ATOM 3805  H H    . THR A 1 110 ? -14.848 8.819   -0.129  1.00 0.00 ? 110 THR A H    2  
ATOM 3806  H HA   . THR A 1 110 ? -15.650 10.697  -2.228  1.00 0.00 ? 110 THR A HA   2  
ATOM 3807  H HB   . THR A 1 110 ? -16.071 11.983  -0.236  1.00 0.00 ? 110 THR A HB   2  
ATOM 3808  H HG1  . THR A 1 110 ? -14.706 13.451  -1.171  1.00 0.00 ? 110 THR A HG1  2  
ATOM 3809  H HG21 . THR A 1 110 ? -14.655 10.285  1.240   1.00 0.00 ? 110 THR A HG21 2  
ATOM 3810  H HG22 . THR A 1 110 ? -13.300 11.368  0.843   1.00 0.00 ? 110 THR A HG22 2  
ATOM 3811  H HG23 . THR A 1 110 ? -14.719 12.000  1.712   1.00 0.00 ? 110 THR A HG23 2  
ATOM 3812  N N    . GLU A 1 111 ? -13.141 11.148  -2.757  1.00 0.00 ? 111 GLU A N    2  
ATOM 3813  C CA   . GLU A 1 111 ? -11.826 11.028  -3.364  1.00 0.00 ? 111 GLU A CA   2  
ATOM 3814  C C    . GLU A 1 111 ? -10.745 10.973  -2.283  1.00 0.00 ? 111 GLU A C    2  
ATOM 3815  O O    . GLU A 1 111 ? -10.634 11.884  -1.464  1.00 0.00 ? 111 GLU A O    2  
ATOM 3816  C CB   . GLU A 1 111 ? -11.566 12.176  -4.341  1.00 0.00 ? 111 GLU A CB   2  
ATOM 3817  C CG   . GLU A 1 111 ? -10.685 11.718  -5.505  1.00 0.00 ? 111 GLU A CG   2  
ATOM 3818  C CD   . GLU A 1 111 ? -11.128 12.368  -6.818  1.00 0.00 ? 111 GLU A CD   2  
ATOM 3819  O OE1  . GLU A 1 111 ? -10.998 13.607  -6.909  1.00 0.00 ? 111 GLU A OE1  2  
ATOM 3820  O OE2  . GLU A 1 111 ? -11.585 11.610  -7.700  1.00 0.00 ? 111 GLU A OE2  2  
ATOM 3821  H H    . GLU A 1 111 ? -13.647 11.974  -3.005  1.00 0.00 ? 111 GLU A H    2  
ATOM 3822  H HA   . GLU A 1 111 ? -11.846 10.088  -3.916  1.00 0.00 ? 111 GLU A HA   2  
ATOM 3823  H HB2  . GLU A 1 111 ? -12.514 12.553  -4.725  1.00 0.00 ? 111 GLU A HB2  2  
ATOM 3824  H HB3  . GLU A 1 111 ? -11.084 13.002  -3.818  1.00 0.00 ? 111 GLU A HB3  2  
ATOM 3825  H HG2  . GLU A 1 111 ? -9.645  11.973  -5.301  1.00 0.00 ? 111 GLU A HG2  2  
ATOM 3826  H HG3  . GLU A 1 111 ? -10.734 10.633  -5.597  1.00 0.00 ? 111 GLU A HG3  2  
ATOM 3827  N N    . VAL A 1 112 ? -9.975  9.895   -2.315  1.00 0.00 ? 112 VAL A N    2  
ATOM 3828  C CA   . VAL A 1 112 ? -8.907  9.709   -1.348  1.00 0.00 ? 112 VAL A CA   2  
ATOM 3829  C C    . VAL A 1 112 ? -7.592  9.461   -2.089  1.00 0.00 ? 112 VAL A C    2  
ATOM 3830  O O    . VAL A 1 112 ? -7.537  8.645   -3.008  1.00 0.00 ? 112 VAL A O    2  
ATOM 3831  C CB   . VAL A 1 112 ? -9.269  8.583   -0.378  1.00 0.00 ? 112 VAL A CB   2  
ATOM 3832  C CG1  . VAL A 1 112 ? -8.308  8.554   0.813   1.00 0.00 ? 112 VAL A CG1  2  
ATOM 3833  C CG2  . VAL A 1 112 ? -10.720 8.709   0.091   1.00 0.00 ? 112 VAL A CG2  2  
ATOM 3834  H H    . VAL A 1 112 ? -10.072 9.158   -2.984  1.00 0.00 ? 112 VAL A H    2  
ATOM 3835  H HA   . VAL A 1 112 ? -8.818  10.632  -0.775  1.00 0.00 ? 112 VAL A HA   2  
ATOM 3836  H HB   . VAL A 1 112 ? -9.170  7.637   -0.911  1.00 0.00 ? 112 VAL A HB   2  
ATOM 3837  H HG11 . VAL A 1 112 ? -7.452  9.195   0.603   1.00 0.00 ? 112 VAL A HG11 2  
ATOM 3838  H HG12 . VAL A 1 112 ? -8.823  8.915   1.703   1.00 0.00 ? 112 VAL A HG12 2  
ATOM 3839  H HG13 . VAL A 1 112 ? -7.966  7.533   0.979   1.00 0.00 ? 112 VAL A HG13 2  
ATOM 3840  H HG21 . VAL A 1 112 ? -11.189 9.559   -0.403  1.00 0.00 ? 112 VAL A HG21 2  
ATOM 3841  H HG22 . VAL A 1 112 ? -11.263 7.797   -0.160  1.00 0.00 ? 112 VAL A HG22 2  
ATOM 3842  H HG23 . VAL A 1 112 ? -10.741 8.858   1.171   1.00 0.00 ? 112 VAL A HG23 2  
ATOM 3843  N N    . GLU A 1 113 ? -6.563  10.178  -1.660  1.00 0.00 ? 113 GLU A N    2  
ATOM 3844  C CA   . GLU A 1 113 ? -5.252  10.045  -2.272  1.00 0.00 ? 113 GLU A CA   2  
ATOM 3845  C C    . GLU A 1 113 ? -4.332  9.211   -1.378  1.00 0.00 ? 113 GLU A C    2  
ATOM 3846  O O    . GLU A 1 113 ? -4.049  9.593   -0.243  1.00 0.00 ? 113 GLU A O    2  
ATOM 3847  C CB   . GLU A 1 113 ? -4.640  11.418  -2.559  1.00 0.00 ? 113 GLU A CB   2  
ATOM 3848  C CG   . GLU A 1 113 ? -3.126  11.312  -2.760  1.00 0.00 ? 113 GLU A CG   2  
ATOM 3849  C CD   . GLU A 1 113 ? -2.510  12.688  -3.019  1.00 0.00 ? 113 GLU A CD   2  
ATOM 3850  O OE1  . GLU A 1 113 ? -3.273  13.579  -3.450  1.00 0.00 ? 113 GLU A OE1  2  
ATOM 3851  O OE2  . GLU A 1 113 ? -1.290  12.817  -2.781  1.00 0.00 ? 113 GLU A OE2  2  
ATOM 3852  H H    . GLU A 1 113 ? -6.616  10.839  -0.912  1.00 0.00 ? 113 GLU A H    2  
ATOM 3853  H HA   . GLU A 1 113 ? -5.423  9.526   -3.214  1.00 0.00 ? 113 GLU A HA   2  
ATOM 3854  H HB2  . GLU A 1 113 ? -5.099  11.845  -3.451  1.00 0.00 ? 113 GLU A HB2  2  
ATOM 3855  H HB3  . GLU A 1 113 ? -4.854  12.096  -1.734  1.00 0.00 ? 113 GLU A HB3  2  
ATOM 3856  H HG2  . GLU A 1 113 ? -2.669  10.865  -1.877  1.00 0.00 ? 113 GLU A HG2  2  
ATOM 3857  H HG3  . GLU A 1 113 ? -2.913  10.650  -3.599  1.00 0.00 ? 113 GLU A HG3  2  
ATOM 3858  N N    . ALA A 1 114 ? -3.890  8.087   -1.923  1.00 0.00 ? 114 ALA A N    2  
ATOM 3859  C CA   . ALA A 1 114 ? -3.008  7.196   -1.190  1.00 0.00 ? 114 ALA A CA   2  
ATOM 3860  C C    . ALA A 1 114 ? -2.277  6.283   -2.177  1.00 0.00 ? 114 ALA A C    2  
ATOM 3861  O O    . ALA A 1 114 ? -2.546  6.318   -3.376  1.00 0.00 ? 114 ALA A O    2  
ATOM 3862  C CB   . ALA A 1 114 ? -3.819  6.409   -0.159  1.00 0.00 ? 114 ALA A CB   2  
ATOM 3863  H H    . ALA A 1 114 ? -4.125  7.784   -2.847  1.00 0.00 ? 114 ALA A H    2  
ATOM 3864  H HA   . ALA A 1 114 ? -2.276  7.810   -0.666  1.00 0.00 ? 114 ALA A HA   2  
ATOM 3865  H HB1  . ALA A 1 114 ? -4.882  6.587   -0.320  1.00 0.00 ? 114 ALA A HB1  2  
ATOM 3866  H HB2  . ALA A 1 114 ? -3.609  5.344   -0.267  1.00 0.00 ? 114 ALA A HB2  2  
ATOM 3867  H HB3  . ALA A 1 114 ? -3.544  6.734   0.844   1.00 0.00 ? 114 ALA A HB3  2  
ATOM 3868  N N    . PHE A 1 115 ? -1.366  5.488   -1.635  1.00 0.00 ? 115 PHE A N    2  
ATOM 3869  C CA   . PHE A 1 115 ? -0.594  4.568   -2.452  1.00 0.00 ? 115 PHE A CA   2  
ATOM 3870  C C    . PHE A 1 115 ? -0.867  3.117   -2.051  1.00 0.00 ? 115 PHE A C    2  
ATOM 3871  O O    . PHE A 1 115 ? -1.439  2.858   -0.994  1.00 0.00 ? 115 PHE A O    2  
ATOM 3872  C CB   . PHE A 1 115 ? 0.883   4.883   -2.208  1.00 0.00 ? 115 PHE A CB   2  
ATOM 3873  C CG   . PHE A 1 115 ? 1.304   6.283   -2.658  1.00 0.00 ? 115 PHE A CG   2  
ATOM 3874  C CD1  . PHE A 1 115 ? 1.750   6.484   -3.927  1.00 0.00 ? 115 PHE A CD1  2  
ATOM 3875  C CD2  . PHE A 1 115 ? 1.232   7.327   -1.789  1.00 0.00 ? 115 PHE A CD2  2  
ATOM 3876  C CE1  . PHE A 1 115 ? 2.140   7.784   -4.345  1.00 0.00 ? 115 PHE A CE1  2  
ATOM 3877  C CE2  . PHE A 1 115 ? 1.622   8.627   -2.207  1.00 0.00 ? 115 PHE A CE2  2  
ATOM 3878  C CZ   . PHE A 1 115 ? 2.068   8.828   -3.476  1.00 0.00 ? 115 PHE A CZ   2  
ATOM 3879  H H    . PHE A 1 115 ? -1.153  5.466   -0.658  1.00 0.00 ? 115 PHE A H    2  
ATOM 3880  H HA   . PHE A 1 115 ? -0.899  4.720   -3.488  1.00 0.00 ? 115 PHE A HA   2  
ATOM 3881  H HB2  . PHE A 1 115 ? 1.096   4.775   -1.144  1.00 0.00 ? 115 PHE A HB2  2  
ATOM 3882  H HB3  . PHE A 1 115 ? 1.493   4.146   -2.731  1.00 0.00 ? 115 PHE A HB3  2  
ATOM 3883  H HD1  . PHE A 1 115 ? 1.808   5.648   -4.623  1.00 0.00 ? 115 PHE A HD1  2  
ATOM 3884  H HD2  . PHE A 1 115 ? 0.874   7.166   -0.772  1.00 0.00 ? 115 PHE A HD2  2  
ATOM 3885  H HE1  . PHE A 1 115 ? 2.498   7.945   -5.362  1.00 0.00 ? 115 PHE A HE1  2  
ATOM 3886  H HE2  . PHE A 1 115 ? 1.564   9.463   -1.510  1.00 0.00 ? 115 PHE A HE2  2  
ATOM 3887  H HZ   . PHE A 1 115 ? 2.368   9.826   -3.796  1.00 0.00 ? 115 PHE A HZ   2  
ATOM 3888  N N    . ALA A 1 116 ? -0.445  2.207   -2.918  1.00 0.00 ? 116 ALA A N    2  
ATOM 3889  C CA   . ALA A 1 116 ? -0.636  0.789   -2.667  1.00 0.00 ? 116 ALA A CA   2  
ATOM 3890  C C    . ALA A 1 116 ? 0.690   0.171   -2.220  1.00 0.00 ? 116 ALA A C    2  
ATOM 3891  O O    . ALA A 1 116 ? 1.739   0.805   -2.318  1.00 0.00 ? 116 ALA A O    2  
ATOM 3892  C CB   . ALA A 1 116 ? -1.198  0.120   -3.923  1.00 0.00 ? 116 ALA A CB   2  
ATOM 3893  H H    . ALA A 1 116 ? 0.020   2.426   -3.776  1.00 0.00 ? 116 ALA A H    2  
ATOM 3894  H HA   . ALA A 1 116 ? -1.364  0.690   -1.862  1.00 0.00 ? 116 ALA A HA   2  
ATOM 3895  H HB1  . ALA A 1 116 ? -2.013  0.723   -4.323  1.00 0.00 ? 116 ALA A HB1  2  
ATOM 3896  H HB2  . ALA A 1 116 ? -0.410  0.033   -4.671  1.00 0.00 ? 116 ALA A HB2  2  
ATOM 3897  H HB3  . ALA A 1 116 ? -1.570  -0.873  -3.670  1.00 0.00 ? 116 ALA A HB3  2  
ATOM 3898  N N    . LEU A 1 117 ? 0.599   -1.061  -1.739  1.00 0.00 ? 117 LEU A N    2  
ATOM 3899  C CA   . LEU A 1 117 ? 1.779   -1.772  -1.277  1.00 0.00 ? 117 LEU A CA   2  
ATOM 3900  C C    . LEU A 1 117 ? 1.530   -3.278  -1.369  1.00 0.00 ? 117 LEU A C    2  
ATOM 3901  O O    . LEU A 1 117 ? 0.616   -3.800  -0.732  1.00 0.00 ? 117 LEU A O    2  
ATOM 3902  C CB   . LEU A 1 117 ? 2.176   -1.299  0.123   1.00 0.00 ? 117 LEU A CB   2  
ATOM 3903  C CG   . LEU A 1 117 ? 3.671   -1.335  0.445   1.00 0.00 ? 117 LEU A CG   2  
ATOM 3904  C CD1  . LEU A 1 117 ? 4.301   -2.648  -0.025  1.00 0.00 ? 117 LEU A CD1  2  
ATOM 3905  C CD2  . LEU A 1 117 ? 4.387   -0.115  -0.139  1.00 0.00 ? 117 LEU A CD2  2  
ATOM 3906  H H    . LEU A 1 117 ? -0.258  -1.570  -1.663  1.00 0.00 ? 117 LEU A H    2  
ATOM 3907  H HA   . LEU A 1 117 ? 2.599   -1.516  -1.948  1.00 0.00 ? 117 LEU A HA   2  
ATOM 3908  H HB2  . LEU A 1 117 ? 1.821   -0.276  0.253   1.00 0.00 ? 117 LEU A HB2  2  
ATOM 3909  H HB3  . LEU A 1 117 ? 1.652   -1.914  0.855   1.00 0.00 ? 117 LEU A HB3  2  
ATOM 3910  H HG   . LEU A 1 117 ? 3.789   -1.290  1.527   1.00 0.00 ? 117 LEU A HG   2  
ATOM 3911  H HD11 . LEU A 1 117 ? 4.108   -2.783  -1.089  1.00 0.00 ? 117 LEU A HD11 2  
ATOM 3912  H HD12 . LEU A 1 117 ? 5.377   -2.616  0.148   1.00 0.00 ? 117 LEU A HD12 2  
ATOM 3913  H HD13 . LEU A 1 117 ? 3.868   -3.478  0.532   1.00 0.00 ? 117 LEU A HD13 2  
ATOM 3914  H HD21 . LEU A 1 117 ? 5.465   -0.260  -0.071  1.00 0.00 ? 117 LEU A HD21 2  
ATOM 3915  H HD22 . LEU A 1 117 ? 4.102   0.009   -1.183  1.00 0.00 ? 117 LEU A HD22 2  
ATOM 3916  H HD23 . LEU A 1 117 ? 4.104   0.775   0.424   1.00 0.00 ? 117 LEU A HD23 2  
ATOM 3917  N N    . ILE A 1 118 ? 2.358   -3.935  -2.167  1.00 0.00 ? 118 ILE A N    2  
ATOM 3918  C CA   . ILE A 1 118 ? 2.239   -5.372  -2.351  1.00 0.00 ? 118 ILE A CA   2  
ATOM 3919  C C    . ILE A 1 118 ? 2.950   -6.089  -1.202  1.00 0.00 ? 118 ILE A C    2  
ATOM 3920  O O    . ILE A 1 118 ? 3.988   -5.631  -0.727  1.00 0.00 ? 118 ILE A O    2  
ATOM 3921  C CB   . ILE A 1 118 ? 2.745   -5.778  -3.737  1.00 0.00 ? 118 ILE A CB   2  
ATOM 3922  C CG1  . ILE A 1 118 ? 2.828   -7.301  -3.865  1.00 0.00 ? 118 ILE A CG1  2  
ATOM 3923  C CG2  . ILE A 1 118 ? 4.080   -5.103  -4.053  1.00 0.00 ? 118 ILE A CG2  2  
ATOM 3924  C CD1  . ILE A 1 118 ? 3.026   -7.718  -5.324  1.00 0.00 ? 118 ILE A CD1  2  
ATOM 3925  H H    . ILE A 1 118 ? 3.099   -3.504  -2.682  1.00 0.00 ? 118 ILE A H    2  
ATOM 3926  H HA   . ILE A 1 118 ? 1.179   -5.620  -2.309  1.00 0.00 ? 118 ILE A HA   2  
ATOM 3927  H HB   . ILE A 1 118 ? 2.025   -5.432  -4.478  1.00 0.00 ? 118 ILE A HB   2  
ATOM 3928  H HG12 . ILE A 1 118 ? 3.653   -7.676  -3.260  1.00 0.00 ? 118 ILE A HG12 2  
ATOM 3929  H HG13 . ILE A 1 118 ? 1.916   -7.753  -3.474  1.00 0.00 ? 118 ILE A HG13 2  
ATOM 3930  H HG21 . ILE A 1 118 ? 3.912   -4.263  -4.728  1.00 0.00 ? 118 ILE A HG21 2  
ATOM 3931  H HG22 . ILE A 1 118 ? 4.533   -4.742  -3.130  1.00 0.00 ? 118 ILE A HG22 2  
ATOM 3932  H HG23 . ILE A 1 118 ? 4.748   -5.822  -4.528  1.00 0.00 ? 118 ILE A HG23 2  
ATOM 3933  H HD11 . ILE A 1 118 ? 2.123   -7.494  -5.892  1.00 0.00 ? 118 ILE A HD11 2  
ATOM 3934  H HD12 . ILE A 1 118 ? 3.868   -7.170  -5.747  1.00 0.00 ? 118 ILE A HD12 2  
ATOM 3935  H HD13 . ILE A 1 118 ? 3.228   -8.788  -5.371  1.00 0.00 ? 118 ILE A HD13 2  
ATOM 3936  N N    . ALA A 1 119 ? 2.364   -7.203  -0.789  1.00 0.00 ? 119 ALA A N    2  
ATOM 3937  C CA   . ALA A 1 119 ? 2.928   -7.988  0.295   1.00 0.00 ? 119 ALA A CA   2  
ATOM 3938  C C    . ALA A 1 119 ? 4.288   -8.541  -0.135  1.00 0.00 ? 119 ALA A C    2  
ATOM 3939  O O    . ALA A 1 119 ? 5.276   -8.397  0.583   1.00 0.00 ? 119 ALA A O    2  
ATOM 3940  C CB   . ALA A 1 119 ? 1.947   -9.095  0.689   1.00 0.00 ? 119 ALA A CB   2  
ATOM 3941  H H    . ALA A 1 119 ? 1.520   -7.569  -1.181  1.00 0.00 ? 119 ALA A H    2  
ATOM 3942  H HA   . ALA A 1 119 ? 3.068   -7.324  1.148   1.00 0.00 ? 119 ALA A HA   2  
ATOM 3943  H HB1  . ALA A 1 119 ? 1.860   -9.134  1.775   1.00 0.00 ? 119 ALA A HB1  2  
ATOM 3944  H HB2  . ALA A 1 119 ? 0.970   -8.886  0.253   1.00 0.00 ? 119 ALA A HB2  2  
ATOM 3945  H HB3  . ALA A 1 119 ? 2.313   -10.053 0.319   1.00 0.00 ? 119 ALA A HB3  2  
ATOM 3946  N N    . ASP A 1 120 ? 4.296   -9.161  -1.306  1.00 0.00 ? 120 ASP A N    2  
ATOM 3947  C CA   . ASP A 1 120 ? 5.518   -9.736  -1.841  1.00 0.00 ? 120 ASP A CA   2  
ATOM 3948  C C    . ASP A 1 120 ? 6.683   -8.777  -1.583  1.00 0.00 ? 120 ASP A C    2  
ATOM 3949  O O    . ASP A 1 120 ? 7.546   -9.052  -0.751  1.00 0.00 ? 120 ASP A O    2  
ATOM 3950  C CB   . ASP A 1 120 ? 5.410   -9.953  -3.351  1.00 0.00 ? 120 ASP A CB   2  
ATOM 3951  C CG   . ASP A 1 120 ? 5.483   -11.413 -3.802  1.00 0.00 ? 120 ASP A CG   2  
ATOM 3952  O OD1  . ASP A 1 120 ? 6.518   -12.047 -3.506  1.00 0.00 ? 120 ASP A OD1  2  
ATOM 3953  O OD2  . ASP A 1 120 ? 4.501   -11.862 -4.431  1.00 0.00 ? 120 ASP A OD2  2  
ATOM 3954  H H    . ASP A 1 120 ? 3.488   -9.274  -1.884  1.00 0.00 ? 120 ASP A H    2  
ATOM 3955  H HA   . ASP A 1 120 ? 5.639   -10.687 -1.322  1.00 0.00 ? 120 ASP A HA   2  
ATOM 3956  H HB2  . ASP A 1 120 ? 4.468   -9.528  -3.698  1.00 0.00 ? 120 ASP A HB2  2  
ATOM 3957  H HB3  . ASP A 1 120 ? 6.210   -9.397  -3.841  1.00 0.00 ? 120 ASP A HB3  2  
ATOM 3958  N N    . GLU A 1 121 ? 6.669   -7.671  -2.312  1.00 0.00 ? 121 GLU A N    2  
ATOM 3959  C CA   . GLU A 1 121 ? 7.713   -6.670  -2.173  1.00 0.00 ? 121 GLU A CA   2  
ATOM 3960  C C    . GLU A 1 121 ? 7.978   -6.382  -0.694  1.00 0.00 ? 121 GLU A C    2  
ATOM 3961  O O    . GLU A 1 121 ? 9.129   -6.333  -0.264  1.00 0.00 ? 121 GLU A O    2  
ATOM 3962  C CB   . GLU A 1 121 ? 7.348   -5.388  -2.925  1.00 0.00 ? 121 GLU A CB   2  
ATOM 3963  C CG   . GLU A 1 121 ? 7.189   -5.658  -4.422  1.00 0.00 ? 121 GLU A CG   2  
ATOM 3964  C CD   . GLU A 1 121 ? 8.541   -5.598  -5.136  1.00 0.00 ? 121 GLU A CD   2  
ATOM 3965  O OE1  . GLU A 1 121 ? 9.430   -6.379  -4.733  1.00 0.00 ? 121 GLU A OE1  2  
ATOM 3966  O OE2  . GLU A 1 121 ? 8.654   -4.774  -6.069  1.00 0.00 ? 121 GLU A OE2  2  
ATOM 3967  H H    . GLU A 1 121 ? 5.964   -7.455  -2.987  1.00 0.00 ? 121 GLU A H    2  
ATOM 3968  H HA   . GLU A 1 121 ? 8.600   -7.111  -2.628  1.00 0.00 ? 121 GLU A HA   2  
ATOM 3969  H HB2  . GLU A 1 121 ? 6.420   -4.980  -2.525  1.00 0.00 ? 121 GLU A HB2  2  
ATOM 3970  H HB3  . GLU A 1 121 ? 8.121   -4.637  -2.766  1.00 0.00 ? 121 GLU A HB3  2  
ATOM 3971  H HG2  . GLU A 1 121 ? 6.737   -6.638  -4.573  1.00 0.00 ? 121 GLU A HG2  2  
ATOM 3972  H HG3  . GLU A 1 121 ? 6.511   -4.923  -4.858  1.00 0.00 ? 121 GLU A HG3  2  
ATOM 3973  N N    . LEU A 1 122 ? 6.893   -6.197  0.044   1.00 0.00 ? 122 LEU A N    2  
ATOM 3974  C CA   . LEU A 1 122 ? 6.993   -5.915  1.466   1.00 0.00 ? 122 LEU A CA   2  
ATOM 3975  C C    . LEU A 1 122 ? 7.813   -7.015  2.143   1.00 0.00 ? 122 LEU A C    2  
ATOM 3976  O O    . LEU A 1 122 ? 8.787   -6.730  2.838   1.00 0.00 ? 122 LEU A O    2  
ATOM 3977  C CB   . LEU A 1 122 ? 5.603   -5.722  2.073   1.00 0.00 ? 122 LEU A CB   2  
ATOM 3978  C CG   . LEU A 1 122 ? 5.500   -4.689  3.198   1.00 0.00 ? 122 LEU A CG   2  
ATOM 3979  C CD1  . LEU A 1 122 ? 4.038   -4.380  3.526   1.00 0.00 ? 122 LEU A CD1  2  
ATOM 3980  C CD2  . LEU A 1 122 ? 6.281   -5.144  4.433   1.00 0.00 ? 122 LEU A CD2  2  
ATOM 3981  H H    . LEU A 1 122 ? 5.960   -6.238  -0.314  1.00 0.00 ? 122 LEU A H    2  
ATOM 3982  H HA   . LEU A 1 122 ? 7.527   -4.970  1.574   1.00 0.00 ? 122 LEU A HA   2  
ATOM 3983  H HB2  . LEU A 1 122 ? 4.917   -5.432  1.277   1.00 0.00 ? 122 LEU A HB2  2  
ATOM 3984  H HB3  . LEU A 1 122 ? 5.259   -6.682  2.456   1.00 0.00 ? 122 LEU A HB3  2  
ATOM 3985  H HG   . LEU A 1 122 ? 5.955   -3.761  2.852   1.00 0.00 ? 122 LEU A HG   2  
ATOM 3986  H HD11 . LEU A 1 122 ? 3.408   -5.206  3.195   1.00 0.00 ? 122 LEU A HD11 2  
ATOM 3987  H HD12 . LEU A 1 122 ? 3.927   -4.248  4.602   1.00 0.00 ? 122 LEU A HD12 2  
ATOM 3988  H HD13 . LEU A 1 122 ? 3.736   -3.466  3.015   1.00 0.00 ? 122 LEU A HD13 2  
ATOM 3989  H HD21 . LEU A 1 122 ? 7.091   -5.805  4.127   1.00 0.00 ? 122 LEU A HD21 2  
ATOM 3990  H HD22 . LEU A 1 122 ? 6.694   -4.273  4.942   1.00 0.00 ? 122 LEU A HD22 2  
ATOM 3991  H HD23 . LEU A 1 122 ? 5.612   -5.677  5.109   1.00 0.00 ? 122 LEU A HD23 2  
ATOM 3992  N N    . LYS A 1 123 ? 7.388   -8.250  1.916   1.00 0.00 ? 123 LYS A N    2  
ATOM 3993  C CA   . LYS A 1 123 ? 8.071   -9.394  2.496   1.00 0.00 ? 123 LYS A CA   2  
ATOM 3994  C C    . LYS A 1 123 ? 9.536   -9.386  2.054   1.00 0.00 ? 123 LYS A C    2  
ATOM 3995  O O    . LYS A 1 123 ? 10.439  -9.480  2.884   1.00 0.00 ? 123 LYS A O    2  
ATOM 3996  C CB   . LYS A 1 123 ? 7.331   -10.689 2.153   1.00 0.00 ? 123 LYS A CB   2  
ATOM 3997  C CG   . LYS A 1 123 ? 7.503   -11.729 3.262   1.00 0.00 ? 123 LYS A CG   2  
ATOM 3998  C CD   . LYS A 1 123 ? 6.161   -12.364 3.631   1.00 0.00 ? 123 LYS A CD   2  
ATOM 3999  C CE   . LYS A 1 123 ? 5.945   -13.671 2.866   1.00 0.00 ? 123 LYS A CE   2  
ATOM 4000  N NZ   . LYS A 1 123 ? 7.009   -14.646 3.195   1.00 0.00 ? 123 LYS A NZ   2  
ATOM 4001  H H    . LYS A 1 123 ? 6.595   -8.473  1.350   1.00 0.00 ? 123 LYS A H    2  
ATOM 4002  H HA   . LYS A 1 123 ? 8.036   -9.280  3.580   1.00 0.00 ? 123 LYS A HA   2  
ATOM 4003  H HB2  . LYS A 1 123 ? 6.272   -10.480 2.007   1.00 0.00 ? 123 LYS A HB2  2  
ATOM 4004  H HB3  . LYS A 1 123 ? 7.709   -11.089 1.212   1.00 0.00 ? 123 LYS A HB3  2  
ATOM 4005  H HG2  . LYS A 1 123 ? 8.199   -12.502 2.936   1.00 0.00 ? 123 LYS A HG2  2  
ATOM 4006  H HG3  . LYS A 1 123 ? 7.941   -11.258 4.142   1.00 0.00 ? 123 LYS A HG3  2  
ATOM 4007  H HD2  . LYS A 1 123 ? 6.128   -12.556 4.703   1.00 0.00 ? 123 LYS A HD2  2  
ATOM 4008  H HD3  . LYS A 1 123 ? 5.352   -11.669 3.407   1.00 0.00 ? 123 LYS A HD3  2  
ATOM 4009  H HE2  . LYS A 1 123 ? 4.970   -14.089 3.116   1.00 0.00 ? 123 LYS A HE2  2  
ATOM 4010  H HE3  . LYS A 1 123 ? 5.942   -13.476 1.794   1.00 0.00 ? 123 LYS A HE3  2  
ATOM 4011  H HZ1  . LYS A 1 123 ? 7.638   -14.728 2.421   1.00 0.00 ? 123 LYS A HZ1  2  
ATOM 4012  H HZ2  . LYS A 1 123 ? 7.511   -14.333 4.001   1.00 0.00 ? 123 LYS A HZ2  2  
ATOM 4013  H HZ3  . LYS A 1 123 ? 6.597   -15.538 3.385   1.00 0.00 ? 123 LYS A HZ3  2  
ATOM 4014  N N    . PHE A 1 124 ? 9.726   -9.274  0.748   1.00 0.00 ? 124 PHE A N    2  
ATOM 4015  C CA   . PHE A 1 124 ? 11.065  -9.253  0.185   1.00 0.00 ? 124 PHE A CA   2  
ATOM 4016  C C    . PHE A 1 124 ? 11.968  -8.286  0.955   1.00 0.00 ? 124 PHE A C    2  
ATOM 4017  O O    . PHE A 1 124 ? 12.985  -8.693  1.514   1.00 0.00 ? 124 PHE A O    2  
ATOM 4018  C CB   . PHE A 1 124 ? 10.936  -8.770  -1.261  1.00 0.00 ? 124 PHE A CB   2  
ATOM 4019  C CG   . PHE A 1 124 ? 12.276  -8.565  -1.970  1.00 0.00 ? 124 PHE A CG   2  
ATOM 4020  C CD1  . PHE A 1 124 ? 12.942  -7.386  -1.837  1.00 0.00 ? 124 PHE A CD1  2  
ATOM 4021  C CD2  . PHE A 1 124 ? 12.801  -9.560  -2.734  1.00 0.00 ? 124 PHE A CD2  2  
ATOM 4022  C CE1  . PHE A 1 124 ? 14.186  -7.196  -2.496  1.00 0.00 ? 124 PHE A CE1  2  
ATOM 4023  C CE2  . PHE A 1 124 ? 14.044  -9.369  -3.392  1.00 0.00 ? 124 PHE A CE2  2  
ATOM 4024  C CZ   . PHE A 1 124 ? 14.710  -8.191  -3.259  1.00 0.00 ? 124 PHE A CZ   2  
ATOM 4025  H H    . PHE A 1 124 ? 8.986   -9.198  0.079   1.00 0.00 ? 124 PHE A H    2  
ATOM 4026  H HA   . PHE A 1 124 ? 11.466  -10.264 0.266   1.00 0.00 ? 124 PHE A HA   2  
ATOM 4027  H HB2  . PHE A 1 124 ? 10.346  -9.494  -1.823  1.00 0.00 ? 124 PHE A HB2  2  
ATOM 4028  H HB3  . PHE A 1 124 ? 10.383  -7.831  -1.271  1.00 0.00 ? 124 PHE A HB3  2  
ATOM 4029  H HD1  . PHE A 1 124 ? 12.521  -6.589  -1.225  1.00 0.00 ? 124 PHE A HD1  2  
ATOM 4030  H HD2  . PHE A 1 124 ? 12.267  -10.504 -2.840  1.00 0.00 ? 124 PHE A HD2  2  
ATOM 4031  H HE1  . PHE A 1 124 ? 14.719  -6.251  -2.389  1.00 0.00 ? 124 PHE A HE1  2  
ATOM 4032  H HE2  . PHE A 1 124 ? 14.465  -10.167 -4.004  1.00 0.00 ? 124 PHE A HE2  2  
ATOM 4033  H HZ   . PHE A 1 124 ? 15.665  -8.044  -3.765  1.00 0.00 ? 124 PHE A HZ   2  
ATOM 4034  N N    . VAL A 1 125 ? 11.563  -7.025  0.958   1.00 0.00 ? 125 VAL A N    2  
ATOM 4035  C CA   . VAL A 1 125 ? 12.322  -5.997  1.649   1.00 0.00 ? 125 VAL A CA   2  
ATOM 4036  C C    . VAL A 1 125 ? 12.350  -6.309  3.147   1.00 0.00 ? 125 VAL A C    2  
ATOM 4037  O O    . VAL A 1 125 ? 13.321  -5.995  3.832   1.00 0.00 ? 125 VAL A O    2  
ATOM 4038  C CB   . VAL A 1 125 ? 11.740  -4.617  1.337   1.00 0.00 ? 125 VAL A CB   2  
ATOM 4039  C CG1  . VAL A 1 125 ? 10.694  -4.215  2.379   1.00 0.00 ? 125 VAL A CG1  2  
ATOM 4040  C CG2  . VAL A 1 125 ? 12.846  -3.565  1.236   1.00 0.00 ? 125 VAL A CG2  2  
ATOM 4041  H H    . VAL A 1 125 ? 10.734  -6.702  0.500   1.00 0.00 ? 125 VAL A H    2  
ATOM 4042  H HA   . VAL A 1 125 ? 13.342  -6.028  1.266   1.00 0.00 ? 125 VAL A HA   2  
ATOM 4043  H HB   . VAL A 1 125 ? 11.243  -4.674  0.368   1.00 0.00 ? 125 VAL A HB   2  
ATOM 4044  H HG11 . VAL A 1 125 ? 11.134  -4.271  3.375   1.00 0.00 ? 125 VAL A HG11 2  
ATOM 4045  H HG12 . VAL A 1 125 ? 10.362  -3.195  2.185   1.00 0.00 ? 125 VAL A HG12 2  
ATOM 4046  H HG13 . VAL A 1 125 ? 9.843   -4.892  2.319   1.00 0.00 ? 125 VAL A HG13 2  
ATOM 4047  H HG21 . VAL A 1 125 ? 13.591  -3.745  2.012   1.00 0.00 ? 125 VAL A HG21 2  
ATOM 4048  H HG22 . VAL A 1 125 ? 13.320  -3.630  0.256   1.00 0.00 ? 125 VAL A HG22 2  
ATOM 4049  H HG23 . VAL A 1 125 ? 12.417  -2.572  1.367   1.00 0.00 ? 125 VAL A HG23 2  
ATOM 4050  N N    . ALA A 1 126 ? 11.272  -6.925  3.610   1.00 0.00 ? 126 ALA A N    2  
ATOM 4051  C CA   . ALA A 1 126 ? 11.160  -7.283  5.013   1.00 0.00 ? 126 ALA A CA   2  
ATOM 4052  C C    . ALA A 1 126 ? 12.233  -8.317  5.359   1.00 0.00 ? 126 ALA A C    2  
ATOM 4053  O O    . ALA A 1 126 ? 12.967  -8.154  6.332   1.00 0.00 ? 126 ALA A O    2  
ATOM 4054  C CB   . ALA A 1 126 ? 9.746   -7.794  5.299   1.00 0.00 ? 126 ALA A CB   2  
ATOM 4055  H H    . ALA A 1 126 ? 10.486  -7.178  3.045   1.00 0.00 ? 126 ALA A H    2  
ATOM 4056  H HA   . ALA A 1 126 ? 11.333  -6.382  5.601   1.00 0.00 ? 126 ALA A HA   2  
ATOM 4057  H HB1  . ALA A 1 126 ? 9.638   -7.986  6.367   1.00 0.00 ? 126 ALA A HB1  2  
ATOM 4058  H HB2  . ALA A 1 126 ? 9.019   -7.043  4.989   1.00 0.00 ? 126 ALA A HB2  2  
ATOM 4059  H HB3  . ALA A 1 126 ? 9.574   -8.716  4.745   1.00 0.00 ? 126 ALA A HB3  2  
ATOM 4060  N N    . SER A 1 127 ? 12.291  -9.359  4.541   1.00 0.00 ? 127 SER A N    2  
ATOM 4061  C CA   . SER A 1 127 ? 13.263  -10.419 4.748   1.00 0.00 ? 127 SER A CA   2  
ATOM 4062  C C    . SER A 1 127 ? 14.674  -9.898  4.465   1.00 0.00 ? 127 SER A C    2  
ATOM 4063  O O    . SER A 1 127 ? 15.559  -10.000 5.314   1.00 0.00 ? 127 SER A O    2  
ATOM 4064  C CB   . SER A 1 127 ? 12.956  -11.628 3.861   1.00 0.00 ? 127 SER A CB   2  
ATOM 4065  O OG   . SER A 1 127 ? 13.250  -12.858 4.517   1.00 0.00 ? 127 SER A OG   2  
ATOM 4066  H H    . SER A 1 127 ? 11.691  -9.484  3.751   1.00 0.00 ? 127 SER A H    2  
ATOM 4067  H HA   . SER A 1 127 ? 13.163  -10.702 5.795   1.00 0.00 ? 127 SER A HA   2  
ATOM 4068  H HB2  . SER A 1 127 ? 11.904  -11.611 3.577   1.00 0.00 ? 127 SER A HB2  2  
ATOM 4069  H HB3  . SER A 1 127 ? 13.536  -11.559 2.941   1.00 0.00 ? 127 SER A HB3  2  
ATOM 4070  H HG   . SER A 1 127 ? 12.716  -12.934 5.358   1.00 0.00 ? 127 SER A HG   2  
ATOM 4071  N N    . GLN A 1 128 ? 14.840  -9.351  3.270   1.00 0.00 ? 128 GLN A N    2  
ATOM 4072  C CA   . GLN A 1 128 ? 16.128  -8.814  2.865   1.00 0.00 ? 128 GLN A CA   2  
ATOM 4073  C C    . GLN A 1 128 ? 16.802  -8.108  4.043   1.00 0.00 ? 128 GLN A C    2  
ATOM 4074  O O    . GLN A 1 128 ? 17.982  -8.331  4.312   1.00 0.00 ? 128 GLN A O    2  
ATOM 4075  C CB   . GLN A 1 128 ? 15.977  -7.869  1.672   1.00 0.00 ? 128 GLN A CB   2  
ATOM 4076  C CG   . GLN A 1 128 ? 16.448  -8.538  0.379   1.00 0.00 ? 128 GLN A CG   2  
ATOM 4077  C CD   . GLN A 1 128 ? 17.972  -8.482  0.256   1.00 0.00 ? 128 GLN A CD   2  
ATOM 4078  O OE1  . GLN A 1 128 ? 18.682  -9.417  0.587   1.00 0.00 ? 128 GLN A OE1  2  
ATOM 4079  N NE2  . GLN A 1 128 ? 18.433  -7.336  -0.238  1.00 0.00 ? 128 GLN A NE2  2  
ATOM 4080  H H    . GLN A 1 128 ? 14.115  -9.272  2.586   1.00 0.00 ? 128 GLN A H    2  
ATOM 4081  H HA   . GLN A 1 128 ? 16.720  -9.678  2.563   1.00 0.00 ? 128 GLN A HA   2  
ATOM 4082  H HB2  . GLN A 1 128 ? 14.934  -7.568  1.571   1.00 0.00 ? 128 GLN A HB2  2  
ATOM 4083  H HB3  . GLN A 1 128 ? 16.555  -6.961  1.847   1.00 0.00 ? 128 GLN A HB3  2  
ATOM 4084  H HG2  . GLN A 1 128 ? 16.116  -9.576  0.361   1.00 0.00 ? 128 GLN A HG2  2  
ATOM 4085  H HG3  . GLN A 1 128 ? 15.992  -8.043  -0.478  1.00 0.00 ? 128 GLN A HG3  2  
ATOM 4086  H HE21 . GLN A 1 128 ? 17.796  -6.608  -0.490  1.00 0.00 ? 128 GLN A HE21 2  
ATOM 4087  H HE22 . GLN A 1 128 ? 19.417  -7.203  -0.356  1.00 0.00 ? 128 GLN A HE22 2  
ATOM 4088  N N    . PHE A 1 129 ? 16.025  -7.270  4.713   1.00 0.00 ? 129 PHE A N    2  
ATOM 4089  C CA   . PHE A 1 129 ? 16.532  -6.529  5.855   1.00 0.00 ? 129 PHE A CA   2  
ATOM 4090  C C    . PHE A 1 129 ? 16.688  -7.441  7.074   1.00 0.00 ? 129 PHE A C    2  
ATOM 4091  O O    . PHE A 1 129 ? 17.777  -7.551  7.636   1.00 0.00 ? 129 PHE A O    2  
ATOM 4092  C CB   . PHE A 1 129 ? 15.506  -5.441  6.175   1.00 0.00 ? 129 PHE A CB   2  
ATOM 4093  C CG   . PHE A 1 129 ? 16.120  -4.066  6.446   1.00 0.00 ? 129 PHE A CG   2  
ATOM 4094  C CD1  . PHE A 1 129 ? 16.722  -3.380  5.438   1.00 0.00 ? 129 PHE A CD1  2  
ATOM 4095  C CD2  . PHE A 1 129 ? 16.063  -3.531  7.695   1.00 0.00 ? 129 PHE A CD2  2  
ATOM 4096  C CE1  . PHE A 1 129 ? 17.292  -2.104  5.690   1.00 0.00 ? 129 PHE A CE1  2  
ATOM 4097  C CE2  . PHE A 1 129 ? 16.633  -2.255  7.946   1.00 0.00 ? 129 PHE A CE2  2  
ATOM 4098  C CZ   . PHE A 1 129 ? 17.236  -1.568  6.939   1.00 0.00 ? 129 PHE A CZ   2  
ATOM 4099  H H    . PHE A 1 129 ? 15.067  -7.094  4.487   1.00 0.00 ? 129 PHE A H    2  
ATOM 4100  H HA   . PHE A 1 129 ? 17.507  -6.131  5.575   1.00 0.00 ? 129 PHE A HA   2  
ATOM 4101  H HB2  . PHE A 1 129 ? 14.808  -5.358  5.342   1.00 0.00 ? 129 PHE A HB2  2  
ATOM 4102  H HB3  . PHE A 1 129 ? 14.926  -5.747  7.046   1.00 0.00 ? 129 PHE A HB3  2  
ATOM 4103  H HD1  . PHE A 1 129 ? 16.768  -3.810  4.437   1.00 0.00 ? 129 PHE A HD1  2  
ATOM 4104  H HD2  . PHE A 1 129 ? 15.580  -4.081  8.502   1.00 0.00 ? 129 PHE A HD2  2  
ATOM 4105  H HE1  . PHE A 1 129 ? 17.775  -1.554  4.882   1.00 0.00 ? 129 PHE A HE1  2  
ATOM 4106  H HE2  . PHE A 1 129 ? 16.588  -1.825  8.947   1.00 0.00 ? 129 PHE A HE2  2  
ATOM 4107  H HZ   . PHE A 1 129 ? 17.673  -0.589  7.132   1.00 0.00 ? 129 PHE A HZ   2  
ATOM 4108  N N    . ARG A 1 130 ? 15.584  -8.071  7.447   1.00 0.00 ? 130 ARG A N    2  
ATOM 4109  C CA   . ARG A 1 130 ? 15.584  -8.969  8.589   1.00 0.00 ? 130 ARG A CA   2  
ATOM 4110  C C    . ARG A 1 130 ? 16.348  -8.342  9.758   1.00 0.00 ? 130 ARG A C    2  
ATOM 4111  O O    . ARG A 1 130 ? 17.554  -8.541  9.894   1.00 0.00 ? 130 ARG A O    2  
ATOM 4112  C CB   . ARG A 1 130 ? 16.224  -10.313 8.233   1.00 0.00 ? 130 ARG A CB   2  
ATOM 4113  C CG   . ARG A 1 130 ? 15.162  -11.404 8.089   1.00 0.00 ? 130 ARG A CG   2  
ATOM 4114  C CD   . ARG A 1 130 ? 15.648  -12.725 8.690   1.00 0.00 ? 130 ARG A CD   2  
ATOM 4115  N NE   . ARG A 1 130 ? 14.583  -13.324 9.525   1.00 0.00 ? 130 ARG A NE   2  
ATOM 4116  C CZ   . ARG A 1 130 ? 14.755  -14.402 10.302  1.00 0.00 ? 130 ARG A CZ   2  
ATOM 4117  N NH1  . ARG A 1 130 ? 15.950  -15.005 10.356  1.00 0.00 ? 130 ARG A NH1  2  
ATOM 4118  N NH2  . ARG A 1 130 ? 13.732  -14.876 11.026  1.00 0.00 ? 130 ARG A NH2  2  
ATOM 4119  H H    . ARG A 1 130 ? 14.702  -7.975  6.985   1.00 0.00 ? 130 ARG A H    2  
ATOM 4120  H HA   . ARG A 1 130 ? 14.531  -9.106  8.837   1.00 0.00 ? 130 ARG A HA   2  
ATOM 4121  H HB2  . ARG A 1 130 ? 16.782  -10.218 7.302   1.00 0.00 ? 130 ARG A HB2  2  
ATOM 4122  H HB3  . ARG A 1 130 ? 16.939  -10.595 9.006   1.00 0.00 ? 130 ARG A HB3  2  
ATOM 4123  H HG2  . ARG A 1 130 ? 14.244  -11.091 8.586   1.00 0.00 ? 130 ARG A HG2  2  
ATOM 4124  H HG3  . ARG A 1 130 ? 14.922  -11.547 7.035   1.00 0.00 ? 130 ARG A HG3  2  
ATOM 4125  H HD2  . ARG A 1 130 ? 15.929  -13.415 7.893   1.00 0.00 ? 130 ARG A HD2  2  
ATOM 4126  H HD3  . ARG A 1 130 ? 16.541  -12.553 9.291   1.00 0.00 ? 130 ARG A HD3  2  
ATOM 4127  H HE   . ARG A 1 130 ? 13.679  -12.898 9.507   1.00 0.00 ? 130 ARG A HE   2  
ATOM 4128  H HH11 . ARG A 1 130 ? 16.714  -14.652 9.816   1.00 0.00 ? 130 ARG A HH11 2  
ATOM 4129  H HH12 . ARG A 1 130 ? 16.078  -15.810 10.936  1.00 0.00 ? 130 ARG A HH12 2  
ATOM 4130  H HH21 . ARG A 1 130 ? 12.840  -14.425 10.985  1.00 0.00 ? 130 ARG A HH21 2  
ATOM 4131  H HH22 . ARG A 1 130 ? 13.860  -15.680 11.606  1.00 0.00 ? 130 ARG A HH22 2  
ATOM 4132  N N    . ARG A 1 131 ? 15.614  -7.598  10.571  1.00 0.00 ? 131 ARG A N    2  
ATOM 4133  C CA   . ARG A 1 131 ? 16.207  -6.941  11.724  1.00 0.00 ? 131 ARG A CA   2  
ATOM 4134  C C    . ARG A 1 131 ? 15.128  -6.598  12.753  1.00 0.00 ? 131 ARG A C    2  
ATOM 4135  O O    . ARG A 1 131 ? 14.095  -6.025  12.407  1.00 0.00 ? 131 ARG A O    2  
ATOM 4136  C CB   . ARG A 1 131 ? 16.935  -5.659  11.312  1.00 0.00 ? 131 ARG A CB   2  
ATOM 4137  C CG   . ARG A 1 131 ? 18.452  -5.862  11.329  1.00 0.00 ? 131 ARG A CG   2  
ATOM 4138  C CD   . ARG A 1 131 ? 19.149  -4.719  12.070  1.00 0.00 ? 131 ARG A CD   2  
ATOM 4139  N NE   . ARG A 1 131 ? 20.582  -4.677  11.702  1.00 0.00 ? 131 ARG A NE   2  
ATOM 4140  C CZ   . ARG A 1 131 ? 21.503  -5.530  12.170  1.00 0.00 ? 131 ARG A CZ   2  
ATOM 4141  N NH1  . ARG A 1 131 ? 21.147  -6.497  13.026  1.00 0.00 ? 131 ARG A NH1  2  
ATOM 4142  N NH2  . ARG A 1 131 ? 22.780  -5.417  11.781  1.00 0.00 ? 131 ARG A NH2  2  
ATOM 4143  H H    . ARG A 1 131 ? 14.633  -7.441  10.454  1.00 0.00 ? 131 ARG A H    2  
ATOM 4144  H HA   . ARG A 1 131 ? 16.915  -7.666  12.124  1.00 0.00 ? 131 ARG A HA   2  
ATOM 4145  H HB2  . ARG A 1 131 ? 16.616  -5.359  10.314  1.00 0.00 ? 131 ARG A HB2  2  
ATOM 4146  H HB3  . ARG A 1 131 ? 16.665  -4.850  11.990  1.00 0.00 ? 131 ARG A HB3  2  
ATOM 4147  H HG2  . ARG A 1 131 ? 18.690  -6.811  11.809  1.00 0.00 ? 131 ARG A HG2  2  
ATOM 4148  H HG3  . ARG A 1 131 ? 18.826  -5.919  10.307  1.00 0.00 ? 131 ARG A HG3  2  
ATOM 4149  H HD2  . ARG A 1 131 ? 18.673  -3.770  11.823  1.00 0.00 ? 131 ARG A HD2  2  
ATOM 4150  H HD3  . ARG A 1 131 ? 19.046  -4.857  13.147  1.00 0.00 ? 131 ARG A HD3  2  
ATOM 4151  H HE   . ARG A 1 131 ? 20.881  -3.967  11.065  1.00 0.00 ? 131 ARG A HE   2  
ATOM 4152  H HH11 . ARG A 1 131 ? 20.194  -6.582  13.317  1.00 0.00 ? 131 ARG A HH11 2  
ATOM 4153  H HH12 . ARG A 1 131 ? 21.835  -7.134  13.375  1.00 0.00 ? 131 ARG A HH12 2  
ATOM 4154  H HH21 . ARG A 1 131 ? 23.046  -4.695  11.141  1.00 0.00 ? 131 ARG A HH21 2  
ATOM 4155  H HH22 . ARG A 1 131 ? 23.468  -6.053  12.130  1.00 0.00 ? 131 ARG A HH22 2  
ATOM 4156  N N    . SER A 1 132 ? 15.404  -6.962  13.996  1.00 0.00 ? 132 SER A N    2  
ATOM 4157  C CA   . SER A 1 132 ? 14.469  -6.700  15.078  1.00 0.00 ? 132 SER A CA   2  
ATOM 4158  C C    . SER A 1 132 ? 15.120  -7.031  16.423  1.00 0.00 ? 132 SER A C    2  
ATOM 4159  O O    . SER A 1 132 ? 16.039  -7.845  16.488  1.00 0.00 ? 132 SER A O    2  
ATOM 4160  C CB   . SER A 1 132 ? 13.181  -7.505  14.899  1.00 0.00 ? 132 SER A CB   2  
ATOM 4161  O OG   . SER A 1 132 ? 13.372  -8.889  15.182  1.00 0.00 ? 132 SER A OG   2  
ATOM 4162  H H    . SER A 1 132 ? 16.246  -7.427  14.269  1.00 0.00 ? 132 SER A H    2  
ATOM 4163  H HA   . SER A 1 132 ? 14.244  -5.636  15.013  1.00 0.00 ? 132 SER A HA   2  
ATOM 4164  H HB2  . SER A 1 132 ? 12.409  -7.104  15.556  1.00 0.00 ? 132 SER A HB2  2  
ATOM 4165  H HB3  . SER A 1 132 ? 12.820  -7.390  13.877  1.00 0.00 ? 132 SER A HB3  2  
ATOM 4166  H HG   . SER A 1 132 ? 12.836  -9.151  15.985  1.00 0.00 ? 132 SER A HG   2  
ATOM 4167  N N    . GLY A 1 133 ? 14.617  -6.382  17.462  1.00 0.00 ? 133 GLY A N    2  
ATOM 4168  C CA   . GLY A 1 133 ? 15.137  -6.597  18.802  1.00 0.00 ? 133 GLY A CA   2  
ATOM 4169  C C    . GLY A 1 133 ? 14.646  -7.928  19.374  1.00 0.00 ? 133 GLY A C    2  
ATOM 4170  O O    . GLY A 1 133 ? 13.912  -8.660  18.711  1.00 0.00 ? 133 GLY A O    2  
ATOM 4171  H H    . GLY A 1 133 ? 13.869  -5.721  17.401  1.00 0.00 ? 133 GLY A H    2  
ATOM 4172  H HA2  . GLY A 1 133 ? 16.227  -6.587  18.778  1.00 0.00 ? 133 GLY A HA2  2  
ATOM 4173  H HA3  . GLY A 1 133 ? 14.825  -5.780  19.453  1.00 0.00 ? 133 GLY A HA3  2  
ATOM 4174  N N    . PRO A 1 134 ? 15.082  -8.210  20.631  1.00 0.00 ? 134 PRO A N    2  
ATOM 4175  C CA   . PRO A 1 134 ? 14.695  -9.440  21.299  1.00 0.00 ? 134 PRO A CA   2  
ATOM 4176  C C    . PRO A 1 134 ? 13.245  -9.370  21.781  1.00 0.00 ? 134 PRO A C    2  
ATOM 4177  O O    . PRO A 1 134 ? 12.987  -9.053  22.941  1.00 0.00 ? 134 PRO A O    2  
ATOM 4178  C CB   . PRO A 1 134 ? 15.691  -9.601  22.436  1.00 0.00 ? 134 PRO A CB   2  
ATOM 4179  C CG   . PRO A 1 134 ? 16.306  -8.227  22.648  1.00 0.00 ? 134 PRO A CG   2  
ATOM 4180  C CD   . PRO A 1 134 ? 15.952  -7.367  21.446  1.00 0.00 ? 134 PRO A CD   2  
ATOM 4181  H HA   . PRO A 1 134 ? 14.734  -10.209 20.661  1.00 0.00 ? 134 PRO A HA   2  
ATOM 4182  H HB2  . PRO A 1 134 ? 15.197  -9.951  23.342  1.00 0.00 ? 134 PRO A HB2  2  
ATOM 4183  H HB3  . PRO A 1 134 ? 16.455  -10.336 22.185  1.00 0.00 ? 134 PRO A HB3  2  
ATOM 4184  H HG2  . PRO A 1 134 ? 15.927  -7.776  23.565  1.00 0.00 ? 134 PRO A HG2  2  
ATOM 4185  H HG3  . PRO A 1 134 ? 17.388  -8.306  22.756  1.00 0.00 ? 134 PRO A HG3  2  
ATOM 4186  H HD2  . PRO A 1 134 ? 15.445  -6.451  21.750  1.00 0.00 ? 134 PRO A HD2  2  
ATOM 4187  H HD3  . PRO A 1 134 ? 16.844  -7.069  20.895  1.00 0.00 ? 134 PRO A HD3  2  
ATOM 4188  N N    . SER A 1 135 ? 12.335  -9.670  20.865  1.00 0.00 ? 135 SER A N    2  
ATOM 4189  C CA   . SER A 1 135 ? 10.917  -9.644  21.182  1.00 0.00 ? 135 SER A CA   2  
ATOM 4190  C C    . SER A 1 135 ? 10.160  -10.612 20.270  1.00 0.00 ? 135 SER A C    2  
ATOM 4191  O O    . SER A 1 135 ? 9.496   -11.530 20.749  1.00 0.00 ? 135 SER A O    2  
ATOM 4192  C CB   . SER A 1 135 ? 10.348  -8.231  21.046  1.00 0.00 ? 135 SER A CB   2  
ATOM 4193  O OG   . SER A 1 135 ? 9.588   -7.849  22.190  1.00 0.00 ? 135 SER A OG   2  
ATOM 4194  H H    . SER A 1 135 ? 12.553  -9.926  19.924  1.00 0.00 ? 135 SER A H    2  
ATOM 4195  H HA   . SER A 1 135 ? 10.848  -9.965  22.222  1.00 0.00 ? 135 SER A HA   2  
ATOM 4196  H HB2  . SER A 1 135 ? 11.165  -7.523  20.901  1.00 0.00 ? 135 SER A HB2  2  
ATOM 4197  H HB3  . SER A 1 135 ? 9.718   -8.177  20.158  1.00 0.00 ? 135 SER A HB3  2  
ATOM 4198  H HG   . SER A 1 135 ? 8.961   -8.584  22.445  1.00 0.00 ? 135 SER A HG   2  
ATOM 4199  N N    . SER A 1 136 ? 10.285  -10.373 18.973  1.00 0.00 ? 136 SER A N    2  
ATOM 4200  C CA   . SER A 1 136 ? 9.621   -11.211 17.990  1.00 0.00 ? 136 SER A CA   2  
ATOM 4201  C C    . SER A 1 136 ? 10.324  -12.567 17.898  1.00 0.00 ? 136 SER A C    2  
ATOM 4202  O O    . SER A 1 136 ? 9.708   -13.606 18.128  1.00 0.00 ? 136 SER A O    2  
ATOM 4203  C CB   . SER A 1 136 ? 9.591   -10.534 16.618  1.00 0.00 ? 136 SER A CB   2  
ATOM 4204  O OG   . SER A 1 136 ? 8.532   -11.027 15.802  1.00 0.00 ? 136 SER A OG   2  
ATOM 4205  H H    . SER A 1 136 ? 10.827  -9.624  18.592  1.00 0.00 ? 136 SER A H    2  
ATOM 4206  H HA   . SER A 1 136 ? 8.601   -11.333 18.356  1.00 0.00 ? 136 SER A HA   2  
ATOM 4207  H HB2  . SER A 1 136 ? 9.478   -9.458  16.748  1.00 0.00 ? 136 SER A HB2  2  
ATOM 4208  H HB3  . SER A 1 136 ? 10.544  -10.696 16.114  1.00 0.00 ? 136 SER A HB3  2  
ATOM 4209  H HG   . SER A 1 136 ? 8.206   -10.305 15.192  1.00 0.00 ? 136 SER A HG   2  
ATOM 4210  N N    . GLY A 1 137 ? 11.604  -12.512 17.561  1.00 0.00 ? 137 GLY A N    2  
ATOM 4211  C CA   . GLY A 1 137 ? 12.397  -13.723 17.435  1.00 0.00 ? 137 GLY A CA   2  
ATOM 4212  C C    . GLY A 1 137 ? 12.552  -14.420 18.789  1.00 0.00 ? 137 GLY A C    2  
ATOM 4213  O O    . GLY A 1 137 ? 11.719  -14.250 19.677  1.00 0.00 ? 137 GLY A O    2  
ATOM 4214  H H    . GLY A 1 137 ? 12.097  -11.662 17.375  1.00 0.00 ? 137 GLY A H    2  
ATOM 4215  H HA2  . GLY A 1 137 ? 11.923  -14.401 16.726  1.00 0.00 ? 137 GLY A HA2  2  
ATOM 4216  H HA3  . GLY A 1 137 ? 13.381  -13.478 17.034  1.00 0.00 ? 137 GLY A HA3  2  
ATOM 4217  N N    . GLY A 1 1   ? 8.354   11.897  -9.793  1.00 0.00 ? 1   GLY A N    3  
ATOM 4218  C CA   . GLY A 1 1   ? 7.187   12.130  -10.627 1.00 0.00 ? 1   GLY A CA   3  
ATOM 4219  C C    . GLY A 1 1   ? 5.972   12.509  -9.777  1.00 0.00 ? 1   GLY A C    3  
ATOM 4220  O O    . GLY A 1 1   ? 5.438   13.609  -9.907  1.00 0.00 ? 1   GLY A O    3  
ATOM 4221  H H1   . GLY A 1 1   ? 8.194   11.982  -8.809  1.00 0.00 ? 1   GLY A H1   3  
ATOM 4222  H HA2  . GLY A 1 1   ? 7.399   12.927  -11.340 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 4223  H HA3  . GLY A 1 1   ? 6.965   11.234  -11.206 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 4224  N N    . SER A 1 2   ? 5.572   11.576  -8.925  1.00 0.00 ? 2   SER A N    3  
ATOM 4225  C CA   . SER A 1 2   ? 4.430   11.798  -8.054  1.00 0.00 ? 2   SER A CA   3  
ATOM 4226  C C    . SER A 1 2   ? 4.618   11.037  -6.741  1.00 0.00 ? 2   SER A C    3  
ATOM 4227  O O    . SER A 1 2   ? 4.350   9.839   -6.669  1.00 0.00 ? 2   SER A O    3  
ATOM 4228  C CB   . SER A 1 2   ? 3.128   11.370  -8.734  1.00 0.00 ? 2   SER A CB   3  
ATOM 4229  O OG   . SER A 1 2   ? 2.435   12.477  -9.304  1.00 0.00 ? 2   SER A OG   3  
ATOM 4230  H H    . SER A 1 2   ? 6.012   10.684  -8.826  1.00 0.00 ? 2   SER A H    3  
ATOM 4231  H HA   . SER A 1 2   ? 4.409   12.873  -7.874  1.00 0.00 ? 2   SER A HA   3  
ATOM 4232  H HB2  . SER A 1 2   ? 3.348   10.640  -9.513  1.00 0.00 ? 2   SER A HB2  3  
ATOM 4233  H HB3  . SER A 1 2   ? 2.485   10.876  -8.006  1.00 0.00 ? 2   SER A HB3  3  
ATOM 4234  H HG   . SER A 1 2   ? 2.619   13.305  -8.775  1.00 0.00 ? 2   SER A HG   3  
ATOM 4235  N N    . SER A 1 3   ? 5.078   11.764  -5.733  1.00 0.00 ? 3   SER A N    3  
ATOM 4236  C CA   . SER A 1 3   ? 5.305   11.173  -4.426  1.00 0.00 ? 3   SER A CA   3  
ATOM 4237  C C    . SER A 1 3   ? 4.532   11.949  -3.358  1.00 0.00 ? 3   SER A C    3  
ATOM 4238  O O    . SER A 1 3   ? 4.203   13.119  -3.552  1.00 0.00 ? 3   SER A O    3  
ATOM 4239  C CB   . SER A 1 3   ? 6.797   11.145  -4.085  1.00 0.00 ? 3   SER A CB   3  
ATOM 4240  O OG   . SER A 1 3   ? 7.022   10.990  -2.687  1.00 0.00 ? 3   SER A OG   3  
ATOM 4241  H H    . SER A 1 3   ? 5.294   12.738  -5.799  1.00 0.00 ? 3   SER A H    3  
ATOM 4242  H HA   . SER A 1 3   ? 4.932   10.152  -4.502  1.00 0.00 ? 3   SER A HA   3  
ATOM 4243  H HB2  . SER A 1 3   ? 7.276   10.326  -4.622  1.00 0.00 ? 3   SER A HB2  3  
ATOM 4244  H HB3  . SER A 1 3   ? 7.264   12.067  -4.428  1.00 0.00 ? 3   SER A HB3  3  
ATOM 4245  H HG   . SER A 1 3   ? 7.268   10.043  -2.482  1.00 0.00 ? 3   SER A HG   3  
ATOM 4246  N N    . GLY A 1 4   ? 4.263   11.268  -2.254  1.00 0.00 ? 4   GLY A N    3  
ATOM 4247  C CA   . GLY A 1 4   ? 3.535   11.879  -1.156  1.00 0.00 ? 4   GLY A CA   3  
ATOM 4248  C C    . GLY A 1 4   ? 4.476   12.677  -0.250  1.00 0.00 ? 4   GLY A C    3  
ATOM 4249  O O    . GLY A 1 4   ? 5.132   13.614  -0.703  1.00 0.00 ? 4   GLY A O    3  
ATOM 4250  H H    . GLY A 1 4   ? 4.534   10.317  -2.104  1.00 0.00 ? 4   GLY A H    3  
ATOM 4251  H HA2  . GLY A 1 4   ? 2.760   12.536  -1.550  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 4252  H HA3  . GLY A 1 4   ? 3.032   11.107  -0.574  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 4253  N N    . SER A 1 5   ? 4.511   12.276  1.012   1.00 0.00 ? 5   SER A N    3  
ATOM 4254  C CA   . SER A 1 5   ? 5.361   12.942  1.985   1.00 0.00 ? 5   SER A CA   3  
ATOM 4255  C C    . SER A 1 5   ? 5.761   11.960  3.088   1.00 0.00 ? 5   SER A C    3  
ATOM 4256  O O    . SER A 1 5   ? 6.938   11.637  3.239   1.00 0.00 ? 5   SER A O    3  
ATOM 4257  C CB   . SER A 1 5   ? 4.658   14.160  2.587   1.00 0.00 ? 5   SER A CB   3  
ATOM 4258  O OG   . SER A 1 5   ? 5.480   15.323  2.548   1.00 0.00 ? 5   SER A OG   3  
ATOM 4259  H H    . SER A 1 5   ? 3.974   11.513  1.372   1.00 0.00 ? 5   SER A H    3  
ATOM 4260  H HA   . SER A 1 5   ? 6.238   13.268  1.426   1.00 0.00 ? 5   SER A HA   3  
ATOM 4261  H HB2  . SER A 1 5   ? 3.733   14.351  2.043   1.00 0.00 ? 5   SER A HB2  3  
ATOM 4262  H HB3  . SER A 1 5   ? 4.382   13.945  3.619   1.00 0.00 ? 5   SER A HB3  3  
ATOM 4263  H HG   . SER A 1 5   ? 5.673   15.574  1.600   1.00 0.00 ? 5   SER A HG   3  
ATOM 4264  N N    . SER A 1 6   ? 4.759   11.514  3.832   1.00 0.00 ? 6   SER A N    3  
ATOM 4265  C CA   . SER A 1 6   ? 4.992   10.576  4.917   1.00 0.00 ? 6   SER A CA   3  
ATOM 4266  C C    . SER A 1 6   ? 3.759   10.505  5.820   1.00 0.00 ? 6   SER A C    3  
ATOM 4267  O O    . SER A 1 6   ? 3.215   11.535  6.216   1.00 0.00 ? 6   SER A O    3  
ATOM 4268  C CB   . SER A 1 6   ? 6.225   10.972  5.732   1.00 0.00 ? 6   SER A CB   3  
ATOM 4269  O OG   . SER A 1 6   ? 7.359   10.173  5.406   1.00 0.00 ? 6   SER A OG   3  
ATOM 4270  H H    . SER A 1 6   ? 3.804   11.782  3.702   1.00 0.00 ? 6   SER A H    3  
ATOM 4271  H HA   . SER A 1 6   ? 5.169   9.615   4.434   1.00 0.00 ? 6   SER A HA   3  
ATOM 4272  H HB2  . SER A 1 6   ? 6.457   12.022  5.551   1.00 0.00 ? 6   SER A HB2  3  
ATOM 4273  H HB3  . SER A 1 6   ? 6.004   10.873  6.794   1.00 0.00 ? 6   SER A HB3  3  
ATOM 4274  H HG   . SER A 1 6   ? 8.198   10.638  5.690   1.00 0.00 ? 6   SER A HG   3  
ATOM 4275  N N    . GLY A 1 7   ? 3.355   9.279   6.120   1.00 0.00 ? 7   GLY A N    3  
ATOM 4276  C CA   . GLY A 1 7   ? 2.197   9.060   6.969   1.00 0.00 ? 7   GLY A CA   3  
ATOM 4277  C C    . GLY A 1 7   ? 2.577   8.265   8.220   1.00 0.00 ? 7   GLY A C    3  
ATOM 4278  O O    . GLY A 1 7   ? 1.707   7.744   8.917   1.00 0.00 ? 7   GLY A O    3  
ATOM 4279  H H    . GLY A 1 7   ? 3.803   8.447   5.794   1.00 0.00 ? 7   GLY A H    3  
ATOM 4280  H HA2  . GLY A 1 7   ? 1.767   10.019  7.260   1.00 0.00 ? 7   GLY A HA2  3  
ATOM 4281  H HA3  . GLY A 1 7   ? 1.429   8.523   6.412   1.00 0.00 ? 7   GLY A HA3  3  
ATOM 4282  N N    . VAL A 1 8   ? 3.876   8.198   8.467   1.00 0.00 ? 8   VAL A N    3  
ATOM 4283  C CA   . VAL A 1 8   ? 4.382   7.475   9.622   1.00 0.00 ? 8   VAL A CA   3  
ATOM 4284  C C    . VAL A 1 8   ? 4.412   8.412   10.831  1.00 0.00 ? 8   VAL A C    3  
ATOM 4285  O O    . VAL A 1 8   ? 5.472   8.660   11.403  1.00 0.00 ? 8   VAL A O    3  
ATOM 4286  C CB   . VAL A 1 8   ? 5.750   6.868   9.302   1.00 0.00 ? 8   VAL A CB   3  
ATOM 4287  C CG1  . VAL A 1 8   ? 6.284   6.065   10.489  1.00 0.00 ? 8   VAL A CG1  3  
ATOM 4288  C CG2  . VAL A 1 8   ? 5.685   6.006   8.040   1.00 0.00 ? 8   VAL A CG2  3  
ATOM 4289  H H    . VAL A 1 8   ? 4.577   8.624   7.896   1.00 0.00 ? 8   VAL A H    3  
ATOM 4290  H HA   . VAL A 1 8   ? 3.690   6.658   9.828   1.00 0.00 ? 8   VAL A HA   3  
ATOM 4291  H HB   . VAL A 1 8   ? 6.443   7.687   9.112   1.00 0.00 ? 8   VAL A HB   3  
ATOM 4292  H HG11 . VAL A 1 8   ? 5.714   6.315   11.384  1.00 0.00 ? 8   VAL A HG11 3  
ATOM 4293  H HG12 . VAL A 1 8   ? 6.185   5.000   10.281  1.00 0.00 ? 8   VAL A HG12 3  
ATOM 4294  H HG13 . VAL A 1 8   ? 7.335   6.308   10.649  1.00 0.00 ? 8   VAL A HG13 3  
ATOM 4295  H HG21 . VAL A 1 8   ? 5.532   4.963   8.320   1.00 0.00 ? 8   VAL A HG21 3  
ATOM 4296  H HG22 . VAL A 1 8   ? 4.857   6.339   7.414   1.00 0.00 ? 8   VAL A HG22 3  
ATOM 4297  H HG23 . VAL A 1 8   ? 6.620   6.100   7.487   1.00 0.00 ? 8   VAL A HG23 3  
ATOM 4298  N N    . ARG A 1 9   ? 3.235   8.907   11.185  1.00 0.00 ? 9   ARG A N    3  
ATOM 4299  C CA   . ARG A 1 9   ? 3.113   9.811   12.316  1.00 0.00 ? 9   ARG A CA   3  
ATOM 4300  C C    . ARG A 1 9   ? 3.156   9.027   13.629  1.00 0.00 ? 9   ARG A C    3  
ATOM 4301  O O    . ARG A 1 9   ? 2.115   8.682   14.186  1.00 0.00 ? 9   ARG A O    3  
ATOM 4302  C CB   . ARG A 1 9   ? 1.807   10.605  12.248  1.00 0.00 ? 9   ARG A CB   3  
ATOM 4303  C CG   . ARG A 1 9   ? 2.077   12.079  11.939  1.00 0.00 ? 9   ARG A CG   3  
ATOM 4304  C CD   . ARG A 1 9   ? 1.280   12.538  10.716  1.00 0.00 ? 9   ARG A CD   3  
ATOM 4305  N NE   . ARG A 1 9   ? 0.980   13.984  10.821  1.00 0.00 ? 9   ARG A NE   3  
ATOM 4306  C CZ   . ARG A 1 9   ? 1.903   14.951  10.732  1.00 0.00 ? 9   ARG A CZ   3  
ATOM 4307  N NH1  . ARG A 1 9   ? 3.190   14.633  10.536  1.00 0.00 ? 9   ARG A NH1  3  
ATOM 4308  N NH2  . ARG A 1 9   ? 1.539   16.236  10.839  1.00 0.00 ? 9   ARG A NH2  3  
ATOM 4309  H H    . ARG A 1 9   ? 2.377   8.700   10.715  1.00 0.00 ? 9   ARG A H    3  
ATOM 4310  H HA   . ARG A 1 9   ? 3.968   10.481  12.231  1.00 0.00 ? 9   ARG A HA   3  
ATOM 4311  H HB2  . ARG A 1 9   ? 1.159   10.182  11.480  1.00 0.00 ? 9   ARG A HB2  3  
ATOM 4312  H HB3  . ARG A 1 9   ? 1.275   10.520  13.195  1.00 0.00 ? 9   ARG A HB3  3  
ATOM 4313  H HG2  . ARG A 1 9   ? 1.811   12.690  12.801  1.00 0.00 ? 9   ARG A HG2  3  
ATOM 4314  H HG3  . ARG A 1 9   ? 3.142   12.227  11.760  1.00 0.00 ? 9   ARG A HG3  3  
ATOM 4315  H HD2  . ARG A 1 9   ? 1.848   12.342  9.807   1.00 0.00 ? 9   ARG A HD2  3  
ATOM 4316  H HD3  . ARG A 1 9   ? 0.353   11.970  10.642  1.00 0.00 ? 9   ARG A HD3  3  
ATOM 4317  H HE   . ARG A 1 9   ? 0.029   14.256  10.968  1.00 0.00 ? 9   ARG A HE   3  
ATOM 4318  H HH11 . ARG A 1 9   ? 3.461   13.674  10.456  1.00 0.00 ? 9   ARG A HH11 3  
ATOM 4319  H HH12 . ARG A 1 9   ? 3.879   15.355  10.469  1.00 0.00 ? 9   ARG A HH12 3  
ATOM 4320  H HH21 . ARG A 1 9   ? 0.579   16.474  10.986  1.00 0.00 ? 9   ARG A HH21 3  
ATOM 4321  H HH22 . ARG A 1 9   ? 2.228   16.958  10.773  1.00 0.00 ? 9   ARG A HH22 3  
ATOM 4322  N N    . ARG A 1 10  ? 4.373   8.768   14.087  1.00 0.00 ? 10  ARG A N    3  
ATOM 4323  C CA   . ARG A 1 10  ? 4.566   8.032   15.324  1.00 0.00 ? 10  ARG A CA   3  
ATOM 4324  C C    . ARG A 1 10  ? 3.780   6.719   15.289  1.00 0.00 ? 10  ARG A C    3  
ATOM 4325  O O    . ARG A 1 10  ? 3.216   6.302   16.299  1.00 0.00 ? 10  ARG A O    3  
ATOM 4326  C CB   . ARG A 1 10  ? 4.114   8.855   16.532  1.00 0.00 ? 10  ARG A CB   3  
ATOM 4327  C CG   . ARG A 1 10  ? 5.317   9.366   17.328  1.00 0.00 ? 10  ARG A CG   3  
ATOM 4328  C CD   . ARG A 1 10  ? 6.029   8.217   18.044  1.00 0.00 ? 10  ARG A CD   3  
ATOM 4329  N NE   . ARG A 1 10  ? 7.213   8.728   18.770  1.00 0.00 ? 10  ARG A NE   3  
ATOM 4330  C CZ   . ARG A 1 10  ? 7.149   9.464   19.889  1.00 0.00 ? 10  ARG A CZ   3  
ATOM 4331  N NH1  . ARG A 1 10  ? 5.958   9.778   20.416  1.00 0.00 ? 10  ARG A NH1  3  
ATOM 4332  N NH2  . ARG A 1 10  ? 8.275   9.885   20.479  1.00 0.00 ? 10  ARG A NH2  3  
ATOM 4333  H H    . ARG A 1 10  ? 5.215   9.052   13.628  1.00 0.00 ? 10  ARG A H    3  
ATOM 4334  H HA   . ARG A 1 10  ? 5.639   7.846   15.373  1.00 0.00 ? 10  ARG A HA   3  
ATOM 4335  H HB2  . ARG A 1 10  ? 3.511   9.699   16.196  1.00 0.00 ? 10  ARG A HB2  3  
ATOM 4336  H HB3  . ARG A 1 10  ? 3.480   8.246   17.176  1.00 0.00 ? 10  ARG A HB3  3  
ATOM 4337  H HG2  . ARG A 1 10  ? 6.015   9.869   16.657  1.00 0.00 ? 10  ARG A HG2  3  
ATOM 4338  H HG3  . ARG A 1 10  ? 4.988   10.106  18.057  1.00 0.00 ? 10  ARG A HG3  3  
ATOM 4339  H HD2  . ARG A 1 10  ? 5.345   7.734   18.742  1.00 0.00 ? 10  ARG A HD2  3  
ATOM 4340  H HD3  . ARG A 1 10  ? 6.334   7.460   17.322  1.00 0.00 ? 10  ARG A HD3  3  
ATOM 4341  H HE   . ARG A 1 10  ? 8.117   8.512   18.403  1.00 0.00 ? 10  ARG A HE   3  
ATOM 4342  H HH11 . ARG A 1 10  ? 5.117   9.464   19.976  1.00 0.00 ? 10  ARG A HH11 3  
ATOM 4343  H HH12 . ARG A 1 10  ? 5.910   10.326  21.251  1.00 0.00 ? 10  ARG A HH12 3  
ATOM 4344  H HH21 . ARG A 1 10  ? 9.164   9.650   20.085  1.00 0.00 ? 10  ARG A HH21 3  
ATOM 4345  H HH22 . ARG A 1 10  ? 8.227   10.433  21.314  1.00 0.00 ? 10  ARG A HH22 3  
ATOM 4346  N N    . VAL A 1 11  ? 3.770   6.105   14.115  1.00 0.00 ? 11  VAL A N    3  
ATOM 4347  C CA   . VAL A 1 11  ? 3.063   4.848   13.934  1.00 0.00 ? 11  VAL A CA   3  
ATOM 4348  C C    . VAL A 1 11  ? 3.833   3.729   14.638  1.00 0.00 ? 11  VAL A C    3  
ATOM 4349  O O    . VAL A 1 11  ? 5.062   3.691   14.590  1.00 0.00 ? 11  VAL A O    3  
ATOM 4350  C CB   . VAL A 1 11  ? 2.846   4.579   12.444  1.00 0.00 ? 11  VAL A CB   3  
ATOM 4351  C CG1  . VAL A 1 11  ? 2.903   3.080   12.143  1.00 0.00 ? 11  VAL A CG1  3  
ATOM 4352  C CG2  . VAL A 1 11  ? 1.525   5.185   11.964  1.00 0.00 ? 11  VAL A CG2  3  
ATOM 4353  H H    . VAL A 1 11  ? 4.231   6.451   13.298  1.00 0.00 ? 11  VAL A H    3  
ATOM 4354  H HA   . VAL A 1 11  ? 2.085   4.950   14.405  1.00 0.00 ? 11  VAL A HA   3  
ATOM 4355  H HB   . VAL A 1 11  ? 3.655   5.062   11.895  1.00 0.00 ? 11  VAL A HB   3  
ATOM 4356  H HG11 . VAL A 1 11  ? 2.844   2.923   11.066  1.00 0.00 ? 11  VAL A HG11 3  
ATOM 4357  H HG12 . VAL A 1 11  ? 3.840   2.669   12.520  1.00 0.00 ? 11  VAL A HG12 3  
ATOM 4358  H HG13 . VAL A 1 11  ? 2.066   2.580   12.629  1.00 0.00 ? 11  VAL A HG13 3  
ATOM 4359  H HG21 . VAL A 1 11  ? 1.573   6.271   12.044  1.00 0.00 ? 11  VAL A HG21 3  
ATOM 4360  H HG22 . VAL A 1 11  ? 1.354   4.904   10.925  1.00 0.00 ? 11  VAL A HG22 3  
ATOM 4361  H HG23 . VAL A 1 11  ? 0.708   4.810   12.581  1.00 0.00 ? 11  VAL A HG23 3  
ATOM 4362  N N    . PRO A 1 12  ? 3.059   2.821   15.291  1.00 0.00 ? 12  PRO A N    3  
ATOM 4363  C CA   . PRO A 1 12  ? 3.656   1.704   16.003  1.00 0.00 ? 12  PRO A CA   3  
ATOM 4364  C C    . PRO A 1 12  ? 4.150   0.633   15.029  1.00 0.00 ? 12  PRO A C    3  
ATOM 4365  O O    . PRO A 1 12  ? 5.143   -0.043  15.294  1.00 0.00 ? 12  PRO A O    3  
ATOM 4366  C CB   . PRO A 1 12  ? 2.564   1.202   16.933  1.00 0.00 ? 12  PRO A CB   3  
ATOM 4367  C CG   . PRO A 1 12  ? 1.259   1.752   16.379  1.00 0.00 ? 12  PRO A CG   3  
ATOM 4368  C CD   . PRO A 1 12  ? 1.602   2.834   15.368  1.00 0.00 ? 12  PRO A CD   3  
ATOM 4369  H HA   . PRO A 1 12  ? 4.464   2.007   16.509  1.00 0.00 ? 12  PRO A HA   3  
ATOM 4370  H HB2  . PRO A 1 12  ? 2.547   0.113   16.964  1.00 0.00 ? 12  PRO A HB2  3  
ATOM 4371  H HB3  . PRO A 1 12  ? 2.731   1.547   17.954  1.00 0.00 ? 12  PRO A HB3  3  
ATOM 4372  H HG2  . PRO A 1 12  ? 0.680   0.958   15.907  1.00 0.00 ? 12  PRO A HG2  3  
ATOM 4373  H HG3  . PRO A 1 12  ? 0.645   2.160   17.182  1.00 0.00 ? 12  PRO A HG3  3  
ATOM 4374  H HD2  . PRO A 1 12  ? 1.152   2.626   14.398  1.00 0.00 ? 12  PRO A HD2  3  
ATOM 4375  H HD3  . PRO A 1 12  ? 1.231   3.807   15.689  1.00 0.00 ? 12  PRO A HD3  3  
ATOM 4376  N N    . LEU A 1 13  ? 3.434   0.512   13.920  1.00 0.00 ? 13  LEU A N    3  
ATOM 4377  C CA   . LEU A 1 13  ? 3.788   -0.465  12.905  1.00 0.00 ? 13  LEU A CA   3  
ATOM 4378  C C    . LEU A 1 13  ? 5.306   -0.471  12.714  1.00 0.00 ? 13  LEU A C    3  
ATOM 4379  O O    . LEU A 1 13  ? 5.966   -1.470  12.994  1.00 0.00 ? 13  LEU A O    3  
ATOM 4380  C CB   . LEU A 1 13  ? 3.007   -0.204  11.615  1.00 0.00 ? 13  LEU A CB   3  
ATOM 4381  C CG   . LEU A 1 13  ? 1.491   -0.392  11.698  1.00 0.00 ? 13  LEU A CG   3  
ATOM 4382  C CD1  . LEU A 1 13  ? 0.761   0.666   10.870  1.00 0.00 ? 13  LEU A CD1  3  
ATOM 4383  C CD2  . LEU A 1 13  ? 1.092   -1.813  11.294  1.00 0.00 ? 13  LEU A CD2  3  
ATOM 4384  H H    . LEU A 1 13  ? 2.628   1.065   13.712  1.00 0.00 ? 13  LEU A H    3  
ATOM 4385  H HA   . LEU A 1 13  ? 3.482   -1.445  13.273  1.00 0.00 ? 13  LEU A HA   3  
ATOM 4386  H HB2  . LEU A 1 13  ? 3.209   0.818   11.292  1.00 0.00 ? 13  LEU A HB2  3  
ATOM 4387  H HB3  . LEU A 1 13  ? 3.394   -0.865  10.839  1.00 0.00 ? 13  LEU A HB3  3  
ATOM 4388  H HG   . LEU A 1 13  ? 1.186   -0.256  12.736  1.00 0.00 ? 13  LEU A HG   3  
ATOM 4389  H HD11 . LEU A 1 13  ? 0.276   1.379   11.537  1.00 0.00 ? 13  LEU A HD11 3  
ATOM 4390  H HD12 . LEU A 1 13  ? 1.477   1.190   10.237  1.00 0.00 ? 13  LEU A HD12 3  
ATOM 4391  H HD13 . LEU A 1 13  ? 0.008   0.183   10.246  1.00 0.00 ? 13  LEU A HD13 3  
ATOM 4392  H HD21 . LEU A 1 13  ? 0.633   -1.794  10.305  1.00 0.00 ? 13  LEU A HD21 3  
ATOM 4393  H HD22 . LEU A 1 13  ? 1.979   -2.446  11.270  1.00 0.00 ? 13  LEU A HD22 3  
ATOM 4394  H HD23 . LEU A 1 13  ? 0.381   -2.211  12.017  1.00 0.00 ? 13  LEU A HD23 3  
ATOM 4395  N N    . PHE A 1 14  ? 5.815   0.657   12.240  1.00 0.00 ? 14  PHE A N    3  
ATOM 4396  C CA   . PHE A 1 14  ? 7.243   0.795   12.010  1.00 0.00 ? 14  PHE A CA   3  
ATOM 4397  C C    . PHE A 1 14  ? 7.991   1.028   13.324  1.00 0.00 ? 14  PHE A C    3  
ATOM 4398  O O    . PHE A 1 14  ? 8.666   2.043   13.487  1.00 0.00 ? 14  PHE A O    3  
ATOM 4399  C CB   . PHE A 1 14  ? 7.434   2.014   11.105  1.00 0.00 ? 14  PHE A CB   3  
ATOM 4400  C CG   . PHE A 1 14  ? 6.411   2.114   9.971   1.00 0.00 ? 14  PHE A CG   3  
ATOM 4401  C CD1  . PHE A 1 14  ? 6.639   1.476   8.792   1.00 0.00 ? 14  PHE A CD1  3  
ATOM 4402  C CD2  . PHE A 1 14  ? 5.275   2.841   10.143  1.00 0.00 ? 14  PHE A CD2  3  
ATOM 4403  C CE1  . PHE A 1 14  ? 5.690   1.569   7.740   1.00 0.00 ? 14  PHE A CE1  3  
ATOM 4404  C CE2  . PHE A 1 14  ? 4.326   2.934   9.091   1.00 0.00 ? 14  PHE A CE2  3  
ATOM 4405  C CZ   . PHE A 1 14  ? 4.553   2.296   7.911   1.00 0.00 ? 14  PHE A CZ   3  
ATOM 4406  H H    . PHE A 1 14  ? 5.270   1.465   12.016  1.00 0.00 ? 14  PHE A H    3  
ATOM 4407  H HA   . PHE A 1 14  ? 7.588   -0.134  11.557  1.00 0.00 ? 14  PHE A HA   3  
ATOM 4408  H HB2  . PHE A 1 14  ? 7.377   2.917   11.712  1.00 0.00 ? 14  PHE A HB2  3  
ATOM 4409  H HB3  . PHE A 1 14  ? 8.435   1.981   10.675  1.00 0.00 ? 14  PHE A HB3  3  
ATOM 4410  H HD1  . PHE A 1 14  ? 7.550   0.893   8.654   1.00 0.00 ? 14  PHE A HD1  3  
ATOM 4411  H HD2  . PHE A 1 14  ? 5.093   3.352   11.088  1.00 0.00 ? 14  PHE A HD2  3  
ATOM 4412  H HE1  . PHE A 1 14  ? 5.872   1.058   6.795   1.00 0.00 ? 14  PHE A HE1  3  
ATOM 4413  H HE2  . PHE A 1 14  ? 3.415   3.517   9.228   1.00 0.00 ? 14  PHE A HE2  3  
ATOM 4414  H HZ   . PHE A 1 14  ? 3.825   2.367   7.104   1.00 0.00 ? 14  PHE A HZ   3  
ATOM 4415  N N    . GLU A 1 15  ? 7.845   0.070   14.228  1.00 0.00 ? 15  GLU A N    3  
ATOM 4416  C CA   . GLU A 1 15  ? 8.499   0.158   15.523  1.00 0.00 ? 15  GLU A CA   3  
ATOM 4417  C C    . GLU A 1 15  ? 9.978   -0.210  15.397  1.00 0.00 ? 15  GLU A C    3  
ATOM 4418  O O    . GLU A 1 15  ? 10.848  0.542   15.834  1.00 0.00 ? 15  GLU A O    3  
ATOM 4419  C CB   . GLU A 1 15  ? 7.798   -0.731  16.552  1.00 0.00 ? 15  GLU A CB   3  
ATOM 4420  C CG   . GLU A 1 15  ? 6.851   0.088   17.431  1.00 0.00 ? 15  GLU A CG   3  
ATOM 4421  C CD   . GLU A 1 15  ? 7.397   0.215   18.855  1.00 0.00 ? 15  GLU A CD   3  
ATOM 4422  O OE1  . GLU A 1 15  ? 8.230   1.123   19.065  1.00 0.00 ? 15  GLU A OE1  3  
ATOM 4423  O OE2  . GLU A 1 15  ? 6.969   -0.600  19.701  1.00 0.00 ? 15  GLU A OE2  3  
ATOM 4424  H H    . GLU A 1 15  ? 7.295   -0.753  14.088  1.00 0.00 ? 15  GLU A H    3  
ATOM 4425  H HA   . GLU A 1 15  ? 8.401   1.200   15.826  1.00 0.00 ? 15  GLU A HA   3  
ATOM 4426  H HB2  . GLU A 1 15  ? 7.239   -1.514  16.040  1.00 0.00 ? 15  GLU A HB2  3  
ATOM 4427  H HB3  . GLU A 1 15  ? 8.542   -1.227  17.176  1.00 0.00 ? 15  GLU A HB3  3  
ATOM 4428  H HG2  . GLU A 1 15  ? 6.717   1.080   17.000  1.00 0.00 ? 15  GLU A HG2  3  
ATOM 4429  H HG3  . GLU A 1 15  ? 5.870   -0.385  17.455  1.00 0.00 ? 15  GLU A HG3  3  
ATOM 4430  N N    . ASN A 1 16  ? 10.219  -1.367  14.798  1.00 0.00 ? 16  ASN A N    3  
ATOM 4431  C CA   . ASN A 1 16  ? 11.578  -1.844  14.609  1.00 0.00 ? 16  ASN A CA   3  
ATOM 4432  C C    . ASN A 1 16  ? 12.007  -1.588  13.162  1.00 0.00 ? 16  ASN A C    3  
ATOM 4433  O O    . ASN A 1 16  ? 13.192  -1.663  12.840  1.00 0.00 ? 16  ASN A O    3  
ATOM 4434  C CB   . ASN A 1 16  ? 11.676  -3.348  14.872  1.00 0.00 ? 16  ASN A CB   3  
ATOM 4435  C CG   . ASN A 1 16  ? 10.688  -4.123  13.998  1.00 0.00 ? 16  ASN A CG   3  
ATOM 4436  O OD1  . ASN A 1 16  ? 9.481   -4.027  14.145  1.00 0.00 ? 16  ASN A OD1  3  
ATOM 4437  N ND2  . ASN A 1 16  ? 11.267  -4.895  13.083  1.00 0.00 ? 16  ASN A ND2  3  
ATOM 4438  H H    . ASN A 1 16  ? 9.505   -1.973  14.445  1.00 0.00 ? 16  ASN A H    3  
ATOM 4439  H HA   . ASN A 1 16  ? 12.180  -1.287  15.327  1.00 0.00 ? 16  ASN A HA   3  
ATOM 4440  H HB2  . ASN A 1 16  ? 12.691  -3.690  14.672  1.00 0.00 ? 16  ASN A HB2  3  
ATOM 4441  H HB3  . ASN A 1 16  ? 11.473  -3.550  15.924  1.00 0.00 ? 16  ASN A HB3  3  
ATOM 4442  H HD21 . ASN A 1 16  ? 12.264  -4.929  13.015  1.00 0.00 ? 16  ASN A HD21 3  
ATOM 4443  H HD22 . ASN A 1 16  ? 10.705  -5.442  12.462  1.00 0.00 ? 16  ASN A HD22 3  
ATOM 4444  N N    . MET A 1 17  ? 11.020  -1.292  12.330  1.00 0.00 ? 17  MET A N    3  
ATOM 4445  C CA   . MET A 1 17  ? 11.281  -1.025  10.925  1.00 0.00 ? 17  MET A CA   3  
ATOM 4446  C C    . MET A 1 17  ? 12.158  0.217   10.757  1.00 0.00 ? 17  MET A C    3  
ATOM 4447  O O    . MET A 1 17  ? 11.729  1.330   11.059  1.00 0.00 ? 17  MET A O    3  
ATOM 4448  C CB   . MET A 1 17  ? 9.955   -0.818  10.190  1.00 0.00 ? 17  MET A CB   3  
ATOM 4449  C CG   . MET A 1 17  ? 9.128   -2.105  10.177  1.00 0.00 ? 17  MET A CG   3  
ATOM 4450  S SD   . MET A 1 17  ? 7.492   -1.773  9.547   1.00 0.00 ? 17  MET A SD   3  
ATOM 4451  C CE   . MET A 1 17  ? 7.872   -1.500  7.824   1.00 0.00 ? 17  MET A CE   3  
ATOM 4452  H H    . MET A 1 17  ? 10.059  -1.233  12.600  1.00 0.00 ? 17  MET A H    3  
ATOM 4453  H HA   . MET A 1 17  ? 11.808  -1.904  10.553  1.00 0.00 ? 17  MET A HA   3  
ATOM 4454  H HB2  . MET A 1 17  ? 9.388   -0.022  10.674  1.00 0.00 ? 17  MET A HB2  3  
ATOM 4455  H HB3  . MET A 1 17  ? 10.149  -0.495  9.167   1.00 0.00 ? 17  MET A HB3  3  
ATOM 4456  H HG2  . MET A 1 17  ? 9.619   -2.856  9.558   1.00 0.00 ? 17  MET A HG2  3  
ATOM 4457  H HG3  . MET A 1 17  ? 9.063   -2.515  11.185  1.00 0.00 ? 17  MET A HG3  3  
ATOM 4458  H HE1  . MET A 1 17  ? 8.926   -1.242  7.721   1.00 0.00 ? 17  MET A HE1  3  
ATOM 4459  H HE2  . MET A 1 17  ? 7.663   -2.407  7.258   1.00 0.00 ? 17  MET A HE2  3  
ATOM 4460  H HE3  . MET A 1 17  ? 7.259   -0.684  7.442   1.00 0.00 ? 17  MET A HE3  3  
ATOM 4461  N N    . ASP A 1 18  ? 13.370  -0.015  10.275  1.00 0.00 ? 18  ASP A N    3  
ATOM 4462  C CA   . ASP A 1 18  ? 14.312  1.072   10.063  1.00 0.00 ? 18  ASP A CA   3  
ATOM 4463  C C    . ASP A 1 18  ? 13.881  1.881   8.838   1.00 0.00 ? 18  ASP A C    3  
ATOM 4464  O O    . ASP A 1 18  ? 13.207  1.361   7.951   1.00 0.00 ? 18  ASP A O    3  
ATOM 4465  C CB   . ASP A 1 18  ? 15.721  0.536   9.804   1.00 0.00 ? 18  ASP A CB   3  
ATOM 4466  C CG   . ASP A 1 18  ? 16.542  0.242   11.062  1.00 0.00 ? 18  ASP A CG   3  
ATOM 4467  O OD1  . ASP A 1 18  ? 16.967  1.226   11.705  1.00 0.00 ? 18  ASP A OD1  3  
ATOM 4468  O OD2  . ASP A 1 18  ? 16.726  -0.960  11.351  1.00 0.00 ? 18  ASP A OD2  3  
ATOM 4469  H H    . ASP A 1 18  ? 13.711  -0.923  10.032  1.00 0.00 ? 18  ASP A H    3  
ATOM 4470  H HA   . ASP A 1 18  ? 14.284  1.658   10.981  1.00 0.00 ? 18  ASP A HA   3  
ATOM 4471  H HB2  . ASP A 1 18  ? 15.644  -0.378  9.217   1.00 0.00 ? 18  ASP A HB2  3  
ATOM 4472  H HB3  . ASP A 1 18  ? 16.263  1.261   9.196   1.00 0.00 ? 18  ASP A HB3  3  
ATOM 4473  N N    . GLU A 1 19  ? 14.289  3.142   8.829   1.00 0.00 ? 19  GLU A N    3  
ATOM 4474  C CA   . GLU A 1 19  ? 13.955  4.029   7.728   1.00 0.00 ? 19  GLU A CA   3  
ATOM 4475  C C    . GLU A 1 19  ? 14.233  3.342   6.389   1.00 0.00 ? 19  GLU A C    3  
ATOM 4476  O O    . GLU A 1 19  ? 13.384  3.341   5.499   1.00 0.00 ? 19  GLU A O    3  
ATOM 4477  C CB   . GLU A 1 19  ? 14.719  5.350   7.836   1.00 0.00 ? 19  GLU A CB   3  
ATOM 4478  C CG   . GLU A 1 19  ? 14.099  6.257   8.901   1.00 0.00 ? 19  GLU A CG   3  
ATOM 4479  C CD   . GLU A 1 19  ? 15.151  6.705   9.918   1.00 0.00 ? 19  GLU A CD   3  
ATOM 4480  O OE1  . GLU A 1 19  ? 16.306  6.912   9.487   1.00 0.00 ? 19  GLU A OE1  3  
ATOM 4481  O OE2  . GLU A 1 19  ? 14.775  6.832   11.103  1.00 0.00 ? 19  GLU A OE2  3  
ATOM 4482  H H    . GLU A 1 19  ? 14.838  3.558   9.555   1.00 0.00 ? 19  GLU A H    3  
ATOM 4483  H HA   . GLU A 1 19  ? 12.887  4.225   7.828   1.00 0.00 ? 19  GLU A HA   3  
ATOM 4484  H HB2  . GLU A 1 19  ? 15.762  5.151   8.084   1.00 0.00 ? 19  GLU A HB2  3  
ATOM 4485  H HB3  . GLU A 1 19  ? 14.712  5.858   6.871   1.00 0.00 ? 19  GLU A HB3  3  
ATOM 4486  H HG2  . GLU A 1 19  ? 13.653  7.130   8.425   1.00 0.00 ? 19  GLU A HG2  3  
ATOM 4487  H HG3  . GLU A 1 19  ? 13.296  5.726   9.412   1.00 0.00 ? 19  GLU A HG3  3  
ATOM 4488  N N    . ARG A 1 20  ? 15.426  2.773   6.289   1.00 0.00 ? 20  ARG A N    3  
ATOM 4489  C CA   . ARG A 1 20  ? 15.827  2.084   5.074   1.00 0.00 ? 20  ARG A CA   3  
ATOM 4490  C C    . ARG A 1 20  ? 14.690  1.193   4.570   1.00 0.00 ? 20  ARG A C    3  
ATOM 4491  O O    . ARG A 1 20  ? 14.486  1.064   3.364   1.00 0.00 ? 20  ARG A O    3  
ATOM 4492  C CB   . ARG A 1 20  ? 17.071  1.227   5.313   1.00 0.00 ? 20  ARG A CB   3  
ATOM 4493  C CG   . ARG A 1 20  ? 18.268  2.094   5.708   1.00 0.00 ? 20  ARG A CG   3  
ATOM 4494  C CD   . ARG A 1 20  ? 19.051  2.544   4.473   1.00 0.00 ? 20  ARG A CD   3  
ATOM 4495  N NE   . ARG A 1 20  ? 20.367  1.868   4.435   1.00 0.00 ? 20  ARG A NE   3  
ATOM 4496  C CZ   . ARG A 1 20  ? 21.342  2.171   3.567   1.00 0.00 ? 20  ARG A CZ   3  
ATOM 4497  N NH1  . ARG A 1 20  ? 21.155  3.141   2.661   1.00 0.00 ? 20  ARG A NH1  3  
ATOM 4498  N NH2  . ARG A 1 20  ? 22.504  1.505   3.606   1.00 0.00 ? 20  ARG A NH2  3  
ATOM 4499  H H    . ARG A 1 20  ? 16.110  2.778   7.018   1.00 0.00 ? 20  ARG A H    3  
ATOM 4500  H HA   . ARG A 1 20  ? 16.047  2.880   4.362   1.00 0.00 ? 20  ARG A HA   3  
ATOM 4501  H HB2  . ARG A 1 20  ? 16.870  0.498   6.099   1.00 0.00 ? 20  ARG A HB2  3  
ATOM 4502  H HB3  . ARG A 1 20  ? 17.308  0.664   4.410   1.00 0.00 ? 20  ARG A HB3  3  
ATOM 4503  H HG2  . ARG A 1 20  ? 17.921  2.967   6.261   1.00 0.00 ? 20  ARG A HG2  3  
ATOM 4504  H HG3  . ARG A 1 20  ? 18.923  1.534   6.375   1.00 0.00 ? 20  ARG A HG3  3  
ATOM 4505  H HD2  . ARG A 1 20  ? 18.487  2.311   3.570   1.00 0.00 ? 20  ARG A HD2  3  
ATOM 4506  H HD3  . ARG A 1 20  ? 19.188  3.625   4.493   1.00 0.00 ? 20  ARG A HD3  3  
ATOM 4507  H HE   . ARG A 1 20  ? 20.539  1.139   5.098   1.00 0.00 ? 20  ARG A HE   3  
ATOM 4508  H HH11 . ARG A 1 20  ? 20.288  3.638   2.632   1.00 0.00 ? 20  ARG A HH11 3  
ATOM 4509  H HH12 . ARG A 1 20  ? 21.883  3.367   2.014   1.00 0.00 ? 20  ARG A HH12 3  
ATOM 4510  H HH21 . ARG A 1 20  ? 22.644  0.782   4.282   1.00 0.00 ? 20  ARG A HH21 3  
ATOM 4511  H HH22 . ARG A 1 20  ? 23.232  1.731   2.959   1.00 0.00 ? 20  ARG A HH22 3  
ATOM 4512  N N    . LEU A 1 21  ? 13.980  0.600   5.519   1.00 0.00 ? 21  LEU A N    3  
ATOM 4513  C CA   . LEU A 1 21  ? 12.869  -0.275  5.186   1.00 0.00 ? 21  LEU A CA   3  
ATOM 4514  C C    . LEU A 1 21  ? 11.671  0.571   4.750   1.00 0.00 ? 21  LEU A C    3  
ATOM 4515  O O    . LEU A 1 21  ? 10.935  0.189   3.841   1.00 0.00 ? 21  LEU A O    3  
ATOM 4516  C CB   . LEU A 1 21  ? 12.564  -1.220  6.350   1.00 0.00 ? 21  LEU A CB   3  
ATOM 4517  C CG   . LEU A 1 21  ? 11.830  -2.513  5.990   1.00 0.00 ? 21  LEU A CG   3  
ATOM 4518  C CD1  . LEU A 1 21  ? 12.456  -3.175  4.760   1.00 0.00 ? 21  LEU A CD1  3  
ATOM 4519  C CD2  . LEU A 1 21  ? 11.775  -3.464  7.187   1.00 0.00 ? 21  LEU A CD2  3  
ATOM 4520  H H    . LEU A 1 21  ? 14.153  0.710   6.498   1.00 0.00 ? 21  LEU A H    3  
ATOM 4521  H HA   . LEU A 1 21  ? 13.181  -0.893  4.343   1.00 0.00 ? 21  LEU A HA   3  
ATOM 4522  H HB2  . LEU A 1 21  ? 13.505  -1.483  6.835   1.00 0.00 ? 21  LEU A HB2  3  
ATOM 4523  H HB3  . LEU A 1 21  ? 11.967  -0.679  7.084   1.00 0.00 ? 21  LEU A HB3  3  
ATOM 4524  H HG   . LEU A 1 21  ? 10.801  -2.261  5.731   1.00 0.00 ? 21  LEU A HG   3  
ATOM 4525  H HD11 . LEU A 1 21  ? 13.532  -3.001  4.762   1.00 0.00 ? 21  LEU A HD11 3  
ATOM 4526  H HD12 . LEU A 1 21  ? 12.261  -4.247  4.786   1.00 0.00 ? 21  LEU A HD12 3  
ATOM 4527  H HD13 . LEU A 1 21  ? 12.020  -2.748  3.857   1.00 0.00 ? 21  LEU A HD13 3  
ATOM 4528  H HD21 . LEU A 1 21  ? 10.986  -3.146  7.868   1.00 0.00 ? 21  LEU A HD21 3  
ATOM 4529  H HD22 . LEU A 1 21  ? 11.567  -4.476  6.838   1.00 0.00 ? 21  LEU A HD22 3  
ATOM 4530  H HD23 . LEU A 1 21  ? 12.732  -3.449  7.707   1.00 0.00 ? 21  LEU A HD23 3  
ATOM 4531  N N    . LEU A 1 22  ? 11.513  1.703   5.419   1.00 0.00 ? 22  LEU A N    3  
ATOM 4532  C CA   . LEU A 1 22  ? 10.417  2.606   5.112   1.00 0.00 ? 22  LEU A CA   3  
ATOM 4533  C C    . LEU A 1 22  ? 10.588  3.145   3.690   1.00 0.00 ? 22  LEU A C    3  
ATOM 4534  O O    . LEU A 1 22  ? 9.690   3.010   2.860   1.00 0.00 ? 22  LEU A O    3  
ATOM 4535  C CB   . LEU A 1 22  ? 10.311  3.701   6.176   1.00 0.00 ? 22  LEU A CB   3  
ATOM 4536  C CG   . LEU A 1 22  ? 9.496   3.350   7.422   1.00 0.00 ? 22  LEU A CG   3  
ATOM 4537  C CD1  . LEU A 1 22  ? 8.013   3.192   7.079   1.00 0.00 ? 22  LEU A CD1  3  
ATOM 4538  C CD2  . LEU A 1 22  ? 10.059  2.108   8.114   1.00 0.00 ? 22  LEU A CD2  3  
ATOM 4539  H H    . LEU A 1 22  ? 12.116  2.006   6.157   1.00 0.00 ? 22  LEU A H    3  
ATOM 4540  H HA   . LEU A 1 22  ? 9.495   2.027   5.154   1.00 0.00 ? 22  LEU A HA   3  
ATOM 4541  H HB2  . LEU A 1 22  ? 11.319  3.973   6.490   1.00 0.00 ? 22  LEU A HB2  3  
ATOM 4542  H HB3  . LEU A 1 22  ? 9.872   4.586   5.715   1.00 0.00 ? 22  LEU A HB3  3  
ATOM 4543  H HG   . LEU A 1 22  ? 9.577   4.177   8.127   1.00 0.00 ? 22  LEU A HG   3  
ATOM 4544  H HD11 . LEU A 1 22  ? 7.408   3.521   7.925   1.00 0.00 ? 22  LEU A HD11 3  
ATOM 4545  H HD12 . LEU A 1 22  ? 7.775   3.798   6.205   1.00 0.00 ? 22  LEU A HD12 3  
ATOM 4546  H HD13 . LEU A 1 22  ? 7.799   2.145   6.865   1.00 0.00 ? 22  LEU A HD13 3  
ATOM 4547  H HD21 . LEU A 1 22  ? 9.750   2.103   9.159   1.00 0.00 ? 22  LEU A HD21 3  
ATOM 4548  H HD22 . LEU A 1 22  ? 9.682   1.213   7.619   1.00 0.00 ? 22  LEU A HD22 3  
ATOM 4549  H HD23 . LEU A 1 22  ? 11.148  2.123   8.057   1.00 0.00 ? 22  LEU A HD23 3  
ATOM 4550  N N    . ASP A 1 23  ? 11.746  3.742   3.453   1.00 0.00 ? 23  ASP A N    3  
ATOM 4551  C CA   . ASP A 1 23  ? 12.046  4.301   2.146   1.00 0.00 ? 23  ASP A CA   3  
ATOM 4552  C C    . ASP A 1 23  ? 11.860  3.221   1.079   1.00 0.00 ? 23  ASP A C    3  
ATOM 4553  O O    . ASP A 1 23  ? 11.234  3.462   0.049   1.00 0.00 ? 23  ASP A O    3  
ATOM 4554  C CB   . ASP A 1 23  ? 13.494  4.791   2.076   1.00 0.00 ? 23  ASP A CB   3  
ATOM 4555  C CG   . ASP A 1 23  ? 13.777  5.817   0.977   1.00 0.00 ? 23  ASP A CG   3  
ATOM 4556  O OD1  . ASP A 1 23  ? 13.384  6.987   1.178   1.00 0.00 ? 23  ASP A OD1  3  
ATOM 4557  O OD2  . ASP A 1 23  ? 14.379  5.409   -0.039  1.00 0.00 ? 23  ASP A OD2  3  
ATOM 4558  H H    . ASP A 1 23  ? 12.471  3.847   4.134   1.00 0.00 ? 23  ASP A H    3  
ATOM 4559  H HA   . ASP A 1 23  ? 11.352  5.132   2.024   1.00 0.00 ? 23  ASP A HA   3  
ATOM 4560  H HB2  . ASP A 1 23  ? 13.761  5.228   3.038   1.00 0.00 ? 23  ASP A HB2  3  
ATOM 4561  H HB3  . ASP A 1 23  ? 14.146  3.930   1.925   1.00 0.00 ? 23  ASP A HB3  3  
ATOM 4562  N N    . ALA A 1 24  ? 12.415  2.052   1.363   1.00 0.00 ? 24  ALA A N    3  
ATOM 4563  C CA   . ALA A 1 24  ? 12.318  0.933   0.441   1.00 0.00 ? 24  ALA A CA   3  
ATOM 4564  C C    . ALA A 1 24  ? 10.844  0.600   0.203   1.00 0.00 ? 24  ALA A C    3  
ATOM 4565  O O    . ALA A 1 24  ? 10.457  0.237   -0.906  1.00 0.00 ? 24  ALA A O    3  
ATOM 4566  C CB   . ALA A 1 24  ? 13.103  -0.257  0.997   1.00 0.00 ? 24  ALA A CB   3  
ATOM 4567  H H    . ALA A 1 24  ? 12.923  1.863   2.204   1.00 0.00 ? 24  ALA A H    3  
ATOM 4568  H HA   . ALA A 1 24  ? 12.769  1.241   -0.503  1.00 0.00 ? 24  ALA A HA   3  
ATOM 4569  H HB1  . ALA A 1 24  ? 13.098  -0.218  2.086   1.00 0.00 ? 24  ALA A HB1  3  
ATOM 4570  H HB2  . ALA A 1 24  ? 12.638  -1.185  0.665   1.00 0.00 ? 24  ALA A HB2  3  
ATOM 4571  H HB3  . ALA A 1 24  ? 14.130  -0.215  0.636   1.00 0.00 ? 24  ALA A HB3  3  
ATOM 4572  N N    . ILE A 1 25  ? 10.062  0.735   1.264   1.00 0.00 ? 25  ILE A N    3  
ATOM 4573  C CA   . ILE A 1 25  ? 8.638   0.453   1.185   1.00 0.00 ? 25  ILE A CA   3  
ATOM 4574  C C    . ILE A 1 25  ? 7.928   1.624   0.501   1.00 0.00 ? 25  ILE A C    3  
ATOM 4575  O O    . ILE A 1 25  ? 6.899   1.437   -0.147  1.00 0.00 ? 25  ILE A O    3  
ATOM 4576  C CB   . ILE A 1 25  ? 8.080   0.120   2.569   1.00 0.00 ? 25  ILE A CB   3  
ATOM 4577  C CG1  . ILE A 1 25  ? 8.570   -1.251  3.042   1.00 0.00 ? 25  ILE A CG1  3  
ATOM 4578  C CG2  . ILE A 1 25  ? 6.554   0.220   2.584   1.00 0.00 ? 25  ILE A CG2  3  
ATOM 4579  C CD1  . ILE A 1 25  ? 8.498   -1.363  4.566   1.00 0.00 ? 25  ILE A CD1  3  
ATOM 4580  H H    . ILE A 1 25  ? 10.384  1.031   2.163   1.00 0.00 ? 25  ILE A H    3  
ATOM 4581  H HA   . ILE A 1 25  ? 8.515   -0.435  0.565   1.00 0.00 ? 25  ILE A HA   3  
ATOM 4582  H HB   . ILE A 1 25  ? 8.458   0.858   3.277   1.00 0.00 ? 25  ILE A HB   3  
ATOM 4583  H HG12 . ILE A 1 25  ? 7.963   -2.034  2.587   1.00 0.00 ? 25  ILE A HG12 3  
ATOM 4584  H HG13 . ILE A 1 25  ? 9.596   -1.409  2.710   1.00 0.00 ? 25  ILE A HG13 3  
ATOM 4585  H HG21 . ILE A 1 25  ? 6.256   1.256   2.422   1.00 0.00 ? 25  ILE A HG21 3  
ATOM 4586  H HG22 . ILE A 1 25  ? 6.141   -0.405  1.792   1.00 0.00 ? 25  ILE A HG22 3  
ATOM 4587  H HG23 . ILE A 1 25  ? 6.177   -0.121  3.549   1.00 0.00 ? 25  ILE A HG23 3  
ATOM 4588  H HD11 . ILE A 1 25  ? 8.715   -2.388  4.866   1.00 0.00 ? 25  ILE A HD11 3  
ATOM 4589  H HD12 . ILE A 1 25  ? 9.230   -0.691  5.015   1.00 0.00 ? 25  ILE A HD12 3  
ATOM 4590  H HD13 . ILE A 1 25  ? 7.499   -1.089  4.904   1.00 0.00 ? 25  ILE A HD13 3  
ATOM 4591  N N    . CYS A 1 26  ? 8.506   2.804   0.669   1.00 0.00 ? 26  CYS A N    3  
ATOM 4592  C CA   . CYS A 1 26  ? 7.941   4.005   0.077   1.00 0.00 ? 26  CYS A CA   3  
ATOM 4593  C C    . CYS A 1 26  ? 8.112   3.917   -1.441  1.00 0.00 ? 26  CYS A C    3  
ATOM 4594  O O    . CYS A 1 26  ? 7.137   4.015   -2.186  1.00 0.00 ? 26  CYS A O    3  
ATOM 4595  C CB   . CYS A 1 26  ? 8.577   5.272   0.650   1.00 0.00 ? 26  CYS A CB   3  
ATOM 4596  S SG   . CYS A 1 26  ? 8.068   5.493   2.394   1.00 0.00 ? 26  CYS A SG   3  
ATOM 4597  H H    . CYS A 1 26  ? 9.342   2.947   1.198   1.00 0.00 ? 26  CYS A H    3  
ATOM 4598  H HA   . CYS A 1 26  ? 6.885   4.020   0.347   1.00 0.00 ? 26  CYS A HA   3  
ATOM 4599  H HB2  . CYS A 1 26  ? 9.663   5.205   0.586   1.00 0.00 ? 26  CYS A HB2  3  
ATOM 4600  H HB3  . CYS A 1 26  ? 8.275   6.139   0.062   1.00 0.00 ? 26  CYS A HB3  3  
ATOM 4601  H HG   . CYS A 1 26  ? 9.273   5.824   2.850   1.00 0.00 ? 26  CYS A HG   3  
ATOM 4602  N N    . GLU A 1 27  ? 9.357   3.734   -1.855  1.00 0.00 ? 27  GLU A N    3  
ATOM 4603  C CA   . GLU A 1 27  ? 9.668   3.633   -3.271  1.00 0.00 ? 27  GLU A CA   3  
ATOM 4604  C C    . GLU A 1 27  ? 8.754   2.607   -3.943  1.00 0.00 ? 27  GLU A C    3  
ATOM 4605  O O    . GLU A 1 27  ? 8.464   2.714   -5.133  1.00 0.00 ? 27  GLU A O    3  
ATOM 4606  C CB   . GLU A 1 27  ? 11.141  3.277   -3.484  1.00 0.00 ? 27  GLU A CB   3  
ATOM 4607  C CG   . GLU A 1 27  ? 11.415  1.822   -3.101  1.00 0.00 ? 27  GLU A CG   3  
ATOM 4608  C CD   . GLU A 1 27  ? 12.645  1.284   -3.835  1.00 0.00 ? 27  GLU A CD   3  
ATOM 4609  O OE1  . GLU A 1 27  ? 13.762  1.555   -3.345  1.00 0.00 ? 27  GLU A OE1  3  
ATOM 4610  O OE2  . GLU A 1 27  ? 12.440  0.614   -4.870  1.00 0.00 ? 27  GLU A OE2  3  
ATOM 4611  H H    . GLU A 1 27  ? 10.144  3.656   -1.243  1.00 0.00 ? 27  GLU A H    3  
ATOM 4612  H HA   . GLU A 1 27  ? 9.477   4.624   -3.681  1.00 0.00 ? 27  GLU A HA   3  
ATOM 4613  H HB2  . GLU A 1 27  ? 11.410  3.439   -4.528  1.00 0.00 ? 27  GLU A HB2  3  
ATOM 4614  H HB3  . GLU A 1 27  ? 11.769  3.939   -2.887  1.00 0.00 ? 27  GLU A HB3  3  
ATOM 4615  H HG2  . GLU A 1 27  ? 11.569  1.748   -2.024  1.00 0.00 ? 27  GLU A HG2  3  
ATOM 4616  H HG3  . GLU A 1 27  ? 10.546  1.209   -3.342  1.00 0.00 ? 27  GLU A HG3  3  
ATOM 4617  N N    . ARG A 1 28  ? 8.324   1.635   -3.150  1.00 0.00 ? 28  ARG A N    3  
ATOM 4618  C CA   . ARG A 1 28  ? 7.449   0.591   -3.654  1.00 0.00 ? 28  ARG A CA   3  
ATOM 4619  C C    . ARG A 1 28  ? 6.066   1.164   -3.970  1.00 0.00 ? 28  ARG A C    3  
ATOM 4620  O O    . ARG A 1 28  ? 5.419   0.742   -4.927  1.00 0.00 ? 28  ARG A O    3  
ATOM 4621  C CB   . ARG A 1 28  ? 7.303   -0.543  -2.637  1.00 0.00 ? 28  ARG A CB   3  
ATOM 4622  C CG   . ARG A 1 28  ? 7.871   -1.852  -3.191  1.00 0.00 ? 28  ARG A CG   3  
ATOM 4623  C CD   . ARG A 1 28  ? 9.119   -2.279  -2.416  1.00 0.00 ? 28  ARG A CD   3  
ATOM 4624  N NE   . ARG A 1 28  ? 9.931   -3.207  -3.236  1.00 0.00 ? 28  ARG A NE   3  
ATOM 4625  C CZ   . ARG A 1 28  ? 11.222  -3.481  -3.004  1.00 0.00 ? 28  ARG A CZ   3  
ATOM 4626  N NH1  . ARG A 1 28  ? 11.856  -2.900  -1.977  1.00 0.00 ? 28  ARG A NH1  3  
ATOM 4627  N NH2  . ARG A 1 28  ? 11.878  -4.336  -3.800  1.00 0.00 ? 28  ARG A NH2  3  
ATOM 4628  H H    . ARG A 1 28  ? 8.565   1.555   -2.183  1.00 0.00 ? 28  ARG A H    3  
ATOM 4629  H HA   . ARG A 1 28  ? 7.939   0.228   -4.557  1.00 0.00 ? 28  ARG A HA   3  
ATOM 4630  H HB2  . ARG A 1 28  ? 7.821   -0.279  -1.716  1.00 0.00 ? 28  ARG A HB2  3  
ATOM 4631  H HB3  . ARG A 1 28  ? 6.251   -0.677  -2.385  1.00 0.00 ? 28  ARG A HB3  3  
ATOM 4632  H HG2  . ARG A 1 28  ? 7.115   -2.635  -3.130  1.00 0.00 ? 28  ARG A HG2  3  
ATOM 4633  H HG3  . ARG A 1 28  ? 8.117   -1.728  -4.245  1.00 0.00 ? 28  ARG A HG3  3  
ATOM 4634  H HD2  . ARG A 1 28  ? 9.711   -1.402  -2.152  1.00 0.00 ? 28  ARG A HD2  3  
ATOM 4635  H HD3  . ARG A 1 28  ? 8.831   -2.762  -1.483  1.00 0.00 ? 28  ARG A HD3  3  
ATOM 4636  H HE   . ARG A 1 28  ? 9.488   -3.657  -4.011  1.00 0.00 ? 28  ARG A HE   3  
ATOM 4637  H HH11 . ARG A 1 28  ? 11.366  -2.262  -1.383  1.00 0.00 ? 28  ARG A HH11 3  
ATOM 4638  H HH12 . ARG A 1 28  ? 12.819  -3.105  -1.804  1.00 0.00 ? 28  ARG A HH12 3  
ATOM 4639  H HH21 . ARG A 1 28  ? 11.405  -4.769  -4.567  1.00 0.00 ? 28  ARG A HH21 3  
ATOM 4640  H HH22 . ARG A 1 28  ? 12.842  -4.540  -3.628  1.00 0.00 ? 28  ARG A HH22 3  
ATOM 4641  N N    . LEU A 1 29  ? 5.653   2.117   -3.146  1.00 0.00 ? 29  LEU A N    3  
ATOM 4642  C CA   . LEU A 1 29  ? 4.359   2.752   -3.326  1.00 0.00 ? 29  LEU A CA   3  
ATOM 4643  C C    . LEU A 1 29  ? 4.108   2.977   -4.819  1.00 0.00 ? 29  LEU A C    3  
ATOM 4644  O O    . LEU A 1 29  ? 4.932   3.577   -5.506  1.00 0.00 ? 29  LEU A O    3  
ATOM 4645  C CB   . LEU A 1 29  ? 4.268   4.029   -2.488  1.00 0.00 ? 29  LEU A CB   3  
ATOM 4646  C CG   . LEU A 1 29  ? 4.521   3.867   -0.988  1.00 0.00 ? 29  LEU A CG   3  
ATOM 4647  C CD1  . LEU A 1 29  ? 4.917   5.201   -0.351  1.00 0.00 ? 29  LEU A CD1  3  
ATOM 4648  C CD2  . LEU A 1 29  ? 3.313   3.236   -0.293  1.00 0.00 ? 29  LEU A CD2  3  
ATOM 4649  H H    . LEU A 1 29  ? 6.185   2.454   -2.370  1.00 0.00 ? 29  LEU A H    3  
ATOM 4650  H HA   . LEU A 1 29  ? 3.602   2.065   -2.948  1.00 0.00 ? 29  LEU A HA   3  
ATOM 4651  H HB2  . LEU A 1 29  ? 4.985   4.750   -2.882  1.00 0.00 ? 29  LEU A HB2  3  
ATOM 4652  H HB3  . LEU A 1 29  ? 3.276   4.460   -2.625  1.00 0.00 ? 29  LEU A HB3  3  
ATOM 4653  H HG   . LEU A 1 29  ? 5.361   3.185   -0.855  1.00 0.00 ? 29  LEU A HG   3  
ATOM 4654  H HD11 . LEU A 1 29  ? 4.137   5.939   -0.540  1.00 0.00 ? 29  LEU A HD11 3  
ATOM 4655  H HD12 . LEU A 1 29  ? 5.039   5.068   0.724   1.00 0.00 ? 29  LEU A HD12 3  
ATOM 4656  H HD13 . LEU A 1 29  ? 5.856   5.546   -0.784  1.00 0.00 ? 29  LEU A HD13 3  
ATOM 4657  H HD21 . LEU A 1 29  ? 3.598   2.910   0.707   1.00 0.00 ? 29  LEU A HD21 3  
ATOM 4658  H HD22 . LEU A 1 29  ? 2.511   3.970   -0.221  1.00 0.00 ? 29  LEU A HD22 3  
ATOM 4659  H HD23 . LEU A 1 29  ? 2.969   2.378   -0.871  1.00 0.00 ? 29  LEU A HD23 3  
ATOM 4660  N N    . LYS A 1 30  ? 2.967   2.482   -5.275  1.00 0.00 ? 30  LYS A N    3  
ATOM 4661  C CA   . LYS A 1 30  ? 2.598   2.620   -6.674  1.00 0.00 ? 30  LYS A CA   3  
ATOM 4662  C C    . LYS A 1 30  ? 1.496   3.674   -6.804  1.00 0.00 ? 30  LYS A C    3  
ATOM 4663  O O    . LYS A 1 30  ? 0.743   3.909   -5.860  1.00 0.00 ? 30  LYS A O    3  
ATOM 4664  C CB   . LYS A 1 30  ? 2.222   1.261   -7.266  1.00 0.00 ? 30  LYS A CB   3  
ATOM 4665  C CG   . LYS A 1 30  ? 3.457   0.539   -7.809  1.00 0.00 ? 30  LYS A CG   3  
ATOM 4666  C CD   . LYS A 1 30  ? 3.091   -0.361  -8.991  1.00 0.00 ? 30  LYS A CD   3  
ATOM 4667  C CE   . LYS A 1 30  ? 4.346   -0.926  -9.659  1.00 0.00 ? 30  LYS A CE   3  
ATOM 4668  N NZ   . LYS A 1 30  ? 4.224   -0.858  -11.133 1.00 0.00 ? 30  LYS A NZ   3  
ATOM 4669  H H    . LYS A 1 30  ? 2.303   1.994   -4.709  1.00 0.00 ? 30  LYS A H    3  
ATOM 4670  H HA   . LYS A 1 30  ? 3.478   2.974   -7.211  1.00 0.00 ? 30  LYS A HA   3  
ATOM 4671  H HB2  . LYS A 1 30  ? 1.744   0.647   -6.504  1.00 0.00 ? 30  LYS A HB2  3  
ATOM 4672  H HB3  . LYS A 1 30  ? 1.495   1.397   -8.067  1.00 0.00 ? 30  LYS A HB3  3  
ATOM 4673  H HG2  . LYS A 1 30  ? 4.202   1.270   -8.122  1.00 0.00 ? 30  LYS A HG2  3  
ATOM 4674  H HG3  . LYS A 1 30  ? 3.910   -0.059  -7.018  1.00 0.00 ? 30  LYS A HG3  3  
ATOM 4675  H HD2  . LYS A 1 30  ? 2.458   -1.180  -8.647  1.00 0.00 ? 30  LYS A HD2  3  
ATOM 4676  H HD3  . LYS A 1 30  ? 2.511   0.206   -9.719  1.00 0.00 ? 30  LYS A HD3  3  
ATOM 4677  H HE2  . LYS A 1 30  ? 5.222   -0.365  -9.335  1.00 0.00 ? 30  LYS A HE2  3  
ATOM 4678  H HE3  . LYS A 1 30  ? 4.497   -1.960  -9.348  1.00 0.00 ? 30  LYS A HE3  3  
ATOM 4679  H HZ1  . LYS A 1 30  ? 4.192   0.099   -11.421 1.00 0.00 ? 30  LYS A HZ1  3  
ATOM 4680  H HZ2  . LYS A 1 30  ? 5.012   -1.307  -11.553 1.00 0.00 ? 30  LYS A HZ2  3  
ATOM 4681  H HZ3  . LYS A 1 30  ? 3.384   -1.321  -11.419 1.00 0.00 ? 30  LYS A HZ3  3  
ATOM 4682  N N    . PRO A 1 31  ? 1.434   4.295   -8.012  1.00 0.00 ? 31  PRO A N    3  
ATOM 4683  C CA   . PRO A 1 31  ? 0.437   5.318   -8.277  1.00 0.00 ? 31  PRO A CA   3  
ATOM 4684  C C    . PRO A 1 31  ? -0.945  4.695   -8.488  1.00 0.00 ? 31  PRO A C    3  
ATOM 4685  O O    . PRO A 1 31  ? -1.198  4.073   -9.519  1.00 0.00 ? 31  PRO A O    3  
ATOM 4686  C CB   . PRO A 1 31  ? 0.948   6.058   -9.502  1.00 0.00 ? 31  PRO A CB   3  
ATOM 4687  C CG   . PRO A 1 31  ? 1.966   5.135   -10.152 1.00 0.00 ? 31  PRO A CG   3  
ATOM 4688  C CD   . PRO A 1 31  ? 2.309   4.042   -9.153  1.00 0.00 ? 31  PRO A CD   3  
ATOM 4689  H HA   . PRO A 1 31  ? 0.344   5.926   -7.488  1.00 0.00 ? 31  PRO A HA   3  
ATOM 4690  H HB2  . PRO A 1 31  ? 0.133   6.286   -10.189 1.00 0.00 ? 31  PRO A HB2  3  
ATOM 4691  H HB3  . PRO A 1 31  ? 1.405   7.007   -9.223  1.00 0.00 ? 31  PRO A HB3  3  
ATOM 4692  H HG2  . PRO A 1 31  ? 1.560   4.702   -11.066 1.00 0.00 ? 31  PRO A HG2  3  
ATOM 4693  H HG3  . PRO A 1 31  ? 2.861   5.690   -10.433 1.00 0.00 ? 31  PRO A HG3  3  
ATOM 4694  H HD2  . PRO A 1 31  ? 2.135   3.052   -9.573  1.00 0.00 ? 31  PRO A HD2  3  
ATOM 4695  H HD3  . PRO A 1 31  ? 3.359   4.085   -8.864  1.00 0.00 ? 31  PRO A HD3  3  
ATOM 4696  N N    . CYS A 1 32  ? -1.802  4.883   -7.496  1.00 0.00 ? 32  CYS A N    3  
ATOM 4697  C CA   . CYS A 1 32  ? -3.151  4.347   -7.560  1.00 0.00 ? 32  CYS A CA   3  
ATOM 4698  C C    . CYS A 1 32  ? -4.070  5.262   -6.748  1.00 0.00 ? 32  CYS A C    3  
ATOM 4699  O O    . CYS A 1 32  ? -3.608  5.999   -5.879  1.00 0.00 ? 32  CYS A O    3  
ATOM 4700  C CB   . CYS A 1 32  ? -3.208  2.899   -7.070  1.00 0.00 ? 32  CYS A CB   3  
ATOM 4701  S SG   . CYS A 1 32  ? -2.049  1.864   -8.036  1.00 0.00 ? 32  CYS A SG   3  
ATOM 4702  H H    . CYS A 1 32  ? -1.588  5.390   -6.661  1.00 0.00 ? 32  CYS A H    3  
ATOM 4703  H HA   . CYS A 1 32  ? -3.437  4.345   -8.612  1.00 0.00 ? 32  CYS A HA   3  
ATOM 4704  H HB2  . CYS A 1 32  ? -2.952  2.855   -6.011  1.00 0.00 ? 32  CYS A HB2  3  
ATOM 4705  H HB3  . CYS A 1 32  ? -4.223  2.513   -7.169  1.00 0.00 ? 32  CYS A HB3  3  
ATOM 4706  H HG   . CYS A 1 32  ? -2.555  0.695   -7.655  1.00 0.00 ? 32  CYS A HG   3  
ATOM 4707  N N    . LEU A 1 33  ? -5.355  5.184   -7.061  1.00 0.00 ? 33  LEU A N    3  
ATOM 4708  C CA   . LEU A 1 33  ? -6.344  5.995   -6.371  1.00 0.00 ? 33  LEU A CA   3  
ATOM 4709  C C    . LEU A 1 33  ? -7.624  5.180   -6.181  1.00 0.00 ? 33  LEU A C    3  
ATOM 4710  O O    . LEU A 1 33  ? -7.917  4.285   -6.972  1.00 0.00 ? 33  LEU A O    3  
ATOM 4711  C CB   . LEU A 1 33  ? -6.561  7.318   -7.109  1.00 0.00 ? 33  LEU A CB   3  
ATOM 4712  C CG   . LEU A 1 33  ? -7.490  8.323   -6.426  1.00 0.00 ? 33  LEU A CG   3  
ATOM 4713  C CD1  . LEU A 1 33  ? -6.770  9.648   -6.168  1.00 0.00 ? 33  LEU A CD1  3  
ATOM 4714  C CD2  . LEU A 1 33  ? -8.776  8.517   -7.232  1.00 0.00 ? 33  LEU A CD2  3  
ATOM 4715  H H    . LEU A 1 33  ? -5.723  4.582   -7.770  1.00 0.00 ? 33  LEU A H    3  
ATOM 4716  H HA   . LEU A 1 33  ? -5.939  6.238   -5.388  1.00 0.00 ? 33  LEU A HA   3  
ATOM 4717  H HB2  . LEU A 1 33  ? -5.590  7.792   -7.257  1.00 0.00 ? 33  LEU A HB2  3  
ATOM 4718  H HB3  . LEU A 1 33  ? -6.961  7.097   -8.099  1.00 0.00 ? 33  LEU A HB3  3  
ATOM 4719  H HG   . LEU A 1 33  ? -7.776  7.918   -5.455  1.00 0.00 ? 33  LEU A HG   3  
ATOM 4720  H HD11 . LEU A 1 33  ? -6.129  9.549   -5.292  1.00 0.00 ? 33  LEU A HD11 3  
ATOM 4721  H HD12 . LEU A 1 33  ? -6.162  9.906   -7.036  1.00 0.00 ? 33  LEU A HD12 3  
ATOM 4722  H HD13 . LEU A 1 33  ? -7.505  10.434  -5.994  1.00 0.00 ? 33  LEU A HD13 3  
ATOM 4723  H HD21 . LEU A 1 33  ? -8.739  9.475   -7.750  1.00 0.00 ? 33  LEU A HD21 3  
ATOM 4724  H HD22 . LEU A 1 33  ? -8.872  7.713   -7.961  1.00 0.00 ? 33  LEU A HD22 3  
ATOM 4725  H HD23 . LEU A 1 33  ? -9.633  8.501   -6.558  1.00 0.00 ? 33  LEU A HD23 3  
ATOM 4726  N N    . PHE A 1 34  ? -8.353  5.519   -5.128  1.00 0.00 ? 34  PHE A N    3  
ATOM 4727  C CA   . PHE A 1 34  ? -9.595  4.829   -4.824  1.00 0.00 ? 34  PHE A CA   3  
ATOM 4728  C C    . PHE A 1 34  ? -10.805 5.670   -5.239  1.00 0.00 ? 34  PHE A C    3  
ATOM 4729  O O    . PHE A 1 34  ? -11.048 6.735   -4.674  1.00 0.00 ? 34  PHE A O    3  
ATOM 4730  C CB   . PHE A 1 34  ? -9.631  4.619   -3.309  1.00 0.00 ? 34  PHE A CB   3  
ATOM 4731  C CG   . PHE A 1 34  ? -8.374  3.956   -2.743  1.00 0.00 ? 34  PHE A CG   3  
ATOM 4732  C CD1  . PHE A 1 34  ? -7.904  2.806   -3.297  1.00 0.00 ? 34  PHE A CD1  3  
ATOM 4733  C CD2  . PHE A 1 34  ? -7.726  4.516   -1.687  1.00 0.00 ? 34  PHE A CD2  3  
ATOM 4734  C CE1  . PHE A 1 34  ? -6.737  2.190   -2.772  1.00 0.00 ? 34  PHE A CE1  3  
ATOM 4735  C CE2  . PHE A 1 34  ? -6.559  3.901   -1.162  1.00 0.00 ? 34  PHE A CE2  3  
ATOM 4736  C CZ   . PHE A 1 34  ? -6.089  2.751   -1.715  1.00 0.00 ? 34  PHE A CZ   3  
ATOM 4737  H H    . PHE A 1 34  ? -8.108  6.248   -4.490  1.00 0.00 ? 34  PHE A H    3  
ATOM 4738  H HA   . PHE A 1 34  ? -9.593  3.896   -5.388  1.00 0.00 ? 34  PHE A HA   3  
ATOM 4739  H HB2  . PHE A 1 34  ? -9.772  5.583   -2.822  1.00 0.00 ? 34  PHE A HB2  3  
ATOM 4740  H HB3  . PHE A 1 34  ? -10.497 4.006   -3.058  1.00 0.00 ? 34  PHE A HB3  3  
ATOM 4741  H HD1  . PHE A 1 34  ? -8.423  2.356   -4.144  1.00 0.00 ? 34  PHE A HD1  3  
ATOM 4742  H HD2  . PHE A 1 34  ? -8.103  5.438   -1.243  1.00 0.00 ? 34  PHE A HD2  3  
ATOM 4743  H HE1  . PHE A 1 34  ? -6.360  1.269   -3.215  1.00 0.00 ? 34  PHE A HE1  3  
ATOM 4744  H HE2  . PHE A 1 34  ? -6.040  4.350   -0.315  1.00 0.00 ? 34  PHE A HE2  3  
ATOM 4745  H HZ   . PHE A 1 34  ? -5.193  2.278   -1.312  1.00 0.00 ? 34  PHE A HZ   3  
ATOM 4746  N N    . THR A 1 35  ? -11.531 5.159   -6.223  1.00 0.00 ? 35  THR A N    3  
ATOM 4747  C CA   . THR A 1 35  ? -12.708 5.850   -6.720  1.00 0.00 ? 35  THR A CA   3  
ATOM 4748  C C    . THR A 1 35  ? -13.937 5.472   -5.891  1.00 0.00 ? 35  THR A C    3  
ATOM 4749  O O    . THR A 1 35  ? -13.812 4.860   -4.831  1.00 0.00 ? 35  THR A O    3  
ATOM 4750  C CB   . THR A 1 35  ? -12.856 5.523   -8.207  1.00 0.00 ? 35  THR A CB   3  
ATOM 4751  O OG1  . THR A 1 35  ? -12.409 4.174   -8.312  1.00 0.00 ? 35  THR A OG1  3  
ATOM 4752  C CG2  . THR A 1 35  ? -11.874 6.309   -9.079  1.00 0.00 ? 35  THR A CG2  3  
ATOM 4753  H H    . THR A 1 35  ? -11.326 4.292   -6.677  1.00 0.00 ? 35  THR A H    3  
ATOM 4754  H HA   . THR A 1 35  ? -12.556 6.922   -6.596  1.00 0.00 ? 35  THR A HA   3  
ATOM 4755  H HB   . THR A 1 35  ? -13.882 5.678   -8.540  1.00 0.00 ? 35  THR A HB   3  
ATOM 4756  H HG1  . THR A 1 35  ? -12.349 3.907   -9.274  1.00 0.00 ? 35  THR A HG1  3  
ATOM 4757  H HG21 . THR A 1 35  ? -10.906 6.360   -8.581  1.00 0.00 ? 35  THR A HG21 3  
ATOM 4758  H HG22 . THR A 1 35  ? -11.761 5.808   -10.041 1.00 0.00 ? 35  THR A HG22 3  
ATOM 4759  H HG23 . THR A 1 35  ? -12.256 7.318   -9.237  1.00 0.00 ? 35  THR A HG23 3  
ATOM 4760  N N    . GLU A 1 36  ? -15.098 5.853   -6.404  1.00 0.00 ? 36  GLU A N    3  
ATOM 4761  C CA   . GLU A 1 36  ? -16.349 5.563   -5.724  1.00 0.00 ? 36  GLU A CA   3  
ATOM 4762  C C    . GLU A 1 36  ? -16.672 4.070   -5.823  1.00 0.00 ? 36  GLU A C    3  
ATOM 4763  O O    . GLU A 1 36  ? -16.395 3.438   -6.841  1.00 0.00 ? 36  GLU A O    3  
ATOM 4764  C CB   . GLU A 1 36  ? -17.490 6.410   -6.290  1.00 0.00 ? 36  GLU A CB   3  
ATOM 4765  C CG   . GLU A 1 36  ? -18.112 5.742   -7.518  1.00 0.00 ? 36  GLU A CG   3  
ATOM 4766  C CD   . GLU A 1 36  ? -19.008 6.720   -8.279  1.00 0.00 ? 36  GLU A CD   3  
ATOM 4767  O OE1  . GLU A 1 36  ? -20.203 6.793   -7.920  1.00 0.00 ? 36  GLU A OE1  3  
ATOM 4768  O OE2  . GLU A 1 36  ? -18.478 7.373   -9.204  1.00 0.00 ? 36  GLU A OE2  3  
ATOM 4769  H H    . GLU A 1 36  ? -15.192 6.351   -7.266  1.00 0.00 ? 36  GLU A H    3  
ATOM 4770  H HA   . GLU A 1 36  ? -16.183 5.837   -4.682  1.00 0.00 ? 36  GLU A HA   3  
ATOM 4771  H HB2  . GLU A 1 36  ? -18.253 6.556   -5.525  1.00 0.00 ? 36  GLU A HB2  3  
ATOM 4772  H HB3  . GLU A 1 36  ? -17.116 7.397   -6.559  1.00 0.00 ? 36  GLU A HB3  3  
ATOM 4773  H HG2  . GLU A 1 36  ? -17.324 5.377   -8.176  1.00 0.00 ? 36  GLU A HG2  3  
ATOM 4774  H HG3  . GLU A 1 36  ? -18.696 4.874   -7.208  1.00 0.00 ? 36  GLU A HG3  3  
ATOM 4775  N N    . LYS A 1 37  ? -17.253 3.551   -4.751  1.00 0.00 ? 37  LYS A N    3  
ATOM 4776  C CA   . LYS A 1 37  ? -17.617 2.145   -4.704  1.00 0.00 ? 37  LYS A CA   3  
ATOM 4777  C C    . LYS A 1 37  ? -16.351 1.292   -4.802  1.00 0.00 ? 37  LYS A C    3  
ATOM 4778  O O    . LYS A 1 37  ? -16.343 0.262   -5.475  1.00 0.00 ? 37  LYS A O    3  
ATOM 4779  C CB   . LYS A 1 37  ? -18.659 1.826   -5.778  1.00 0.00 ? 37  LYS A CB   3  
ATOM 4780  C CG   . LYS A 1 37  ? -19.924 2.663   -5.582  1.00 0.00 ? 37  LYS A CG   3  
ATOM 4781  C CD   . LYS A 1 37  ? -21.156 1.928   -6.113  1.00 0.00 ? 37  LYS A CD   3  
ATOM 4782  C CE   . LYS A 1 37  ? -21.191 1.951   -7.643  1.00 0.00 ? 37  LYS A CE   3  
ATOM 4783  N NZ   . LYS A 1 37  ? -22.570 1.734   -8.133  1.00 0.00 ? 37  LYS A NZ   3  
ATOM 4784  H H    . LYS A 1 37  ? -17.475 4.073   -3.927  1.00 0.00 ? 37  LYS A H    3  
ATOM 4785  H HA   . LYS A 1 37  ? -18.085 1.961   -3.737  1.00 0.00 ? 37  LYS A HA   3  
ATOM 4786  H HB2  . LYS A 1 37  ? -18.240 2.019   -6.766  1.00 0.00 ? 37  LYS A HB2  3  
ATOM 4787  H HB3  . LYS A 1 37  ? -18.910 0.766   -5.742  1.00 0.00 ? 37  LYS A HB3  3  
ATOM 4788  H HG2  . LYS A 1 37  ? -20.057 2.884   -4.523  1.00 0.00 ? 37  LYS A HG2  3  
ATOM 4789  H HG3  . LYS A 1 37  ? -19.816 3.618   -6.095  1.00 0.00 ? 37  LYS A HG3  3  
ATOM 4790  H HD2  . LYS A 1 37  ? -21.149 0.896   -5.761  1.00 0.00 ? 37  LYS A HD2  3  
ATOM 4791  H HD3  . LYS A 1 37  ? -22.060 2.392   -5.718  1.00 0.00 ? 37  LYS A HD3  3  
ATOM 4792  H HE2  . LYS A 1 37  ? -20.815 2.907   -8.006  1.00 0.00 ? 37  LYS A HE2  3  
ATOM 4793  H HE3  . LYS A 1 37  ? -20.532 1.178   -8.039  1.00 0.00 ? 37  LYS A HE3  3  
ATOM 4794  H HZ1  . LYS A 1 37  ? -22.548 1.150   -8.944  1.00 0.00 ? 37  LYS A HZ1  3  
ATOM 4795  H HZ2  . LYS A 1 37  ? -23.113 1.292   -7.419  1.00 0.00 ? 37  LYS A HZ2  3  
ATOM 4796  H HZ3  . LYS A 1 37  ? -22.983 2.614   -8.368  1.00 0.00 ? 37  LYS A HZ3  3  
ATOM 4797  N N    . SER A 1 38  ? -15.312 1.751   -4.120  1.00 0.00 ? 38  SER A N    3  
ATOM 4798  C CA   . SER A 1 38  ? -14.044 1.043   -4.122  1.00 0.00 ? 38  SER A CA   3  
ATOM 4799  C C    . SER A 1 38  ? -13.761 0.472   -2.731  1.00 0.00 ? 38  SER A C    3  
ATOM 4800  O O    . SER A 1 38  ? -13.738 1.209   -1.746  1.00 0.00 ? 38  SER A O    3  
ATOM 4801  C CB   . SER A 1 38  ? -12.901 1.960   -4.561  1.00 0.00 ? 38  SER A CB   3  
ATOM 4802  O OG   . SER A 1 38  ? -12.557 2.906   -3.552  1.00 0.00 ? 38  SER A OG   3  
ATOM 4803  H H    . SER A 1 38  ? -15.327 2.590   -3.575  1.00 0.00 ? 38  SER A H    3  
ATOM 4804  H HA   . SER A 1 38  ? -14.163 0.239   -4.848  1.00 0.00 ? 38  SER A HA   3  
ATOM 4805  H HB2  . SER A 1 38  ? -12.026 1.358   -4.806  1.00 0.00 ? 38  SER A HB2  3  
ATOM 4806  H HB3  . SER A 1 38  ? -13.189 2.488   -5.470  1.00 0.00 ? 38  SER A HB3  3  
ATOM 4807  H HG   . SER A 1 38  ? -12.019 2.461   -2.835  1.00 0.00 ? 38  SER A HG   3  
ATOM 4808  N N    . TYR A 1 39  ? -13.555 -0.836  -2.693  1.00 0.00 ? 39  TYR A N    3  
ATOM 4809  C CA   . TYR A 1 39  ? -13.275 -1.514  -1.439  1.00 0.00 ? 39  TYR A CA   3  
ATOM 4810  C C    . TYR A 1 39  ? -11.770 -1.714  -1.247  1.00 0.00 ? 39  TYR A C    3  
ATOM 4811  O O    . TYR A 1 39  ? -11.139 -2.460  -1.994  1.00 0.00 ? 39  TYR A O    3  
ATOM 4812  C CB   . TYR A 1 39  ? -13.950 -2.883  -1.540  1.00 0.00 ? 39  TYR A CB   3  
ATOM 4813  C CG   . TYR A 1 39  ? -15.185 -3.036  -0.649  1.00 0.00 ? 39  TYR A CG   3  
ATOM 4814  C CD1  . TYR A 1 39  ? -16.126 -2.028  -0.596  1.00 0.00 ? 39  TYR A CD1  3  
ATOM 4815  C CD2  . TYR A 1 39  ? -15.357 -4.181  0.102   1.00 0.00 ? 39  TYR A CD2  3  
ATOM 4816  C CE1  . TYR A 1 39  ? -17.288 -2.171  0.243   1.00 0.00 ? 39  TYR A CE1  3  
ATOM 4817  C CE2  . TYR A 1 39  ? -16.518 -4.324  0.940   1.00 0.00 ? 39  TYR A CE2  3  
ATOM 4818  C CZ   . TYR A 1 39  ? -17.426 -3.312  0.970   1.00 0.00 ? 39  TYR A CZ   3  
ATOM 4819  O OH   . TYR A 1 39  ? -18.524 -3.448  1.762   1.00 0.00 ? 39  TYR A OH   3  
ATOM 4820  H H    . TYR A 1 39  ? -13.575 -1.429  -3.499  1.00 0.00 ? 39  TYR A H    3  
ATOM 4821  H HA   . TYR A 1 39  ? -13.658 -0.894  -0.629  1.00 0.00 ? 39  TYR A HA   3  
ATOM 4822  H HB2  . TYR A 1 39  ? -14.239 -3.059  -2.576  1.00 0.00 ? 39  TYR A HB2  3  
ATOM 4823  H HB3  . TYR A 1 39  ? -13.227 -3.654  -1.276  1.00 0.00 ? 39  TYR A HB3  3  
ATOM 4824  H HD1  . TYR A 1 39  ? -15.990 -1.123  -1.188  1.00 0.00 ? 39  TYR A HD1  3  
ATOM 4825  H HD2  . TYR A 1 39  ? -14.613 -4.977  0.059   1.00 0.00 ? 39  TYR A HD2  3  
ATOM 4826  H HE1  . TYR A 1 39  ? -18.038 -1.383  0.294   1.00 0.00 ? 39  TYR A HE1  3  
ATOM 4827  H HE2  . TYR A 1 39  ? -16.667 -5.224  1.538   1.00 0.00 ? 39  TYR A HE2  3  
ATOM 4828  H HH   . TYR A 1 39  ? -18.273 -3.897  2.619   1.00 0.00 ? 39  TYR A HH   3  
ATOM 4829  N N    . LEU A 1 40  ? -11.239 -1.034  -0.242  1.00 0.00 ? 40  LEU A N    3  
ATOM 4830  C CA   . LEU A 1 40  ? -9.820  -1.127  0.057   1.00 0.00 ? 40  LEU A CA   3  
ATOM 4831  C C    . LEU A 1 40  ? -9.523  -2.493  0.680   1.00 0.00 ? 40  LEU A C    3  
ATOM 4832  O O    . LEU A 1 40  ? -8.721  -3.260  0.151   1.00 0.00 ? 40  LEU A O    3  
ATOM 4833  C CB   . LEU A 1 40  ? -9.376  0.053   0.923   1.00 0.00 ? 40  LEU A CB   3  
ATOM 4834  C CG   . LEU A 1 40  ? -9.185  1.385   0.195   1.00 0.00 ? 40  LEU A CG   3  
ATOM 4835  C CD1  . LEU A 1 40  ? -10.525 1.941   -0.292  1.00 0.00 ? 40  LEU A CD1  3  
ATOM 4836  C CD2  . LEU A 1 40  ? -8.434  2.388   1.073   1.00 0.00 ? 40  LEU A CD2  3  
ATOM 4837  H H    . LEU A 1 40  ? -11.759 -0.429  0.361   1.00 0.00 ? 40  LEU A H    3  
ATOM 4838  H HA   . LEU A 1 40  ? -9.281  -1.054  -0.887  1.00 0.00 ? 40  LEU A HA   3  
ATOM 4839  H HB2  . LEU A 1 40  ? -10.114 0.196   1.713   1.00 0.00 ? 40  LEU A HB2  3  
ATOM 4840  H HB3  . LEU A 1 40  ? -8.436  -0.211  1.409   1.00 0.00 ? 40  LEU A HB3  3  
ATOM 4841  H HG   . LEU A 1 40  ? -8.571  1.207   -0.688  1.00 0.00 ? 40  LEU A HG   3  
ATOM 4842  H HD11 . LEU A 1 40  ? -11.337 1.464   0.258   1.00 0.00 ? 40  LEU A HD11 3  
ATOM 4843  H HD12 . LEU A 1 40  ? -10.555 3.017   -0.124  1.00 0.00 ? 40  LEU A HD12 3  
ATOM 4844  H HD13 . LEU A 1 40  ? -10.638 1.736   -1.356  1.00 0.00 ? 40  LEU A HD13 3  
ATOM 4845  H HD21 . LEU A 1 40  ? -9.074  2.697   1.900   1.00 0.00 ? 40  LEU A HD21 3  
ATOM 4846  H HD22 . LEU A 1 40  ? -7.531  1.921   1.467   1.00 0.00 ? 40  LEU A HD22 3  
ATOM 4847  H HD23 . LEU A 1 40  ? -8.163  3.260   0.479   1.00 0.00 ? 40  LEU A HD23 3  
ATOM 4848  N N    . VAL A 1 41  ? -10.187 -2.755  1.797   1.00 0.00 ? 41  VAL A N    3  
ATOM 4849  C CA   . VAL A 1 41  ? -10.004 -4.015  2.498   1.00 0.00 ? 41  VAL A CA   3  
ATOM 4850  C C    . VAL A 1 41  ? -11.373 -4.619  2.816   1.00 0.00 ? 41  VAL A C    3  
ATOM 4851  O O    . VAL A 1 41  ? -12.377 -3.908  2.852   1.00 0.00 ? 41  VAL A O    3  
ATOM 4852  C CB   . VAL A 1 41  ? -9.142  -3.800  3.743   1.00 0.00 ? 41  VAL A CB   3  
ATOM 4853  C CG1  . VAL A 1 41  ? -7.743  -3.311  3.363   1.00 0.00 ? 41  VAL A CG1  3  
ATOM 4854  C CG2  . VAL A 1 41  ? -9.815  -2.832  4.717   1.00 0.00 ? 41  VAL A CG2  3  
ATOM 4855  H H    . VAL A 1 41  ? -10.838 -2.126  2.221   1.00 0.00 ? 41  VAL A H    3  
ATOM 4856  H HA   . VAL A 1 41  ? -9.470  -4.689  1.829   1.00 0.00 ? 41  VAL A HA   3  
ATOM 4857  H HB   . VAL A 1 41  ? -9.035  -4.761  4.246   1.00 0.00 ? 41  VAL A HB   3  
ATOM 4858  H HG11 . VAL A 1 41  ? -7.060  -4.160  3.321   1.00 0.00 ? 41  VAL A HG11 3  
ATOM 4859  H HG12 . VAL A 1 41  ? -7.780  -2.826  2.387   1.00 0.00 ? 41  VAL A HG12 3  
ATOM 4860  H HG13 . VAL A 1 41  ? -7.392  -2.598  4.109   1.00 0.00 ? 41  VAL A HG13 3  
ATOM 4861  H HG21 . VAL A 1 41  ? -9.705  -1.812  4.350   1.00 0.00 ? 41  VAL A HG21 3  
ATOM 4862  H HG22 . VAL A 1 41  ? -10.875 -3.076  4.797   1.00 0.00 ? 41  VAL A HG22 3  
ATOM 4863  H HG23 . VAL A 1 41  ? -9.347  -2.919  5.698   1.00 0.00 ? 41  VAL A HG23 3  
ATOM 4864  N N    . ARG A 1 42  ? -11.371 -5.925  3.039   1.00 0.00 ? 42  ARG A N    3  
ATOM 4865  C CA   . ARG A 1 42  ? -12.600 -6.633  3.352   1.00 0.00 ? 42  ARG A CA   3  
ATOM 4866  C C    . ARG A 1 42  ? -12.391 -7.551  4.559   1.00 0.00 ? 42  ARG A C    3  
ATOM 4867  O O    . ARG A 1 42  ? -11.281 -8.024  4.798   1.00 0.00 ? 42  ARG A O    3  
ATOM 4868  C CB   . ARG A 1 42  ? -13.074 -7.468  2.161   1.00 0.00 ? 42  ARG A CB   3  
ATOM 4869  C CG   . ARG A 1 42  ? -14.481 -7.053  1.726   1.00 0.00 ? 42  ARG A CG   3  
ATOM 4870  C CD   . ARG A 1 42  ? -15.516 -8.099  2.145   1.00 0.00 ? 42  ARG A CD   3  
ATOM 4871  N NE   . ARG A 1 42  ? -16.040 -8.800  0.952   1.00 0.00 ? 42  ARG A NE   3  
ATOM 4872  C CZ   . ARG A 1 42  ? -16.821 -9.887  1.002   1.00 0.00 ? 42  ARG A CZ   3  
ATOM 4873  N NH1  . ARG A 1 42  ? -17.175 -10.404 2.186   1.00 0.00 ? 42  ARG A NH1  3  
ATOM 4874  N NH2  . ARG A 1 42  ? -17.250 -10.457 -0.133  1.00 0.00 ? 42  ARG A NH2  3  
ATOM 4875  H H    . ARG A 1 42  ? -10.550 -6.496  3.007   1.00 0.00 ? 42  ARG A H    3  
ATOM 4876  H HA   . ARG A 1 42  ? -13.324 -5.850  3.577   1.00 0.00 ? 42  ARG A HA   3  
ATOM 4877  H HB2  . ARG A 1 42  ? -12.381 -7.347  1.329   1.00 0.00 ? 42  ARG A HB2  3  
ATOM 4878  H HB3  . ARG A 1 42  ? -13.070 -8.525  2.429   1.00 0.00 ? 42  ARG A HB3  3  
ATOM 4879  H HG2  . ARG A 1 42  ? -14.733 -6.089  2.168   1.00 0.00 ? 42  ARG A HG2  3  
ATOM 4880  H HG3  . ARG A 1 42  ? -14.507 -6.924  0.644   1.00 0.00 ? 42  ARG A HG3  3  
ATOM 4881  H HD2  . ARG A 1 42  ? -15.063 -8.816  2.830   1.00 0.00 ? 42  ARG A HD2  3  
ATOM 4882  H HD3  . ARG A 1 42  ? -16.334 -7.618  2.683   1.00 0.00 ? 42  ARG A HD3  3  
ATOM 4883  H HE   . ARG A 1 42  ? -15.794 -8.440  0.052   1.00 0.00 ? 42  ARG A HE   3  
ATOM 4884  H HH11 . ARG A 1 42  ? -16.855 -9.979  3.033   1.00 0.00 ? 42  ARG A HH11 3  
ATOM 4885  H HH12 . ARG A 1 42  ? -17.759 -11.215 2.224   1.00 0.00 ? 42  ARG A HH12 3  
ATOM 4886  H HH21 . ARG A 1 42  ? -16.986 -10.071 -1.017  1.00 0.00 ? 42  ARG A HH21 3  
ATOM 4887  H HH22 . ARG A 1 42  ? -17.833 -11.268 -0.095  1.00 0.00 ? 42  ARG A HH22 3  
ATOM 4888  N N    . GLU A 1 43  ? -13.475 -7.775  5.287   1.00 0.00 ? 43  GLU A N    3  
ATOM 4889  C CA   . GLU A 1 43  ? -13.424 -8.627  6.462   1.00 0.00 ? 43  GLU A CA   3  
ATOM 4890  C C    . GLU A 1 43  ? -13.770 -10.070 6.087   1.00 0.00 ? 43  GLU A C    3  
ATOM 4891  O O    . GLU A 1 43  ? -14.933 -10.390 5.845   1.00 0.00 ? 43  GLU A O    3  
ATOM 4892  C CB   . GLU A 1 43  ? -14.356 -8.107  7.558   1.00 0.00 ? 43  GLU A CB   3  
ATOM 4893  C CG   . GLU A 1 43  ? -13.707 -8.236  8.938   1.00 0.00 ? 43  GLU A CG   3  
ATOM 4894  C CD   . GLU A 1 43  ? -14.714 -7.928  10.048  1.00 0.00 ? 43  GLU A CD   3  
ATOM 4895  O OE1  . GLU A 1 43  ? -15.764 -8.606  10.066  1.00 0.00 ? 43  GLU A OE1  3  
ATOM 4896  O OE2  . GLU A 1 43  ? -14.410 -7.022  10.854  1.00 0.00 ? 43  GLU A OE2  3  
ATOM 4897  H H    . GLU A 1 43  ? -14.374 -7.386  5.085   1.00 0.00 ? 43  GLU A H    3  
ATOM 4898  H HA   . GLU A 1 43  ? -12.394 -8.574  6.815   1.00 0.00 ? 43  GLU A HA   3  
ATOM 4899  H HB2  . GLU A 1 43  ? -14.603 -7.063  7.365   1.00 0.00 ? 43  GLU A HB2  3  
ATOM 4900  H HB3  . GLU A 1 43  ? -15.293 -8.664  7.539   1.00 0.00 ? 43  GLU A HB3  3  
ATOM 4901  H HG2  . GLU A 1 43  ? -13.317 -9.246  9.066   1.00 0.00 ? 43  GLU A HG2  3  
ATOM 4902  H HG3  . GLU A 1 43  ? -12.860 -7.555  9.010   1.00 0.00 ? 43  GLU A HG3  3  
ATOM 4903  N N    . GLY A 1 44  ? -12.740 -10.902 6.052   1.00 0.00 ? 44  GLY A N    3  
ATOM 4904  C CA   . GLY A 1 44  ? -12.921 -12.302 5.710   1.00 0.00 ? 44  GLY A CA   3  
ATOM 4905  C C    . GLY A 1 44  ? -12.094 -12.678 4.479   1.00 0.00 ? 44  GLY A C    3  
ATOM 4906  O O    . GLY A 1 44  ? -11.694 -13.831 4.323   1.00 0.00 ? 44  GLY A O    3  
ATOM 4907  H H    . GLY A 1 44  ? -11.797 -10.633 6.250   1.00 0.00 ? 44  GLY A H    3  
ATOM 4908  H HA2  . GLY A 1 44  ? -12.627 -12.927 6.554   1.00 0.00 ? 44  GLY A HA2  3  
ATOM 4909  H HA3  . GLY A 1 44  ? -13.975 -12.501 5.519   1.00 0.00 ? 44  GLY A HA3  3  
ATOM 4910  N N    . ASP A 1 45  ? -11.862 -11.683 3.635   1.00 0.00 ? 45  ASP A N    3  
ATOM 4911  C CA   . ASP A 1 45  ? -11.091 -11.894 2.422   1.00 0.00 ? 45  ASP A CA   3  
ATOM 4912  C C    . ASP A 1 45  ? -9.612  -11.629 2.711   1.00 0.00 ? 45  ASP A C    3  
ATOM 4913  O O    . ASP A 1 45  ? -9.278  -10.933 3.669   1.00 0.00 ? 45  ASP A O    3  
ATOM 4914  C CB   . ASP A 1 45  ? -11.534 -10.937 1.314   1.00 0.00 ? 45  ASP A CB   3  
ATOM 4915  C CG   . ASP A 1 45  ? -11.085 -9.486  1.494   1.00 0.00 ? 45  ASP A CG   3  
ATOM 4916  O OD1  . ASP A 1 45  ? -10.936 -9.080  2.667   1.00 0.00 ? 45  ASP A OD1  3  
ATOM 4917  O OD2  . ASP A 1 45  ? -10.902 -8.815  0.455   1.00 0.00 ? 45  ASP A OD2  3  
ATOM 4918  H H    . ASP A 1 45  ? -12.191 -10.748 3.769   1.00 0.00 ? 45  ASP A H    3  
ATOM 4919  H HA   . ASP A 1 45  ? -11.281 -12.929 2.138   1.00 0.00 ? 45  ASP A HA   3  
ATOM 4920  H HB2  . ASP A 1 45  ? -11.150 -11.305 0.362   1.00 0.00 ? 45  ASP A HB2  3  
ATOM 4921  H HB3  . ASP A 1 45  ? -12.622 -10.960 1.248   1.00 0.00 ? 45  ASP A HB3  3  
ATOM 4922  N N    . PRO A 1 46  ? -8.743  -12.214 1.844   1.00 0.00 ? 46  PRO A N    3  
ATOM 4923  C CA   . PRO A 1 46  ? -7.308  -12.048 1.996   1.00 0.00 ? 46  PRO A CA   3  
ATOM 4924  C C    . PRO A 1 46  ? -6.866  -10.652 1.552   1.00 0.00 ? 46  PRO A C    3  
ATOM 4925  O O    . PRO A 1 46  ? -7.639  -9.921  0.935   1.00 0.00 ? 46  PRO A O    3  
ATOM 4926  C CB   . PRO A 1 46  ? -6.692  -13.160 1.162   1.00 0.00 ? 46  PRO A CB   3  
ATOM 4927  C CG   . PRO A 1 46  ? -7.783  -13.616 0.206   1.00 0.00 ? 46  PRO A CG   3  
ATOM 4928  C CD   . PRO A 1 46  ? -9.103  -13.045 0.699   1.00 0.00 ? 46  PRO A CD   3  
ATOM 4929  H HA   . PRO A 1 46  ? -7.050  -12.122 2.960   1.00 0.00 ? 46  PRO A HA   3  
ATOM 4930  H HB2  . PRO A 1 46  ? -5.820  -12.801 0.616   1.00 0.00 ? 46  PRO A HB2  3  
ATOM 4931  H HB3  . PRO A 1 46  ? -6.357  -13.982 1.793   1.00 0.00 ? 46  PRO A HB3  3  
ATOM 4932  H HG2  . PRO A 1 46  ? -7.572  -13.271 -0.806  1.00 0.00 ? 46  PRO A HG2  3  
ATOM 4933  H HG3  . PRO A 1 46  ? -7.828  -14.704 0.170   1.00 0.00 ? 46  PRO A HG3  3  
ATOM 4934  H HD2  . PRO A 1 46  ? -9.595  -12.459 -0.077  1.00 0.00 ? 46  PRO A HD2  3  
ATOM 4935  H HD3  . PRO A 1 46  ? -9.794  -13.837 0.986   1.00 0.00 ? 46  PRO A HD3  3  
ATOM 4936  N N    . VAL A 1 47  ? -5.626  -10.325 1.883   1.00 0.00 ? 47  VAL A N    3  
ATOM 4937  C CA   . VAL A 1 47  ? -5.072  -9.030  1.525   1.00 0.00 ? 47  VAL A CA   3  
ATOM 4938  C C    . VAL A 1 47  ? -3.947  -9.225  0.507   1.00 0.00 ? 47  VAL A C    3  
ATOM 4939  O O    . VAL A 1 47  ? -2.922  -9.830  0.819   1.00 0.00 ? 47  VAL A O    3  
ATOM 4940  C CB   . VAL A 1 47  ? -4.619  -8.289  2.785   1.00 0.00 ? 47  VAL A CB   3  
ATOM 4941  C CG1  . VAL A 1 47  ? -4.227  -6.846  2.460   1.00 0.00 ? 47  VAL A CG1  3  
ATOM 4942  C CG2  . VAL A 1 47  ? -5.699  -8.334  3.866   1.00 0.00 ? 47  VAL A CG2  3  
ATOM 4943  H H    . VAL A 1 47  ? -5.004  -10.927 2.385   1.00 0.00 ? 47  VAL A H    3  
ATOM 4944  H HA   . VAL A 1 47  ? -5.869  -8.449  1.060   1.00 0.00 ? 47  VAL A HA   3  
ATOM 4945  H HB   . VAL A 1 47  ? -3.735  -8.797  3.172   1.00 0.00 ? 47  VAL A HB   3  
ATOM 4946  H HG11 . VAL A 1 47  ? -3.796  -6.803  1.460   1.00 0.00 ? 47  VAL A HG11 3  
ATOM 4947  H HG12 . VAL A 1 47  ? -5.111  -6.211  2.503   1.00 0.00 ? 47  VAL A HG12 3  
ATOM 4948  H HG13 . VAL A 1 47  ? -3.493  -6.497  3.187   1.00 0.00 ? 47  VAL A HG13 3  
ATOM 4949  H HG21 . VAL A 1 47  ? -6.158  -9.323  3.881   1.00 0.00 ? 47  VAL A HG21 3  
ATOM 4950  H HG22 . VAL A 1 47  ? -5.250  -8.128  4.838   1.00 0.00 ? 47  VAL A HG22 3  
ATOM 4951  H HG23 . VAL A 1 47  ? -6.460  -7.584  3.652   1.00 0.00 ? 47  VAL A HG23 3  
ATOM 4952  N N    . ASN A 1 48  ? -4.176  -8.701  -0.688  1.00 0.00 ? 48  ASN A N    3  
ATOM 4953  C CA   . ASN A 1 48  ? -3.193  -8.810  -1.753  1.00 0.00 ? 48  ASN A CA   3  
ATOM 4954  C C    . ASN A 1 48  ? -2.179  -7.671  -1.624  1.00 0.00 ? 48  ASN A C    3  
ATOM 4955  O O    . ASN A 1 48  ? -0.978  -7.884  -1.780  1.00 0.00 ? 48  ASN A O    3  
ATOM 4956  C CB   . ASN A 1 48  ? -3.856  -8.698  -3.127  1.00 0.00 ? 48  ASN A CB   3  
ATOM 4957  C CG   . ASN A 1 48  ? -3.132  -9.567  -4.158  1.00 0.00 ? 48  ASN A CG   3  
ATOM 4958  O OD1  . ASN A 1 48  ? -1.949  -9.844  -4.052  1.00 0.00 ? 48  ASN A OD1  3  
ATOM 4959  N ND2  . ASN A 1 48  ? -3.907  -9.980  -5.157  1.00 0.00 ? 48  ASN A ND2  3  
ATOM 4960  H H    . ASN A 1 48  ? -5.012  -8.211  -0.933  1.00 0.00 ? 48  ASN A H    3  
ATOM 4961  H HA   . ASN A 1 48  ? -2.737  -9.791  -1.623  1.00 0.00 ? 48  ASN A HA   3  
ATOM 4962  H HB2  . ASN A 1 48  ? -4.900  -9.005  -3.057  1.00 0.00 ? 48  ASN A HB2  3  
ATOM 4963  H HB3  . ASN A 1 48  ? -3.851  -7.658  -3.455  1.00 0.00 ? 48  ASN A HB3  3  
ATOM 4964  H HD21 . ASN A 1 48  ? -4.871  -9.717  -5.184  1.00 0.00 ? 48  ASN A HD21 3  
ATOM 4965  H HD22 . ASN A 1 48  ? -3.525  -10.554 -5.881  1.00 0.00 ? 48  ASN A HD22 3  
ATOM 4966  N N    . GLU A 1 49  ? -2.701  -6.486  -1.340  1.00 0.00 ? 49  GLU A N    3  
ATOM 4967  C CA   . GLU A 1 49  ? -1.856  -5.314  -1.188  1.00 0.00 ? 49  GLU A CA   3  
ATOM 4968  C C    . GLU A 1 49  ? -2.397  -4.410  -0.079  1.00 0.00 ? 49  GLU A C    3  
ATOM 4969  O O    . GLU A 1 49  ? -3.597  -4.407  0.194   1.00 0.00 ? 49  GLU A O    3  
ATOM 4970  C CB   . GLU A 1 49  ? -1.735  -4.551  -2.508  1.00 0.00 ? 49  GLU A CB   3  
ATOM 4971  C CG   . GLU A 1 49  ? -3.104  -4.063  -2.987  1.00 0.00 ? 49  GLU A CG   3  
ATOM 4972  C CD   . GLU A 1 49  ? -3.948  -5.227  -3.510  1.00 0.00 ? 49  GLU A CD   3  
ATOM 4973  O OE1  . GLU A 1 49  ? -3.579  -5.761  -4.578  1.00 0.00 ? 49  GLU A OE1  3  
ATOM 4974  O OE2  . GLU A 1 49  ? -4.944  -5.557  -2.829  1.00 0.00 ? 49  GLU A OE2  3  
ATOM 4975  H H    . GLU A 1 49  ? -3.679  -6.321  -1.215  1.00 0.00 ? 49  GLU A H    3  
ATOM 4976  H HA   . GLU A 1 49  ? -0.875  -5.698  -0.907  1.00 0.00 ? 49  GLU A HA   3  
ATOM 4977  H HB2  . GLU A 1 49  ? -1.066  -3.699  -2.380  1.00 0.00 ? 49  GLU A HB2  3  
ATOM 4978  H HB3  . GLU A 1 49  ? -1.289  -5.195  -3.266  1.00 0.00 ? 49  GLU A HB3  3  
ATOM 4979  H HG2  . GLU A 1 49  ? -3.626  -3.570  -2.167  1.00 0.00 ? 49  GLU A HG2  3  
ATOM 4980  H HG3  . GLU A 1 49  ? -2.975  -3.321  -3.775  1.00 0.00 ? 49  GLU A HG3  3  
ATOM 4981  N N    . MET A 1 50  ? -1.487  -3.664  0.530   1.00 0.00 ? 50  MET A N    3  
ATOM 4982  C CA   . MET A 1 50  ? -1.858  -2.758  1.603   1.00 0.00 ? 50  MET A CA   3  
ATOM 4983  C C    . MET A 1 50  ? -2.072  -1.338  1.073   1.00 0.00 ? 50  MET A C    3  
ATOM 4984  O O    . MET A 1 50  ? -1.351  -0.890  0.182   1.00 0.00 ? 50  MET A O    3  
ATOM 4985  C CB   . MET A 1 50  ? -0.758  -2.746  2.665   1.00 0.00 ? 50  MET A CB   3  
ATOM 4986  C CG   . MET A 1 50  ? -1.147  -1.857  3.849   1.00 0.00 ? 50  MET A CG   3  
ATOM 4987  S SD   . MET A 1 50  ? -0.423  -2.491  5.352   1.00 0.00 ? 50  MET A SD   3  
ATOM 4988  C CE   . MET A 1 50  ? -0.337  -0.988  6.312   1.00 0.00 ? 50  MET A CE   3  
ATOM 4989  H H    . MET A 1 50  ? -0.514  -3.673  0.302   1.00 0.00 ? 50  MET A H    3  
ATOM 4990  H HA   . MET A 1 50  ? -2.794  -3.147  2.005   1.00 0.00 ? 50  MET A HA   3  
ATOM 4991  H HB2  . MET A 1 50  ? -0.573  -3.762  3.014   1.00 0.00 ? 50  MET A HB2  3  
ATOM 4992  H HB3  . MET A 1 50  ? 0.173   -2.385  2.226   1.00 0.00 ? 50  MET A HB3  3  
ATOM 4993  H HG2  . MET A 1 50  ? -0.809  -0.836  3.674   1.00 0.00 ? 50  MET A HG2  3  
ATOM 4994  H HG3  . MET A 1 50  ? -2.232  -1.821  3.945   1.00 0.00 ? 50  MET A HG3  3  
ATOM 4995  H HE1  . MET A 1 50  ? -1.271  -0.437  6.208   1.00 0.00 ? 50  MET A HE1  3  
ATOM 4996  H HE2  . MET A 1 50  ? -0.175  -1.236  7.361   1.00 0.00 ? 50  MET A HE2  3  
ATOM 4997  H HE3  . MET A 1 50  ? 0.489   -0.374  5.952   1.00 0.00 ? 50  MET A HE3  3  
ATOM 4998  N N    . LEU A 1 51  ? -3.065  -0.671  1.642   1.00 0.00 ? 51  LEU A N    3  
ATOM 4999  C CA   . LEU A 1 51  ? -3.382  0.688   1.238   1.00 0.00 ? 51  LEU A CA   3  
ATOM 5000  C C    . LEU A 1 51  ? -2.998  1.652   2.361   1.00 0.00 ? 51  LEU A C    3  
ATOM 5001  O O    . LEU A 1 51  ? -3.445  1.498   3.497   1.00 0.00 ? 51  LEU A O    3  
ATOM 5002  C CB   . LEU A 1 51  ? -4.848  0.792   0.812   1.00 0.00 ? 51  LEU A CB   3  
ATOM 5003  C CG   . LEU A 1 51  ? -5.244  -0.008  -0.431  1.00 0.00 ? 51  LEU A CG   3  
ATOM 5004  C CD1  . LEU A 1 51  ? -4.062  -0.148  -1.393  1.00 0.00 ? 51  LEU A CD1  3  
ATOM 5005  C CD2  . LEU A 1 51  ? -5.831  -1.367  -0.044  1.00 0.00 ? 51  LEU A CD2  3  
ATOM 5006  H H    . LEU A 1 51  ? -3.646  -1.044  2.365   1.00 0.00 ? 51  LEU A H    3  
ATOM 5007  H HA   . LEU A 1 51  ? -2.775  0.918   0.362   1.00 0.00 ? 51  LEU A HA   3  
ATOM 5008  H HB2  . LEU A 1 51  ? -5.471  0.465   1.644   1.00 0.00 ? 51  LEU A HB2  3  
ATOM 5009  H HB3  . LEU A 1 51  ? -5.080  1.842   0.633   1.00 0.00 ? 51  LEU A HB3  3  
ATOM 5010  H HG   . LEU A 1 51  ? -6.024  0.541   -0.957  1.00 0.00 ? 51  LEU A HG   3  
ATOM 5011  H HD11 . LEU A 1 51  ? -3.326  -0.829  -0.967  1.00 0.00 ? 51  LEU A HD11 3  
ATOM 5012  H HD12 . LEU A 1 51  ? -4.414  -0.542  -2.346  1.00 0.00 ? 51  LEU A HD12 3  
ATOM 5013  H HD13 . LEU A 1 51  ? -3.605  0.829   -1.551  1.00 0.00 ? 51  LEU A HD13 3  
ATOM 5014  H HD21 . LEU A 1 51  ? -6.917  -1.333  -0.135  1.00 0.00 ? 51  LEU A HD21 3  
ATOM 5015  H HD22 . LEU A 1 51  ? -5.435  -2.136  -0.707  1.00 0.00 ? 51  LEU A HD22 3  
ATOM 5016  H HD23 . LEU A 1 51  ? -5.560  -1.600  0.986   1.00 0.00 ? 51  LEU A HD23 3  
ATOM 5017  N N    . PHE A 1 52  ? -2.174  2.627   2.006   1.00 0.00 ? 52  PHE A N    3  
ATOM 5018  C CA   . PHE A 1 52  ? -1.725  3.616   2.970   1.00 0.00 ? 52  PHE A CA   3  
ATOM 5019  C C    . PHE A 1 52  ? -2.444  4.951   2.762   1.00 0.00 ? 52  PHE A C    3  
ATOM 5020  O O    . PHE A 1 52  ? -2.099  5.712   1.860   1.00 0.00 ? 52  PHE A O    3  
ATOM 5021  C CB   . PHE A 1 52  ? -0.225  3.817   2.740   1.00 0.00 ? 52  PHE A CB   3  
ATOM 5022  C CG   . PHE A 1 52  ? 0.631   2.611   3.129   1.00 0.00 ? 52  PHE A CG   3  
ATOM 5023  C CD1  . PHE A 1 52  ? 0.578   1.472   2.387   1.00 0.00 ? 52  PHE A CD1  3  
ATOM 5024  C CD2  . PHE A 1 52  ? 1.445   2.677   4.216   1.00 0.00 ? 52  PHE A CD2  3  
ATOM 5025  C CE1  . PHE A 1 52  ? 1.373   0.352   2.748   1.00 0.00 ? 52  PHE A CE1  3  
ATOM 5026  C CE2  . PHE A 1 52  ? 2.240   1.557   4.577   1.00 0.00 ? 52  PHE A CE2  3  
ATOM 5027  C CZ   . PHE A 1 52  ? 2.187   0.418   3.835   1.00 0.00 ? 52  PHE A CZ   3  
ATOM 5028  H H    . PHE A 1 52  ? -1.815  2.745   1.080   1.00 0.00 ? 52  PHE A H    3  
ATOM 5029  H HA   . PHE A 1 52  ? -1.959  3.230   3.963   1.00 0.00 ? 52  PHE A HA   3  
ATOM 5030  H HB2  . PHE A 1 52  ? -0.057  4.045   1.688   1.00 0.00 ? 52  PHE A HB2  3  
ATOM 5031  H HB3  . PHE A 1 52  ? 0.106   4.684   3.311   1.00 0.00 ? 52  PHE A HB3  3  
ATOM 5032  H HD1  . PHE A 1 52  ? -0.074  1.419   1.515   1.00 0.00 ? 52  PHE A HD1  3  
ATOM 5033  H HD2  . PHE A 1 52  ? 1.487   3.589   4.811   1.00 0.00 ? 52  PHE A HD2  3  
ATOM 5034  H HE1  . PHE A 1 52  ? 1.331   -0.561  2.153   1.00 0.00 ? 52  PHE A HE1  3  
ATOM 5035  H HE2  . PHE A 1 52  ? 2.892   1.609   5.449   1.00 0.00 ? 52  PHE A HE2  3  
ATOM 5036  H HZ   . PHE A 1 52  ? 2.797   -0.442  4.112   1.00 0.00 ? 52  PHE A HZ   3  
ATOM 5037  N N    . ILE A 1 53  ? -3.431  5.193   3.612   1.00 0.00 ? 53  ILE A N    3  
ATOM 5038  C CA   . ILE A 1 53  ? -4.202  6.422   3.533   1.00 0.00 ? 53  ILE A CA   3  
ATOM 5039  C C    . ILE A 1 53  ? -3.270  7.618   3.738   1.00 0.00 ? 53  ILE A C    3  
ATOM 5040  O O    . ILE A 1 53  ? -2.630  7.739   4.781   1.00 0.00 ? 53  ILE A O    3  
ATOM 5041  C CB   . ILE A 1 53  ? -5.376  6.383   4.513   1.00 0.00 ? 53  ILE A CB   3  
ATOM 5042  C CG1  . ILE A 1 53  ? -6.441  5.385   4.052   1.00 0.00 ? 53  ILE A CG1  3  
ATOM 5043  C CG2  . ILE A 1 53  ? -5.956  7.782   4.730   1.00 0.00 ? 53  ILE A CG2  3  
ATOM 5044  C CD1  . ILE A 1 53  ? -6.860  5.659   2.606   1.00 0.00 ? 53  ILE A CD1  3  
ATOM 5045  H H    . ILE A 1 53  ? -3.705  4.569   4.343   1.00 0.00 ? 53  ILE A H    3  
ATOM 5046  H HA   . ILE A 1 53  ? -4.622  6.480   2.529   1.00 0.00 ? 53  ILE A HA   3  
ATOM 5047  H HB   . ILE A 1 53  ? -5.004  6.035   5.477   1.00 0.00 ? 53  ILE A HB   3  
ATOM 5048  H HG12 . ILE A 1 53  ? -6.054  4.370   4.137   1.00 0.00 ? 53  ILE A HG12 3  
ATOM 5049  H HG13 . ILE A 1 53  ? -7.311  5.450   4.705   1.00 0.00 ? 53  ILE A HG13 3  
ATOM 5050  H HG21 . ILE A 1 53  ? -6.140  8.253   3.765   1.00 0.00 ? 53  ILE A HG21 3  
ATOM 5051  H HG22 . ILE A 1 53  ? -6.894  7.704   5.281   1.00 0.00 ? 53  ILE A HG22 3  
ATOM 5052  H HG23 . ILE A 1 53  ? -5.248  8.384   5.300   1.00 0.00 ? 53  ILE A HG23 3  
ATOM 5053  H HD11 . ILE A 1 53  ? -6.096  5.278   1.929   1.00 0.00 ? 53  ILE A HD11 3  
ATOM 5054  H HD12 . ILE A 1 53  ? -7.808  5.161   2.402   1.00 0.00 ? 53  ILE A HD12 3  
ATOM 5055  H HD13 . ILE A 1 53  ? -6.974  6.733   2.458   1.00 0.00 ? 53  ILE A HD13 3  
ATOM 5056  N N    . ILE A 1 54  ? -3.222  8.471   2.725   1.00 0.00 ? 54  ILE A N    3  
ATOM 5057  C CA   . ILE A 1 54  ? -2.379  9.653   2.782   1.00 0.00 ? 54  ILE A CA   3  
ATOM 5058  C C    . ILE A 1 54  ? -3.221  10.855  3.216   1.00 0.00 ? 54  ILE A C    3  
ATOM 5059  O O    . ILE A 1 54  ? -2.830  11.599  4.114   1.00 0.00 ? 54  ILE A O    3  
ATOM 5060  C CB   . ILE A 1 54  ? -1.655  9.859   1.449   1.00 0.00 ? 54  ILE A CB   3  
ATOM 5061  C CG1  . ILE A 1 54  ? -1.011  8.557   0.968   1.00 0.00 ? 54  ILE A CG1  3  
ATOM 5062  C CG2  . ILE A 1 54  ? -0.639  10.999  1.547   1.00 0.00 ? 54  ILE A CG2  3  
ATOM 5063  C CD1  . ILE A 1 54  ? 0.228   8.218   1.800   1.00 0.00 ? 54  ILE A CD1  3  
ATOM 5064  H H    . ILE A 1 54  ? -3.746  8.366   1.880   1.00 0.00 ? 54  ILE A H    3  
ATOM 5065  H HA   . ILE A 1 54  ? -1.616  9.474   3.539   1.00 0.00 ? 54  ILE A HA   3  
ATOM 5066  H HB   . ILE A 1 54  ? -2.393  10.149  0.701   1.00 0.00 ? 54  ILE A HB   3  
ATOM 5067  H HG12 . ILE A 1 54  ? -1.733  7.743   1.037   1.00 0.00 ? 54  ILE A HG12 3  
ATOM 5068  H HG13 . ILE A 1 54  ? -0.735  8.650   -0.082  1.00 0.00 ? 54  ILE A HG13 3  
ATOM 5069  H HG21 . ILE A 1 54  ? -1.036  11.883  1.048   1.00 0.00 ? 54  ILE A HG21 3  
ATOM 5070  H HG22 . ILE A 1 54  ? -0.451  11.228  2.596   1.00 0.00 ? 54  ILE A HG22 3  
ATOM 5071  H HG23 . ILE A 1 54  ? 0.292   10.697  1.068   1.00 0.00 ? 54  ILE A HG23 3  
ATOM 5072  H HD11 . ILE A 1 54  ? 1.112   8.248   1.163   1.00 0.00 ? 54  ILE A HD11 3  
ATOM 5073  H HD12 . ILE A 1 54  ? 0.335   8.946   2.605   1.00 0.00 ? 54  ILE A HD12 3  
ATOM 5074  H HD13 . ILE A 1 54  ? 0.119   7.220   2.224   1.00 0.00 ? 54  ILE A HD13 3  
ATOM 5075  N N    . ARG A 1 55  ? -4.361  11.007  2.559   1.00 0.00 ? 55  ARG A N    3  
ATOM 5076  C CA   . ARG A 1 55  ? -5.261  12.105  2.866   1.00 0.00 ? 55  ARG A CA   3  
ATOM 5077  C C    . ARG A 1 55  ? -6.615  11.888  2.187   1.00 0.00 ? 55  ARG A C    3  
ATOM 5078  O O    . ARG A 1 55  ? -6.680  11.352  1.082   1.00 0.00 ? 55  ARG A O    3  
ATOM 5079  C CB   . ARG A 1 55  ? -4.676  13.442  2.405   1.00 0.00 ? 55  ARG A CB   3  
ATOM 5080  C CG   . ARG A 1 55  ? -4.368  14.347  3.600   1.00 0.00 ? 55  ARG A CG   3  
ATOM 5081  C CD   . ARG A 1 55  ? -3.716  15.653  3.145   1.00 0.00 ? 55  ARG A CD   3  
ATOM 5082  N NE   . ARG A 1 55  ? -4.169  16.771  4.002   1.00 0.00 ? 55  ARG A NE   3  
ATOM 5083  C CZ   . ARG A 1 55  ? -3.877  18.059  3.774   1.00 0.00 ? 55  ARG A CZ   3  
ATOM 5084  N NH1  . ARG A 1 55  ? -3.131  18.399  2.715   1.00 0.00 ? 55  ARG A NH1  3  
ATOM 5085  N NH2  . ARG A 1 55  ? -4.331  19.006  4.606   1.00 0.00 ? 55  ARG A NH2  3  
ATOM 5086  H H    . ARG A 1 55  ? -4.671  10.397  1.829   1.00 0.00 ? 55  ARG A H    3  
ATOM 5087  H HA   . ARG A 1 55  ? -5.360  12.090  3.951   1.00 0.00 ? 55  ARG A HA   3  
ATOM 5088  H HB2  . ARG A 1 55  ? -3.765  13.267  1.833   1.00 0.00 ? 55  ARG A HB2  3  
ATOM 5089  H HB3  . ARG A 1 55  ? -5.380  13.941  1.739   1.00 0.00 ? 55  ARG A HB3  3  
ATOM 5090  H HG2  . ARG A 1 55  ? -5.288  14.565  4.142   1.00 0.00 ? 55  ARG A HG2  3  
ATOM 5091  H HG3  . ARG A 1 55  ? -3.706  13.827  4.293   1.00 0.00 ? 55  ARG A HG3  3  
ATOM 5092  H HD2  . ARG A 1 55  ? -2.630  15.564  3.193   1.00 0.00 ? 55  ARG A HD2  3  
ATOM 5093  H HD3  . ARG A 1 55  ? -3.973  15.855  2.105   1.00 0.00 ? 55  ARG A HD3  3  
ATOM 5094  H HE   . ARG A 1 55  ? -4.728  16.552  4.802   1.00 0.00 ? 55  ARG A HE   3  
ATOM 5095  H HH11 . ARG A 1 55  ? -2.791  17.692  2.094   1.00 0.00 ? 55  ARG A HH11 3  
ATOM 5096  H HH12 . ARG A 1 55  ? -2.913  19.361  2.545   1.00 0.00 ? 55  ARG A HH12 3  
ATOM 5097  H HH21 . ARG A 1 55  ? -4.888  18.752  5.397   1.00 0.00 ? 55  ARG A HH21 3  
ATOM 5098  H HH22 . ARG A 1 55  ? -4.113  19.967  4.436   1.00 0.00 ? 55  ARG A HH22 3  
ATOM 5099  N N    . GLY A 1 56  ? -7.662  12.315  2.877   1.00 0.00 ? 56  GLY A N    3  
ATOM 5100  C CA   . GLY A 1 56  ? -9.011  12.174  2.354   1.00 0.00 ? 56  GLY A CA   3  
ATOM 5101  C C    . GLY A 1 56  ? -9.966  11.660  3.433   1.00 0.00 ? 56  GLY A C    3  
ATOM 5102  O O    . GLY A 1 56  ? -9.783  11.944  4.616   1.00 0.00 ? 56  GLY A O    3  
ATOM 5103  H H    . GLY A 1 56  ? -7.601  12.750  3.775   1.00 0.00 ? 56  GLY A H    3  
ATOM 5104  H HA2  . GLY A 1 56  ? -9.362  13.135  1.980   1.00 0.00 ? 56  GLY A HA2  3  
ATOM 5105  H HA3  . GLY A 1 56  ? -9.007  11.485  1.509   1.00 0.00 ? 56  GLY A HA3  3  
ATOM 5106  N N    . ARG A 1 57  ? -10.964 10.912  2.987   1.00 0.00 ? 57  ARG A N    3  
ATOM 5107  C CA   . ARG A 1 57  ? -11.948 10.355  3.900   1.00 0.00 ? 57  ARG A CA   3  
ATOM 5108  C C    . ARG A 1 57  ? -12.397 8.974   3.419   1.00 0.00 ? 57  ARG A C    3  
ATOM 5109  O O    . ARG A 1 57  ? -12.267 8.651   2.240   1.00 0.00 ? 57  ARG A O    3  
ATOM 5110  C CB   . ARG A 1 57  ? -13.170 11.269  4.016   1.00 0.00 ? 57  ARG A CB   3  
ATOM 5111  C CG   . ARG A 1 57  ? -13.909 11.032  5.335   1.00 0.00 ? 57  ARG A CG   3  
ATOM 5112  C CD   . ARG A 1 57  ? -13.932 12.303  6.187   1.00 0.00 ? 57  ARG A CD   3  
ATOM 5113  N NE   . ARG A 1 57  ? -15.323 12.785  6.337   1.00 0.00 ? 57  ARG A NE   3  
ATOM 5114  C CZ   . ARG A 1 57  ? -15.932 13.604  5.469   1.00 0.00 ? 57  ARG A CZ   3  
ATOM 5115  N NH1  . ARG A 1 57  ? -15.277 14.036  4.383   1.00 0.00 ? 57  ARG A NH1  3  
ATOM 5116  N NH2  . ARG A 1 57  ? -17.197 13.990  5.687   1.00 0.00 ? 57  ARG A NH2  3  
ATOM 5117  H H    . ARG A 1 57  ? -11.106 10.685  2.024   1.00 0.00 ? 57  ARG A H    3  
ATOM 5118  H HA   . ARG A 1 57  ? -11.433 10.289  4.858   1.00 0.00 ? 57  ARG A HA   3  
ATOM 5119  H HB2  . ARG A 1 57  ? -12.857 12.311  3.953   1.00 0.00 ? 57  ARG A HB2  3  
ATOM 5120  H HB3  . ARG A 1 57  ? -13.845 11.088  3.180   1.00 0.00 ? 57  ARG A HB3  3  
ATOM 5121  H HG2  . ARG A 1 57  ? -14.929 10.707  5.131   1.00 0.00 ? 57  ARG A HG2  3  
ATOM 5122  H HG3  . ARG A 1 57  ? -13.423 10.228  5.888   1.00 0.00 ? 57  ARG A HG3  3  
ATOM 5123  H HD2  . ARG A 1 57  ? -13.500 12.101  7.167   1.00 0.00 ? 57  ARG A HD2  3  
ATOM 5124  H HD3  . ARG A 1 57  ? -13.319 13.074  5.720   1.00 0.00 ? 57  ARG A HD3  3  
ATOM 5125  H HE   . ARG A 1 57  ? -15.840 12.482  7.137   1.00 0.00 ? 57  ARG A HE   3  
ATOM 5126  H HH11 . ARG A 1 57  ? -14.334 13.748  4.221   1.00 0.00 ? 57  ARG A HH11 3  
ATOM 5127  H HH12 . ARG A 1 57  ? -15.732 14.647  3.735   1.00 0.00 ? 57  ARG A HH12 3  
ATOM 5128  H HH21 . ARG A 1 57  ? -17.686 13.668  6.497   1.00 0.00 ? 57  ARG A HH21 3  
ATOM 5129  H HH22 . ARG A 1 57  ? -17.652 14.601  5.039   1.00 0.00 ? 57  ARG A HH22 3  
ATOM 5130  N N    . LEU A 1 58  ? -12.916 8.196   4.358   1.00 0.00 ? 58  LEU A N    3  
ATOM 5131  C CA   . LEU A 1 58  ? -13.385 6.857   4.044   1.00 0.00 ? 58  LEU A CA   3  
ATOM 5132  C C    . LEU A 1 58  ? -14.401 6.416   5.101   1.00 0.00 ? 58  LEU A C    3  
ATOM 5133  O O    . LEU A 1 58  ? -14.574 7.087   6.117   1.00 0.00 ? 58  LEU A O    3  
ATOM 5134  C CB   . LEU A 1 58  ? -12.203 5.897   3.891   1.00 0.00 ? 58  LEU A CB   3  
ATOM 5135  C CG   . LEU A 1 58  ? -11.403 6.022   2.593   1.00 0.00 ? 58  LEU A CG   3  
ATOM 5136  C CD1  . LEU A 1 58  ? -10.172 6.909   2.790   1.00 0.00 ? 58  LEU A CD1  3  
ATOM 5137  C CD2  . LEU A 1 58  ? -11.033 4.643   2.042   1.00 0.00 ? 58  LEU A CD2  3  
ATOM 5138  H H    . LEU A 1 58  ? -13.018 8.466   5.315   1.00 0.00 ? 58  LEU A H    3  
ATOM 5139  H HA   . LEU A 1 58  ? -13.889 6.904   3.079   1.00 0.00 ? 58  LEU A HA   3  
ATOM 5140  H HB2  . LEU A 1 58  ? -11.524 6.052   4.729   1.00 0.00 ? 58  LEU A HB2  3  
ATOM 5141  H HB3  . LEU A 1 58  ? -12.576 4.876   3.968   1.00 0.00 ? 58  LEU A HB3  3  
ATOM 5142  H HG   . LEU A 1 58  ? -12.033 6.507   1.848   1.00 0.00 ? 58  LEU A HG   3  
ATOM 5143  H HD11 . LEU A 1 58  ? -9.959  7.445   1.865   1.00 0.00 ? 58  LEU A HD11 3  
ATOM 5144  H HD12 . LEU A 1 58  ? -10.365 7.625   3.589   1.00 0.00 ? 58  LEU A HD12 3  
ATOM 5145  H HD13 . LEU A 1 58  ? -9.316  6.289   3.056   1.00 0.00 ? 58  LEU A HD13 3  
ATOM 5146  H HD21 . LEU A 1 58  ? -11.930 4.145   1.675   1.00 0.00 ? 58  LEU A HD21 3  
ATOM 5147  H HD22 . LEU A 1 58  ? -10.320 4.757   1.225   1.00 0.00 ? 58  LEU A HD22 3  
ATOM 5148  H HD23 . LEU A 1 58  ? -10.584 4.044   2.835   1.00 0.00 ? 58  LEU A HD23 3  
ATOM 5149  N N    . GLU A 1 59  ? -15.045 5.292   4.824   1.00 0.00 ? 59  GLU A N    3  
ATOM 5150  C CA   . GLU A 1 59  ? -16.039 4.755   5.737   1.00 0.00 ? 59  GLU A CA   3  
ATOM 5151  C C    . GLU A 1 59  ? -15.675 3.323   6.135   1.00 0.00 ? 59  GLU A C    3  
ATOM 5152  O O    . GLU A 1 59  ? -15.600 2.438   5.284   1.00 0.00 ? 59  GLU A O    3  
ATOM 5153  C CB   . GLU A 1 59  ? -17.438 4.814   5.122   1.00 0.00 ? 59  GLU A CB   3  
ATOM 5154  C CG   . GLU A 1 59  ? -17.721 3.566   4.283   1.00 0.00 ? 59  GLU A CG   3  
ATOM 5155  C CD   . GLU A 1 59  ? -19.033 3.711   3.509   1.00 0.00 ? 59  GLU A CD   3  
ATOM 5156  O OE1  . GLU A 1 59  ? -20.090 3.701   4.177   1.00 0.00 ? 59  GLU A OE1  3  
ATOM 5157  O OE2  . GLU A 1 59  ? -18.950 3.829   2.267   1.00 0.00 ? 59  GLU A OE2  3  
ATOM 5158  H H    . GLU A 1 59  ? -14.898 4.753   3.994   1.00 0.00 ? 59  GLU A H    3  
ATOM 5159  H HA   . GLU A 1 59  ? -16.007 5.402   6.614   1.00 0.00 ? 59  GLU A HA   3  
ATOM 5160  H HB2  . GLU A 1 59  ? -18.184 4.902   5.912   1.00 0.00 ? 59  GLU A HB2  3  
ATOM 5161  H HB3  . GLU A 1 59  ? -17.528 5.703   4.498   1.00 0.00 ? 59  GLU A HB3  3  
ATOM 5162  H HG2  . GLU A 1 59  ? -16.900 3.398   3.585   1.00 0.00 ? 59  GLU A HG2  3  
ATOM 5163  H HG3  . GLU A 1 59  ? -17.772 2.691   4.931   1.00 0.00 ? 59  GLU A HG3  3  
ATOM 5164  N N    . SER A 1 60  ? -15.458 3.140   7.429   1.00 0.00 ? 60  SER A N    3  
ATOM 5165  C CA   . SER A 1 60  ? -15.103 1.830   7.950   1.00 0.00 ? 60  SER A CA   3  
ATOM 5166  C C    . SER A 1 60  ? -16.332 1.165   8.573   1.00 0.00 ? 60  SER A C    3  
ATOM 5167  O O    . SER A 1 60  ? -17.121 1.821   9.251   1.00 0.00 ? 60  SER A O    3  
ATOM 5168  C CB   . SER A 1 60  ? -13.977 1.934   8.980   1.00 0.00 ? 60  SER A CB   3  
ATOM 5169  O OG   . SER A 1 60  ? -14.476 2.152   10.297  1.00 0.00 ? 60  SER A OG   3  
ATOM 5170  H H    . SER A 1 60  ? -15.521 3.864   8.115   1.00 0.00 ? 60  SER A H    3  
ATOM 5171  H HA   . SER A 1 60  ? -14.755 1.261   7.088   1.00 0.00 ? 60  SER A HA   3  
ATOM 5172  H HB2  . SER A 1 60  ? -13.385 1.019   8.963   1.00 0.00 ? 60  SER A HB2  3  
ATOM 5173  H HB3  . SER A 1 60  ? -13.309 2.750   8.706   1.00 0.00 ? 60  SER A HB3  3  
ATOM 5174  H HG   . SER A 1 60  ? -14.465 3.129   10.510  1.00 0.00 ? 60  SER A HG   3  
ATOM 5175  N N    . VAL A 1 61  ? -16.456 -0.130  8.321   1.00 0.00 ? 61  VAL A N    3  
ATOM 5176  C CA   . VAL A 1 61  ? -17.575 -0.892  8.848   1.00 0.00 ? 61  VAL A CA   3  
ATOM 5177  C C    . VAL A 1 61  ? -17.102 -2.301  9.209   1.00 0.00 ? 61  VAL A C    3  
ATOM 5178  O O    . VAL A 1 61  ? -16.159 -2.816  8.611   1.00 0.00 ? 61  VAL A O    3  
ATOM 5179  C CB   . VAL A 1 61  ? -18.730 -0.887  7.845   1.00 0.00 ? 61  VAL A CB   3  
ATOM 5180  C CG1  . VAL A 1 61  ? -19.632 -2.107  8.042   1.00 0.00 ? 61  VAL A CG1  3  
ATOM 5181  C CG2  . VAL A 1 61  ? -19.535 0.410   7.941   1.00 0.00 ? 61  VAL A CG2  3  
ATOM 5182  H H    . VAL A 1 61  ? -15.809 -0.657  7.769   1.00 0.00 ? 61  VAL A H    3  
ATOM 5183  H HA   . VAL A 1 61  ? -17.914 -0.392  9.756   1.00 0.00 ? 61  VAL A HA   3  
ATOM 5184  H HB   . VAL A 1 61  ? -18.304 -0.944  6.843   1.00 0.00 ? 61  VAL A HB   3  
ATOM 5185  H HG11 . VAL A 1 61  ? -19.074 -3.014  7.805   1.00 0.00 ? 61  VAL A HG11 3  
ATOM 5186  H HG12 . VAL A 1 61  ? -19.968 -2.148  9.078   1.00 0.00 ? 61  VAL A HG12 3  
ATOM 5187  H HG13 . VAL A 1 61  ? -20.497 -2.031  7.382   1.00 0.00 ? 61  VAL A HG13 3  
ATOM 5188  H HG21 . VAL A 1 61  ? -19.207 0.977   8.812   1.00 0.00 ? 61  VAL A HG21 3  
ATOM 5189  H HG22 . VAL A 1 61  ? -19.376 1.004   7.040   1.00 0.00 ? 61  VAL A HG22 3  
ATOM 5190  H HG23 . VAL A 1 61  ? -20.594 0.175   8.038   1.00 0.00 ? 61  VAL A HG23 3  
ATOM 5191  N N    . THR A 1 62  ? -17.779 -2.886  10.187  1.00 0.00 ? 62  THR A N    3  
ATOM 5192  C CA   . THR A 1 62  ? -17.440 -4.226  10.635  1.00 0.00 ? 62  THR A CA   3  
ATOM 5193  C C    . THR A 1 62  ? -18.710 -5.028  10.927  1.00 0.00 ? 62  THR A C    3  
ATOM 5194  O O    . THR A 1 62  ? -19.752 -4.454  11.240  1.00 0.00 ? 62  THR A O    3  
ATOM 5195  C CB   . THR A 1 62  ? -16.510 -4.100  11.842  1.00 0.00 ? 62  THR A CB   3  
ATOM 5196  O OG1  . THR A 1 62  ? -16.018 -5.422  12.042  1.00 0.00 ? 62  THR A OG1  3  
ATOM 5197  C CG2  . THR A 1 62  ? -17.267 -3.785  13.134  1.00 0.00 ? 62  THR A CG2  3  
ATOM 5198  H H    . THR A 1 62  ? -18.545 -2.461  10.669  1.00 0.00 ? 62  THR A H    3  
ATOM 5199  H HA   . THR A 1 62  ? -16.919 -4.737  9.825   1.00 0.00 ? 62  THR A HA   3  
ATOM 5200  H HB   . THR A 1 62  ? -15.731 -3.360  11.658  1.00 0.00 ? 62  THR A HB   3  
ATOM 5201  H HG1  . THR A 1 62  ? -16.764 -6.026  12.323  1.00 0.00 ? 62  THR A HG1  3  
ATOM 5202  H HG21 . THR A 1 62  ? -18.301 -3.535  12.898  1.00 0.00 ? 62  THR A HG21 3  
ATOM 5203  H HG22 . THR A 1 62  ? -17.244 -4.656  13.790  1.00 0.00 ? 62  THR A HG22 3  
ATOM 5204  H HG23 . THR A 1 62  ? -16.794 -2.941  13.636  1.00 0.00 ? 62  THR A HG23 3  
ATOM 5205  N N    . THR A 1 63  ? -18.581 -6.342  10.815  1.00 0.00 ? 63  THR A N    3  
ATOM 5206  C CA   . THR A 1 63  ? -19.705 -7.228  11.063  1.00 0.00 ? 63  THR A CA   3  
ATOM 5207  C C    . THR A 1 63  ? -19.248 -8.688  11.041  1.00 0.00 ? 63  THR A C    3  
ATOM 5208  O O    . THR A 1 63  ? -19.781 -9.498  10.284  1.00 0.00 ? 63  THR A O    3  
ATOM 5209  C CB   . THR A 1 63  ? -20.791 -6.916  10.032  1.00 0.00 ? 63  THR A CB   3  
ATOM 5210  O OG1  . THR A 1 63  ? -21.757 -7.945  10.222  1.00 0.00 ? 63  THR A OG1  3  
ATOM 5211  C CG2  . THR A 1 63  ? -20.308 -7.118  8.594   1.00 0.00 ? 63  THR A CG2  3  
ATOM 5212  H H    . THR A 1 63  ? -17.730 -6.800  10.560  1.00 0.00 ? 63  THR A H    3  
ATOM 5213  H HA   . THR A 1 63  ? -20.086 -7.027  12.065  1.00 0.00 ? 63  THR A HA   3  
ATOM 5214  H HB   . THR A 1 63  ? -21.183 -5.908  10.172  1.00 0.00 ? 63  THR A HB   3  
ATOM 5215  H HG1  . THR A 1 63  ? -22.047 -7.970  11.178  1.00 0.00 ? 63  THR A HG1  3  
ATOM 5216  H HG21 . THR A 1 63  ? -19.416 -7.744  8.595   1.00 0.00 ? 63  THR A HG21 3  
ATOM 5217  H HG22 . THR A 1 63  ? -21.092 -7.604  8.012   1.00 0.00 ? 63  THR A HG22 3  
ATOM 5218  H HG23 . THR A 1 63  ? -20.073 -6.151  8.150   1.00 0.00 ? 63  THR A HG23 3  
ATOM 5219  N N    . ASP A 1 64  ? -18.266 -8.980  11.881  1.00 0.00 ? 64  ASP A N    3  
ATOM 5220  C CA   . ASP A 1 64  ? -17.732 -10.328 11.968  1.00 0.00 ? 64  ASP A CA   3  
ATOM 5221  C C    . ASP A 1 64  ? -18.638 -11.175 12.864  1.00 0.00 ? 64  ASP A C    3  
ATOM 5222  O O    . ASP A 1 64  ? -18.718 -10.943 14.069  1.00 0.00 ? 64  ASP A O    3  
ATOM 5223  C CB   . ASP A 1 64  ? -16.330 -10.327 12.581  1.00 0.00 ? 64  ASP A CB   3  
ATOM 5224  C CG   . ASP A 1 64  ? -16.217 -9.624  13.935  1.00 0.00 ? 64  ASP A CG   3  
ATOM 5225  O OD1  . ASP A 1 64  ? -17.096 -8.780  14.212  1.00 0.00 ? 64  ASP A OD1  3  
ATOM 5226  O OD2  . ASP A 1 64  ? -15.254 -9.948  14.664  1.00 0.00 ? 64  ASP A OD2  3  
ATOM 5227  H H    . ASP A 1 64  ? -17.839 -8.316  12.494  1.00 0.00 ? 64  ASP A H    3  
ATOM 5228  H HA   . ASP A 1 64  ? -17.703 -10.692 10.941  1.00 0.00 ? 64  ASP A HA   3  
ATOM 5229  H HB2  . ASP A 1 64  ? -15.998 -11.359 12.695  1.00 0.00 ? 64  ASP A HB2  3  
ATOM 5230  H HB3  . ASP A 1 64  ? -15.645 -9.847  11.882  1.00 0.00 ? 64  ASP A HB3  3  
ATOM 5231  N N    . GLY A 1 65  ? -19.298 -12.140 12.240  1.00 0.00 ? 65  GLY A N    3  
ATOM 5232  C CA   . GLY A 1 65  ? -20.196 -13.022 12.965  1.00 0.00 ? 65  GLY A CA   3  
ATOM 5233  C C    . GLY A 1 65  ? -21.263 -12.223 13.716  1.00 0.00 ? 65  GLY A C    3  
ATOM 5234  O O    . GLY A 1 65  ? -20.980 -11.624 14.752  1.00 0.00 ? 65  GLY A O    3  
ATOM 5235  H H    . GLY A 1 65  ? -19.228 -12.322 11.259  1.00 0.00 ? 65  GLY A H    3  
ATOM 5236  H HA2  . GLY A 1 65  ? -20.675 -13.712 12.270  1.00 0.00 ? 65  GLY A HA2  3  
ATOM 5237  H HA3  . GLY A 1 65  ? -19.626 -13.627 13.671  1.00 0.00 ? 65  GLY A HA3  3  
ATOM 5238  N N    . GLY A 1 66  ? -22.467 -12.240 13.163  1.00 0.00 ? 66  GLY A N    3  
ATOM 5239  C CA   . GLY A 1 66  ? -23.578 -11.524 13.767  1.00 0.00 ? 66  GLY A CA   3  
ATOM 5240  C C    . GLY A 1 66  ? -24.666 -12.493 14.234  1.00 0.00 ? 66  GLY A C    3  
ATOM 5241  O O    . GLY A 1 66  ? -24.390 -13.664 14.491  1.00 0.00 ? 66  GLY A O    3  
ATOM 5242  H H    . GLY A 1 66  ? -22.689 -12.730 12.320  1.00 0.00 ? 66  GLY A H    3  
ATOM 5243  H HA2  . GLY A 1 66  ? -23.220 -10.938 14.614  1.00 0.00 ? 66  GLY A HA2  3  
ATOM 5244  H HA3  . GLY A 1 66  ? -23.997 -10.821 13.047  1.00 0.00 ? 66  GLY A HA3  3  
ATOM 5245  N N    . ARG A 1 67  ? -25.879 -11.969 14.330  1.00 0.00 ? 67  ARG A N    3  
ATOM 5246  C CA   . ARG A 1 67  ? -27.010 -12.773 14.761  1.00 0.00 ? 67  ARG A CA   3  
ATOM 5247  C C    . ARG A 1 67  ? -28.294 -11.942 14.734  1.00 0.00 ? 67  ARG A C    3  
ATOM 5248  O O    . ARG A 1 67  ? -29.276 -12.332 14.105  1.00 0.00 ? 67  ARG A O    3  
ATOM 5249  C CB   . ARG A 1 67  ? -26.792 -13.316 16.175  1.00 0.00 ? 67  ARG A CB   3  
ATOM 5250  C CG   . ARG A 1 67  ? -27.525 -14.645 16.371  1.00 0.00 ? 67  ARG A CG   3  
ATOM 5251  C CD   . ARG A 1 67  ? -28.235 -14.684 17.726  1.00 0.00 ? 67  ARG A CD   3  
ATOM 5252  N NE   . ARG A 1 67  ? -29.221 -15.787 17.748  1.00 0.00 ? 67  ARG A NE   3  
ATOM 5253  C CZ   . ARG A 1 67  ? -30.048 -16.035 18.773  1.00 0.00 ? 67  ARG A CZ   3  
ATOM 5254  N NH1  . ARG A 1 67  ? -30.013 -15.260 19.865  1.00 0.00 ? 67  ARG A NH1  3  
ATOM 5255  N NH2  . ARG A 1 67  ? -30.910 -17.059 18.706  1.00 0.00 ? 67  ARG A NH2  3  
ATOM 5256  H H    . ARG A 1 67  ? -26.095 -11.016 14.119  1.00 0.00 ? 67  ARG A H    3  
ATOM 5257  H HA   . ARG A 1 67  ? -27.058 -13.593 14.045  1.00 0.00 ? 67  ARG A HA   3  
ATOM 5258  H HB2  . ARG A 1 67  ? -25.726 -13.455 16.355  1.00 0.00 ? 67  ARG A HB2  3  
ATOM 5259  H HB3  . ARG A 1 67  ? -27.146 -12.589 16.906  1.00 0.00 ? 67  ARG A HB3  3  
ATOM 5260  H HG2  . ARG A 1 67  ? -28.252 -14.785 15.571  1.00 0.00 ? 67  ARG A HG2  3  
ATOM 5261  H HG3  . ARG A 1 67  ? -26.815 -15.469 16.305  1.00 0.00 ? 67  ARG A HG3  3  
ATOM 5262  H HD2  . ARG A 1 67  ? -27.506 -14.820 18.525  1.00 0.00 ? 67  ARG A HD2  3  
ATOM 5263  H HD3  . ARG A 1 67  ? -28.737 -13.734 17.911  1.00 0.00 ? 67  ARG A HD3  3  
ATOM 5264  H HE   . ARG A 1 67  ? -29.274 -16.386 16.949  1.00 0.00 ? 67  ARG A HE   3  
ATOM 5265  H HH11 . ARG A 1 67  ? -29.369 -14.496 19.916  1.00 0.00 ? 67  ARG A HH11 3  
ATOM 5266  H HH12 . ARG A 1 67  ? -30.630 -15.444 20.630  1.00 0.00 ? 67  ARG A HH12 3  
ATOM 5267  H HH21 . ARG A 1 67  ? -30.937 -17.638 17.891  1.00 0.00 ? 67  ARG A HH21 3  
ATOM 5268  H HH22 . ARG A 1 67  ? -31.527 -17.244 19.471  1.00 0.00 ? 67  ARG A HH22 3  
ATOM 5269  N N    . SER A 1 68  ? -28.244 -10.812 15.423  1.00 0.00 ? 68  SER A N    3  
ATOM 5270  C CA   . SER A 1 68  ? -29.391 -9.922  15.486  1.00 0.00 ? 68  SER A CA   3  
ATOM 5271  C C    . SER A 1 68  ? -29.328 -8.907  14.343  1.00 0.00 ? 68  SER A C    3  
ATOM 5272  O O    . SER A 1 68  ? -30.252 -8.818  13.535  1.00 0.00 ? 68  SER A O    3  
ATOM 5273  C CB   . SER A 1 68  ? -29.455 -9.200  16.833  1.00 0.00 ? 68  SER A CB   3  
ATOM 5274  O OG   . SER A 1 68  ? -29.569 -10.112 17.922  1.00 0.00 ? 68  SER A OG   3  
ATOM 5275  H H    . SER A 1 68  ? -27.440 -10.502 15.932  1.00 0.00 ? 68  SER A H    3  
ATOM 5276  H HA   . SER A 1 68  ? -30.263 -10.567 15.377  1.00 0.00 ? 68  SER A HA   3  
ATOM 5277  H HB2  . SER A 1 68  ? -28.560 -8.592  16.962  1.00 0.00 ? 68  SER A HB2  3  
ATOM 5278  H HB3  . SER A 1 68  ? -30.307 -8.520  16.840  1.00 0.00 ? 68  SER A HB3  3  
ATOM 5279  H HG   . SER A 1 68  ? -29.435 -11.049 17.599  1.00 0.00 ? 68  SER A HG   3  
ATOM 5280  N N    . GLY A 1 69  ? -28.230 -8.166  14.311  1.00 0.00 ? 69  GLY A N    3  
ATOM 5281  C CA   . GLY A 1 69  ? -28.036 -7.160  13.280  1.00 0.00 ? 69  GLY A CA   3  
ATOM 5282  C C    . GLY A 1 69  ? -27.518 -5.852  13.882  1.00 0.00 ? 69  GLY A C    3  
ATOM 5283  O O    . GLY A 1 69  ? -28.296 -4.939  14.153  1.00 0.00 ? 69  GLY A O    3  
ATOM 5284  H H    . GLY A 1 69  ? -27.484 -8.244  14.972  1.00 0.00 ? 69  GLY A H    3  
ATOM 5285  H HA2  . GLY A 1 69  ? -27.328 -7.528  12.537  1.00 0.00 ? 69  GLY A HA2  3  
ATOM 5286  H HA3  . GLY A 1 69  ? -28.977 -6.979  12.762  1.00 0.00 ? 69  GLY A HA3  3  
ATOM 5287  N N    . PHE A 1 70  ? -26.208 -5.803  14.072  1.00 0.00 ? 70  PHE A N    3  
ATOM 5288  C CA   . PHE A 1 70  ? -25.577 -4.622  14.636  1.00 0.00 ? 70  PHE A CA   3  
ATOM 5289  C C    . PHE A 1 70  ? -24.233 -4.343  13.962  1.00 0.00 ? 70  PHE A C    3  
ATOM 5290  O O    . PHE A 1 70  ? -23.236 -4.999  14.262  1.00 0.00 ? 70  PHE A O    3  
ATOM 5291  C CB   . PHE A 1 70  ? -25.341 -4.907  16.121  1.00 0.00 ? 70  PHE A CB   3  
ATOM 5292  C CG   . PHE A 1 70  ? -25.866 -3.815  17.055  1.00 0.00 ? 70  PHE A CG   3  
ATOM 5293  C CD1  . PHE A 1 70  ? -25.422 -2.536  16.924  1.00 0.00 ? 70  PHE A CD1  3  
ATOM 5294  C CD2  . PHE A 1 70  ? -26.776 -4.123  18.017  1.00 0.00 ? 70  PHE A CD2  3  
ATOM 5295  C CE1  . PHE A 1 70  ? -25.909 -1.523  17.792  1.00 0.00 ? 70  PHE A CE1  3  
ATOM 5296  C CE2  . PHE A 1 70  ? -27.263 -3.110  18.885  1.00 0.00 ? 70  PHE A CE2  3  
ATOM 5297  C CZ   . PHE A 1 70  ? -26.819 -1.831  18.754  1.00 0.00 ? 70  PHE A CZ   3  
ATOM 5298  H H    . PHE A 1 70  ? -25.582 -6.550  13.849  1.00 0.00 ? 70  PHE A H    3  
ATOM 5299  H HA   . PHE A 1 70  ? -26.250 -3.782  14.462  1.00 0.00 ? 70  PHE A HA   3  
ATOM 5300  H HB2  . PHE A 1 70  ? -25.817 -5.852  16.379  1.00 0.00 ? 70  PHE A HB2  3  
ATOM 5301  H HB3  . PHE A 1 70  ? -24.271 -5.032  16.290  1.00 0.00 ? 70  PHE A HB3  3  
ATOM 5302  H HD1  . PHE A 1 70  ? -24.692 -2.289  16.153  1.00 0.00 ? 70  PHE A HD1  3  
ATOM 5303  H HD2  . PHE A 1 70  ? -27.132 -5.148  18.123  1.00 0.00 ? 70  PHE A HD2  3  
ATOM 5304  H HE1  . PHE A 1 70  ? -25.553 -0.498  17.687  1.00 0.00 ? 70  PHE A HE1  3  
ATOM 5305  H HE2  . PHE A 1 70  ? -27.993 -3.357  19.656  1.00 0.00 ? 70  PHE A HE2  3  
ATOM 5306  H HZ   . PHE A 1 70  ? -27.193 -1.054  19.420  1.00 0.00 ? 70  PHE A HZ   3  
ATOM 5307  N N    . TYR A 1 71  ? -24.248 -3.370  13.064  1.00 0.00 ? 71  TYR A N    3  
ATOM 5308  C CA   . TYR A 1 71  ? -23.042 -2.996  12.344  1.00 0.00 ? 71  TYR A CA   3  
ATOM 5309  C C    . TYR A 1 71  ? -22.376 -1.777  12.985  1.00 0.00 ? 71  TYR A C    3  
ATOM 5310  O O    . TYR A 1 71  ? -22.959 -0.694  13.021  1.00 0.00 ? 71  TYR A O    3  
ATOM 5311  C CB   . TYR A 1 71  ? -23.491 -2.631  10.928  1.00 0.00 ? 71  TYR A CB   3  
ATOM 5312  C CG   . TYR A 1 71  ? -23.601 -3.829  9.982   1.00 0.00 ? 71  TYR A CG   3  
ATOM 5313  C CD1  . TYR A 1 71  ? -24.666 -4.699  10.091  1.00 0.00 ? 71  TYR A CD1  3  
ATOM 5314  C CD2  . TYR A 1 71  ? -22.634 -4.038  9.020   1.00 0.00 ? 71  TYR A CD2  3  
ATOM 5315  C CE1  . TYR A 1 71  ? -24.769 -5.826  9.200   1.00 0.00 ? 71  TYR A CE1  3  
ATOM 5316  C CE2  . TYR A 1 71  ? -22.737 -5.165  8.129   1.00 0.00 ? 71  TYR A CE2  3  
ATOM 5317  C CZ   . TYR A 1 71  ? -23.799 -6.004  8.264   1.00 0.00 ? 71  TYR A CZ   3  
ATOM 5318  O OH   . TYR A 1 71  ? -23.897 -7.068  7.423   1.00 0.00 ? 71  TYR A OH   3  
ATOM 5319  H H    . TYR A 1 71  ? -25.063 -2.841  12.825  1.00 0.00 ? 71  TYR A H    3  
ATOM 5320  H HA   . TYR A 1 71  ? -22.352 -3.839  12.383  1.00 0.00 ? 71  TYR A HA   3  
ATOM 5321  H HB2  . TYR A 1 71  ? -24.460 -2.134  10.982  1.00 0.00 ? 71  TYR A HB2  3  
ATOM 5322  H HB3  . TYR A 1 71  ? -22.788 -1.913  10.508  1.00 0.00 ? 71  TYR A HB3  3  
ATOM 5323  H HD1  . TYR A 1 71  ? -25.430 -4.533  10.851  1.00 0.00 ? 71  TYR A HD1  3  
ATOM 5324  H HD2  . TYR A 1 71  ? -21.793 -3.351  8.934   1.00 0.00 ? 71  TYR A HD2  3  
ATOM 5325  H HE1  . TYR A 1 71  ? -25.605 -6.521  9.276   1.00 0.00 ? 71  TYR A HE1  3  
ATOM 5326  H HE2  . TYR A 1 71  ? -21.980 -5.343  7.365   1.00 0.00 ? 71  TYR A HE2  3  
ATOM 5327  H HH   . TYR A 1 71  ? -24.693 -7.623  7.664   1.00 0.00 ? 71  TYR A HH   3  
ATOM 5328  N N    . ASN A 1 72  ? -21.165 -1.993  13.476  1.00 0.00 ? 72  ASN A N    3  
ATOM 5329  C CA   . ASN A 1 72  ? -20.414 -0.925  14.114  1.00 0.00 ? 72  ASN A CA   3  
ATOM 5330  C C    . ASN A 1 72  ? -19.732 -0.075  13.040  1.00 0.00 ? 72  ASN A C    3  
ATOM 5331  O O    . ASN A 1 72  ? -18.646 -0.414  12.571  1.00 0.00 ? 72  ASN A O    3  
ATOM 5332  C CB   . ASN A 1 72  ? -19.327 -1.488  15.032  1.00 0.00 ? 72  ASN A CB   3  
ATOM 5333  C CG   . ASN A 1 72  ? -19.929 -2.013  16.337  1.00 0.00 ? 72  ASN A CG   3  
ATOM 5334  O OD1  . ASN A 1 72  ? -20.506 -1.281  17.123  1.00 0.00 ? 72  ASN A OD1  3  
ATOM 5335  N ND2  . ASN A 1 72  ? -19.763 -3.320  16.521  1.00 0.00 ? 72  ASN A ND2  3  
ATOM 5336  H H    . ASN A 1 72  ? -20.698 -2.877  13.443  1.00 0.00 ? 72  ASN A H    3  
ATOM 5337  H HA   . ASN A 1 72  ? -21.149 -0.361  14.688  1.00 0.00 ? 72  ASN A HA   3  
ATOM 5338  H HB2  . ASN A 1 72  ? -18.796 -2.293  14.522  1.00 0.00 ? 72  ASN A HB2  3  
ATOM 5339  H HB3  . ASN A 1 72  ? -18.594 -0.712  15.252  1.00 0.00 ? 72  ASN A HB3  3  
ATOM 5340  H HD21 . ASN A 1 72  ? -19.280 -3.865  15.836  1.00 0.00 ? 72  ASN A HD21 3  
ATOM 5341  H HD22 . ASN A 1 72  ? -20.122 -3.758  17.346  1.00 0.00 ? 72  ASN A HD22 3  
ATOM 5342  N N    . ARG A 1 73  ? -20.397 1.013   12.681  1.00 0.00 ? 73  ARG A N    3  
ATOM 5343  C CA   . ARG A 1 73  ? -19.869 1.914   11.671  1.00 0.00 ? 73  ARG A CA   3  
ATOM 5344  C C    . ARG A 1 73  ? -18.920 2.930   12.310  1.00 0.00 ? 73  ARG A C    3  
ATOM 5345  O O    . ARG A 1 73  ? -19.162 3.396   13.423  1.00 0.00 ? 73  ARG A O    3  
ATOM 5346  C CB   . ARG A 1 73  ? -20.996 2.660   10.955  1.00 0.00 ? 73  ARG A CB   3  
ATOM 5347  C CG   . ARG A 1 73  ? -20.435 3.698   9.980   1.00 0.00 ? 73  ARG A CG   3  
ATOM 5348  C CD   . ARG A 1 73  ? -21.560 4.505   9.331   1.00 0.00 ? 73  ARG A CD   3  
ATOM 5349  N NE   . ARG A 1 73  ? -21.065 5.847   8.950   1.00 0.00 ? 73  ARG A NE   3  
ATOM 5350  C CZ   . ARG A 1 73  ? -21.857 6.908   8.741   1.00 0.00 ? 73  ARG A CZ   3  
ATOM 5351  N NH1  . ARG A 1 73  ? -23.185 6.790   8.875   1.00 0.00 ? 73  ARG A NH1  3  
ATOM 5352  N NH2  . ARG A 1 73  ? -21.320 8.087   8.399   1.00 0.00 ? 73  ARG A NH2  3  
ATOM 5353  H H    . ARG A 1 73  ? -21.280 1.282   13.067  1.00 0.00 ? 73  ARG A H    3  
ATOM 5354  H HA   . ARG A 1 73  ? -19.339 1.268   10.971  1.00 0.00 ? 73  ARG A HA   3  
ATOM 5355  H HB2  . ARG A 1 73  ? -21.622 1.950   10.415  1.00 0.00 ? 73  ARG A HB2  3  
ATOM 5356  H HB3  . ARG A 1 73  ? -21.634 3.154   11.688  1.00 0.00 ? 73  ARG A HB3  3  
ATOM 5357  H HG2  . ARG A 1 73  ? -19.758 4.369   10.509  1.00 0.00 ? 73  ARG A HG2  3  
ATOM 5358  H HG3  . ARG A 1 73  ? -19.849 3.197   9.209   1.00 0.00 ? 73  ARG A HG3  3  
ATOM 5359  H HD2  . ARG A 1 73  ? -21.932 3.983   8.450   1.00 0.00 ? 73  ARG A HD2  3  
ATOM 5360  H HD3  . ARG A 1 73  ? -22.397 4.600   10.023  1.00 0.00 ? 73  ARG A HD3  3  
ATOM 5361  H HE   . ARG A 1 73  ? -20.079 5.970   8.842   1.00 0.00 ? 73  ARG A HE   3  
ATOM 5362  H HH11 . ARG A 1 73  ? -23.585 5.910   9.130   1.00 0.00 ? 73  ARG A HH11 3  
ATOM 5363  H HH12 . ARG A 1 73  ? -23.775 7.582   8.719   1.00 0.00 ? 73  ARG A HH12 3  
ATOM 5364  H HH21 . ARG A 1 73  ? -20.329 8.176   8.300   1.00 0.00 ? 73  ARG A HH21 3  
ATOM 5365  H HH22 . ARG A 1 73  ? -21.910 8.879   8.243   1.00 0.00 ? 73  ARG A HH22 3  
ATOM 5366  N N    . SER A 1 74  ? -17.860 3.243   11.580  1.00 0.00 ? 74  SER A N    3  
ATOM 5367  C CA   . SER A 1 74  ? -16.873 4.194   12.061  1.00 0.00 ? 74  SER A CA   3  
ATOM 5368  C C    . SER A 1 74  ? -16.257 4.951   10.883  1.00 0.00 ? 74  SER A C    3  
ATOM 5369  O O    . SER A 1 74  ? -16.505 4.614   9.726   1.00 0.00 ? 74  SER A O    3  
ATOM 5370  C CB   . SER A 1 74  ? -15.781 3.493   12.872  1.00 0.00 ? 74  SER A CB   3  
ATOM 5371  O OG   . SER A 1 74  ? -16.292 2.922   14.073  1.00 0.00 ? 74  SER A OG   3  
ATOM 5372  H H    . SER A 1 74  ? -17.671 2.859   10.676  1.00 0.00 ? 74  SER A H    3  
ATOM 5373  H HA   . SER A 1 74  ? -17.423 4.878   12.709  1.00 0.00 ? 74  SER A HA   3  
ATOM 5374  H HB2  . SER A 1 74  ? -15.324 2.712   12.264  1.00 0.00 ? 74  SER A HB2  3  
ATOM 5375  H HB3  . SER A 1 74  ? -14.995 4.208   13.115  1.00 0.00 ? 74  SER A HB3  3  
ATOM 5376  H HG   . SER A 1 74  ? -15.767 3.252   14.858  1.00 0.00 ? 74  SER A HG   3  
ATOM 5377  N N    . LEU A 1 75  ? -15.464 5.959   11.217  1.00 0.00 ? 75  LEU A N    3  
ATOM 5378  C CA   . LEU A 1 75  ? -14.810 6.765   10.201  1.00 0.00 ? 75  LEU A CA   3  
ATOM 5379  C C    . LEU A 1 75  ? -13.308 6.819   10.486  1.00 0.00 ? 75  LEU A C    3  
ATOM 5380  O O    . LEU A 1 75  ? -12.883 6.641   11.627  1.00 0.00 ? 75  LEU A O    3  
ATOM 5381  C CB   . LEU A 1 75  ? -15.468 8.144   10.106  1.00 0.00 ? 75  LEU A CB   3  
ATOM 5382  C CG   . LEU A 1 75  ? -15.232 8.911   8.803   1.00 0.00 ? 75  LEU A CG   3  
ATOM 5383  C CD1  . LEU A 1 75  ? -16.312 8.584   7.771   1.00 0.00 ? 75  LEU A CD1  3  
ATOM 5384  C CD2  . LEU A 1 75  ? -15.125 10.415  9.064   1.00 0.00 ? 75  LEU A CD2  3  
ATOM 5385  H H    . LEU A 1 75  ? -15.267 6.226   12.160  1.00 0.00 ? 75  LEU A H    3  
ATOM 5386  H HA   . LEU A 1 75  ? -14.962 6.269   9.242   1.00 0.00 ? 75  LEU A HA   3  
ATOM 5387  H HB2  . LEU A 1 75  ? -16.542 8.022   10.243  1.00 0.00 ? 75  LEU A HB2  3  
ATOM 5388  H HB3  . LEU A 1 75  ? -15.107 8.754   10.934  1.00 0.00 ? 75  LEU A HB3  3  
ATOM 5389  H HG   . LEU A 1 75  ? -14.278 8.588   8.385   1.00 0.00 ? 75  LEU A HG   3  
ATOM 5390  H HD11 . LEU A 1 75  ? -17.247 9.065   8.058   1.00 0.00 ? 75  LEU A HD11 3  
ATOM 5391  H HD12 . LEU A 1 75  ? -16.001 8.948   6.792   1.00 0.00 ? 75  LEU A HD12 3  
ATOM 5392  H HD13 . LEU A 1 75  ? -16.458 7.504   7.727   1.00 0.00 ? 75  LEU A HD13 3  
ATOM 5393  H HD21 . LEU A 1 75  ? -14.088 10.730  8.954   1.00 0.00 ? 75  LEU A HD21 3  
ATOM 5394  H HD22 . LEU A 1 75  ? -15.747 10.953  8.348   1.00 0.00 ? 75  LEU A HD22 3  
ATOM 5395  H HD23 . LEU A 1 75  ? -15.465 10.633  10.077  1.00 0.00 ? 75  LEU A HD23 3  
ATOM 5396  N N    . LEU A 1 76  ? -12.546 7.064   9.431   1.00 0.00 ? 76  LEU A N    3  
ATOM 5397  C CA   . LEU A 1 76  ? -11.100 7.143   9.554   1.00 0.00 ? 76  LEU A CA   3  
ATOM 5398  C C    . LEU A 1 76  ? -10.618 8.483   8.997   1.00 0.00 ? 76  LEU A C    3  
ATOM 5399  O O    . LEU A 1 76  ? -11.314 9.118   8.207   1.00 0.00 ? 76  LEU A O    3  
ATOM 5400  C CB   . LEU A 1 76  ? -10.439 5.930   8.896   1.00 0.00 ? 76  LEU A CB   3  
ATOM 5401  C CG   . LEU A 1 76  ? -11.119 4.581   9.141   1.00 0.00 ? 76  LEU A CG   3  
ATOM 5402  C CD1  . LEU A 1 76  ? -10.672 3.546   8.106   1.00 0.00 ? 76  LEU A CD1  3  
ATOM 5403  C CD2  . LEU A 1 76  ? -10.880 4.098   10.573  1.00 0.00 ? 76  LEU A CD2  3  
ATOM 5404  H H    . LEU A 1 76  ? -12.900 7.207   8.507   1.00 0.00 ? 76  LEU A H    3  
ATOM 5405  H HA   . LEU A 1 76  ? -10.860 7.103   10.617  1.00 0.00 ? 76  LEU A HA   3  
ATOM 5406  H HB2  . LEU A 1 76  ? -10.396 6.103   7.821   1.00 0.00 ? 76  LEU A HB2  3  
ATOM 5407  H HB3  . LEU A 1 76  ? -9.410  5.865   9.250   1.00 0.00 ? 76  LEU A HB3  3  
ATOM 5408  H HG   . LEU A 1 76  ? -12.194 4.713   9.021   1.00 0.00 ? 76  LEU A HG   3  
ATOM 5409  H HD11 . LEU A 1 76  ? -10.648 2.559   8.566   1.00 0.00 ? 76  LEU A HD11 3  
ATOM 5410  H HD12 . LEU A 1 76  ? -11.374 3.541   7.271   1.00 0.00 ? 76  LEU A HD12 3  
ATOM 5411  H HD13 . LEU A 1 76  ? -9.677  3.802   7.742   1.00 0.00 ? 76  LEU A HD13 3  
ATOM 5412  H HD21 . LEU A 1 76  ? -10.937 3.010   10.604  1.00 0.00 ? 76  LEU A HD21 3  
ATOM 5413  H HD22 . LEU A 1 76  ? -9.894  4.421   10.906  1.00 0.00 ? 76  LEU A HD22 3  
ATOM 5414  H HD23 . LEU A 1 76  ? -11.641 4.520   11.230  1.00 0.00 ? 76  LEU A HD23 3  
ATOM 5415  N N    . LYS A 1 77  ? -9.428  8.875   9.431   1.00 0.00 ? 77  LYS A N    3  
ATOM 5416  C CA   . LYS A 1 77  ? -8.845  10.128  8.986   1.00 0.00 ? 77  LYS A CA   3  
ATOM 5417  C C    . LYS A 1 77  ? -7.362  9.914   8.677   1.00 0.00 ? 77  LYS A C    3  
ATOM 5418  O O    . LYS A 1 77  ? -6.843  8.810   8.840   1.00 0.00 ? 77  LYS A O    3  
ATOM 5419  C CB   . LYS A 1 77  ? -9.106  11.235  10.010  1.00 0.00 ? 77  LYS A CB   3  
ATOM 5420  C CG   . LYS A 1 77  ? -8.119  11.146  11.176  1.00 0.00 ? 77  LYS A CG   3  
ATOM 5421  C CD   . LYS A 1 77  ? -8.196  12.396  12.055  1.00 0.00 ? 77  LYS A CD   3  
ATOM 5422  C CE   . LYS A 1 77  ? -6.856  12.665  12.744  1.00 0.00 ? 77  LYS A CE   3  
ATOM 5423  N NZ   . LYS A 1 77  ? -6.931  13.898  13.558  1.00 0.00 ? 77  LYS A NZ   3  
ATOM 5424  H H    . LYS A 1 77  ? -8.868  8.352   10.074  1.00 0.00 ? 77  LYS A H    3  
ATOM 5425  H HA   . LYS A 1 77  ? -9.351  10.416  8.065   1.00 0.00 ? 77  LYS A HA   3  
ATOM 5426  H HB2  . LYS A 1 77  ? -9.019  12.209  9.529   1.00 0.00 ? 77  LYS A HB2  3  
ATOM 5427  H HB3  . LYS A 1 77  ? -10.126 11.155  10.385  1.00 0.00 ? 77  LYS A HB3  3  
ATOM 5428  H HG2  . LYS A 1 77  ? -8.337  10.262  11.775  1.00 0.00 ? 77  LYS A HG2  3  
ATOM 5429  H HG3  . LYS A 1 77  ? -7.106  11.029  10.792  1.00 0.00 ? 77  LYS A HG3  3  
ATOM 5430  H HD2  . LYS A 1 77  ? -8.475  13.256  11.447  1.00 0.00 ? 77  LYS A HD2  3  
ATOM 5431  H HD3  . LYS A 1 77  ? -8.976  12.270  12.806  1.00 0.00 ? 77  LYS A HD3  3  
ATOM 5432  H HE2  . LYS A 1 77  ? -6.590  11.819  13.377  1.00 0.00 ? 77  LYS A HE2  3  
ATOM 5433  H HE3  . LYS A 1 77  ? -6.069  12.764  11.996  1.00 0.00 ? 77  LYS A HE3  3  
ATOM 5434  H HZ1  . LYS A 1 77  ? -6.824  13.666  14.525  1.00 0.00 ? 77  LYS A HZ1  3  
ATOM 5435  H HZ2  . LYS A 1 77  ? -6.201  14.525  13.283  1.00 0.00 ? 77  LYS A HZ2  3  
ATOM 5436  H HZ3  . LYS A 1 77  ? -7.818  14.338  13.418  1.00 0.00 ? 77  LYS A HZ3  3  
ATOM 5437  N N    . GLU A 1 78  ? -6.721  10.987  8.236   1.00 0.00 ? 78  GLU A N    3  
ATOM 5438  C CA   . GLU A 1 78  ? -5.308  10.930  7.903   1.00 0.00 ? 78  GLU A CA   3  
ATOM 5439  C C    . GLU A 1 78  ? -4.508  10.362  9.077   1.00 0.00 ? 78  GLU A C    3  
ATOM 5440  O O    . GLU A 1 78  ? -4.625  10.844  10.203  1.00 0.00 ? 78  GLU A O    3  
ATOM 5441  C CB   . GLU A 1 78  ? -4.784  12.309  7.498   1.00 0.00 ? 78  GLU A CB   3  
ATOM 5442  C CG   . GLU A 1 78  ? -5.015  13.332  8.612   1.00 0.00 ? 78  GLU A CG   3  
ATOM 5443  C CD   . GLU A 1 78  ? -4.442  14.698  8.230   1.00 0.00 ? 78  GLU A CD   3  
ATOM 5444  O OE1  . GLU A 1 78  ? -3.204  14.772  8.079   1.00 0.00 ? 78  GLU A OE1  3  
ATOM 5445  O OE2  . GLU A 1 78  ? -5.256  15.637  8.097   1.00 0.00 ? 78  GLU A OE2  3  
ATOM 5446  H H    . GLU A 1 78  ? -7.150  11.880  8.106   1.00 0.00 ? 78  GLU A H    3  
ATOM 5447  H HA   . GLU A 1 78  ? -5.238  10.256  7.048   1.00 0.00 ? 78  GLU A HA   3  
ATOM 5448  H HB2  . GLU A 1 78  ? -3.719  12.246  7.273   1.00 0.00 ? 78  GLU A HB2  3  
ATOM 5449  H HB3  . GLU A 1 78  ? -5.283  12.639  6.587   1.00 0.00 ? 78  GLU A HB3  3  
ATOM 5450  H HG2  . GLU A 1 78  ? -6.083  13.424  8.811   1.00 0.00 ? 78  GLU A HG2  3  
ATOM 5451  H HG3  . GLU A 1 78  ? -4.548  12.983  9.533   1.00 0.00 ? 78  GLU A HG3  3  
ATOM 5452  N N    . GLY A 1 79  ? -3.712  9.347   8.774   1.00 0.00 ? 79  GLY A N    3  
ATOM 5453  C CA   . GLY A 1 79  ? -2.893  8.709   9.791   1.00 0.00 ? 79  GLY A CA   3  
ATOM 5454  C C    . GLY A 1 79  ? -3.307  7.249   9.992   1.00 0.00 ? 79  GLY A C    3  
ATOM 5455  O O    . GLY A 1 79  ? -2.471  6.400   10.295  1.00 0.00 ? 79  GLY A O    3  
ATOM 5456  H H    . GLY A 1 79  ? -3.623  8.961   7.856   1.00 0.00 ? 79  GLY A H    3  
ATOM 5457  H HA2  . GLY A 1 79  ? -1.844  8.756   9.500   1.00 0.00 ? 79  GLY A HA2  3  
ATOM 5458  H HA3  . GLY A 1 79  ? -2.988  9.250   10.732  1.00 0.00 ? 79  GLY A HA3  3  
ATOM 5459  N N    . ASP A 1 80  ? -4.597  7.003   9.815   1.00 0.00 ? 80  ASP A N    3  
ATOM 5460  C CA   . ASP A 1 80  ? -5.131  5.662   9.973   1.00 0.00 ? 80  ASP A CA   3  
ATOM 5461  C C    . ASP A 1 80  ? -4.764  4.823   8.747   1.00 0.00 ? 80  ASP A C    3  
ATOM 5462  O O    . ASP A 1 80  ? -4.743  5.331   7.627   1.00 0.00 ? 80  ASP A O    3  
ATOM 5463  C CB   . ASP A 1 80  ? -6.657  5.686   10.089  1.00 0.00 ? 80  ASP A CB   3  
ATOM 5464  C CG   . ASP A 1 80  ? -7.223  4.980   11.322  1.00 0.00 ? 80  ASP A CG   3  
ATOM 5465  O OD1  . ASP A 1 80  ? -7.301  3.733   11.276  1.00 0.00 ? 80  ASP A OD1  3  
ATOM 5466  O OD2  . ASP A 1 80  ? -7.565  5.703   12.283  1.00 0.00 ? 80  ASP A OD2  3  
ATOM 5467  H H    . ASP A 1 80  ? -5.270  7.700   9.569   1.00 0.00 ? 80  ASP A H    3  
ATOM 5468  H HA   . ASP A 1 80  ? -4.681  5.280   10.889  1.00 0.00 ? 80  ASP A HA   3  
ATOM 5469  H HB2  . ASP A 1 80  ? -6.988  6.725   10.099  1.00 0.00 ? 80  ASP A HB2  3  
ATOM 5470  H HB3  . ASP A 1 80  ? -7.081  5.225   9.197   1.00 0.00 ? 80  ASP A HB3  3  
ATOM 5471  N N    . PHE A 1 81  ? -4.482  3.554   9.001   1.00 0.00 ? 81  PHE A N    3  
ATOM 5472  C CA   . PHE A 1 81  ? -4.116  2.640   7.932   1.00 0.00 ? 81  PHE A CA   3  
ATOM 5473  C C    . PHE A 1 81  ? -5.108  1.478   7.840   1.00 0.00 ? 81  PHE A C    3  
ATOM 5474  O O    . PHE A 1 81  ? -5.848  1.213   8.786   1.00 0.00 ? 81  PHE A O    3  
ATOM 5475  C CB   . PHE A 1 81  ? -2.731  2.087   8.271   1.00 0.00 ? 81  PHE A CB   3  
ATOM 5476  C CG   . PHE A 1 81  ? -2.436  2.022   9.771   1.00 0.00 ? 81  PHE A CG   3  
ATOM 5477  C CD1  . PHE A 1 81  ? -2.777  0.915   10.483  1.00 0.00 ? 81  PHE A CD1  3  
ATOM 5478  C CD2  . PHE A 1 81  ? -1.834  3.071   10.392  1.00 0.00 ? 81  PHE A CD2  3  
ATOM 5479  C CE1  . PHE A 1 81  ? -2.504  0.854   11.875  1.00 0.00 ? 81  PHE A CE1  3  
ATOM 5480  C CE2  . PHE A 1 81  ? -1.561  3.011   11.784  1.00 0.00 ? 81  PHE A CE2  3  
ATOM 5481  C CZ   . PHE A 1 81  ? -1.901  1.904   12.496  1.00 0.00 ? 81  PHE A CZ   3  
ATOM 5482  H H    . PHE A 1 81  ? -4.501  3.149   9.915   1.00 0.00 ? 81  PHE A H    3  
ATOM 5483  H HA   . PHE A 1 81  ? -4.136  3.207   7.001   1.00 0.00 ? 81  PHE A HA   3  
ATOM 5484  H HB2  . PHE A 1 81  ? -2.637  1.086   7.849   1.00 0.00 ? 81  PHE A HB2  3  
ATOM 5485  H HB3  . PHE A 1 81  ? -1.975  2.708   7.789   1.00 0.00 ? 81  PHE A HB3  3  
ATOM 5486  H HD1  . PHE A 1 81  ? -3.260  0.074   9.986   1.00 0.00 ? 81  PHE A HD1  3  
ATOM 5487  H HD2  . PHE A 1 81  ? -1.561  3.959   9.820   1.00 0.00 ? 81  PHE A HD2  3  
ATOM 5488  H HE1  . PHE A 1 81  ? -2.777  -0.033  12.447  1.00 0.00 ? 81  PHE A HE1  3  
ATOM 5489  H HE2  . PHE A 1 81  ? -1.078  3.852   12.281  1.00 0.00 ? 81  PHE A HE2  3  
ATOM 5490  H HZ   . PHE A 1 81  ? -1.692  1.858   13.565  1.00 0.00 ? 81  PHE A HZ   3  
ATOM 5491  N N    . CYS A 1 82  ? -5.090  0.816   6.693   1.00 0.00 ? 82  CYS A N    3  
ATOM 5492  C CA   . CYS A 1 82  ? -5.978  -0.311  6.465   1.00 0.00 ? 82  CYS A CA   3  
ATOM 5493  C C    . CYS A 1 82  ? -5.123  -1.546  6.176   1.00 0.00 ? 82  CYS A C    3  
ATOM 5494  O O    . CYS A 1 82  ? -3.943  -1.426  5.851   1.00 0.00 ? 82  CYS A O    3  
ATOM 5495  C CB   . CYS A 1 82  ? -6.973  -0.029  5.337   1.00 0.00 ? 82  CYS A CB   3  
ATOM 5496  S SG   . CYS A 1 82  ? -7.960  1.461   5.731   1.00 0.00 ? 82  CYS A SG   3  
ATOM 5497  H H    . CYS A 1 82  ? -4.485  1.038   5.928   1.00 0.00 ? 82  CYS A H    3  
ATOM 5498  H HA   . CYS A 1 82  ? -6.555  -0.445  7.380   1.00 0.00 ? 82  CYS A HA   3  
ATOM 5499  H HB2  . CYS A 1 82  ? -6.439  0.117   4.398   1.00 0.00 ? 82  CYS A HB2  3  
ATOM 5500  H HB3  . CYS A 1 82  ? -7.632  -0.886  5.199   1.00 0.00 ? 82  CYS A HB3  3  
ATOM 5501  H HG   . CYS A 1 82  ? -7.283  1.791   6.827   1.00 0.00 ? 82  CYS A HG   3  
ATOM 5502  N N    . GLY A 1 83  ? -5.751  -2.705  6.306   1.00 0.00 ? 83  GLY A N    3  
ATOM 5503  C CA   . GLY A 1 83  ? -5.063  -3.961  6.062   1.00 0.00 ? 83  GLY A CA   3  
ATOM 5504  C C    . GLY A 1 83  ? -3.617  -3.899  6.559   1.00 0.00 ? 83  GLY A C    3  
ATOM 5505  O O    . GLY A 1 83  ? -2.696  -4.303  5.851   1.00 0.00 ? 83  GLY A O    3  
ATOM 5506  H H    . GLY A 1 83  ? -6.712  -2.794  6.571   1.00 0.00 ? 83  GLY A H    3  
ATOM 5507  H HA2  . GLY A 1 83  ? -5.589  -4.772  6.566   1.00 0.00 ? 83  GLY A HA2  3  
ATOM 5508  H HA3  . GLY A 1 83  ? -5.075  -4.187  4.996   1.00 0.00 ? 83  GLY A HA3  3  
ATOM 5509  N N    . ASP A 1 84  ? -3.463  -3.388  7.772   1.00 0.00 ? 84  ASP A N    3  
ATOM 5510  C CA   . ASP A 1 84  ? -2.145  -3.267  8.371   1.00 0.00 ? 84  ASP A CA   3  
ATOM 5511  C C    . ASP A 1 84  ? -1.543  -4.662  8.554   1.00 0.00 ? 84  ASP A C    3  
ATOM 5512  O O    . ASP A 1 84  ? -0.337  -4.847  8.398   1.00 0.00 ? 84  ASP A O    3  
ATOM 5513  C CB   . ASP A 1 84  ? -2.224  -2.602  9.747   1.00 0.00 ? 84  ASP A CB   3  
ATOM 5514  C CG   . ASP A 1 84  ? -2.403  -3.565  10.921  1.00 0.00 ? 84  ASP A CG   3  
ATOM 5515  O OD1  . ASP A 1 84  ? -3.513  -4.129  11.028  1.00 0.00 ? 84  ASP A OD1  3  
ATOM 5516  O OD2  . ASP A 1 84  ? -1.426  -3.716  11.686  1.00 0.00 ? 84  ASP A OD2  3  
ATOM 5517  H H    . ASP A 1 84  ? -4.217  -3.061  8.341   1.00 0.00 ? 84  ASP A H    3  
ATOM 5518  H HA   . ASP A 1 84  ? -1.570  -2.653  7.678   1.00 0.00 ? 84  ASP A HA   3  
ATOM 5519  H HB2  . ASP A 1 84  ? -1.314  -2.023  9.906   1.00 0.00 ? 84  ASP A HB2  3  
ATOM 5520  H HB3  . ASP A 1 84  ? -3.055  -1.896  9.745   1.00 0.00 ? 84  ASP A HB3  3  
ATOM 5521  N N    . GLU A 1 85  ? -2.411  -5.607  8.884   1.00 0.00 ? 85  GLU A N    3  
ATOM 5522  C CA   . GLU A 1 85  ? -1.980  -6.979  9.090   1.00 0.00 ? 85  GLU A CA   3  
ATOM 5523  C C    . GLU A 1 85  ? -0.947  -7.376  8.033   1.00 0.00 ? 85  GLU A C    3  
ATOM 5524  O O    . GLU A 1 85  ? 0.043   -8.037  8.345   1.00 0.00 ? 85  GLU A O    3  
ATOM 5525  C CB   . GLU A 1 85  ? -3.173  -7.937  9.077   1.00 0.00 ? 85  GLU A CB   3  
ATOM 5526  C CG   . GLU A 1 85  ? -3.542  -8.373  10.496  1.00 0.00 ? 85  GLU A CG   3  
ATOM 5527  C CD   . GLU A 1 85  ? -2.572  -9.439  11.011  1.00 0.00 ? 85  GLU A CD   3  
ATOM 5528  O OE1  . GLU A 1 85  ? -1.456  -9.044  11.412  1.00 0.00 ? 85  GLU A OE1  3  
ATOM 5529  O OE2  . GLU A 1 85  ? -2.968  -10.624 10.993  1.00 0.00 ? 85  GLU A OE2  3  
ATOM 5530  H H    . GLU A 1 85  ? -3.390  -5.448  9.009   1.00 0.00 ? 85  GLU A H    3  
ATOM 5531  H HA   . GLU A 1 85  ? -1.522  -6.994  10.079  1.00 0.00 ? 85  GLU A HA   3  
ATOM 5532  H HB2  . GLU A 1 85  ? -4.029  -7.451  8.608   1.00 0.00 ? 85  GLU A HB2  3  
ATOM 5533  H HB3  . GLU A 1 85  ? -2.935  -8.813  8.473   1.00 0.00 ? 85  GLU A HB3  3  
ATOM 5534  H HG2  . GLU A 1 85  ? -3.527  -7.510  11.161  1.00 0.00 ? 85  GLU A HG2  3  
ATOM 5535  H HG3  . GLU A 1 85  ? -4.558  -8.766  10.507  1.00 0.00 ? 85  GLU A HG3  3  
ATOM 5536  N N    . LEU A 1 86  ? -1.212  -6.955  6.805   1.00 0.00 ? 86  LEU A N    3  
ATOM 5537  C CA   . LEU A 1 86  ? -0.318  -7.258  5.701   1.00 0.00 ? 86  LEU A CA   3  
ATOM 5538  C C    . LEU A 1 86  ? 1.107   -6.845  6.076   1.00 0.00 ? 86  LEU A C    3  
ATOM 5539  O O    . LEU A 1 86  ? 2.050   -7.611  5.882   1.00 0.00 ? 86  LEU A O    3  
ATOM 5540  C CB   . LEU A 1 86  ? -0.825  -6.615  4.409   1.00 0.00 ? 86  LEU A CB   3  
ATOM 5541  C CG   . LEU A 1 86  ? -0.032  -6.941  3.141   1.00 0.00 ? 86  LEU A CG   3  
ATOM 5542  C CD1  . LEU A 1 86  ? -0.037  -8.445  2.863   1.00 0.00 ? 86  LEU A CD1  3  
ATOM 5543  C CD2  . LEU A 1 86  ? -0.551  -6.135  1.948   1.00 0.00 ? 86  LEU A CD2  3  
ATOM 5544  H H    . LEU A 1 86  ? -2.019  -6.418  6.561   1.00 0.00 ? 86  LEU A H    3  
ATOM 5545  H HA   . LEU A 1 86  ? -0.337  -8.338  5.552   1.00 0.00 ? 86  LEU A HA   3  
ATOM 5546  H HB2  . LEU A 1 86  ? -1.859  -6.921  4.255   1.00 0.00 ? 86  LEU A HB2  3  
ATOM 5547  H HB3  . LEU A 1 86  ? -0.829  -5.533  4.543   1.00 0.00 ? 86  LEU A HB3  3  
ATOM 5548  H HG   . LEU A 1 86  ? 1.005   -6.646  3.302   1.00 0.00 ? 86  LEU A HG   3  
ATOM 5549  H HD11 . LEU A 1 86  ? -0.925  -8.894  3.309   1.00 0.00 ? 86  LEU A HD11 3  
ATOM 5550  H HD12 . LEU A 1 86  ? -0.045  -8.616  1.787   1.00 0.00 ? 86  LEU A HD12 3  
ATOM 5551  H HD13 . LEU A 1 86  ? 0.855   -8.898  3.296   1.00 0.00 ? 86  LEU A HD13 3  
ATOM 5552  H HD21 . LEU A 1 86  ? 0.268   -5.563  1.513   1.00 0.00 ? 86  LEU A HD21 3  
ATOM 5553  H HD22 . LEU A 1 86  ? -0.957  -6.816  1.200   1.00 0.00 ? 86  LEU A HD22 3  
ATOM 5554  H HD23 . LEU A 1 86  ? -1.333  -5.454  2.282   1.00 0.00 ? 86  LEU A HD23 3  
ATOM 5555  N N    . LEU A 1 87  ? 1.218   -5.636  6.606   1.00 0.00 ? 87  LEU A N    3  
ATOM 5556  C CA   . LEU A 1 87  ? 2.512   -5.112  7.010   1.00 0.00 ? 87  LEU A CA   3  
ATOM 5557  C C    . LEU A 1 87  ? 3.211   -6.131  7.913   1.00 0.00 ? 87  LEU A C    3  
ATOM 5558  O O    . LEU A 1 87  ? 4.325   -6.563  7.621   1.00 0.00 ? 87  LEU A O    3  
ATOM 5559  C CB   . LEU A 1 87  ? 2.355   -3.731  7.649   1.00 0.00 ? 87  LEU A CB   3  
ATOM 5560  C CG   . LEU A 1 87  ? 3.480   -2.732  7.372   1.00 0.00 ? 87  LEU A CG   3  
ATOM 5561  C CD1  . LEU A 1 87  ? 3.303   -2.072  6.003   1.00 0.00 ? 87  LEU A CD1  3  
ATOM 5562  C CD2  . LEU A 1 87  ? 3.587   -1.700  8.497   1.00 0.00 ? 87  LEU A CD2  3  
ATOM 5563  H H    . LEU A 1 87  ? 0.446   -5.020  6.761   1.00 0.00 ? 87  LEU A H    3  
ATOM 5564  H HA   . LEU A 1 87  ? 3.109   -4.984  6.107   1.00 0.00 ? 87  LEU A HA   3  
ATOM 5565  H HB2  . LEU A 1 87  ? 1.417   -3.297  7.302   1.00 0.00 ? 87  LEU A HB2  3  
ATOM 5566  H HB3  . LEU A 1 87  ? 2.267   -3.859  8.728   1.00 0.00 ? 87  LEU A HB3  3  
ATOM 5567  H HG   . LEU A 1 87  ? 4.423   -3.279  7.346   1.00 0.00 ? 87  LEU A HG   3  
ATOM 5568  H HD11 . LEU A 1 87  ? 4.212   -2.203  5.416   1.00 0.00 ? 87  LEU A HD11 3  
ATOM 5569  H HD12 . LEU A 1 87  ? 2.465   -2.534  5.483   1.00 0.00 ? 87  LEU A HD12 3  
ATOM 5570  H HD13 . LEU A 1 87  ? 3.107   -1.008  6.136   1.00 0.00 ? 87  LEU A HD13 3  
ATOM 5571  H HD21 . LEU A 1 87  ? 4.284   -0.915  8.204   1.00 0.00 ? 87  LEU A HD21 3  
ATOM 5572  H HD22 . LEU A 1 87  ? 2.606   -1.264  8.684   1.00 0.00 ? 87  LEU A HD22 3  
ATOM 5573  H HD23 . LEU A 1 87  ? 3.947   -2.187  9.403   1.00 0.00 ? 87  LEU A HD23 3  
ATOM 5574  N N    . THR A 1 88  ? 2.527   -6.485  8.991   1.00 0.00 ? 88  THR A N    3  
ATOM 5575  C CA   . THR A 1 88  ? 3.068   -7.445  9.938   1.00 0.00 ? 88  THR A CA   3  
ATOM 5576  C C    . THR A 1 88  ? 3.253   -8.809  9.269   1.00 0.00 ? 88  THR A C    3  
ATOM 5577  O O    . THR A 1 88  ? 4.275   -9.466  9.463   1.00 0.00 ? 88  THR A O    3  
ATOM 5578  C CB   . THR A 1 88  ? 2.139   -7.486  11.153  1.00 0.00 ? 88  THR A CB   3  
ATOM 5579  O OG1  . THR A 1 88  ? 2.841   -6.749  12.151  1.00 0.00 ? 88  THR A OG1  3  
ATOM 5580  C CG2  . THR A 1 88  ? 2.013   -8.891  11.747  1.00 0.00 ? 88  THR A CG2  3  
ATOM 5581  H H    . THR A 1 88  ? 1.622   -6.129  9.221   1.00 0.00 ? 88  THR A H    3  
ATOM 5582  H HA   . THR A 1 88  ? 4.056   -7.104  10.247  1.00 0.00 ? 88  THR A HA   3  
ATOM 5583  H HB   . THR A 1 88  ? 1.159   -7.077  10.908  1.00 0.00 ? 88  THR A HB   3  
ATOM 5584  H HG1  . THR A 1 88  ? 3.659   -7.250  12.435  1.00 0.00 ? 88  THR A HG1  3  
ATOM 5585  H HG21 . THR A 1 88  ? 1.425   -8.846  12.664  1.00 0.00 ? 88  THR A HG21 3  
ATOM 5586  H HG22 . THR A 1 88  ? 1.517   -9.545  11.029  1.00 0.00 ? 88  THR A HG22 3  
ATOM 5587  H HG23 . THR A 1 88  ? 3.005   -9.282  11.970  1.00 0.00 ? 88  THR A HG23 3  
ATOM 5588  N N    . TRP A 1 89  ? 2.249   -9.193  8.495   1.00 0.00 ? 89  TRP A N    3  
ATOM 5589  C CA   . TRP A 1 89  ? 2.288   -10.466 7.796   1.00 0.00 ? 89  TRP A CA   3  
ATOM 5590  C C    . TRP A 1 89  ? 3.695   -10.647 7.221   1.00 0.00 ? 89  TRP A C    3  
ATOM 5591  O O    . TRP A 1 89  ? 4.415   -11.564 7.610   1.00 0.00 ? 89  TRP A O    3  
ATOM 5592  C CB   . TRP A 1 89  ? 1.193   -10.541 6.731   1.00 0.00 ? 89  TRP A CB   3  
ATOM 5593  C CG   . TRP A 1 89  ? 1.386   -11.670 5.717   1.00 0.00 ? 89  TRP A CG   3  
ATOM 5594  C CD1  . TRP A 1 89  ? 0.987   -12.946 5.816   1.00 0.00 ? 89  TRP A CD1  3  
ATOM 5595  C CD2  . TRP A 1 89  ? 2.047   -11.573 4.438   1.00 0.00 ? 89  TRP A CD2  3  
ATOM 5596  N NE1  . TRP A 1 89  ? 1.342   -13.675 4.699   1.00 0.00 ? 89  TRP A NE1  3  
ATOM 5597  C CE2  . TRP A 1 89  ? 2.007   -12.814 3.834   1.00 0.00 ? 89  TRP A CE2  3  
ATOM 5598  C CE3  . TRP A 1 89  ? 2.660   -10.474 3.811   1.00 0.00 ? 89  TRP A CE3  3  
ATOM 5599  C CZ2  . TRP A 1 89  ? 2.560   -13.072 2.575   1.00 0.00 ? 89  TRP A CZ2  3  
ATOM 5600  C CZ3  . TRP A 1 89  ? 3.208   -10.748 2.553   1.00 0.00 ? 89  TRP A CZ3  3  
ATOM 5601  C CH2  . TRP A 1 89  ? 3.176   -11.992 1.932   1.00 0.00 ? 89  TRP A CH2  3  
ATOM 5602  H H    . TRP A 1 89  ? 1.422   -8.653  8.343   1.00 0.00 ? 89  TRP A H    3  
ATOM 5603  H HA   . TRP A 1 89  ? 2.079   -11.252 8.522   1.00 0.00 ? 89  TRP A HA   3  
ATOM 5604  H HB2  . TRP A 1 89  ? 0.229   -10.670 7.224   1.00 0.00 ? 89  TRP A HB2  3  
ATOM 5605  H HB3  . TRP A 1 89  ? 1.153   -9.591  6.198   1.00 0.00 ? 89  TRP A HB3  3  
ATOM 5606  H HD1  . TRP A 1 89  ? 0.451   -13.356 6.672   1.00 0.00 ? 89  TRP A HD1  3  
ATOM 5607  H HE1  . TRP A 1 89  ? 1.137   -14.732 4.527   1.00 0.00 ? 89  TRP A HE1  3  
ATOM 5608  H HE3  . TRP A 1 89  ? 2.705   -9.484  4.266   1.00 0.00 ? 89  TRP A HE3  3  
ATOM 5609  H HZ2  . TRP A 1 89  ? 2.515   -14.062 2.120   1.00 0.00 ? 89  TRP A HZ2  3  
ATOM 5610  H HZ3  . TRP A 1 89  ? 3.696   -9.930  2.023   1.00 0.00 ? 89  TRP A HZ3  3  
ATOM 5611  H HH2  . TRP A 1 89  ? 3.627   -12.125 0.948   1.00 0.00 ? 89  TRP A HH2  3  
ATOM 5612  N N    . ALA A 1 90  ? 4.043   -9.757  6.303   1.00 0.00 ? 90  ALA A N    3  
ATOM 5613  C CA   . ALA A 1 90  ? 5.350   -9.807  5.670   1.00 0.00 ? 90  ALA A CA   3  
ATOM 5614  C C    . ALA A 1 90  ? 6.431   -9.887  6.749   1.00 0.00 ? 90  ALA A C    3  
ATOM 5615  O O    . ALA A 1 90  ? 7.311   -10.744 6.689   1.00 0.00 ? 90  ALA A O    3  
ATOM 5616  C CB   . ALA A 1 90  ? 5.523   -8.589  4.760   1.00 0.00 ? 90  ALA A CB   3  
ATOM 5617  H H    . ALA A 1 90  ? 3.450   -9.014  5.991   1.00 0.00 ? 90  ALA A H    3  
ATOM 5618  H HA   . ALA A 1 90  ? 5.389   -10.709 5.060   1.00 0.00 ? 90  ALA A HA   3  
ATOM 5619  H HB1  . ALA A 1 90  ? 4.549   -8.144  4.559   1.00 0.00 ? 90  ALA A HB1  3  
ATOM 5620  H HB2  . ALA A 1 90  ? 6.163   -7.856  5.251   1.00 0.00 ? 90  ALA A HB2  3  
ATOM 5621  H HB3  . ALA A 1 90  ? 5.981   -8.900  3.821   1.00 0.00 ? 90  ALA A HB3  3  
ATOM 5622  N N    . LEU A 1 91  ? 6.330   -8.981  7.711   1.00 0.00 ? 91  LEU A N    3  
ATOM 5623  C CA   . LEU A 1 91  ? 7.289   -8.939  8.802   1.00 0.00 ? 91  LEU A CA   3  
ATOM 5624  C C    . LEU A 1 91  ? 7.391   -10.326 9.440   1.00 0.00 ? 91  LEU A C    3  
ATOM 5625  O O    . LEU A 1 91  ? 8.475   -10.752 9.836   1.00 0.00 ? 91  LEU A O    3  
ATOM 5626  C CB   . LEU A 1 91  ? 6.924   -7.831  9.793   1.00 0.00 ? 91  LEU A CB   3  
ATOM 5627  C CG   . LEU A 1 91  ? 7.805   -6.581  9.756   1.00 0.00 ? 91  LEU A CG   3  
ATOM 5628  C CD1  . LEU A 1 91  ? 8.273   -6.282  8.330   1.00 0.00 ? 91  LEU A CD1  3  
ATOM 5629  C CD2  . LEU A 1 91  ? 7.088   -5.386  10.387  1.00 0.00 ? 91  LEU A CD2  3  
ATOM 5630  H H    . LEU A 1 91  ? 5.611   -8.287  7.753   1.00 0.00 ? 91  LEU A H    3  
ATOM 5631  H HA   . LEU A 1 91  ? 8.258   -8.682  8.375   1.00 0.00 ? 91  LEU A HA   3  
ATOM 5632  H HB2  . LEU A 1 91  ? 5.893   -7.531  9.608   1.00 0.00 ? 91  LEU A HB2  3  
ATOM 5633  H HB3  . LEU A 1 91  ? 6.959   -8.247  10.800  1.00 0.00 ? 91  LEU A HB3  3  
ATOM 5634  H HG   . LEU A 1 91  ? 8.697   -6.774  10.353  1.00 0.00 ? 91  LEU A HG   3  
ATOM 5635  H HD11 . LEU A 1 91  ? 8.177   -5.214  8.133   1.00 0.00 ? 91  LEU A HD11 3  
ATOM 5636  H HD12 . LEU A 1 91  ? 9.316   -6.579  8.220   1.00 0.00 ? 91  LEU A HD12 3  
ATOM 5637  H HD13 . LEU A 1 91  ? 7.659   -6.839  7.622   1.00 0.00 ? 91  LEU A HD13 3  
ATOM 5638  H HD21 . LEU A 1 91  ? 7.453   -4.463  9.935   1.00 0.00 ? 91  LEU A HD21 3  
ATOM 5639  H HD22 . LEU A 1 91  ? 6.015   -5.474  10.216  1.00 0.00 ? 91  LEU A HD22 3  
ATOM 5640  H HD23 . LEU A 1 91  ? 7.285   -5.369  11.459  1.00 0.00 ? 91  LEU A HD23 3  
ATOM 5641  N N    . ASP A 1 92  ? 6.248   -10.991 9.520   1.00 0.00 ? 92  ASP A N    3  
ATOM 5642  C CA   . ASP A 1 92  ? 6.195   -12.321 10.103  1.00 0.00 ? 92  ASP A CA   3  
ATOM 5643  C C    . ASP A 1 92  ? 5.774   -13.327 9.031   1.00 0.00 ? 92  ASP A C    3  
ATOM 5644  O O    . ASP A 1 92  ? 4.586   -13.591 8.854   1.00 0.00 ? 92  ASP A O    3  
ATOM 5645  C CB   . ASP A 1 92  ? 5.172   -12.384 11.239  1.00 0.00 ? 92  ASP A CB   3  
ATOM 5646  C CG   . ASP A 1 92  ? 5.740   -12.790 12.600  1.00 0.00 ? 92  ASP A CG   3  
ATOM 5647  O OD1  . ASP A 1 92  ? 6.342   -11.909 13.250  1.00 0.00 ? 92  ASP A OD1  3  
ATOM 5648  O OD2  . ASP A 1 92  ? 5.559   -13.974 12.960  1.00 0.00 ? 92  ASP A OD2  3  
ATOM 5649  H H    . ASP A 1 92  ? 5.371   -10.636 9.196   1.00 0.00 ? 92  ASP A H    3  
ATOM 5650  H HA   . ASP A 1 92  ? 7.201   -12.508 10.480  1.00 0.00 ? 92  ASP A HA   3  
ATOM 5651  H HB2  . ASP A 1 92  ? 4.699   -11.407 11.336  1.00 0.00 ? 92  ASP A HB2  3  
ATOM 5652  H HB3  . ASP A 1 92  ? 4.389   -13.091 10.963  1.00 0.00 ? 92  ASP A HB3  3  
ATOM 5653  N N    . PRO A 1 93  ? 6.798   -13.875 8.323   1.00 0.00 ? 93  PRO A N    3  
ATOM 5654  C CA   . PRO A 1 93  ? 6.546   -14.847 7.273   1.00 0.00 ? 93  PRO A CA   3  
ATOM 5655  C C    . PRO A 1 93  ? 6.178   -16.210 7.863   1.00 0.00 ? 93  PRO A C    3  
ATOM 5656  O O    . PRO A 1 93  ? 5.520   -17.016 7.208   1.00 0.00 ? 93  PRO A O    3  
ATOM 5657  C CB   . PRO A 1 93  ? 7.826   -14.881 6.453   1.00 0.00 ? 93  PRO A CB   3  
ATOM 5658  C CG   . PRO A 1 93  ? 8.905   -14.280 7.340   1.00 0.00 ? 93  PRO A CG   3  
ATOM 5659  C CD   . PRO A 1 93  ? 8.218   -13.586 8.505   1.00 0.00 ? 93  PRO A CD   3  
ATOM 5660  H HA   . PRO A 1 93  ? 5.761   -14.566 6.722   1.00 0.00 ? 93  PRO A HA   3  
ATOM 5661  H HB2  . PRO A 1 93  ? 8.080   -15.901 6.167   1.00 0.00 ? 93  PRO A HB2  3  
ATOM 5662  H HB3  . PRO A 1 93  ? 7.715   -14.309 5.531   1.00 0.00 ? 93  PRO A HB3  3  
ATOM 5663  H HG2  . PRO A 1 93  ? 9.579   -15.057 7.701   1.00 0.00 ? 93  PRO A HG2  3  
ATOM 5664  H HG3  . PRO A 1 93  ? 9.510   -13.570 6.776   1.00 0.00 ? 93  PRO A HG3  3  
ATOM 5665  H HD2  . PRO A 1 93  ? 8.580   -13.965 9.460   1.00 0.00 ? 93  PRO A HD2  3  
ATOM 5666  H HD3  . PRO A 1 93  ? 8.408   -12.513 8.495   1.00 0.00 ? 93  PRO A HD3  3  
ATOM 5667  N N    . LYS A 1 94  ? 6.619   -16.424 9.093   1.00 0.00 ? 94  LYS A N    3  
ATOM 5668  C CA   . LYS A 1 94  ? 6.344   -17.676 9.779   1.00 0.00 ? 94  LYS A CA   3  
ATOM 5669  C C    . LYS A 1 94  ? 4.835   -17.927 9.787   1.00 0.00 ? 94  LYS A C    3  
ATOM 5670  O O    . LYS A 1 94  ? 4.392   -19.072 9.711   1.00 0.00 ? 94  LYS A O    3  
ATOM 5671  C CB   . LYS A 1 94  ? 6.975   -17.672 11.173  1.00 0.00 ? 94  LYS A CB   3  
ATOM 5672  C CG   . LYS A 1 94  ? 8.487   -17.454 11.091  1.00 0.00 ? 94  LYS A CG   3  
ATOM 5673  C CD   . LYS A 1 94  ? 9.136   -18.466 10.144  1.00 0.00 ? 94  LYS A CD   3  
ATOM 5674  C CE   . LYS A 1 94  ? 10.470  -18.964 10.705  1.00 0.00 ? 94  LYS A CE   3  
ATOM 5675  N NZ   . LYS A 1 94  ? 11.592  -18.171 10.153  1.00 0.00 ? 94  LYS A NZ   3  
ATOM 5676  H H    . LYS A 1 94  ? 7.154   -15.763 9.619   1.00 0.00 ? 94  LYS A H    3  
ATOM 5677  H HA   . LYS A 1 94  ? 6.824   -18.472 9.210   1.00 0.00 ? 94  LYS A HA   3  
ATOM 5678  H HB2  . LYS A 1 94  ? 6.523   -16.887 11.779  1.00 0.00 ? 94  LYS A HB2  3  
ATOM 5679  H HB3  . LYS A 1 94  ? 6.767   -18.619 11.672  1.00 0.00 ? 94  LYS A HB3  3  
ATOM 5680  H HG2  . LYS A 1 94  ? 8.693   -16.442 10.743  1.00 0.00 ? 94  LYS A HG2  3  
ATOM 5681  H HG3  . LYS A 1 94  ? 8.926   -17.546 12.084  1.00 0.00 ? 94  LYS A HG3  3  
ATOM 5682  H HD2  . LYS A 1 94  ? 8.464   -19.311 9.993   1.00 0.00 ? 94  LYS A HD2  3  
ATOM 5683  H HD3  . LYS A 1 94  ? 9.296   -18.007 9.169   1.00 0.00 ? 94  LYS A HD3  3  
ATOM 5684  H HE2  . LYS A 1 94  ? 10.465  -18.889 11.792  1.00 0.00 ? 94  LYS A HE2  3  
ATOM 5685  H HE3  . LYS A 1 94  ? 10.605  -20.017 10.458  1.00 0.00 ? 94  LYS A HE3  3  
ATOM 5686  H HZ1  . LYS A 1 94  ? 12.071  -18.710 9.460   1.00 0.00 ? 94  LYS A HZ1  3  
ATOM 5687  H HZ2  . LYS A 1 94  ? 11.236  -17.334 9.737   1.00 0.00 ? 94  LYS A HZ2  3  
ATOM 5688  H HZ3  . LYS A 1 94  ? 12.226  -17.934 10.889  1.00 0.00 ? 94  LYS A HZ3  3  
ATOM 5689  N N    . SER A 1 95  ? 4.087   -16.838 9.880   1.00 0.00 ? 95  SER A N    3  
ATOM 5690  C CA   . SER A 1 95  ? 2.636   -16.925 9.899   1.00 0.00 ? 95  SER A CA   3  
ATOM 5691  C C    . SER A 1 95  ? 2.160   -17.937 8.855   1.00 0.00 ? 95  SER A C    3  
ATOM 5692  O O    . SER A 1 95  ? 1.446   -18.883 9.183   1.00 0.00 ? 95  SER A O    3  
ATOM 5693  C CB   . SER A 1 95  ? 1.998   -15.558 9.645   1.00 0.00 ? 95  SER A CB   3  
ATOM 5694  O OG   . SER A 1 95  ? 0.837   -15.354 10.444  1.00 0.00 ? 95  SER A OG   3  
ATOM 5695  H H    . SER A 1 95  ? 4.455   -15.910 9.942   1.00 0.00 ? 95  SER A H    3  
ATOM 5696  H HA   . SER A 1 95  ? 2.381   -17.263 10.904  1.00 0.00 ? 95  SER A HA   3  
ATOM 5697  H HB2  . SER A 1 95  ? 2.726   -14.774 9.855   1.00 0.00 ? 95  SER A HB2  3  
ATOM 5698  H HB3  . SER A 1 95  ? 1.733   -15.473 8.591   1.00 0.00 ? 95  SER A HB3  3  
ATOM 5699  H HG   . SER A 1 95  ? 0.606   -16.195 10.934  1.00 0.00 ? 95  SER A HG   3  
ATOM 5700  N N    . GLY A 1 96  ? 2.573   -17.702 7.618   1.00 0.00 ? 96  GLY A N    3  
ATOM 5701  C CA   . GLY A 1 96  ? 2.197   -18.580 6.524   1.00 0.00 ? 96  GLY A CA   3  
ATOM 5702  C C    . GLY A 1 96  ? 2.201   -17.829 5.191   1.00 0.00 ? 96  GLY A C    3  
ATOM 5703  O O    . GLY A 1 96  ? 2.523   -16.642 5.145   1.00 0.00 ? 96  GLY A O    3  
ATOM 5704  H H    . GLY A 1 96  ? 3.154   -16.929 7.360   1.00 0.00 ? 96  GLY A H    3  
ATOM 5705  H HA2  . GLY A 1 96  ? 2.890   -19.421 6.473   1.00 0.00 ? 96  GLY A HA2  3  
ATOM 5706  H HA3  . GLY A 1 96  ? 1.206   -18.994 6.709   1.00 0.00 ? 96  GLY A HA3  3  
ATOM 5707  N N    . SER A 1 97  ? 1.840   -18.550 4.140   1.00 0.00 ? 97  SER A N    3  
ATOM 5708  C CA   . SER A 1 97  ? 1.798   -17.966 2.811   1.00 0.00 ? 97  SER A CA   3  
ATOM 5709  C C    . SER A 1 97  ? 0.445   -17.291 2.578   1.00 0.00 ? 97  SER A C    3  
ATOM 5710  O O    . SER A 1 97  ? 0.385   -16.166 2.083   1.00 0.00 ? 97  SER A O    3  
ATOM 5711  C CB   . SER A 1 97  ? 2.054   -19.024 1.736   1.00 0.00 ? 97  SER A CB   3  
ATOM 5712  O OG   . SER A 1 97  ? 3.053   -18.611 0.807   1.00 0.00 ? 97  SER A OG   3  
ATOM 5713  H H    . SER A 1 97  ? 1.580   -19.514 4.187   1.00 0.00 ? 97  SER A H    3  
ATOM 5714  H HA   . SER A 1 97  ? 2.601   -17.229 2.793   1.00 0.00 ? 97  SER A HA   3  
ATOM 5715  H HB2  . SER A 1 97  ? 2.365   -19.955 2.211   1.00 0.00 ? 97  SER A HB2  3  
ATOM 5716  H HB3  . SER A 1 97  ? 1.127   -19.232 1.203   1.00 0.00 ? 97  SER A HB3  3  
ATOM 5717  H HG   . SER A 1 97  ? 2.916   -17.651 0.563   1.00 0.00 ? 97  SER A HG   3  
ATOM 5718  N N    . ASN A 1 98  ? -0.608  -18.006 2.946   1.00 0.00 ? 98  ASN A N    3  
ATOM 5719  C CA   . ASN A 1 98  ? -1.957  -17.490 2.784   1.00 0.00 ? 98  ASN A CA   3  
ATOM 5720  C C    . ASN A 1 98  ? -2.001  -16.033 3.251   1.00 0.00 ? 98  ASN A C    3  
ATOM 5721  O O    . ASN A 1 98  ? -1.742  -15.744 4.419   1.00 0.00 ? 98  ASN A O    3  
ATOM 5722  C CB   . ASN A 1 98  ? -2.956  -18.286 3.625   1.00 0.00 ? 98  ASN A CB   3  
ATOM 5723  C CG   . ASN A 1 98  ? -3.593  -19.408 2.803   1.00 0.00 ? 98  ASN A CG   3  
ATOM 5724  O OD1  . ASN A 1 98  ? -4.405  -19.182 1.920   1.00 0.00 ? 98  ASN A OD1  3  
ATOM 5725  N ND2  . ASN A 1 98  ? -3.182  -20.627 3.140   1.00 0.00 ? 98  ASN A ND2  3  
ATOM 5726  H H    . ASN A 1 98  ? -0.551  -18.920 3.348   1.00 0.00 ? 98  ASN A H    3  
ATOM 5727  H HA   . ASN A 1 98  ? -2.177  -17.594 1.722   1.00 0.00 ? 98  ASN A HA   3  
ATOM 5728  H HB2  . ASN A 1 98  ? -2.451  -18.709 4.494   1.00 0.00 ? 98  ASN A HB2  3  
ATOM 5729  H HB3  . ASN A 1 98  ? -3.733  -17.620 4.001   1.00 0.00 ? 98  ASN A HB3  3  
ATOM 5730  H HD21 . ASN A 1 98  ? -2.513  -20.743 3.875   1.00 0.00 ? 98  ASN A HD21 3  
ATOM 5731  H HD22 . ASN A 1 98  ? -3.541  -21.427 2.660   1.00 0.00 ? 98  ASN A HD22 3  
ATOM 5732  N N    . LEU A 1 99  ? -2.330  -15.155 2.316   1.00 0.00 ? 99  LEU A N    3  
ATOM 5733  C CA   . LEU A 1 99  ? -2.411  -13.736 2.617   1.00 0.00 ? 99  LEU A CA   3  
ATOM 5734  C C    . LEU A 1 99  ? -3.220  -13.537 3.900   1.00 0.00 ? 99  LEU A C    3  
ATOM 5735  O O    . LEU A 1 99  ? -4.023  -14.392 4.271   1.00 0.00 ? 99  LEU A O    3  
ATOM 5736  C CB   . LEU A 1 99  ? -2.962  -12.964 1.417   1.00 0.00 ? 99  LEU A CB   3  
ATOM 5737  C CG   . LEU A 1 99  ? -2.179  -13.108 0.110   1.00 0.00 ? 99  LEU A CG   3  
ATOM 5738  C CD1  . LEU A 1 99  ? -3.048  -12.735 -1.093  1.00 0.00 ? 99  LEU A CD1  3  
ATOM 5739  C CD2  . LEU A 1 99  ? -0.883  -12.296 0.155   1.00 0.00 ? 99  LEU A CD2  3  
ATOM 5740  H H    . LEU A 1 99  ? -2.538  -15.398 1.369   1.00 0.00 ? 99  LEU A H    3  
ATOM 5741  H HA   . LEU A 1 99  ? -1.395  -13.380 2.790   1.00 0.00 ? 99  LEU A HA   3  
ATOM 5742  H HB2  . LEU A 1 99  ? -3.988  -13.289 1.241   1.00 0.00 ? 99  LEU A HB2  3  
ATOM 5743  H HB3  . LEU A 1 99  ? -3.003  -11.906 1.678   1.00 0.00 ? 99  LEU A HB3  3  
ATOM 5744  H HG   . LEU A 1 99  ? -1.900  -14.155 -0.007  1.00 0.00 ? 99  LEU A HG   3  
ATOM 5745  H HD11 . LEU A 1 99  ? -3.387  -11.704 -0.991  1.00 0.00 ? 99  LEU A HD11 3  
ATOM 5746  H HD12 . LEU A 1 99  ? -2.464  -12.836 -2.008  1.00 0.00 ? 99  LEU A HD12 3  
ATOM 5747  H HD13 . LEU A 1 99  ? -3.911  -13.399 -1.138  1.00 0.00 ? 99  LEU A HD13 3  
ATOM 5748  H HD21 . LEU A 1 99  ? -1.115  -11.253 0.371   1.00 0.00 ? 99  LEU A HD21 3  
ATOM 5749  H HD22 . LEU A 1 99  ? -0.233  -12.693 0.934   1.00 0.00 ? 99  LEU A HD22 3  
ATOM 5750  H HD23 . LEU A 1 99  ? -0.378  -12.364 -0.809  1.00 0.00 ? 99  LEU A HD23 3  
ATOM 5751  N N    . PRO A 1 100 ? -2.974  -12.373 4.560   1.00 0.00 ? 100 PRO A N    3  
ATOM 5752  C CA   . PRO A 1 100 ? -3.670  -12.051 5.794   1.00 0.00 ? 100 PRO A CA   3  
ATOM 5753  C C    . PRO A 1 100 ? -5.114  -11.628 5.515   1.00 0.00 ? 100 PRO A C    3  
ATOM 5754  O O    . PRO A 1 100 ? -5.485  -11.398 4.365   1.00 0.00 ? 100 PRO A O    3  
ATOM 5755  C CB   . PRO A 1 100 ? -2.842  -10.950 6.437   1.00 0.00 ? 100 PRO A CB   3  
ATOM 5756  C CG   . PRO A 1 100 ? -1.978  -10.376 5.326   1.00 0.00 ? 100 PRO A CG   3  
ATOM 5757  C CD   . PRO A 1 100 ? -2.030  -11.338 4.151   1.00 0.00 ? 100 PRO A CD   3  
ATOM 5758  H HA   . PRO A 1 100 ? -3.731  -12.859 6.380   1.00 0.00 ? 100 PRO A HA   3  
ATOM 5759  H HB2  . PRO A 1 100 ? -3.483  -10.182 6.871   1.00 0.00 ? 100 PRO A HB2  3  
ATOM 5760  H HB3  . PRO A 1 100 ? -2.227  -11.346 7.245   1.00 0.00 ? 100 PRO A HB3  3  
ATOM 5761  H HG2  . PRO A 1 100 ? -2.342  -9.391  5.030   1.00 0.00 ? 100 PRO A HG2  3  
ATOM 5762  H HG3  . PRO A 1 100 ? -0.952  -10.246 5.669   1.00 0.00 ? 100 PRO A HG3  3  
ATOM 5763  H HD2  . PRO A 1 100 ? -2.363  -10.835 3.242   1.00 0.00 ? 100 PRO A HD2  3  
ATOM 5764  H HD3  . PRO A 1 100 ? -1.047  -11.759 3.940   1.00 0.00 ? 100 PRO A HD3  3  
ATOM 5765  N N    . SER A 1 101 ? -5.888  -11.538 6.586   1.00 0.00 ? 101 SER A N    3  
ATOM 5766  C CA   . SER A 1 101 ? -7.282  -11.146 6.470   1.00 0.00 ? 101 SER A CA   3  
ATOM 5767  C C    . SER A 1 101 ? -7.541  -9.883  7.294   1.00 0.00 ? 101 SER A C    3  
ATOM 5768  O O    . SER A 1 101 ? -7.207  -9.830  8.477   1.00 0.00 ? 101 SER A O    3  
ATOM 5769  C CB   . SER A 1 101 ? -8.211  -12.275 6.923   1.00 0.00 ? 101 SER A CB   3  
ATOM 5770  O OG   . SER A 1 101 ? -7.783  -13.544 6.438   1.00 0.00 ? 101 SER A OG   3  
ATOM 5771  H H    . SER A 1 101 ? -5.578  -11.726 7.518   1.00 0.00 ? 101 SER A H    3  
ATOM 5772  H HA   . SER A 1 101 ? -7.440  -10.950 5.410   1.00 0.00 ? 101 SER A HA   3  
ATOM 5773  H HB2  . SER A 1 101 ? -8.250  -12.297 8.012   1.00 0.00 ? 101 SER A HB2  3  
ATOM 5774  H HB3  . SER A 1 101 ? -9.223  -12.074 6.572   1.00 0.00 ? 101 SER A HB3  3  
ATOM 5775  H HG   . SER A 1 101 ? -7.281  -13.432 5.581   1.00 0.00 ? 101 SER A HG   3  
ATOM 5776  N N    . SER A 1 102 ? -8.134  -8.897  6.637   1.00 0.00 ? 102 SER A N    3  
ATOM 5777  C CA   . SER A 1 102 ? -8.442  -7.638  7.294   1.00 0.00 ? 102 SER A CA   3  
ATOM 5778  C C    . SER A 1 102 ? -9.372  -7.882  8.484   1.00 0.00 ? 102 SER A C    3  
ATOM 5779  O O    . SER A 1 102 ? -9.999  -8.936  8.580   1.00 0.00 ? 102 SER A O    3  
ATOM 5780  C CB   . SER A 1 102 ? -9.079  -6.648  6.317   1.00 0.00 ? 102 SER A CB   3  
ATOM 5781  O OG   . SER A 1 102 ? -8.810  -5.296  6.676   1.00 0.00 ? 102 SER A OG   3  
ATOM 5782  H H    . SER A 1 102 ? -8.403  -8.949  5.675   1.00 0.00 ? 102 SER A H    3  
ATOM 5783  H HA   . SER A 1 102 ? -7.482  -7.247  7.632   1.00 0.00 ? 102 SER A HA   3  
ATOM 5784  H HB2  . SER A 1 102 ? -8.701  -6.838  5.311   1.00 0.00 ? 102 SER A HB2  3  
ATOM 5785  H HB3  . SER A 1 102 ? -10.156 -6.809  6.288   1.00 0.00 ? 102 SER A HB3  3  
ATOM 5786  H HG   . SER A 1 102 ? -9.669  -4.804  6.821   1.00 0.00 ? 102 SER A HG   3  
ATOM 5787  N N    . THR A 1 103 ? -9.432  -6.890  9.360   1.00 0.00 ? 103 THR A N    3  
ATOM 5788  C CA   . THR A 1 103 ? -10.275 -6.984  10.540  1.00 0.00 ? 103 THR A CA   3  
ATOM 5789  C C    . THR A 1 103 ? -11.437 -5.994  10.445  1.00 0.00 ? 103 THR A C    3  
ATOM 5790  O O    . THR A 1 103 ? -12.270 -5.920  11.347  1.00 0.00 ? 103 THR A O    3  
ATOM 5791  C CB   . THR A 1 103 ? -9.392  -6.769  11.771  1.00 0.00 ? 103 THR A CB   3  
ATOM 5792  O OG1  . THR A 1 103 ? -8.873  -5.453  11.599  1.00 0.00 ? 103 THR A OG1  3  
ATOM 5793  C CG2  . THR A 1 103 ? -8.151  -7.663  11.764  1.00 0.00 ? 103 THR A CG2  3  
ATOM 5794  H H    . THR A 1 103 ? -8.919  -6.037  9.275   1.00 0.00 ? 103 THR A H    3  
ATOM 5795  H HA   . THR A 1 103 ? -10.709 -7.984  10.574  1.00 0.00 ? 103 THR A HA   3  
ATOM 5796  H HB   . THR A 1 103 ? -9.964  -6.904  12.688  1.00 0.00 ? 103 THR A HB   3  
ATOM 5797  H HG1  . THR A 1 103 ? -9.376  -4.809  12.176  1.00 0.00 ? 103 THR A HG1  3  
ATOM 5798  H HG21 . THR A 1 103 ? -8.350  -8.566  12.341  1.00 0.00 ? 103 THR A HG21 3  
ATOM 5799  H HG22 . THR A 1 103 ? -7.904  -7.935  10.738  1.00 0.00 ? 103 THR A HG22 3  
ATOM 5800  H HG23 . THR A 1 103 ? -7.313  -7.125  12.209  1.00 0.00 ? 103 THR A HG23 3  
ATOM 5801  N N    . ARG A 1 104 ? -11.456 -5.257  9.344   1.00 0.00 ? 104 ARG A N    3  
ATOM 5802  C CA   . ARG A 1 104 ? -12.502 -4.274  9.119   1.00 0.00 ? 104 ARG A CA   3  
ATOM 5803  C C    . ARG A 1 104 ? -12.545 -3.871  7.644   1.00 0.00 ? 104 ARG A C    3  
ATOM 5804  O O    . ARG A 1 104 ? -11.513 -3.840  6.975   1.00 0.00 ? 104 ARG A O    3  
ATOM 5805  C CB   . ARG A 1 104 ? -12.278 -3.025  9.975   1.00 0.00 ? 104 ARG A CB   3  
ATOM 5806  C CG   . ARG A 1 104 ? -11.052 -2.245  9.495   1.00 0.00 ? 104 ARG A CG   3  
ATOM 5807  C CD   . ARG A 1 104 ? -11.439 -0.832  9.056   1.00 0.00 ? 104 ARG A CD   3  
ATOM 5808  N NE   . ARG A 1 104 ? -11.316 0.105   10.195  1.00 0.00 ? 104 ARG A NE   3  
ATOM 5809  C CZ   . ARG A 1 104 ? -10.162 0.383   10.817  1.00 0.00 ? 104 ARG A CZ   3  
ATOM 5810  N NH1  . ARG A 1 104 ? -9.025  -0.202  10.414  1.00 0.00 ? 104 ARG A NH1  3  
ATOM 5811  N NH2  . ARG A 1 104 ? -10.144 1.245   11.842  1.00 0.00 ? 104 ARG A NH2  3  
ATOM 5812  H H    . ARG A 1 104 ? -10.775 -5.323  8.615   1.00 0.00 ? 104 ARG A H    3  
ATOM 5813  H HA   . ARG A 1 104 ? -13.424 -4.775  9.416   1.00 0.00 ? 104 ARG A HA   3  
ATOM 5814  H HB2  . ARG A 1 104 ? -13.160 -2.386  9.931   1.00 0.00 ? 104 ARG A HB2  3  
ATOM 5815  H HB3  . ARG A 1 104 ? -12.145 -3.314  11.018  1.00 0.00 ? 104 ARG A HB3  3  
ATOM 5816  H HG2  . ARG A 1 104 ? -10.315 -2.191  10.296  1.00 0.00 ? 104 ARG A HG2  3  
ATOM 5817  H HG3  . ARG A 1 104 ? -10.583 -2.773  8.665   1.00 0.00 ? 104 ARG A HG3  3  
ATOM 5818  H HD2  . ARG A 1 104 ? -10.797 -0.508  8.237   1.00 0.00 ? 104 ARG A HD2  3  
ATOM 5819  H HD3  . ARG A 1 104 ? -12.462 -0.826  8.679   1.00 0.00 ? 104 ARG A HD3  3  
ATOM 5820  H HE   . ARG A 1 104 ? -12.145 0.558   10.521  1.00 0.00 ? 104 ARG A HE   3  
ATOM 5821  H HH11 . ARG A 1 104 ? -9.038  -0.845  9.649   1.00 0.00 ? 104 ARG A HH11 3  
ATOM 5822  H HH12 . ARG A 1 104 ? -8.164  0.006   10.878  1.00 0.00 ? 104 ARG A HH12 3  
ATOM 5823  H HH21 . ARG A 1 104 ? -10.992 1.682   12.143  1.00 0.00 ? 104 ARG A HH21 3  
ATOM 5824  H HH22 . ARG A 1 104 ? -9.283  1.453   12.307  1.00 0.00 ? 104 ARG A HH22 3  
ATOM 5825  N N    . THR A 1 105 ? -13.749 -3.574  7.179   1.00 0.00 ? 105 THR A N    3  
ATOM 5826  C CA   . THR A 1 105 ? -13.940 -3.175  5.795   1.00 0.00 ? 105 THR A CA   3  
ATOM 5827  C C    . THR A 1 105 ? -14.000 -1.651  5.683   1.00 0.00 ? 105 THR A C    3  
ATOM 5828  O O    . THR A 1 105 ? -14.462 -0.975  6.600   1.00 0.00 ? 105 THR A O    3  
ATOM 5829  C CB   . THR A 1 105 ? -15.196 -3.873  5.270   1.00 0.00 ? 105 THR A CB   3  
ATOM 5830  O OG1  . THR A 1 105 ? -14.840 -5.252  5.238   1.00 0.00 ? 105 THR A OG1  3  
ATOM 5831  C CG2  . THR A 1 105 ? -15.490 -3.529  3.809   1.00 0.00 ? 105 THR A CG2  3  
ATOM 5832  H H    . THR A 1 105 ? -14.584 -3.602  7.729   1.00 0.00 ? 105 THR A H    3  
ATOM 5833  H HA   . THR A 1 105 ? -13.074 -3.504  5.220   1.00 0.00 ? 105 THR A HA   3  
ATOM 5834  H HB   . THR A 1 105 ? -16.057 -3.652  5.903   1.00 0.00 ? 105 THR A HB   3  
ATOM 5835  H HG1  . THR A 1 105 ? -15.591 -5.791  4.857   1.00 0.00 ? 105 THR A HG1  3  
ATOM 5836  H HG21 . THR A 1 105 ? -14.801 -4.073  3.162   1.00 0.00 ? 105 THR A HG21 3  
ATOM 5837  H HG22 . THR A 1 105 ? -16.514 -3.813  3.567   1.00 0.00 ? 105 THR A HG22 3  
ATOM 5838  H HG23 . THR A 1 105 ? -15.364 -2.458  3.655   1.00 0.00 ? 105 THR A HG23 3  
ATOM 5839  N N    . VAL A 1 106 ? -13.525 -1.153  4.550   1.00 0.00 ? 106 VAL A N    3  
ATOM 5840  C CA   . VAL A 1 106 ? -13.519 0.279   4.306   1.00 0.00 ? 106 VAL A CA   3  
ATOM 5841  C C    . VAL A 1 106 ? -13.975 0.549   2.870   1.00 0.00 ? 106 VAL A C    3  
ATOM 5842  O O    . VAL A 1 106 ? -13.665 -0.220  1.961   1.00 0.00 ? 106 VAL A O    3  
ATOM 5843  C CB   . VAL A 1 106 ? -12.136 0.856   4.612   1.00 0.00 ? 106 VAL A CB   3  
ATOM 5844  C CG1  . VAL A 1 106 ? -11.963 2.235   3.972   1.00 0.00 ? 106 VAL A CG1  3  
ATOM 5845  C CG2  . VAL A 1 106 ? -11.889 0.916   6.121   1.00 0.00 ? 106 VAL A CG2  3  
ATOM 5846  H H    . VAL A 1 106 ? -13.151 -1.710  3.808   1.00 0.00 ? 106 VAL A H    3  
ATOM 5847  H HA   . VAL A 1 106 ? -14.234 0.733   4.992   1.00 0.00 ? 106 VAL A HA   3  
ATOM 5848  H HB   . VAL A 1 106 ? -11.391 0.189   4.177   1.00 0.00 ? 106 VAL A HB   3  
ATOM 5849  H HG11 . VAL A 1 106 ? -12.934 2.723   3.892   1.00 0.00 ? 106 VAL A HG11 3  
ATOM 5850  H HG12 . VAL A 1 106 ? -11.301 2.842   4.590   1.00 0.00 ? 106 VAL A HG12 3  
ATOM 5851  H HG13 . VAL A 1 106 ? -11.530 2.123   2.978   1.00 0.00 ? 106 VAL A HG13 3  
ATOM 5852  H HG21 . VAL A 1 106 ? -10.901 1.337   6.311   1.00 0.00 ? 106 VAL A HG21 3  
ATOM 5853  H HG22 . VAL A 1 106 ? -12.647 1.545   6.588   1.00 0.00 ? 106 VAL A HG22 3  
ATOM 5854  H HG23 . VAL A 1 106 ? -11.942 -0.089  6.538   1.00 0.00 ? 106 VAL A HG23 3  
ATOM 5855  N N    . LYS A 1 107 ? -14.703 1.644   2.711   1.00 0.00 ? 107 LYS A N    3  
ATOM 5856  C CA   . LYS A 1 107 ? -15.205 2.026   1.402   1.00 0.00 ? 107 LYS A CA   3  
ATOM 5857  C C    . LYS A 1 107 ? -14.880 3.498   1.145   1.00 0.00 ? 107 LYS A C    3  
ATOM 5858  O O    . LYS A 1 107 ? -14.688 4.269   2.085   1.00 0.00 ? 107 LYS A O    3  
ATOM 5859  C CB   . LYS A 1 107 ? -16.694 1.695   1.281   1.00 0.00 ? 107 LYS A CB   3  
ATOM 5860  C CG   . LYS A 1 107 ? -17.074 1.397   -0.171  1.00 0.00 ? 107 LYS A CG   3  
ATOM 5861  C CD   . LYS A 1 107 ? -18.456 1.962   -0.503  1.00 0.00 ? 107 LYS A CD   3  
ATOM 5862  C CE   . LYS A 1 107 ? -18.341 3.325   -1.189  1.00 0.00 ? 107 LYS A CE   3  
ATOM 5863  N NZ   . LYS A 1 107 ? -19.541 3.592   -2.014  1.00 0.00 ? 107 LYS A NZ   3  
ATOM 5864  H H    . LYS A 1 107 ? -14.951 2.265   3.455   1.00 0.00 ? 107 LYS A H    3  
ATOM 5865  H HA   . LYS A 1 107 ? -14.680 1.422   0.662   1.00 0.00 ? 107 LYS A HA   3  
ATOM 5866  H HB2  . LYS A 1 107 ? -16.931 0.834   1.907   1.00 0.00 ? 107 LYS A HB2  3  
ATOM 5867  H HB3  . LYS A 1 107 ? -17.287 2.531   1.652   1.00 0.00 ? 107 LYS A HB3  3  
ATOM 5868  H HG2  . LYS A 1 107 ? -16.330 1.829   -0.841  1.00 0.00 ? 107 LYS A HG2  3  
ATOM 5869  H HG3  . LYS A 1 107 ? -17.067 0.320   -0.339  1.00 0.00 ? 107 LYS A HG3  3  
ATOM 5870  H HD2  . LYS A 1 107 ? -18.990 1.268   -1.152  1.00 0.00 ? 107 LYS A HD2  3  
ATOM 5871  H HD3  . LYS A 1 107 ? -19.043 2.059   0.411   1.00 0.00 ? 107 LYS A HD3  3  
ATOM 5872  H HE2  . LYS A 1 107 ? -18.227 4.107   -0.439  1.00 0.00 ? 107 LYS A HE2  3  
ATOM 5873  H HE3  . LYS A 1 107 ? -17.449 3.349   -1.814  1.00 0.00 ? 107 LYS A HE3  3  
ATOM 5874  H HZ1  . LYS A 1 107 ? -19.722 2.805   -2.603  1.00 0.00 ? 107 LYS A HZ1  3  
ATOM 5875  H HZ2  . LYS A 1 107 ? -20.327 3.750   -1.417  1.00 0.00 ? 107 LYS A HZ2  3  
ATOM 5876  H HZ3  . LYS A 1 107 ? -19.382 4.402   -2.579  1.00 0.00 ? 107 LYS A HZ3  3  
ATOM 5877  N N    . ALA A 1 108 ? -14.828 3.846   -0.133  1.00 0.00 ? 108 ALA A N    3  
ATOM 5878  C CA   . ALA A 1 108 ? -14.529 5.213   -0.525  1.00 0.00 ? 108 ALA A CA   3  
ATOM 5879  C C    . ALA A 1 108 ? -15.820 5.907   -0.961  1.00 0.00 ? 108 ALA A C    3  
ATOM 5880  O O    . ALA A 1 108 ? -16.451 5.498   -1.935  1.00 0.00 ? 108 ALA A O    3  
ATOM 5881  C CB   . ALA A 1 108 ? -13.468 5.207   -1.628  1.00 0.00 ? 108 ALA A CB   3  
ATOM 5882  H H    . ALA A 1 108 ? -14.985 3.213   -0.891  1.00 0.00 ? 108 ALA A H    3  
ATOM 5883  H HA   . ALA A 1 108 ? -14.126 5.728   0.347   1.00 0.00 ? 108 ALA A HA   3  
ATOM 5884  H HB1  . ALA A 1 108 ? -13.012 6.194   -1.698  1.00 0.00 ? 108 ALA A HB1  3  
ATOM 5885  H HB2  . ALA A 1 108 ? -12.702 4.469   -1.392  1.00 0.00 ? 108 ALA A HB2  3  
ATOM 5886  H HB3  . ALA A 1 108 ? -13.935 4.954   -2.580  1.00 0.00 ? 108 ALA A HB3  3  
ATOM 5887  N N    . LEU A 1 109 ? -16.175 6.947   -0.220  1.00 0.00 ? 109 LEU A N    3  
ATOM 5888  C CA   . LEU A 1 109 ? -17.380 7.702   -0.518  1.00 0.00 ? 109 LEU A CA   3  
ATOM 5889  C C    . LEU A 1 109 ? -17.005 8.968   -1.291  1.00 0.00 ? 109 LEU A C    3  
ATOM 5890  O O    . LEU A 1 109 ? -17.827 9.522   -2.019  1.00 0.00 ? 109 LEU A O    3  
ATOM 5891  C CB   . LEU A 1 109 ? -18.172 7.975   0.762   1.00 0.00 ? 109 LEU A CB   3  
ATOM 5892  C CG   . LEU A 1 109 ? -18.018 6.940   1.879   1.00 0.00 ? 109 LEU A CG   3  
ATOM 5893  C CD1  . LEU A 1 109 ? -16.948 7.373   2.883   1.00 0.00 ? 109 LEU A CD1  3  
ATOM 5894  C CD2  . LEU A 1 109 ? -19.361 6.662   2.557   1.00 0.00 ? 109 LEU A CD2  3  
ATOM 5895  H H    . LEU A 1 109 ? -15.656 7.273   0.570   1.00 0.00 ? 109 LEU A H    3  
ATOM 5896  H HA   . LEU A 1 109 ? -18.006 7.080   -1.158  1.00 0.00 ? 109 LEU A HA   3  
ATOM 5897  H HB2  . LEU A 1 109 ? -17.872 8.948   1.151   1.00 0.00 ? 109 LEU A HB2  3  
ATOM 5898  H HB3  . LEU A 1 109 ? -19.228 8.047   0.504   1.00 0.00 ? 109 LEU A HB3  3  
ATOM 5899  H HG   . LEU A 1 109 ? -17.682 6.004   1.434   1.00 0.00 ? 109 LEU A HG   3  
ATOM 5900  H HD11 . LEU A 1 109 ? -17.428 7.710   3.802   1.00 0.00 ? 109 LEU A HD11 3  
ATOM 5901  H HD12 . LEU A 1 109 ? -16.294 6.530   3.103   1.00 0.00 ? 109 LEU A HD12 3  
ATOM 5902  H HD13 . LEU A 1 109 ? -16.361 8.188   2.460   1.00 0.00 ? 109 LEU A HD13 3  
ATOM 5903  H HD21 . LEU A 1 109 ? -19.991 6.075   1.888   1.00 0.00 ? 109 LEU A HD21 3  
ATOM 5904  H HD22 . LEU A 1 109 ? -19.194 6.105   3.479   1.00 0.00 ? 109 LEU A HD22 3  
ATOM 5905  H HD23 . LEU A 1 109 ? -19.855 7.606   2.786   1.00 0.00 ? 109 LEU A HD23 3  
ATOM 5906  N N    . THR A 1 110 ? -15.762 9.390   -1.106  1.00 0.00 ? 110 THR A N    3  
ATOM 5907  C CA   . THR A 1 110 ? -15.268 10.580  -1.776  1.00 0.00 ? 110 THR A CA   3  
ATOM 5908  C C    . THR A 1 110 ? -13.864 10.335  -2.332  1.00 0.00 ? 110 THR A C    3  
ATOM 5909  O O    . THR A 1 110 ? -13.219 9.346   -1.987  1.00 0.00 ? 110 THR A O    3  
ATOM 5910  C CB   . THR A 1 110 ? -15.334 11.743  -0.784  1.00 0.00 ? 110 THR A CB   3  
ATOM 5911  O OG1  . THR A 1 110 ? -14.573 12.774  -1.407  1.00 0.00 ? 110 THR A OG1  3  
ATOM 5912  C CG2  . THR A 1 110 ? -14.576 11.451  0.512   1.00 0.00 ? 110 THR A CG2  3  
ATOM 5913  H H    . THR A 1 110 ? -15.100 8.933   -0.511  1.00 0.00 ? 110 THR A H    3  
ATOM 5914  H HA   . THR A 1 110 ? -15.917 10.790  -2.626  1.00 0.00 ? 110 THR A HA   3  
ATOM 5915  H HB   . THR A 1 110 ? -16.368 12.020  -0.576  1.00 0.00 ? 110 THR A HB   3  
ATOM 5916  H HG1  . THR A 1 110 ? -14.990 13.665  -1.224  1.00 0.00 ? 110 THR A HG1  3  
ATOM 5917  H HG21 . THR A 1 110 ? -13.507 11.593  0.348   1.00 0.00 ? 110 THR A HG21 3  
ATOM 5918  H HG22 . THR A 1 110 ? -14.917 12.130  1.294   1.00 0.00 ? 110 THR A HG22 3  
ATOM 5919  H HG23 . THR A 1 110 ? -14.762 10.422  0.818   1.00 0.00 ? 110 THR A HG23 3  
ATOM 5920  N N    . GLU A 1 111 ? -13.432 11.253  -3.185  1.00 0.00 ? 111 GLU A N    3  
ATOM 5921  C CA   . GLU A 1 111 ? -12.116 11.148  -3.792  1.00 0.00 ? 111 GLU A CA   3  
ATOM 5922  C C    . GLU A 1 111 ? -11.048 10.947  -2.715  1.00 0.00 ? 111 GLU A C    3  
ATOM 5923  O O    . GLU A 1 111 ? -10.893 11.782  -1.826  1.00 0.00 ? 111 GLU A O    3  
ATOM 5924  C CB   . GLU A 1 111 ? -11.807 12.380  -4.646  1.00 0.00 ? 111 GLU A CB   3  
ATOM 5925  C CG   . GLU A 1 111 ? -10.762 12.057  -5.716  1.00 0.00 ? 111 GLU A CG   3  
ATOM 5926  C CD   . GLU A 1 111 ? -10.811 13.078  -6.855  1.00 0.00 ? 111 GLU A CD   3  
ATOM 5927  O OE1  . GLU A 1 111 ? -11.929 13.309  -7.363  1.00 0.00 ? 111 GLU A OE1  3  
ATOM 5928  O OE2  . GLU A 1 111 ? -9.728  13.604  -7.192  1.00 0.00 ? 111 GLU A OE2  3  
ATOM 5929  H H    . GLU A 1 111 ? -13.962 12.054  -3.461  1.00 0.00 ? 111 GLU A H    3  
ATOM 5930  H HA   . GLU A 1 111 ? -12.163 10.270  -4.436  1.00 0.00 ? 111 GLU A HA   3  
ATOM 5931  H HB2  . GLU A 1 111 ? -12.721 12.736  -5.121  1.00 0.00 ? 111 GLU A HB2  3  
ATOM 5932  H HB3  . GLU A 1 111 ? -11.444 13.187  -4.010  1.00 0.00 ? 111 GLU A HB3  3  
ATOM 5933  H HG2  . GLU A 1 111 ? -9.768  12.053  -5.269  1.00 0.00 ? 111 GLU A HG2  3  
ATOM 5934  H HG3  . GLU A 1 111 ? -10.939 11.057  -6.112  1.00 0.00 ? 111 GLU A HG3  3  
ATOM 5935  N N    . VAL A 1 112 ? -10.340 9.833   -2.830  1.00 0.00 ? 112 VAL A N    3  
ATOM 5936  C CA   . VAL A 1 112 ? -9.291  9.511   -1.877  1.00 0.00 ? 112 VAL A CA   3  
ATOM 5937  C C    . VAL A 1 112 ? -7.933  9.581   -2.577  1.00 0.00 ? 112 VAL A C    3  
ATOM 5938  O O    . VAL A 1 112 ? -7.838  9.346   -3.781  1.00 0.00 ? 112 VAL A O    3  
ATOM 5939  C CB   . VAL A 1 112 ? -9.565  8.147   -1.239  1.00 0.00 ? 112 VAL A CB   3  
ATOM 5940  C CG1  . VAL A 1 112 ? -8.564  7.855   -0.120  1.00 0.00 ? 112 VAL A CG1  3  
ATOM 5941  C CG2  . VAL A 1 112 ? -11.003 8.062   -0.725  1.00 0.00 ? 112 VAL A CG2  3  
ATOM 5942  H H    . VAL A 1 112 ? -10.473 9.159   -3.557  1.00 0.00 ? 112 VAL A H    3  
ATOM 5943  H HA   . VAL A 1 112 ? -9.320  10.264  -1.090  1.00 0.00 ? 112 VAL A HA   3  
ATOM 5944  H HB   . VAL A 1 112 ? -9.439  7.386   -2.009  1.00 0.00 ? 112 VAL A HB   3  
ATOM 5945  H HG11 . VAL A 1 112 ? -8.793  6.888   0.329   1.00 0.00 ? 112 VAL A HG11 3  
ATOM 5946  H HG12 . VAL A 1 112 ? -7.555  7.834   -0.532  1.00 0.00 ? 112 VAL A HG12 3  
ATOM 5947  H HG13 . VAL A 1 112 ? -8.630  8.633   0.639   1.00 0.00 ? 112 VAL A HG13 3  
ATOM 5948  H HG21 . VAL A 1 112 ? -11.643 7.642   -1.501  1.00 0.00 ? 112 VAL A HG21 3  
ATOM 5949  H HG22 . VAL A 1 112 ? -11.036 7.423   0.158   1.00 0.00 ? 112 VAL A HG22 3  
ATOM 5950  H HG23 . VAL A 1 112 ? -11.356 9.059   -0.464  1.00 0.00 ? 112 VAL A HG23 3  
ATOM 5951  N N    . GLU A 1 113 ? -6.915  9.906   -1.793  1.00 0.00 ? 113 GLU A N    3  
ATOM 5952  C CA   . GLU A 1 113 ? -5.566  10.011  -2.323  1.00 0.00 ? 113 GLU A CA   3  
ATOM 5953  C C    . GLU A 1 113 ? -4.593  9.209   -1.457  1.00 0.00 ? 113 GLU A C    3  
ATOM 5954  O O    . GLU A 1 113 ? -4.283  9.605   -0.334  1.00 0.00 ? 113 GLU A O    3  
ATOM 5955  C CB   . GLU A 1 113 ? -5.130  11.474  -2.428  1.00 0.00 ? 113 GLU A CB   3  
ATOM 5956  C CG   . GLU A 1 113 ? -5.687  12.123  -3.696  1.00 0.00 ? 113 GLU A CG   3  
ATOM 5957  C CD   . GLU A 1 113 ? -5.994  13.604  -3.465  1.00 0.00 ? 113 GLU A CD   3  
ATOM 5958  O OE1  . GLU A 1 113 ? -6.495  13.914  -2.363  1.00 0.00 ? 113 GLU A OE1  3  
ATOM 5959  O OE2  . GLU A 1 113 ? -5.720  14.392  -4.396  1.00 0.00 ? 113 GLU A OE2  3  
ATOM 5960  H H    . GLU A 1 113 ? -7.001  10.096  -0.815  1.00 0.00 ? 113 GLU A H    3  
ATOM 5961  H HA   . GLU A 1 113 ? -5.613  9.580   -3.323  1.00 0.00 ? 113 GLU A HA   3  
ATOM 5962  H HB2  . GLU A 1 113 ? -5.475  12.023  -1.552  1.00 0.00 ? 113 GLU A HB2  3  
ATOM 5963  H HB3  . GLU A 1 113 ? -4.042  11.533  -2.432  1.00 0.00 ? 113 GLU A HB3  3  
ATOM 5964  H HG2  . GLU A 1 113 ? -4.968  12.019  -4.508  1.00 0.00 ? 113 GLU A HG2  3  
ATOM 5965  H HG3  . GLU A 1 113 ? -6.595  11.604  -4.006  1.00 0.00 ? 113 GLU A HG3  3  
ATOM 5966  N N    . ALA A 1 114 ? -4.137  8.095   -2.012  1.00 0.00 ? 114 ALA A N    3  
ATOM 5967  C CA   . ALA A 1 114 ? -3.204  7.234   -1.304  1.00 0.00 ? 114 ALA A CA   3  
ATOM 5968  C C    . ALA A 1 114 ? -2.493  6.325   -2.308  1.00 0.00 ? 114 ALA A C    3  
ATOM 5969  O O    . ALA A 1 114 ? -2.819  6.330   -3.495  1.00 0.00 ? 114 ALA A O    3  
ATOM 5970  C CB   . ALA A 1 114 ? -3.954  6.443   -0.231  1.00 0.00 ? 114 ALA A CB   3  
ATOM 5971  H H    . ALA A 1 114 ? -4.393  7.780   -2.925  1.00 0.00 ? 114 ALA A H    3  
ATOM 5972  H HA   . ALA A 1 114 ? -2.466  7.873   -0.818  1.00 0.00 ? 114 ALA A HA   3  
ATOM 5973  H HB1  . ALA A 1 114 ? -3.719  5.383   -0.329  1.00 0.00 ? 114 ALA A HB1  3  
ATOM 5974  H HB2  . ALA A 1 114 ? -3.651  6.792   0.757   1.00 0.00 ? 114 ALA A HB2  3  
ATOM 5975  H HB3  . ALA A 1 114 ? -5.027  6.589   -0.354  1.00 0.00 ? 114 ALA A HB3  3  
ATOM 5976  N N    . PHE A 1 115 ? -1.535  5.567   -1.797  1.00 0.00 ? 115 PHE A N    3  
ATOM 5977  C CA   . PHE A 1 115 ? -0.775  4.655   -2.634  1.00 0.00 ? 115 PHE A CA   3  
ATOM 5978  C C    . PHE A 1 115 ? -1.064  3.199   -2.262  1.00 0.00 ? 115 PHE A C    3  
ATOM 5979  O O    . PHE A 1 115 ? -1.765  2.931   -1.287  1.00 0.00 ? 115 PHE A O    3  
ATOM 5980  C CB   . PHE A 1 115 ? 0.706   4.948   -2.386  1.00 0.00 ? 115 PHE A CB   3  
ATOM 5981  C CG   . PHE A 1 115 ? 1.109   6.397   -2.667  1.00 0.00 ? 115 PHE A CG   3  
ATOM 5982  C CD1  . PHE A 1 115 ? 0.972   7.341   -1.698  1.00 0.00 ? 115 PHE A CD1  3  
ATOM 5983  C CD2  . PHE A 1 115 ? 1.604   6.741   -3.886  1.00 0.00 ? 115 PHE A CD2  3  
ATOM 5984  C CE1  . PHE A 1 115 ? 1.346   8.686   -1.958  1.00 0.00 ? 115 PHE A CE1  3  
ATOM 5985  C CE2  . PHE A 1 115 ? 1.978   8.086   -4.147  1.00 0.00 ? 115 PHE A CE2  3  
ATOM 5986  C CZ   . PHE A 1 115 ? 1.841   9.030   -3.177  1.00 0.00 ? 115 PHE A CZ   3  
ATOM 5987  H H    . PHE A 1 115 ? -1.276  5.569   -0.831  1.00 0.00 ? 115 PHE A H    3  
ATOM 5988  H HA   . PHE A 1 115 ? -1.081  4.831   -3.665  1.00 0.00 ? 115 PHE A HA   3  
ATOM 5989  H HB2  . PHE A 1 115 ? 0.944   4.710   -1.349  1.00 0.00 ? 115 PHE A HB2  3  
ATOM 5990  H HB3  . PHE A 1 115 ? 1.306   4.287   -3.011  1.00 0.00 ? 115 PHE A HB3  3  
ATOM 5991  H HD1  . PHE A 1 115 ? 0.575   7.065   -0.721  1.00 0.00 ? 115 PHE A HD1  3  
ATOM 5992  H HD2  . PHE A 1 115 ? 1.714   5.984   -4.663  1.00 0.00 ? 115 PHE A HD2  3  
ATOM 5993  H HE1  . PHE A 1 115 ? 1.236   9.442   -1.181  1.00 0.00 ? 115 PHE A HE1  3  
ATOM 5994  H HE2  . PHE A 1 115 ? 2.375   8.361   -5.123  1.00 0.00 ? 115 PHE A HE2  3  
ATOM 5995  H HZ   . PHE A 1 115 ? 2.128   10.062  -3.377  1.00 0.00 ? 115 PHE A HZ   3  
ATOM 5996  N N    . ALA A 1 116 ? -0.509  2.297   -3.058  1.00 0.00 ? 116 ALA A N    3  
ATOM 5997  C CA   . ALA A 1 116 ? -0.698  0.875   -2.824  1.00 0.00 ? 116 ALA A CA   3  
ATOM 5998  C C    . ALA A 1 116 ? 0.631   0.252   -2.396  1.00 0.00 ? 116 ALA A C    3  
ATOM 5999  O O    . ALA A 1 116 ? 1.687   0.861   -2.557  1.00 0.00 ? 116 ALA A O    3  
ATOM 6000  C CB   . ALA A 1 116 ? -1.269  0.222   -4.084  1.00 0.00 ? 116 ALA A CB   3  
ATOM 6001  H H    . ALA A 1 116 ? 0.059   2.523   -3.849  1.00 0.00 ? 116 ALA A H    3  
ATOM 6002  H HA   . ALA A 1 116 ? -1.420  0.765   -2.014  1.00 0.00 ? 116 ALA A HA   3  
ATOM 6003  H HB1  . ALA A 1 116 ? -1.578  -0.798  -3.857  1.00 0.00 ? 116 ALA A HB1  3  
ATOM 6004  H HB2  . ALA A 1 116 ? -2.130  0.793   -4.432  1.00 0.00 ? 116 ALA A HB2  3  
ATOM 6005  H HB3  . ALA A 1 116 ? -0.506  0.206   -4.863  1.00 0.00 ? 116 ALA A HB3  3  
ATOM 6006  N N    . LEU A 1 117 ? 0.536   -0.955  -1.858  1.00 0.00 ? 117 LEU A N    3  
ATOM 6007  C CA   . LEU A 1 117 ? 1.719   -1.668  -1.405  1.00 0.00 ? 117 LEU A CA   3  
ATOM 6008  C C    . LEU A 1 117 ? 1.473   -3.174  -1.512  1.00 0.00 ? 117 LEU A C    3  
ATOM 6009  O O    . LEU A 1 117 ? 0.556   -3.704  -0.886  1.00 0.00 ? 117 LEU A O    3  
ATOM 6010  C CB   . LEU A 1 117 ? 2.117   -1.208  -0.001  1.00 0.00 ? 117 LEU A CB   3  
ATOM 6011  C CG   . LEU A 1 117 ? 3.619   -1.096  0.268   1.00 0.00 ? 117 LEU A CG   3  
ATOM 6012  C CD1  . LEU A 1 117 ? 4.344   -2.385  -0.123  1.00 0.00 ? 117 LEU A CD1  3  
ATOM 6013  C CD2  . LEU A 1 117 ? 4.210   0.129   -0.432  1.00 0.00 ? 117 LEU A CD2  3  
ATOM 6014  H H    . LEU A 1 117 ? -0.327  -1.444  -1.730  1.00 0.00 ? 117 LEU A H    3  
ATOM 6015  H HA   . LEU A 1 117 ? 2.537   -1.403  -2.075  1.00 0.00 ? 117 LEU A HA   3  
ATOM 6016  H HB2  . LEU A 1 117 ? 1.661   -0.235  0.184   1.00 0.00 ? 117 LEU A HB2  3  
ATOM 6017  H HB3  . LEU A 1 117 ? 1.690   -1.903  0.722   1.00 0.00 ? 117 LEU A HB3  3  
ATOM 6018  H HG   . LEU A 1 117 ? 3.765   -0.956  1.339   1.00 0.00 ? 117 LEU A HG   3  
ATOM 6019  H HD11 . LEU A 1 117 ? 3.613   -3.134  -0.429  1.00 0.00 ? 117 LEU A HD11 3  
ATOM 6020  H HD12 . LEU A 1 117 ? 5.025   -2.183  -0.950  1.00 0.00 ? 117 LEU A HD12 3  
ATOM 6021  H HD13 . LEU A 1 117 ? 4.910   -2.757  0.731   1.00 0.00 ? 117 LEU A HD13 3  
ATOM 6022  H HD21 . LEU A 1 117 ? 3.606   0.376   -1.306  1.00 0.00 ? 117 LEU A HD21 3  
ATOM 6023  H HD22 . LEU A 1 117 ? 4.215   0.974   0.256   1.00 0.00 ? 117 LEU A HD22 3  
ATOM 6024  H HD23 . LEU A 1 117 ? 5.231   -0.089  -0.746  1.00 0.00 ? 117 LEU A HD23 3  
ATOM 6025  N N    . ILE A 1 118 ? 2.309   -3.823  -2.310  1.00 0.00 ? 118 ILE A N    3  
ATOM 6026  C CA   . ILE A 1 118 ? 2.194   -5.258  -2.507  1.00 0.00 ? 118 ILE A CA   3  
ATOM 6027  C C    . ILE A 1 118 ? 2.929   -5.983  -1.378  1.00 0.00 ? 118 ILE A C    3  
ATOM 6028  O O    . ILE A 1 118 ? 3.968   -5.521  -0.911  1.00 0.00 ? 118 ILE A O    3  
ATOM 6029  C CB   . ILE A 1 118 ? 2.678   -5.647  -3.906  1.00 0.00 ? 118 ILE A CB   3  
ATOM 6030  C CG1  . ILE A 1 118 ? 2.770   -7.167  -4.051  1.00 0.00 ? 118 ILE A CG1  3  
ATOM 6031  C CG2  . ILE A 1 118 ? 4.003   -4.958  -4.239  1.00 0.00 ? 118 ILE A CG2  3  
ATOM 6032  C CD1  . ILE A 1 118 ? 2.977   -7.567  -5.513  1.00 0.00 ? 118 ILE A CD1  3  
ATOM 6033  H H    . ILE A 1 118 ? 3.052   -3.385  -2.816  1.00 0.00 ? 118 ILE A H    3  
ATOM 6034  H HA   . ILE A 1 118 ? 1.136   -5.512  -2.450  1.00 0.00 ? 118 ILE A HA   3  
ATOM 6035  H HB   . ILE A 1 118 ? 1.943   -5.298  -4.631  1.00 0.00 ? 118 ILE A HB   3  
ATOM 6036  H HG12 . ILE A 1 118 ? 3.595   -7.544  -3.446  1.00 0.00 ? 118 ILE A HG12 3  
ATOM 6037  H HG13 . ILE A 1 118 ? 1.859   -7.628  -3.670  1.00 0.00 ? 118 ILE A HG13 3  
ATOM 6038  H HG21 . ILE A 1 118 ? 3.816   -4.110  -4.897  1.00 0.00 ? 118 ILE A HG21 3  
ATOM 6039  H HG22 . ILE A 1 118 ? 4.472   -4.608  -3.319  1.00 0.00 ? 118 ILE A HG22 3  
ATOM 6040  H HG23 . ILE A 1 118 ? 4.665   -5.666  -4.737  1.00 0.00 ? 118 ILE A HG23 3  
ATOM 6041  H HD11 . ILE A 1 118 ? 3.811   -7.002  -5.929  1.00 0.00 ? 118 ILE A HD11 3  
ATOM 6042  H HD12 . ILE A 1 118 ? 3.195   -8.633  -5.571  1.00 0.00 ? 118 ILE A HD12 3  
ATOM 6043  H HD13 . ILE A 1 118 ? 2.072   -7.350  -6.081  1.00 0.00 ? 118 ILE A HD13 3  
ATOM 6044  N N    . ALA A 1 119 ? 2.359   -7.109  -0.973  1.00 0.00 ? 119 ALA A N    3  
ATOM 6045  C CA   . ALA A 1 119 ? 2.947   -7.903  0.093   1.00 0.00 ? 119 ALA A CA   3  
ATOM 6046  C C    . ALA A 1 119 ? 4.302   -8.445  -0.369  1.00 0.00 ? 119 ALA A C    3  
ATOM 6047  O O    . ALA A 1 119 ? 5.302   -8.305  0.334   1.00 0.00 ? 119 ALA A O    3  
ATOM 6048  C CB   . ALA A 1 119 ? 1.979   -9.018  0.492   1.00 0.00 ? 119 ALA A CB   3  
ATOM 6049  H H    . ALA A 1 119 ? 1.514   -7.478  -1.358  1.00 0.00 ? 119 ALA A H    3  
ATOM 6050  H HA   . ALA A 1 119 ? 3.100   -7.247  0.950   1.00 0.00 ? 119 ALA A HA   3  
ATOM 6051  H HB1  . ALA A 1 119 ? 2.354   -9.974  0.125   1.00 0.00 ? 119 ALA A HB1  3  
ATOM 6052  H HB2  . ALA A 1 119 ? 1.894   -9.054  1.578   1.00 0.00 ? 119 ALA A HB2  3  
ATOM 6053  H HB3  . ALA A 1 119 ? 0.999   -8.821  0.057   1.00 0.00 ? 119 ALA A HB3  3  
ATOM 6054  N N    . ASP A 1 120 ? 4.290   -9.051  -1.546  1.00 0.00 ? 120 ASP A N    3  
ATOM 6055  C CA   . ASP A 1 120 ? 5.506   -9.615  -2.109  1.00 0.00 ? 120 ASP A CA   3  
ATOM 6056  C C    . ASP A 1 120 ? 6.672   -8.657  -1.855  1.00 0.00 ? 120 ASP A C    3  
ATOM 6057  O O    . ASP A 1 120 ? 7.583   -8.972  -1.091  1.00 0.00 ? 120 ASP A O    3  
ATOM 6058  C CB   . ASP A 1 120 ? 5.374   -9.808  -3.621  1.00 0.00 ? 120 ASP A CB   3  
ATOM 6059  C CG   . ASP A 1 120 ? 5.435   -11.261 -4.095  1.00 0.00 ? 120 ASP A CG   3  
ATOM 6060  O OD1  . ASP A 1 120 ? 5.384   -12.148 -3.215  1.00 0.00 ? 120 ASP A OD1  3  
ATOM 6061  O OD2  . ASP A 1 120 ? 5.531   -11.453 -5.327  1.00 0.00 ? 120 ASP A OD2  3  
ATOM 6062  H H    . ASP A 1 120 ? 3.473   -9.161  -2.111  1.00 0.00 ? 120 ASP A H    3  
ATOM 6063  H HA   . ASP A 1 120 ? 5.636   -10.573 -1.608  1.00 0.00 ? 120 ASP A HA   3  
ATOM 6064  H HB2  . ASP A 1 120 ? 4.428   -9.375  -3.947  1.00 0.00 ? 120 ASP A HB2  3  
ATOM 6065  H HB3  . ASP A 1 120 ? 6.168   -9.247  -4.115  1.00 0.00 ? 120 ASP A HB3  3  
ATOM 6066  N N    . GLU A 1 121 ? 6.605   -7.507  -2.510  1.00 0.00 ? 121 GLU A N    3  
ATOM 6067  C CA   . GLU A 1 121 ? 7.644   -6.502  -2.364  1.00 0.00 ? 121 GLU A CA   3  
ATOM 6068  C C    . GLU A 1 121 ? 7.938   -6.253  -0.883  1.00 0.00 ? 121 GLU A C    3  
ATOM 6069  O O    . GLU A 1 121 ? 9.097   -6.129  -0.489  1.00 0.00 ? 121 GLU A O    3  
ATOM 6070  C CB   . GLU A 1 121 ? 7.253   -5.203  -3.071  1.00 0.00 ? 121 GLU A CB   3  
ATOM 6071  C CG   . GLU A 1 121 ? 7.056   -5.433  -4.571  1.00 0.00 ? 121 GLU A CG   3  
ATOM 6072  C CD   . GLU A 1 121 ? 8.391   -5.371  -5.315  1.00 0.00 ? 121 GLU A CD   3  
ATOM 6073  O OE1  . GLU A 1 121 ? 9.207   -6.292  -5.096  1.00 0.00 ? 121 GLU A OE1  3  
ATOM 6074  O OE2  . GLU A 1 121 ? 8.566   -4.403  -6.087  1.00 0.00 ? 121 GLU A OE2  3  
ATOM 6075  H H    . GLU A 1 121 ? 5.860   -7.259  -3.129  1.00 0.00 ? 121 GLU A H    3  
ATOM 6076  H HA   . GLU A 1 121 ? 8.524   -6.922  -2.851  1.00 0.00 ? 121 GLU A HA   3  
ATOM 6077  H HB2  . GLU A 1 121 ? 6.334   -4.810  -2.636  1.00 0.00 ? 121 GLU A HB2  3  
ATOM 6078  H HB3  . GLU A 1 121 ? 8.027   -4.451  -2.914  1.00 0.00 ? 121 GLU A HB3  3  
ATOM 6079  H HG2  . GLU A 1 121 ? 6.589   -6.404  -4.735  1.00 0.00 ? 121 GLU A HG2  3  
ATOM 6080  H HG3  . GLU A 1 121 ? 6.377   -4.680  -4.972  1.00 0.00 ? 121 GLU A HG3  3  
ATOM 6081  N N    . LEU A 1 122 ? 6.869   -6.187  -0.104  1.00 0.00 ? 122 LEU A N    3  
ATOM 6082  C CA   . LEU A 1 122 ? 6.998   -5.955  1.325   1.00 0.00 ? 122 LEU A CA   3  
ATOM 6083  C C    . LEU A 1 122 ? 7.824   -7.082  1.948   1.00 0.00 ? 122 LEU A C    3  
ATOM 6084  O O    . LEU A 1 122 ? 8.911   -6.843  2.472   1.00 0.00 ? 122 LEU A O    3  
ATOM 6085  C CB   . LEU A 1 122 ? 5.620   -5.777  1.965   1.00 0.00 ? 122 LEU A CB   3  
ATOM 6086  C CG   . LEU A 1 122 ? 5.526   -4.729  3.076   1.00 0.00 ? 122 LEU A CG   3  
ATOM 6087  C CD1  . LEU A 1 122 ? 4.083   -4.563  3.554   1.00 0.00 ? 122 LEU A CD1  3  
ATOM 6088  C CD2  . LEU A 1 122 ? 6.476   -5.065  4.228   1.00 0.00 ? 122 LEU A CD2  3  
ATOM 6089  H H    . LEU A 1 122 ? 5.930   -6.289  -0.432  1.00 0.00 ? 122 LEU A H    3  
ATOM 6090  H HA   . LEU A 1 122 ? 7.538   -5.018  1.457   1.00 0.00 ? 122 LEU A HA   3  
ATOM 6091  H HB2  . LEU A 1 122 ? 4.909   -5.512  1.183   1.00 0.00 ? 122 LEU A HB2  3  
ATOM 6092  H HB3  . LEU A 1 122 ? 5.303   -6.738  2.372   1.00 0.00 ? 122 LEU A HB3  3  
ATOM 6093  H HG   . LEU A 1 122 ? 5.842   -3.769  2.668   1.00 0.00 ? 122 LEU A HG   3  
ATOM 6094  H HD11 . LEU A 1 122 ? 4.066   -3.953  4.457   1.00 0.00 ? 122 LEU A HD11 3  
ATOM 6095  H HD12 . LEU A 1 122 ? 3.496   -4.076  2.775   1.00 0.00 ? 122 LEU A HD12 3  
ATOM 6096  H HD13 . LEU A 1 122 ? 3.657   -5.543  3.770   1.00 0.00 ? 122 LEU A HD13 3  
ATOM 6097  H HD21 . LEU A 1 122 ? 5.899   -5.238  5.136   1.00 0.00 ? 122 LEU A HD21 3  
ATOM 6098  H HD22 . LEU A 1 122 ? 7.043   -5.963  3.981   1.00 0.00 ? 122 LEU A HD22 3  
ATOM 6099  H HD23 . LEU A 1 122 ? 7.163   -4.233  4.387   1.00 0.00 ? 122 LEU A HD23 3  
ATOM 6100  N N    . LYS A 1 123 ? 7.277   -8.287  1.869   1.00 0.00 ? 123 LYS A N    3  
ATOM 6101  C CA   . LYS A 1 123 ? 7.950   -9.451  2.419   1.00 0.00 ? 123 LYS A CA   3  
ATOM 6102  C C    . LYS A 1 123 ? 9.414   -9.447  1.972   1.00 0.00 ? 123 LYS A C    3  
ATOM 6103  O O    . LYS A 1 123 ? 10.318  -9.590  2.794   1.00 0.00 ? 123 LYS A O    3  
ATOM 6104  C CB   . LYS A 1 123 ? 7.198   -10.730 2.047   1.00 0.00 ? 123 LYS A CB   3  
ATOM 6105  C CG   . LYS A 1 123 ? 7.412   -11.819 3.101   1.00 0.00 ? 123 LYS A CG   3  
ATOM 6106  C CD   . LYS A 1 123 ? 6.076   -12.400 3.568   1.00 0.00 ? 123 LYS A CD   3  
ATOM 6107  C CE   . LYS A 1 123 ? 5.793   -13.740 2.886   1.00 0.00 ? 123 LYS A CE   3  
ATOM 6108  N NZ   . LYS A 1 123 ? 5.611   -14.807 3.895   1.00 0.00 ? 123 LYS A NZ   3  
ATOM 6109  H H    . LYS A 1 123 ? 6.393   -8.473  1.441   1.00 0.00 ? 123 LYS A H    3  
ATOM 6110  H HA   . LYS A 1 123 ? 7.921   -9.364  3.505   1.00 0.00 ? 123 LYS A HA   3  
ATOM 6111  H HB2  . LYS A 1 123 ? 6.133   -10.516 1.952   1.00 0.00 ? 123 LYS A HB2  3  
ATOM 6112  H HB3  . LYS A 1 123 ? 7.538   -11.088 1.075   1.00 0.00 ? 123 LYS A HB3  3  
ATOM 6113  H HG2  . LYS A 1 123 ? 8.034   -12.613 2.687   1.00 0.00 ? 123 LYS A HG2  3  
ATOM 6114  H HG3  . LYS A 1 123 ? 7.950   -11.404 3.953   1.00 0.00 ? 123 LYS A HG3  3  
ATOM 6115  H HD2  . LYS A 1 123 ? 6.092   -12.535 4.649   1.00 0.00 ? 123 LYS A HD2  3  
ATOM 6116  H HD3  . LYS A 1 123 ? 5.272   -11.699 3.346   1.00 0.00 ? 123 LYS A HD3  3  
ATOM 6117  H HE2  . LYS A 1 123 ? 4.899   -13.659 2.268   1.00 0.00 ? 123 LYS A HE2  3  
ATOM 6118  H HE3  . LYS A 1 123 ? 6.618   -13.998 2.221   1.00 0.00 ? 123 LYS A HE3  3  
ATOM 6119  H HZ1  . LYS A 1 123 ? 4.786   -15.331 3.681   1.00 0.00 ? 123 LYS A HZ1  3  
ATOM 6120  H HZ2  . LYS A 1 123 ? 6.405   -15.416 3.884   1.00 0.00 ? 123 LYS A HZ2  3  
ATOM 6121  H HZ3  . LYS A 1 123 ? 5.519   -14.396 4.802   1.00 0.00 ? 123 LYS A HZ3  3  
ATOM 6122  N N    . PHE A 1 124 ? 9.602   -9.282  0.671   1.00 0.00 ? 124 PHE A N    3  
ATOM 6123  C CA   . PHE A 1 124 ? 10.940  -9.257  0.105   1.00 0.00 ? 124 PHE A CA   3  
ATOM 6124  C C    . PHE A 1 124 ? 11.849  -8.308  0.889   1.00 0.00 ? 124 PHE A C    3  
ATOM 6125  O O    . PHE A 1 124 ? 12.844  -8.736  1.471   1.00 0.00 ? 124 PHE A O    3  
ATOM 6126  C CB   . PHE A 1 124 ? 10.809  -8.748  -1.332  1.00 0.00 ? 124 PHE A CB   3  
ATOM 6127  C CG   . PHE A 1 124 ? 12.147  -8.534  -2.041  1.00 0.00 ? 124 PHE A CG   3  
ATOM 6128  C CD1  . PHE A 1 124 ? 12.852  -7.390  -1.831  1.00 0.00 ? 124 PHE A CD1  3  
ATOM 6129  C CD2  . PHE A 1 124 ? 12.633  -9.488  -2.880  1.00 0.00 ? 124 PHE A CD2  3  
ATOM 6130  C CE1  . PHE A 1 124 ? 14.094  -7.190  -2.489  1.00 0.00 ? 124 PHE A CE1  3  
ATOM 6131  C CE2  . PHE A 1 124 ? 13.876  -9.288  -3.538  1.00 0.00 ? 124 PHE A CE2  3  
ATOM 6132  C CZ   . PHE A 1 124 ? 14.580  -8.144  -3.328  1.00 0.00 ? 124 PHE A CZ   3  
ATOM 6133  H H    . PHE A 1 124 ? 8.861   -9.166  0.009   1.00 0.00 ? 124 PHE A H    3  
ATOM 6134  H HA   . PHE A 1 124 ? 11.336  -10.271 0.167   1.00 0.00 ? 124 PHE A HA   3  
ATOM 6135  H HB2  . PHE A 1 124 ? 10.215  -9.460  -1.906  1.00 0.00 ? 124 PHE A HB2  3  
ATOM 6136  H HB3  . PHE A 1 124 ? 10.258  -7.808  -1.324  1.00 0.00 ? 124 PHE A HB3  3  
ATOM 6137  H HD1  . PHE A 1 124 ? 12.463  -6.625  -1.159  1.00 0.00 ? 124 PHE A HD1  3  
ATOM 6138  H HD2  . PHE A 1 124 ? 12.068  -10.405 -3.048  1.00 0.00 ? 124 PHE A HD2  3  
ATOM 6139  H HE1  . PHE A 1 124 ? 14.659  -6.273  -2.321  1.00 0.00 ? 124 PHE A HE1  3  
ATOM 6140  H HE2  . PHE A 1 124 ? 14.265  -10.053 -4.210  1.00 0.00 ? 124 PHE A HE2  3  
ATOM 6141  H HZ   . PHE A 1 124 ? 15.534  -7.991  -3.833  1.00 0.00 ? 124 PHE A HZ   3  
ATOM 6142  N N    . VAL A 1 125 ? 11.474  -7.037  0.878   1.00 0.00 ? 125 VAL A N    3  
ATOM 6143  C CA   . VAL A 1 125 ? 12.243  -6.024  1.580   1.00 0.00 ? 125 VAL A CA   3  
ATOM 6144  C C    . VAL A 1 125 ? 12.234  -6.331  3.079   1.00 0.00 ? 125 VAL A C    3  
ATOM 6145  O O    . VAL A 1 125 ? 13.175  -5.985  3.792   1.00 0.00 ? 125 VAL A O    3  
ATOM 6146  C CB   . VAL A 1 125 ? 11.699  -4.633  1.251   1.00 0.00 ? 125 VAL A CB   3  
ATOM 6147  C CG1  . VAL A 1 125 ? 10.603  -4.226  2.238   1.00 0.00 ? 125 VAL A CG1  3  
ATOM 6148  C CG2  . VAL A 1 125 ? 12.824  -3.596  1.223   1.00 0.00 ? 125 VAL A CG2  3  
ATOM 6149  H H    . VAL A 1 125 ? 10.663  -6.698  0.401   1.00 0.00 ? 125 VAL A H    3  
ATOM 6150  H HA   . VAL A 1 125 ? 13.269  -6.080  1.216   1.00 0.00 ? 125 VAL A HA   3  
ATOM 6151  H HB   . VAL A 1 125 ? 11.256  -4.673  0.256   1.00 0.00 ? 125 VAL A HB   3  
ATOM 6152  H HG11 . VAL A 1 125 ? 9.729   -4.862  2.094   1.00 0.00 ? 125 VAL A HG11 3  
ATOM 6153  H HG12 . VAL A 1 125 ? 10.971  -4.341  3.258   1.00 0.00 ? 125 VAL A HG12 3  
ATOM 6154  H HG13 . VAL A 1 125 ? 10.327  -3.185  2.067   1.00 0.00 ? 125 VAL A HG13 3  
ATOM 6155  H HG21 . VAL A 1 125 ? 12.579  -2.776  1.898   1.00 0.00 ? 125 VAL A HG21 3  
ATOM 6156  H HG22 . VAL A 1 125 ? 13.756  -4.063  1.542   1.00 0.00 ? 125 VAL A HG22 3  
ATOM 6157  H HG23 . VAL A 1 125 ? 12.939  -3.212  0.210   1.00 0.00 ? 125 VAL A HG23 3  
ATOM 6158  N N    . ALA A 1 126 ? 11.162  -6.977  3.512   1.00 0.00 ? 126 ALA A N    3  
ATOM 6159  C CA   . ALA A 1 126 ? 11.018  -7.335  4.913   1.00 0.00 ? 126 ALA A CA   3  
ATOM 6160  C C    . ALA A 1 126 ? 12.085  -8.367  5.283   1.00 0.00 ? 126 ALA A C    3  
ATOM 6161  O O    . ALA A 1 126 ? 12.772  -8.220  6.293   1.00 0.00 ? 126 ALA A O    3  
ATOM 6162  C CB   . ALA A 1 126 ? 9.599   -7.847  5.166   1.00 0.00 ? 126 ALA A CB   3  
ATOM 6163  H H    . ALA A 1 126 ? 10.402  -7.255  2.924   1.00 0.00 ? 126 ALA A H    3  
ATOM 6164  H HA   . ALA A 1 126 ? 11.177  -6.433  5.503   1.00 0.00 ? 126 ALA A HA   3  
ATOM 6165  H HB1  . ALA A 1 126 ? 8.884   -7.204  4.653   1.00 0.00 ? 126 ALA A HB1  3  
ATOM 6166  H HB2  . ALA A 1 126 ? 9.507   -8.865  4.789   1.00 0.00 ? 126 ALA A HB2  3  
ATOM 6167  H HB3  . ALA A 1 126 ? 9.395   -7.836  6.237   1.00 0.00 ? 126 ALA A HB3  3  
ATOM 6168  N N    . SER A 1 127 ? 12.191  -9.388  4.446   1.00 0.00 ? 127 SER A N    3  
ATOM 6169  C CA   . SER A 1 127 ? 13.163  -10.445 4.673   1.00 0.00 ? 127 SER A CA   3  
ATOM 6170  C C    . SER A 1 127 ? 14.567  -9.947  4.325   1.00 0.00 ? 127 SER A C    3  
ATOM 6171  O O    . SER A 1 127 ? 15.501  -10.114 5.108   1.00 0.00 ? 127 SER A O    3  
ATOM 6172  C CB   . SER A 1 127 ? 12.823  -11.691 3.853   1.00 0.00 ? 127 SER A CB   3  
ATOM 6173  O OG   . SER A 1 127 ? 13.085  -12.892 4.575   1.00 0.00 ? 127 SER A OG   3  
ATOM 6174  H H    . SER A 1 127 ? 11.629  -9.500  3.627   1.00 0.00 ? 127 SER A H    3  
ATOM 6175  H HA   . SER A 1 127 ? 13.092  -10.678 5.735   1.00 0.00 ? 127 SER A HA   3  
ATOM 6176  H HB2  . SER A 1 127 ? 11.771  -11.662 3.568   1.00 0.00 ? 127 SER A HB2  3  
ATOM 6177  H HB3  . SER A 1 127 ? 13.404  -11.688 2.931   1.00 0.00 ? 127 SER A HB3  3  
ATOM 6178  H HG   . SER A 1 127 ? 12.226  -13.357 4.789   1.00 0.00 ? 127 SER A HG   3  
ATOM 6179  N N    . GLN A 1 128 ? 14.673  -9.346  3.149   1.00 0.00 ? 128 GLN A N    3  
ATOM 6180  C CA   . GLN A 1 128 ? 15.948  -8.823  2.687   1.00 0.00 ? 128 GLN A CA   3  
ATOM 6181  C C    . GLN A 1 128 ? 16.721  -8.204  3.854   1.00 0.00 ? 128 GLN A C    3  
ATOM 6182  O O    . GLN A 1 128 ? 17.927  -8.408  3.980   1.00 0.00 ? 128 GLN A O    3  
ATOM 6183  C CB   . GLN A 1 128 ? 15.748  -7.807  1.561   1.00 0.00 ? 128 GLN A CB   3  
ATOM 6184  C CG   . GLN A 1 128 ? 15.975  -8.453  0.193   1.00 0.00 ? 128 GLN A CG   3  
ATOM 6185  C CD   . GLN A 1 128 ? 17.466  -8.515  -0.144  1.00 0.00 ? 128 GLN A CD   3  
ATOM 6186  O OE1  . GLN A 1 128 ? 18.062  -7.562  -0.618  1.00 0.00 ? 128 GLN A OE1  3  
ATOM 6187  N NE2  . GLN A 1 128 ? 18.033  -9.687  0.127   1.00 0.00 ? 128 GLN A NE2  3  
ATOM 6188  H H    . GLN A 1 128 ? 13.908  -9.214  2.518   1.00 0.00 ? 128 GLN A H    3  
ATOM 6189  H HA   . GLN A 1 128 ? 16.490  -9.684  2.299   1.00 0.00 ? 128 GLN A HA   3  
ATOM 6190  H HB2  . GLN A 1 128 ? 14.739  -7.396  1.611   1.00 0.00 ? 128 GLN A HB2  3  
ATOM 6191  H HB3  . GLN A 1 128 ? 16.438  -6.973  1.692   1.00 0.00 ? 128 GLN A HB3  3  
ATOM 6192  H HG2  . GLN A 1 128 ? 15.555  -9.459  0.188   1.00 0.00 ? 128 GLN A HG2  3  
ATOM 6193  H HG3  . GLN A 1 128 ? 15.448  -7.884  -0.573  1.00 0.00 ? 128 GLN A HG3  3  
ATOM 6194  H HE21 . GLN A 1 128 ? 17.487  -10.429 0.516   1.00 0.00 ? 128 GLN A HE21 3  
ATOM 6195  H HE22 . GLN A 1 128 ? 19.006  -9.827  -0.059  1.00 0.00 ? 128 GLN A HE22 3  
ATOM 6196  N N    . PHE A 1 129 ? 15.995  -7.461  4.676   1.00 0.00 ? 129 PHE A N    3  
ATOM 6197  C CA   . PHE A 1 129 ? 16.597  -6.812  5.827   1.00 0.00 ? 129 PHE A CA   3  
ATOM 6198  C C    . PHE A 1 129 ? 16.871  -7.820  6.945   1.00 0.00 ? 129 PHE A C    3  
ATOM 6199  O O    . PHE A 1 129 ? 18.000  -7.935  7.419   1.00 0.00 ? 129 PHE A O    3  
ATOM 6200  C CB   . PHE A 1 129 ? 15.594  -5.772  6.330   1.00 0.00 ? 129 PHE A CB   3  
ATOM 6201  C CG   . PHE A 1 129 ? 16.218  -4.414  6.660   1.00 0.00 ? 129 PHE A CG   3  
ATOM 6202  C CD1  . PHE A 1 129 ? 16.793  -3.672  5.676   1.00 0.00 ? 129 PHE A CD1  3  
ATOM 6203  C CD2  . PHE A 1 129 ? 16.198  -3.949  7.938   1.00 0.00 ? 129 PHE A CD2  3  
ATOM 6204  C CE1  . PHE A 1 129 ? 17.372  -2.413  5.982   1.00 0.00 ? 129 PHE A CE1  3  
ATOM 6205  C CE2  . PHE A 1 129 ? 16.777  -2.689  8.244   1.00 0.00 ? 129 PHE A CE2  3  
ATOM 6206  C CZ   . PHE A 1 129 ? 17.352  -1.948  7.260   1.00 0.00 ? 129 PHE A CZ   3  
ATOM 6207  H H    . PHE A 1 129 ? 15.014  -7.301  4.566   1.00 0.00 ? 129 PHE A H    3  
ATOM 6208  H HA   . PHE A 1 129 ? 17.539  -6.375  5.496   1.00 0.00 ? 129 PHE A HA   3  
ATOM 6209  H HB2  . PHE A 1 129 ? 14.822  -5.631  5.574   1.00 0.00 ? 129 PHE A HB2  3  
ATOM 6210  H HB3  . PHE A 1 129 ? 15.100  -6.159  7.221   1.00 0.00 ? 129 PHE A HB3  3  
ATOM 6211  H HD1  . PHE A 1 129 ? 16.809  -4.045  4.651   1.00 0.00 ? 129 PHE A HD1  3  
ATOM 6212  H HD2  . PHE A 1 129 ? 15.738  -4.543  8.727   1.00 0.00 ? 129 PHE A HD2  3  
ATOM 6213  H HE1  . PHE A 1 129 ? 17.833  -1.818  5.193   1.00 0.00 ? 129 PHE A HE1  3  
ATOM 6214  H HE2  . PHE A 1 129 ? 16.761  -2.317  9.268   1.00 0.00 ? 129 PHE A HE2  3  
ATOM 6215  H HZ   . PHE A 1 129 ? 17.796  -0.980  7.495   1.00 0.00 ? 129 PHE A HZ   3  
ATOM 6216  N N    . ARG A 1 130 ? 15.819  -8.526  7.333   1.00 0.00 ? 130 ARG A N    3  
ATOM 6217  C CA   . ARG A 1 130 ? 15.932  -9.521  8.385   1.00 0.00 ? 130 ARG A CA   3  
ATOM 6218  C C    . ARG A 1 130 ? 16.788  -8.983  9.534   1.00 0.00 ? 130 ARG A C    3  
ATOM 6219  O O    . ARG A 1 130 ? 17.989  -9.243  9.593   1.00 0.00 ? 130 ARG A O    3  
ATOM 6220  C CB   . ARG A 1 130 ? 16.555  -10.814 7.856   1.00 0.00 ? 130 ARG A CB   3  
ATOM 6221  C CG   . ARG A 1 130 ? 15.548  -11.965 7.897   1.00 0.00 ? 130 ARG A CG   3  
ATOM 6222  C CD   . ARG A 1 130 ? 16.259  -13.319 7.857   1.00 0.00 ? 130 ARG A CD   3  
ATOM 6223  N NE   . ARG A 1 130 ? 15.945  -14.019 6.592   1.00 0.00 ? 130 ARG A NE   3  
ATOM 6224  C CZ   . ARG A 1 130 ? 14.817  -14.710 6.376   1.00 0.00 ? 130 ARG A CZ   3  
ATOM 6225  N NH1  . ARG A 1 130 ? 13.889  -14.796 7.340   1.00 0.00 ? 130 ARG A NH1  3  
ATOM 6226  N NH2  . ARG A 1 130 ? 14.616  -15.313 5.197   1.00 0.00 ? 130 ARG A NH2  3  
ATOM 6227  H H    . ARG A 1 130 ? 14.904  -8.426  6.942   1.00 0.00 ? 130 ARG A H    3  
ATOM 6228  H HA   . ARG A 1 130 ? 14.907  -9.700  8.710   1.00 0.00 ? 130 ARG A HA   3  
ATOM 6229  H HB2  . ARG A 1 130 ? 16.900  -10.664 6.833   1.00 0.00 ? 130 ARG A HB2  3  
ATOM 6230  H HB3  . ARG A 1 130 ? 17.430  -11.071 8.453   1.00 0.00 ? 130 ARG A HB3  3  
ATOM 6231  H HG2  . ARG A 1 130 ? 14.945  -11.893 8.802   1.00 0.00 ? 130 ARG A HG2  3  
ATOM 6232  H HG3  . ARG A 1 130 ? 14.864  -11.884 7.052   1.00 0.00 ? 130 ARG A HG3  3  
ATOM 6233  H HD2  . ARG A 1 130 ? 17.336  -13.175 7.945   1.00 0.00 ? 130 ARG A HD2  3  
ATOM 6234  H HD3  . ARG A 1 130 ? 15.949  -13.927 8.707   1.00 0.00 ? 130 ARG A HD3  3  
ATOM 6235  H HE   . ARG A 1 130 ? 16.616  -13.975 5.852   1.00 0.00 ? 130 ARG A HE   3  
ATOM 6236  H HH11 . ARG A 1 130 ? 14.039  -14.346 8.220   1.00 0.00 ? 130 ARG A HH11 3  
ATOM 6237  H HH12 . ARG A 1 130 ? 13.048  -15.311 7.179   1.00 0.00 ? 130 ARG A HH12 3  
ATOM 6238  H HH21 . ARG A 1 130 ? 15.308  -15.249 4.478   1.00 0.00 ? 130 ARG A HH21 3  
ATOM 6239  H HH22 . ARG A 1 130 ? 13.774  -15.829 5.036   1.00 0.00 ? 130 ARG A HH22 3  
ATOM 6240  N N    . ARG A 1 131 ? 16.136  -8.244  10.420  1.00 0.00 ? 131 ARG A N    3  
ATOM 6241  C CA   . ARG A 1 131 ? 16.822  -7.668  11.564  1.00 0.00 ? 131 ARG A CA   3  
ATOM 6242  C C    . ARG A 1 131 ? 15.823  -7.358  12.681  1.00 0.00 ? 131 ARG A C    3  
ATOM 6243  O O    . ARG A 1 131 ? 15.132  -6.341  12.635  1.00 0.00 ? 131 ARG A O    3  
ATOM 6244  C CB   . ARG A 1 131 ? 17.557  -6.384  11.175  1.00 0.00 ? 131 ARG A CB   3  
ATOM 6245  C CG   . ARG A 1 131 ? 18.397  -5.859  12.342  1.00 0.00 ? 131 ARG A CG   3  
ATOM 6246  C CD   . ARG A 1 131 ? 19.646  -5.134  11.835  1.00 0.00 ? 131 ARG A CD   3  
ATOM 6247  N NE   . ARG A 1 131 ? 20.768  -6.089  11.705  1.00 0.00 ? 131 ARG A NE   3  
ATOM 6248  C CZ   . ARG A 1 131 ? 22.036  -5.731  11.462  1.00 0.00 ? 131 ARG A CZ   3  
ATOM 6249  N NH1  . ARG A 1 131 ? 22.351  -4.436  11.321  1.00 0.00 ? 131 ARG A NH1  3  
ATOM 6250  N NH2  . ARG A 1 131 ? 22.989  -6.667  11.359  1.00 0.00 ? 131 ARG A NH2  3  
ATOM 6251  H H    . ARG A 1 131 ? 15.159  -8.038  10.365  1.00 0.00 ? 131 ARG A H    3  
ATOM 6252  H HA   . ARG A 1 131 ? 17.534  -8.432  11.875  1.00 0.00 ? 131 ARG A HA   3  
ATOM 6253  H HB2  . ARG A 1 131 ? 18.201  -6.575  10.316  1.00 0.00 ? 131 ARG A HB2  3  
ATOM 6254  H HB3  . ARG A 1 131 ? 16.836  -5.625  10.871  1.00 0.00 ? 131 ARG A HB3  3  
ATOM 6255  H HG2  . ARG A 1 131 ? 17.799  -5.179  12.948  1.00 0.00 ? 131 ARG A HG2  3  
ATOM 6256  H HG3  . ARG A 1 131 ? 18.690  -6.688  12.986  1.00 0.00 ? 131 ARG A HG3  3  
ATOM 6257  H HD2  . ARG A 1 131 ? 19.440  -4.668  10.872  1.00 0.00 ? 131 ARG A HD2  3  
ATOM 6258  H HD3  . ARG A 1 131 ? 19.917  -4.334  12.525  1.00 0.00 ? 131 ARG A HD3  3  
ATOM 6259  H HE   . ARG A 1 131 ? 20.568  -7.064  11.804  1.00 0.00 ? 131 ARG A HE   3  
ATOM 6260  H HH11 . ARG A 1 131 ? 21.639  -3.737  11.398  1.00 0.00 ? 131 ARG A HH11 3  
ATOM 6261  H HH12 . ARG A 1 131 ? 23.297  -4.168  11.140  1.00 0.00 ? 131 ARG A HH12 3  
ATOM 6262  H HH21 . ARG A 1 131 ? 22.755  -7.633  11.464  1.00 0.00 ? 131 ARG A HH21 3  
ATOM 6263  H HH22 . ARG A 1 131 ? 23.936  -6.399  11.178  1.00 0.00 ? 131 ARG A HH22 3  
ATOM 6264  N N    . SER A 1 132 ? 15.780  -8.252  13.657  1.00 0.00 ? 132 SER A N    3  
ATOM 6265  C CA   . SER A 1 132 ? 14.878  -8.086  14.784  1.00 0.00 ? 132 SER A CA   3  
ATOM 6266  C C    . SER A 1 132 ? 13.426  -8.139  14.304  1.00 0.00 ? 132 SER A C    3  
ATOM 6267  O O    . SER A 1 132 ? 13.053  -7.440  13.363  1.00 0.00 ? 132 SER A O    3  
ATOM 6268  C CB   . SER A 1 132 ? 15.146  -6.770  15.516  1.00 0.00 ? 132 SER A CB   3  
ATOM 6269  O OG   . SER A 1 132 ? 15.072  -6.921  16.931  1.00 0.00 ? 132 SER A OG   3  
ATOM 6270  H H    . SER A 1 132 ? 16.346  -9.075  13.687  1.00 0.00 ? 132 SER A H    3  
ATOM 6271  H HA   . SER A 1 132 ? 15.091  -8.922  15.450  1.00 0.00 ? 132 SER A HA   3  
ATOM 6272  H HB2  . SER A 1 132 ? 16.134  -6.398  15.243  1.00 0.00 ? 132 SER A HB2  3  
ATOM 6273  H HB3  . SER A 1 132 ? 14.423  -6.021  15.193  1.00 0.00 ? 132 SER A HB3  3  
ATOM 6274  H HG   . SER A 1 132 ? 15.428  -7.816  17.198  1.00 0.00 ? 132 SER A HG   3  
ATOM 6275  N N    . GLY A 1 133 ? 12.645  -8.976  14.972  1.00 0.00 ? 133 GLY A N    3  
ATOM 6276  C CA   . GLY A 1 133 ? 11.243  -9.130  14.626  1.00 0.00 ? 133 GLY A CA   3  
ATOM 6277  C C    . GLY A 1 133 ? 10.341  -8.700  15.785  1.00 0.00 ? 133 GLY A C    3  
ATOM 6278  O O    . GLY A 1 133 ? 10.689  -8.889  16.950  1.00 0.00 ? 133 GLY A O    3  
ATOM 6279  H H    . GLY A 1 133 ? 12.956  -9.541  15.737  1.00 0.00 ? 133 GLY A H    3  
ATOM 6280  H HA2  . GLY A 1 133 ? 11.015  -8.532  13.743  1.00 0.00 ? 133 GLY A HA2  3  
ATOM 6281  H HA3  . GLY A 1 133 ? 11.040  -10.169 14.368  1.00 0.00 ? 133 GLY A HA3  3  
ATOM 6282  N N    . PRO A 1 134 ? 9.170   -8.116  15.416  1.00 0.00 ? 134 PRO A N    3  
ATOM 6283  C CA   . PRO A 1 134 ? 8.216   -7.658  16.412  1.00 0.00 ? 134 PRO A CA   3  
ATOM 6284  C C    . PRO A 1 134 ? 7.470   -8.838  17.039  1.00 0.00 ? 134 PRO A C    3  
ATOM 6285  O O    . PRO A 1 134 ? 7.653   -9.982  16.628  1.00 0.00 ? 134 PRO A O    3  
ATOM 6286  C CB   . PRO A 1 134 ? 7.297   -6.703  15.667  1.00 0.00 ? 134 PRO A CB   3  
ATOM 6287  C CG   . PRO A 1 134 ? 7.480   -7.016  14.191  1.00 0.00 ? 134 PRO A CG   3  
ATOM 6288  C CD   . PRO A 1 134 ? 8.724   -7.876  14.047  1.00 0.00 ? 134 PRO A CD   3  
ATOM 6289  H HA   . PRO A 1 134 ? 8.691   -7.204  17.165  1.00 0.00 ? 134 PRO A HA   3  
ATOM 6290  H HB2  . PRO A 1 134 ? 6.260   -6.842  15.971  1.00 0.00 ? 134 PRO A HB2  3  
ATOM 6291  H HB3  . PRO A 1 134 ? 7.556   -5.666  15.882  1.00 0.00 ? 134 PRO A HB3  3  
ATOM 6292  H HG2  . PRO A 1 134 ? 6.607   -7.539  13.801  1.00 0.00 ? 134 PRO A HG2  3  
ATOM 6293  H HG3  . PRO A 1 134 ? 7.583   -6.096  13.616  1.00 0.00 ? 134 PRO A HG3  3  
ATOM 6294  H HD2  . PRO A 1 134 ? 8.502   -8.811  13.533  1.00 0.00 ? 134 PRO A HD2  3  
ATOM 6295  H HD3  . PRO A 1 134 ? 9.492   -7.367  13.464  1.00 0.00 ? 134 PRO A HD3  3  
ATOM 6296  N N    . SER A 1 135 ? 6.644   -8.518  18.025  1.00 0.00 ? 135 SER A N    3  
ATOM 6297  C CA   . SER A 1 135 ? 5.870   -9.537  18.713  1.00 0.00 ? 135 SER A CA   3  
ATOM 6298  C C    . SER A 1 135 ? 4.380   -9.198  18.642  1.00 0.00 ? 135 SER A C    3  
ATOM 6299  O O    . SER A 1 135 ? 4.002   -8.028  18.682  1.00 0.00 ? 135 SER A O    3  
ATOM 6300  C CB   . SER A 1 135 ? 6.314   -9.675  20.171  1.00 0.00 ? 135 SER A CB   3  
ATOM 6301  O OG   . SER A 1 135 ? 7.133   -10.824 20.373  1.00 0.00 ? 135 SER A OG   3  
ATOM 6302  H H    . SER A 1 135 ? 6.501   -7.584  18.354  1.00 0.00 ? 135 SER A H    3  
ATOM 6303  H HA   . SER A 1 135 ? 6.078   -10.465 18.181  1.00 0.00 ? 135 SER A HA   3  
ATOM 6304  H HB2  . SER A 1 135 ? 6.862   -8.782  20.469  1.00 0.00 ? 135 SER A HB2  3  
ATOM 6305  H HB3  . SER A 1 135 ? 5.435   -9.739  20.813  1.00 0.00 ? 135 SER A HB3  3  
ATOM 6306  H HG   . SER A 1 135 ? 8.063   -10.641 20.054  1.00 0.00 ? 135 SER A HG   3  
ATOM 6307  N N    . SER A 1 136 ? 3.572   -10.244 18.537  1.00 0.00 ? 136 SER A N    3  
ATOM 6308  C CA   . SER A 1 136 ? 2.132   -10.072 18.460  1.00 0.00 ? 136 SER A CA   3  
ATOM 6309  C C    . SER A 1 136 ? 1.486   -10.467 19.789  1.00 0.00 ? 136 SER A C    3  
ATOM 6310  O O    . SER A 1 136 ? 0.836   -9.646  20.435  1.00 0.00 ? 136 SER A O    3  
ATOM 6311  C CB   . SER A 1 136 ? 1.539   -10.898 17.316  1.00 0.00 ? 136 SER A CB   3  
ATOM 6312  O OG   . SER A 1 136 ? 2.214   -10.664 16.083  1.00 0.00 ? 136 SER A OG   3  
ATOM 6313  H H    . SER A 1 136 ? 3.887   -11.193 18.505  1.00 0.00 ? 136 SER A H    3  
ATOM 6314  H HA   . SER A 1 136 ? 1.978   -9.012  18.259  1.00 0.00 ? 136 SER A HA   3  
ATOM 6315  H HB2  . SER A 1 136 ? 1.598   -11.958 17.566  1.00 0.00 ? 136 SER A HB2  3  
ATOM 6316  H HB3  . SER A 1 136 ? 0.483   -10.655 17.203  1.00 0.00 ? 136 SER A HB3  3  
ATOM 6317  H HG   . SER A 1 136 ? 2.284   -9.681  15.912  1.00 0.00 ? 136 SER A HG   3  
ATOM 6318  N N    . GLY A 1 137 ? 1.686   -11.723 20.158  1.00 0.00 ? 137 GLY A N    3  
ATOM 6319  C CA   . GLY A 1 137 ? 1.131   -12.236 21.399  1.00 0.00 ? 137 GLY A CA   3  
ATOM 6320  C C    . GLY A 1 137 ? 1.395   -13.737 21.539  1.00 0.00 ? 137 GLY A C    3  
ATOM 6321  O O    . GLY A 1 137 ? 1.587   -14.432 20.542  1.00 0.00 ? 137 GLY A O    3  
ATOM 6322  H H    . GLY A 1 137 ? 2.215   -12.384 19.627  1.00 0.00 ? 137 GLY A H    3  
ATOM 6323  H HA2  . GLY A 1 137 ? 1.570   -11.706 22.244  1.00 0.00 ? 137 GLY A HA2  3  
ATOM 6324  H HA3  . GLY A 1 137 ? 0.058   -12.048 21.427  1.00 0.00 ? 137 GLY A HA3  3  
ATOM 6325  N N    . GLY A 1 1   ? -1.225  14.464  -4.648  1.00 0.00 ? 1   GLY A N    4  
ATOM 6326  C CA   . GLY A 1 1   ? -0.929  14.723  -3.249  1.00 0.00 ? 1   GLY A CA   4  
ATOM 6327  C C    . GLY A 1 1   ? 0.207   13.824  -2.755  1.00 0.00 ? 1   GLY A C    4  
ATOM 6328  O O    . GLY A 1 1   ? -0.020  12.910  -1.963  1.00 0.00 ? 1   GLY A O    4  
ATOM 6329  H H1   . GLY A 1 1   ? -1.563  15.254  -5.161  1.00 0.00 ? 1   GLY A H1   4  
ATOM 6330  H HA2  . GLY A 1 1   ? -0.652  15.769  -3.120  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 6331  H HA3  . GLY A 1 1   ? -1.821  14.552  -2.647  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 6332  N N    . SER A 1 2   ? 1.404   14.115  -3.242  1.00 0.00 ? 2   SER A N    4  
ATOM 6333  C CA   . SER A 1 2   ? 2.575   13.344  -2.860  1.00 0.00 ? 2   SER A CA   4  
ATOM 6334  C C    . SER A 1 2   ? 2.790   13.435  -1.347  1.00 0.00 ? 2   SER A C    4  
ATOM 6335  O O    . SER A 1 2   ? 2.775   12.420  -0.653  1.00 0.00 ? 2   SER A O    4  
ATOM 6336  C CB   . SER A 1 2   ? 3.821   13.830  -3.603  1.00 0.00 ? 2   SER A CB   4  
ATOM 6337  O OG   . SER A 1 2   ? 4.806   12.807  -3.719  1.00 0.00 ? 2   SER A OG   4  
ATOM 6338  H H    . SER A 1 2   ? 1.580   14.859  -3.886  1.00 0.00 ? 2   SER A H    4  
ATOM 6339  H HA   . SER A 1 2   ? 2.354   12.318  -3.154  1.00 0.00 ? 2   SER A HA   4  
ATOM 6340  H HB2  . SER A 1 2   ? 3.538   14.176  -4.597  1.00 0.00 ? 2   SER A HB2  4  
ATOM 6341  H HB3  . SER A 1 2   ? 4.246   14.685  -3.078  1.00 0.00 ? 2   SER A HB3  4  
ATOM 6342  H HG   . SER A 1 2   ? 4.452   12.053  -4.272  1.00 0.00 ? 2   SER A HG   4  
ATOM 6343  N N    . SER A 1 3   ? 2.985   14.660  -0.882  1.00 0.00 ? 3   SER A N    4  
ATOM 6344  C CA   . SER A 1 3   ? 3.203   14.897  0.535   1.00 0.00 ? 3   SER A CA   4  
ATOM 6345  C C    . SER A 1 3   ? 2.225   15.957  1.045   1.00 0.00 ? 3   SER A C    4  
ATOM 6346  O O    . SER A 1 3   ? 1.920   16.916  0.338   1.00 0.00 ? 3   SER A O    4  
ATOM 6347  C CB   . SER A 1 3   ? 4.645   15.331  0.805   1.00 0.00 ? 3   SER A CB   4  
ATOM 6348  O OG   . SER A 1 3   ? 4.947   16.585  0.200   1.00 0.00 ? 3   SER A OG   4  
ATOM 6349  H H    . SER A 1 3   ? 2.996   15.480  -1.454  1.00 0.00 ? 3   SER A H    4  
ATOM 6350  H HA   . SER A 1 3   ? 3.016   13.939  1.019   1.00 0.00 ? 3   SER A HA   4  
ATOM 6351  H HB2  . SER A 1 3   ? 4.807   15.400  1.881   1.00 0.00 ? 3   SER A HB2  4  
ATOM 6352  H HB3  . SER A 1 3   ? 5.329   14.571  0.428   1.00 0.00 ? 3   SER A HB3  4  
ATOM 6353  H HG   . SER A 1 3   ? 5.936   16.738  0.205   1.00 0.00 ? 3   SER A HG   4  
ATOM 6354  N N    . GLY A 1 4   ? 1.760   15.748  2.268   1.00 0.00 ? 4   GLY A N    4  
ATOM 6355  C CA   . GLY A 1 4   ? 0.823   16.673  2.881   1.00 0.00 ? 4   GLY A CA   4  
ATOM 6356  C C    . GLY A 1 4   ? 0.944   16.647  4.406   1.00 0.00 ? 4   GLY A C    4  
ATOM 6357  O O    . GLY A 1 4   ? 1.848   17.260  4.971   1.00 0.00 ? 4   GLY A O    4  
ATOM 6358  H H    . GLY A 1 4   ? 2.013   14.965  2.836   1.00 0.00 ? 4   GLY A H    4  
ATOM 6359  H HA2  . GLY A 1 4   ? 1.011   17.683  2.515   1.00 0.00 ? 4   GLY A HA2  4  
ATOM 6360  H HA3  . GLY A 1 4   ? -0.194  16.413  2.588   1.00 0.00 ? 4   GLY A HA3  4  
ATOM 6361  N N    . SER A 1 5   ? 0.019   15.931  5.028   1.00 0.00 ? 5   SER A N    4  
ATOM 6362  C CA   . SER A 1 5   ? 0.011   15.816  6.477   1.00 0.00 ? 5   SER A CA   4  
ATOM 6363  C C    . SER A 1 5   ? 0.866   14.625  6.913   1.00 0.00 ? 5   SER A C    4  
ATOM 6364  O O    . SER A 1 5   ? 1.852   14.793  7.629   1.00 0.00 ? 5   SER A O    4  
ATOM 6365  C CB   . SER A 1 5   ? -1.416  15.668  7.009   1.00 0.00 ? 5   SER A CB   4  
ATOM 6366  O OG   . SER A 1 5   ? -1.559  16.224  8.314   1.00 0.00 ? 5   SER A OG   4  
ATOM 6367  H H    . SER A 1 5   ? -0.713  15.435  4.561   1.00 0.00 ? 5   SER A H    4  
ATOM 6368  H HA   . SER A 1 5   ? 0.439   16.749  6.842   1.00 0.00 ? 5   SER A HA   4  
ATOM 6369  H HB2  . SER A 1 5   ? -2.110  16.160  6.328   1.00 0.00 ? 5   SER A HB2  4  
ATOM 6370  H HB3  . SER A 1 5   ? -1.686  14.613  7.033   1.00 0.00 ? 5   SER A HB3  4  
ATOM 6371  H HG   . SER A 1 5   ? -2.415  16.736  8.375   1.00 0.00 ? 5   SER A HG   4  
ATOM 6372  N N    . SER A 1 6   ? 0.458   13.448  6.462   1.00 0.00 ? 6   SER A N    4  
ATOM 6373  C CA   . SER A 1 6   ? 1.175   12.229  6.796   1.00 0.00 ? 6   SER A CA   4  
ATOM 6374  C C    . SER A 1 6   ? 1.081   11.962  8.300   1.00 0.00 ? 6   SER A C    4  
ATOM 6375  O O    . SER A 1 6   ? 1.908   12.445  9.072   1.00 0.00 ? 6   SER A O    4  
ATOM 6376  C CB   . SER A 1 6   ? 2.640   12.315  6.363   1.00 0.00 ? 6   SER A CB   4  
ATOM 6377  O OG   . SER A 1 6   ? 3.315   11.069  6.510   1.00 0.00 ? 6   SER A OG   4  
ATOM 6378  H H    . SER A 1 6   ? -0.344  13.320  5.879   1.00 0.00 ? 6   SER A H    4  
ATOM 6379  H HA   . SER A 1 6   ? 0.677   11.438  6.235   1.00 0.00 ? 6   SER A HA   4  
ATOM 6380  H HB2  . SER A 1 6   ? 2.692   12.634  5.322   1.00 0.00 ? 6   SER A HB2  4  
ATOM 6381  H HB3  . SER A 1 6   ? 3.149   13.075  6.955   1.00 0.00 ? 6   SER A HB3  4  
ATOM 6382  H HG   . SER A 1 6   ? 3.038   10.629  7.365   1.00 0.00 ? 6   SER A HG   4  
ATOM 6383  N N    . GLY A 1 7   ? 0.067   11.195  8.670   1.00 0.00 ? 7   GLY A N    4  
ATOM 6384  C CA   . GLY A 1 7   ? -0.146  10.859  10.067  1.00 0.00 ? 7   GLY A CA   4  
ATOM 6385  C C    . GLY A 1 7   ? 0.782   9.724   10.506  1.00 0.00 ? 7   GLY A C    4  
ATOM 6386  O O    . GLY A 1 7   ? 0.327   8.721   11.053  1.00 0.00 ? 7   GLY A O    4  
ATOM 6387  H H    . GLY A 1 7   ? -0.601  10.807  8.035   1.00 0.00 ? 7   GLY A H    4  
ATOM 6388  H HA2  . GLY A 1 7   ? 0.030   11.737  10.688  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 6389  H HA3  . GLY A 1 7   ? -1.184  10.564  10.220  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 6390  N N    . VAL A 1 8   ? 2.067   9.920   10.248  1.00 0.00 ? 8   VAL A N    4  
ATOM 6391  C CA   . VAL A 1 8   ? 3.063   8.925   10.608  1.00 0.00 ? 8   VAL A CA   4  
ATOM 6392  C C    . VAL A 1 8   ? 3.879   9.436   11.797  1.00 0.00 ? 8   VAL A C    4  
ATOM 6393  O O    . VAL A 1 8   ? 5.106   9.496   11.732  1.00 0.00 ? 8   VAL A O    4  
ATOM 6394  C CB   . VAL A 1 8   ? 3.927   8.585   9.392   1.00 0.00 ? 8   VAL A CB   4  
ATOM 6395  C CG1  . VAL A 1 8   ? 5.110   7.700   9.791   1.00 0.00 ? 8   VAL A CG1  4  
ATOM 6396  C CG2  . VAL A 1 8   ? 3.091   7.923   8.295   1.00 0.00 ? 8   VAL A CG2  4  
ATOM 6397  H H    . VAL A 1 8   ? 2.429   10.738  9.802   1.00 0.00 ? 8   VAL A H    4  
ATOM 6398  H HA   . VAL A 1 8   ? 2.532   8.022   10.909  1.00 0.00 ? 8   VAL A HA   4  
ATOM 6399  H HB   . VAL A 1 8   ? 4.325   9.517   8.993   1.00 0.00 ? 8   VAL A HB   4  
ATOM 6400  H HG11 . VAL A 1 8   ? 5.285   6.957   9.013   1.00 0.00 ? 8   VAL A HG11 4  
ATOM 6401  H HG12 . VAL A 1 8   ? 6.000   8.317   9.912   1.00 0.00 ? 8   VAL A HG12 4  
ATOM 6402  H HG13 . VAL A 1 8   ? 4.886   7.196   10.731  1.00 0.00 ? 8   VAL A HG13 4  
ATOM 6403  H HG21 . VAL A 1 8   ? 2.487   8.678   7.792   1.00 0.00 ? 8   VAL A HG21 4  
ATOM 6404  H HG22 . VAL A 1 8   ? 3.754   7.447   7.571   1.00 0.00 ? 8   VAL A HG22 4  
ATOM 6405  H HG23 . VAL A 1 8   ? 2.438   7.171   8.739   1.00 0.00 ? 8   VAL A HG23 4  
ATOM 6406  N N    . ARG A 1 9   ? 3.165   9.790   12.856  1.00 0.00 ? 9   ARG A N    4  
ATOM 6407  C CA   . ARG A 1 9   ? 3.808   10.293  14.058  1.00 0.00 ? 9   ARG A CA   4  
ATOM 6408  C C    . ARG A 1 9   ? 4.650   9.193   14.710  1.00 0.00 ? 9   ARG A C    4  
ATOM 6409  O O    . ARG A 1 9   ? 5.868   9.321   14.817  1.00 0.00 ? 9   ARG A O    4  
ATOM 6410  C CB   . ARG A 1 9   ? 2.774   10.799  15.066  1.00 0.00 ? 9   ARG A CB   4  
ATOM 6411  C CG   . ARG A 1 9   ? 2.700   12.327  15.055  1.00 0.00 ? 9   ARG A CG   4  
ATOM 6412  C CD   . ARG A 1 9   ? 3.452   12.920  16.248  1.00 0.00 ? 9   ARG A CD   4  
ATOM 6413  N NE   . ARG A 1 9   ? 4.726   13.521  15.796  1.00 0.00 ? 9   ARG A NE   4  
ATOM 6414  C CZ   . ARG A 1 9   ? 4.809   14.590  14.992  1.00 0.00 ? 9   ARG A CZ   4  
ATOM 6415  N NH1  . ARG A 1 9   ? 3.692   15.182  14.547  1.00 0.00 ? 9   ARG A NH1  4  
ATOM 6416  N NH2  . ARG A 1 9   ? 6.009   15.067  14.632  1.00 0.00 ? 9   ARG A NH2  4  
ATOM 6417  H H    . ARG A 1 9   ? 2.168   9.737   12.901  1.00 0.00 ? 9   ARG A H    4  
ATOM 6418  H HA   . ARG A 1 9   ? 4.436   11.115  13.715  1.00 0.00 ? 9   ARG A HA   4  
ATOM 6419  H HB2  . ARG A 1 9   ? 1.795   10.382  14.827  1.00 0.00 ? 9   ARG A HB2  4  
ATOM 6420  H HB3  . ARG A 1 9   ? 3.034   10.450  16.065  1.00 0.00 ? 9   ARG A HB3  4  
ATOM 6421  H HG2  . ARG A 1 9   ? 3.125   12.709  14.127  1.00 0.00 ? 9   ARG A HG2  4  
ATOM 6422  H HG3  . ARG A 1 9   ? 1.658   12.644  15.083  1.00 0.00 ? 9   ARG A HG3  4  
ATOM 6423  H HD2  . ARG A 1 9   ? 2.837   13.676  16.737  1.00 0.00 ? 9   ARG A HD2  4  
ATOM 6424  H HD3  . ARG A 1 9   ? 3.649   12.143  16.987  1.00 0.00 ? 9   ARG A HD3  4  
ATOM 6425  H HE   . ARG A 1 9   ? 5.579   13.104  16.109  1.00 0.00 ? 9   ARG A HE   4  
ATOM 6426  H HH11 . ARG A 1 9   ? 2.797   14.826  14.815  1.00 0.00 ? 9   ARG A HH11 4  
ATOM 6427  H HH12 . ARG A 1 9   ? 3.754   15.979  13.947  1.00 0.00 ? 9   ARG A HH12 4  
ATOM 6428  H HH21 . ARG A 1 9   ? 6.842   14.625  14.964  1.00 0.00 ? 9   ARG A HH21 4  
ATOM 6429  H HH22 . ARG A 1 9   ? 6.070   15.864  14.032  1.00 0.00 ? 9   ARG A HH22 4  
ATOM 6430  N N    . ARG A 1 10  ? 3.966   8.139   15.128  1.00 0.00 ? 10  ARG A N    4  
ATOM 6431  C CA   . ARG A 1 10  ? 4.635   7.018   15.767  1.00 0.00 ? 10  ARG A CA   4  
ATOM 6432  C C    . ARG A 1 10  ? 3.693   5.815   15.849  1.00 0.00 ? 10  ARG A C    4  
ATOM 6433  O O    . ARG A 1 10  ? 3.324   5.385   16.941  1.00 0.00 ? 10  ARG A O    4  
ATOM 6434  C CB   . ARG A 1 10  ? 5.105   7.387   17.175  1.00 0.00 ? 10  ARG A CB   4  
ATOM 6435  C CG   . ARG A 1 10  ? 6.584   7.777   17.175  1.00 0.00 ? 10  ARG A CG   4  
ATOM 6436  C CD   . ARG A 1 10  ? 7.434   6.706   17.861  1.00 0.00 ? 10  ARG A CD   4  
ATOM 6437  N NE   . ARG A 1 10  ? 8.713   7.293   18.321  1.00 0.00 ? 10  ARG A NE   4  
ATOM 6438  C CZ   . ARG A 1 10  ? 9.796   6.574   18.644  1.00 0.00 ? 10  ARG A CZ   4  
ATOM 6439  N NH1  . ARG A 1 10  ? 9.762   5.237   18.560  1.00 0.00 ? 10  ARG A NH1  4  
ATOM 6440  N NH2  . ARG A 1 10  ? 10.913  7.191   19.052  1.00 0.00 ? 10  ARG A NH2  4  
ATOM 6441  H H    . ARG A 1 10  ? 2.974   8.043   15.037  1.00 0.00 ? 10  ARG A H    4  
ATOM 6442  H HA   . ARG A 1 10  ? 5.491   6.803   15.127  1.00 0.00 ? 10  ARG A HA   4  
ATOM 6443  H HB2  . ARG A 1 10  ? 4.507   8.214   17.557  1.00 0.00 ? 10  ARG A HB2  4  
ATOM 6444  H HB3  . ARG A 1 10  ? 4.948   6.543   17.847  1.00 0.00 ? 10  ARG A HB3  4  
ATOM 6445  H HG2  . ARG A 1 10  ? 6.927   7.916   16.149  1.00 0.00 ? 10  ARG A HG2  4  
ATOM 6446  H HG3  . ARG A 1 10  ? 6.712   8.731   17.686  1.00 0.00 ? 10  ARG A HG3  4  
ATOM 6447  H HD2  . ARG A 1 10  ? 6.891   6.287   18.709  1.00 0.00 ? 10  ARG A HD2  4  
ATOM 6448  H HD3  . ARG A 1 10  ? 7.629   5.886   17.170  1.00 0.00 ? 10  ARG A HD3  4  
ATOM 6449  H HE   . ARG A 1 10  ? 8.772   8.288   18.396  1.00 0.00 ? 10  ARG A HE   4  
ATOM 6450  H HH11 . ARG A 1 10  ? 8.929   4.776   18.256  1.00 0.00 ? 10  ARG A HH11 4  
ATOM 6451  H HH12 . ARG A 1 10  ? 10.571  4.700   18.801  1.00 0.00 ? 10  ARG A HH12 4  
ATOM 6452  H HH21 . ARG A 1 10  ? 10.938  8.189   19.115  1.00 0.00 ? 10  ARG A HH21 4  
ATOM 6453  H HH22 . ARG A 1 10  ? 11.722  6.654   19.293  1.00 0.00 ? 10  ARG A HH22 4  
ATOM 6454  N N    . VAL A 1 11  ? 3.331   5.305   14.681  1.00 0.00 ? 11  VAL A N    4  
ATOM 6455  C CA   . VAL A 1 11  ? 2.440   4.160   14.607  1.00 0.00 ? 11  VAL A CA   4  
ATOM 6456  C C    . VAL A 1 11  ? 3.183   2.910   15.083  1.00 0.00 ? 11  VAL A C    4  
ATOM 6457  O O    . VAL A 1 11  ? 4.412   2.877   15.084  1.00 0.00 ? 11  VAL A O    4  
ATOM 6458  C CB   . VAL A 1 11  ? 1.883   4.021   13.189  1.00 0.00 ? 11  VAL A CB   4  
ATOM 6459  C CG1  . VAL A 1 11  ? 1.233   5.327   12.725  1.00 0.00 ? 11  VAL A CG1  4  
ATOM 6460  C CG2  . VAL A 1 11  ? 2.972   3.573   12.213  1.00 0.00 ? 11  VAL A CG2  4  
ATOM 6461  H H    . VAL A 1 11  ? 3.636   5.661   13.797  1.00 0.00 ? 11  VAL A H    4  
ATOM 6462  H HA   . VAL A 1 11  ? 1.605   4.350   15.281  1.00 0.00 ? 11  VAL A HA   4  
ATOM 6463  H HB   . VAL A 1 11  ? 1.111   3.251   13.207  1.00 0.00 ? 11  VAL A HB   4  
ATOM 6464  H HG11 . VAL A 1 11  ? 2.010   6.040   12.448  1.00 0.00 ? 11  VAL A HG11 4  
ATOM 6465  H HG12 . VAL A 1 11  ? 0.597   5.129   11.863  1.00 0.00 ? 11  VAL A HG12 4  
ATOM 6466  H HG13 . VAL A 1 11  ? 0.631   5.741   13.534  1.00 0.00 ? 11  VAL A HG13 4  
ATOM 6467  H HG21 . VAL A 1 11  ? 2.511   3.100   11.347  1.00 0.00 ? 11  VAL A HG21 4  
ATOM 6468  H HG22 . VAL A 1 11  ? 3.549   4.440   11.890  1.00 0.00 ? 11  VAL A HG22 4  
ATOM 6469  H HG23 . VAL A 1 11  ? 3.633   2.861   12.708  1.00 0.00 ? 11  VAL A HG23 4  
ATOM 6470  N N    . PRO A 1 12  ? 2.384   1.886   15.487  1.00 0.00 ? 12  PRO A N    4  
ATOM 6471  C CA   . PRO A 1 12  ? 2.952   0.637   15.964  1.00 0.00 ? 12  PRO A CA   4  
ATOM 6472  C C    . PRO A 1 12  ? 3.494   -0.198  14.802  1.00 0.00 ? 12  PRO A C    4  
ATOM 6473  O O    . PRO A 1 12  ? 4.344   -1.065  14.999  1.00 0.00 ? 12  PRO A O    4  
ATOM 6474  C CB   . PRO A 1 12  ? 1.821   -0.050  16.712  1.00 0.00 ? 12  PRO A CB   4  
ATOM 6475  C CG   . PRO A 1 12  ? 0.541   0.615   16.233  1.00 0.00 ? 12  PRO A CG   4  
ATOM 6476  C CD   . PRO A 1 12  ? 0.924   1.890   15.500  1.00 0.00 ? 12  PRO A CD   4  
ATOM 6477  H HA   . PRO A 1 12  ? 3.735   0.817   16.559  1.00 0.00 ? 12  PRO A HA   4  
ATOM 6478  H HB2  . PRO A 1 12  ? 1.808   -1.120  16.503  1.00 0.00 ? 12  PRO A HB2  4  
ATOM 6479  H HB3  . PRO A 1 12  ? 1.941   0.063   17.789  1.00 0.00 ? 12  PRO A HB3  4  
ATOM 6480  H HG2  . PRO A 1 12  ? -0.013  -0.053  15.574  1.00 0.00 ? 12  PRO A HG2  4  
ATOM 6481  H HG3  . PRO A 1 12  ? -0.110  0.841   17.078  1.00 0.00 ? 12  PRO A HG3  4  
ATOM 6482  H HD2  . PRO A 1 12  ? 0.519   1.902   14.488  1.00 0.00 ? 12  PRO A HD2  4  
ATOM 6483  H HD3  . PRO A 1 12  ? 0.535   2.772   16.009  1.00 0.00 ? 12  PRO A HD3  4  
ATOM 6484  N N    . LEU A 1 13  ? 2.980   0.093   13.616  1.00 0.00 ? 13  LEU A N    4  
ATOM 6485  C CA   . LEU A 1 13  ? 3.402   -0.620  12.422  1.00 0.00 ? 13  LEU A CA   4  
ATOM 6486  C C    . LEU A 1 13  ? 4.925   -0.541  12.297  1.00 0.00 ? 13  LEU A C    4  
ATOM 6487  O O    . LEU A 1 13  ? 5.611   -1.559  12.376  1.00 0.00 ? 13  LEU A O    4  
ATOM 6488  C CB   . LEU A 1 13  ? 2.656   -0.095  11.193  1.00 0.00 ? 13  LEU A CB   4  
ATOM 6489  C CG   . LEU A 1 13  ? 1.152   -0.371  11.153  1.00 0.00 ? 13  LEU A CG   4  
ATOM 6490  C CD1  . LEU A 1 13  ? 0.457   0.527   10.128  1.00 0.00 ? 13  LEU A CD1  4  
ATOM 6491  C CD2  . LEU A 1 13  ? 0.873   -1.854  10.898  1.00 0.00 ? 13  LEU A CD2  4  
ATOM 6492  H H    . LEU A 1 13  ? 2.290   0.800   13.464  1.00 0.00 ? 13  LEU A H    4  
ATOM 6493  H HA   . LEU A 1 13  ? 3.119   -1.665  12.549  1.00 0.00 ? 13  LEU A HA   4  
ATOM 6494  H HB2  . LEU A 1 13  ? 2.810   0.982   11.132  1.00 0.00 ? 13  LEU A HB2  4  
ATOM 6495  H HB3  . LEU A 1 13  ? 3.110   -0.533  10.304  1.00 0.00 ? 13  LEU A HB3  4  
ATOM 6496  H HG   . LEU A 1 13  ? 0.734   -0.128  12.130  1.00 0.00 ? 13  LEU A HG   4  
ATOM 6497  H HD11 . LEU A 1 13  ? 0.620   0.129   9.126   1.00 0.00 ? 13  LEU A HD11 4  
ATOM 6498  H HD12 . LEU A 1 13  ? -0.612  0.557   10.337  1.00 0.00 ? 13  LEU A HD12 4  
ATOM 6499  H HD13 . LEU A 1 13  ? 0.868   1.535   10.190  1.00 0.00 ? 13  LEU A HD13 4  
ATOM 6500  H HD21 . LEU A 1 13  ? 0.299   -2.264  11.729  1.00 0.00 ? 13  LEU A HD21 4  
ATOM 6501  H HD22 . LEU A 1 13  ? 0.305   -1.963  9.975   1.00 0.00 ? 13  LEU A HD22 4  
ATOM 6502  H HD23 . LEU A 1 13  ? 1.818   -2.391  10.809  1.00 0.00 ? 13  LEU A HD23 4  
ATOM 6503  N N    . PHE A 1 14  ? 5.409   0.677   12.105  1.00 0.00 ? 14  PHE A N    4  
ATOM 6504  C CA   . PHE A 1 14  ? 6.838   0.902   11.969  1.00 0.00 ? 14  PHE A CA   4  
ATOM 6505  C C    . PHE A 1 14  ? 7.514   0.975   13.340  1.00 0.00 ? 14  PHE A C    4  
ATOM 6506  O O    . PHE A 1 14  ? 8.151   1.975   13.669  1.00 0.00 ? 14  PHE A O    4  
ATOM 6507  C CB   . PHE A 1 14  ? 7.014   2.243   11.255  1.00 0.00 ? 14  PHE A CB   4  
ATOM 6508  C CG   . PHE A 1 14  ? 6.114   2.418   10.029  1.00 0.00 ? 14  PHE A CG   4  
ATOM 6509  C CD1  . PHE A 1 14  ? 6.184   1.530   9.002   1.00 0.00 ? 14  PHE A CD1  4  
ATOM 6510  C CD2  . PHE A 1 14  ? 5.244   3.461   9.968   1.00 0.00 ? 14  PHE A CD2  4  
ATOM 6511  C CE1  . PHE A 1 14  ? 5.350   1.692   7.864   1.00 0.00 ? 14  PHE A CE1  4  
ATOM 6512  C CE2  . PHE A 1 14  ? 4.409   3.624   8.831   1.00 0.00 ? 14  PHE A CE2  4  
ATOM 6513  C CZ   . PHE A 1 14  ? 4.480   2.736   7.803   1.00 0.00 ? 14  PHE A CZ   4  
ATOM 6514  H H    . PHE A 1 14  ? 4.844   1.500   12.043  1.00 0.00 ? 14  PHE A H    4  
ATOM 6515  H HA   . PHE A 1 14  ? 7.246   0.060   11.409  1.00 0.00 ? 14  PHE A HA   4  
ATOM 6516  H HB2  . PHE A 1 14  ? 6.810   3.049   11.960  1.00 0.00 ? 14  PHE A HB2  4  
ATOM 6517  H HB3  . PHE A 1 14  ? 8.054   2.345   10.946  1.00 0.00 ? 14  PHE A HB3  4  
ATOM 6518  H HD1  . PHE A 1 14  ? 6.882   0.693   9.051   1.00 0.00 ? 14  PHE A HD1  4  
ATOM 6519  H HD2  . PHE A 1 14  ? 5.188   4.173   10.791  1.00 0.00 ? 14  PHE A HD2  4  
ATOM 6520  H HE1  . PHE A 1 14  ? 5.406   0.980   7.041   1.00 0.00 ? 14  PHE A HE1  4  
ATOM 6521  H HE2  . PHE A 1 14  ? 3.712   4.460   8.781   1.00 0.00 ? 14  PHE A HE2  4  
ATOM 6522  H HZ   . PHE A 1 14  ? 3.839   2.860   6.930   1.00 0.00 ? 14  PHE A HZ   4  
ATOM 6523  N N    . GLU A 1 15  ? 7.353   -0.097  14.102  1.00 0.00 ? 15  GLU A N    4  
ATOM 6524  C CA   . GLU A 1 15  ? 7.941   -0.167  15.429  1.00 0.00 ? 15  GLU A CA   4  
ATOM 6525  C C    . GLU A 1 15  ? 9.402   -0.610  15.340  1.00 0.00 ? 15  GLU A C    4  
ATOM 6526  O O    . GLU A 1 15  ? 10.291  0.060   15.864  1.00 0.00 ? 15  GLU A O    4  
ATOM 6527  C CB   . GLU A 1 15  ? 7.138   -1.102  16.335  1.00 0.00 ? 15  GLU A CB   4  
ATOM 6528  C CG   . GLU A 1 15  ? 6.339   -0.310  17.371  1.00 0.00 ? 15  GLU A CG   4  
ATOM 6529  C CD   . GLU A 1 15  ? 6.570   -0.860  18.780  1.00 0.00 ? 15  GLU A CD   4  
ATOM 6530  O OE1  . GLU A 1 15  ? 6.361   -2.080  18.954  1.00 0.00 ? 15  GLU A OE1  4  
ATOM 6531  O OE2  . GLU A 1 15  ? 6.950   -0.049  19.651  1.00 0.00 ? 15  GLU A OE2  4  
ATOM 6532  H H    . GLU A 1 15  ? 6.834   -0.906  13.826  1.00 0.00 ? 15  GLU A H    4  
ATOM 6533  H HA   . GLU A 1 15  ? 7.885   0.848   15.824  1.00 0.00 ? 15  GLU A HA   4  
ATOM 6534  H HB2  . GLU A 1 15  ? 6.460   -1.706  15.731  1.00 0.00 ? 15  GLU A HB2  4  
ATOM 6535  H HB3  . GLU A 1 15  ? 7.814   -1.792  16.841  1.00 0.00 ? 15  GLU A HB3  4  
ATOM 6536  H HG2  . GLU A 1 15  ? 6.630   0.740   17.335  1.00 0.00 ? 15  GLU A HG2  4  
ATOM 6537  H HG3  . GLU A 1 15  ? 5.277   -0.355  17.129  1.00 0.00 ? 15  GLU A HG3  4  
ATOM 6538  N N    . ASN A 1 16  ? 9.606   -1.736  14.672  1.00 0.00 ? 16  ASN A N    4  
ATOM 6539  C CA   . ASN A 1 16  ? 10.945  -2.277  14.508  1.00 0.00 ? 16  ASN A CA   4  
ATOM 6540  C C    . ASN A 1 16  ? 11.407  -2.053  13.067  1.00 0.00 ? 16  ASN A C    4  
ATOM 6541  O O    . ASN A 1 16  ? 12.354  -2.691  12.609  1.00 0.00 ? 16  ASN A O    4  
ATOM 6542  C CB   . ASN A 1 16  ? 10.969  -3.782  14.784  1.00 0.00 ? 16  ASN A CB   4  
ATOM 6543  C CG   . ASN A 1 16  ? 9.842   -4.495  14.035  1.00 0.00 ? 16  ASN A CG   4  
ATOM 6544  O OD1  . ASN A 1 16  ? 8.824   -4.863  14.597  1.00 0.00 ? 16  ASN A OD1  4  
ATOM 6545  N ND2  . ASN A 1 16  ? 10.079  -4.668  12.738  1.00 0.00 ? 16  ASN A ND2  4  
ATOM 6546  H H    . ASN A 1 16  ? 8.878   -2.275  14.249  1.00 0.00 ? 16  ASN A H    4  
ATOM 6547  H HA   . ASN A 1 16  ? 11.561  -1.742  15.231  1.00 0.00 ? 16  ASN A HA   4  
ATOM 6548  H HB2  . ASN A 1 16  ? 11.931  -4.195  14.481  1.00 0.00 ? 16  ASN A HB2  4  
ATOM 6549  H HB3  . ASN A 1 16  ? 10.869  -3.960  15.855  1.00 0.00 ? 16  ASN A HB3  4  
ATOM 6550  H HD21 . ASN A 1 16  ? 10.936  -4.341  12.339  1.00 0.00 ? 16  ASN A HD21 4  
ATOM 6551  H HD22 . ASN A 1 16  ? 9.401   -5.125  12.162  1.00 0.00 ? 16  ASN A HD22 4  
ATOM 6552  N N    . MET A 1 17  ? 10.717  -1.146  12.392  1.00 0.00 ? 17  MET A N    4  
ATOM 6553  C CA   . MET A 1 17  ? 11.045  -0.830  11.012  1.00 0.00 ? 17  MET A CA   4  
ATOM 6554  C C    . MET A 1 17  ? 12.231  0.134   10.937  1.00 0.00 ? 17  MET A C    4  
ATOM 6555  O O    . MET A 1 17  ? 12.331  1.064   11.736  1.00 0.00 ? 17  MET A O    4  
ATOM 6556  C CB   . MET A 1 17  ? 9.830   -0.199  10.330  1.00 0.00 ? 17  MET A CB   4  
ATOM 6557  C CG   . MET A 1 17  ? 8.917   -1.271  9.733   1.00 0.00 ? 17  MET A CG   4  
ATOM 6558  S SD   . MET A 1 17  ? 8.607   -0.920  8.010   1.00 0.00 ? 17  MET A SD   4  
ATOM 6559  C CE   . MET A 1 17  ? 7.524   -2.279  7.606   1.00 0.00 ? 17  MET A CE   4  
ATOM 6560  H H    . MET A 1 17  ? 9.948   -0.631  12.772  1.00 0.00 ? 17  MET A H    4  
ATOM 6561  H HA   . MET A 1 17  ? 11.311  -1.781  10.550  1.00 0.00 ? 17  MET A HA   4  
ATOM 6562  H HB2  . MET A 1 17  ? 9.272   0.398   11.052  1.00 0.00 ? 17  MET A HB2  4  
ATOM 6563  H HB3  . MET A 1 17  ? 10.161  0.481   9.544   1.00 0.00 ? 17  MET A HB3  4  
ATOM 6564  H HG2  . MET A 1 17  ? 9.381   -2.253  9.834   1.00 0.00 ? 17  MET A HG2  4  
ATOM 6565  H HG3  . MET A 1 17  ? 7.976   -1.306  10.280  1.00 0.00 ? 17  MET A HG3  4  
ATOM 6566  H HE1  . MET A 1 17  ? 7.376   -2.317  6.527   1.00 0.00 ? 17  MET A HE1  4  
ATOM 6567  H HE2  . MET A 1 17  ? 7.972   -3.214  7.944   1.00 0.00 ? 17  MET A HE2  4  
ATOM 6568  H HE3  . MET A 1 17  ? 6.563   -2.137  8.100   1.00 0.00 ? 17  MET A HE3  4  
ATOM 6569  N N    . ASP A 1 18  ? 13.100  -0.122  9.970   1.00 0.00 ? 18  ASP A N    4  
ATOM 6570  C CA   . ASP A 1 18  ? 14.275  0.711   9.780   1.00 0.00 ? 18  ASP A CA   4  
ATOM 6571  C C    . ASP A 1 18  ? 13.999  1.729   8.671   1.00 0.00 ? 18  ASP A C    4  
ATOM 6572  O O    . ASP A 1 18  ? 13.273  1.437   7.722   1.00 0.00 ? 18  ASP A O    4  
ATOM 6573  C CB   . ASP A 1 18  ? 15.484  -0.128  9.361   1.00 0.00 ? 18  ASP A CB   4  
ATOM 6574  C CG   . ASP A 1 18  ? 15.848  -1.262  10.322  1.00 0.00 ? 18  ASP A CG   4  
ATOM 6575  O OD1  . ASP A 1 18  ? 16.130  -0.941  11.497  1.00 0.00 ? 18  ASP A OD1  4  
ATOM 6576  O OD2  . ASP A 1 18  ? 15.836  -2.423  9.860   1.00 0.00 ? 18  ASP A OD2  4  
ATOM 6577  H H    . ASP A 1 18  ? 13.011  -0.880  9.324   1.00 0.00 ? 18  ASP A H    4  
ATOM 6578  H HA   . ASP A 1 18  ? 14.450  1.184   10.746  1.00 0.00 ? 18  ASP A HA   4  
ATOM 6579  H HB2  . ASP A 1 18  ? 15.288  -0.555  8.378   1.00 0.00 ? 18  ASP A HB2  4  
ATOM 6580  H HB3  . ASP A 1 18  ? 16.346  0.531   9.257   1.00 0.00 ? 18  ASP A HB3  4  
ATOM 6581  N N    . GLU A 1 19  ? 14.594  2.903   8.828   1.00 0.00 ? 19  GLU A N    4  
ATOM 6582  C CA   . GLU A 1 19  ? 14.422  3.965   7.853   1.00 0.00 ? 19  GLU A CA   4  
ATOM 6583  C C    . GLU A 1 19  ? 14.552  3.409   6.433   1.00 0.00 ? 19  GLU A C    4  
ATOM 6584  O O    . GLU A 1 19  ? 13.806  3.802   5.538   1.00 0.00 ? 19  GLU A O    4  
ATOM 6585  C CB   . GLU A 1 19  ? 15.423  5.097   8.092   1.00 0.00 ? 19  GLU A CB   4  
ATOM 6586  C CG   . GLU A 1 19  ? 14.979  5.985   9.257   1.00 0.00 ? 19  GLU A CG   4  
ATOM 6587  C CD   . GLU A 1 19  ? 14.988  7.461   8.856   1.00 0.00 ? 19  GLU A CD   4  
ATOM 6588  O OE1  . GLU A 1 19  ? 14.205  7.806   7.944   1.00 0.00 ? 19  GLU A OE1  4  
ATOM 6589  O OE2  . GLU A 1 19  ? 15.778  8.211   9.469   1.00 0.00 ? 19  GLU A OE2  4  
ATOM 6590  H H    . GLU A 1 19  ? 15.183  3.132   9.603   1.00 0.00 ? 19  GLU A H    4  
ATOM 6591  H HA   . GLU A 1 19  ? 13.411  4.343   8.011   1.00 0.00 ? 19  GLU A HA   4  
ATOM 6592  H HB2  . GLU A 1 19  ? 16.407  4.679   8.303   1.00 0.00 ? 19  GLU A HB2  4  
ATOM 6593  H HB3  . GLU A 1 19  ? 15.520  5.699   7.188   1.00 0.00 ? 19  GLU A HB3  4  
ATOM 6594  H HG2  . GLU A 1 19  ? 13.978  5.697   9.577   1.00 0.00 ? 19  GLU A HG2  4  
ATOM 6595  H HG3  . GLU A 1 19  ? 15.642  5.831   10.108  1.00 0.00 ? 19  GLU A HG3  4  
ATOM 6596  N N    . ARG A 1 20  ? 15.505  2.503   6.273   1.00 0.00 ? 20  ARG A N    4  
ATOM 6597  C CA   . ARG A 1 20  ? 15.743  1.888   4.977   1.00 0.00 ? 20  ARG A CA   4  
ATOM 6598  C C    . ARG A 1 20  ? 14.482  1.169   4.492   1.00 0.00 ? 20  ARG A C    4  
ATOM 6599  O O    . ARG A 1 20  ? 14.143  1.232   3.311   1.00 0.00 ? 20  ARG A O    4  
ATOM 6600  C CB   . ARG A 1 20  ? 16.898  0.887   5.046   1.00 0.00 ? 20  ARG A CB   4  
ATOM 6601  C CG   . ARG A 1 20  ? 18.192  1.574   5.488   1.00 0.00 ? 20  ARG A CG   4  
ATOM 6602  C CD   . ARG A 1 20  ? 18.812  2.367   4.336   1.00 0.00 ? 20  ARG A CD   4  
ATOM 6603  N NE   . ARG A 1 20  ? 19.978  1.638   3.789   1.00 0.00 ? 20  ARG A NE   4  
ATOM 6604  C CZ   . ARG A 1 20  ? 20.462  1.815   2.552   1.00 0.00 ? 20  ARG A CZ   4  
ATOM 6605  N NH1  . ARG A 1 20  ? 19.884  2.697   1.726   1.00 0.00 ? 20  ARG A NH1  4  
ATOM 6606  N NH2  . ARG A 1 20  ? 21.525  1.109   2.141   1.00 0.00 ? 20  ARG A NH2  4  
ATOM 6607  H H    . ARG A 1 20  ? 16.107  2.188   7.006   1.00 0.00 ? 20  ARG A H    4  
ATOM 6608  H HA   . ARG A 1 20  ? 15.999  2.717   4.318   1.00 0.00 ? 20  ARG A HA   4  
ATOM 6609  H HB2  . ARG A 1 20  ? 16.650  0.088   5.744   1.00 0.00 ? 20  ARG A HB2  4  
ATOM 6610  H HB3  . ARG A 1 20  ? 17.042  0.425   4.070   1.00 0.00 ? 20  ARG A HB3  4  
ATOM 6611  H HG2  . ARG A 1 20  ? 17.987  2.241   6.325   1.00 0.00 ? 20  ARG A HG2  4  
ATOM 6612  H HG3  . ARG A 1 20  ? 18.902  0.826   5.843   1.00 0.00 ? 20  ARG A HG3  4  
ATOM 6613  H HD2  . ARG A 1 20  ? 18.072  2.526   3.552   1.00 0.00 ? 20  ARG A HD2  4  
ATOM 6614  H HD3  . ARG A 1 20  ? 19.121  3.352   4.687   1.00 0.00 ? 20  ARG A HD3  4  
ATOM 6615  H HE   . ARG A 1 20  ? 20.434  0.972   4.380   1.00 0.00 ? 20  ARG A HE   4  
ATOM 6616  H HH11 . ARG A 1 20  ? 19.091  3.224   2.033   1.00 0.00 ? 20  ARG A HH11 4  
ATOM 6617  H HH12 . ARG A 1 20  ? 20.245  2.829   0.803   1.00 0.00 ? 20  ARG A HH12 4  
ATOM 6618  H HH21 . ARG A 1 20  ? 21.956  0.451   2.758   1.00 0.00 ? 20  ARG A HH21 4  
ATOM 6619  H HH22 . ARG A 1 20  ? 21.886  1.241   1.218   1.00 0.00 ? 20  ARG A HH22 4  
ATOM 6620  N N    . LEU A 1 21  ? 13.823  0.502   5.427   1.00 0.00 ? 21  LEU A N    4  
ATOM 6621  C CA   . LEU A 1 21  ? 12.608  -0.229  5.110   1.00 0.00 ? 21  LEU A CA   4  
ATOM 6622  C C    . LEU A 1 21  ? 11.517  0.761   4.693   1.00 0.00 ? 21  LEU A C    4  
ATOM 6623  O O    . LEU A 1 21  ? 10.748  0.491   3.772   1.00 0.00 ? 21  LEU A O    4  
ATOM 6624  C CB   . LEU A 1 21  ? 12.205  -1.132  6.277   1.00 0.00 ? 21  LEU A CB   4  
ATOM 6625  C CG   . LEU A 1 21  ? 11.411  -2.388  5.910   1.00 0.00 ? 21  LEU A CG   4  
ATOM 6626  C CD1  . LEU A 1 21  ? 12.104  -3.167  4.790   1.00 0.00 ? 21  LEU A CD1  4  
ATOM 6627  C CD2  . LEU A 1 21  ? 11.160  -3.258  7.143   1.00 0.00 ? 21  LEU A CD2  4  
ATOM 6628  H H    . LEU A 1 21  ? 14.106  0.455   6.385   1.00 0.00 ? 21  LEU A H    4  
ATOM 6629  H HA   . LEU A 1 21  ? 12.828  -0.877  4.261   1.00 0.00 ? 21  LEU A HA   4  
ATOM 6630  H HB2  . LEU A 1 21  ? 13.110  -1.439  6.802   1.00 0.00 ? 21  LEU A HB2  4  
ATOM 6631  H HB3  . LEU A 1 21  ? 11.613  -0.545  6.978   1.00 0.00 ? 21  LEU A HB3  4  
ATOM 6632  H HG   . LEU A 1 21  ? 10.437  -2.078  5.531   1.00 0.00 ? 21  LEU A HG   4  
ATOM 6633  H HD11 . LEU A 1 21  ? 11.808  -4.215  4.840   1.00 0.00 ? 21  LEU A HD11 4  
ATOM 6634  H HD12 . LEU A 1 21  ? 11.814  -2.752  3.825   1.00 0.00 ? 21  LEU A HD12 4  
ATOM 6635  H HD13 . LEU A 1 21  ? 13.185  -3.089  4.908   1.00 0.00 ? 21  LEU A HD13 4  
ATOM 6636  H HD21 . LEU A 1 21  ? 12.100  -3.420  7.671   1.00 0.00 ? 21  LEU A HD21 4  
ATOM 6637  H HD22 . LEU A 1 21  ? 10.454  -2.756  7.804   1.00 0.00 ? 21  LEU A HD22 4  
ATOM 6638  H HD23 . LEU A 1 21  ? 10.748  -4.218  6.833   1.00 0.00 ? 21  LEU A HD23 4  
ATOM 6639  N N    . LEU A 1 22  ? 11.486  1.886   5.392   1.00 0.00 ? 22  LEU A N    4  
ATOM 6640  C CA   . LEU A 1 22  ? 10.502  2.917   5.107   1.00 0.00 ? 22  LEU A CA   4  
ATOM 6641  C C    . LEU A 1 22  ? 10.651  3.369   3.653   1.00 0.00 ? 22  LEU A C    4  
ATOM 6642  O O    . LEU A 1 22  ? 9.752   3.162   2.840   1.00 0.00 ? 22  LEU A O    4  
ATOM 6643  C CB   . LEU A 1 22  ? 10.613  4.058   6.120   1.00 0.00 ? 22  LEU A CB   4  
ATOM 6644  C CG   . LEU A 1 22  ? 9.821   3.883   7.417   1.00 0.00 ? 22  LEU A CG   4  
ATOM 6645  C CD1  . LEU A 1 22  ? 8.316   3.864   7.142   1.00 0.00 ? 22  LEU A CD1  4  
ATOM 6646  C CD2  . LEU A 1 22  ? 10.280  2.636   8.176   1.00 0.00 ? 22  LEU A CD2  4  
ATOM 6647  H H    . LEU A 1 22  ? 12.115  2.097   6.140   1.00 0.00 ? 22  LEU A H    4  
ATOM 6648  H HA   . LEU A 1 22  ? 9.516   2.470   5.231   1.00 0.00 ? 22  LEU A HA   4  
ATOM 6649  H HB2  . LEU A 1 22  ? 11.665  4.190   6.375   1.00 0.00 ? 22  LEU A HB2  4  
ATOM 6650  H HB3  . LEU A 1 22  ? 10.284  4.978   5.638   1.00 0.00 ? 22  LEU A HB3  4  
ATOM 6651  H HG   . LEU A 1 22  ? 10.020  4.741   8.058   1.00 0.00 ? 22  LEU A HG   4  
ATOM 6652  H HD11 . LEU A 1 22  ? 8.106   4.426   6.232   1.00 0.00 ? 22  LEU A HD11 4  
ATOM 6653  H HD12 . LEU A 1 22  ? 7.982   2.833   7.017   1.00 0.00 ? 22  LEU A HD12 4  
ATOM 6654  H HD13 . LEU A 1 22  ? 7.787   4.318   7.980   1.00 0.00 ? 22  LEU A HD13 4  
ATOM 6655  H HD21 . LEU A 1 22  ? 11.314  2.412   7.914   1.00 0.00 ? 22  LEU A HD21 4  
ATOM 6656  H HD22 . LEU A 1 22  ? 10.208  2.816   9.249   1.00 0.00 ? 22  LEU A HD22 4  
ATOM 6657  H HD23 . LEU A 1 22  ? 9.646   1.792   7.906   1.00 0.00 ? 22  LEU A HD23 4  
ATOM 6658  N N    . ASP A 1 23  ? 11.794  3.977   3.370   1.00 0.00 ? 23  ASP A N    4  
ATOM 6659  C CA   . ASP A 1 23  ? 12.072  4.460   2.028   1.00 0.00 ? 23  ASP A CA   4  
ATOM 6660  C C    . ASP A 1 23  ? 11.666  3.391   1.011   1.00 0.00 ? 23  ASP A C    4  
ATOM 6661  O O    . ASP A 1 23  ? 10.790  3.621   0.180   1.00 0.00 ? 23  ASP A O    4  
ATOM 6662  C CB   . ASP A 1 23  ? 13.563  4.746   1.844   1.00 0.00 ? 23  ASP A CB   4  
ATOM 6663  C CG   . ASP A 1 23  ? 13.910  5.620   0.636   1.00 0.00 ? 23  ASP A CG   4  
ATOM 6664  O OD1  . ASP A 1 23  ? 12.957  6.159   0.034   1.00 0.00 ? 23  ASP A OD1  4  
ATOM 6665  O OD2  . ASP A 1 23  ? 15.120  5.729   0.343   1.00 0.00 ? 23  ASP A OD2  4  
ATOM 6666  H H    . ASP A 1 23  ? 12.520  4.141   4.037   1.00 0.00 ? 23  ASP A H    4  
ATOM 6667  H HA   . ASP A 1 23  ? 11.488  5.375   1.926   1.00 0.00 ? 23  ASP A HA   4  
ATOM 6668  H HB2  . ASP A 1 23  ? 13.939  5.232   2.744   1.00 0.00 ? 23  ASP A HB2  4  
ATOM 6669  H HB3  . ASP A 1 23  ? 14.091  3.797   1.750   1.00 0.00 ? 23  ASP A HB3  4  
ATOM 6670  N N    . ALA A 1 24  ? 12.324  2.245   1.112   1.00 0.00 ? 24  ALA A N    4  
ATOM 6671  C CA   . ALA A 1 24  ? 12.043  1.140   0.211   1.00 0.00 ? 24  ALA A CA   4  
ATOM 6672  C C    . ALA A 1 24  ? 10.530  1.011   0.025   1.00 0.00 ? 24  ALA A C    4  
ATOM 6673  O O    . ALA A 1 24  ? 10.017  1.209   -1.075  1.00 0.00 ? 24  ALA A O    4  
ATOM 6674  C CB   . ALA A 1 24  ? 12.673  -0.141  0.763   1.00 0.00 ? 24  ALA A CB   4  
ATOM 6675  H H    . ALA A 1 24  ? 13.036  2.066   1.791   1.00 0.00 ? 24  ALA A H    4  
ATOM 6676  H HA   . ALA A 1 24  ? 12.501  1.370   -0.750  1.00 0.00 ? 24  ALA A HA   4  
ATOM 6677  H HB1  . ALA A 1 24  ? 12.472  -0.967  0.081   1.00 0.00 ? 24  ALA A HB1  4  
ATOM 6678  H HB2  . ALA A 1 24  ? 13.750  -0.003  0.859   1.00 0.00 ? 24  ALA A HB2  4  
ATOM 6679  H HB3  . ALA A 1 24  ? 12.247  -0.364  1.740   1.00 0.00 ? 24  ALA A HB3  4  
ATOM 6680  N N    . ILE A 1 25  ? 9.857   0.680   1.118   1.00 0.00 ? 25  ILE A N    4  
ATOM 6681  C CA   . ILE A 1 25  ? 8.413   0.523   1.089   1.00 0.00 ? 25  ILE A CA   4  
ATOM 6682  C C    . ILE A 1 25  ? 7.781   1.767   0.461   1.00 0.00 ? 25  ILE A C    4  
ATOM 6683  O O    . ILE A 1 25  ? 6.745   1.678   -0.195  1.00 0.00 ? 25  ILE A O    4  
ATOM 6684  C CB   . ILE A 1 25  ? 7.881   0.201   2.486   1.00 0.00 ? 25  ILE A CB   4  
ATOM 6685  C CG1  . ILE A 1 25  ? 8.350   -1.180  2.947   1.00 0.00 ? 25  ILE A CG1  4  
ATOM 6686  C CG2  . ILE A 1 25  ? 6.358   0.336   2.538   1.00 0.00 ? 25  ILE A CG2  4  
ATOM 6687  C CD1  . ILE A 1 25  ? 8.095   -1.376  4.443   1.00 0.00 ? 25  ILE A CD1  4  
ATOM 6688  H H    . ILE A 1 25  ? 10.282  0.521   2.009   1.00 0.00 ? 25  ILE A H    4  
ATOM 6689  H HA   . ILE A 1 25  ? 8.191   -0.335  0.454   1.00 0.00 ? 25  ILE A HA   4  
ATOM 6690  H HB   . ILE A 1 25  ? 8.292   0.930   3.185   1.00 0.00 ? 25  ILE A HB   4  
ATOM 6691  H HG12 . ILE A 1 25  ? 7.829   -1.953  2.382   1.00 0.00 ? 25  ILE A HG12 4  
ATOM 6692  H HG13 . ILE A 1 25  ? 9.414   -1.296  2.738   1.00 0.00 ? 25  ILE A HG13 4  
ATOM 6693  H HG21 . ILE A 1 25  ? 5.901   -0.502  2.011   1.00 0.00 ? 25  ILE A HG21 4  
ATOM 6694  H HG22 . ILE A 1 25  ? 6.028   0.335   3.576   1.00 0.00 ? 25  ILE A HG22 4  
ATOM 6695  H HG23 . ILE A 1 25  ? 6.059   1.270   2.062   1.00 0.00 ? 25  ILE A HG23 4  
ATOM 6696  H HD11 . ILE A 1 25  ? 8.650   -0.627  5.007   1.00 0.00 ? 25  ILE A HD11 4  
ATOM 6697  H HD12 . ILE A 1 25  ? 7.029   -1.268  4.647   1.00 0.00 ? 25  ILE A HD12 4  
ATOM 6698  H HD13 . ILE A 1 25  ? 8.422   -2.372  4.741   1.00 0.00 ? 25  ILE A HD13 4  
ATOM 6699  N N    . CYS A 1 26  ? 8.432   2.899   0.686   1.00 0.00 ? 26  CYS A N    4  
ATOM 6700  C CA   . CYS A 1 26  ? 7.947   4.160   0.151   1.00 0.00 ? 26  CYS A CA   4  
ATOM 6701  C C    . CYS A 1 26  ? 8.077   4.118   -1.372  1.00 0.00 ? 26  CYS A C    4  
ATOM 6702  O O    . CYS A 1 26  ? 7.075   4.142   -2.085  1.00 0.00 ? 26  CYS A O    4  
ATOM 6703  C CB   . CYS A 1 26  ? 8.691   5.354   0.754   1.00 0.00 ? 26  CYS A CB   4  
ATOM 6704  S SG   . CYS A 1 26  ? 7.502   6.674   1.194   1.00 0.00 ? 26  CYS A SG   4  
ATOM 6705  H H    . CYS A 1 26  ? 9.275   2.963   1.221   1.00 0.00 ? 26  CYS A H    4  
ATOM 6706  H HA   . CYS A 1 26  ? 6.902   4.245   0.448   1.00 0.00 ? 26  CYS A HA   4  
ATOM 6707  H HB2  . CYS A 1 26  ? 9.242   5.040   1.640   1.00 0.00 ? 26  CYS A HB2  4  
ATOM 6708  H HB3  . CYS A 1 26  ? 9.423   5.735   0.042   1.00 0.00 ? 26  CYS A HB3  4  
ATOM 6709  H HG   . CYS A 1 26  ? 6.943   6.024   2.211   1.00 0.00 ? 26  CYS A HG   4  
ATOM 6710  N N    . GLU A 1 27  ? 9.320   4.054   -1.827  1.00 0.00 ? 27  GLU A N    4  
ATOM 6711  C CA   . GLU A 1 27  ? 9.594   4.008   -3.253  1.00 0.00 ? 27  GLU A CA   4  
ATOM 6712  C C    . GLU A 1 27  ? 8.659   3.011   -3.941  1.00 0.00 ? 27  GLU A C    4  
ATOM 6713  O O    . GLU A 1 27  ? 8.253   3.221   -5.083  1.00 0.00 ? 27  GLU A O    4  
ATOM 6714  C CB   . GLU A 1 27  ? 11.060  3.658   -3.519  1.00 0.00 ? 27  GLU A CB   4  
ATOM 6715  C CG   . GLU A 1 27  ? 11.944  4.904   -3.440  1.00 0.00 ? 27  GLU A CG   4  
ATOM 6716  C CD   . GLU A 1 27  ? 13.412  4.552   -3.690  1.00 0.00 ? 27  GLU A CD   4  
ATOM 6717  O OE1  . GLU A 1 27  ? 13.800  4.547   -4.878  1.00 0.00 ? 27  GLU A OE1  4  
ATOM 6718  O OE2  . GLU A 1 27  ? 14.112  4.295   -2.686  1.00 0.00 ? 27  GLU A OE2  4  
ATOM 6719  H H    . GLU A 1 27  ? 10.130  4.034   -1.240  1.00 0.00 ? 27  GLU A H    4  
ATOM 6720  H HA   . GLU A 1 27  ? 9.395   5.015   -3.619  1.00 0.00 ? 27  GLU A HA   4  
ATOM 6721  H HB2  . GLU A 1 27  ? 11.399  2.921   -2.791  1.00 0.00 ? 27  GLU A HB2  4  
ATOM 6722  H HB3  . GLU A 1 27  ? 11.156  3.201   -4.504  1.00 0.00 ? 27  GLU A HB3  4  
ATOM 6723  H HG2  . GLU A 1 27  ? 11.612  5.637   -4.176  1.00 0.00 ? 27  GLU A HG2  4  
ATOM 6724  H HG3  . GLU A 1 27  ? 11.839  5.368   -2.459  1.00 0.00 ? 27  GLU A HG3  4  
ATOM 6725  N N    . ARG A 1 28  ? 8.345   1.947   -3.217  1.00 0.00 ? 28  ARG A N    4  
ATOM 6726  C CA   . ARG A 1 28  ? 7.465   0.917   -3.743  1.00 0.00 ? 28  ARG A CA   4  
ATOM 6727  C C    . ARG A 1 28  ? 6.075   1.495   -4.017  1.00 0.00 ? 28  ARG A C    4  
ATOM 6728  O O    . ARG A 1 28  ? 5.434   1.138   -5.005  1.00 0.00 ? 28  ARG A O    4  
ATOM 6729  C CB   . ARG A 1 28  ? 7.340   -0.253  -2.765  1.00 0.00 ? 28  ARG A CB   4  
ATOM 6730  C CG   . ARG A 1 28  ? 8.713   -0.837  -2.429  1.00 0.00 ? 28  ARG A CG   4  
ATOM 6731  C CD   . ARG A 1 28  ? 8.916   -2.190  -3.114  1.00 0.00 ? 28  ARG A CD   4  
ATOM 6732  N NE   . ARG A 1 28  ? 10.028  -2.922  -2.468  1.00 0.00 ? 28  ARG A NE   4  
ATOM 6733  C CZ   . ARG A 1 28  ? 11.323  -2.618  -2.632  1.00 0.00 ? 28  ARG A CZ   4  
ATOM 6734  N NH1  . ARG A 1 28  ? 11.676  -1.595  -3.422  1.00 0.00 ? 28  ARG A NH1  4  
ATOM 6735  N NH2  . ARG A 1 28  ? 12.265  -3.338  -2.007  1.00 0.00 ? 28  ARG A NH2  4  
ATOM 6736  H H    . ARG A 1 28  ? 8.679   1.783   -2.289  1.00 0.00 ? 28  ARG A H    4  
ATOM 6737  H HA   . ARG A 1 28  ? 7.942   0.588   -4.667  1.00 0.00 ? 28  ARG A HA   4  
ATOM 6738  H HB2  . ARG A 1 28  ? 6.850   0.084   -1.851  1.00 0.00 ? 28  ARG A HB2  4  
ATOM 6739  H HB3  . ARG A 1 28  ? 6.707   -1.028  -3.199  1.00 0.00 ? 28  ARG A HB3  4  
ATOM 6740  H HG2  . ARG A 1 28  ? 9.494   -0.145  -2.746  1.00 0.00 ? 28  ARG A HG2  4  
ATOM 6741  H HG3  . ARG A 1 28  ? 8.809   -0.953  -1.350  1.00 0.00 ? 28  ARG A HG3  4  
ATOM 6742  H HD2  . ARG A 1 28  ? 8.000   -2.778  -3.054  1.00 0.00 ? 28  ARG A HD2  4  
ATOM 6743  H HD3  . ARG A 1 28  ? 9.132   -2.043  -4.172  1.00 0.00 ? 28  ARG A HD3  4  
ATOM 6744  H HE   . ARG A 1 28  ? 9.800   -3.692  -1.872  1.00 0.00 ? 28  ARG A HE   4  
ATOM 6745  H HH11 . ARG A 1 28  ? 10.973  -1.058  -3.889  1.00 0.00 ? 28  ARG A HH11 4  
ATOM 6746  H HH12 . ARG A 1 28  ? 12.642  -1.368  -3.545  1.00 0.00 ? 28  ARG A HH12 4  
ATOM 6747  H HH21 . ARG A 1 28  ? 12.001  -4.101  -1.418  1.00 0.00 ? 28  ARG A HH21 4  
ATOM 6748  H HH22 . ARG A 1 28  ? 13.231  -3.111  -2.130  1.00 0.00 ? 28  ARG A HH22 4  
ATOM 6749  N N    . LEU A 1 29  ? 5.651   2.378   -3.126  1.00 0.00 ? 29  LEU A N    4  
ATOM 6750  C CA   . LEU A 1 29  ? 4.348   3.009   -3.259  1.00 0.00 ? 29  LEU A CA   4  
ATOM 6751  C C    . LEU A 1 29  ? 4.075   3.297   -4.737  1.00 0.00 ? 29  LEU A C    4  
ATOM 6752  O O    . LEU A 1 29  ? 4.817   4.042   -5.376  1.00 0.00 ? 29  LEU A O    4  
ATOM 6753  C CB   . LEU A 1 29  ? 4.259   4.247   -2.365  1.00 0.00 ? 29  LEU A CB   4  
ATOM 6754  C CG   . LEU A 1 29  ? 4.504   4.016   -0.872  1.00 0.00 ? 29  LEU A CG   4  
ATOM 6755  C CD1  . LEU A 1 29  ? 4.857   5.325   -0.165  1.00 0.00 ? 29  LEU A CD1  4  
ATOM 6756  C CD2  . LEU A 1 29  ? 3.307   3.317   -0.222  1.00 0.00 ? 29  LEU A CD2  4  
ATOM 6757  H H    . LEU A 1 29  ? 6.178   2.663   -2.326  1.00 0.00 ? 29  LEU A H    4  
ATOM 6758  H HA   . LEU A 1 29  ? 3.603   2.299   -2.902  1.00 0.00 ? 29  LEU A HA   4  
ATOM 6759  H HB2  . LEU A 1 29  ? 4.981   4.982   -2.721  1.00 0.00 ? 29  LEU A HB2  4  
ATOM 6760  H HB3  . LEU A 1 29  ? 3.269   4.688   -2.486  1.00 0.00 ? 29  LEU A HB3  4  
ATOM 6761  H HG   . LEU A 1 29  ? 5.361   3.351   -0.766  1.00 0.00 ? 29  LEU A HG   4  
ATOM 6762  H HD11 . LEU A 1 29  ? 5.808   5.698   -0.543  1.00 0.00 ? 29  LEU A HD11 4  
ATOM 6763  H HD12 . LEU A 1 29  ? 4.076   6.063   -0.355  1.00 0.00 ? 29  LEU A HD12 4  
ATOM 6764  H HD13 . LEU A 1 29  ? 4.936   5.149   0.908   1.00 0.00 ? 29  LEU A HD13 4  
ATOM 6765  H HD21 . LEU A 1 29  ? 2.865   3.975   0.526   1.00 0.00 ? 29  LEU A HD21 4  
ATOM 6766  H HD22 . LEU A 1 29  ? 2.565   3.084   -0.985  1.00 0.00 ? 29  LEU A HD22 4  
ATOM 6767  H HD23 . LEU A 1 29  ? 3.640   2.396   0.255   1.00 0.00 ? 29  LEU A HD23 4  
ATOM 6768  N N    . LYS A 1 30  ? 3.007   2.693   -5.237  1.00 0.00 ? 30  LYS A N    4  
ATOM 6769  C CA   . LYS A 1 30  ? 2.627   2.875   -6.627  1.00 0.00 ? 30  LYS A CA   4  
ATOM 6770  C C    . LYS A 1 30  ? 1.499   3.905   -6.712  1.00 0.00 ? 30  LYS A C    4  
ATOM 6771  O O    . LYS A 1 30  ? 0.737   4.076   -5.762  1.00 0.00 ? 30  LYS A O    4  
ATOM 6772  C CB   . LYS A 1 30  ? 2.280   1.529   -7.269  1.00 0.00 ? 30  LYS A CB   4  
ATOM 6773  C CG   . LYS A 1 30  ? 3.487   0.947   -8.007  1.00 0.00 ? 30  LYS A CG   4  
ATOM 6774  C CD   . LYS A 1 30  ? 3.180   0.752   -9.493  1.00 0.00 ? 30  LYS A CD   4  
ATOM 6775  C CE   . LYS A 1 30  ? 3.476   -0.684  -9.931  1.00 0.00 ? 30  LYS A CE   4  
ATOM 6776  N NZ   . LYS A 1 30  ? 2.225   -1.381  -10.303 1.00 0.00 ? 30  LYS A NZ   4  
ATOM 6777  H H    . LYS A 1 30  ? 2.409   2.089   -4.711  1.00 0.00 ? 30  LYS A H    4  
ATOM 6778  H HA   . LYS A 1 30  ? 3.495   3.269   -7.155  1.00 0.00 ? 30  LYS A HA   4  
ATOM 6779  H HB2  . LYS A 1 30  ? 1.947   0.831   -6.501  1.00 0.00 ? 30  LYS A HB2  4  
ATOM 6780  H HB3  . LYS A 1 30  ? 1.451   1.657   -7.964  1.00 0.00 ? 30  LYS A HB3  4  
ATOM 6781  H HG2  . LYS A 1 30  ? 4.343   1.612   -7.893  1.00 0.00 ? 30  LYS A HG2  4  
ATOM 6782  H HG3  . LYS A 1 30  ? 3.764   -0.009  -7.561  1.00 0.00 ? 30  LYS A HG3  4  
ATOM 6783  H HD2  . LYS A 1 30  ? 2.132   0.985   -9.685  1.00 0.00 ? 30  LYS A HD2  4  
ATOM 6784  H HD3  . LYS A 1 30  ? 3.775   1.447   -10.085 1.00 0.00 ? 30  LYS A HD3  4  
ATOM 6785  H HE2  . LYS A 1 30  ? 4.162   -0.677  -10.778 1.00 0.00 ? 30  LYS A HE2  4  
ATOM 6786  H HE3  . LYS A 1 30  ? 3.973   -1.221  -9.123  1.00 0.00 ? 30  LYS A HE3  4  
ATOM 6787  H HZ1  . LYS A 1 30  ? 1.602   -1.389  -9.521  1.00 0.00 ? 30  LYS A HZ1  4  
ATOM 6788  H HZ2  . LYS A 1 30  ? 1.793   -0.904  -11.069 1.00 0.00 ? 30  LYS A HZ2  4  
ATOM 6789  H HZ3  . LYS A 1 30  ? 2.435   -2.321  -10.572 1.00 0.00 ? 30  LYS A HZ3  4  
ATOM 6790  N N    . PRO A 1 31  ? 1.427   4.582   -7.889  1.00 0.00 ? 31  PRO A N    4  
ATOM 6791  C CA   . PRO A 1 31  ? 0.405   5.591   -8.111  1.00 0.00 ? 31  PRO A CA   4  
ATOM 6792  C C    . PRO A 1 31  ? -0.960  4.945   -8.359  1.00 0.00 ? 31  PRO A C    4  
ATOM 6793  O O    . PRO A 1 31  ? -1.181  4.334   -9.404  1.00 0.00 ? 31  PRO A O    4  
ATOM 6794  C CB   . PRO A 1 31  ? 0.902   6.402   -9.296  1.00 0.00 ? 31  PRO A CB   4  
ATOM 6795  C CG   . PRO A 1 31  ? 1.945   5.536   -9.984  1.00 0.00 ? 31  PRO A CG   4  
ATOM 6796  C CD   . PRO A 1 31  ? 2.312   4.406   -9.037  1.00 0.00 ? 31  PRO A CD   4  
ATOM 6797  H HA   . PRO A 1 31  ? 0.294   6.158   -7.294  1.00 0.00 ? 31  PRO A HA   4  
ATOM 6798  H HB2  . PRO A 1 31  ? 0.085   6.642   -9.976  1.00 0.00 ? 31  PRO A HB2  4  
ATOM 6799  H HB3  . PRO A 1 31  ? 1.333   7.348   -8.969  1.00 0.00 ? 31  PRO A HB3  4  
ATOM 6800  H HG2  . PRO A 1 31  ? 1.554   5.138   -10.920 1.00 0.00 ? 31  PRO A HG2  4  
ATOM 6801  H HG3  . PRO A 1 31  ? 2.827   6.127   -10.233 1.00 0.00 ? 31  PRO A HG3  4  
ATOM 6802  H HD2  . PRO A 1 31  ? 2.165   3.433   -9.505  1.00 0.00 ? 31  PRO A HD2  4  
ATOM 6803  H HD3  . PRO A 1 31  ? 3.360   4.462   -8.740  1.00 0.00 ? 31  PRO A HD3  4  
ATOM 6804  N N    . CYS A 1 32  ? -1.839  5.100   -7.380  1.00 0.00 ? 32  CYS A N    4  
ATOM 6805  C CA   . CYS A 1 32  ? -3.176  4.539   -7.479  1.00 0.00 ? 32  CYS A CA   4  
ATOM 6806  C C    . CYS A 1 32  ? -4.137  5.449   -6.713  1.00 0.00 ? 32  CYS A C    4  
ATOM 6807  O O    . CYS A 1 32  ? -3.712  6.241   -5.873  1.00 0.00 ? 32  CYS A O    4  
ATOM 6808  C CB   . CYS A 1 32  ? -3.224  3.098   -6.967  1.00 0.00 ? 32  CYS A CB   4  
ATOM 6809  S SG   . CYS A 1 32  ? -2.102  2.044   -7.957  1.00 0.00 ? 32  CYS A SG   4  
ATOM 6810  H H    . CYS A 1 32  ? -1.652  5.598   -6.533  1.00 0.00 ? 32  CYS A H    4  
ATOM 6811  H HA   . CYS A 1 32  ? -3.428  4.515   -8.540  1.00 0.00 ? 32  CYS A HA   4  
ATOM 6812  H HB2  . CYS A 1 32  ? -2.934  3.067   -5.917  1.00 0.00 ? 32  CYS A HB2  4  
ATOM 6813  H HB3  . CYS A 1 32  ? -4.243  2.716   -7.028  1.00 0.00 ? 32  CYS A HB3  4  
ATOM 6814  H HG   . CYS A 1 32  ? -0.972  2.569   -7.491  1.00 0.00 ? 32  CYS A HG   4  
ATOM 6815  N N    . LEU A 1 33  ? -5.416  5.307   -7.030  1.00 0.00 ? 33  LEU A N    4  
ATOM 6816  C CA   . LEU A 1 33  ? -6.441  6.107   -6.381  1.00 0.00 ? 33  LEU A CA   4  
ATOM 6817  C C    . LEU A 1 33  ? -7.686  5.246   -6.154  1.00 0.00 ? 33  LEU A C    4  
ATOM 6818  O O    . LEU A 1 33  ? -7.947  4.315   -6.913  1.00 0.00 ? 33  LEU A O    4  
ATOM 6819  C CB   . LEU A 1 33  ? -6.713  7.382   -7.182  1.00 0.00 ? 33  LEU A CB   4  
ATOM 6820  C CG   . LEU A 1 33  ? -7.744  8.342   -6.586  1.00 0.00 ? 33  LEU A CG   4  
ATOM 6821  C CD1  . LEU A 1 33  ? -7.073  9.616   -6.069  1.00 0.00 ? 33  LEU A CD1  4  
ATOM 6822  C CD2  . LEU A 1 33  ? -8.855  8.647   -7.592  1.00 0.00 ? 33  LEU A CD2  4  
ATOM 6823  H H    . LEU A 1 33  ? -5.754  4.661   -7.714  1.00 0.00 ? 33  LEU A H    4  
ATOM 6824  H HA   . LEU A 1 33  ? -6.051  6.413   -5.410  1.00 0.00 ? 33  LEU A HA   4  
ATOM 6825  H HB2  . LEU A 1 33  ? -5.772  7.919   -7.302  1.00 0.00 ? 33  LEU A HB2  4  
ATOM 6826  H HB3  . LEU A 1 33  ? -7.046  7.096   -8.180  1.00 0.00 ? 33  LEU A HB3  4  
ATOM 6827  H HG   . LEU A 1 33  ? -8.210  7.854   -5.730  1.00 0.00 ? 33  LEU A HG   4  
ATOM 6828  H HD11 . LEU A 1 33  ? -7.804  10.218  -5.530  1.00 0.00 ? 33  LEU A HD11 4  
ATOM 6829  H HD12 . LEU A 1 33  ? -6.255  9.350   -5.399  1.00 0.00 ? 33  LEU A HD12 4  
ATOM 6830  H HD13 . LEU A 1 33  ? -6.681  10.187  -6.911  1.00 0.00 ? 33  LEU A HD13 4  
ATOM 6831  H HD21 . LEU A 1 33  ? -8.520  8.383   -8.595  1.00 0.00 ? 33  LEU A HD21 4  
ATOM 6832  H HD22 . LEU A 1 33  ? -9.742  8.065   -7.341  1.00 0.00 ? 33  LEU A HD22 4  
ATOM 6833  H HD23 . LEU A 1 33  ? -9.096  9.710   -7.557  1.00 0.00 ? 33  LEU A HD23 4  
ATOM 6834  N N    . PHE A 1 34  ? -8.420  5.589   -5.106  1.00 0.00 ? 34  PHE A N    4  
ATOM 6835  C CA   . PHE A 1 34  ? -9.630  4.859   -4.769  1.00 0.00 ? 34  PHE A CA   4  
ATOM 6836  C C    . PHE A 1 34  ? -10.877 5.657   -5.157  1.00 0.00 ? 34  PHE A C    4  
ATOM 6837  O O    . PHE A 1 34  ? -11.172 6.687   -4.552  1.00 0.00 ? 34  PHE A O    4  
ATOM 6838  C CB   . PHE A 1 34  ? -9.622  4.654   -3.253  1.00 0.00 ? 34  PHE A CB   4  
ATOM 6839  C CG   . PHE A 1 34  ? -8.358  3.973   -2.724  1.00 0.00 ? 34  PHE A CG   4  
ATOM 6840  C CD1  . PHE A 1 34  ? -7.907  2.830   -3.307  1.00 0.00 ? 34  PHE A CD1  4  
ATOM 6841  C CD2  . PHE A 1 34  ? -7.685  4.511   -1.671  1.00 0.00 ? 34  PHE A CD2  4  
ATOM 6842  C CE1  . PHE A 1 34  ? -6.733  2.198   -2.816  1.00 0.00 ? 34  PHE A CE1  4  
ATOM 6843  C CE2  . PHE A 1 34  ? -6.512  3.879   -1.181  1.00 0.00 ? 34  PHE A CE2  4  
ATOM 6844  C CZ   . PHE A 1 34  ? -6.061  2.736   -1.763  1.00 0.00 ? 34  PHE A CZ   4  
ATOM 6845  H H    . PHE A 1 34  ? -8.200  6.348   -4.493  1.00 0.00 ? 34  PHE A H    4  
ATOM 6846  H HA   . PHE A 1 34  ? -9.611  3.924   -5.329  1.00 0.00 ? 34  PHE A HA   4  
ATOM 6847  H HB2  . PHE A 1 34  ? -9.732  5.622   -2.765  1.00 0.00 ? 34  PHE A HB2  4  
ATOM 6848  H HB3  . PHE A 1 34  ? -10.489 4.055   -2.973  1.00 0.00 ? 34  PHE A HB3  4  
ATOM 6849  H HD1  . PHE A 1 34  ? -8.445  2.399   -4.151  1.00 0.00 ? 34  PHE A HD1  4  
ATOM 6850  H HD2  . PHE A 1 34  ? -8.047  5.427   -1.204  1.00 0.00 ? 34  PHE A HD2  4  
ATOM 6851  H HE1  . PHE A 1 34  ? -6.372  1.282   -3.283  1.00 0.00 ? 34  PHE A HE1  4  
ATOM 6852  H HE2  . PHE A 1 34  ? -5.973  4.310   -0.337  1.00 0.00 ? 34  PHE A HE2  4  
ATOM 6853  H HZ   . PHE A 1 34  ? -5.161  2.251   -1.387  1.00 0.00 ? 34  PHE A HZ   4  
ATOM 6854  N N    . THR A 1 35  ? -11.575 5.152   -6.163  1.00 0.00 ? 35  THR A N    4  
ATOM 6855  C CA   . THR A 1 35  ? -12.783 5.804   -6.639  1.00 0.00 ? 35  THR A CA   4  
ATOM 6856  C C    . THR A 1 35  ? -13.991 5.358   -5.813  1.00 0.00 ? 35  THR A C    4  
ATOM 6857  O O    . THR A 1 35  ? -13.834 4.717   -4.774  1.00 0.00 ? 35  THR A O    4  
ATOM 6858  C CB   . THR A 1 35  ? -12.924 5.506   -8.133  1.00 0.00 ? 35  THR A CB   4  
ATOM 6859  O OG1  . THR A 1 35  ? -12.419 4.181   -8.272  1.00 0.00 ? 35  THR A OG1  4  
ATOM 6860  C CG2  . THR A 1 35  ? -11.985 6.355   -8.991  1.00 0.00 ? 35  THR A CG2  4  
ATOM 6861  H H    . THR A 1 35  ? -11.327 4.314   -6.650  1.00 0.00 ? 35  THR A H    4  
ATOM 6862  H HA   . THR A 1 35  ? -12.674 6.878   -6.491  1.00 0.00 ? 35  THR A HA   4  
ATOM 6863  H HB   . THR A 1 35  ? -13.959 5.621   -8.456  1.00 0.00 ? 35  THR A HB   4  
ATOM 6864  H HG1  . THR A 1 35  ? -12.949 3.683   -8.958  1.00 0.00 ? 35  THR A HG1  4  
ATOM 6865  H HG21 . THR A 1 35  ? -12.326 7.391   -8.987  1.00 0.00 ? 35  THR A HG21 4  
ATOM 6866  H HG22 . THR A 1 35  ? -10.975 6.304   -8.585  1.00 0.00 ? 35  THR A HG22 4  
ATOM 6867  H HG23 . THR A 1 35  ? -11.985 5.977   -10.013 1.00 0.00 ? 35  THR A HG23 4  
ATOM 6868  N N    . GLU A 1 36  ? -15.168 5.713   -6.305  1.00 0.00 ? 36  GLU A N    4  
ATOM 6869  C CA   . GLU A 1 36  ? -16.402 5.357   -5.626  1.00 0.00 ? 36  GLU A CA   4  
ATOM 6870  C C    . GLU A 1 36  ? -16.628 3.845   -5.694  1.00 0.00 ? 36  GLU A C    4  
ATOM 6871  O O    . GLU A 1 36  ? -16.375 3.222   -6.723  1.00 0.00 ? 36  GLU A O    4  
ATOM 6872  C CB   . GLU A 1 36  ? -17.592 6.117   -6.216  1.00 0.00 ? 36  GLU A CB   4  
ATOM 6873  C CG   . GLU A 1 36  ? -18.159 5.386   -7.434  1.00 0.00 ? 36  GLU A CG   4  
ATOM 6874  C CD   . GLU A 1 36  ? -19.128 6.282   -8.209  1.00 0.00 ? 36  GLU A CD   4  
ATOM 6875  O OE1  . GLU A 1 36  ? -20.313 6.314   -7.810  1.00 0.00 ? 36  GLU A OE1  4  
ATOM 6876  O OE2  . GLU A 1 36  ? -18.663 6.914   -9.181  1.00 0.00 ? 36  GLU A OE2  4  
ATOM 6877  H H    . GLU A 1 36  ? -15.286 6.234   -7.151  1.00 0.00 ? 36  GLU A H    4  
ATOM 6878  H HA   . GLU A 1 36  ? -16.261 5.664   -4.589  1.00 0.00 ? 36  GLU A HA   4  
ATOM 6879  H HB2  . GLU A 1 36  ? -18.369 6.227   -5.459  1.00 0.00 ? 36  GLU A HB2  4  
ATOM 6880  H HB3  . GLU A 1 36  ? -17.281 7.121   -6.502  1.00 0.00 ? 36  GLU A HB3  4  
ATOM 6881  H HG2  . GLU A 1 36  ? -17.345 5.075   -8.088  1.00 0.00 ? 36  GLU A HG2  4  
ATOM 6882  H HG3  . GLU A 1 36  ? -18.674 4.480   -7.112  1.00 0.00 ? 36  GLU A HG3  4  
ATOM 6883  N N    . LYS A 1 37  ? -17.103 3.300   -4.584  1.00 0.00 ? 37  LYS A N    4  
ATOM 6884  C CA   . LYS A 1 37  ? -17.366 1.873   -4.504  1.00 0.00 ? 37  LYS A CA   4  
ATOM 6885  C C    . LYS A 1 37  ? -16.040 1.111   -4.535  1.00 0.00 ? 37  LYS A C    4  
ATOM 6886  O O    . LYS A 1 37  ? -15.982 -0.023  -5.006  1.00 0.00 ? 37  LYS A O    4  
ATOM 6887  C CB   . LYS A 1 37  ? -18.345 1.447   -5.601  1.00 0.00 ? 37  LYS A CB   4  
ATOM 6888  C CG   . LYS A 1 37  ? -19.680 2.180   -5.459  1.00 0.00 ? 37  LYS A CG   4  
ATOM 6889  C CD   . LYS A 1 37  ? -20.830 1.338   -6.016  1.00 0.00 ? 37  LYS A CD   4  
ATOM 6890  C CE   . LYS A 1 37  ? -20.758 1.255   -7.542  1.00 0.00 ? 37  LYS A CE   4  
ATOM 6891  N NZ   . LYS A 1 37  ? -22.118 1.225   -8.125  1.00 0.00 ? 37  LYS A NZ   4  
ATOM 6892  H H    . LYS A 1 37  ? -17.306 3.814   -3.750  1.00 0.00 ? 37  LYS A H    4  
ATOM 6893  H HA   . LYS A 1 37  ? -17.852 1.683   -3.547  1.00 0.00 ? 37  LYS A HA   4  
ATOM 6894  H HB2  . LYS A 1 37  ? -17.914 1.656   -6.580  1.00 0.00 ? 37  LYS A HB2  4  
ATOM 6895  H HB3  . LYS A 1 37  ? -18.509 0.371   -5.548  1.00 0.00 ? 37  LYS A HB3  4  
ATOM 6896  H HG2  . LYS A 1 37  ? -19.866 2.405   -4.408  1.00 0.00 ? 37  LYS A HG2  4  
ATOM 6897  H HG3  . LYS A 1 37  ? -19.634 3.133   -5.985  1.00 0.00 ? 37  LYS A HG3  4  
ATOM 6898  H HD2  . LYS A 1 37  ? -20.790 0.335   -5.592  1.00 0.00 ? 37  LYS A HD2  4  
ATOM 6899  H HD3  . LYS A 1 37  ? -21.783 1.774   -5.717  1.00 0.00 ? 37  LYS A HD3  4  
ATOM 6900  H HE2  . LYS A 1 37  ? -20.207 2.110   -7.934  1.00 0.00 ? 37  LYS A HE2  4  
ATOM 6901  H HE3  . LYS A 1 37  ? -20.210 0.360   -7.838  1.00 0.00 ? 37  LYS A HE3  4  
ATOM 6902  H HZ1  . LYS A 1 37  ? -22.119 1.716   -8.996  1.00 0.00 ? 37  LYS A HZ1  4  
ATOM 6903  H HZ2  . LYS A 1 37  ? -22.395 0.276   -8.276  1.00 0.00 ? 37  LYS A HZ2  4  
ATOM 6904  H HZ3  . LYS A 1 37  ? -22.760 1.663   -7.495  1.00 0.00 ? 37  LYS A HZ3  4  
ATOM 6905  N N    . SER A 1 38  ? -15.006 1.766   -4.025  1.00 0.00 ? 38  SER A N    4  
ATOM 6906  C CA   . SER A 1 38  ? -13.684 1.165   -3.988  1.00 0.00 ? 38  SER A CA   4  
ATOM 6907  C C    . SER A 1 38  ? -13.429 0.548   -2.611  1.00 0.00 ? 38  SER A C    4  
ATOM 6908  O O    . SER A 1 38  ? -13.340 1.262   -1.614  1.00 0.00 ? 38  SER A O    4  
ATOM 6909  C CB   . SER A 1 38  ? -12.601 2.195   -4.317  1.00 0.00 ? 38  SER A CB   4  
ATOM 6910  O OG   . SER A 1 38  ? -12.661 2.616   -5.677  1.00 0.00 ? 38  SER A OG   4  
ATOM 6911  H H    . SER A 1 38  ? -15.062 2.689   -3.644  1.00 0.00 ? 38  SER A H    4  
ATOM 6912  H HA   . SER A 1 38  ? -13.696 0.393   -4.757  1.00 0.00 ? 38  SER A HA   4  
ATOM 6913  H HB2  . SER A 1 38  ? -12.714 3.060   -3.664  1.00 0.00 ? 38  SER A HB2  4  
ATOM 6914  H HB3  . SER A 1 38  ? -11.620 1.767   -4.113  1.00 0.00 ? 38  SER A HB3  4  
ATOM 6915  H HG   . SER A 1 38  ? -12.648 1.821   -6.282  1.00 0.00 ? 38  SER A HG   4  
ATOM 6916  N N    . TYR A 1 39  ? -13.318 -0.773  -2.602  1.00 0.00 ? 39  TYR A N    4  
ATOM 6917  C CA   . TYR A 1 39  ? -13.075 -1.494  -1.364  1.00 0.00 ? 39  TYR A CA   4  
ATOM 6918  C C    . TYR A 1 39  ? -11.582 -1.774  -1.177  1.00 0.00 ? 39  TYR A C    4  
ATOM 6919  O O    . TYR A 1 39  ? -10.984 -2.516  -1.954  1.00 0.00 ? 39  TYR A O    4  
ATOM 6920  C CB   . TYR A 1 39  ? -13.818 -2.824  -1.498  1.00 0.00 ? 39  TYR A CB   4  
ATOM 6921  C CG   . TYR A 1 39  ? -15.272 -2.775  -1.025  1.00 0.00 ? 39  TYR A CG   4  
ATOM 6922  C CD1  . TYR A 1 39  ? -15.561 -2.464  0.288   1.00 0.00 ? 39  TYR A CD1  4  
ATOM 6923  C CD2  . TYR A 1 39  ? -16.296 -3.042  -1.912  1.00 0.00 ? 39  TYR A CD2  4  
ATOM 6924  C CE1  . TYR A 1 39  ? -16.930 -2.417  0.733   1.00 0.00 ? 39  TYR A CE1  4  
ATOM 6925  C CE2  . TYR A 1 39  ? -17.664 -2.995  -1.467  1.00 0.00 ? 39  TYR A CE2  4  
ATOM 6926  C CZ   . TYR A 1 39  ? -17.914 -2.685  -0.167  1.00 0.00 ? 39  TYR A CZ   4  
ATOM 6927  O OH   . TYR A 1 39  ? -19.207 -2.641  0.253   1.00 0.00 ? 39  TYR A OH   4  
ATOM 6928  H H    . TYR A 1 39  ? -13.392 -1.346  -3.417  1.00 0.00 ? 39  TYR A H    4  
ATOM 6929  H HA   . TYR A 1 39  ? -13.427 -0.875  -0.539  1.00 0.00 ? 39  TYR A HA   4  
ATOM 6930  H HB2  . TYR A 1 39  ? -13.797 -3.137  -2.542  1.00 0.00 ? 39  TYR A HB2  4  
ATOM 6931  H HB3  . TYR A 1 39  ? -13.287 -3.585  -0.927  1.00 0.00 ? 39  TYR A HB3  4  
ATOM 6932  H HD1  . TYR A 1 39  ? -14.753 -2.253  0.988   1.00 0.00 ? 39  TYR A HD1  4  
ATOM 6933  H HD2  . TYR A 1 39  ? -16.068 -3.288  -2.950  1.00 0.00 ? 39  TYR A HD2  4  
ATOM 6934  H HE1  . TYR A 1 39  ? -17.171 -2.173  1.767   1.00 0.00 ? 39  TYR A HE1  4  
ATOM 6935  H HE2  . TYR A 1 39  ? -18.482 -3.204  -2.157  1.00 0.00 ? 39  TYR A HE2  4  
ATOM 6936  H HH   . TYR A 1 39  ? -19.792 -2.291  -0.478  1.00 0.00 ? 39  TYR A HH   4  
ATOM 6937  N N    . LEU A 1 40  ? -11.023 -1.165  -0.142  1.00 0.00 ? 40  LEU A N    4  
ATOM 6938  C CA   . LEU A 1 40  ? -9.612  -1.339  0.157   1.00 0.00 ? 40  LEU A CA   4  
ATOM 6939  C C    . LEU A 1 40  ? -9.394  -2.721  0.777   1.00 0.00 ? 40  LEU A C    4  
ATOM 6940  O O    . LEU A 1 40  ? -8.644  -3.535  0.240   1.00 0.00 ? 40  LEU A O    4  
ATOM 6941  C CB   . LEU A 1 40  ? -9.102  -0.188  1.026   1.00 0.00 ? 40  LEU A CB   4  
ATOM 6942  C CG   . LEU A 1 40  ? -8.972  1.169   0.331   1.00 0.00 ? 40  LEU A CG   4  
ATOM 6943  C CD1  . LEU A 1 40  ? -10.327 1.649   -0.193  1.00 0.00 ? 40  LEU A CD1  4  
ATOM 6944  C CD2  . LEU A 1 40  ? -8.318  2.198   1.256   1.00 0.00 ? 40  LEU A CD2  4  
ATOM 6945  H H    . LEU A 1 40  ? -11.517 -0.563  0.486   1.00 0.00 ? 40  LEU A H    4  
ATOM 6946  H HA   . LEU A 1 40  ? -9.070  -1.295  -0.787  1.00 0.00 ? 40  LEU A HA   4  
ATOM 6947  H HB2  . LEU A 1 40  ? -9.774  -0.075  1.877   1.00 0.00 ? 40  LEU A HB2  4  
ATOM 6948  H HB3  . LEU A 1 40  ? -8.126  -0.465  1.425   1.00 0.00 ? 40  LEU A HB3  4  
ATOM 6949  H HG   . LEU A 1 40  ? -8.317  1.050   -0.532  1.00 0.00 ? 40  LEU A HG   4  
ATOM 6950  H HD11 . LEU A 1 40  ? -10.520 1.200   -1.167  1.00 0.00 ? 40  LEU A HD11 4  
ATOM 6951  H HD12 . LEU A 1 40  ? -11.111 1.355   0.505   1.00 0.00 ? 40  LEU A HD12 4  
ATOM 6952  H HD13 . LEU A 1 40  ? -10.315 2.735   -0.289  1.00 0.00 ? 40  LEU A HD13 4  
ATOM 6953  H HD21 . LEU A 1 40  ? -8.229  3.151   0.735   1.00 0.00 ? 40  LEU A HD21 4  
ATOM 6954  H HD22 . LEU A 1 40  ? -8.932  2.328   2.147   1.00 0.00 ? 40  LEU A HD22 4  
ATOM 6955  H HD23 . LEU A 1 40  ? -7.327  1.848   1.546   1.00 0.00 ? 40  LEU A HD23 4  
ATOM 6956  N N    . VAL A 1 41  ? -10.062 -2.943  1.899   1.00 0.00 ? 41  VAL A N    4  
ATOM 6957  C CA   . VAL A 1 41  ? -9.951  -4.212  2.598   1.00 0.00 ? 41  VAL A CA   4  
ATOM 6958  C C    . VAL A 1 41  ? -11.350 -4.785  2.833   1.00 0.00 ? 41  VAL A C    4  
ATOM 6959  O O    . VAL A 1 41  ? -12.315 -4.036  2.974   1.00 0.00 ? 41  VAL A O    4  
ATOM 6960  C CB   . VAL A 1 41  ? -9.154  -4.029  3.892   1.00 0.00 ? 41  VAL A CB   4  
ATOM 6961  C CG1  . VAL A 1 41  ? -7.797  -3.380  3.613   1.00 0.00 ? 41  VAL A CG1  4  
ATOM 6962  C CG2  . VAL A 1 41  ? -9.951  -3.216  4.915   1.00 0.00 ? 41  VAL A CG2  4  
ATOM 6963  H H    . VAL A 1 41  ? -10.670 -2.276  2.330   1.00 0.00 ? 41  VAL A H    4  
ATOM 6964  H HA   . VAL A 1 41  ? -9.396  -4.894  1.954   1.00 0.00 ? 41  VAL A HA   4  
ATOM 6965  H HB   . VAL A 1 41  ? -8.973  -5.016  4.317   1.00 0.00 ? 41  VAL A HB   4  
ATOM 6966  H HG11 . VAL A 1 41  ? -7.208  -3.363  4.530   1.00 0.00 ? 41  VAL A HG11 4  
ATOM 6967  H HG12 . VAL A 1 41  ? -7.269  -3.956  2.852   1.00 0.00 ? 41  VAL A HG12 4  
ATOM 6968  H HG13 . VAL A 1 41  ? -7.947  -2.361  3.258   1.00 0.00 ? 41  VAL A HG13 4  
ATOM 6969  H HG21 . VAL A 1 41  ? -9.910  -2.159  4.651   1.00 0.00 ? 41  VAL A HG21 4  
ATOM 6970  H HG22 . VAL A 1 41  ? -10.988 -3.550  4.917   1.00 0.00 ? 41  VAL A HG22 4  
ATOM 6971  H HG23 . VAL A 1 41  ? -9.521  -3.359  5.907   1.00 0.00 ? 41  VAL A HG23 4  
ATOM 6972  N N    . ARG A 1 42  ? -11.415 -6.108  2.869   1.00 0.00 ? 42  ARG A N    4  
ATOM 6973  C CA   . ARG A 1 42  ? -12.680 -6.789  3.084   1.00 0.00 ? 42  ARG A CA   4  
ATOM 6974  C C    . ARG A 1 42  ? -12.541 -7.824  4.203   1.00 0.00 ? 42  ARG A C    4  
ATOM 6975  O O    . ARG A 1 42  ? -11.639 -8.659  4.172   1.00 0.00 ? 42  ARG A O    4  
ATOM 6976  C CB   . ARG A 1 42  ? -13.153 -7.488  1.808   1.00 0.00 ? 42  ARG A CB   4  
ATOM 6977  C CG   . ARG A 1 42  ? -14.417 -6.825  1.257   1.00 0.00 ? 42  ARG A CG   4  
ATOM 6978  C CD   . ARG A 1 42  ? -14.075 -5.832  0.145   1.00 0.00 ? 42  ARG A CD   4  
ATOM 6979  N NE   . ARG A 1 42  ? -15.058 -5.945  -0.955  1.00 0.00 ? 42  ARG A NE   4  
ATOM 6980  C CZ   . ARG A 1 42  ? -15.197 -7.030  -1.729  1.00 0.00 ? 42  ARG A CZ   4  
ATOM 6981  N NH1  . ARG A 1 42  ? -14.418 -8.102  -1.527  1.00 0.00 ? 42  ARG A NH1  4  
ATOM 6982  N NH2  . ARG A 1 42  ? -16.116 -7.044  -2.704  1.00 0.00 ? 42  ARG A NH2  4  
ATOM 6983  H H    . ARG A 1 42  ? -10.624 -6.710  2.753   1.00 0.00 ? 42  ARG A H    4  
ATOM 6984  H HA   . ARG A 1 42  ? -13.377 -6.000  3.365   1.00 0.00 ? 42  ARG A HA   4  
ATOM 6985  H HB2  . ARG A 1 42  ? -12.364 -7.456  1.057   1.00 0.00 ? 42  ARG A HB2  4  
ATOM 6986  H HB3  . ARG A 1 42  ? -13.351 -8.540  2.017   1.00 0.00 ? 42  ARG A HB3  4  
ATOM 6987  H HG2  . ARG A 1 42  ? -15.094 -7.588  0.872   1.00 0.00 ? 42  ARG A HG2  4  
ATOM 6988  H HG3  . ARG A 1 42  ? -14.942 -6.310  2.061   1.00 0.00 ? 42  ARG A HG3  4  
ATOM 6989  H HD2  . ARG A 1 42  ? -14.075 -4.816  0.541   1.00 0.00 ? 42  ARG A HD2  4  
ATOM 6990  H HD3  . ARG A 1 42  ? -13.071 -6.027  -0.231  1.00 0.00 ? 42  ARG A HD3  4  
ATOM 6991  H HE   . ARG A 1 42  ? -15.655 -5.163  -1.133  1.00 0.00 ? 42  ARG A HE   4  
ATOM 6992  H HH11 . ARG A 1 42  ? -13.732 -8.091  -0.800  1.00 0.00 ? 42  ARG A HH11 4  
ATOM 6993  H HH12 . ARG A 1 42  ? -14.522 -8.911  -2.105  1.00 0.00 ? 42  ARG A HH12 4  
ATOM 6994  H HH21 . ARG A 1 42  ? -16.697 -6.245  -2.855  1.00 0.00 ? 42  ARG A HH21 4  
ATOM 6995  H HH22 . ARG A 1 42  ? -16.220 -7.854  -3.282  1.00 0.00 ? 42  ARG A HH22 4  
ATOM 6996  N N    . GLU A 1 43  ? -13.449 -7.735  5.164   1.00 0.00 ? 43  GLU A N    4  
ATOM 6997  C CA   . GLU A 1 43  ? -13.439 -8.653  6.290   1.00 0.00 ? 43  GLU A CA   4  
ATOM 6998  C C    . GLU A 1 43  ? -13.871 -10.050 5.840   1.00 0.00 ? 43  GLU A C    4  
ATOM 6999  O O    . GLU A 1 43  ? -15.046 -10.278 5.556   1.00 0.00 ? 43  GLU A O    4  
ATOM 7000  C CB   . GLU A 1 43  ? -14.331 -8.141  7.423   1.00 0.00 ? 43  GLU A CB   4  
ATOM 7001  C CG   . GLU A 1 43  ? -13.599 -8.195  8.765   1.00 0.00 ? 43  GLU A CG   4  
ATOM 7002  C CD   . GLU A 1 43  ? -14.022 -9.425  9.571   1.00 0.00 ? 43  GLU A CD   4  
ATOM 7003  O OE1  . GLU A 1 43  ? -13.502 -10.517 9.255   1.00 0.00 ? 43  GLU A OE1  4  
ATOM 7004  O OE2  . GLU A 1 43  ? -14.855 -9.245  10.486  1.00 0.00 ? 43  GLU A OE2  4  
ATOM 7005  H H    . GLU A 1 43  ? -14.179 -7.052  5.182   1.00 0.00 ? 43  GLU A H    4  
ATOM 7006  H HA   . GLU A 1 43  ? -12.405 -8.678  6.634   1.00 0.00 ? 43  GLU A HA   4  
ATOM 7007  H HB2  . GLU A 1 43  ? -14.639 -7.117  7.213   1.00 0.00 ? 43  GLU A HB2  4  
ATOM 7008  H HB3  . GLU A 1 43  ? -15.239 -8.742  7.475   1.00 0.00 ? 43  GLU A HB3  4  
ATOM 7009  H HG2  . GLU A 1 43  ? -12.523 -8.219  8.595   1.00 0.00 ? 43  GLU A HG2  4  
ATOM 7010  H HG3  . GLU A 1 43  ? -13.812 -7.291  9.336   1.00 0.00 ? 43  GLU A HG3  4  
ATOM 7011  N N    . GLY A 1 44  ? -12.898 -10.948 5.789   1.00 0.00 ? 44  GLY A N    4  
ATOM 7012  C CA   . GLY A 1 44  ? -13.163 -12.316 5.378   1.00 0.00 ? 44  GLY A CA   4  
ATOM 7013  C C    . GLY A 1 44  ? -12.308 -12.701 4.169   1.00 0.00 ? 44  GLY A C    4  
ATOM 7014  O O    . GLY A 1 44  ? -12.038 -13.880 3.945   1.00 0.00 ? 44  GLY A O    4  
ATOM 7015  H H    . GLY A 1 44  ? -11.945 -10.753 6.022   1.00 0.00 ? 44  GLY A H    4  
ATOM 7016  H HA2  . GLY A 1 44  ? -12.956 -12.994 6.206   1.00 0.00 ? 44  GLY A HA2  4  
ATOM 7017  H HA3  . GLY A 1 44  ? -14.219 -12.427 5.132   1.00 0.00 ? 44  GLY A HA3  4  
ATOM 7018  N N    . ASP A 1 45  ? -11.906 -11.684 3.421   1.00 0.00 ? 45  ASP A N    4  
ATOM 7019  C CA   . ASP A 1 45  ? -11.088 -11.901 2.240   1.00 0.00 ? 45  ASP A CA   4  
ATOM 7020  C C    . ASP A 1 45  ? -9.623  -11.617 2.581   1.00 0.00 ? 45  ASP A C    4  
ATOM 7021  O O    . ASP A 1 45  ? -9.332  -10.918 3.551   1.00 0.00 ? 45  ASP A O    4  
ATOM 7022  C CB   . ASP A 1 45  ? -11.499 -10.961 1.105   1.00 0.00 ? 45  ASP A CB   4  
ATOM 7023  C CG   . ASP A 1 45  ? -13.002 -10.696 0.998   1.00 0.00 ? 45  ASP A CG   4  
ATOM 7024  O OD1  . ASP A 1 45  ? -13.754 -11.397 1.708   1.00 0.00 ? 45  ASP A OD1  4  
ATOM 7025  O OD2  . ASP A 1 45  ? -13.365 -9.798  0.207   1.00 0.00 ? 45  ASP A OD2  4  
ATOM 7026  H H    . ASP A 1 45  ? -12.130 -10.728 3.610   1.00 0.00 ? 45  ASP A H    4  
ATOM 7027  H HA   . ASP A 1 45  ? -11.257 -12.941 1.961   1.00 0.00 ? 45  ASP A HA   4  
ATOM 7028  H HB2  . ASP A 1 45  ? -10.986 -10.009 1.237   1.00 0.00 ? 45  ASP A HB2  4  
ATOM 7029  H HB3  . ASP A 1 45  ? -11.151 -11.382 0.161   1.00 0.00 ? 45  ASP A HB3  4  
ATOM 7030  N N    . PRO A 1 46  ? -8.717  -12.189 1.744   1.00 0.00 ? 46  PRO A N    4  
ATOM 7031  C CA   . PRO A 1 46  ? -7.290  -12.005 1.947   1.00 0.00 ? 46  PRO A CA   4  
ATOM 7032  C C    . PRO A 1 46  ? -6.852  -10.603 1.519   1.00 0.00 ? 46  PRO A C    4  
ATOM 7033  O O    . PRO A 1 46  ? -7.626  -9.865  0.913   1.00 0.00 ? 46  PRO A O    4  
ATOM 7034  C CB   . PRO A 1 46  ? -6.632  -13.107 1.133   1.00 0.00 ? 46  PRO A CB   4  
ATOM 7035  C CG   . PRO A 1 46  ? -7.683  -13.576 0.139   1.00 0.00 ? 46  PRO A CG   4  
ATOM 7036  C CD   . PRO A 1 46  ? -9.026  -13.023 0.586   1.00 0.00 ? 46  PRO A CD   4  
ATOM 7037  H HA   . PRO A 1 46  ? -7.066  -12.078 2.918   1.00 0.00 ? 46  PRO A HA   4  
ATOM 7038  H HB2  . PRO A 1 46  ? -5.746  -12.736 0.618   1.00 0.00 ? 46  PRO A HB2  4  
ATOM 7039  H HB3  . PRO A 1 46  ? -6.308  -13.927 1.775   1.00 0.00 ? 46  PRO A HB3  4  
ATOM 7040  H HG2  . PRO A 1 46  ? -7.441  -13.227 -0.865  1.00 0.00 ? 46  PRO A HG2  4  
ATOM 7041  H HG3  . PRO A 1 46  ? -7.712  -14.665 0.100   1.00 0.00 ? 46  PRO A HG3  4  
ATOM 7042  H HD2  . PRO A 1 46  ? -9.498  -12.442 -0.206  1.00 0.00 ? 46  PRO A HD2  4  
ATOM 7043  H HD3  . PRO A 1 46  ? -9.717  -13.825 0.848   1.00 0.00 ? 46  PRO A HD3  4  
ATOM 7044  N N    . VAL A 1 47  ? -5.612  -10.278 1.853   1.00 0.00 ? 47  VAL A N    4  
ATOM 7045  C CA   . VAL A 1 47  ? -5.061  -8.978  1.511   1.00 0.00 ? 47  VAL A CA   4  
ATOM 7046  C C    . VAL A 1 47  ? -3.895  -9.162  0.537   1.00 0.00 ? 47  VAL A C    4  
ATOM 7047  O O    . VAL A 1 47  ? -2.804  -9.562  0.939   1.00 0.00 ? 47  VAL A O    4  
ATOM 7048  C CB   . VAL A 1 47  ? -4.664  -8.227  2.783   1.00 0.00 ? 47  VAL A CB   4  
ATOM 7049  C CG1  . VAL A 1 47  ? -4.146  -6.826  2.454   1.00 0.00 ? 47  VAL A CG1  4  
ATOM 7050  C CG2  . VAL A 1 47  ? -5.832  -8.162  3.769   1.00 0.00 ? 47  VAL A CG2  4  
ATOM 7051  H H    . VAL A 1 47  ? -4.988  -10.885 2.346   1.00 0.00 ? 47  VAL A H    4  
ATOM 7052  H HA   . VAL A 1 47  ? -5.846  -8.408  1.014   1.00 0.00 ? 47  VAL A HA   4  
ATOM 7053  H HB   . VAL A 1 47  ? -3.854  -8.780  3.260   1.00 0.00 ? 47  VAL A HB   4  
ATOM 7054  H HG11 . VAL A 1 47  ? -4.372  -6.590  1.414   1.00 0.00 ? 47  VAL A HG11 4  
ATOM 7055  H HG12 . VAL A 1 47  ? -4.629  -6.097  3.105   1.00 0.00 ? 47  VAL A HG12 4  
ATOM 7056  H HG13 . VAL A 1 47  ? -3.067  -6.792  2.608   1.00 0.00 ? 47  VAL A HG13 4  
ATOM 7057  H HG21 . VAL A 1 47  ? -6.538  -7.397  3.445   1.00 0.00 ? 47  VAL A HG21 4  
ATOM 7058  H HG22 . VAL A 1 47  ? -6.334  -9.129  3.802   1.00 0.00 ? 47  VAL A HG22 4  
ATOM 7059  H HG23 . VAL A 1 47  ? -5.457  -7.913  4.761   1.00 0.00 ? 47  VAL A HG23 4  
ATOM 7060  N N    . ASN A 1 48  ? -4.166  -8.862  -0.724  1.00 0.00 ? 48  ASN A N    4  
ATOM 7061  C CA   . ASN A 1 48  ? -3.154  -8.989  -1.758  1.00 0.00 ? 48  ASN A CA   4  
ATOM 7062  C C    . ASN A 1 48  ? -2.150  -7.842  -1.627  1.00 0.00 ? 48  ASN A C    4  
ATOM 7063  O O    . ASN A 1 48  ? -0.941  -8.062  -1.680  1.00 0.00 ? 48  ASN A O    4  
ATOM 7064  C CB   . ASN A 1 48  ? -3.778  -8.914  -3.153  1.00 0.00 ? 48  ASN A CB   4  
ATOM 7065  C CG   . ASN A 1 48  ? -3.103  -9.898  -4.110  1.00 0.00 ? 48  ASN A CG   4  
ATOM 7066  O OD1  . ASN A 1 48  ? -2.220  -9.551  -4.878  1.00 0.00 ? 48  ASN A OD1  4  
ATOM 7067  N ND2  . ASN A 1 48  ? -3.565  -11.142 -4.022  1.00 0.00 ? 48  ASN A ND2  4  
ATOM 7068  H H    . ASN A 1 48  ? -5.057  -8.537  -1.043  1.00 0.00 ? 48  ASN A H    4  
ATOM 7069  H HA   . ASN A 1 48  ? -2.696  -9.965  -1.593  1.00 0.00 ? 48  ASN A HA   4  
ATOM 7070  H HB2  . ASN A 1 48  ? -4.844  -9.135  -3.091  1.00 0.00 ? 48  ASN A HB2  4  
ATOM 7071  H HB3  . ASN A 1 48  ? -3.685  -7.900  -3.543  1.00 0.00 ? 48  ASN A HB3  4  
ATOM 7072  H HD21 . ASN A 1 48  ? -4.291  -11.361 -3.370  1.00 0.00 ? 48  ASN A HD21 4  
ATOM 7073  H HD22 . ASN A 1 48  ? -3.186  -11.859 -4.607  1.00 0.00 ? 48  ASN A HD22 4  
ATOM 7074  N N    . GLU A 1 49  ? -2.688  -6.644  -1.459  1.00 0.00 ? 49  GLU A N    4  
ATOM 7075  C CA   . GLU A 1 49  ? -1.855  -5.462  -1.320  1.00 0.00 ? 49  GLU A CA   4  
ATOM 7076  C C    . GLU A 1 49  ? -2.403  -4.551  -0.219  1.00 0.00 ? 49  GLU A C    4  
ATOM 7077  O O    . GLU A 1 49  ? -3.609  -4.522  0.023   1.00 0.00 ? 49  GLU A O    4  
ATOM 7078  C CB   . GLU A 1 49  ? -1.743  -4.710  -2.648  1.00 0.00 ? 49  GLU A CB   4  
ATOM 7079  C CG   . GLU A 1 49  ? -3.123  -4.288  -3.157  1.00 0.00 ? 49  GLU A CG   4  
ATOM 7080  C CD   . GLU A 1 49  ? -3.922  -5.498  -3.643  1.00 0.00 ? 49  GLU A CD   4  
ATOM 7081  O OE1  . GLU A 1 49  ? -3.541  -6.040  -4.703  1.00 0.00 ? 49  GLU A OE1  4  
ATOM 7082  O OE2  . GLU A 1 49  ? -4.895  -5.854  -2.944  1.00 0.00 ? 49  GLU A OE2  4  
ATOM 7083  H H    . GLU A 1 49  ? -3.673  -6.474  -1.417  1.00 0.00 ? 49  GLU A H    4  
ATOM 7084  H HA   . GLU A 1 49  ? -0.870  -5.833  -1.036  1.00 0.00 ? 49  GLU A HA   4  
ATOM 7085  H HB2  . GLU A 1 49  ? -1.113  -3.829  -2.520  1.00 0.00 ? 49  GLU A HB2  4  
ATOM 7086  H HB3  . GLU A 1 49  ? -1.257  -5.344  -3.389  1.00 0.00 ? 49  GLU A HB3  4  
ATOM 7087  H HG2  . GLU A 1 49  ? -3.669  -3.783  -2.360  1.00 0.00 ? 49  GLU A HG2  4  
ATOM 7088  H HG3  . GLU A 1 49  ? -3.011  -3.571  -3.970  1.00 0.00 ? 49  GLU A HG3  4  
ATOM 7089  N N    . MET A 1 50  ? -1.492  -3.831  0.418   1.00 0.00 ? 50  MET A N    4  
ATOM 7090  C CA   . MET A 1 50  ? -1.870  -2.922  1.487   1.00 0.00 ? 50  MET A CA   4  
ATOM 7091  C C    . MET A 1 50  ? -2.045  -1.497  0.959   1.00 0.00 ? 50  MET A C    4  
ATOM 7092  O O    . MET A 1 50  ? -1.332  -1.076  0.049   1.00 0.00 ? 50  MET A O    4  
ATOM 7093  C CB   . MET A 1 50  ? -0.792  -2.936  2.573   1.00 0.00 ? 50  MET A CB   4  
ATOM 7094  C CG   . MET A 1 50  ? -1.147  -1.975  3.710   1.00 0.00 ? 50  MET A CG   4  
ATOM 7095  S SD   . MET A 1 50  ? -0.379  -2.515  5.228   1.00 0.00 ? 50  MET A SD   4  
ATOM 7096  C CE   . MET A 1 50  ? -0.462  -1.002  6.172   1.00 0.00 ? 50  MET A CE   4  
ATOM 7097  H H    . MET A 1 50  ? -0.513  -3.861  0.215   1.00 0.00 ? 50  MET A H    4  
ATOM 7098  H HA   . MET A 1 50  ? -2.821  -3.296  1.867   1.00 0.00 ? 50  MET A HA   4  
ATOM 7099  H HB2  . MET A 1 50  ? -0.681  -3.946  2.967   1.00 0.00 ? 50  MET A HB2  4  
ATOM 7100  H HB3  . MET A 1 50  ? 0.168   -2.655  2.141   1.00 0.00 ? 50  MET A HB3  4  
ATOM 7101  H HG2  . MET A 1 50  ? -0.814  -0.967  3.462   1.00 0.00 ? 50  MET A HG2  4  
ATOM 7102  H HG3  . MET A 1 50  ? -2.229  -1.932  3.835   1.00 0.00 ? 50  MET A HG3  4  
ATOM 7103  H HE1  . MET A 1 50  ? 0.447   -0.423  6.011   1.00 0.00 ? 50  MET A HE1  4  
ATOM 7104  H HE2  . MET A 1 50  ? -1.326  -0.420  5.850   1.00 0.00 ? 50  MET A HE2  4  
ATOM 7105  H HE3  . MET A 1 50  ? -0.559  -1.240  7.231   1.00 0.00 ? 50  MET A HE3  4  
ATOM 7106  N N    . LEU A 1 51  ? -2.998  -0.793  1.552   1.00 0.00 ? 51  LEU A N    4  
ATOM 7107  C CA   . LEU A 1 51  ? -3.275  0.576   1.153   1.00 0.00 ? 51  LEU A CA   4  
ATOM 7108  C C    . LEU A 1 51  ? -2.854  1.525   2.276   1.00 0.00 ? 51  LEU A C    4  
ATOM 7109  O O    . LEU A 1 51  ? -3.234  1.335   3.431   1.00 0.00 ? 51  LEU A O    4  
ATOM 7110  C CB   . LEU A 1 51  ? -4.740  0.726   0.739   1.00 0.00 ? 51  LEU A CB   4  
ATOM 7111  C CG   . LEU A 1 51  ? -5.146  0.022   -0.558  1.00 0.00 ? 51  LEU A CG   4  
ATOM 7112  C CD1  . LEU A 1 51  ? -4.042  0.134   -1.611  1.00 0.00 ? 51  LEU A CD1  4  
ATOM 7113  C CD2  . LEU A 1 51  ? -5.540  -1.432  -0.292  1.00 0.00 ? 51  LEU A CD2  4  
ATOM 7114  H H    . LEU A 1 51  ? -3.573  -1.143  2.292   1.00 0.00 ? 51  LEU A H    4  
ATOM 7115  H HA   . LEU A 1 51  ? -2.668  0.789   0.274   1.00 0.00 ? 51  LEU A HA   4  
ATOM 7116  H HB2  . LEU A 1 51  ? -5.367  0.347   1.546   1.00 0.00 ? 51  LEU A HB2  4  
ATOM 7117  H HB3  . LEU A 1 51  ? -4.961  1.789   0.636   1.00 0.00 ? 51  LEU A HB3  4  
ATOM 7118  H HG   . LEU A 1 51  ? -6.026  0.526   -0.959  1.00 0.00 ? 51  LEU A HG   4  
ATOM 7119  H HD11 . LEU A 1 51  ? -4.481  0.068   -2.607  1.00 0.00 ? 51  LEU A HD11 4  
ATOM 7120  H HD12 . LEU A 1 51  ? -3.531  1.091   -1.502  1.00 0.00 ? 51  LEU A HD12 4  
ATOM 7121  H HD13 . LEU A 1 51  ? -3.327  -0.677  -1.475  1.00 0.00 ? 51  LEU A HD13 4  
ATOM 7122  H HD21 . LEU A 1 51  ? -5.147  -2.066  -1.088  1.00 0.00 ? 51  LEU A HD21 4  
ATOM 7123  H HD22 . LEU A 1 51  ? -5.126  -1.751  0.664   1.00 0.00 ? 51  LEU A HD22 4  
ATOM 7124  H HD23 . LEU A 1 51  ? -6.626  -1.515  -0.264  1.00 0.00 ? 51  LEU A HD23 4  
ATOM 7125  N N    . PHE A 1 52  ? -2.073  2.527   1.899   1.00 0.00 ? 52  PHE A N    4  
ATOM 7126  C CA   . PHE A 1 52  ? -1.596  3.507   2.860   1.00 0.00 ? 52  PHE A CA   4  
ATOM 7127  C C    . PHE A 1 52  ? -2.268  4.864   2.639   1.00 0.00 ? 52  PHE A C    4  
ATOM 7128  O O    . PHE A 1 52  ? -1.919  5.589   1.709   1.00 0.00 ? 52  PHE A O    4  
ATOM 7129  C CB   . PHE A 1 52  ? -0.089  3.655   2.637   1.00 0.00 ? 52  PHE A CB   4  
ATOM 7130  C CG   . PHE A 1 52  ? 0.723   2.420   3.034   1.00 0.00 ? 52  PHE A CG   4  
ATOM 7131  C CD1  . PHE A 1 52  ? 0.633   1.281   2.296   1.00 0.00 ? 52  PHE A CD1  4  
ATOM 7132  C CD2  . PHE A 1 52  ? 1.534   2.462   4.125   1.00 0.00 ? 52  PHE A CD2  4  
ATOM 7133  C CE1  . PHE A 1 52  ? 1.386   0.136   2.664   1.00 0.00 ? 52  PHE A CE1  4  
ATOM 7134  C CE2  . PHE A 1 52  ? 2.287   1.316   4.493   1.00 0.00 ? 52  PHE A CE2  4  
ATOM 7135  C CZ   . PHE A 1 52  ? 2.197   0.177   3.755   1.00 0.00 ? 52  PHE A CZ   4  
ATOM 7136  H H    . PHE A 1 52  ? -1.768  2.675   0.958   1.00 0.00 ? 52  PHE A H    4  
ATOM 7137  H HA   . PHE A 1 52  ? -1.848  3.136   3.853   1.00 0.00 ? 52  PHE A HA   4  
ATOM 7138  H HB2  . PHE A 1 52  ? 0.092   3.874   1.585   1.00 0.00 ? 52  PHE A HB2  4  
ATOM 7139  H HB3  . PHE A 1 52  ? 0.270   4.512   3.207   1.00 0.00 ? 52  PHE A HB3  4  
ATOM 7140  H HD1  . PHE A 1 52  ? -0.017  1.248   1.422   1.00 0.00 ? 52  PHE A HD1  4  
ATOM 7141  H HD2  . PHE A 1 52  ? 1.605   3.374   4.716   1.00 0.00 ? 52  PHE A HD2  4  
ATOM 7142  H HE1  . PHE A 1 52  ? 1.315   -0.777  2.073   1.00 0.00 ? 52  PHE A HE1  4  
ATOM 7143  H HE2  . PHE A 1 52  ? 2.937   1.349   5.367   1.00 0.00 ? 52  PHE A HE2  4  
ATOM 7144  H HZ   . PHE A 1 52  ? 2.776   -0.703  4.038   1.00 0.00 ? 52  PHE A HZ   4  
ATOM 7145  N N    . ILE A 1 53  ? -3.219  5.166   3.511   1.00 0.00 ? 53  ILE A N    4  
ATOM 7146  C CA   . ILE A 1 53  ? -3.942  6.423   3.423   1.00 0.00 ? 53  ILE A CA   4  
ATOM 7147  C C    . ILE A 1 53  ? -2.962  7.584   3.597   1.00 0.00 ? 53  ILE A C    4  
ATOM 7148  O O    . ILE A 1 53  ? -2.254  7.659   4.601   1.00 0.00 ? 53  ILE A O    4  
ATOM 7149  C CB   . ILE A 1 53  ? -5.103  6.444   4.420   1.00 0.00 ? 53  ILE A CB   4  
ATOM 7150  C CG1  . ILE A 1 53  ? -6.210  5.477   3.993   1.00 0.00 ? 53  ILE A CG1  4  
ATOM 7151  C CG2  . ILE A 1 53  ? -5.630  7.866   4.619   1.00 0.00 ? 53  ILE A CG2  4  
ATOM 7152  C CD1  . ILE A 1 53  ? -6.647  5.747   2.552   1.00 0.00 ? 53  ILE A CD1  4  
ATOM 7153  H H    . ILE A 1 53  ? -3.496  4.570   4.265   1.00 0.00 ? 53  ILE A H    4  
ATOM 7154  H HA   . ILE A 1 53  ? -4.374  6.482   2.424   1.00 0.00 ? 53  ILE A HA   4  
ATOM 7155  H HB   . ILE A 1 53  ? -4.731  6.100   5.385   1.00 0.00 ? 53  ILE A HB   4  
ATOM 7156  H HG12 . ILE A 1 53  ? -5.855  4.450   4.083   1.00 0.00 ? 53  ILE A HG12 4  
ATOM 7157  H HG13 . ILE A 1 53  ? -7.065  5.579   4.662   1.00 0.00 ? 53  ILE A HG13 4  
ATOM 7158  H HG21 . ILE A 1 53  ? -5.228  8.276   5.545   1.00 0.00 ? 53  ILE A HG21 4  
ATOM 7159  H HG22 . ILE A 1 53  ? -5.318  8.489   3.780   1.00 0.00 ? 53  ILE A HG22 4  
ATOM 7160  H HG23 . ILE A 1 53  ? -6.718  7.846   4.672   1.00 0.00 ? 53  ILE A HG23 4  
ATOM 7161  H HD11 . ILE A 1 53  ? -5.916  5.323   1.864   1.00 0.00 ? 53  ILE A HD11 4  
ATOM 7162  H HD12 . ILE A 1 53  ? -7.620  5.287   2.376   1.00 0.00 ? 53  ILE A HD12 4  
ATOM 7163  H HD13 . ILE A 1 53  ? -6.719  6.822   2.389   1.00 0.00 ? 53  ILE A HD13 4  
ATOM 7164  N N    . ILE A 1 54  ? -2.951  8.462   2.604   1.00 0.00 ? 54  ILE A N    4  
ATOM 7165  C CA   . ILE A 1 54  ? -2.069  9.616   2.635   1.00 0.00 ? 54  ILE A CA   4  
ATOM 7166  C C    . ILE A 1 54  ? -2.871  10.855  3.039   1.00 0.00 ? 54  ILE A C    4  
ATOM 7167  O O    . ILE A 1 54  ? -2.426  11.642  3.872   1.00 0.00 ? 54  ILE A O    4  
ATOM 7168  C CB   . ILE A 1 54  ? -1.336  9.765   1.301   1.00 0.00 ? 54  ILE A CB   4  
ATOM 7169  C CG1  . ILE A 1 54  ? -0.638  8.461   0.909   1.00 0.00 ? 54  ILE A CG1  4  
ATOM 7170  C CG2  . ILE A 1 54  ? -0.363  10.946  1.338   1.00 0.00 ? 54  ILE A CG2  4  
ATOM 7171  C CD1  . ILE A 1 54  ? 0.645   8.261   1.717   1.00 0.00 ? 54  ILE A CD1  4  
ATOM 7172  H H    . ILE A 1 54  ? -3.530  8.393   1.792   1.00 0.00 ? 54  ILE A H    4  
ATOM 7173  H HA   . ILE A 1 54  ? -1.313  9.429   3.399   1.00 0.00 ? 54  ILE A HA   4  
ATOM 7174  H HB   . ILE A 1 54  ? -2.074  9.981   0.528   1.00 0.00 ? 54  ILE A HB   4  
ATOM 7175  H HG12 . ILE A 1 54  ? -1.312  7.620   1.075   1.00 0.00 ? 54  ILE A HG12 4  
ATOM 7176  H HG13 . ILE A 1 54  ? -0.403  8.476   -0.155  1.00 0.00 ? 54  ILE A HG13 4  
ATOM 7177  H HG21 . ILE A 1 54  ? 0.032   11.059  2.348   1.00 0.00 ? 54  ILE A HG21 4  
ATOM 7178  H HG22 . ILE A 1 54  ? 0.457   10.764  0.645   1.00 0.00 ? 54  ILE A HG22 4  
ATOM 7179  H HG23 . ILE A 1 54  ? -0.887  11.857  1.050   1.00 0.00 ? 54  ILE A HG23 4  
ATOM 7180  H HD11 . ILE A 1 54  ? 0.611   7.295   2.221   1.00 0.00 ? 54  ILE A HD11 4  
ATOM 7181  H HD12 . ILE A 1 54  ? 1.505   8.291   1.048   1.00 0.00 ? 54  ILE A HD12 4  
ATOM 7182  H HD13 . ILE A 1 54  ? 0.735   9.055   2.459   1.00 0.00 ? 54  ILE A HD13 4  
ATOM 7183  N N    . ARG A 1 55  ? -4.039  10.989  2.428   1.00 0.00 ? 55  ARG A N    4  
ATOM 7184  C CA   . ARG A 1 55  ? -4.907  12.118  2.713   1.00 0.00 ? 55  ARG A CA   4  
ATOM 7185  C C    . ARG A 1 55  ? -6.258  11.939  2.017   1.00 0.00 ? 55  ARG A C    4  
ATOM 7186  O O    . ARG A 1 55  ? -6.326  11.892  0.790   1.00 0.00 ? 55  ARG A O    4  
ATOM 7187  C CB   . ARG A 1 55  ? -4.273  13.431  2.250   1.00 0.00 ? 55  ARG A CB   4  
ATOM 7188  C CG   . ARG A 1 55  ? -3.941  14.331  3.442   1.00 0.00 ? 55  ARG A CG   4  
ATOM 7189  C CD   . ARG A 1 55  ? -4.708  15.653  3.361   1.00 0.00 ? 55  ARG A CD   4  
ATOM 7190  N NE   . ARG A 1 55  ? -4.119  16.638  4.295   1.00 0.00 ? 55  ARG A NE   4  
ATOM 7191  C CZ   . ARG A 1 55  ? -4.613  17.866  4.501   1.00 0.00 ? 55  ARG A CZ   4  
ATOM 7192  N NH1  . ARG A 1 55  ? -5.708  18.268  3.840   1.00 0.00 ? 55  ARG A NH1  4  
ATOM 7193  N NH2  . ARG A 1 55  ? -4.013  18.693  5.368   1.00 0.00 ? 55  ARG A NH2  4  
ATOM 7194  H H    . ARG A 1 55  ? -4.393  10.344  1.751   1.00 0.00 ? 55  ARG A H    4  
ATOM 7195  H HA   . ARG A 1 55  ? -5.021  12.116  3.797   1.00 0.00 ? 55  ARG A HA   4  
ATOM 7196  H HB2  . ARG A 1 55  ? -3.364  13.221  1.685   1.00 0.00 ? 55  ARG A HB2  4  
ATOM 7197  H HB3  . ARG A 1 55  ? -4.954  13.951  1.576   1.00 0.00 ? 55  ARG A HB3  4  
ATOM 7198  H HG2  . ARG A 1 55  ? -4.191  13.818  4.370   1.00 0.00 ? 55  ARG A HG2  4  
ATOM 7199  H HG3  . ARG A 1 55  ? -2.870  14.530  3.466   1.00 0.00 ? 55  ARG A HG3  4  
ATOM 7200  H HD2  . ARG A 1 55  ? -4.676  16.040  2.342   1.00 0.00 ? 55  ARG A HD2  4  
ATOM 7201  H HD3  . ARG A 1 55  ? -5.758  15.489  3.606   1.00 0.00 ? 55  ARG A HD3  4  
ATOM 7202  H HE   . ARG A 1 55  ? -3.301  16.370  4.804   1.00 0.00 ? 55  ARG A HE   4  
ATOM 7203  H HH11 . ARG A 1 55  ? -6.156  17.651  3.194   1.00 0.00 ? 55  ARG A HH11 4  
ATOM 7204  H HH12 . ARG A 1 55  ? -6.076  19.185  3.994   1.00 0.00 ? 55  ARG A HH12 4  
ATOM 7205  H HH21 . ARG A 1 55  ? -3.196  18.393  5.861   1.00 0.00 ? 55  ARG A HH21 4  
ATOM 7206  H HH22 . ARG A 1 55  ? -4.381  19.610  5.522   1.00 0.00 ? 55  ARG A HH22 4  
ATOM 7207  N N    . GLY A 1 56  ? -7.299  11.844  2.831   1.00 0.00 ? 56  GLY A N    4  
ATOM 7208  C CA   . GLY A 1 56  ? -8.644  11.671  2.309   1.00 0.00 ? 56  GLY A CA   4  
ATOM 7209  C C    . GLY A 1 56  ? -9.606  11.223  3.411   1.00 0.00 ? 56  GLY A C    4  
ATOM 7210  O O    . GLY A 1 56  ? -9.367  11.478  4.590   1.00 0.00 ? 56  GLY A O    4  
ATOM 7211  H H    . GLY A 1 56  ? -7.234  11.883  3.828   1.00 0.00 ? 56  GLY A H    4  
ATOM 7212  H HA2  . GLY A 1 56  ? -8.992  12.607  1.875   1.00 0.00 ? 56  GLY A HA2  4  
ATOM 7213  H HA3  . GLY A 1 56  ? -8.634  10.932  1.508   1.00 0.00 ? 56  GLY A HA3  4  
ATOM 7214  N N    . ARG A 1 57  ? -10.675 10.564  2.988   1.00 0.00 ? 57  ARG A N    4  
ATOM 7215  C CA   . ARG A 1 57  ? -11.675 10.079  3.924   1.00 0.00 ? 57  ARG A CA   4  
ATOM 7216  C C    . ARG A 1 57  ? -12.196 8.710   3.481   1.00 0.00 ? 57  ARG A C    4  
ATOM 7217  O O    . ARG A 1 57  ? -12.105 8.357   2.307   1.00 0.00 ? 57  ARG A O    4  
ATOM 7218  C CB   . ARG A 1 57  ? -12.849 11.054  4.030   1.00 0.00 ? 57  ARG A CB   4  
ATOM 7219  C CG   . ARG A 1 57  ? -13.565 10.905  5.373   1.00 0.00 ? 57  ARG A CG   4  
ATOM 7220  C CD   . ARG A 1 57  ? -13.464 12.192  6.195   1.00 0.00 ? 57  ARG A CD   4  
ATOM 7221  N NE   . ARG A 1 57  ? -14.799 12.820  6.318   1.00 0.00 ? 57  ARG A NE   4  
ATOM 7222  C CZ   . ARG A 1 57  ? -15.030 13.974  6.959   1.00 0.00 ? 57  ARG A CZ   4  
ATOM 7223  N NH1  . ARG A 1 57  ? -14.018 14.634  7.537   1.00 0.00 ? 57  ARG A NH1  4  
ATOM 7224  N NH2  . ARG A 1 57  ? -16.274 14.468  7.021   1.00 0.00 ? 57  ARG A NH2  4  
ATOM 7225  H H    . ARG A 1 57  ? -10.862 10.362  2.026   1.00 0.00 ? 57  ARG A H    4  
ATOM 7226  H HA   . ARG A 1 57  ? -11.153 10.011  4.878   1.00 0.00 ? 57  ARG A HA   4  
ATOM 7227  H HB2  . ARG A 1 57  ? -12.488 12.077  3.917   1.00 0.00 ? 57  ARG A HB2  4  
ATOM 7228  H HB3  . ARG A 1 57  ? -13.552 10.873  3.217   1.00 0.00 ? 57  ARG A HB3  4  
ATOM 7229  H HG2  . ARG A 1 57  ? -14.614 10.658  5.205   1.00 0.00 ? 57  ARG A HG2  4  
ATOM 7230  H HG3  . ARG A 1 57  ? -13.129 10.078  5.933   1.00 0.00 ? 57  ARG A HG3  4  
ATOM 7231  H HD2  . ARG A 1 57  ? -13.064 11.972  7.184   1.00 0.00 ? 57  ARG A HD2  4  
ATOM 7232  H HD3  . ARG A 1 57  ? -12.771 12.885  5.717   1.00 0.00 ? 57  ARG A HD3  4  
ATOM 7233  H HE   . ARG A 1 57  ? -15.577 12.353  5.898   1.00 0.00 ? 57  ARG A HE   4  
ATOM 7234  H HH11 . ARG A 1 57  ? -13.089 14.265  7.491   1.00 0.00 ? 57  ARG A HH11 4  
ATOM 7235  H HH12 . ARG A 1 57  ? -14.190 15.495  8.015   1.00 0.00 ? 57  ARG A HH12 4  
ATOM 7236  H HH21 . ARG A 1 57  ? -17.030 13.976  6.589   1.00 0.00 ? 57  ARG A HH21 4  
ATOM 7237  H HH22 . ARG A 1 57  ? -16.447 15.329  7.499   1.00 0.00 ? 57  ARG A HH22 4  
ATOM 7238  N N    . LEU A 1 58  ? -12.730 7.976   4.446   1.00 0.00 ? 58  LEU A N    4  
ATOM 7239  C CA   . LEU A 1 58  ? -13.266 6.654   4.171   1.00 0.00 ? 58  LEU A CA   4  
ATOM 7240  C C    . LEU A 1 58  ? -14.268 6.277   5.264   1.00 0.00 ? 58  LEU A C    4  
ATOM 7241  O O    . LEU A 1 58  ? -14.393 6.980   6.266   1.00 0.00 ? 58  LEU A O    4  
ATOM 7242  C CB   . LEU A 1 58  ? -12.132 5.641   4.001   1.00 0.00 ? 58  LEU A CB   4  
ATOM 7243  C CG   . LEU A 1 58  ? -11.409 5.664   2.653   1.00 0.00 ? 58  LEU A CG   4  
ATOM 7244  C CD1  . LEU A 1 58  ? -10.087 6.427   2.752   1.00 0.00 ? 58  LEU A CD1  4  
ATOM 7245  C CD2  . LEU A 1 58  ? -11.213 4.246   2.111   1.00 0.00 ? 58  LEU A CD2  4  
ATOM 7246  H H    . LEU A 1 58  ? -12.800 8.271   5.399   1.00 0.00 ? 58  LEU A H    4  
ATOM 7247  H HA   . LEU A 1 58  ? -13.796 6.707   3.220   1.00 0.00 ? 58  LEU A HA   4  
ATOM 7248  H HB2  . LEU A 1 58  ? -11.397 5.813   4.788   1.00 0.00 ? 58  LEU A HB2  4  
ATOM 7249  H HB3  . LEU A 1 58  ? -12.538 4.641   4.156   1.00 0.00 ? 58  LEU A HB3  4  
ATOM 7250  H HG   . LEU A 1 58  ? -12.035 6.198   1.938   1.00 0.00 ? 58  LEU A HG   4  
ATOM 7251  H HD11 . LEU A 1 58  ? -10.240 7.347   3.317   1.00 0.00 ? 58  LEU A HD11 4  
ATOM 7252  H HD12 . LEU A 1 58  ? -9.347  5.808   3.260   1.00 0.00 ? 58  LEU A HD12 4  
ATOM 7253  H HD13 . LEU A 1 58  ? -9.731  6.671   1.751   1.00 0.00 ? 58  LEU A HD13 4  
ATOM 7254  H HD21 . LEU A 1 58  ? -10.646 4.288   1.182   1.00 0.00 ? 58  LEU A HD21 4  
ATOM 7255  H HD22 . LEU A 1 58  ? -10.668 3.650   2.843   1.00 0.00 ? 58  LEU A HD22 4  
ATOM 7256  H HD23 . LEU A 1 58  ? -12.186 3.792   1.924   1.00 0.00 ? 58  LEU A HD23 4  
ATOM 7257  N N    . GLU A 1 59  ? -14.957 5.168   5.034   1.00 0.00 ? 59  GLU A N    4  
ATOM 7258  C CA   . GLU A 1 59  ? -15.944 4.690   5.987   1.00 0.00 ? 59  GLU A CA   4  
ATOM 7259  C C    . GLU A 1 59  ? -15.580 3.283   6.466   1.00 0.00 ? 59  GLU A C    4  
ATOM 7260  O O    . GLU A 1 59  ? -15.533 2.345   5.671   1.00 0.00 ? 59  GLU A O    4  
ATOM 7261  C CB   . GLU A 1 59  ? -17.348 4.717   5.381   1.00 0.00 ? 59  GLU A CB   4  
ATOM 7262  C CG   . GLU A 1 59  ? -17.629 3.437   4.590   1.00 0.00 ? 59  GLU A CG   4  
ATOM 7263  C CD   . GLU A 1 59  ? -18.944 3.549   3.815   1.00 0.00 ? 59  GLU A CD   4  
ATOM 7264  O OE1  . GLU A 1 59  ? -19.959 3.881   4.464   1.00 0.00 ? 59  GLU A OE1  4  
ATOM 7265  O OE2  . GLU A 1 59  ? -18.904 3.300   2.591   1.00 0.00 ? 59  GLU A OE2  4  
ATOM 7266  H H    . GLU A 1 59  ? -14.849 4.603   4.217   1.00 0.00 ? 59  GLU A H    4  
ATOM 7267  H HA   . GLU A 1 59  ? -15.902 5.388   6.823   1.00 0.00 ? 59  GLU A HA   4  
ATOM 7268  H HB2  . GLU A 1 59  ? -18.088 4.829   6.173   1.00 0.00 ? 59  GLU A HB2  4  
ATOM 7269  H HB3  . GLU A 1 59  ? -17.450 5.582   4.726   1.00 0.00 ? 59  GLU A HB3  4  
ATOM 7270  H HG2  . GLU A 1 59  ? -16.810 3.246   3.898   1.00 0.00 ? 59  GLU A HG2  4  
ATOM 7271  H HG3  . GLU A 1 59  ? -17.676 2.588   5.271   1.00 0.00 ? 59  GLU A HG3  4  
ATOM 7272  N N    . SER A 1 60  ? -15.333 3.179   7.763   1.00 0.00 ? 60  SER A N    4  
ATOM 7273  C CA   . SER A 1 60  ? -14.976 1.903   8.358   1.00 0.00 ? 60  SER A CA   4  
ATOM 7274  C C    . SER A 1 60  ? -16.221 1.229   8.938   1.00 0.00 ? 60  SER A C    4  
ATOM 7275  O O    . SER A 1 60  ? -17.000 1.862   9.648   1.00 0.00 ? 60  SER A O    4  
ATOM 7276  C CB   . SER A 1 60  ? -13.913 2.079   9.444   1.00 0.00 ? 60  SER A CB   4  
ATOM 7277  O OG   . SER A 1 60  ? -13.856 0.959   10.322  1.00 0.00 ? 60  SER A OG   4  
ATOM 7278  H H    . SER A 1 60  ? -15.374 3.947   8.403   1.00 0.00 ? 60  SER A H    4  
ATOM 7279  H HA   . SER A 1 60  ? -14.565 1.309   7.541   1.00 0.00 ? 60  SER A HA   4  
ATOM 7280  H HB2  . SER A 1 60  ? -12.938 2.224   8.977   1.00 0.00 ? 60  SER A HB2  4  
ATOM 7281  H HB3  . SER A 1 60  ? -14.128 2.980   10.019  1.00 0.00 ? 60  SER A HB3  4  
ATOM 7282  H HG   . SER A 1 60  ? -13.931 0.110   9.799   1.00 0.00 ? 60  SER A HG   4  
ATOM 7283  N N    . VAL A 1 61  ? -16.369 -0.048  8.614   1.00 0.00 ? 61  VAL A N    4  
ATOM 7284  C CA   . VAL A 1 61  ? -17.506 -0.815  9.095   1.00 0.00 ? 61  VAL A CA   4  
ATOM 7285  C C    . VAL A 1 61  ? -17.036 -2.211  9.508   1.00 0.00 ? 61  VAL A C    4  
ATOM 7286  O O    . VAL A 1 61  ? -16.043 -2.715  8.985   1.00 0.00 ? 61  VAL A O    4  
ATOM 7287  C CB   . VAL A 1 61  ? -18.604 -0.844  8.030   1.00 0.00 ? 61  VAL A CB   4  
ATOM 7288  C CG1  . VAL A 1 61  ? -19.476 -2.093  8.176   1.00 0.00 ? 61  VAL A CG1  4  
ATOM 7289  C CG2  . VAL A 1 61  ? -19.454 0.427   8.083   1.00 0.00 ? 61  VAL A CG2  4  
ATOM 7290  H H    . VAL A 1 61  ? -15.730 -0.556  8.036   1.00 0.00 ? 61  VAL A H    4  
ATOM 7291  H HA   . VAL A 1 61  ? -17.900 -0.303  9.973   1.00 0.00 ? 61  VAL A HA   4  
ATOM 7292  H HB   . VAL A 1 61  ? -18.123 -0.884  7.053   1.00 0.00 ? 61  VAL A HB   4  
ATOM 7293  H HG11 . VAL A 1 61  ? -19.807 -2.186  9.211   1.00 0.00 ? 61  VAL A HG11 4  
ATOM 7294  H HG12 . VAL A 1 61  ? -20.344 -2.008  7.523   1.00 0.00 ? 61  VAL A HG12 4  
ATOM 7295  H HG13 . VAL A 1 61  ? -18.897 -2.974  7.900   1.00 0.00 ? 61  VAL A HG13 4  
ATOM 7296  H HG21 . VAL A 1 61  ? -20.014 0.451   9.018   1.00 0.00 ? 61  VAL A HG21 4  
ATOM 7297  H HG22 . VAL A 1 61  ? -18.804 1.301   8.027   1.00 0.00 ? 61  VAL A HG22 4  
ATOM 7298  H HG23 . VAL A 1 61  ? -20.148 0.436   7.243   1.00 0.00 ? 61  VAL A HG23 4  
ATOM 7299  N N    . THR A 1 62  ? -17.771 -2.796  10.441  1.00 0.00 ? 62  THR A N    4  
ATOM 7300  C CA   . THR A 1 62  ? -17.442 -4.124  10.931  1.00 0.00 ? 62  THR A CA   4  
ATOM 7301  C C    . THR A 1 62  ? -18.641 -5.061  10.776  1.00 0.00 ? 62  THR A C    4  
ATOM 7302  O O    . THR A 1 62  ? -19.775 -4.606  10.632  1.00 0.00 ? 62  THR A O    4  
ATOM 7303  C CB   . THR A 1 62  ? -16.958 -3.989  12.376  1.00 0.00 ? 62  THR A CB   4  
ATOM 7304  O OG1  . THR A 1 62  ? -16.643 -5.324  12.762  1.00 0.00 ? 62  THR A OG1  4  
ATOM 7305  C CG2  . THR A 1 62  ? -18.080 -3.579  13.333  1.00 0.00 ? 62  THR A CG2  4  
ATOM 7306  H H    . THR A 1 62  ? -18.577 -2.379  10.861  1.00 0.00 ? 62  THR A H    4  
ATOM 7307  H HA   . THR A 1 62  ? -16.639 -4.528  10.314  1.00 0.00 ? 62  THR A HA   4  
ATOM 7308  H HB   . THR A 1 62  ? -16.118 -3.298  12.442  1.00 0.00 ? 62  THR A HB   4  
ATOM 7309  H HG1  . THR A 1 62  ? -15.659 -5.480  12.680  1.00 0.00 ? 62  THR A HG1  4  
ATOM 7310  H HG21 . THR A 1 62  ? -18.250 -2.505  13.253  1.00 0.00 ? 62  THR A HG21 4  
ATOM 7311  H HG22 . THR A 1 62  ? -18.993 -4.112  13.072  1.00 0.00 ? 62  THR A HG22 4  
ATOM 7312  H HG23 . THR A 1 62  ? -17.793 -3.826  14.355  1.00 0.00 ? 62  THR A HG23 4  
ATOM 7313  N N    . THR A 1 63  ? -18.350 -6.353  10.812  1.00 0.00 ? 63  THR A N    4  
ATOM 7314  C CA   . THR A 1 63  ? -19.390 -7.359  10.678  1.00 0.00 ? 63  THR A CA   4  
ATOM 7315  C C    . THR A 1 63  ? -19.401 -8.282  11.898  1.00 0.00 ? 63  THR A C    4  
ATOM 7316  O O    . THR A 1 63  ? -20.445 -8.492  12.513  1.00 0.00 ? 63  THR A O    4  
ATOM 7317  C CB   . THR A 1 63  ? -19.165 -8.099  9.358   1.00 0.00 ? 63  THR A CB   4  
ATOM 7318  O OG1  . THR A 1 63  ? -17.982 -8.860  9.584   1.00 0.00 ? 63  THR A OG1  4  
ATOM 7319  C CG2  . THR A 1 63  ? -18.788 -7.155  8.214   1.00 0.00 ? 63  THR A CG2  4  
ATOM 7320  H H    . THR A 1 63  ? -17.425 -6.715  10.929  1.00 0.00 ? 63  THR A H    4  
ATOM 7321  H HA   . THR A 1 63  ? -20.356 -6.853  10.651  1.00 0.00 ? 63  THR A HA   4  
ATOM 7322  H HB   . THR A 1 63  ? -20.035 -8.701  9.095   1.00 0.00 ? 63  THR A HB   4  
ATOM 7323  H HG1  . THR A 1 63  ? -17.206 -8.249  9.740   1.00 0.00 ? 63  THR A HG1  4  
ATOM 7324  H HG21 . THR A 1 63  ? -17.906 -6.579  8.494   1.00 0.00 ? 63  THR A HG21 4  
ATOM 7325  H HG22 . THR A 1 63  ? -18.572 -7.738  7.318   1.00 0.00 ? 63  THR A HG22 4  
ATOM 7326  H HG23 . THR A 1 63  ? -19.617 -6.476  8.015   1.00 0.00 ? 63  THR A HG23 4  
ATOM 7327  N N    . ASP A 1 64  ? -18.226 -8.808  12.212  1.00 0.00 ? 64  ASP A N    4  
ATOM 7328  C CA   . ASP A 1 64  ? -18.086 -9.703  13.347  1.00 0.00 ? 64  ASP A CA   4  
ATOM 7329  C C    . ASP A 1 64  ? -18.185 -8.896  14.643  1.00 0.00 ? 64  ASP A C    4  
ATOM 7330  O O    . ASP A 1 64  ? -17.177 -8.412  15.156  1.00 0.00 ? 64  ASP A O    4  
ATOM 7331  C CB   . ASP A 1 64  ? -16.727 -10.406 13.331  1.00 0.00 ? 64  ASP A CB   4  
ATOM 7332  C CG   . ASP A 1 64  ? -16.523 -11.445 14.435  1.00 0.00 ? 64  ASP A CG   4  
ATOM 7333  O OD1  . ASP A 1 64  ? -17.270 -12.447 14.417  1.00 0.00 ? 64  ASP A OD1  4  
ATOM 7334  O OD2  . ASP A 1 64  ? -15.625 -11.214 15.273  1.00 0.00 ? 64  ASP A OD2  4  
ATOM 7335  H H    . ASP A 1 64  ? -17.381 -8.632  11.706  1.00 0.00 ? 64  ASP A H    4  
ATOM 7336  H HA   . ASP A 1 64  ? -18.896 -10.426 13.243  1.00 0.00 ? 64  ASP A HA   4  
ATOM 7337  H HB2  . ASP A 1 64  ? -16.600 -10.895 12.365  1.00 0.00 ? 64  ASP A HB2  4  
ATOM 7338  H HB3  . ASP A 1 64  ? -15.944 -9.652  13.413  1.00 0.00 ? 64  ASP A HB3  4  
ATOM 7339  N N    . GLY A 1 65  ? -19.409 -8.775  15.136  1.00 0.00 ? 65  GLY A N    4  
ATOM 7340  C CA   . GLY A 1 65  ? -19.653 -8.035  16.362  1.00 0.00 ? 65  GLY A CA   4  
ATOM 7341  C C    . GLY A 1 65  ? -20.514 -8.847  17.331  1.00 0.00 ? 65  GLY A C    4  
ATOM 7342  O O    . GLY A 1 65  ? -21.723 -8.969  17.140  1.00 0.00 ? 65  GLY A O    4  
ATOM 7343  H H    . GLY A 1 65  ? -20.224 -9.172  14.712  1.00 0.00 ? 65  GLY A H    4  
ATOM 7344  H HA2  . GLY A 1 65  ? -18.703 -7.785  16.835  1.00 0.00 ? 65  GLY A HA2  4  
ATOM 7345  H HA3  . GLY A 1 65  ? -20.150 -7.093  16.129  1.00 0.00 ? 65  GLY A HA3  4  
ATOM 7346  N N    . GLY A 1 66  ? -19.857 -9.382  18.350  1.00 0.00 ? 66  GLY A N    4  
ATOM 7347  C CA   . GLY A 1 66  ? -20.548 -10.179 19.350  1.00 0.00 ? 66  GLY A CA   4  
ATOM 7348  C C    . GLY A 1 66  ? -21.092 -11.472 18.739  1.00 0.00 ? 66  GLY A C    4  
ATOM 7349  O O    . GLY A 1 66  ? -20.372 -12.463 18.629  1.00 0.00 ? 66  GLY A O    4  
ATOM 7350  H H    . GLY A 1 66  ? -18.874 -9.278  18.498  1.00 0.00 ? 66  GLY A H    4  
ATOM 7351  H HA2  . GLY A 1 66  ? -19.865 -10.417 20.165  1.00 0.00 ? 66  GLY A HA2  4  
ATOM 7352  H HA3  . GLY A 1 66  ? -21.367 -9.602  19.778  1.00 0.00 ? 66  GLY A HA3  4  
ATOM 7353  N N    . ARG A 1 67  ? -22.360 -11.420 18.358  1.00 0.00 ? 67  ARG A N    4  
ATOM 7354  C CA   . ARG A 1 67  ? -23.010 -12.575 17.762  1.00 0.00 ? 67  ARG A CA   4  
ATOM 7355  C C    . ARG A 1 67  ? -24.062 -12.126 16.745  1.00 0.00 ? 67  ARG A C    4  
ATOM 7356  O O    . ARG A 1 67  ? -24.029 -12.541 15.588  1.00 0.00 ? 67  ARG A O    4  
ATOM 7357  C CB   . ARG A 1 67  ? -23.680 -13.443 18.829  1.00 0.00 ? 67  ARG A CB   4  
ATOM 7358  C CG   . ARG A 1 67  ? -23.084 -14.852 18.843  1.00 0.00 ? 67  ARG A CG   4  
ATOM 7359  C CD   . ARG A 1 67  ? -24.183 -15.913 18.761  1.00 0.00 ? 67  ARG A CD   4  
ATOM 7360  N NE   . ARG A 1 67  ? -23.586 -17.241 18.497  1.00 0.00 ? 67  ARG A NE   4  
ATOM 7361  C CZ   . ARG A 1 67  ? -23.087 -18.043 19.448  1.00 0.00 ? 67  ARG A CZ   4  
ATOM 7362  N NH1  . ARG A 1 67  ? -23.111 -17.657 20.731  1.00 0.00 ? 67  ARG A NH1  4  
ATOM 7363  N NH2  . ARG A 1 67  ? -22.565 -19.232 19.116  1.00 0.00 ? 67  ARG A NH2  4  
ATOM 7364  H H    . ARG A 1 67  ? -22.940 -10.611 18.451  1.00 0.00 ? 67  ARG A H    4  
ATOM 7365  H HA   . ARG A 1 67  ? -22.206 -13.127 17.276  1.00 0.00 ? 67  ARG A HA   4  
ATOM 7366  H HB2  . ARG A 1 67  ? -23.555 -12.981 19.809  1.00 0.00 ? 67  ARG A HB2  4  
ATOM 7367  H HB3  . ARG A 1 67  ? -24.751 -13.499 18.637  1.00 0.00 ? 67  ARG A HB3  4  
ATOM 7368  H HG2  . ARG A 1 67  ? -22.397 -14.969 18.005  1.00 0.00 ? 67  ARG A HG2  4  
ATOM 7369  H HG3  . ARG A 1 67  ? -22.502 -14.995 19.754  1.00 0.00 ? 67  ARG A HG3  4  
ATOM 7370  H HD2  . ARG A 1 67  ? -24.747 -15.937 19.694  1.00 0.00 ? 67  ARG A HD2  4  
ATOM 7371  H HD3  . ARG A 1 67  ? -24.888 -15.658 17.969  1.00 0.00 ? 67  ARG A HD3  4  
ATOM 7372  H HE   . ARG A 1 67  ? -23.552 -17.560 17.550  1.00 0.00 ? 67  ARG A HE   4  
ATOM 7373  H HH11 . ARG A 1 67  ? -23.501 -16.770 20.978  1.00 0.00 ? 67  ARG A HH11 4  
ATOM 7374  H HH12 . ARG A 1 67  ? -22.739 -18.255 21.440  1.00 0.00 ? 67  ARG A HH12 4  
ATOM 7375  H HH21 . ARG A 1 67  ? -22.547 -19.520 18.158  1.00 0.00 ? 67  ARG A HH21 4  
ATOM 7376  H HH22 . ARG A 1 67  ? -22.193 -19.830 19.825  1.00 0.00 ? 67  ARG A HH22 4  
ATOM 7377  N N    . SER A 1 68  ? -24.971 -11.284 17.215  1.00 0.00 ? 68  SER A N    4  
ATOM 7378  C CA   . SER A 1 68  ? -26.030 -10.774 16.362  1.00 0.00 ? 68  SER A CA   4  
ATOM 7379  C C    . SER A 1 68  ? -26.295 -9.301  16.679  1.00 0.00 ? 68  SER A C    4  
ATOM 7380  O O    . SER A 1 68  ? -26.060 -8.852  17.800  1.00 0.00 ? 68  SER A O    4  
ATOM 7381  C CB   . SER A 1 68  ? -27.313 -11.591 16.528  1.00 0.00 ? 68  SER A CB   4  
ATOM 7382  O OG   . SER A 1 68  ? -27.509 -12.503 15.451  1.00 0.00 ? 68  SER A OG   4  
ATOM 7383  H H    . SER A 1 68  ? -24.990 -10.951 18.158  1.00 0.00 ? 68  SER A H    4  
ATOM 7384  H HA   . SER A 1 68  ? -25.659 -10.885 15.343  1.00 0.00 ? 68  SER A HA   4  
ATOM 7385  H HB2  . SER A 1 68  ? -27.272 -12.144 17.467  1.00 0.00 ? 68  SER A HB2  4  
ATOM 7386  H HB3  . SER A 1 68  ? -28.167 -10.917 16.592  1.00 0.00 ? 68  SER A HB3  4  
ATOM 7387  H HG   . SER A 1 68  ? -28.107 -13.250 15.739  1.00 0.00 ? 68  SER A HG   4  
ATOM 7388  N N    . GLY A 1 69  ? -26.780 -8.589  15.672  1.00 0.00 ? 69  GLY A N    4  
ATOM 7389  C CA   . GLY A 1 69  ? -27.079 -7.176  15.830  1.00 0.00 ? 69  GLY A CA   4  
ATOM 7390  C C    . GLY A 1 69  ? -26.805 -6.410  14.535  1.00 0.00 ? 69  GLY A C    4  
ATOM 7391  O O    . GLY A 1 69  ? -26.610 -7.014  13.481  1.00 0.00 ? 69  GLY A O    4  
ATOM 7392  H H    . GLY A 1 69  ? -26.968 -8.962  14.764  1.00 0.00 ? 69  GLY A H    4  
ATOM 7393  H HA2  . GLY A 1 69  ? -28.123 -7.051  16.117  1.00 0.00 ? 69  GLY A HA2  4  
ATOM 7394  H HA3  . GLY A 1 69  ? -26.475 -6.761  16.637  1.00 0.00 ? 69  GLY A HA3  4  
ATOM 7395  N N    . PHE A 1 70  ? -26.798 -5.090  14.655  1.00 0.00 ? 70  PHE A N    4  
ATOM 7396  C CA   . PHE A 1 70  ? -26.551 -4.235  13.507  1.00 0.00 ? 70  PHE A CA   4  
ATOM 7397  C C    . PHE A 1 70  ? -25.055 -3.958  13.341  1.00 0.00 ? 70  PHE A C    4  
ATOM 7398  O O    . PHE A 1 70  ? -24.256 -4.309  14.207  1.00 0.00 ? 70  PHE A O    4  
ATOM 7399  C CB   . PHE A 1 70  ? -27.276 -2.914  13.769  1.00 0.00 ? 70  PHE A CB   4  
ATOM 7400  C CG   . PHE A 1 70  ? -28.300 -2.541  12.695  1.00 0.00 ? 70  PHE A CG   4  
ATOM 7401  C CD1  . PHE A 1 70  ? -27.903 -1.865  11.583  1.00 0.00 ? 70  PHE A CD1  4  
ATOM 7402  C CD2  . PHE A 1 70  ? -29.606 -2.887  12.851  1.00 0.00 ? 70  PHE A CD2  4  
ATOM 7403  C CE1  . PHE A 1 70  ? -28.853 -1.520  10.586  1.00 0.00 ? 70  PHE A CE1  4  
ATOM 7404  C CE2  . PHE A 1 70  ? -30.556 -2.541  11.853  1.00 0.00 ? 70  PHE A CE2  4  
ATOM 7405  C CZ   . PHE A 1 70  ? -30.159 -1.865  10.742  1.00 0.00 ? 70  PHE A CZ   4  
ATOM 7406  H H    . PHE A 1 70  ? -26.957 -4.607  15.516  1.00 0.00 ? 70  PHE A H    4  
ATOM 7407  H HA   . PHE A 1 70  ? -26.921 -4.760  12.627  1.00 0.00 ? 70  PHE A HA   4  
ATOM 7408  H HB2  . PHE A 1 70  ? -27.782 -2.973  14.733  1.00 0.00 ? 70  PHE A HB2  4  
ATOM 7409  H HB3  . PHE A 1 70  ? -26.538 -2.115  13.846  1.00 0.00 ? 70  PHE A HB3  4  
ATOM 7410  H HD1  . PHE A 1 70  ? -26.856 -1.588  11.458  1.00 0.00 ? 70  PHE A HD1  4  
ATOM 7411  H HD2  . PHE A 1 70  ? -29.924 -3.429  13.741  1.00 0.00 ? 70  PHE A HD2  4  
ATOM 7412  H HE1  . PHE A 1 70  ? -28.535 -0.978  9.695   1.00 0.00 ? 70  PHE A HE1  4  
ATOM 7413  H HE2  . PHE A 1 70  ? -31.602 -2.818  11.978  1.00 0.00 ? 70  PHE A HE2  4  
ATOM 7414  H HZ   . PHE A 1 70  ? -30.888 -1.600  9.976   1.00 0.00 ? 70  PHE A HZ   4  
ATOM 7415  N N    . TYR A 1 71  ? -24.723 -3.330  12.223  1.00 0.00 ? 71  TYR A N    4  
ATOM 7416  C CA   . TYR A 1 71  ? -23.338 -3.002  11.932  1.00 0.00 ? 71  TYR A CA   4  
ATOM 7417  C C    . TYR A 1 71  ? -22.932 -1.689  12.606  1.00 0.00 ? 71  TYR A C    4  
ATOM 7418  O O    . TYR A 1 71  ? -23.671 -0.707  12.555  1.00 0.00 ? 71  TYR A O    4  
ATOM 7419  C CB   . TYR A 1 71  ? -23.255 -2.829  10.414  1.00 0.00 ? 71  TYR A CB   4  
ATOM 7420  C CG   . TYR A 1 71  ? -23.167 -4.147  9.642   1.00 0.00 ? 71  TYR A CG   4  
ATOM 7421  C CD1  . TYR A 1 71  ? -24.059 -5.166  9.912   1.00 0.00 ? 71  TYR A CD1  4  
ATOM 7422  C CD2  . TYR A 1 71  ? -22.197 -4.318  8.675   1.00 0.00 ? 71  TYR A CD2  4  
ATOM 7423  C CE1  . TYR A 1 71  ? -23.977 -6.406  9.186   1.00 0.00 ? 71  TYR A CE1  4  
ATOM 7424  C CE2  . TYR A 1 71  ? -22.115 -5.558  7.948   1.00 0.00 ? 71  TYR A CE2  4  
ATOM 7425  C CZ   . TYR A 1 71  ? -23.009 -6.541  8.240   1.00 0.00 ? 71  TYR A CZ   4  
ATOM 7426  O OH   . TYR A 1 71  ? -22.931 -7.713  7.553   1.00 0.00 ? 71  TYR A OH   4  
ATOM 7427  H H    . TYR A 1 71  ? -25.380 -3.048  11.524  1.00 0.00 ? 71  TYR A H    4  
ATOM 7428  H HA   . TYR A 1 71  ? -22.713 -3.807  12.318  1.00 0.00 ? 71  TYR A HA   4  
ATOM 7429  H HB2  . TYR A 1 71  ? -24.130 -2.278  10.073  1.00 0.00 ? 71  TYR A HB2  4  
ATOM 7430  H HB3  . TYR A 1 71  ? -22.382 -2.222  10.175  1.00 0.00 ? 71  TYR A HB3  4  
ATOM 7431  H HD1  . TYR A 1 71  ? -24.825 -5.031  10.676  1.00 0.00 ? 71  TYR A HD1  4  
ATOM 7432  H HD2  . TYR A 1 71  ? -21.493 -3.513  8.462   1.00 0.00 ? 71  TYR A HD2  4  
ATOM 7433  H HE1  . TYR A 1 71  ? -24.674 -7.219  9.389   1.00 0.00 ? 71  TYR A HE1  4  
ATOM 7434  H HE2  . TYR A 1 71  ? -21.354 -5.706  7.182   1.00 0.00 ? 71  TYR A HE2  4  
ATOM 7435  H HH   . TYR A 1 71  ? -21.977 -7.920  7.337   1.00 0.00 ? 71  TYR A HH   4  
ATOM 7436  N N    . ASN A 1 72  ? -21.759 -1.715  13.221  1.00 0.00 ? 72  ASN A N    4  
ATOM 7437  C CA   . ASN A 1 72  ? -21.247 -0.539  13.904  1.00 0.00 ? 72  ASN A CA   4  
ATOM 7438  C C    . ASN A 1 72  ? -20.442 0.309   12.917  1.00 0.00 ? 72  ASN A C    4  
ATOM 7439  O O    . ASN A 1 72  ? -19.274 0.025   12.658  1.00 0.00 ? 72  ASN A O    4  
ATOM 7440  C CB   . ASN A 1 72  ? -20.320 -0.931  15.056  1.00 0.00 ? 72  ASN A CB   4  
ATOM 7441  C CG   . ASN A 1 72  ? -21.032 -0.797  16.403  1.00 0.00 ? 72  ASN A CG   4  
ATOM 7442  O OD1  . ASN A 1 72  ? -22.091 -0.203  16.518  1.00 0.00 ? 72  ASN A OD1  4  
ATOM 7443  N ND2  . ASN A 1 72  ? -20.393 -1.381  17.413  1.00 0.00 ? 72  ASN A ND2  4  
ATOM 7444  H H    . ASN A 1 72  ? -21.165 -2.517  13.258  1.00 0.00 ? 72  ASN A H    4  
ATOM 7445  H HA   . ASN A 1 72  ? -22.128 -0.018  14.279  1.00 0.00 ? 72  ASN A HA   4  
ATOM 7446  H HB2  . ASN A 1 72  ? -19.980 -1.958  14.920  1.00 0.00 ? 72  ASN A HB2  4  
ATOM 7447  H HB3  . ASN A 1 72  ? -19.432 -0.298  15.045  1.00 0.00 ? 72  ASN A HB3  4  
ATOM 7448  H HD21 . ASN A 1 72  ? -19.526 -1.853  17.251  1.00 0.00 ? 72  ASN A HD21 4  
ATOM 7449  H HD22 . ASN A 1 72  ? -20.780 -1.348  18.335  1.00 0.00 ? 72  ASN A HD22 4  
ATOM 7450  N N    . ARG A 1 73  ? -21.100 1.332   12.391  1.00 0.00 ? 73  ARG A N    4  
ATOM 7451  C CA   . ARG A 1 73  ? -20.460 2.223   11.438  1.00 0.00 ? 73  ARG A CA   4  
ATOM 7452  C C    . ARG A 1 73  ? -19.450 3.126   12.150  1.00 0.00 ? 73  ARG A C    4  
ATOM 7453  O O    . ARG A 1 73  ? -19.623 3.452   13.323  1.00 0.00 ? 73  ARG A O    4  
ATOM 7454  C CB   . ARG A 1 73  ? -21.492 3.093   10.718  1.00 0.00 ? 73  ARG A CB   4  
ATOM 7455  C CG   . ARG A 1 73  ? -21.820 2.524   9.336   1.00 0.00 ? 73  ARG A CG   4  
ATOM 7456  C CD   . ARG A 1 73  ? -22.749 1.313   9.448   1.00 0.00 ? 73  ARG A CD   4  
ATOM 7457  N NE   . ARG A 1 73  ? -22.814 0.604   8.150   1.00 0.00 ? 73  ARG A NE   4  
ATOM 7458  C CZ   . ARG A 1 73  ? -23.826 -0.192  7.779   1.00 0.00 ? 73  ARG A CZ   4  
ATOM 7459  N NH1  . ARG A 1 73  ? -24.864 -0.385  8.604   1.00 0.00 ? 73  ARG A NH1  4  
ATOM 7460  N NH2  . ARG A 1 73  ? -23.801 -0.794  6.582   1.00 0.00 ? 73  ARG A NH2  4  
ATOM 7461  H H    . ARG A 1 73  ? -22.050 1.556   12.607  1.00 0.00 ? 73  ARG A H    4  
ATOM 7462  H HA   . ARG A 1 73  ? -19.963 1.561   10.729  1.00 0.00 ? 73  ARG A HA   4  
ATOM 7463  H HB2  . ARG A 1 73  ? -22.402 3.153   11.316  1.00 0.00 ? 73  ARG A HB2  4  
ATOM 7464  H HB3  . ARG A 1 73  ? -21.110 4.108   10.616  1.00 0.00 ? 73  ARG A HB3  4  
ATOM 7465  H HG2  . ARG A 1 73  ? -22.292 3.293   8.725   1.00 0.00 ? 73  ARG A HG2  4  
ATOM 7466  H HG3  . ARG A 1 73  ? -20.899 2.235   8.830   1.00 0.00 ? 73  ARG A HG3  4  
ATOM 7467  H HD2  . ARG A 1 73  ? -22.387 0.637   10.222  1.00 0.00 ? 73  ARG A HD2  4  
ATOM 7468  H HD3  . ARG A 1 73  ? -23.746 1.635   9.746   1.00 0.00 ? 73  ARG A HD3  4  
ATOM 7469  H HE   . ARG A 1 73  ? -22.055 0.727   7.510   1.00 0.00 ? 73  ARG A HE   4  
ATOM 7470  H HH11 . ARG A 1 73  ? -24.883 0.064   9.497   1.00 0.00 ? 73  ARG A HH11 4  
ATOM 7471  H HH12 . ARG A 1 73  ? -25.619 -0.979  8.327   1.00 0.00 ? 73  ARG A HH12 4  
ATOM 7472  H HH21 . ARG A 1 73  ? -23.026 -0.650  5.966   1.00 0.00 ? 73  ARG A HH21 4  
ATOM 7473  H HH22 . ARG A 1 73  ? -24.556 -1.388  6.305   1.00 0.00 ? 73  ARG A HH22 4  
ATOM 7474  N N    . SER A 1 74  ? -18.418 3.504   11.410  1.00 0.00 ? 74  SER A N    4  
ATOM 7475  C CA   . SER A 1 74  ? -17.381 4.362   11.956  1.00 0.00 ? 74  SER A CA   4  
ATOM 7476  C C    . SER A 1 74  ? -16.659 5.095   10.824  1.00 0.00 ? 74  SER A C    4  
ATOM 7477  O O    . SER A 1 74  ? -16.862 4.787   9.651   1.00 0.00 ? 74  SER A O    4  
ATOM 7478  C CB   . SER A 1 74  ? -16.382 3.557   12.790  1.00 0.00 ? 74  SER A CB   4  
ATOM 7479  O OG   . SER A 1 74  ? -15.986 2.356   12.134  1.00 0.00 ? 74  SER A OG   4  
ATOM 7480  H H    . SER A 1 74  ? -18.285 3.234   10.457  1.00 0.00 ? 74  SER A H    4  
ATOM 7481  H HA   . SER A 1 74  ? -17.902 5.071   12.599  1.00 0.00 ? 74  SER A HA   4  
ATOM 7482  H HB2  . SER A 1 74  ? -15.501 4.168   12.990  1.00 0.00 ? 74  SER A HB2  4  
ATOM 7483  H HB3  . SER A 1 74  ? -16.827 3.315   13.754  1.00 0.00 ? 74  SER A HB3  4  
ATOM 7484  H HG   . SER A 1 74  ? -16.076 1.580   12.759  1.00 0.00 ? 74  SER A HG   4  
ATOM 7485  N N    . LEU A 1 75  ? -15.830 6.052   11.215  1.00 0.00 ? 75  LEU A N    4  
ATOM 7486  C CA   . LEU A 1 75  ? -15.076 6.831   10.247  1.00 0.00 ? 75  LEU A CA   4  
ATOM 7487  C C    . LEU A 1 75  ? -13.613 6.906   10.688  1.00 0.00 ? 75  LEU A C    4  
ATOM 7488  O O    . LEU A 1 75  ? -13.312 6.791   11.875  1.00 0.00 ? 75  LEU A O    4  
ATOM 7489  C CB   . LEU A 1 75  ? -15.727 8.200   10.039  1.00 0.00 ? 75  LEU A CB   4  
ATOM 7490  C CG   . LEU A 1 75  ? -15.285 8.970   8.792   1.00 0.00 ? 75  LEU A CG   4  
ATOM 7491  C CD1  . LEU A 1 75  ? -16.214 8.680   7.612   1.00 0.00 ? 75  LEU A CD1  4  
ATOM 7492  C CD2  . LEU A 1 75  ? -15.178 10.468  9.083   1.00 0.00 ? 75  LEU A CD2  4  
ATOM 7493  H H    . LEU A 1 75  ? -15.670 6.297   12.171  1.00 0.00 ? 75  LEU A H    4  
ATOM 7494  H HA   . LEU A 1 75  ? -15.124 6.304   9.295   1.00 0.00 ? 75  LEU A HA   4  
ATOM 7495  H HB2  . LEU A 1 75  ? -16.807 8.064   9.994   1.00 0.00 ? 75  LEU A HB2  4  
ATOM 7496  H HB3  . LEU A 1 75  ? -15.520 8.816   10.914  1.00 0.00 ? 75  LEU A HB3  4  
ATOM 7497  H HG   . LEU A 1 75  ? -14.290 8.624   8.512   1.00 0.00 ? 75  LEU A HG   4  
ATOM 7498  H HD11 . LEU A 1 75  ? -17.189 9.129   7.797   1.00 0.00 ? 75  LEU A HD11 4  
ATOM 7499  H HD12 . LEU A 1 75  ? -15.787 9.102   6.702   1.00 0.00 ? 75  LEU A HD12 4  
ATOM 7500  H HD13 . LEU A 1 75  ? -16.327 7.602   7.494   1.00 0.00 ? 75  LEU A HD13 4  
ATOM 7501  H HD21 . LEU A 1 75  ? -14.529 10.626  9.944   1.00 0.00 ? 75  LEU A HD21 4  
ATOM 7502  H HD22 . LEU A 1 75  ? -14.759 10.977  8.214   1.00 0.00 ? 75  LEU A HD22 4  
ATOM 7503  H HD23 . LEU A 1 75  ? -16.169 10.869  9.296   1.00 0.00 ? 75  LEU A HD23 4  
ATOM 7504  N N    . LEU A 1 76  ? -12.743 7.100   9.708   1.00 0.00 ? 76  LEU A N    4  
ATOM 7505  C CA   . LEU A 1 76  ? -11.318 7.192   9.980   1.00 0.00 ? 76  LEU A CA   4  
ATOM 7506  C C    . LEU A 1 76  ? -10.838 8.614   9.684   1.00 0.00 ? 76  LEU A C    4  
ATOM 7507  O O    . LEU A 1 76  ? -11.532 9.382   9.021   1.00 0.00 ? 76  LEU A O    4  
ATOM 7508  C CB   . LEU A 1 76  ? -10.555 6.112   9.210   1.00 0.00 ? 76  LEU A CB   4  
ATOM 7509  C CG   . LEU A 1 76  ? -11.109 4.690   9.321   1.00 0.00 ? 76  LEU A CG   4  
ATOM 7510  C CD1  . LEU A 1 76  ? -10.424 3.755   8.322   1.00 0.00 ? 76  LEU A CD1  4  
ATOM 7511  C CD2  . LEU A 1 76  ? -11.004 4.172   10.757  1.00 0.00 ? 76  LEU A CD2  4  
ATOM 7512  H H    . LEU A 1 76  ? -12.996 7.193   8.745   1.00 0.00 ? 76  LEU A H    4  
ATOM 7513  H HA   . LEU A 1 76  ? -11.175 6.992   11.042  1.00 0.00 ? 76  LEU A HA   4  
ATOM 7514  H HB2  . LEU A 1 76  ? -10.534 6.391   8.156   1.00 0.00 ? 76  LEU A HB2  4  
ATOM 7515  H HB3  . LEU A 1 76  ? -9.522  6.106   9.558   1.00 0.00 ? 76  LEU A HB3  4  
ATOM 7516  H HG   . LEU A 1 76  ? -12.168 4.715   9.064   1.00 0.00 ? 76  LEU A HG   4  
ATOM 7517  H HD11 . LEU A 1 76  ? -10.567 4.136   7.311   1.00 0.00 ? 76  LEU A HD11 4  
ATOM 7518  H HD12 . LEU A 1 76  ? -9.358  3.704   8.545   1.00 0.00 ? 76  LEU A HD12 4  
ATOM 7519  H HD13 . LEU A 1 76  ? -10.860 2.759   8.400   1.00 0.00 ? 76  LEU A HD13 4  
ATOM 7520  H HD21 . LEU A 1 76  ? -10.271 4.764   11.304  1.00 0.00 ? 76  LEU A HD21 4  
ATOM 7521  H HD22 . LEU A 1 76  ? -11.976 4.254   11.245  1.00 0.00 ? 76  LEU A HD22 4  
ATOM 7522  H HD23 . LEU A 1 76  ? -10.692 3.128   10.744  1.00 0.00 ? 76  LEU A HD23 4  
ATOM 7523  N N    . LYS A 1 77  ? -9.652  8.921   10.190  1.00 0.00 ? 77  LYS A N    4  
ATOM 7524  C CA   . LYS A 1 77  ? -9.071  10.237  9.989   1.00 0.00 ? 77  LYS A CA   4  
ATOM 7525  C C    . LYS A 1 77  ? -7.704  10.089  9.317   1.00 0.00 ? 77  LYS A C    4  
ATOM 7526  O O    . LYS A 1 77  ? -7.324  8.991   8.911   1.00 0.00 ? 77  LYS A O    4  
ATOM 7527  C CB   . LYS A 1 77  ? -9.026  11.011  11.308  1.00 0.00 ? 77  LYS A CB   4  
ATOM 7528  C CG   . LYS A 1 77  ? -7.836  10.570  12.162  1.00 0.00 ? 77  LYS A CG   4  
ATOM 7529  C CD   . LYS A 1 77  ? -7.368  11.704  13.077  1.00 0.00 ? 77  LYS A CD   4  
ATOM 7530  C CE   . LYS A 1 77  ? -7.080  12.974  12.273  1.00 0.00 ? 77  LYS A CE   4  
ATOM 7531  N NZ   . LYS A 1 77  ? -6.081  13.813  12.971  1.00 0.00 ? 77  LYS A NZ   4  
ATOM 7532  H H    . LYS A 1 77  ? -9.094  8.290   10.728  1.00 0.00 ? 77  LYS A H    4  
ATOM 7533  H HA   . LYS A 1 77  ? -9.729  10.786  9.315   1.00 0.00 ? 77  LYS A HA   4  
ATOM 7534  H HB2  . LYS A 1 77  ? -8.957  12.080  11.105  1.00 0.00 ? 77  LYS A HB2  4  
ATOM 7535  H HB3  . LYS A 1 77  ? -9.953  10.851  11.859  1.00 0.00 ? 77  LYS A HB3  4  
ATOM 7536  H HG2  . LYS A 1 77  ? -8.116  9.705   12.763  1.00 0.00 ? 77  LYS A HG2  4  
ATOM 7537  H HG3  . LYS A 1 77  ? -7.016  10.258  11.516  1.00 0.00 ? 77  LYS A HG3  4  
ATOM 7538  H HD2  . LYS A 1 77  ? -8.132  11.910  13.827  1.00 0.00 ? 77  LYS A HD2  4  
ATOM 7539  H HD3  . LYS A 1 77  ? -6.470  11.397  13.612  1.00 0.00 ? 77  LYS A HD3  4  
ATOM 7540  H HE2  . LYS A 1 77  ? -6.713  12.708  11.282  1.00 0.00 ? 77  LYS A HE2  4  
ATOM 7541  H HE3  . LYS A 1 77  ? -8.002  13.538  12.130  1.00 0.00 ? 77  LYS A HE3  4  
ATOM 7542  H HZ1  . LYS A 1 77  ? -5.208  13.766  12.485  1.00 0.00 ? 77  LYS A HZ1  4  
ATOM 7543  H HZ2  . LYS A 1 77  ? -6.400  14.761  12.993  1.00 0.00 ? 77  LYS A HZ2  4  
ATOM 7544  H HZ3  . LYS A 1 77  ? -5.961  13.480  13.906  1.00 0.00 ? 77  LYS A HZ3  4  
ATOM 7545  N N    . GLU A 1 78  ? -7.003  11.209  9.220   1.00 0.00 ? 78  GLU A N    4  
ATOM 7546  C CA   . GLU A 1 78  ? -5.687  11.217  8.604   1.00 0.00 ? 78  GLU A CA   4  
ATOM 7547  C C    . GLU A 1 78  ? -4.679  10.492  9.497   1.00 0.00 ? 78  GLU A C    4  
ATOM 7548  O O    . GLU A 1 78  ? -4.532  10.827  10.672  1.00 0.00 ? 78  GLU A O    4  
ATOM 7549  C CB   . GLU A 1 78  ? -5.230  12.647  8.308   1.00 0.00 ? 78  GLU A CB   4  
ATOM 7550  C CG   . GLU A 1 78  ? -5.997  13.233  7.121   1.00 0.00 ? 78  GLU A CG   4  
ATOM 7551  C CD   . GLU A 1 78  ? -6.462  14.660  7.420   1.00 0.00 ? 78  GLU A CD   4  
ATOM 7552  O OE1  . GLU A 1 78  ? -5.602  15.460  7.847   1.00 0.00 ? 78  GLU A OE1  4  
ATOM 7553  O OE2  . GLU A 1 78  ? -7.668  14.918  7.215   1.00 0.00 ? 78  GLU A OE2  4  
ATOM 7554  H H    . GLU A 1 78  ? -7.320  12.097  9.553   1.00 0.00 ? 78  GLU A H    4  
ATOM 7555  H HA   . GLU A 1 78  ? -5.804  10.678  7.664   1.00 0.00 ? 78  GLU A HA   4  
ATOM 7556  H HB2  . GLU A 1 78  ? -5.382  13.271  9.188   1.00 0.00 ? 78  GLU A HB2  4  
ATOM 7557  H HB3  . GLU A 1 78  ? -4.161  12.653  8.094   1.00 0.00 ? 78  GLU A HB3  4  
ATOM 7558  H HG2  . GLU A 1 78  ? -5.360  13.232  6.236   1.00 0.00 ? 78  GLU A HG2  4  
ATOM 7559  H HG3  . GLU A 1 78  ? -6.859  12.606  6.894   1.00 0.00 ? 78  GLU A HG3  4  
ATOM 7560  N N    . GLY A 1 79  ? -4.009  9.513   8.906   1.00 0.00 ? 79  GLY A N    4  
ATOM 7561  C CA   . GLY A 1 79  ? -3.019  8.739   9.634   1.00 0.00 ? 79  GLY A CA   4  
ATOM 7562  C C    . GLY A 1 79  ? -3.545  7.338   9.955   1.00 0.00 ? 79  GLY A C    4  
ATOM 7563  O O    . GLY A 1 79  ? -2.898  6.577   10.673  1.00 0.00 ? 79  GLY A O    4  
ATOM 7564  H H    . GLY A 1 79  ? -4.135  9.248   7.950   1.00 0.00 ? 79  GLY A H    4  
ATOM 7565  H HA2  . GLY A 1 79  ? -2.106  8.661   9.043   1.00 0.00 ? 79  GLY A HA2  4  
ATOM 7566  H HA3  . GLY A 1 79  ? -2.757  9.253   10.558  1.00 0.00 ? 79  GLY A HA3  4  
ATOM 7567  N N    . ASP A 1 80  ? -4.714  7.041   9.407   1.00 0.00 ? 80  ASP A N    4  
ATOM 7568  C CA   . ASP A 1 80  ? -5.335  5.745   9.626   1.00 0.00 ? 80  ASP A CA   4  
ATOM 7569  C C    . ASP A 1 80  ? -5.048  4.838   8.428   1.00 0.00 ? 80  ASP A C    4  
ATOM 7570  O O    . ASP A 1 80  ? -5.364  5.186   7.291   1.00 0.00 ? 80  ASP A O    4  
ATOM 7571  C CB   . ASP A 1 80  ? -6.853  5.878   9.765   1.00 0.00 ? 80  ASP A CB   4  
ATOM 7572  C CG   . ASP A 1 80  ? -7.339  6.328   11.144  1.00 0.00 ? 80  ASP A CG   4  
ATOM 7573  O OD1  . ASP A 1 80  ? -7.135  7.521   11.456  1.00 0.00 ? 80  ASP A OD1  4  
ATOM 7574  O OD2  . ASP A 1 80  ? -7.903  5.469   11.855  1.00 0.00 ? 80  ASP A OD2  4  
ATOM 7575  H H    . ASP A 1 80  ? -5.234  7.665   8.824   1.00 0.00 ? 80  ASP A H    4  
ATOM 7576  H HA   . ASP A 1 80  ? -4.895  5.369   10.549  1.00 0.00 ? 80  ASP A HA   4  
ATOM 7577  H HB2  . ASP A 1 80  ? -7.210  6.590   9.020   1.00 0.00 ? 80  ASP A HB2  4  
ATOM 7578  H HB3  . ASP A 1 80  ? -7.310  4.917   9.531   1.00 0.00 ? 80  ASP A HB3  4  
ATOM 7579  N N    . PHE A 1 81  ? -4.451  3.692   8.723   1.00 0.00 ? 81  PHE A N    4  
ATOM 7580  C CA   . PHE A 1 81  ? -4.118  2.732   7.684   1.00 0.00 ? 81  PHE A CA   4  
ATOM 7581  C C    . PHE A 1 81  ? -5.090  1.551   7.697   1.00 0.00 ? 81  PHE A C    4  
ATOM 7582  O O    . PHE A 1 81  ? -5.804  1.341   8.676   1.00 0.00 ? 81  PHE A O    4  
ATOM 7583  C CB   . PHE A 1 81  ? -2.708  2.220   7.985   1.00 0.00 ? 81  PHE A CB   4  
ATOM 7584  C CG   . PHE A 1 81  ? -2.486  1.829   9.447   1.00 0.00 ? 81  PHE A CG   4  
ATOM 7585  C CD1  . PHE A 1 81  ? -2.960  0.643   9.913   1.00 0.00 ? 81  PHE A CD1  4  
ATOM 7586  C CD2  . PHE A 1 81  ? -1.814  2.668   10.281  1.00 0.00 ? 81  PHE A CD2  4  
ATOM 7587  C CE1  . PHE A 1 81  ? -2.754  0.280   11.271  1.00 0.00 ? 81  PHE A CE1  4  
ATOM 7588  C CE2  . PHE A 1 81  ? -1.608  2.305   11.638  1.00 0.00 ? 81  PHE A CE2  4  
ATOM 7589  C CZ   . PHE A 1 81  ? -2.083  1.119   12.104  1.00 0.00 ? 81  PHE A CZ   4  
ATOM 7590  H H    . PHE A 1 81  ? -4.197  3.417   9.650   1.00 0.00 ? 81  PHE A H    4  
ATOM 7591  H HA   . PHE A 1 81  ? -4.192  3.251   6.729   1.00 0.00 ? 81  PHE A HA   4  
ATOM 7592  H HB2  . PHE A 1 81  ? -2.504  1.356   7.353   1.00 0.00 ? 81  PHE A HB2  4  
ATOM 7593  H HB3  . PHE A 1 81  ? -1.987  2.991   7.712   1.00 0.00 ? 81  PHE A HB3  4  
ATOM 7594  H HD1  . PHE A 1 81  ? -3.499  -0.029  9.245   1.00 0.00 ? 81  PHE A HD1  4  
ATOM 7595  H HD2  . PHE A 1 81  ? -1.434  3.619   9.907   1.00 0.00 ? 81  PHE A HD2  4  
ATOM 7596  H HE1  . PHE A 1 81  ? -3.135  -0.671  11.644  1.00 0.00 ? 81  PHE A HE1  4  
ATOM 7597  H HE2  . PHE A 1 81  ? -1.070  2.977   12.306  1.00 0.00 ? 81  PHE A HE2  4  
ATOM 7598  H HZ   . PHE A 1 81  ? -1.925  0.840   13.146  1.00 0.00 ? 81  PHE A HZ   4  
ATOM 7599  N N    . CYS A 1 82  ? -5.087  0.811   6.598   1.00 0.00 ? 82  CYS A N    4  
ATOM 7600  C CA   . CYS A 1 82  ? -5.959  -0.343  6.470   1.00 0.00 ? 82  CYS A CA   4  
ATOM 7601  C C    . CYS A 1 82  ? -5.099  -1.561  6.126   1.00 0.00 ? 82  CYS A C    4  
ATOM 7602  O O    . CYS A 1 82  ? -3.929  -1.418  5.774   1.00 0.00 ? 82  CYS A O    4  
ATOM 7603  C CB   . CYS A 1 82  ? -7.058  -0.110  5.431   1.00 0.00 ? 82  CYS A CB   4  
ATOM 7604  S SG   . CYS A 1 82  ? -8.050  1.359   5.889   1.00 0.00 ? 82  CYS A SG   4  
ATOM 7605  H H    . CYS A 1 82  ? -4.503  0.989   5.806   1.00 0.00 ? 82  CYS A H    4  
ATOM 7606  H HA   . CYS A 1 82  ? -6.448  -0.475  7.436   1.00 0.00 ? 82  CYS A HA   4  
ATOM 7607  H HB2  . CYS A 1 82  ? -6.615  0.033   4.446   1.00 0.00 ? 82  CYS A HB2  4  
ATOM 7608  H HB3  . CYS A 1 82  ? -7.702  -0.987  5.367   1.00 0.00 ? 82  CYS A HB3  4  
ATOM 7609  H HG   . CYS A 1 82  ? -7.016  2.182   6.044   1.00 0.00 ? 82  CYS A HG   4  
ATOM 7610  N N    . GLY A 1 83  ? -5.711  -2.730  6.240   1.00 0.00 ? 83  GLY A N    4  
ATOM 7611  C CA   . GLY A 1 83  ? -5.016  -3.971  5.946   1.00 0.00 ? 83  GLY A CA   4  
ATOM 7612  C C    . GLY A 1 83  ? -3.572  -3.923  6.451   1.00 0.00 ? 83  GLY A C    4  
ATOM 7613  O O    . GLY A 1 83  ? -2.634  -4.127  5.681   1.00 0.00 ? 83  GLY A O    4  
ATOM 7614  H H    . GLY A 1 83  ? -6.663  -2.837  6.527   1.00 0.00 ? 83  GLY A H    4  
ATOM 7615  H HA2  . GLY A 1 83  ? -5.540  -4.805  6.411   1.00 0.00 ? 83  GLY A HA2  4  
ATOM 7616  H HA3  . GLY A 1 83  ? -5.023  -4.150  4.871   1.00 0.00 ? 83  GLY A HA3  4  
ATOM 7617  N N    . ASP A 1 84  ? -3.439  -3.653  7.741   1.00 0.00 ? 84  ASP A N    4  
ATOM 7618  C CA   . ASP A 1 84  ? -2.125  -3.576  8.357   1.00 0.00 ? 84  ASP A CA   4  
ATOM 7619  C C    . ASP A 1 84  ? -1.590  -4.992  8.585   1.00 0.00 ? 84  ASP A C    4  
ATOM 7620  O O    . ASP A 1 84  ? -0.378  -5.206  8.601   1.00 0.00 ? 84  ASP A O    4  
ATOM 7621  C CB   . ASP A 1 84  ? -2.194  -2.874  9.715   1.00 0.00 ? 84  ASP A CB   4  
ATOM 7622  C CG   . ASP A 1 84  ? -3.421  -3.219  10.560  1.00 0.00 ? 84  ASP A CG   4  
ATOM 7623  O OD1  . ASP A 1 84  ? -4.524  -2.782  10.166  1.00 0.00 ? 84  ASP A OD1  4  
ATOM 7624  O OD2  . ASP A 1 84  ? -3.229  -3.913  11.582  1.00 0.00 ? 84  ASP A OD2  4  
ATOM 7625  H H    . ASP A 1 84  ? -4.206  -3.489  8.360   1.00 0.00 ? 84  ASP A H    4  
ATOM 7626  H HA   . ASP A 1 84  ? -1.514  -3.006  7.658   1.00 0.00 ? 84  ASP A HA   4  
ATOM 7627  H HB2  . ASP A 1 84  ? -1.298  -3.124  10.282  1.00 0.00 ? 84  ASP A HB2  4  
ATOM 7628  H HB3  . ASP A 1 84  ? -2.176  -1.796  9.550   1.00 0.00 ? 84  ASP A HB3  4  
ATOM 7629  N N    . GLU A 1 85  ? -2.518  -5.921  8.755   1.00 0.00 ? 85  GLU A N    4  
ATOM 7630  C CA   . GLU A 1 85  ? -2.155  -7.310  8.981   1.00 0.00 ? 85  GLU A CA   4  
ATOM 7631  C C    . GLU A 1 85  ? -1.160  -7.778  7.916   1.00 0.00 ? 85  GLU A C    4  
ATOM 7632  O O    . GLU A 1 85  ? -0.430  -8.745  8.126   1.00 0.00 ? 85  GLU A O    4  
ATOM 7633  C CB   . GLU A 1 85  ? -3.396  -8.205  9.002   1.00 0.00 ? 85  GLU A CB   4  
ATOM 7634  C CG   . GLU A 1 85  ? -3.904  -8.402  10.432  1.00 0.00 ? 85  GLU A CG   4  
ATOM 7635  C CD   . GLU A 1 85  ? -2.807  -8.978  11.330  1.00 0.00 ? 85  GLU A CD   4  
ATOM 7636  O OE1  . GLU A 1 85  ? -2.039  -9.821  10.817  1.00 0.00 ? 85  GLU A OE1  4  
ATOM 7637  O OE2  . GLU A 1 85  ? -2.761  -8.563  12.508  1.00 0.00 ? 85  GLU A OE2  4  
ATOM 7638  H H    . GLU A 1 85  ? -3.502  -5.739  8.740   1.00 0.00 ? 85  GLU A H    4  
ATOM 7639  H HA   . GLU A 1 85  ? -1.683  -7.330  9.963   1.00 0.00 ? 85  GLU A HA   4  
ATOM 7640  H HB2  . GLU A 1 85  ? -4.181  -7.759  8.392   1.00 0.00 ? 85  GLU A HB2  4  
ATOM 7641  H HB3  . GLU A 1 85  ? -3.158  -9.172  8.560   1.00 0.00 ? 85  GLU A HB3  4  
ATOM 7642  H HG2  . GLU A 1 85  ? -4.245  -7.449  10.835  1.00 0.00 ? 85  GLU A HG2  4  
ATOM 7643  H HG3  . GLU A 1 85  ? -4.764  -9.072  10.427  1.00 0.00 ? 85  GLU A HG3  4  
ATOM 7644  N N    . LEU A 1 86  ? -1.163  -7.069  6.797   1.00 0.00 ? 86  LEU A N    4  
ATOM 7645  C CA   . LEU A 1 86  ? -0.269  -7.399  5.700   1.00 0.00 ? 86  LEU A CA   4  
ATOM 7646  C C    . LEU A 1 86  ? 1.161   -7.007  6.076   1.00 0.00 ? 86  LEU A C    4  
ATOM 7647  O O    . LEU A 1 86  ? 2.093   -7.785  5.880   1.00 0.00 ? 86  LEU A O    4  
ATOM 7648  C CB   . LEU A 1 86  ? -0.760  -6.760  4.399   1.00 0.00 ? 86  LEU A CB   4  
ATOM 7649  C CG   . LEU A 1 86  ? 0.058   -7.079  3.145   1.00 0.00 ? 86  LEU A CG   4  
ATOM 7650  C CD1  . LEU A 1 86  ? -0.135  -8.537  2.721   1.00 0.00 ? 86  LEU A CD1  4  
ATOM 7651  C CD2  . LEU A 1 86  ? -0.272  -6.105  2.013   1.00 0.00 ? 86  LEU A CD2  4  
ATOM 7652  H H    . LEU A 1 86  ? -1.759  -6.283  6.634   1.00 0.00 ? 86  LEU A H    4  
ATOM 7653  H HA   . LEU A 1 86  ? -0.307  -8.480  5.562   1.00 0.00 ? 86  LEU A HA   4  
ATOM 7654  H HB2  . LEU A 1 86  ? -1.789  -7.076  4.227   1.00 0.00 ? 86  LEU A HB2  4  
ATOM 7655  H HB3  . LEU A 1 86  ? -0.777  -5.679  4.532   1.00 0.00 ? 86  LEU A HB3  4  
ATOM 7656  H HG   . LEU A 1 86  ? 1.113   -6.950  3.384   1.00 0.00 ? 86  LEU A HG   4  
ATOM 7657  H HD11 . LEU A 1 86  ? -1.091  -8.901  3.096   1.00 0.00 ? 86  LEU A HD11 4  
ATOM 7658  H HD12 . LEU A 1 86  ? -0.121  -8.603  1.633   1.00 0.00 ? 86  LEU A HD12 4  
ATOM 7659  H HD13 . LEU A 1 86  ? 0.672   -9.144  3.132   1.00 0.00 ? 86  LEU A HD13 4  
ATOM 7660  H HD21 . LEU A 1 86  ? -0.243  -6.632  1.060   1.00 0.00 ? 86  LEU A HD21 4  
ATOM 7661  H HD22 . LEU A 1 86  ? -1.268  -5.690  2.169   1.00 0.00 ? 86  LEU A HD22 4  
ATOM 7662  H HD23 . LEU A 1 86  ? 0.460   -5.297  2.004   1.00 0.00 ? 86  LEU A HD23 4  
ATOM 7663  N N    . LEU A 1 87  ? 1.289   -5.802  6.611   1.00 0.00 ? 87  LEU A N    4  
ATOM 7664  C CA   . LEU A 1 87  ? 2.590   -5.297  7.016   1.00 0.00 ? 87  LEU A CA   4  
ATOM 7665  C C    . LEU A 1 87  ? 3.264   -6.318  7.935   1.00 0.00 ? 87  LEU A C    4  
ATOM 7666  O O    . LEU A 1 87  ? 4.431   -6.655  7.744   1.00 0.00 ? 87  LEU A O    4  
ATOM 7667  C CB   . LEU A 1 87  ? 2.455   -3.906  7.638   1.00 0.00 ? 87  LEU A CB   4  
ATOM 7668  C CG   . LEU A 1 87  ? 3.559   -2.906  7.289   1.00 0.00 ? 87  LEU A CG   4  
ATOM 7669  C CD1  . LEU A 1 87  ? 3.425   -2.422  5.844   1.00 0.00 ? 87  LEU A CD1  4  
ATOM 7670  C CD2  . LEU A 1 87  ? 3.580   -1.743  8.284   1.00 0.00 ? 87  LEU A CD2  4  
ATOM 7671  H H    . LEU A 1 87  ? 0.525   -5.175  6.767   1.00 0.00 ? 87  LEU A H    4  
ATOM 7672  H HA   . LEU A 1 87  ? 3.194   -5.191  6.116   1.00 0.00 ? 87  LEU A HA   4  
ATOM 7673  H HB2  . LEU A 1 87  ? 1.499   -3.483  7.329   1.00 0.00 ? 87  LEU A HB2  4  
ATOM 7674  H HB3  . LEU A 1 87  ? 2.420   -4.015  8.721   1.00 0.00 ? 87  LEU A HB3  4  
ATOM 7675  H HG   . LEU A 1 87  ? 4.519   -3.416  7.370   1.00 0.00 ? 87  LEU A HG   4  
ATOM 7676  H HD11 . LEU A 1 87  ? 4.275   -2.775  5.262   1.00 0.00 ? 87  LEU A HD11 4  
ATOM 7677  H HD12 . LEU A 1 87  ? 2.502   -2.812  5.414   1.00 0.00 ? 87  LEU A HD12 4  
ATOM 7678  H HD13 . LEU A 1 87  ? 3.400   -1.332  5.827   1.00 0.00 ? 87  LEU A HD13 4  
ATOM 7679  H HD21 . LEU A 1 87  ? 4.287   -0.986  7.943   1.00 0.00 ? 87  LEU A HD21 4  
ATOM 7680  H HD22 . LEU A 1 87  ? 2.584   -1.306  8.352   1.00 0.00 ? 87  LEU A HD22 4  
ATOM 7681  H HD23 . LEU A 1 87  ? 3.885   -2.110  9.264   1.00 0.00 ? 87  LEU A HD23 4  
ATOM 7682  N N    . THR A 1 88  ? 2.499   -6.782  8.913   1.00 0.00 ? 88  THR A N    4  
ATOM 7683  C CA   . THR A 1 88  ? 3.008   -7.758  9.862   1.00 0.00 ? 88  THR A CA   4  
ATOM 7684  C C    . THR A 1 88  ? 3.220   -9.109  9.176   1.00 0.00 ? 88  THR A C    4  
ATOM 7685  O O    . THR A 1 88  ? 4.206   -9.795  9.441   1.00 0.00 ? 88  THR A O    4  
ATOM 7686  C CB   . THR A 1 88  ? 2.036   -7.821  11.042  1.00 0.00 ? 88  THR A CB   4  
ATOM 7687  O OG1  . THR A 1 88  ? 2.679   -7.064  12.063  1.00 0.00 ? 88  THR A OG1  4  
ATOM 7688  C CG2  . THR A 1 88  ? 1.925   -9.228  11.634  1.00 0.00 ? 88  THR A CG2  4  
ATOM 7689  H H    . THR A 1 88  ? 1.551   -6.503  9.062   1.00 0.00 ? 88  THR A H    4  
ATOM 7690  H HA   . THR A 1 88  ? 3.984   -7.420  10.212  1.00 0.00 ? 88  THR A HA   4  
ATOM 7691  H HB   . THR A 1 88  ? 1.055   -7.440  10.759  1.00 0.00 ? 88  THR A HB   4  
ATOM 7692  H HG1  . THR A 1 88  ? 1.999   -6.556  12.592  1.00 0.00 ? 88  THR A HG1  4  
ATOM 7693  H HG21 . THR A 1 88  ? 1.334   -9.191  12.549  1.00 0.00 ? 88  THR A HG21 4  
ATOM 7694  H HG22 . THR A 1 88  ? 1.441   -9.888  10.915  1.00 0.00 ? 88  THR A HG22 4  
ATOM 7695  H HG23 . THR A 1 88  ? 2.922   -9.606  11.860  1.00 0.00 ? 88  THR A HG23 4  
ATOM 7696  N N    . TRP A 1 89  ? 2.279   -9.450  8.308   1.00 0.00 ? 89  TRP A N    4  
ATOM 7697  C CA   . TRP A 1 89  ? 2.351   -10.706 7.582   1.00 0.00 ? 89  TRP A CA   4  
ATOM 7698  C C    . TRP A 1 89  ? 3.769   -10.851 7.026   1.00 0.00 ? 89  TRP A C    4  
ATOM 7699  O O    . TRP A 1 89  ? 4.507   -11.750 7.425   1.00 0.00 ? 89  TRP A O    4  
ATOM 7700  C CB   . TRP A 1 89  ? 1.274   -10.775 6.497   1.00 0.00 ? 89  TRP A CB   4  
ATOM 7701  C CG   . TRP A 1 89  ? 1.487   -11.897 5.479   1.00 0.00 ? 89  TRP A CG   4  
ATOM 7702  C CD1  . TRP A 1 89  ? 1.127   -13.184 5.582   1.00 0.00 ? 89  TRP A CD1  4  
ATOM 7703  C CD2  . TRP A 1 89  ? 2.127   -11.779 4.191   1.00 0.00 ? 89  TRP A CD2  4  
ATOM 7704  N NE1  . TRP A 1 89  ? 1.487   -13.901 4.459   1.00 0.00 ? 89  TRP A NE1  4  
ATOM 7705  C CE2  . TRP A 1 89  ? 2.114   -13.019 3.586   1.00 0.00 ? 89  TRP A CE2  4  
ATOM 7706  C CE3  . TRP A 1 89  ? 2.698   -10.661 3.558   1.00 0.00 ? 89  TRP A CE3  4  
ATOM 7707  C CZ2  . TRP A 1 89  ? 2.658   -13.259 2.319   1.00 0.00 ? 89  TRP A CZ2  4  
ATOM 7708  C CZ3  . TRP A 1 89  ? 3.237   -10.917 2.292   1.00 0.00 ? 89  TRP A CZ3  4  
ATOM 7709  C CH2  . TRP A 1 89  ? 3.233   -12.160 1.669   1.00 0.00 ? 89  TRP A CH2  4  
ATOM 7710  H H    . TRP A 1 89  ? 1.481   -8.885  8.098   1.00 0.00 ? 89  TRP A H    4  
ATOM 7711  H HA   . TRP A 1 89  ? 2.143   -11.511 8.287   1.00 0.00 ? 89  TRP A HA   4  
ATOM 7712  H HB2  . TRP A 1 89  ? 0.302   -10.910 6.973   1.00 0.00 ? 89  TRP A HB2  4  
ATOM 7713  H HB3  . TRP A 1 89  ? 1.241   -9.821  5.971   1.00 0.00 ? 89  TRP A HB3  4  
ATOM 7714  H HD1  . TRP A 1 89  ? 0.614   -13.610 6.444   1.00 0.00 ? 89  TRP A HD1  4  
ATOM 7715  H HE1  . TRP A 1 89  ? 1.312   -14.963 4.288   1.00 0.00 ? 89  TRP A HE1  4  
ATOM 7716  H HE3  . TRP A 1 89  ? 2.720   -9.671  4.014   1.00 0.00 ? 89  TRP A HE3  4  
ATOM 7717  H HZ2  . TRP A 1 89  ? 2.636   -14.249 1.863   1.00 0.00 ? 89  TRP A HZ2  4  
ATOM 7718  H HZ3  . TRP A 1 89  ? 3.693   -10.084 1.757   1.00 0.00 ? 89  TRP A HZ3  4  
ATOM 7719  H HH2  . TRP A 1 89  ? 3.674   -12.279 0.680   1.00 0.00 ? 89  TRP A HH2  4  
ATOM 7720  N N    . ALA A 1 90  ? 4.107   -9.952  6.113   1.00 0.00 ? 90  ALA A N    4  
ATOM 7721  C CA   . ALA A 1 90  ? 5.423   -9.968  5.498   1.00 0.00 ? 90  ALA A CA   4  
ATOM 7722  C C    . ALA A 1 90  ? 6.491   -10.043 6.591   1.00 0.00 ? 90  ALA A C    4  
ATOM 7723  O O    . ALA A 1 90  ? 7.392   -10.878 6.527   1.00 0.00 ? 90  ALA A O    4  
ATOM 7724  C CB   . ALA A 1 90  ? 5.586   -8.735  4.607   1.00 0.00 ? 90  ALA A CB   4  
ATOM 7725  H H    . ALA A 1 90  ? 3.500   -9.224  5.793   1.00 0.00 ? 90  ALA A H    4  
ATOM 7726  H HA   . ALA A 1 90  ? 5.488   -10.862 4.876   1.00 0.00 ? 90  ALA A HA   4  
ATOM 7727  H HB1  . ALA A 1 90  ? 4.654   -8.170  4.594   1.00 0.00 ? 90  ALA A HB1  4  
ATOM 7728  H HB2  . ALA A 1 90  ? 6.386   -8.107  4.998   1.00 0.00 ? 90  ALA A HB2  4  
ATOM 7729  H HB3  . ALA A 1 90  ? 5.834   -9.050  3.593   1.00 0.00 ? 90  ALA A HB3  4  
ATOM 7730  N N    . LEU A 1 91  ? 6.354   -9.159  7.568   1.00 0.00 ? 91  LEU A N    4  
ATOM 7731  C CA   . LEU A 1 91  ? 7.296   -9.114  8.674   1.00 0.00 ? 91  LEU A CA   4  
ATOM 7732  C C    . LEU A 1 91  ? 7.422   -10.510 9.288   1.00 0.00 ? 91  LEU A C    4  
ATOM 7733  O O    . LEU A 1 91  ? 8.472   -10.866 9.820   1.00 0.00 ? 91  LEU A O    4  
ATOM 7734  C CB   . LEU A 1 91  ? 6.892   -8.034  9.679   1.00 0.00 ? 91  LEU A CB   4  
ATOM 7735  C CG   . LEU A 1 91  ? 7.644   -6.706  9.575   1.00 0.00 ? 91  LEU A CG   4  
ATOM 7736  C CD1  . LEU A 1 91  ? 7.888   -6.327  8.113   1.00 0.00 ? 91  LEU A CD1  4  
ATOM 7737  C CD2  . LEU A 1 91  ? 6.912   -5.600  10.339  1.00 0.00 ? 91  LEU A CD2  4  
ATOM 7738  H H    . LEU A 1 91  ? 5.618   -8.484  7.613   1.00 0.00 ? 91  LEU A H    4  
ATOM 7739  H HA   . LEU A 1 91  ? 8.266   -8.828  8.266   1.00 0.00 ? 91  LEU A HA   4  
ATOM 7740  H HB2  . LEU A 1 91  ? 5.826   -7.836  9.560   1.00 0.00 ? 91  LEU A HB2  4  
ATOM 7741  H HB3  . LEU A 1 91  ? 7.032   -8.431  10.684  1.00 0.00 ? 91  LEU A HB3  4  
ATOM 7742  H HG   . LEU A 1 91  ? 8.620   -6.829  10.043  1.00 0.00 ? 91  LEU A HG   4  
ATOM 7743  H HD11 . LEU A 1 91  ? 8.946   -6.445  7.879   1.00 0.00 ? 91  LEU A HD11 4  
ATOM 7744  H HD12 . LEU A 1 91  ? 7.298   -6.976  7.466   1.00 0.00 ? 91  LEU A HD12 4  
ATOM 7745  H HD13 . LEU A 1 91  ? 7.594   -5.290  7.952   1.00 0.00 ? 91  LEU A HD13 4  
ATOM 7746  H HD21 . LEU A 1 91  ? 7.121   -5.695  11.405  1.00 0.00 ? 91  LEU A HD21 4  
ATOM 7747  H HD22 . LEU A 1 91  ? 7.255   -4.627  9.987   1.00 0.00 ? 91  LEU A HD22 4  
ATOM 7748  H HD23 . LEU A 1 91  ? 5.839   -5.691  10.170  1.00 0.00 ? 91  LEU A HD23 4  
ATOM 7749  N N    . ASP A 1 92  ? 6.335   -11.263 9.195   1.00 0.00 ? 92  ASP A N    4  
ATOM 7750  C CA   . ASP A 1 92  ? 6.311   -12.611 9.735   1.00 0.00 ? 92  ASP A CA   4  
ATOM 7751  C C    . ASP A 1 92  ? 6.616   -13.610 8.616   1.00 0.00 ? 92  ASP A C    4  
ATOM 7752  O O    . ASP A 1 92  ? 5.813   -13.785 7.700   1.00 0.00 ? 92  ASP A O    4  
ATOM 7753  C CB   . ASP A 1 92  ? 4.933   -12.950 10.308  1.00 0.00 ? 92  ASP A CB   4  
ATOM 7754  C CG   . ASP A 1 92  ? 4.933   -13.389 11.774  1.00 0.00 ? 92  ASP A CG   4  
ATOM 7755  O OD1  . ASP A 1 92  ? 5.990   -13.214 12.419  1.00 0.00 ? 92  ASP A OD1  4  
ATOM 7756  O OD2  . ASP A 1 92  ? 3.876   -13.889 12.216  1.00 0.00 ? 92  ASP A OD2  4  
ATOM 7757  H H    . ASP A 1 92  ? 5.485   -10.966 8.761   1.00 0.00 ? 92  ASP A H    4  
ATOM 7758  H HA   . ASP A 1 92  ? 7.068   -12.620 10.519  1.00 0.00 ? 92  ASP A HA   4  
ATOM 7759  H HB2  . ASP A 1 92  ? 4.289   -12.077 10.206  1.00 0.00 ? 92  ASP A HB2  4  
ATOM 7760  H HB3  . ASP A 1 92  ? 4.491   -13.744 9.707   1.00 0.00 ? 92  ASP A HB3  4  
ATOM 7761  N N    . PRO A 1 93  ? 7.808   -14.254 8.730   1.00 0.00 ? 93  PRO A N    4  
ATOM 7762  C CA   . PRO A 1 93  ? 8.228   -15.230 7.739   1.00 0.00 ? 93  PRO A CA   4  
ATOM 7763  C C    . PRO A 1 93  ? 7.463   -16.544 7.905   1.00 0.00 ? 93  PRO A C    4  
ATOM 7764  O O    . PRO A 1 93  ? 7.253   -17.271 6.935   1.00 0.00 ? 93  PRO A O    4  
ATOM 7765  C CB   . PRO A 1 93  ? 9.726   -15.384 7.950   1.00 0.00 ? 93  PRO A CB   4  
ATOM 7766  C CG   . PRO A 1 93  ? 10.008  -14.846 9.343   1.00 0.00 ? 93  PRO A CG   4  
ATOM 7767  C CD   . PRO A 1 93  ? 8.783   -14.071 9.801   1.00 0.00 ? 93  PRO A CD   4  
ATOM 7768  H HA   . PRO A 1 93  ? 8.015   -14.904 6.818   1.00 0.00 ? 93  PRO A HA   4  
ATOM 7769  H HB2  . PRO A 1 93  ? 10.027  -16.428 7.866   1.00 0.00 ? 93  PRO A HB2  4  
ATOM 7770  H HB3  . PRO A 1 93  ? 10.285  -14.830 7.196   1.00 0.00 ? 93  PRO A HB3  4  
ATOM 7771  H HG2  . PRO A 1 93  ? 10.223  -15.663 10.032  1.00 0.00 ? 93  PRO A HG2  4  
ATOM 7772  H HG3  . PRO A 1 93  ? 10.886  -14.200 9.332   1.00 0.00 ? 93  PRO A HG3  4  
ATOM 7773  H HD2  . PRO A 1 93  ? 8.406   -14.452 10.749  1.00 0.00 ? 93  PRO A HD2  4  
ATOM 7774  H HD3  . PRO A 1 93  ? 9.014   -13.016 9.950   1.00 0.00 ? 93  PRO A HD3  4  
ATOM 7775  N N    . LYS A 1 94  ? 7.067   -16.810 9.141   1.00 0.00 ? 94  LYS A N    4  
ATOM 7776  C CA   . LYS A 1 94  ? 6.329   -18.024 9.446   1.00 0.00 ? 94  LYS A CA   4  
ATOM 7777  C C    . LYS A 1 94  ? 5.037   -18.049 8.628   1.00 0.00 ? 94  LYS A C    4  
ATOM 7778  O O    . LYS A 1 94  ? 4.510   -19.119 8.326   1.00 0.00 ? 94  LYS A O    4  
ATOM 7779  C CB   . LYS A 1 94  ? 6.105   -18.149 10.954  1.00 0.00 ? 94  LYS A CB   4  
ATOM 7780  C CG   . LYS A 1 94  ? 7.433   -18.091 11.713  1.00 0.00 ? 94  LYS A CG   4  
ATOM 7781  C CD   . LYS A 1 94  ? 8.424   -19.118 11.162  1.00 0.00 ? 94  LYS A CD   4  
ATOM 7782  C CE   . LYS A 1 94  ? 9.209   -19.784 12.294  1.00 0.00 ? 94  LYS A CE   4  
ATOM 7783  N NZ   . LYS A 1 94  ? 9.985   -18.775 13.050  1.00 0.00 ? 94  LYS A NZ   4  
ATOM 7784  H H    . LYS A 1 94  ? 7.242   -16.213 9.924   1.00 0.00 ? 94  LYS A H    4  
ATOM 7785  H HA   . LYS A 1 94  ? 6.948   -18.867 9.141   1.00 0.00 ? 94  LYS A HA   4  
ATOM 7786  H HB2  . LYS A 1 94  ? 5.451   -17.348 11.297  1.00 0.00 ? 94  LYS A HB2  4  
ATOM 7787  H HB3  . LYS A 1 94  ? 5.598   -19.089 11.173  1.00 0.00 ? 94  LYS A HB3  4  
ATOM 7788  H HG2  . LYS A 1 94  ? 7.858   -17.091 11.632  1.00 0.00 ? 94  LYS A HG2  4  
ATOM 7789  H HG3  . LYS A 1 94  ? 7.259   -18.280 12.772  1.00 0.00 ? 94  LYS A HG3  4  
ATOM 7790  H HD2  . LYS A 1 94  ? 7.888   -19.877 10.591  1.00 0.00 ? 94  LYS A HD2  4  
ATOM 7791  H HD3  . LYS A 1 94  ? 9.114   -18.630 10.474  1.00 0.00 ? 94  LYS A HD3  4  
ATOM 7792  H HE2  . LYS A 1 94  ? 8.523   -20.302 12.965  1.00 0.00 ? 94  LYS A HE2  4  
ATOM 7793  H HE3  . LYS A 1 94  ? 9.882   -20.537 11.884  1.00 0.00 ? 94  LYS A HE3  4  
ATOM 7794  H HZ1  . LYS A 1 94  ? 10.941  -18.805 12.761  1.00 0.00 ? 94  LYS A HZ1  4  
ATOM 7795  H HZ2  . LYS A 1 94  ? 9.610   -17.865 12.872  1.00 0.00 ? 94  LYS A HZ2  4  
ATOM 7796  H HZ3  . LYS A 1 94  ? 9.926   -18.975 14.029  1.00 0.00 ? 94  LYS A HZ3  4  
ATOM 7797  N N    . SER A 1 95  ? 4.563   -16.858 8.292   1.00 0.00 ? 95  SER A N    4  
ATOM 7798  C CA   . SER A 1 95  ? 3.342   -16.731 7.515   1.00 0.00 ? 95  SER A CA   4  
ATOM 7799  C C    . SER A 1 95  ? 3.681   -16.442 6.051   1.00 0.00 ? 95  SER A C    4  
ATOM 7800  O O    . SER A 1 95  ? 3.846   -15.286 5.664   1.00 0.00 ? 95  SER A O    4  
ATOM 7801  C CB   . SER A 1 95  ? 2.443   -15.628 8.078   1.00 0.00 ? 95  SER A CB   4  
ATOM 7802  O OG   . SER A 1 95  ? 1.769   -16.043 9.263   1.00 0.00 ? 95  SER A OG   4  
ATOM 7803  H H    . SER A 1 95  ? 4.998   -15.993 8.541   1.00 0.00 ? 95  SER A H    4  
ATOM 7804  H HA   . SER A 1 95  ? 2.838   -17.693 7.608   1.00 0.00 ? 95  SER A HA   4  
ATOM 7805  H HB2  . SER A 1 95  ? 3.044   -14.745 8.293   1.00 0.00 ? 95  SER A HB2  4  
ATOM 7806  H HB3  . SER A 1 95  ? 1.709   -15.339 7.326   1.00 0.00 ? 95  SER A HB3  4  
ATOM 7807  H HG   . SER A 1 95  ? 1.136   -16.788 9.054   1.00 0.00 ? 95  SER A HG   4  
ATOM 7808  N N    . GLY A 1 96  ? 3.776   -17.513 5.277   1.00 0.00 ? 96  GLY A N    4  
ATOM 7809  C CA   . GLY A 1 96  ? 4.092   -17.390 3.864   1.00 0.00 ? 96  GLY A CA   4  
ATOM 7810  C C    . GLY A 1 96  ? 3.441   -18.514 3.056   1.00 0.00 ? 96  GLY A C    4  
ATOM 7811  O O    . GLY A 1 96  ? 4.123   -19.238 2.331   1.00 0.00 ? 96  GLY A O    4  
ATOM 7812  H H    . GLY A 1 96  ? 3.640   -18.450 5.599   1.00 0.00 ? 96  GLY A H    4  
ATOM 7813  H HA2  . GLY A 1 96  ? 3.748   -16.424 3.493   1.00 0.00 ? 96  GLY A HA2  4  
ATOM 7814  H HA3  . GLY A 1 96  ? 5.173   -17.417 3.726   1.00 0.00 ? 96  GLY A HA3  4  
ATOM 7815  N N    . SER A 1 97  ? 2.130   -18.625 3.207   1.00 0.00 ? 97  SER A N    4  
ATOM 7816  C CA   . SER A 1 97  ? 1.379   -19.648 2.500   1.00 0.00 ? 97  SER A CA   4  
ATOM 7817  C C    . SER A 1 97  ? 0.059   -19.069 1.987   1.00 0.00 ? 97  SER A C    4  
ATOM 7818  O O    . SER A 1 97  ? -0.271  -19.213 0.811   1.00 0.00 ? 97  SER A O    4  
ATOM 7819  C CB   . SER A 1 97  ? 1.114   -20.857 3.400   1.00 0.00 ? 97  SER A CB   4  
ATOM 7820  O OG   . SER A 1 97  ? 1.552   -22.074 2.802   1.00 0.00 ? 97  SER A OG   4  
ATOM 7821  H H    . SER A 1 97  ? 1.583   -18.032 3.798   1.00 0.00 ? 97  SER A H    4  
ATOM 7822  H HA   . SER A 1 97  ? 2.014   -19.949 1.667   1.00 0.00 ? 97  SER A HA   4  
ATOM 7823  H HB2  . SER A 1 97  ? 1.623   -20.718 4.354   1.00 0.00 ? 97  SER A HB2  4  
ATOM 7824  H HB3  . SER A 1 97  ? 0.047   -20.922 3.615   1.00 0.00 ? 97  SER A HB3  4  
ATOM 7825  H HG   . SER A 1 97  ? 0.975   -22.832 3.106   1.00 0.00 ? 97  SER A HG   4  
ATOM 7826  N N    . ASN A 1 98  ? -0.661  -18.426 2.895   1.00 0.00 ? 98  ASN A N    4  
ATOM 7827  C CA   . ASN A 1 98  ? -1.937  -17.825 2.550   1.00 0.00 ? 98  ASN A CA   4  
ATOM 7828  C C    . ASN A 1 98  ? -1.941  -16.359 2.988   1.00 0.00 ? 98  ASN A C    4  
ATOM 7829  O O    . ASN A 1 98  ? -1.635  -16.050 4.138   1.00 0.00 ? 98  ASN A O    4  
ATOM 7830  C CB   . ASN A 1 98  ? -3.091  -18.533 3.262   1.00 0.00 ? 98  ASN A CB   4  
ATOM 7831  C CG   . ASN A 1 98  ? -3.678  -19.642 2.386   1.00 0.00 ? 98  ASN A CG   4  
ATOM 7832  O OD1  . ASN A 1 98  ? -4.275  -19.400 1.350   1.00 0.00 ? 98  ASN A OD1  4  
ATOM 7833  N ND2  . ASN A 1 98  ? -3.476  -20.869 2.858   1.00 0.00 ? 98  ASN A ND2  4  
ATOM 7834  H H    . ASN A 1 98  ? -0.386  -18.314 3.850   1.00 0.00 ? 98  ASN A H    4  
ATOM 7835  H HA   . ASN A 1 98  ? -2.024  -17.937 1.469   1.00 0.00 ? 98  ASN A HA   4  
ATOM 7836  H HB2  . ASN A 1 98  ? -2.738  -18.956 4.202   1.00 0.00 ? 98  ASN A HB2  4  
ATOM 7837  H HB3  . ASN A 1 98  ? -3.869  -17.811 3.510   1.00 0.00 ? 98  ASN A HB3  4  
ATOM 7838  H HD21 . ASN A 1 98  ? -2.977  -20.998 3.715   1.00 0.00 ? 98  ASN A HD21 4  
ATOM 7839  H HD22 . ASN A 1 98  ? -3.822  -21.661 2.356   1.00 0.00 ? 98  ASN A HD22 4  
ATOM 7840  N N    . LEU A 1 99  ? -2.290  -15.494 2.047   1.00 0.00 ? 99  LEU A N    4  
ATOM 7841  C CA   . LEU A 1 99  ? -2.337  -14.068 2.321   1.00 0.00 ? 99  LEU A CA   4  
ATOM 7842  C C    . LEU A 1 99  ? -3.093  -13.829 3.630   1.00 0.00 ? 99  LEU A C    4  
ATOM 7843  O O    . LEU A 1 99  ? -3.885  -14.668 4.055   1.00 0.00 ? 99  LEU A O    4  
ATOM 7844  C CB   . LEU A 1 99  ? -2.922  -13.311 1.126   1.00 0.00 ? 99  LEU A CB   4  
ATOM 7845  C CG   . LEU A 1 99  ? -2.122  -13.391 -0.175  1.00 0.00 ? 99  LEU A CG   4  
ATOM 7846  C CD1  . LEU A 1 99  ? -2.987  -13.002 -1.375  1.00 0.00 ? 99  LEU A CD1  4  
ATOM 7847  C CD2  . LEU A 1 99  ? -0.848  -12.547 -0.089  1.00 0.00 ? 99  LEU A CD2  4  
ATOM 7848  H H    . LEU A 1 99  ? -2.538  -15.753 1.113   1.00 0.00 ? 99  LEU A H    4  
ATOM 7849  H HA   . LEU A 1 99  ? -1.310  -13.725 2.448   1.00 0.00 ? 99  LEU A HA   4  
ATOM 7850  H HB2  . LEU A 1 99  ? -3.926  -13.692 0.937   1.00 0.00 ? 99  LEU A HB2  4  
ATOM 7851  H HB3  . LEU A 1 99  ? -3.026  -12.262 1.402   1.00 0.00 ? 99  LEU A HB3  4  
ATOM 7852  H HG   . LEU A 1 99  ? -1.813  -14.426 -0.323  1.00 0.00 ? 99  LEU A HG   4  
ATOM 7853  H HD11 . LEU A 1 99  ? -2.788  -11.965 -1.646  1.00 0.00 ? 99  LEU A HD11 4  
ATOM 7854  H HD12 . LEU A 1 99  ? -2.749  -13.649 -2.220  1.00 0.00 ? 99  LEU A HD12 4  
ATOM 7855  H HD13 . LEU A 1 99  ? -4.040  -13.114 -1.116  1.00 0.00 ? 99  LEU A HD13 4  
ATOM 7856  H HD21 . LEU A 1 99  ? -0.336  -12.564 -1.050  1.00 0.00 ? 99  LEU A HD21 4  
ATOM 7857  H HD22 . LEU A 1 99  ? -1.110  -11.520 0.166   1.00 0.00 ? 99  LEU A HD22 4  
ATOM 7858  H HD23 . LEU A 1 99  ? -0.193  -12.957 0.680   1.00 0.00 ? 99  LEU A HD23 4  
ATOM 7859  N N    . PRO A 1 100 ? -2.814  -12.650 4.248   1.00 0.00 ? 100 PRO A N    4  
ATOM 7860  C CA   . PRO A 1 100 ? -3.458  -12.291 5.499   1.00 0.00 ? 100 PRO A CA   4  
ATOM 7861  C C    . PRO A 1 100 ? -4.909  -11.865 5.267   1.00 0.00 ? 100 PRO A C    4  
ATOM 7862  O O    . PRO A 1 100 ? -5.303  -11.581 4.136   1.00 0.00 ? 100 PRO A O    4  
ATOM 7863  C CB   . PRO A 1 100 ? -2.599  -11.179 6.079   1.00 0.00 ? 100 PRO A CB   4  
ATOM 7864  C CG   . PRO A 1 100 ? -1.777  -10.640 4.920   1.00 0.00 ? 100 PRO A CG   4  
ATOM 7865  C CD   . PRO A 1 100 ? -1.881  -11.632 3.773   1.00 0.00 ? 100 PRO A CD   4  
ATOM 7866  H HA   . PRO A 1 100 ? -3.500  -13.083 6.108   1.00 0.00 ? 100 PRO A HA   4  
ATOM 7867  H HB2  . PRO A 1 100 ? -3.217  -10.396 6.518   1.00 0.00 ? 100 PRO A HB2  4  
ATOM 7868  H HB3  . PRO A 1 100 ? -1.954  -11.557 6.873   1.00 0.00 ? 100 PRO A HB3  4  
ATOM 7869  H HG2  . PRO A 1 100 ? -2.146  -9.662  4.613   1.00 0.00 ? 100 PRO A HG2  4  
ATOM 7870  H HG3  . PRO A 1 100 ? -0.737  -10.509 5.218   1.00 0.00 ? 100 PRO A HG3  4  
ATOM 7871  H HD2  . PRO A 1 100 ? -2.247  -11.152 2.866   1.00 0.00 ? 100 PRO A HD2  4  
ATOM 7872  H HD3  . PRO A 1 100 ? -0.910  -12.066 3.535   1.00 0.00 ? 100 PRO A HD3  4  
ATOM 7873  N N    . SER A 1 101 ? -5.665  -11.834 6.355   1.00 0.00 ? 101 SER A N    4  
ATOM 7874  C CA   . SER A 1 101 ? -7.064  -11.447 6.283   1.00 0.00 ? 101 SER A CA   4  
ATOM 7875  C C    . SER A 1 101 ? -7.317  -10.232 7.177   1.00 0.00 ? 101 SER A C    4  
ATOM 7876  O O    . SER A 1 101 ? -7.012  -10.259 8.368   1.00 0.00 ? 101 SER A O    4  
ATOM 7877  C CB   . SER A 1 101 ? -7.977  -12.606 6.691   1.00 0.00 ? 101 SER A CB   4  
ATOM 7878  O OG   . SER A 1 101 ? -7.538  -13.848 6.147   1.00 0.00 ? 101 SER A OG   4  
ATOM 7879  H H    . SER A 1 101 ? -5.337  -12.066 7.270   1.00 0.00 ? 101 SER A H    4  
ATOM 7880  H HA   . SER A 1 101 ? -7.241  -11.197 5.237   1.00 0.00 ? 101 SER A HA   4  
ATOM 7881  H HB2  . SER A 1 101 ? -8.009  -12.677 7.778   1.00 0.00 ? 101 SER A HB2  4  
ATOM 7882  H HB3  . SER A 1 101 ? -8.993  -12.402 6.354   1.00 0.00 ? 101 SER A HB3  4  
ATOM 7883  H HG   . SER A 1 101 ? -6.665  -14.112 6.558   1.00 0.00 ? 101 SER A HG   4  
ATOM 7884  N N    . SER A 1 102 ? -7.873  -9.195  6.568   1.00 0.00 ? 102 SER A N    4  
ATOM 7885  C CA   . SER A 1 102 ? -8.171  -7.972  7.293   1.00 0.00 ? 102 SER A CA   4  
ATOM 7886  C C    . SER A 1 102 ? -9.326  -8.210  8.268   1.00 0.00 ? 102 SER A C    4  
ATOM 7887  O O    . SER A 1 102 ? -10.257 -8.953  7.963   1.00 0.00 ? 102 SER A O    4  
ATOM 7888  C CB   . SER A 1 102 ? -8.514  -6.831  6.333   1.00 0.00 ? 102 SER A CB   4  
ATOM 7889  O OG   . SER A 1 102 ? -9.347  -7.267  5.263   1.00 0.00 ? 102 SER A OG   4  
ATOM 7890  H H    . SER A 1 102 ? -8.118  -9.181  5.598   1.00 0.00 ? 102 SER A H    4  
ATOM 7891  H HA   . SER A 1 102 ? -7.257  -7.728  7.835   1.00 0.00 ? 102 SER A HA   4  
ATOM 7892  H HB2  . SER A 1 102 ? -9.016  -6.034  6.882   1.00 0.00 ? 102 SER A HB2  4  
ATOM 7893  H HB3  . SER A 1 102 ? -7.594  -6.409  5.928   1.00 0.00 ? 102 SER A HB3  4  
ATOM 7894  H HG   . SER A 1 102 ? -10.305 -7.079  5.477   1.00 0.00 ? 102 SER A HG   4  
ATOM 7895  N N    . THR A 1 103 ? -9.227  -7.566  9.422   1.00 0.00 ? 103 THR A N    4  
ATOM 7896  C CA   . THR A 1 103 ? -10.251 -7.698  10.443  1.00 0.00 ? 103 THR A CA   4  
ATOM 7897  C C    . THR A 1 103 ? -11.135 -6.450  10.477  1.00 0.00 ? 103 THR A C    4  
ATOM 7898  O O    . THR A 1 103 ? -11.739 -6.141  11.503  1.00 0.00 ? 103 THR A O    4  
ATOM 7899  C CB   . THR A 1 103 ? -9.556  -7.987  11.776  1.00 0.00 ? 103 THR A CB   4  
ATOM 7900  O OG1  . THR A 1 103 ? -8.730  -6.847  11.990  1.00 0.00 ? 103 THR A OG1  4  
ATOM 7901  C CG2  . THR A 1 103 ? -8.568  -9.151  11.680  1.00 0.00 ? 103 THR A CG2  4  
ATOM 7902  H H    . THR A 1 103 ? -8.465  -6.963  9.662   1.00 0.00 ? 103 THR A H    4  
ATOM 7903  H HA   . THR A 1 103 ? -10.894 -8.538  10.179  1.00 0.00 ? 103 THR A HA   4  
ATOM 7904  H HB   . THR A 1 103 ? -10.286 -8.160  12.566  1.00 0.00 ? 103 THR A HB   4  
ATOM 7905  H HG1  . THR A 1 103 ? -8.156  -6.987  12.797  1.00 0.00 ? 103 THR A HG1  4  
ATOM 7906  H HG21 . THR A 1 103 ? -8.200  -9.398  12.676  1.00 0.00 ? 103 THR A HG21 4  
ATOM 7907  H HG22 . THR A 1 103 ? -9.069  -10.019 11.252  1.00 0.00 ? 103 THR A HG22 4  
ATOM 7908  H HG23 . THR A 1 103 ? -7.730  -8.865  11.044  1.00 0.00 ? 103 THR A HG23 4  
ATOM 7909  N N    . ARG A 1 104 ? -11.183 -5.767  9.343   1.00 0.00 ? 104 ARG A N    4  
ATOM 7910  C CA   . ARG A 1 104 ? -11.983 -4.559  9.230   1.00 0.00 ? 104 ARG A CA   4  
ATOM 7911  C C    . ARG A 1 104 ? -12.324 -4.283  7.765   1.00 0.00 ? 104 ARG A C    4  
ATOM 7912  O O    . ARG A 1 104 ? -11.575 -4.666  6.867   1.00 0.00 ? 104 ARG A O    4  
ATOM 7913  C CB   . ARG A 1 104 ? -11.242 -3.352  9.810   1.00 0.00 ? 104 ARG A CB   4  
ATOM 7914  C CG   . ARG A 1 104 ? -10.083 -2.933  8.904   1.00 0.00 ? 104 ARG A CG   4  
ATOM 7915  C CD   . ARG A 1 104 ? -10.179 -1.449  8.541   1.00 0.00 ? 104 ARG A CD   4  
ATOM 7916  N NE   . ARG A 1 104 ? -9.156  -0.679  9.284   1.00 0.00 ? 104 ARG A NE   4  
ATOM 7917  C CZ   . ARG A 1 104 ? -9.337  -0.181  10.514  1.00 0.00 ? 104 ARG A CZ   4  
ATOM 7918  N NH1  . ARG A 1 104 ? -10.503 -0.370  11.149  1.00 0.00 ? 104 ARG A NH1  4  
ATOM 7919  N NH2  . ARG A 1 104 ? -8.353  0.505   11.111  1.00 0.00 ? 104 ARG A NH2  4  
ATOM 7920  H H    . ARG A 1 104 ? -10.688 -6.025  8.514   1.00 0.00 ? 104 ARG A H    4  
ATOM 7921  H HA   . ARG A 1 104 ? -12.882 -4.765  9.810   1.00 0.00 ? 104 ARG A HA   4  
ATOM 7922  H HB2  . ARG A 1 104 ? -11.935 -2.519  9.929   1.00 0.00 ? 104 ARG A HB2  4  
ATOM 7923  H HB3  . ARG A 1 104 ? -10.863 -3.595  10.803  1.00 0.00 ? 104 ARG A HB3  4  
ATOM 7924  H HG2  . ARG A 1 104 ? -9.135  -3.127  9.407   1.00 0.00 ? 104 ARG A HG2  4  
ATOM 7925  H HG3  . ARG A 1 104 ? -10.091 -3.534  7.995   1.00 0.00 ? 104 ARG A HG3  4  
ATOM 7926  H HD2  . ARG A 1 104 ? -10.037 -1.319  7.468   1.00 0.00 ? 104 ARG A HD2  4  
ATOM 7927  H HD3  . ARG A 1 104 ? -11.174 -1.072  8.779   1.00 0.00 ? 104 ARG A HD3  4  
ATOM 7928  H HE   . ARG A 1 104 ? -8.275  -0.520  8.839   1.00 0.00 ? 104 ARG A HE   4  
ATOM 7929  H HH11 . ARG A 1 104 ? -11.237 -0.882  10.703  1.00 0.00 ? 104 ARG A HH11 4  
ATOM 7930  H HH12 . ARG A 1 104 ? -10.638 0.002   12.067  1.00 0.00 ? 104 ARG A HH12 4  
ATOM 7931  H HH21 . ARG A 1 104 ? -7.483  0.645   10.638  1.00 0.00 ? 104 ARG A HH21 4  
ATOM 7932  H HH22 . ARG A 1 104 ? -8.488  0.876   12.030  1.00 0.00 ? 104 ARG A HH22 4  
ATOM 7933  N N    . THR A 1 105 ? -13.454 -3.621  7.568   1.00 0.00 ? 105 THR A N    4  
ATOM 7934  C CA   . THR A 1 105 ? -13.904 -3.290  6.226   1.00 0.00 ? 105 THR A CA   4  
ATOM 7935  C C    . THR A 1 105 ? -13.945 -1.772  6.037   1.00 0.00 ? 105 THR A C    4  
ATOM 7936  O O    . THR A 1 105 ? -14.405 -1.046  6.917   1.00 0.00 ? 105 THR A O    4  
ATOM 7937  C CB   . THR A 1 105 ? -15.257 -3.967  6.000   1.00 0.00 ? 105 THR A CB   4  
ATOM 7938  O OG1  . THR A 1 105 ? -14.942 -5.355  5.922   1.00 0.00 ? 105 THR A OG1  4  
ATOM 7939  C CG2  . THR A 1 105 ? -15.853 -3.643  4.629   1.00 0.00 ? 105 THR A CG2  4  
ATOM 7940  H H    . THR A 1 105 ? -14.057 -3.313  8.304   1.00 0.00 ? 105 THR A H    4  
ATOM 7941  H HA   . THR A 1 105 ? -13.178 -3.682  5.514   1.00 0.00 ? 105 THR A HA   4  
ATOM 7942  H HB   . THR A 1 105 ? -15.956 -3.716  6.798   1.00 0.00 ? 105 THR A HB   4  
ATOM 7943  H HG1  . THR A 1 105 ? -15.770 -5.901  6.047   1.00 0.00 ? 105 THR A HG1  4  
ATOM 7944  H HG21 . THR A 1 105 ? -16.056 -4.570  4.093   1.00 0.00 ? 105 THR A HG21 4  
ATOM 7945  H HG22 . THR A 1 105 ? -16.781 -3.087  4.758   1.00 0.00 ? 105 THR A HG22 4  
ATOM 7946  H HG23 . THR A 1 105 ? -15.145 -3.041  4.059   1.00 0.00 ? 105 THR A HG23 4  
ATOM 7947  N N    . VAL A 1 106 ? -13.458 -1.339  4.884   1.00 0.00 ? 106 VAL A N    4  
ATOM 7948  C CA   . VAL A 1 106 ? -13.433 0.079   4.568   1.00 0.00 ? 106 VAL A CA   4  
ATOM 7949  C C    . VAL A 1 106 ? -13.923 0.286   3.133   1.00 0.00 ? 106 VAL A C    4  
ATOM 7950  O O    . VAL A 1 106 ? -13.820 -0.615  2.302   1.00 0.00 ? 106 VAL A O    4  
ATOM 7951  C CB   . VAL A 1 106 ? -12.032 0.645   4.809   1.00 0.00 ? 106 VAL A CB   4  
ATOM 7952  C CG1  . VAL A 1 106 ? -11.903 2.055   4.229   1.00 0.00 ? 106 VAL A CG1  4  
ATOM 7953  C CG2  . VAL A 1 106 ? -11.684 0.631   6.299   1.00 0.00 ? 106 VAL A CG2  4  
ATOM 7954  H H    . VAL A 1 106 ? -13.086 -1.936  4.174   1.00 0.00 ? 106 VAL A H    4  
ATOM 7955  H HA   . VAL A 1 106 ? -14.121 0.580   5.249   1.00 0.00 ? 106 VAL A HA   4  
ATOM 7956  H HB   . VAL A 1 106 ? -11.318 0.003   4.292   1.00 0.00 ? 106 VAL A HB   4  
ATOM 7957  H HG11 . VAL A 1 106 ? -11.040 2.552   4.672   1.00 0.00 ? 106 VAL A HG11 4  
ATOM 7958  H HG12 . VAL A 1 106 ? -11.771 1.992   3.148   1.00 0.00 ? 106 VAL A HG12 4  
ATOM 7959  H HG13 . VAL A 1 106 ? -12.805 2.624   4.452   1.00 0.00 ? 106 VAL A HG13 4  
ATOM 7960  H HG21 . VAL A 1 106 ? -12.476 1.126   6.861   1.00 0.00 ? 106 VAL A HG21 4  
ATOM 7961  H HG22 . VAL A 1 106 ? -11.587 -0.400  6.639   1.00 0.00 ? 106 VAL A HG22 4  
ATOM 7962  H HG23 . VAL A 1 106 ? -10.743 1.157   6.457   1.00 0.00 ? 106 VAL A HG23 4  
ATOM 7963  N N    . LYS A 1 107 ? -14.444 1.479   2.886   1.00 0.00 ? 107 LYS A N    4  
ATOM 7964  C CA   . LYS A 1 107 ? -14.950 1.816   1.566   1.00 0.00 ? 107 LYS A CA   4  
ATOM 7965  C C    . LYS A 1 107 ? -14.597 3.270   1.245   1.00 0.00 ? 107 LYS A C    4  
ATOM 7966  O O    . LYS A 1 107 ? -14.358 4.068   2.150   1.00 0.00 ? 107 LYS A O    4  
ATOM 7967  C CB   . LYS A 1 107 ? -16.446 1.511   1.471   1.00 0.00 ? 107 LYS A CB   4  
ATOM 7968  C CG   . LYS A 1 107 ? -16.837 1.123   0.044   1.00 0.00 ? 107 LYS A CG   4  
ATOM 7969  C CD   . LYS A 1 107 ? -18.178 1.748   -0.347  1.00 0.00 ? 107 LYS A CD   4  
ATOM 7970  C CE   . LYS A 1 107 ? -17.970 3.035   -1.147  1.00 0.00 ? 107 LYS A CE   4  
ATOM 7971  N NZ   . LYS A 1 107 ? -19.172 3.344   -1.953  1.00 0.00 ? 107 LYS A NZ   4  
ATOM 7972  H H    . LYS A 1 107 ? -14.524 2.207   3.567   1.00 0.00 ? 107 LYS A H    4  
ATOM 7973  H HA   . LYS A 1 107 ? -14.443 1.171   0.848   1.00 0.00 ? 107 LYS A HA   4  
ATOM 7974  H HB2  . LYS A 1 107 ? -16.700 0.700   2.155   1.00 0.00 ? 107 LYS A HB2  4  
ATOM 7975  H HB3  . LYS A 1 107 ? -17.019 2.383   1.785   1.00 0.00 ? 107 LYS A HB3  4  
ATOM 7976  H HG2  . LYS A 1 107 ? -16.063 1.450   -0.651  1.00 0.00 ? 107 LYS A HG2  4  
ATOM 7977  H HG3  . LYS A 1 107 ? -16.901 0.038   -0.037  1.00 0.00 ? 107 LYS A HG3  4  
ATOM 7978  H HD2  . LYS A 1 107 ? -18.756 1.038   -0.937  1.00 0.00 ? 107 LYS A HD2  4  
ATOM 7979  H HD3  . LYS A 1 107 ? -18.758 1.964   0.551   1.00 0.00 ? 107 LYS A HD3  4  
ATOM 7980  H HE2  . LYS A 1 107 ? -17.756 3.862   -0.469  1.00 0.00 ? 107 LYS A HE2  4  
ATOM 7981  H HE3  . LYS A 1 107 ? -17.104 2.928   -1.801  1.00 0.00 ? 107 LYS A HE3  4  
ATOM 7982  H HZ1  . LYS A 1 107 ? -18.986 4.133   -2.539  1.00 0.00 ? 107 LYS A HZ1  4  
ATOM 7983  H HZ2  . LYS A 1 107 ? -19.404 2.555   -2.521  1.00 0.00 ? 107 LYS A HZ2  4  
ATOM 7984  H HZ3  . LYS A 1 107 ? -19.937 3.554   -1.344  1.00 0.00 ? 107 LYS A HZ3  4  
ATOM 7985  N N    . ALA A 1 108 ? -14.576 3.569   -0.045  1.00 0.00 ? 108 ALA A N    4  
ATOM 7986  C CA   . ALA A 1 108 ? -14.257 4.913   -0.496  1.00 0.00 ? 108 ALA A CA   4  
ATOM 7987  C C    . ALA A 1 108 ? -15.543 5.621   -0.927  1.00 0.00 ? 108 ALA A C    4  
ATOM 7988  O O    . ALA A 1 108 ? -16.167 5.235   -1.915  1.00 0.00 ? 108 ALA A O    4  
ATOM 7989  C CB   . ALA A 1 108 ? -13.225 4.842   -1.624  1.00 0.00 ? 108 ALA A CB   4  
ATOM 7990  H H    . ALA A 1 108 ? -14.771 2.914   -0.775  1.00 0.00 ? 108 ALA A H    4  
ATOM 7991  H HA   . ALA A 1 108 ? -13.820 5.451   0.345   1.00 0.00 ? 108 ALA A HA   4  
ATOM 7992  H HB1  . ALA A 1 108 ? -12.558 5.701   -1.561  1.00 0.00 ? 108 ALA A HB1  4  
ATOM 7993  H HB2  . ALA A 1 108 ? -12.645 3.924   -1.528  1.00 0.00 ? 108 ALA A HB2  4  
ATOM 7994  H HB3  . ALA A 1 108 ? -13.737 4.849   -2.586  1.00 0.00 ? 108 ALA A HB3  4  
ATOM 7995  N N    . LEU A 1 109 ? -15.901 6.644   -0.165  1.00 0.00 ? 109 LEU A N    4  
ATOM 7996  C CA   . LEU A 1 109 ? -17.102 7.409   -0.456  1.00 0.00 ? 109 LEU A CA   4  
ATOM 7997  C C    . LEU A 1 109 ? -16.726 8.653   -1.263  1.00 0.00 ? 109 LEU A C    4  
ATOM 7998  O O    . LEU A 1 109 ? -17.566 9.227   -1.954  1.00 0.00 ? 109 LEU A O    4  
ATOM 7999  C CB   . LEU A 1 109 ? -17.865 7.719   0.833   1.00 0.00 ? 109 LEU A CB   4  
ATOM 8000  C CG   . LEU A 1 109 ? -17.786 6.657   1.931   1.00 0.00 ? 109 LEU A CG   4  
ATOM 8001  C CD1  . LEU A 1 109 ? -16.702 7.004   2.954   1.00 0.00 ? 109 LEU A CD1  4  
ATOM 8002  C CD2  . LEU A 1 109 ? -19.151 6.448   2.591   1.00 0.00 ? 109 LEU A CD2  4  
ATOM 8003  H H    . LEU A 1 109 ? -15.388 6.951   0.636   1.00 0.00 ? 109 LEU A H    4  
ATOM 8004  H HA   . LEU A 1 109 ? -17.748 6.782   -1.070  1.00 0.00 ? 109 LEU A HA   4  
ATOM 8005  H HB2  . LEU A 1 109 ? -17.489 8.659   1.237   1.00 0.00 ? 109 LEU A HB2  4  
ATOM 8006  H HB3  . LEU A 1 109 ? -18.914 7.877   0.582   1.00 0.00 ? 109 LEU A HB3  4  
ATOM 8007  H HG   . LEU A 1 109 ? -17.503 5.710   1.471   1.00 0.00 ? 109 LEU A HG   4  
ATOM 8008  H HD11 . LEU A 1 109 ? -17.169 7.375   3.866   1.00 0.00 ? 109 LEU A HD11 4  
ATOM 8009  H HD12 . LEU A 1 109 ? -16.119 6.112   3.181   1.00 0.00 ? 109 LEU A HD12 4  
ATOM 8010  H HD13 . LEU A 1 109 ? -16.047 7.771   2.542   1.00 0.00 ? 109 LEU A HD13 4  
ATOM 8011  H HD21 . LEU A 1 109 ? -19.017 5.963   3.558   1.00 0.00 ? 109 LEU A HD21 4  
ATOM 8012  H HD22 . LEU A 1 109 ? -19.637 7.414   2.734   1.00 0.00 ? 109 LEU A HD22 4  
ATOM 8013  H HD23 . LEU A 1 109 ? -19.771 5.820   1.952   1.00 0.00 ? 109 LEU A HD23 4  
ATOM 8014  N N    . THR A 1 110 ? -15.462 9.034   -1.148  1.00 0.00 ? 110 THR A N    4  
ATOM 8015  C CA   . THR A 1 110 ? -14.964 10.200  -1.858  1.00 0.00 ? 110 THR A CA   4  
ATOM 8016  C C    . THR A 1 110 ? -13.590 9.909   -2.464  1.00 0.00 ? 110 THR A C    4  
ATOM 8017  O O    . THR A 1 110 ? -13.044 8.822   -2.280  1.00 0.00 ? 110 THR A O    4  
ATOM 8018  C CB   . THR A 1 110 ? -14.961 11.381  -0.885  1.00 0.00 ? 110 THR A CB   4  
ATOM 8019  O OG1  . THR A 1 110 ? -14.266 12.407  -1.586  1.00 0.00 ? 110 THR A OG1  4  
ATOM 8020  C CG2  . THR A 1 110 ? -14.096 11.120  0.350   1.00 0.00 ? 110 THR A CG2  4  
ATOM 8021  H H    . THR A 1 110 ? -14.785 8.562   -0.583  1.00 0.00 ? 110 THR A H    4  
ATOM 8022  H HA   . THR A 1 110 ? -15.640 10.413  -2.686  1.00 0.00 ? 110 THR A HA   4  
ATOM 8023  H HB   . THR A 1 110 ? -15.978 11.651  -0.598  1.00 0.00 ? 110 THR A HB   4  
ATOM 8024  H HG1  . THR A 1 110 ? -14.097 13.183  -0.979  1.00 0.00 ? 110 THR A HG1  4  
ATOM 8025  H HG21 . THR A 1 110 ? -14.289 11.889  1.098   1.00 0.00 ? 110 THR A HG21 4  
ATOM 8026  H HG22 . THR A 1 110 ? -14.337 10.141  0.763   1.00 0.00 ? 110 THR A HG22 4  
ATOM 8027  H HG23 . THR A 1 110 ? -13.043 11.145  0.067   1.00 0.00 ? 110 THR A HG23 4  
ATOM 8028  N N    . GLU A 1 111 ? -13.070 10.899  -3.174  1.00 0.00 ? 111 GLU A N    4  
ATOM 8029  C CA   . GLU A 1 111 ? -11.769 10.763  -3.808  1.00 0.00 ? 111 GLU A CA   4  
ATOM 8030  C C    . GLU A 1 111 ? -10.667 10.698  -2.749  1.00 0.00 ? 111 GLU A C    4  
ATOM 8031  O O    . GLU A 1 111 ? -10.415 11.677  -2.048  1.00 0.00 ? 111 GLU A O    4  
ATOM 8032  C CB   . GLU A 1 111 ? -11.517 11.907  -4.792  1.00 0.00 ? 111 GLU A CB   4  
ATOM 8033  C CG   . GLU A 1 111 ? -10.644 11.443  -5.959  1.00 0.00 ? 111 GLU A CG   4  
ATOM 8034  C CD   . GLU A 1 111 ? -10.853 12.331  -7.188  1.00 0.00 ? 111 GLU A CD   4  
ATOM 8035  O OE1  . GLU A 1 111 ? -11.994 12.335  -7.698  1.00 0.00 ? 111 GLU A OE1  4  
ATOM 8036  O OE2  . GLU A 1 111 ? -9.866  12.986  -7.589  1.00 0.00 ? 111 GLU A OE2  4  
ATOM 8037  H H    . GLU A 1 111 ? -13.520 11.781  -3.318  1.00 0.00 ? 111 GLU A H    4  
ATOM 8038  H HA   . GLU A 1 111 ? -11.812 9.822   -4.356  1.00 0.00 ? 111 GLU A HA   4  
ATOM 8039  H HB2  . GLU A 1 111 ? -12.468 12.282  -5.171  1.00 0.00 ? 111 GLU A HB2  4  
ATOM 8040  H HB3  . GLU A 1 111 ? -11.031 12.735  -4.277  1.00 0.00 ? 111 GLU A HB3  4  
ATOM 8041  H HG2  . GLU A 1 111 ? -9.595  11.465  -5.665  1.00 0.00 ? 111 GLU A HG2  4  
ATOM 8042  H HG3  . GLU A 1 111 ? -10.883 10.409  -6.209  1.00 0.00 ? 111 GLU A HG3  4  
ATOM 8043  N N    . VAL A 1 112 ? -10.039 9.534   -2.666  1.00 0.00 ? 112 VAL A N    4  
ATOM 8044  C CA   . VAL A 1 112 ? -8.969  9.329   -1.704  1.00 0.00 ? 112 VAL A CA   4  
ATOM 8045  C C    . VAL A 1 112 ? -7.630  9.273   -2.442  1.00 0.00 ? 112 VAL A C    4  
ATOM 8046  O O    . VAL A 1 112 ? -7.528  8.664   -3.506  1.00 0.00 ? 112 VAL A O    4  
ATOM 8047  C CB   . VAL A 1 112 ? -9.246  8.074   -0.873  1.00 0.00 ? 112 VAL A CB   4  
ATOM 8048  C CG1  . VAL A 1 112 ? -8.192  7.898   0.222   1.00 0.00 ? 112 VAL A CG1  4  
ATOM 8049  C CG2  . VAL A 1 112 ? -10.655 8.111   -0.278  1.00 0.00 ? 112 VAL A CG2  4  
ATOM 8050  H H    . VAL A 1 112 ? -10.249 8.743   -3.239  1.00 0.00 ? 112 VAL A H    4  
ATOM 8051  H HA   . VAL A 1 112 ? -8.963  10.185  -1.030  1.00 0.00 ? 112 VAL A HA   4  
ATOM 8052  H HB   . VAL A 1 112 ? -9.186  7.212   -1.538  1.00 0.00 ? 112 VAL A HB   4  
ATOM 8053  H HG11 . VAL A 1 112 ? -8.002  6.836   0.376   1.00 0.00 ? 112 VAL A HG11 4  
ATOM 8054  H HG12 . VAL A 1 112 ? -7.269  8.393   -0.079  1.00 0.00 ? 112 VAL A HG12 4  
ATOM 8055  H HG13 . VAL A 1 112 ? -8.556  8.340   1.150   1.00 0.00 ? 112 VAL A HG13 4  
ATOM 8056  H HG21 . VAL A 1 112 ? -11.314 8.673   -0.940  1.00 0.00 ? 112 VAL A HG21 4  
ATOM 8057  H HG22 . VAL A 1 112 ? -11.031 7.093   -0.171  1.00 0.00 ? 112 VAL A HG22 4  
ATOM 8058  H HG23 . VAL A 1 112 ? -10.624 8.592   0.699   1.00 0.00 ? 112 VAL A HG23 4  
ATOM 8059  N N    . GLU A 1 113 ? -6.636  9.917   -1.848  1.00 0.00 ? 113 GLU A N    4  
ATOM 8060  C CA   . GLU A 1 113 ? -5.307  9.949   -2.435  1.00 0.00 ? 113 GLU A CA   4  
ATOM 8061  C C    . GLU A 1 113 ? -4.327  9.149   -1.575  1.00 0.00 ? 113 GLU A C    4  
ATOM 8062  O O    . GLU A 1 113 ? -3.983  9.566   -0.470  1.00 0.00 ? 113 GLU A O    4  
ATOM 8063  C CB   . GLU A 1 113 ? -4.824  11.389  -2.622  1.00 0.00 ? 113 GLU A CB   4  
ATOM 8064  C CG   . GLU A 1 113 ? -5.721  12.145  -3.604  1.00 0.00 ? 113 GLU A CG   4  
ATOM 8065  C CD   . GLU A 1 113 ? -5.124  13.510  -3.953  1.00 0.00 ? 113 GLU A CD   4  
ATOM 8066  O OE1  . GLU A 1 113 ? -3.952  13.522  -4.387  1.00 0.00 ? 113 GLU A OE1  4  
ATOM 8067  O OE2  . GLU A 1 113 ? -5.853  14.510  -3.777  1.00 0.00 ? 113 GLU A OE2  4  
ATOM 8068  H H    . GLU A 1 113 ? -6.727  10.411  -0.983  1.00 0.00 ? 113 GLU A H    4  
ATOM 8069  H HA   . GLU A 1 113 ? -5.411  9.478   -3.413  1.00 0.00 ? 113 GLU A HA   4  
ATOM 8070  H HB2  . GLU A 1 113 ? -4.819  11.902  -1.660  1.00 0.00 ? 113 GLU A HB2  4  
ATOM 8071  H HB3  . GLU A 1 113 ? -3.798  11.387  -2.988  1.00 0.00 ? 113 GLU A HB3  4  
ATOM 8072  H HG2  . GLU A 1 113 ? -5.848  11.557  -4.513  1.00 0.00 ? 113 GLU A HG2  4  
ATOM 8073  H HG3  . GLU A 1 113 ? -6.712  12.278  -3.170  1.00 0.00 ? 113 GLU A HG3  4  
ATOM 8074  N N    . ALA A 1 114 ? -3.905  8.015   -2.114  1.00 0.00 ? 114 ALA A N    4  
ATOM 8075  C CA   . ALA A 1 114 ? -2.971  7.153   -1.410  1.00 0.00 ? 114 ALA A CA   4  
ATOM 8076  C C    . ALA A 1 114 ? -2.295  6.214   -2.411  1.00 0.00 ? 114 ALA A C    4  
ATOM 8077  O O    . ALA A 1 114 ? -2.642  6.205   -3.591  1.00 0.00 ? 114 ALA A O    4  
ATOM 8078  C CB   . ALA A 1 114 ? -3.711  6.394   -0.306  1.00 0.00 ? 114 ALA A CB   4  
ATOM 8079  H H    . ALA A 1 114 ? -4.190  7.684   -3.014  1.00 0.00 ? 114 ALA A H    4  
ATOM 8080  H HA   . ALA A 1 114 ? -2.214  7.789   -0.951  1.00 0.00 ? 114 ALA A HA   4  
ATOM 8081  H HB1  . ALA A 1 114 ? -3.443  5.338   -0.350  1.00 0.00 ? 114 ALA A HB1  4  
ATOM 8082  H HB2  . ALA A 1 114 ? -3.429  6.800   0.666   1.00 0.00 ? 114 ALA A HB2  4  
ATOM 8083  H HB3  . ALA A 1 114 ? -4.786  6.503   -0.448  1.00 0.00 ? 114 ALA A HB3  4  
ATOM 8084  N N    . PHE A 1 115 ? -1.342  5.447   -1.903  1.00 0.00 ? 115 PHE A N    4  
ATOM 8085  C CA   . PHE A 1 115 ? -0.614  4.507   -2.738  1.00 0.00 ? 115 PHE A CA   4  
ATOM 8086  C C    . PHE A 1 115 ? -0.913  3.063   -2.328  1.00 0.00 ? 115 PHE A C    4  
ATOM 8087  O O    . PHE A 1 115 ? -1.522  2.824   -1.286  1.00 0.00 ? 115 PHE A O    4  
ATOM 8088  C CB   . PHE A 1 115 ? 0.876   4.785   -2.532  1.00 0.00 ? 115 PHE A CB   4  
ATOM 8089  C CG   . PHE A 1 115 ? 1.332   6.150   -3.052  1.00 0.00 ? 115 PHE A CG   4  
ATOM 8090  C CD1  . PHE A 1 115 ? 1.044   7.277   -2.348  1.00 0.00 ? 115 PHE A CD1  4  
ATOM 8091  C CD2  . PHE A 1 115 ? 2.024   6.236   -4.220  1.00 0.00 ? 115 PHE A CD2  4  
ATOM 8092  C CE1  . PHE A 1 115 ? 1.467   8.544   -2.831  1.00 0.00 ? 115 PHE A CE1  4  
ATOM 8093  C CE2  . PHE A 1 115 ? 2.447   7.502   -4.703  1.00 0.00 ? 115 PHE A CE2  4  
ATOM 8094  C CZ   . PHE A 1 115 ? 2.160   8.630   -3.998  1.00 0.00 ? 115 PHE A CZ   4  
ATOM 8095  H H    . PHE A 1 115 ? -1.066  5.460   -0.942  1.00 0.00 ? 115 PHE A H    4  
ATOM 8096  H HA   . PHE A 1 115 ? -0.942  4.665   -3.766  1.00 0.00 ? 115 PHE A HA   4  
ATOM 8097  H HB2  . PHE A 1 115 ? 1.103   4.719   -1.468  1.00 0.00 ? 115 PHE A HB2  4  
ATOM 8098  H HB3  . PHE A 1 115 ? 1.453   4.007   -3.030  1.00 0.00 ? 115 PHE A HB3  4  
ATOM 8099  H HD1  . PHE A 1 115 ? 0.489   7.209   -1.413  1.00 0.00 ? 115 PHE A HD1  4  
ATOM 8100  H HD2  . PHE A 1 115 ? 2.255   5.332   -4.784  1.00 0.00 ? 115 PHE A HD2  4  
ATOM 8101  H HE1  . PHE A 1 115 ? 1.236   9.447   -2.267  1.00 0.00 ? 115 PHE A HE1  4  
ATOM 8102  H HE2  . PHE A 1 115 ? 3.003   7.571   -5.638  1.00 0.00 ? 115 PHE A HE2  4  
ATOM 8103  H HZ   . PHE A 1 115 ? 2.484   9.602   -4.369  1.00 0.00 ? 115 PHE A HZ   4  
ATOM 8104  N N    . ALA A 1 116 ? -0.470  2.139   -3.167  1.00 0.00 ? 116 ALA A N    4  
ATOM 8105  C CA   . ALA A 1 116 ? -0.682  0.726   -2.904  1.00 0.00 ? 116 ALA A CA   4  
ATOM 8106  C C    . ALA A 1 116 ? 0.645   0.083   -2.494  1.00 0.00 ? 116 ALA A C    4  
ATOM 8107  O O    . ALA A 1 116 ? 1.709   0.670   -2.685  1.00 0.00 ? 116 ALA A O    4  
ATOM 8108  C CB   . ALA A 1 116 ? -1.293  0.063   -4.141  1.00 0.00 ? 116 ALA A CB   4  
ATOM 8109  H H    . ALA A 1 116 ? 0.025   2.342   -4.012  1.00 0.00 ? 116 ALA A H    4  
ATOM 8110  H HA   . ALA A 1 116 ? -1.387  0.644   -2.078  1.00 0.00 ? 116 ALA A HA   4  
ATOM 8111  H HB1  . ALA A 1 116 ? -1.584  -0.959  -3.898  1.00 0.00 ? 116 ALA A HB1  4  
ATOM 8112  H HB2  . ALA A 1 116 ? -2.171  0.625   -4.458  1.00 0.00 ? 116 ALA A HB2  4  
ATOM 8113  H HB3  . ALA A 1 116 ? -0.559  0.050   -4.946  1.00 0.00 ? 116 ALA A HB3  4  
ATOM 8114  N N    . LEU A 1 117 ? 0.538   -1.114  -1.936  1.00 0.00 ? 117 LEU A N    4  
ATOM 8115  C CA   . LEU A 1 117 ? 1.716   -1.842  -1.497  1.00 0.00 ? 117 LEU A CA   4  
ATOM 8116  C C    . LEU A 1 117 ? 1.462   -3.345  -1.635  1.00 0.00 ? 117 LEU A C    4  
ATOM 8117  O O    . LEU A 1 117 ? 0.519   -3.875  -1.050  1.00 0.00 ? 117 LEU A O    4  
ATOM 8118  C CB   . LEU A 1 117 ? 2.114   -1.414  -0.083  1.00 0.00 ? 117 LEU A CB   4  
ATOM 8119  C CG   . LEU A 1 117 ? 3.617   -1.349  0.200   1.00 0.00 ? 117 LEU A CG   4  
ATOM 8120  C CD1  . LEU A 1 117 ? 4.310   -2.646  -0.220  1.00 0.00 ? 117 LEU A CD1  4  
ATOM 8121  C CD2  . LEU A 1 117 ? 4.247   -0.122  -0.463  1.00 0.00 ? 117 LEU A CD2  4  
ATOM 8122  H H    . LEU A 1 117 ? -0.331  -1.584  -1.784  1.00 0.00 ? 117 LEU A H    4  
ATOM 8123  H HA   . LEU A 1 117 ? 2.536   -1.568  -2.160  1.00 0.00 ? 117 LEU A HA   4  
ATOM 8124  H HB2  . LEU A 1 117 ? 1.685   -0.431  0.112   1.00 0.00 ? 117 LEU A HB2  4  
ATOM 8125  H HB3  . LEU A 1 117 ? 1.661   -2.106  0.627   1.00 0.00 ? 117 LEU A HB3  4  
ATOM 8126  H HG   . LEU A 1 117 ? 3.758   -1.241  1.275   1.00 0.00 ? 117 LEU A HG   4  
ATOM 8127  H HD11 . LEU A 1 117 ? 5.123   -2.864  0.473   1.00 0.00 ? 117 LEU A HD11 4  
ATOM 8128  H HD12 . LEU A 1 117 ? 3.590   -3.465  -0.203  1.00 0.00 ? 117 LEU A HD12 4  
ATOM 8129  H HD13 . LEU A 1 117 ? 4.711   -2.535  -1.227  1.00 0.00 ? 117 LEU A HD13 4  
ATOM 8130  H HD21 . LEU A 1 117 ? 5.078   -0.437  -1.095  1.00 0.00 ? 117 LEU A HD21 4  
ATOM 8131  H HD22 . LEU A 1 117 ? 3.499   0.386   -1.073  1.00 0.00 ? 117 LEU A HD22 4  
ATOM 8132  H HD23 . LEU A 1 117 ? 4.613   0.559   0.306   1.00 0.00 ? 117 LEU A HD23 4  
ATOM 8133  N N    . ILE A 1 118 ? 2.321   -3.988  -2.412  1.00 0.00 ? 118 ILE A N    4  
ATOM 8134  C CA   . ILE A 1 118 ? 2.201   -5.419  -2.635  1.00 0.00 ? 118 ILE A CA   4  
ATOM 8135  C C    . ILE A 1 118 ? 2.870   -6.168  -1.480  1.00 0.00 ? 118 ILE A C    4  
ATOM 8136  O O    . ILE A 1 118 ? 3.887   -5.722  -0.952  1.00 0.00 ? 118 ILE A O    4  
ATOM 8137  C CB   . ILE A 1 118 ? 2.752   -5.795  -4.012  1.00 0.00 ? 118 ILE A CB   4  
ATOM 8138  C CG1  . ILE A 1 118 ? 2.825   -7.314  -4.177  1.00 0.00 ? 118 ILE A CG1  4  
ATOM 8139  C CG2  . ILE A 1 118 ? 4.104   -5.125  -4.263  1.00 0.00 ? 118 ILE A CG2  4  
ATOM 8140  C CD1  . ILE A 1 118 ? 3.105   -7.695  -5.632  1.00 0.00 ? 118 ILE A CD1  4  
ATOM 8141  H H    . ILE A 1 118 ? 3.085   -3.550  -2.884  1.00 0.00 ? 118 ILE A H    4  
ATOM 8142  H HA   . ILE A 1 118 ? 1.139   -5.662  -2.635  1.00 0.00 ? 118 ILE A HA   4  
ATOM 8143  H HB   . ILE A 1 118 ? 2.062   -5.422  -4.769  1.00 0.00 ? 118 ILE A HB   4  
ATOM 8144  H HG12 . ILE A 1 118 ? 3.609   -7.716  -3.535  1.00 0.00 ? 118 ILE A HG12 4  
ATOM 8145  H HG13 . ILE A 1 118 ? 1.887   -7.765  -3.854  1.00 0.00 ? 118 ILE A HG13 4  
ATOM 8146  H HG21 . ILE A 1 118 ? 4.522   -4.784  -3.316  1.00 0.00 ? 118 ILE A HG21 4  
ATOM 8147  H HG22 . ILE A 1 118 ? 4.784   -5.841  -4.724  1.00 0.00 ? 118 ILE A HG22 4  
ATOM 8148  H HG23 . ILE A 1 118 ? 3.969   -4.273  -4.929  1.00 0.00 ? 118 ILE A HG23 4  
ATOM 8149  H HD11 . ILE A 1 118 ? 3.884   -7.047  -6.034  1.00 0.00 ? 118 ILE A HD11 4  
ATOM 8150  H HD12 . ILE A 1 118 ? 3.434   -8.733  -5.680  1.00 0.00 ? 118 ILE A HD12 4  
ATOM 8151  H HD13 . ILE A 1 118 ? 2.195   -7.575  -6.220  1.00 0.00 ? 118 ILE A HD13 4  
ATOM 8152  N N    . ALA A 1 119 ? 2.271   -7.294  -1.121  1.00 0.00 ? 119 ALA A N    4  
ATOM 8153  C CA   . ALA A 1 119 ? 2.795   -8.109  -0.039  1.00 0.00 ? 119 ALA A CA   4  
ATOM 8154  C C    . ALA A 1 119 ? 4.161   -8.669  -0.443  1.00 0.00 ? 119 ALA A C    4  
ATOM 8155  O O    . ALA A 1 119 ? 5.128   -8.558  0.308   1.00 0.00 ? 119 ALA A O    4  
ATOM 8156  C CB   . ALA A 1 119 ? 1.791   -9.212  0.303   1.00 0.00 ? 119 ALA A CB   4  
ATOM 8157  H H    . ALA A 1 119 ? 1.443   -7.650  -1.556  1.00 0.00 ? 119 ALA A H    4  
ATOM 8158  H HA   . ALA A 1 119 ? 2.919   -7.465  0.831   1.00 0.00 ? 119 ALA A HA   4  
ATOM 8159  H HB1  . ALA A 1 119 ? 1.727   -9.322  1.386   1.00 0.00 ? 119 ALA A HB1  4  
ATOM 8160  H HB2  . ALA A 1 119 ? 0.811   -8.946  -0.094  1.00 0.00 ? 119 ALA A HB2  4  
ATOM 8161  H HB3  . ALA A 1 119 ? 2.120   -10.152 -0.139  1.00 0.00 ? 119 ALA A HB3  4  
ATOM 8162  N N    . ASP A 1 120 ? 4.195   -9.258  -1.630  1.00 0.00 ? 120 ASP A N    4  
ATOM 8163  C CA   . ASP A 1 120 ? 5.426   -9.836  -2.143  1.00 0.00 ? 120 ASP A CA   4  
ATOM 8164  C C    . ASP A 1 120 ? 6.599   -8.916  -1.796  1.00 0.00 ? 120 ASP A C    4  
ATOM 8165  O O    . ASP A 1 120 ? 7.458   -9.276  -0.993  1.00 0.00 ? 120 ASP A O    4  
ATOM 8166  C CB   . ASP A 1 120 ? 5.373   -9.981  -3.665  1.00 0.00 ? 120 ASP A CB   4  
ATOM 8167  C CG   . ASP A 1 120 ? 5.492   -11.417 -4.182  1.00 0.00 ? 120 ASP A CG   4  
ATOM 8168  O OD1  . ASP A 1 120 ? 4.748   -12.273 -3.656  1.00 0.00 ? 120 ASP A OD1  4  
ATOM 8169  O OD2  . ASP A 1 120 ? 6.324   -11.625 -5.091  1.00 0.00 ? 120 ASP A OD2  4  
ATOM 8170  H H    . ASP A 1 120 ? 3.403   -9.344  -2.235  1.00 0.00 ? 120 ASP A H    4  
ATOM 8171  H HA   . ASP A 1 120 ? 5.505   -10.812 -1.665  1.00 0.00 ? 120 ASP A HA   4  
ATOM 8172  H HB2  . ASP A 1 120 ? 4.434   -9.559  -4.023  1.00 0.00 ? 120 ASP A HB2  4  
ATOM 8173  H HB3  . ASP A 1 120 ? 6.176   -9.387  -4.100  1.00 0.00 ? 120 ASP A HB3  4  
ATOM 8174  N N    . GLU A 1 121 ? 6.596   -7.747  -2.419  1.00 0.00 ? 121 GLU A N    4  
ATOM 8175  C CA   . GLU A 1 121 ? 7.650   -6.774  -2.187  1.00 0.00 ? 121 GLU A CA   4  
ATOM 8176  C C    . GLU A 1 121 ? 7.821   -6.525  -0.687  1.00 0.00 ? 121 GLU A C    4  
ATOM 8177  O O    . GLU A 1 121 ? 8.943   -6.482  -0.186  1.00 0.00 ? 121 GLU A O    4  
ATOM 8178  C CB   . GLU A 1 121 ? 7.363   -5.467  -2.930  1.00 0.00 ? 121 GLU A CB   4  
ATOM 8179  C CG   . GLU A 1 121 ? 7.329   -5.694  -4.443  1.00 0.00 ? 121 GLU A CG   4  
ATOM 8180  C CD   . GLU A 1 121 ? 8.711   -5.469  -5.062  1.00 0.00 ? 121 GLU A CD   4  
ATOM 8181  O OE1  . GLU A 1 121 ? 9.661   -6.122  -4.579  1.00 0.00 ? 121 GLU A OE1  4  
ATOM 8182  O OE2  . GLU A 1 121 ? 8.785   -4.651  -6.004  1.00 0.00 ? 121 GLU A OE2  4  
ATOM 8183  H H    . GLU A 1 121 ? 5.894   -7.462  -3.071  1.00 0.00 ? 121 GLU A H    4  
ATOM 8184  H HA   . GLU A 1 121 ? 8.555   -7.224  -2.593  1.00 0.00 ? 121 GLU A HA   4  
ATOM 8185  H HB2  . GLU A 1 121 ? 6.408   -5.058  -2.599  1.00 0.00 ? 121 GLU A HB2  4  
ATOM 8186  H HB3  . GLU A 1 121 ? 8.128   -4.730  -2.686  1.00 0.00 ? 121 GLU A HB3  4  
ATOM 8187  H HG2  . GLU A 1 121 ? 6.992   -6.708  -4.655  1.00 0.00 ? 121 GLU A HG2  4  
ATOM 8188  H HG3  . GLU A 1 121 ? 6.608   -5.016  -4.900  1.00 0.00 ? 121 GLU A HG3  4  
ATOM 8189  N N    . LEU A 1 122 ? 6.691   -6.367  -0.013  1.00 0.00 ? 122 LEU A N    4  
ATOM 8190  C CA   . LEU A 1 122 ? 6.702   -6.123  1.419   1.00 0.00 ? 122 LEU A CA   4  
ATOM 8191  C C    . LEU A 1 122 ? 7.580   -7.173  2.104   1.00 0.00 ? 122 LEU A C    4  
ATOM 8192  O O    . LEU A 1 122 ? 8.500   -6.829  2.845   1.00 0.00 ? 122 LEU A O    4  
ATOM 8193  C CB   . LEU A 1 122 ? 5.273   -6.067  1.964   1.00 0.00 ? 122 LEU A CB   4  
ATOM 8194  C CG   . LEU A 1 122 ? 5.001   -4.995  3.022   1.00 0.00 ? 122 LEU A CG   4  
ATOM 8195  C CD1  . LEU A 1 122 ? 3.510   -4.922  3.357   1.00 0.00 ? 122 LEU A CD1  4  
ATOM 8196  C CD2  . LEU A 1 122 ? 5.858   -5.225  4.268   1.00 0.00 ? 122 LEU A CD2  4  
ATOM 8197  H H    . LEU A 1 122 ? 5.782   -6.403  -0.429  1.00 0.00 ? 122 LEU A H    4  
ATOM 8198  H HA   . LEU A 1 122 ? 7.147   -5.142  1.580   1.00 0.00 ? 122 LEU A HA   4  
ATOM 8199  H HB2  . LEU A 1 122 ? 4.593   -5.905  1.128   1.00 0.00 ? 122 LEU A HB2  4  
ATOM 8200  H HB3  . LEU A 1 122 ? 5.029   -7.040  2.390   1.00 0.00 ? 122 LEU A HB3  4  
ATOM 8201  H HG   . LEU A 1 122 ? 5.285   -4.027  2.609   1.00 0.00 ? 122 LEU A HG   4  
ATOM 8202  H HD11 . LEU A 1 122 ? 3.130   -5.927  3.544   1.00 0.00 ? 122 LEU A HD11 4  
ATOM 8203  H HD12 . LEU A 1 122 ? 3.367   -4.309  4.246   1.00 0.00 ? 122 LEU A HD12 4  
ATOM 8204  H HD13 . LEU A 1 122 ? 2.970   -4.480  2.519   1.00 0.00 ? 122 LEU A HD13 4  
ATOM 8205  H HD21 . LEU A 1 122 ? 5.239   -5.641  5.063   1.00 0.00 ? 122 LEU A HD21 4  
ATOM 8206  H HD22 . LEU A 1 122 ? 6.663   -5.920  4.032   1.00 0.00 ? 122 LEU A HD22 4  
ATOM 8207  H HD23 . LEU A 1 122 ? 6.282   -4.276  4.597   1.00 0.00 ? 122 LEU A HD23 4  
ATOM 8208  N N    . LYS A 1 123 ? 7.265   -8.430  1.831   1.00 0.00 ? 123 LYS A N    4  
ATOM 8209  C CA   . LYS A 1 123 ? 8.014   -9.532  2.412   1.00 0.00 ? 123 LYS A CA   4  
ATOM 8210  C C    . LYS A 1 123 ? 9.491   -9.393  2.036   1.00 0.00 ? 123 LYS A C    4  
ATOM 8211  O O    . LYS A 1 123 ? 10.362  -9.430  2.903   1.00 0.00 ? 123 LYS A O    4  
ATOM 8212  C CB   . LYS A 1 123 ? 7.399   -10.872 2.004   1.00 0.00 ? 123 LYS A CB   4  
ATOM 8213  C CG   . LYS A 1 123 ? 7.622   -11.930 3.087   1.00 0.00 ? 123 LYS A CG   4  
ATOM 8214  C CD   . LYS A 1 123 ? 6.305   -12.608 3.470   1.00 0.00 ? 123 LYS A CD   4  
ATOM 8215  C CE   . LYS A 1 123 ? 6.179   -13.979 2.803   1.00 0.00 ? 123 LYS A CE   4  
ATOM 8216  N NZ   . LYS A 1 123 ? 7.102   -14.949 3.434   1.00 0.00 ? 123 LYS A NZ   4  
ATOM 8217  H H    . LYS A 1 123 ? 6.516   -8.701  1.227   1.00 0.00 ? 123 LYS A H    4  
ATOM 8218  H HA   . LYS A 1 123 ? 7.925   -9.453  3.495   1.00 0.00 ? 123 LYS A HA   4  
ATOM 8219  H HB2  . LYS A 1 123 ? 6.330   -10.747 1.827   1.00 0.00 ? 123 LYS A HB2  4  
ATOM 8220  H HB3  . LYS A 1 123 ? 7.840   -11.208 1.066   1.00 0.00 ? 123 LYS A HB3  4  
ATOM 8221  H HG2  . LYS A 1 123 ? 8.329   -12.678 2.729   1.00 0.00 ? 123 LYS A HG2  4  
ATOM 8222  H HG3  . LYS A 1 123 ? 8.066   -11.466 3.967   1.00 0.00 ? 123 LYS A HG3  4  
ATOM 8223  H HD2  . LYS A 1 123 ? 6.251   -12.720 4.553   1.00 0.00 ? 123 LYS A HD2  4  
ATOM 8224  H HD3  . LYS A 1 123 ? 5.467   -11.977 3.174   1.00 0.00 ? 123 LYS A HD3  4  
ATOM 8225  H HE2  . LYS A 1 123 ? 5.153   -14.337 2.885   1.00 0.00 ? 123 LYS A HE2  4  
ATOM 8226  H HE3  . LYS A 1 123 ? 6.403   -13.894 1.740   1.00 0.00 ? 123 LYS A HE3  4  
ATOM 8227  H HZ1  . LYS A 1 123 ? 8.000   -14.525 3.554   1.00 0.00 ? 123 LYS A HZ1  4  
ATOM 8228  H HZ2  . LYS A 1 123 ? 6.741   -15.221 4.326   1.00 0.00 ? 123 LYS A HZ2  4  
ATOM 8229  H HZ3  . LYS A 1 123 ? 7.189   -15.755 2.849   1.00 0.00 ? 123 LYS A HZ3  4  
ATOM 8230  N N    . PHE A 1 124 ? 9.726   -9.237  0.741   1.00 0.00 ? 124 PHE A N    4  
ATOM 8231  C CA   . PHE A 1 124 ? 11.082  -9.093  0.240   1.00 0.00 ? 124 PHE A CA   4  
ATOM 8232  C C    . PHE A 1 124 ? 11.845  -8.020  1.020   1.00 0.00 ? 124 PHE A C    4  
ATOM 8233  O O    . PHE A 1 124 ? 12.795  -8.328  1.738   1.00 0.00 ? 124 PHE A O    4  
ATOM 8234  C CB   . PHE A 1 124 ? 10.974  -8.662  -1.224  1.00 0.00 ? 124 PHE A CB   4  
ATOM 8235  C CG   . PHE A 1 124 ? 12.320  -8.351  -1.882  1.00 0.00 ? 124 PHE A CG   4  
ATOM 8236  C CD1  . PHE A 1 124 ? 12.848  -7.101  -1.794  1.00 0.00 ? 124 PHE A CD1  4  
ATOM 8237  C CD2  . PHE A 1 124 ? 12.989  -9.325  -2.556  1.00 0.00 ? 124 PHE A CD2  4  
ATOM 8238  C CE1  . PHE A 1 124 ? 14.097  -6.812  -2.405  1.00 0.00 ? 124 PHE A CE1  4  
ATOM 8239  C CE2  . PHE A 1 124 ? 14.238  -9.037  -3.167  1.00 0.00 ? 124 PHE A CE2  4  
ATOM 8240  C CZ   . PHE A 1 124 ? 14.765  -7.786  -3.078  1.00 0.00 ? 124 PHE A CZ   4  
ATOM 8241  H H    . PHE A 1 124 ? 9.012   -9.208  0.042   1.00 0.00 ? 124 PHE A H    4  
ATOM 8242  H HA   . PHE A 1 124 ? 11.579  -10.055 0.368   1.00 0.00 ? 124 PHE A HA   4  
ATOM 8243  H HB2  . PHE A 1 124 ? 10.479  -9.451  -1.790  1.00 0.00 ? 124 PHE A HB2  4  
ATOM 8244  H HB3  . PHE A 1 124 ? 10.339  -7.778  -1.286  1.00 0.00 ? 124 PHE A HB3  4  
ATOM 8245  H HD1  . PHE A 1 124 ? 12.312  -6.320  -1.254  1.00 0.00 ? 124 PHE A HD1  4  
ATOM 8246  H HD2  . PHE A 1 124 ? 12.566  -10.327 -2.627  1.00 0.00 ? 124 PHE A HD2  4  
ATOM 8247  H HE1  . PHE A 1 124 ? 14.520  -5.810  -2.333  1.00 0.00 ? 124 PHE A HE1  4  
ATOM 8248  H HE2  . PHE A 1 124 ? 14.773  -9.817  -3.707  1.00 0.00 ? 124 PHE A HE2  4  
ATOM 8249  H HZ   . PHE A 1 124 ? 15.724  -7.565  -3.547  1.00 0.00 ? 124 PHE A HZ   4  
ATOM 8250  N N    . VAL A 1 125 ? 11.399  -6.784  0.854   1.00 0.00 ? 125 VAL A N    4  
ATOM 8251  C CA   . VAL A 1 125 ? 12.027  -5.664  1.534   1.00 0.00 ? 125 VAL A CA   4  
ATOM 8252  C C    . VAL A 1 125 ? 12.132  -5.974  3.028   1.00 0.00 ? 125 VAL A C    4  
ATOM 8253  O O    . VAL A 1 125 ? 13.130  -5.642  3.667   1.00 0.00 ? 125 VAL A O    4  
ATOM 8254  C CB   . VAL A 1 125 ? 11.255  -4.375  1.243   1.00 0.00 ? 125 VAL A CB   4  
ATOM 8255  C CG1  . VAL A 1 125 ? 10.136  -4.165  2.265   1.00 0.00 ? 125 VAL A CG1  4  
ATOM 8256  C CG2  . VAL A 1 125 ? 12.196  -3.170  1.204   1.00 0.00 ? 125 VAL A CG2  4  
ATOM 8257  H H    . VAL A 1 125 ? 10.625  -6.543  0.268   1.00 0.00 ? 125 VAL A H    4  
ATOM 8258  H HA   . VAL A 1 125 ? 13.032  -5.554  1.127   1.00 0.00 ? 125 VAL A HA   4  
ATOM 8259  H HB   . VAL A 1 125 ? 10.796  -4.474  0.260   1.00 0.00 ? 125 VAL A HB   4  
ATOM 8260  H HG11 . VAL A 1 125 ? 9.672   -3.192  2.101   1.00 0.00 ? 125 VAL A HG11 4  
ATOM 8261  H HG12 . VAL A 1 125 ? 9.387   -4.948  2.150   1.00 0.00 ? 125 VAL A HG12 4  
ATOM 8262  H HG13 . VAL A 1 125 ? 10.551  -4.204  3.272   1.00 0.00 ? 125 VAL A HG13 4  
ATOM 8263  H HG21 . VAL A 1 125 ? 12.701  -3.134  0.239   1.00 0.00 ? 125 VAL A HG21 4  
ATOM 8264  H HG22 . VAL A 1 125 ? 11.620  -2.255  1.347   1.00 0.00 ? 125 VAL A HG22 4  
ATOM 8265  H HG23 . VAL A 1 125 ? 12.936  -3.260  1.999   1.00 0.00 ? 125 VAL A HG23 4  
ATOM 8266  N N    . ALA A 1 126 ? 11.088  -6.607  3.543   1.00 0.00 ? 126 ALA A N    4  
ATOM 8267  C CA   . ALA A 1 126 ? 11.050  -6.966  4.951   1.00 0.00 ? 126 ALA A CA   4  
ATOM 8268  C C    . ALA A 1 126 ? 12.187  -7.943  5.255   1.00 0.00 ? 126 ALA A C    4  
ATOM 8269  O O    . ALA A 1 126 ? 13.135  -7.599  5.959   1.00 0.00 ? 126 ALA A O    4  
ATOM 8270  C CB   . ALA A 1 126 ? 9.676   -7.545  5.293   1.00 0.00 ? 126 ALA A CB   4  
ATOM 8271  H H    . ALA A 1 126 ? 10.280  -6.874  3.017   1.00 0.00 ? 126 ALA A H    4  
ATOM 8272  H HA   . ALA A 1 126 ? 11.201  -6.055  5.530   1.00 0.00 ? 126 ALA A HA   4  
ATOM 8273  H HB1  . ALA A 1 126 ? 8.908   -6.795  5.106   1.00 0.00 ? 126 ALA A HB1  4  
ATOM 8274  H HB2  . ALA A 1 126 ? 9.486   -8.422  4.674   1.00 0.00 ? 126 ALA A HB2  4  
ATOM 8275  H HB3  . ALA A 1 126 ? 9.654   -7.832  6.345   1.00 0.00 ? 126 ALA A HB3  4  
ATOM 8276  N N    . SER A 1 127 ? 12.055  -9.143  4.708   1.00 0.00 ? 127 SER A N    4  
ATOM 8277  C CA   . SER A 1 127 ? 13.060  -10.173 4.911   1.00 0.00 ? 127 SER A CA   4  
ATOM 8278  C C    . SER A 1 127 ? 14.446  -9.627  4.565   1.00 0.00 ? 127 SER A C    4  
ATOM 8279  O O    . SER A 1 127 ? 15.403  -9.835  5.309   1.00 0.00 ? 127 SER A O    4  
ATOM 8280  C CB   . SER A 1 127 ? 12.754  -11.415 4.072   1.00 0.00 ? 127 SER A CB   4  
ATOM 8281  O OG   . SER A 1 127 ? 13.003  -12.619 4.791   1.00 0.00 ? 127 SER A OG   4  
ATOM 8282  H H    . SER A 1 127 ? 11.281  -9.415  4.136   1.00 0.00 ? 127 SER A H    4  
ATOM 8283  H HA   . SER A 1 127 ? 13.002  -10.427 5.970   1.00 0.00 ? 127 SER A HA   4  
ATOM 8284  H HB2  . SER A 1 127 ? 11.711  -11.391 3.756   1.00 0.00 ? 127 SER A HB2  4  
ATOM 8285  H HB3  . SER A 1 127 ? 13.361  -11.400 3.168   1.00 0.00 ? 127 SER A HB3  4  
ATOM 8286  H HG   . SER A 1 127 ? 12.217  -13.233 4.714   1.00 0.00 ? 127 SER A HG   4  
ATOM 8287  N N    . GLN A 1 128 ? 14.511  -8.938  3.435   1.00 0.00 ? 128 GLN A N    4  
ATOM 8288  C CA   . GLN A 1 128 ? 15.764  -8.360  2.981   1.00 0.00 ? 128 GLN A CA   4  
ATOM 8289  C C    . GLN A 1 128 ? 16.557  -7.812  4.168   1.00 0.00 ? 128 GLN A C    4  
ATOM 8290  O O    . GLN A 1 128 ? 17.699  -8.210  4.394   1.00 0.00 ? 128 GLN A O    4  
ATOM 8291  C CB   . GLN A 1 128 ? 15.519  -7.271  1.935   1.00 0.00 ? 128 GLN A CB   4  
ATOM 8292  C CG   . GLN A 1 128 ? 15.552  -7.851  0.520   1.00 0.00 ? 128 GLN A CG   4  
ATOM 8293  C CD   . GLN A 1 128 ? 16.748  -7.311  -0.267  1.00 0.00 ? 128 GLN A CD   4  
ATOM 8294  O OE1  . GLN A 1 128 ? 16.792  -6.159  -0.667  1.00 0.00 ? 128 GLN A OE1  4  
ATOM 8295  N NE2  . GLN A 1 128 ? 17.713  -8.205  -0.466  1.00 0.00 ? 128 GLN A NE2  4  
ATOM 8296  H H    . GLN A 1 128 ? 13.727  -8.773  2.835   1.00 0.00 ? 128 GLN A H    4  
ATOM 8297  H HA   . GLN A 1 128 ? 16.311  -9.182  2.518   1.00 0.00 ? 128 GLN A HA   4  
ATOM 8298  H HB2  . GLN A 1 128 ? 14.553  -6.799  2.116   1.00 0.00 ? 128 GLN A HB2  4  
ATOM 8299  H HB3  . GLN A 1 128 ? 16.276  -6.493  2.030   1.00 0.00 ? 128 GLN A HB3  4  
ATOM 8300  H HG2  . GLN A 1 128 ? 15.606  -8.939  0.570   1.00 0.00 ? 128 GLN A HG2  4  
ATOM 8301  H HG3  . GLN A 1 128 ? 14.627  -7.602  -0.001  1.00 0.00 ? 128 GLN A HG3  4  
ATOM 8302  H HE21 . GLN A 1 128 ? 17.614  -9.134  -0.111  1.00 0.00 ? 128 GLN A HE21 4  
ATOM 8303  H HE22 . GLN A 1 128 ? 18.537  -7.947  -0.970  1.00 0.00 ? 128 GLN A HE22 4  
ATOM 8304  N N    . PHE A 1 129 ? 15.920  -6.907  4.897   1.00 0.00 ? 129 PHE A N    4  
ATOM 8305  C CA   . PHE A 1 129 ? 16.552  -6.300  6.056   1.00 0.00 ? 129 PHE A CA   4  
ATOM 8306  C C    . PHE A 1 129 ? 16.309  -7.136  7.314   1.00 0.00 ? 129 PHE A C    4  
ATOM 8307  O O    . PHE A 1 129 ? 17.256  -7.579  7.962   1.00 0.00 ? 129 PHE A O    4  
ATOM 8308  C CB   . PHE A 1 129 ? 15.914  -4.922  6.243   1.00 0.00 ? 129 PHE A CB   4  
ATOM 8309  C CG   . PHE A 1 129 ? 16.591  -3.808  5.442   1.00 0.00 ? 129 PHE A CG   4  
ATOM 8310  C CD1  . PHE A 1 129 ? 16.304  -3.648  4.122   1.00 0.00 ? 129 PHE A CD1  4  
ATOM 8311  C CD2  . PHE A 1 129 ? 17.481  -2.978  6.050   1.00 0.00 ? 129 PHE A CD2  4  
ATOM 8312  C CE1  . PHE A 1 129 ? 16.933  -2.615  3.379   1.00 0.00 ? 129 PHE A CE1  4  
ATOM 8313  C CE2  . PHE A 1 129 ? 18.110  -1.945  5.306   1.00 0.00 ? 129 PHE A CE2  4  
ATOM 8314  C CZ   . PHE A 1 129 ? 17.822  -1.785  3.987   1.00 0.00 ? 129 PHE A CZ   4  
ATOM 8315  H H    . PHE A 1 129 ? 14.991  -6.589  4.707   1.00 0.00 ? 129 PHE A H    4  
ATOM 8316  H HA   . PHE A 1 129 ? 17.622  -6.253  5.854   1.00 0.00 ? 129 PHE A HA   4  
ATOM 8317  H HB2  . PHE A 1 129 ? 14.864  -4.977  5.954   1.00 0.00 ? 129 PHE A HB2  4  
ATOM 8318  H HB3  . PHE A 1 129 ? 15.939  -4.661  7.301   1.00 0.00 ? 129 PHE A HB3  4  
ATOM 8319  H HD1  . PHE A 1 129 ? 15.591  -4.313  3.635   1.00 0.00 ? 129 PHE A HD1  4  
ATOM 8320  H HD2  . PHE A 1 129 ? 17.711  -3.107  7.107   1.00 0.00 ? 129 PHE A HD2  4  
ATOM 8321  H HE1  . PHE A 1 129 ? 16.702  -2.486  2.321   1.00 0.00 ? 129 PHE A HE1  4  
ATOM 8322  H HE2  . PHE A 1 129 ? 18.823  -1.280  5.793   1.00 0.00 ? 129 PHE A HE2  4  
ATOM 8323  H HZ   . PHE A 1 129 ? 18.305  -0.991  3.416   1.00 0.00 ? 129 PHE A HZ   4  
ATOM 8324  N N    . ARG A 1 130 ? 15.035  -7.327  7.622   1.00 0.00 ? 130 ARG A N    4  
ATOM 8325  C CA   . ARG A 1 130 ? 14.655  -8.102  8.791   1.00 0.00 ? 130 ARG A CA   4  
ATOM 8326  C C    . ARG A 1 130 ? 15.581  -9.310  8.951   1.00 0.00 ? 130 ARG A C    4  
ATOM 8327  O O    . ARG A 1 130 ? 15.778  -10.075 8.008   1.00 0.00 ? 130 ARG A O    4  
ATOM 8328  C CB   . ARG A 1 130 ? 13.209  -8.589  8.683   1.00 0.00 ? 130 ARG A CB   4  
ATOM 8329  C CG   . ARG A 1 130 ? 12.632  -8.906  10.064  1.00 0.00 ? 130 ARG A CG   4  
ATOM 8330  C CD   . ARG A 1 130 ? 11.845  -10.218 10.043  1.00 0.00 ? 130 ARG A CD   4  
ATOM 8331  N NE   . ARG A 1 130 ? 12.648  -11.299 10.657  1.00 0.00 ? 130 ARG A NE   4  
ATOM 8332  C CZ   . ARG A 1 130 ? 13.014  -11.324 11.945  1.00 0.00 ? 130 ARG A CZ   4  
ATOM 8333  N NH1  . ARG A 1 130 ? 12.651  -10.327 12.764  1.00 0.00 ? 130 ARG A NH1  4  
ATOM 8334  N NH2  . ARG A 1 130 ? 13.742  -12.346 12.415  1.00 0.00 ? 130 ARG A NH2  4  
ATOM 8335  H H    . ARG A 1 130 ? 14.270  -6.963  7.090   1.00 0.00 ? 130 ARG A H    4  
ATOM 8336  H HA   . ARG A 1 130 ? 14.761  -7.413  9.629   1.00 0.00 ? 130 ARG A HA   4  
ATOM 8337  H HB2  . ARG A 1 130 ? 12.600  -7.827  8.197   1.00 0.00 ? 130 ARG A HB2  4  
ATOM 8338  H HB3  . ARG A 1 130 ? 13.166  -9.479  8.055   1.00 0.00 ? 130 ARG A HB3  4  
ATOM 8339  H HG2  . ARG A 1 130 ? 13.440  -8.974  10.793  1.00 0.00 ? 130 ARG A HG2  4  
ATOM 8340  H HG3  . ARG A 1 130 ? 11.981  -8.092  10.386  1.00 0.00 ? 130 ARG A HG3  4  
ATOM 8341  H HD2  . ARG A 1 130 ? 10.907  -10.098 10.584  1.00 0.00 ? 130 ARG A HD2  4  
ATOM 8342  H HD3  . ARG A 1 130 ? 11.590  -10.481 9.016   1.00 0.00 ? 130 ARG A HD3  4  
ATOM 8343  H HE   . ARG A 1 130 ? 12.935  -12.059 10.073  1.00 0.00 ? 130 ARG A HE   4  
ATOM 8344  H HH11 . ARG A 1 130 ? 12.108  -9.565  12.414  1.00 0.00 ? 130 ARG A HH11 4  
ATOM 8345  H HH12 . ARG A 1 130 ? 12.925  -10.346 13.726  1.00 0.00 ? 130 ARG A HH12 4  
ATOM 8346  H HH21 . ARG A 1 130 ? 14.012  -13.090 11.804  1.00 0.00 ? 130 ARG A HH21 4  
ATOM 8347  H HH22 . ARG A 1 130 ? 14.015  -12.365 13.377  1.00 0.00 ? 130 ARG A HH22 4  
ATOM 8348  N N    . ARG A 1 131 ? 16.127  -9.442  10.151  1.00 0.00 ? 131 ARG A N    4  
ATOM 8349  C CA   . ARG A 1 131 ? 17.028  -10.543 10.446  1.00 0.00 ? 131 ARG A CA   4  
ATOM 8350  C C    . ARG A 1 131 ? 17.473  -10.486 11.909  1.00 0.00 ? 131 ARG A C    4  
ATOM 8351  O O    . ARG A 1 131 ? 18.330  -9.681  12.270  1.00 0.00 ? 131 ARG A O    4  
ATOM 8352  C CB   . ARG A 1 131 ? 18.262  -10.503 9.542   1.00 0.00 ? 131 ARG A CB   4  
ATOM 8353  C CG   . ARG A 1 131 ? 18.243  -11.656 8.537   1.00 0.00 ? 131 ARG A CG   4  
ATOM 8354  C CD   . ARG A 1 131 ? 19.664  -12.062 8.142   1.00 0.00 ? 131 ARG A CD   4  
ATOM 8355  N NE   . ARG A 1 131 ? 19.665  -13.438 7.598   1.00 0.00 ? 131 ARG A NE   4  
ATOM 8356  C CZ   . ARG A 1 131 ? 19.363  -14.529 8.315   1.00 0.00 ? 131 ARG A CZ   4  
ATOM 8357  N NH1  . ARG A 1 131 ? 19.035  -14.411 9.609   1.00 0.00 ? 131 ARG A NH1  4  
ATOM 8358  N NH2  . ARG A 1 131 ? 19.390  -15.739 7.739   1.00 0.00 ? 131 ARG A NH2  4  
ATOM 8359  H H    . ARG A 1 131 ? 15.962  -8.815  10.912  1.00 0.00 ? 131 ARG A H    4  
ATOM 8360  H HA   . ARG A 1 131 ? 16.444  -11.442 10.249  1.00 0.00 ? 131 ARG A HA   4  
ATOM 8361  H HB2  . ARG A 1 131 ? 18.296  -9.552  9.010   1.00 0.00 ? 131 ARG A HB2  4  
ATOM 8362  H HB3  . ARG A 1 131 ? 19.164  -10.560 10.150  1.00 0.00 ? 131 ARG A HB3  4  
ATOM 8363  H HG2  . ARG A 1 131 ? 17.724  -12.511 8.970   1.00 0.00 ? 131 ARG A HG2  4  
ATOM 8364  H HG3  . ARG A 1 131 ? 17.685  -11.360 7.649   1.00 0.00 ? 131 ARG A HG3  4  
ATOM 8365  H HD2  . ARG A 1 131 ? 20.056  -11.368 7.398   1.00 0.00 ? 131 ARG A HD2  4  
ATOM 8366  H HD3  . ARG A 1 131 ? 20.322  -12.004 9.009   1.00 0.00 ? 131 ARG A HD3  4  
ATOM 8367  H HE   . ARG A 1 131 ? 19.906  -13.562 6.636   1.00 0.00 ? 131 ARG A HE   4  
ATOM 8368  H HH11 . ARG A 1 131 ? 19.015  -13.509 10.040  1.00 0.00 ? 131 ARG A HH11 4  
ATOM 8369  H HH12 . ARG A 1 131 ? 18.810  -15.226 10.144  1.00 0.00 ? 131 ARG A HH12 4  
ATOM 8370  H HH21 . ARG A 1 131 ? 19.635  -15.827 6.773   1.00 0.00 ? 131 ARG A HH21 4  
ATOM 8371  H HH22 . ARG A 1 131 ? 19.165  -16.553 8.274   1.00 0.00 ? 131 ARG A HH22 4  
ATOM 8372  N N    . SER A 1 132 ? 16.871  -11.352 12.711  1.00 0.00 ? 132 SER A N    4  
ATOM 8373  C CA   . SER A 1 132 ? 17.195  -11.411 14.127  1.00 0.00 ? 132 SER A CA   4  
ATOM 8374  C C    . SER A 1 132 ? 16.338  -12.473 14.816  1.00 0.00 ? 132 SER A C    4  
ATOM 8375  O O    . SER A 1 132 ? 15.221  -12.190 15.249  1.00 0.00 ? 132 SER A O    4  
ATOM 8376  C CB   . SER A 1 132 ? 16.993  -10.049 14.795  1.00 0.00 ? 132 SER A CB   4  
ATOM 8377  O OG   . SER A 1 132 ? 17.987  -9.786  15.782  1.00 0.00 ? 132 SER A OG   4  
ATOM 8378  H H    . SER A 1 132 ? 16.175  -12.003 12.410  1.00 0.00 ? 132 SER A H    4  
ATOM 8379  H HA   . SER A 1 132 ? 18.250  -11.683 14.170  1.00 0.00 ? 132 SER A HA   4  
ATOM 8380  H HB2  . SER A 1 132 ? 17.018  -9.266  14.037  1.00 0.00 ? 132 SER A HB2  4  
ATOM 8381  H HB3  . SER A 1 132 ? 16.006  -10.015 15.256  1.00 0.00 ? 132 SER A HB3  4  
ATOM 8382  H HG   . SER A 1 132 ? 18.711  -10.474 15.730  1.00 0.00 ? 132 SER A HG   4  
ATOM 8383  N N    . GLY A 1 133 ? 16.891  -13.674 14.897  1.00 0.00 ? 133 GLY A N    4  
ATOM 8384  C CA   . GLY A 1 133 ? 16.191  -14.780 15.527  1.00 0.00 ? 133 GLY A CA   4  
ATOM 8385  C C    . GLY A 1 133 ? 14.740  -14.855 15.047  1.00 0.00 ? 133 GLY A C    4  
ATOM 8386  O O    . GLY A 1 133 ? 14.372  -14.205 14.070  1.00 0.00 ? 133 GLY A O    4  
ATOM 8387  H H    . GLY A 1 133 ? 17.800  -13.896 14.543  1.00 0.00 ? 133 GLY A H    4  
ATOM 8388  H HA2  . GLY A 1 133 ? 16.702  -15.716 15.299  1.00 0.00 ? 133 GLY A HA2  4  
ATOM 8389  H HA3  . GLY A 1 133 ? 16.214  -14.660 16.610  1.00 0.00 ? 133 GLY A HA3  4  
ATOM 8390  N N    . PRO A 1 134 ? 13.935  -15.675 15.775  1.00 0.00 ? 134 PRO A N    4  
ATOM 8391  C CA   . PRO A 1 134 ? 12.533  -15.843 15.433  1.00 0.00 ? 134 PRO A CA   4  
ATOM 8392  C C    . PRO A 1 134 ? 11.717  -14.617 15.848  1.00 0.00 ? 134 PRO A C    4  
ATOM 8393  O O    . PRO A 1 134 ? 12.249  -13.689 16.455  1.00 0.00 ? 134 PRO A O    4  
ATOM 8394  C CB   . PRO A 1 134 ? 12.103  -17.112 16.151  1.00 0.00 ? 134 PRO A CB   4  
ATOM 8395  C CG   . PRO A 1 134 ? 13.142  -17.352 17.234  1.00 0.00 ? 134 PRO A CG   4  
ATOM 8396  C CD   . PRO A 1 134 ? 14.337  -16.460 16.938  1.00 0.00 ? 134 PRO A CD   4  
ATOM 8397  H HA   . PRO A 1 134 ? 12.424  -15.922 14.443  1.00 0.00 ? 134 PRO A HA   4  
ATOM 8398  H HB2  . PRO A 1 134 ? 11.108  -17.000 16.582  1.00 0.00 ? 134 PRO A HB2  4  
ATOM 8399  H HB3  . PRO A 1 134 ? 12.058  -17.955 15.460  1.00 0.00 ? 134 PRO A HB3  4  
ATOM 8400  H HG2  . PRO A 1 134 ? 12.729  -17.123 18.216  1.00 0.00 ? 134 PRO A HG2  4  
ATOM 8401  H HG3  . PRO A 1 134 ? 13.442  -18.399 17.250  1.00 0.00 ? 134 PRO A HG3  4  
ATOM 8402  H HD2  . PRO A 1 134 ? 14.572  -15.818 17.787  1.00 0.00 ? 134 PRO A HD2  4  
ATOM 8403  H HD3  . PRO A 1 134 ? 15.229  -17.050 16.728  1.00 0.00 ? 134 PRO A HD3  4  
ATOM 8404  N N    . SER A 1 135 ? 10.438  -14.653 15.503  1.00 0.00 ? 135 SER A N    4  
ATOM 8405  C CA   . SER A 1 135 ? 9.543   -13.556 15.831  1.00 0.00 ? 135 SER A CA   4  
ATOM 8406  C C    . SER A 1 135 ? 8.863   -13.820 17.176  1.00 0.00 ? 135 SER A C    4  
ATOM 8407  O O    . SER A 1 135 ? 8.380   -14.924 17.425  1.00 0.00 ? 135 SER A O    4  
ATOM 8408  C CB   . SER A 1 135 ? 8.494   -13.355 14.736  1.00 0.00 ? 135 SER A CB   4  
ATOM 8409  O OG   . SER A 1 135 ? 7.600   -14.460 14.643  1.00 0.00 ? 135 SER A OG   4  
ATOM 8410  H H    . SER A 1 135 ? 10.013  -15.411 15.009  1.00 0.00 ? 135 SER A H    4  
ATOM 8411  H HA   . SER A 1 135 ? 10.179  -12.673 15.891  1.00 0.00 ? 135 SER A HA   4  
ATOM 8412  H HB2  . SER A 1 135 ? 7.928   -12.446 14.939  1.00 0.00 ? 135 SER A HB2  4  
ATOM 8413  H HB3  . SER A 1 135 ? 8.993   -13.211 13.777  1.00 0.00 ? 135 SER A HB3  4  
ATOM 8414  H HG   . SER A 1 135 ? 7.959   -15.235 15.164  1.00 0.00 ? 135 SER A HG   4  
ATOM 8415  N N    . SER A 1 136 ? 8.847   -12.788 18.007  1.00 0.00 ? 136 SER A N    4  
ATOM 8416  C CA   . SER A 1 136 ? 8.234   -12.895 19.320  1.00 0.00 ? 136 SER A CA   4  
ATOM 8417  C C    . SER A 1 136 ? 6.803   -12.355 19.275  1.00 0.00 ? 136 SER A C    4  
ATOM 8418  O O    . SER A 1 136 ? 5.851   -13.084 19.551  1.00 0.00 ? 136 SER A O    4  
ATOM 8419  C CB   . SER A 1 136 ? 9.052   -12.144 20.372  1.00 0.00 ? 136 SER A CB   4  
ATOM 8420  O OG   . SER A 1 136 ? 10.031  -12.979 20.983  1.00 0.00 ? 136 SER A OG   4  
ATOM 8421  H H    . SER A 1 136 ? 9.242   -11.894 17.796  1.00 0.00 ? 136 SER A H    4  
ATOM 8422  H HA   . SER A 1 136 ? 8.234   -13.960 19.553  1.00 0.00 ? 136 SER A HA   4  
ATOM 8423  H HB2  . SER A 1 136 ? 9.543   -11.289 19.907  1.00 0.00 ? 136 SER A HB2  4  
ATOM 8424  H HB3  . SER A 1 136 ? 8.383   -11.750 21.138  1.00 0.00 ? 136 SER A HB3  4  
ATOM 8425  H HG   . SER A 1 136 ? 10.380  -13.640 20.319  1.00 0.00 ? 136 SER A HG   4  
ATOM 8426  N N    . GLY A 1 137 ? 6.696   -11.082 18.924  1.00 0.00 ? 137 GLY A N    4  
ATOM 8427  C CA   . GLY A 1 137 ? 5.397   -10.436 18.839  1.00 0.00 ? 137 GLY A CA   4  
ATOM 8428  C C    . GLY A 1 137 ? 5.376   -9.391  17.722  1.00 0.00 ? 137 GLY A C    4  
ATOM 8429  O O    . GLY A 1 137 ? 4.471   -8.561  17.660  1.00 0.00 ? 137 GLY A O    4  
ATOM 8430  H H    . GLY A 1 137 ? 7.475   -10.496 18.701  1.00 0.00 ? 137 GLY A H    4  
ATOM 8431  H HA2  . GLY A 1 137 ? 4.626   -11.184 18.656  1.00 0.00 ? 137 GLY A HA2  4  
ATOM 8432  H HA3  . GLY A 1 137 ? 5.160   -9.961  19.791  1.00 0.00 ? 137 GLY A HA3  4  
ATOM 8433  N N    . GLY A 1 1   ? 5.644   9.259   -7.393  1.00 0.00 ? 1   GLY A N    5  
ATOM 8434  C CA   . GLY A 1 1   ? 5.596   10.386  -6.477  1.00 0.00 ? 1   GLY A CA   5  
ATOM 8435  C C    . GLY A 1 1   ? 6.998   10.762  -5.996  1.00 0.00 ? 1   GLY A C    5  
ATOM 8436  O O    . GLY A 1 1   ? 7.981   10.540  -6.701  1.00 0.00 ? 1   GLY A O    5  
ATOM 8437  H H1   . GLY A 1 1   ? 4.843   8.662   -7.371  1.00 0.00 ? 1   GLY A H1   5  
ATOM 8438  H HA2  . GLY A 1 1   ? 5.136   11.241  -6.972  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 8439  H HA3  . GLY A 1 1   ? 4.968   10.137  -5.622  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 8440  N N    . SER A 1 2   ? 7.046   11.325  -4.797  1.00 0.00 ? 2   SER A N    5  
ATOM 8441  C CA   . SER A 1 2   ? 8.312   11.734  -4.213  1.00 0.00 ? 2   SER A CA   5  
ATOM 8442  C C    . SER A 1 2   ? 8.247   11.618  -2.689  1.00 0.00 ? 2   SER A C    5  
ATOM 8443  O O    . SER A 1 2   ? 9.044   10.904  -2.082  1.00 0.00 ? 2   SER A O    5  
ATOM 8444  C CB   . SER A 1 2   ? 8.671   13.164  -4.622  1.00 0.00 ? 2   SER A CB   5  
ATOM 8445  O OG   . SER A 1 2   ? 9.826   13.207  -5.455  1.00 0.00 ? 2   SER A OG   5  
ATOM 8446  H H    . SER A 1 2   ? 6.242   11.502  -4.230  1.00 0.00 ? 2   SER A H    5  
ATOM 8447  H HA   . SER A 1 2   ? 9.053   11.044  -4.618  1.00 0.00 ? 2   SER A HA   5  
ATOM 8448  H HB2  . SER A 1 2   ? 7.828   13.613  -5.147  1.00 0.00 ? 2   SER A HB2  5  
ATOM 8449  H HB3  . SER A 1 2   ? 8.846   13.763  -3.728  1.00 0.00 ? 2   SER A HB3  5  
ATOM 8450  H HG   . SER A 1 2   ? 10.419  12.426  -5.259  1.00 0.00 ? 2   SER A HG   5  
ATOM 8451  N N    . SER A 1 3   ? 7.290   12.331  -2.114  1.00 0.00 ? 3   SER A N    5  
ATOM 8452  C CA   . SER A 1 3   ? 7.110   12.317  -0.672  1.00 0.00 ? 3   SER A CA   5  
ATOM 8453  C C    . SER A 1 3   ? 5.881   13.145  -0.290  1.00 0.00 ? 3   SER A C    5  
ATOM 8454  O O    . SER A 1 3   ? 5.310   13.838  -1.130  1.00 0.00 ? 3   SER A O    5  
ATOM 8455  C CB   . SER A 1 3   ? 8.353   12.850  0.043   1.00 0.00 ? 3   SER A CB   5  
ATOM 8456  O OG   . SER A 1 3   ? 8.884   11.905  0.968   1.00 0.00 ? 3   SER A OG   5  
ATOM 8457  H H    . SER A 1 3   ? 6.645   12.909  -2.614  1.00 0.00 ? 3   SER A H    5  
ATOM 8458  H HA   . SER A 1 3   ? 6.962   11.270  -0.410  1.00 0.00 ? 3   SER A HA   5  
ATOM 8459  H HB2  . SER A 1 3   ? 9.114   13.104  -0.694  1.00 0.00 ? 3   SER A HB2  5  
ATOM 8460  H HB3  . SER A 1 3   ? 8.101   13.770  0.571   1.00 0.00 ? 3   SER A HB3  5  
ATOM 8461  H HG   . SER A 1 3   ? 8.154   11.554  1.555   1.00 0.00 ? 3   SER A HG   5  
ATOM 8462  N N    . GLY A 1 4   ? 5.511   13.046  0.979   1.00 0.00 ? 4   GLY A N    5  
ATOM 8463  C CA   . GLY A 1 4   ? 4.361   13.777  1.482   1.00 0.00 ? 4   GLY A CA   5  
ATOM 8464  C C    . GLY A 1 4   ? 4.414   13.900  3.006   1.00 0.00 ? 4   GLY A C    5  
ATOM 8465  O O    . GLY A 1 4   ? 5.287   13.320  3.649   1.00 0.00 ? 4   GLY A O    5  
ATOM 8466  H H    . GLY A 1 4   ? 5.982   12.480  1.656   1.00 0.00 ? 4   GLY A H    5  
ATOM 8467  H HA2  . GLY A 1 4   ? 4.333   14.771  1.034   1.00 0.00 ? 4   GLY A HA2  5  
ATOM 8468  H HA3  . GLY A 1 4   ? 3.444   13.268  1.186   1.00 0.00 ? 4   GLY A HA3  5  
ATOM 8469  N N    . SER A 1 5   ? 3.468   14.659  3.540   1.00 0.00 ? 5   SER A N    5  
ATOM 8470  C CA   . SER A 1 5   ? 3.395   14.865  4.976   1.00 0.00 ? 5   SER A CA   5  
ATOM 8471  C C    . SER A 1 5   ? 1.943   14.765  5.447   1.00 0.00 ? 5   SER A C    5  
ATOM 8472  O O    . SER A 1 5   ? 1.311   15.779  5.742   1.00 0.00 ? 5   SER A O    5  
ATOM 8473  C CB   . SER A 1 5   ? 3.989   16.220  5.369   1.00 0.00 ? 5   SER A CB   5  
ATOM 8474  O OG   . SER A 1 5   ? 5.293   16.090  5.927   1.00 0.00 ? 5   SER A OG   5  
ATOM 8475  H H    . SER A 1 5   ? 2.761   15.127  3.010   1.00 0.00 ? 5   SER A H    5  
ATOM 8476  H HA   . SER A 1 5   ? 3.995   14.066  5.413   1.00 0.00 ? 5   SER A HA   5  
ATOM 8477  H HB2  . SER A 1 5   ? 4.033   16.864  4.491   1.00 0.00 ? 5   SER A HB2  5  
ATOM 8478  H HB3  . SER A 1 5   ? 3.332   16.708  6.090   1.00 0.00 ? 5   SER A HB3  5  
ATOM 8479  H HG   . SER A 1 5   ? 5.769   15.317  5.508   1.00 0.00 ? 5   SER A HG   5  
ATOM 8480  N N    . SER A 1 6   ? 1.456   13.534  5.503   1.00 0.00 ? 6   SER A N    5  
ATOM 8481  C CA   . SER A 1 6   ? 0.090   13.289  5.932   1.00 0.00 ? 6   SER A CA   5  
ATOM 8482  C C    . SER A 1 6   ? -0.172  11.784  6.010   1.00 0.00 ? 6   SER A C    5  
ATOM 8483  O O    . SER A 1 6   ? 0.443   11.005  5.283   1.00 0.00 ? 6   SER A O    5  
ATOM 8484  C CB   . SER A 1 6   ? -0.913  13.954  4.987   1.00 0.00 ? 6   SER A CB   5  
ATOM 8485  O OG   . SER A 1 6   ? -1.207  15.293  5.377   1.00 0.00 ? 6   SER A OG   5  
ATOM 8486  H H    . SER A 1 6   ? 1.976   12.715  5.261   1.00 0.00 ? 6   SER A H    5  
ATOM 8487  H HA   . SER A 1 6   ? 0.012   13.742  6.920   1.00 0.00 ? 6   SER A HA   5  
ATOM 8488  H HB2  . SER A 1 6   ? -0.512  13.951  3.973   1.00 0.00 ? 6   SER A HB2  5  
ATOM 8489  H HB3  . SER A 1 6   ? -1.834  13.372  4.967   1.00 0.00 ? 6   SER A HB3  5  
ATOM 8490  H HG   . SER A 1 6   ? -0.358  15.801  5.524   1.00 0.00 ? 6   SER A HG   5  
ATOM 8491  N N    . GLY A 1 7   ? -1.087  11.419  6.896   1.00 0.00 ? 7   GLY A N    5  
ATOM 8492  C CA   . GLY A 1 7   ? -1.437  10.021  7.078   1.00 0.00 ? 7   GLY A CA   5  
ATOM 8493  C C    . GLY A 1 7   ? -0.214  9.197   7.485   1.00 0.00 ? 7   GLY A C    5  
ATOM 8494  O O    . GLY A 1 7   ? 0.227   9.258   8.632   1.00 0.00 ? 7   GLY A O    5  
ATOM 8495  H H    . GLY A 1 7   ? -1.583  12.059  7.483   1.00 0.00 ? 7   GLY A H    5  
ATOM 8496  H HA2  . GLY A 1 7   ? -2.210  9.932   7.842   1.00 0.00 ? 7   GLY A HA2  5  
ATOM 8497  H HA3  . GLY A 1 7   ? -1.856  9.624   6.153   1.00 0.00 ? 7   GLY A HA3  5  
ATOM 8498  N N    . VAL A 1 8   ? 0.300   8.445   6.523   1.00 0.00 ? 8   VAL A N    5  
ATOM 8499  C CA   . VAL A 1 8   ? 1.464   7.610   6.766   1.00 0.00 ? 8   VAL A CA   5  
ATOM 8500  C C    . VAL A 1 8   ? 2.554   8.446   7.440   1.00 0.00 ? 8   VAL A C    5  
ATOM 8501  O O    . VAL A 1 8   ? 2.414   9.660   7.576   1.00 0.00 ? 8   VAL A O    5  
ATOM 8502  C CB   . VAL A 1 8   ? 1.927   6.964   5.459   1.00 0.00 ? 8   VAL A CB   5  
ATOM 8503  C CG1  . VAL A 1 8   ? 2.812   7.922   4.658   1.00 0.00 ? 8   VAL A CG1  5  
ATOM 8504  C CG2  . VAL A 1 8   ? 2.652   5.643   5.727   1.00 0.00 ? 8   VAL A CG2  5  
ATOM 8505  H H    . VAL A 1 8   ? -0.065  8.401   5.593   1.00 0.00 ? 8   VAL A H    5  
ATOM 8506  H HA   . VAL A 1 8   ? 1.161   6.814   7.447   1.00 0.00 ? 8   VAL A HA   5  
ATOM 8507  H HB   . VAL A 1 8   ? 1.043   6.746   4.861   1.00 0.00 ? 8   VAL A HB   5  
ATOM 8508  H HG11 . VAL A 1 8   ? 3.145   7.431   3.744   1.00 0.00 ? 8   VAL A HG11 5  
ATOM 8509  H HG12 . VAL A 1 8   ? 2.242   8.816   4.403   1.00 0.00 ? 8   VAL A HG12 5  
ATOM 8510  H HG13 . VAL A 1 8   ? 3.679   8.202   5.257   1.00 0.00 ? 8   VAL A HG13 5  
ATOM 8511  H HG21 . VAL A 1 8   ? 2.535   4.985   4.866   1.00 0.00 ? 8   VAL A HG21 5  
ATOM 8512  H HG22 . VAL A 1 8   ? 3.711   5.837   5.895   1.00 0.00 ? 8   VAL A HG22 5  
ATOM 8513  H HG23 . VAL A 1 8   ? 2.224   5.167   6.609   1.00 0.00 ? 8   VAL A HG23 5  
ATOM 8514  N N    . ARG A 1 9   ? 3.614   7.762   7.844   1.00 0.00 ? 9   ARG A N    5  
ATOM 8515  C CA   . ARG A 1 9   ? 4.728   8.427   8.500   1.00 0.00 ? 9   ARG A CA   5  
ATOM 8516  C C    . ARG A 1 9   ? 4.394   8.697   9.969   1.00 0.00 ? 9   ARG A C    5  
ATOM 8517  O O    . ARG A 1 9   ? 3.296   9.152   10.286  1.00 0.00 ? 9   ARG A O    5  
ATOM 8518  C CB   . ARG A 1 9   ? 5.064   9.749   7.809   1.00 0.00 ? 9   ARG A CB   5  
ATOM 8519  C CG   . ARG A 1 9   ? 6.564   9.853   7.524   1.00 0.00 ? 9   ARG A CG   5  
ATOM 8520  C CD   . ARG A 1 9   ? 6.900   11.174  6.830   1.00 0.00 ? 9   ARG A CD   5  
ATOM 8521  N NE   . ARG A 1 9   ? 7.677   12.043  7.743   1.00 0.00 ? 9   ARG A NE   5  
ATOM 8522  C CZ   . ARG A 1 9   ? 8.251   13.196  7.375   1.00 0.00 ? 9   ARG A CZ   5  
ATOM 8523  N NH1  . ARG A 1 9   ? 8.140   13.627  6.111   1.00 0.00 ? 9   ARG A NH1  5  
ATOM 8524  N NH2  . ARG A 1 9   ? 8.937   13.919  8.271   1.00 0.00 ? 9   ARG A NH2  5  
ATOM 8525  H H    . ARG A 1 9   ? 3.720   6.774   7.729   1.00 0.00 ? 9   ARG A H    5  
ATOM 8526  H HA   . ARG A 1 9   ? 5.561   7.730   8.409   1.00 0.00 ? 9   ARG A HA   5  
ATOM 8527  H HB2  . ARG A 1 9   ? 4.507   9.829   6.876   1.00 0.00 ? 9   ARG A HB2  5  
ATOM 8528  H HB3  . ARG A 1 9   ? 4.752   10.583  8.439   1.00 0.00 ? 9   ARG A HB3  5  
ATOM 8529  H HG2  . ARG A 1 9   ? 7.122   9.776   8.457   1.00 0.00 ? 9   ARG A HG2  5  
ATOM 8530  H HG3  . ARG A 1 9   ? 6.877   9.018   6.896   1.00 0.00 ? 9   ARG A HG3  5  
ATOM 8531  H HD2  . ARG A 1 9   ? 7.473   10.982  5.922   1.00 0.00 ? 9   ARG A HD2  5  
ATOM 8532  H HD3  . ARG A 1 9   ? 5.983   11.679  6.527   1.00 0.00 ? 9   ARG A HD3  5  
ATOM 8533  H HE   . ARG A 1 9   ? 7.779   11.750  8.693   1.00 0.00 ? 9   ARG A HE   5  
ATOM 8534  H HH11 . ARG A 1 9   ? 7.628   13.088  5.442   1.00 0.00 ? 9   ARG A HH11 5  
ATOM 8535  H HH12 . ARG A 1 9   ? 8.568   14.488  5.837   1.00 0.00 ? 9   ARG A HH12 5  
ATOM 8536  H HH21 . ARG A 1 9   ? 9.020   13.597  9.215   1.00 0.00 ? 9   ARG A HH21 5  
ATOM 8537  H HH22 . ARG A 1 9   ? 9.365   14.779  7.997   1.00 0.00 ? 9   ARG A HH22 5  
ATOM 8538  N N    . ARG A 1 10  ? 5.361   8.405   10.826  1.00 0.00 ? 10  ARG A N    5  
ATOM 8539  C CA   . ARG A 1 10  ? 5.183   8.610   12.253  1.00 0.00 ? 10  ARG A CA   5  
ATOM 8540  C C    . ARG A 1 10  ? 4.130   7.645   12.801  1.00 0.00 ? 10  ARG A C    5  
ATOM 8541  O O    . ARG A 1 10  ? 3.626   7.834   13.907  1.00 0.00 ? 10  ARG A O    5  
ATOM 8542  C CB   . ARG A 1 10  ? 4.754   10.048  12.553  1.00 0.00 ? 10  ARG A CB   5  
ATOM 8543  C CG   . ARG A 1 10  ? 5.830   10.786  13.351  1.00 0.00 ? 10  ARG A CG   5  
ATOM 8544  C CD   . ARG A 1 10  ? 5.420   10.935  14.817  1.00 0.00 ? 10  ARG A CD   5  
ATOM 8545  N NE   . ARG A 1 10  ? 5.375   12.368  15.187  1.00 0.00 ? 10  ARG A NE   5  
ATOM 8546  C CZ   . ARG A 1 10  ? 4.351   13.184  14.905  1.00 0.00 ? 10  ARG A CZ   5  
ATOM 8547  N NH1  . ARG A 1 10  ? 3.281   12.716  14.249  1.00 0.00 ? 10  ARG A NH1  5  
ATOM 8548  N NH2  . ARG A 1 10  ? 4.396   14.470  15.280  1.00 0.00 ? 10  ARG A NH2  5  
ATOM 8549  H H    . ARG A 1 10  ? 6.251   8.034   10.559  1.00 0.00 ? 10  ARG A H    5  
ATOM 8550  H HA   . ARG A 1 10  ? 6.163   8.410   12.687  1.00 0.00 ? 10  ARG A HA   5  
ATOM 8551  H HB2  . ARG A 1 10  ? 4.561   10.576  11.619  1.00 0.00 ? 10  ARG A HB2  5  
ATOM 8552  H HB3  . ARG A 1 10  ? 3.819   10.042  13.115  1.00 0.00 ? 10  ARG A HB3  5  
ATOM 8553  H HG2  . ARG A 1 10  ? 6.773   10.243  13.286  1.00 0.00 ? 10  ARG A HG2  5  
ATOM 8554  H HG3  . ARG A 1 10  ? 5.999   11.771  12.915  1.00 0.00 ? 10  ARG A HG3  5  
ATOM 8555  H HD2  . ARG A 1 10  ? 4.443   10.479  14.979  1.00 0.00 ? 10  ARG A HD2  5  
ATOM 8556  H HD3  . ARG A 1 10  ? 6.128   10.408  15.457  1.00 0.00 ? 10  ARG A HD3  5  
ATOM 8557  H HE   . ARG A 1 10  ? 6.158   12.750  15.678  1.00 0.00 ? 10  ARG A HE   5  
ATOM 8558  H HH11 . ARG A 1 10  ? 3.247   11.756  13.969  1.00 0.00 ? 10  ARG A HH11 5  
ATOM 8559  H HH12 . ARG A 1 10  ? 2.517   13.325  14.038  1.00 0.00 ? 10  ARG A HH12 5  
ATOM 8560  H HH21 . ARG A 1 10  ? 5.195   14.820  15.770  1.00 0.00 ? 10  ARG A HH21 5  
ATOM 8561  H HH22 . ARG A 1 10  ? 3.632   15.080  15.070  1.00 0.00 ? 10  ARG A HH22 5  
ATOM 8562  N N    . VAL A 1 11  ? 3.829   6.632   12.003  1.00 0.00 ? 11  VAL A N    5  
ATOM 8563  C CA   . VAL A 1 11  ? 2.846   5.637   12.394  1.00 0.00 ? 11  VAL A CA   5  
ATOM 8564  C C    . VAL A 1 11  ? 3.504   4.611   13.318  1.00 0.00 ? 11  VAL A C    5  
ATOM 8565  O O    . VAL A 1 11  ? 4.726   4.468   13.323  1.00 0.00 ? 11  VAL A O    5  
ATOM 8566  C CB   . VAL A 1 11  ? 2.217   5.005   11.150  1.00 0.00 ? 11  VAL A CB   5  
ATOM 8567  C CG1  . VAL A 1 11  ? 1.650   6.077   10.218  1.00 0.00 ? 11  VAL A CG1  5  
ATOM 8568  C CG2  . VAL A 1 11  ? 3.225   4.118   10.417  1.00 0.00 ? 11  VAL A CG2  5  
ATOM 8569  H H    . VAL A 1 11  ? 4.244   6.485   11.105  1.00 0.00 ? 11  VAL A H    5  
ATOM 8570  H HA   . VAL A 1 11  ? 2.059   6.152   12.945  1.00 0.00 ? 11  VAL A HA   5  
ATOM 8571  H HB   . VAL A 1 11  ? 1.391   4.373   11.477  1.00 0.00 ? 11  VAL A HB   5  
ATOM 8572  H HG11 . VAL A 1 11  ? 2.454   6.493   9.611   1.00 0.00 ? 11  VAL A HG11 5  
ATOM 8573  H HG12 . VAL A 1 11  ? 0.898   5.631   9.567   1.00 0.00 ? 11  VAL A HG12 5  
ATOM 8574  H HG13 . VAL A 1 11  ? 1.194   6.870   10.810  1.00 0.00 ? 11  VAL A HG13 5  
ATOM 8575  H HG21 . VAL A 1 11  ? 2.733   3.622   9.581   1.00 0.00 ? 11  VAL A HG21 5  
ATOM 8576  H HG22 . VAL A 1 11  ? 4.046   4.731   10.045  1.00 0.00 ? 11  VAL A HG22 5  
ATOM 8577  H HG23 . VAL A 1 11  ? 3.616   3.367   11.105  1.00 0.00 ? 11  VAL A HG23 5  
ATOM 8578  N N    . PRO A 1 12  ? 2.643   3.904   14.099  1.00 0.00 ? 12  PRO A N    5  
ATOM 8579  C CA   . PRO A 1 12  ? 3.128   2.895   15.025  1.00 0.00 ? 12  PRO A CA   5  
ATOM 8580  C C    . PRO A 1 12  ? 3.551   1.626   14.282  1.00 0.00 ? 12  PRO A C    5  
ATOM 8581  O O    . PRO A 1 12  ? 4.139   0.723   14.874  1.00 0.00 ? 12  PRO A O    5  
ATOM 8582  C CB   . PRO A 1 12  ? 1.978   2.663   15.991  1.00 0.00 ? 12  PRO A CB   5  
ATOM 8583  C CG   . PRO A 1 12  ? 0.737   3.201   15.299  1.00 0.00 ? 12  PRO A CG   5  
ATOM 8584  C CD   . PRO A 1 12  ? 1.190   4.046   14.120  1.00 0.00 ? 12  PRO A CD   5  
ATOM 8585  H HA   . PRO A 1 12  ? 3.948   3.222   15.496  1.00 0.00 ? 12  PRO A HA   5  
ATOM 8586  H HB2  . PRO A 1 12  ? 1.869   1.603   16.221  1.00 0.00 ? 12  PRO A HB2  5  
ATOM 8587  H HB3  . PRO A 1 12  ? 2.152   3.177   16.937  1.00 0.00 ? 12  PRO A HB3  5  
ATOM 8588  H HG2  . PRO A 1 12  ? 0.103   2.381   14.960  1.00 0.00 ? 12  PRO A HG2  5  
ATOM 8589  H HG3  . PRO A 1 12  ? 0.142   3.798   15.990  1.00 0.00 ? 12  PRO A HG3  5  
ATOM 8590  H HD2  . PRO A 1 12  ? 0.745   3.697   13.188  1.00 0.00 ? 12  PRO A HD2  5  
ATOM 8591  H HD3  . PRO A 1 12  ? 0.896   5.088   14.243  1.00 0.00 ? 12  PRO A HD3  5  
ATOM 8592  N N    . LEU A 1 13  ? 3.234   1.599   12.996  1.00 0.00 ? 13  LEU A N    5  
ATOM 8593  C CA   . LEU A 1 13  ? 3.574   0.456   12.166  1.00 0.00 ? 13  LEU A CA   5  
ATOM 8594  C C    . LEU A 1 13  ? 5.095   0.369   12.022  1.00 0.00 ? 13  LEU A C    5  
ATOM 8595  O O    . LEU A 1 13  ? 5.706   -0.612  12.443  1.00 0.00 ? 13  LEU A O    5  
ATOM 8596  C CB   . LEU A 1 13  ? 2.833   0.526   10.829  1.00 0.00 ? 13  LEU A CB   5  
ATOM 8597  C CG   . LEU A 1 13  ? 1.350   0.152   10.863  1.00 0.00 ? 13  LEU A CG   5  
ATOM 8598  C CD1  . LEU A 1 13  ? 0.644   0.588   9.578   1.00 0.00 ? 13  LEU A CD1  5  
ATOM 8599  C CD2  . LEU A 1 13  ? 1.167   -1.342  11.139  1.00 0.00 ? 13  LEU A CD2  5  
ATOM 8600  H H    . LEU A 1 13  ? 2.756   2.338   12.522  1.00 0.00 ? 13  LEU A H    5  
ATOM 8601  H HA   . LEU A 1 13  ? 3.224   -0.438  12.682  1.00 0.00 ? 13  LEU A HA   5  
ATOM 8602  H HB2  . LEU A 1 13  ? 2.923   1.540   10.439  1.00 0.00 ? 13  LEU A HB2  5  
ATOM 8603  H HB3  . LEU A 1 13  ? 3.337   -0.133  10.122  1.00 0.00 ? 13  LEU A HB3  5  
ATOM 8604  H HG   . LEU A 1 13  ? 0.881   0.691   11.687  1.00 0.00 ? 13  LEU A HG   5  
ATOM 8605  H HD11 . LEU A 1 13  ? -0.267  0.005   9.448   1.00 0.00 ? 13  LEU A HD11 5  
ATOM 8606  H HD12 . LEU A 1 13  ? 0.393   1.647   9.643   1.00 0.00 ? 13  LEU A HD12 5  
ATOM 8607  H HD13 . LEU A 1 13  ? 1.305   0.423   8.727   1.00 0.00 ? 13  LEU A HD13 5  
ATOM 8608  H HD21 . LEU A 1 13  ? 1.764   -1.918  10.432  1.00 0.00 ? 13  LEU A HD21 5  
ATOM 8609  H HD22 . LEU A 1 13  ? 1.491   -1.566  12.155  1.00 0.00 ? 13  LEU A HD22 5  
ATOM 8610  H HD23 . LEU A 1 13  ? 0.116   -1.606  11.026  1.00 0.00 ? 13  LEU A HD23 5  
ATOM 8611  N N    . PHE A 1 14  ? 5.661   1.408   11.427  1.00 0.00 ? 14  PHE A N    5  
ATOM 8612  C CA   . PHE A 1 14  ? 7.099   1.461   11.223  1.00 0.00 ? 14  PHE A CA   5  
ATOM 8613  C C    . PHE A 1 14  ? 7.818   1.903   12.499  1.00 0.00 ? 14  PHE A C    5  
ATOM 8614  O O    . PHE A 1 14  ? 8.541   2.898   12.496  1.00 0.00 ? 14  PHE A O    5  
ATOM 8615  C CB   . PHE A 1 14  ? 7.357   2.493   10.123  1.00 0.00 ? 14  PHE A CB   5  
ATOM 8616  C CG   . PHE A 1 14  ? 6.328   2.466   8.991   1.00 0.00 ? 14  PHE A CG   5  
ATOM 8617  C CD1  . PHE A 1 14  ? 6.067   1.303   8.337   1.00 0.00 ? 14  PHE A CD1  5  
ATOM 8618  C CD2  . PHE A 1 14  ? 5.674   3.606   8.639   1.00 0.00 ? 14  PHE A CD2  5  
ATOM 8619  C CE1  . PHE A 1 14  ? 5.112   1.278   7.286   1.00 0.00 ? 14  PHE A CE1  5  
ATOM 8620  C CE2  . PHE A 1 14  ? 4.719   3.581   7.589   1.00 0.00 ? 14  PHE A CE2  5  
ATOM 8621  C CZ   . PHE A 1 14  ? 4.458   2.418   6.934   1.00 0.00 ? 14  PHE A CZ   5  
ATOM 8622  H H    . PHE A 1 14  ? 5.157   2.202   11.087  1.00 0.00 ? 14  PHE A H    5  
ATOM 8623  H HA   . PHE A 1 14  ? 7.425   0.457   10.954  1.00 0.00 ? 14  PHE A HA   5  
ATOM 8624  H HB2  . PHE A 1 14  ? 7.367   3.488   10.568  1.00 0.00 ? 14  PHE A HB2  5  
ATOM 8625  H HB3  . PHE A 1 14  ? 8.348   2.322   9.703   1.00 0.00 ? 14  PHE A HB3  5  
ATOM 8626  H HD1  . PHE A 1 14  ? 6.591   0.390   8.619   1.00 0.00 ? 14  PHE A HD1  5  
ATOM 8627  H HD2  . PHE A 1 14  ? 5.883   4.538   9.164   1.00 0.00 ? 14  PHE A HD2  5  
ATOM 8628  H HE1  . PHE A 1 14  ? 4.903   0.346   6.762   1.00 0.00 ? 14  PHE A HE1  5  
ATOM 8629  H HE2  . PHE A 1 14  ? 4.195   4.495   7.306   1.00 0.00 ? 14  PHE A HE2  5  
ATOM 8630  H HZ   . PHE A 1 14  ? 3.725   2.399   6.128   1.00 0.00 ? 14  PHE A HZ   5  
ATOM 8631  N N    . GLU A 1 15  ? 7.594   1.141   13.560  1.00 0.00 ? 15  GLU A N    5  
ATOM 8632  C CA   . GLU A 1 15  ? 8.212   1.442   14.840  1.00 0.00 ? 15  GLU A CA   5  
ATOM 8633  C C    . GLU A 1 15  ? 9.574   0.753   14.947  1.00 0.00 ? 15  GLU A C    5  
ATOM 8634  O O    . GLU A 1 15  ? 10.574  1.394   15.268  1.00 0.00 ? 15  GLU A O    5  
ATOM 8635  C CB   . GLU A 1 15  ? 7.299   1.034   15.998  1.00 0.00 ? 15  GLU A CB   5  
ATOM 8636  C CG   . GLU A 1 15  ? 6.487   2.229   16.503  1.00 0.00 ? 15  GLU A CG   5  
ATOM 8637  C CD   . GLU A 1 15  ? 6.707   2.446   18.002  1.00 0.00 ? 15  GLU A CD   5  
ATOM 8638  O OE1  . GLU A 1 15  ? 7.729   3.083   18.339  1.00 0.00 ? 15  GLU A OE1  5  
ATOM 8639  O OE2  . GLU A 1 15  ? 5.848   1.972   18.776  1.00 0.00 ? 15  GLU A OE2  5  
ATOM 8640  H H    . GLU A 1 15  ? 7.005   0.333   13.554  1.00 0.00 ? 15  GLU A H    5  
ATOM 8641  H HA   . GLU A 1 15  ? 8.342   2.524   14.852  1.00 0.00 ? 15  GLU A HA   5  
ATOM 8642  H HB2  . GLU A 1 15  ? 6.624   0.243   15.673  1.00 0.00 ? 15  GLU A HB2  5  
ATOM 8643  H HB3  . GLU A 1 15  ? 7.898   0.626   16.813  1.00 0.00 ? 15  GLU A HB3  5  
ATOM 8644  H HG2  . GLU A 1 15  ? 6.775   3.126   15.956  1.00 0.00 ? 15  GLU A HG2  5  
ATOM 8645  H HG3  . GLU A 1 15  ? 5.428   2.062   16.308  1.00 0.00 ? 15  GLU A HG3  5  
ATOM 8646  N N    . ASN A 1 16  ? 9.569   -0.543  14.673  1.00 0.00 ? 16  ASN A N    5  
ATOM 8647  C CA   . ASN A 1 16  ? 10.792  -1.326  14.735  1.00 0.00 ? 16  ASN A CA   5  
ATOM 8648  C C    . ASN A 1 16  ? 11.494  -1.275  13.376  1.00 0.00 ? 16  ASN A C    5  
ATOM 8649  O O    . ASN A 1 16  ? 12.715  -1.401  13.299  1.00 0.00 ? 16  ASN A O    5  
ATOM 8650  C CB   . ASN A 1 16  ? 10.493  -2.791  15.057  1.00 0.00 ? 16  ASN A CB   5  
ATOM 8651  C CG   . ASN A 1 16  ? 9.643   -3.432  13.958  1.00 0.00 ? 16  ASN A CG   5  
ATOM 8652  O OD1  . ASN A 1 16  ? 8.538   -3.007  13.665  1.00 0.00 ? 16  ASN A OD1  5  
ATOM 8653  N ND2  . ASN A 1 16  ? 10.219  -4.476  13.369  1.00 0.00 ? 16  ASN A ND2  5  
ATOM 8654  H H    . ASN A 1 16  ? 8.751   -1.057  14.413  1.00 0.00 ? 16  ASN A H    5  
ATOM 8655  H HA   . ASN A 1 16  ? 11.384  -0.869  15.528  1.00 0.00 ? 16  ASN A HA   5  
ATOM 8656  H HB2  . ASN A 1 16  ? 11.427  -3.341  15.167  1.00 0.00 ? 16  ASN A HB2  5  
ATOM 8657  H HB3  . ASN A 1 16  ? 9.970   -2.858  16.011  1.00 0.00 ? 16  ASN A HB3  5  
ATOM 8658  H HD21 . ASN A 1 16  ? 11.129  -4.774  13.657  1.00 0.00 ? 16  ASN A HD21 5  
ATOM 8659  H HD22 . ASN A 1 16  ? 9.742   -4.963  12.637  1.00 0.00 ? 16  ASN A HD22 5  
ATOM 8660  N N    . MET A 1 17  ? 10.692  -1.089  12.338  1.00 0.00 ? 17  MET A N    5  
ATOM 8661  C CA   . MET A 1 17  ? 11.221  -1.020  10.986  1.00 0.00 ? 17  MET A CA   5  
ATOM 8662  C C    . MET A 1 17  ? 12.411  -0.061  10.912  1.00 0.00 ? 17  MET A C    5  
ATOM 8663  O O    . MET A 1 17  ? 12.596  0.774   11.796  1.00 0.00 ? 17  MET A O    5  
ATOM 8664  C CB   . MET A 1 17  ? 10.123  -0.546  10.032  1.00 0.00 ? 17  MET A CB   5  
ATOM 8665  C CG   . MET A 1 17  ? 10.054  -1.437  8.790   1.00 0.00 ? 17  MET A CG   5  
ATOM 8666  S SD   . MET A 1 17  ? 8.603   -1.036  7.831   1.00 0.00 ? 17  MET A SD   5  
ATOM 8667  C CE   . MET A 1 17  ? 7.614   -2.489  8.142   1.00 0.00 ? 17  MET A CE   5  
ATOM 8668  H H    . MET A 1 17  ? 9.699   -0.988  12.409  1.00 0.00 ? 17  MET A H    5  
ATOM 8669  H HA   . MET A 1 17  ? 11.545  -2.033  10.747  1.00 0.00 ? 17  MET A HA   5  
ATOM 8670  H HB2  . MET A 1 17  ? 9.161   -0.556  10.545  1.00 0.00 ? 17  MET A HB2  5  
ATOM 8671  H HB3  . MET A 1 17  ? 10.315  0.485   9.734   1.00 0.00 ? 17  MET A HB3  5  
ATOM 8672  H HG2  . MET A 1 17  ? 10.950  -1.301  8.184   1.00 0.00 ? 17  MET A HG2  5  
ATOM 8673  H HG3  . MET A 1 17  ? 10.026  -2.486  9.086   1.00 0.00 ? 17  MET A HG3  5  
ATOM 8674  H HE1  . MET A 1 17  ? 7.699   -2.769  9.192   1.00 0.00 ? 17  MET A HE1  5  
ATOM 8675  H HE2  . MET A 1 17  ? 6.571   -2.276  7.906   1.00 0.00 ? 17  MET A HE2  5  
ATOM 8676  H HE3  . MET A 1 17  ? 7.968   -3.310  7.517   1.00 0.00 ? 17  MET A HE3  5  
ATOM 8677  N N    . ASP A 1 18  ? 13.187  -0.214  9.849   1.00 0.00 ? 18  ASP A N    5  
ATOM 8678  C CA   . ASP A 1 18  ? 14.354  0.628   9.648   1.00 0.00 ? 18  ASP A CA   5  
ATOM 8679  C C    . ASP A 1 18  ? 14.066  1.633   8.531   1.00 0.00 ? 18  ASP A C    5  
ATOM 8680  O O    . ASP A 1 18  ? 13.209  1.394   7.682   1.00 0.00 ? 18  ASP A O    5  
ATOM 8681  C CB   . ASP A 1 18  ? 15.569  -0.205  9.233   1.00 0.00 ? 18  ASP A CB   5  
ATOM 8682  C CG   . ASP A 1 18  ? 16.666  -0.320  10.293  1.00 0.00 ? 18  ASP A CG   5  
ATOM 8683  O OD1  . ASP A 1 18  ? 16.310  -0.647  11.445  1.00 0.00 ? 18  ASP A OD1  5  
ATOM 8684  O OD2  . ASP A 1 18  ? 17.837  -0.078  9.926   1.00 0.00 ? 18  ASP A OD2  5  
ATOM 8685  H H    . ASP A 1 18  ? 13.029  -0.896  9.135   1.00 0.00 ? 18  ASP A H    5  
ATOM 8686  H HA   . ASP A 1 18  ? 14.528  1.111   10.609  1.00 0.00 ? 18  ASP A HA   5  
ATOM 8687  H HB2  . ASP A 1 18  ? 15.231  -1.207  8.971   1.00 0.00 ? 18  ASP A HB2  5  
ATOM 8688  H HB3  . ASP A 1 18  ? 15.999  0.232   8.332   1.00 0.00 ? 18  ASP A HB3  5  
ATOM 8689  N N    . GLU A 1 19  ? 14.799  2.736   8.567   1.00 0.00 ? 19  GLU A N    5  
ATOM 8690  C CA   . GLU A 1 19  ? 14.633  3.778   7.568   1.00 0.00 ? 19  GLU A CA   5  
ATOM 8691  C C    . GLU A 1 19  ? 14.750  3.189   6.161   1.00 0.00 ? 19  GLU A C    5  
ATOM 8692  O O    . GLU A 1 19  ? 13.871  3.389   5.325   1.00 0.00 ? 19  GLU A O    5  
ATOM 8693  C CB   . GLU A 1 19  ? 15.648  4.904   7.777   1.00 0.00 ? 19  GLU A CB   5  
ATOM 8694  C CG   . GLU A 1 19  ? 15.289  5.745   9.004   1.00 0.00 ? 19  GLU A CG   5  
ATOM 8695  C CD   . GLU A 1 19  ? 16.492  5.893   9.938   1.00 0.00 ? 19  GLU A CD   5  
ATOM 8696  O OE1  . GLU A 1 19  ? 17.300  6.811   9.683   1.00 0.00 ? 19  GLU A OE1  5  
ATOM 8697  O OE2  . GLU A 1 19  ? 16.576  5.083   10.887  1.00 0.00 ? 19  GLU A OE2  5  
ATOM 8698  H H    . GLU A 1 19  ? 15.495  2.923   9.261   1.00 0.00 ? 19  GLU A H    5  
ATOM 8699  H HA   . GLU A 1 19  ? 13.628  4.170   7.723   1.00 0.00 ? 19  GLU A HA   5  
ATOM 8700  H HB2  . GLU A 1 19  ? 16.645  4.482   7.900   1.00 0.00 ? 19  GLU A HB2  5  
ATOM 8701  H HB3  . GLU A 1 19  ? 15.678  5.540   6.892   1.00 0.00 ? 19  GLU A HB3  5  
ATOM 8702  H HG2  . GLU A 1 19  ? 14.948  6.730   8.687   1.00 0.00 ? 19  GLU A HG2  5  
ATOM 8703  H HG3  . GLU A 1 19  ? 14.463  5.278   9.540   1.00 0.00 ? 19  GLU A HG3  5  
ATOM 8704  N N    . ARG A 1 20  ? 15.844  2.473   5.944   1.00 0.00 ? 20  ARG A N    5  
ATOM 8705  C CA   . ARG A 1 20  ? 16.087  1.853   4.652   1.00 0.00 ? 20  ARG A CA   5  
ATOM 8706  C C    . ARG A 1 20  ? 14.822  1.152   4.153   1.00 0.00 ? 20  ARG A C    5  
ATOM 8707  O O    . ARG A 1 20  ? 14.551  1.133   2.953   1.00 0.00 ? 20  ARG A O    5  
ATOM 8708  C CB   . ARG A 1 20  ? 17.226  0.835   4.736   1.00 0.00 ? 20  ARG A CB   5  
ATOM 8709  C CG   . ARG A 1 20  ? 18.534  1.508   5.157   1.00 0.00 ? 20  ARG A CG   5  
ATOM 8710  C CD   . ARG A 1 20  ? 19.378  1.879   3.936   1.00 0.00 ? 20  ARG A CD   5  
ATOM 8711  N NE   . ARG A 1 20  ? 19.806  0.654   3.225   1.00 0.00 ? 20  ARG A NE   5  
ATOM 8712  C CZ   . ARG A 1 20  ? 20.828  0.605   2.361   1.00 0.00 ? 20  ARG A CZ   5  
ATOM 8713  N NH1  . ARG A 1 20  ? 21.533  1.713   2.094   1.00 0.00 ? 20  ARG A NH1  5  
ATOM 8714  N NH2  . ARG A 1 20  ? 21.145  -0.551  1.762   1.00 0.00 ? 20  ARG A NH2  5  
ATOM 8715  H H    . ARG A 1 20  ? 16.554  2.314   6.629   1.00 0.00 ? 20  ARG A H    5  
ATOM 8716  H HA   . ARG A 1 20  ? 16.365  2.677   3.995   1.00 0.00 ? 20  ARG A HA   5  
ATOM 8717  H HB2  . ARG A 1 20  ? 16.968  0.053   5.451   1.00 0.00 ? 20  ARG A HB2  5  
ATOM 8718  H HB3  . ARG A 1 20  ? 17.358  0.350   3.769   1.00 0.00 ? 20  ARG A HB3  5  
ATOM 8719  H HG2  . ARG A 1 20  ? 18.315  2.404   5.739   1.00 0.00 ? 20  ARG A HG2  5  
ATOM 8720  H HG3  . ARG A 1 20  ? 19.100  0.838   5.805   1.00 0.00 ? 20  ARG A HG3  5  
ATOM 8721  H HD2  . ARG A 1 20  ? 18.801  2.516   3.265   1.00 0.00 ? 20  ARG A HD2  5  
ATOM 8722  H HD3  . ARG A 1 20  ? 20.251  2.452   4.248   1.00 0.00 ? 20  ARG A HD3  5  
ATOM 8723  H HE   . ARG A 1 20  ? 19.300  -0.191  3.401   1.00 0.00 ? 20  ARG A HE   5  
ATOM 8724  H HH11 . ARG A 1 20  ? 21.297  2.576   2.541   1.00 0.00 ? 20  ARG A HH11 5  
ATOM 8725  H HH12 . ARG A 1 20  ? 22.296  1.677   1.449   1.00 0.00 ? 20  ARG A HH12 5  
ATOM 8726  H HH21 . ARG A 1 20  ? 20.619  -1.378  1.961   1.00 0.00 ? 20  ARG A HH21 5  
ATOM 8727  H HH22 . ARG A 1 20  ? 21.908  -0.587  1.117   1.00 0.00 ? 20  ARG A HH22 5  
ATOM 8728  N N    . LEU A 1 21  ? 14.080  0.595   5.098   1.00 0.00 ? 21  LEU A N    5  
ATOM 8729  C CA   . LEU A 1 21  ? 12.850  -0.105  4.769   1.00 0.00 ? 21  LEU A CA   5  
ATOM 8730  C C    . LEU A 1 21  ? 11.779  0.914   4.376   1.00 0.00 ? 21  LEU A C    5  
ATOM 8731  O O    . LEU A 1 21  ? 10.991  0.671   3.463   1.00 0.00 ? 21  LEU A O    5  
ATOM 8732  C CB   . LEU A 1 21  ? 12.432  -1.023  5.919   1.00 0.00 ? 21  LEU A CB   5  
ATOM 8733  C CG   . LEU A 1 21  ? 11.985  -2.432  5.524   1.00 0.00 ? 21  LEU A CG   5  
ATOM 8734  C CD1  . LEU A 1 21  ? 12.960  -3.056  4.523   1.00 0.00 ? 21  LEU A CD1  5  
ATOM 8735  C CD2  . LEU A 1 21  ? 11.789  -3.313  6.759   1.00 0.00 ? 21  LEU A CD2  5  
ATOM 8736  H H    . LEU A 1 21  ? 14.307  0.615   6.072   1.00 0.00 ? 21  LEU A H    5  
ATOM 8737  H HA   . LEU A 1 21  ? 13.056  -0.740  3.908   1.00 0.00 ? 21  LEU A HA   5  
ATOM 8738  H HB2  . LEU A 1 21  ? 13.270  -1.111  6.611   1.00 0.00 ? 21  LEU A HB2  5  
ATOM 8739  H HB3  . LEU A 1 21  ? 11.618  -0.545  6.463   1.00 0.00 ? 21  LEU A HB3  5  
ATOM 8740  H HG   . LEU A 1 21  ? 11.018  -2.357  5.026   1.00 0.00 ? 21  LEU A HG   5  
ATOM 8741  H HD11 . LEU A 1 21  ? 13.044  -4.126  4.717   1.00 0.00 ? 21  LEU A HD11 5  
ATOM 8742  H HD12 . LEU A 1 21  ? 12.591  -2.898  3.510   1.00 0.00 ? 21  LEU A HD12 5  
ATOM 8743  H HD13 . LEU A 1 21  ? 13.939  -2.590  4.631   1.00 0.00 ? 21  LEU A HD13 5  
ATOM 8744  H HD21 . LEU A 1 21  ? 12.211  -2.813  7.632   1.00 0.00 ? 21  LEU A HD21 5  
ATOM 8745  H HD22 . LEU A 1 21  ? 10.725  -3.485  6.918   1.00 0.00 ? 21  LEU A HD22 5  
ATOM 8746  H HD23 . LEU A 1 21  ? 12.293  -4.268  6.608   1.00 0.00 ? 21  LEU A HD23 5  
ATOM 8747  N N    . LEU A 1 22  ? 11.783  2.034   5.084   1.00 0.00 ? 22  LEU A N    5  
ATOM 8748  C CA   . LEU A 1 22  ? 10.822  3.090   4.821   1.00 0.00 ? 22  LEU A CA   5  
ATOM 8749  C C    . LEU A 1 22  ? 11.023  3.614   3.397   1.00 0.00 ? 22  LEU A C    5  
ATOM 8750  O O    . LEU A 1 22  ? 10.071  3.697   2.622   1.00 0.00 ? 22  LEU A O    5  
ATOM 8751  C CB   . LEU A 1 22  ? 10.912  4.177   5.894   1.00 0.00 ? 22  LEU A CB   5  
ATOM 8752  C CG   . LEU A 1 22  ? 10.031  3.975   7.129   1.00 0.00 ? 22  LEU A CG   5  
ATOM 8753  C CD1  . LEU A 1 22  ? 8.548   4.001   6.754   1.00 0.00 ? 22  LEU A CD1  5  
ATOM 8754  C CD2  . LEU A 1 22  ? 10.414  2.693   7.871   1.00 0.00 ? 22  LEU A CD2  5  
ATOM 8755  H H    . LEU A 1 22  ? 12.427  2.224   5.826   1.00 0.00 ? 22  LEU A H    5  
ATOM 8756  H HA   . LEU A 1 22  ? 9.826   2.651   4.890   1.00 0.00 ? 22  LEU A HA   5  
ATOM 8757  H HB2  . LEU A 1 22  ? 11.949  4.253   6.220   1.00 0.00 ? 22  LEU A HB2  5  
ATOM 8758  H HB3  . LEU A 1 22  ? 10.651  5.132   5.438   1.00 0.00 ? 22  LEU A HB3  5  
ATOM 8759  H HG   . LEU A 1 22  ? 10.205  4.807   7.812   1.00 0.00 ? 22  LEU A HG   5  
ATOM 8760  H HD11 . LEU A 1 22  ? 8.435   4.390   5.742   1.00 0.00 ? 22  LEU A HD11 5  
ATOM 8761  H HD12 . LEU A 1 22  ? 8.144   2.990   6.802   1.00 0.00 ? 22  LEU A HD12 5  
ATOM 8762  H HD13 . LEU A 1 22  ? 8.008   4.641   7.452   1.00 0.00 ? 22  LEU A HD13 5  
ATOM 8763  H HD21 . LEU A 1 22  ? 9.527   2.074   8.007   1.00 0.00 ? 22  LEU A HD21 5  
ATOM 8764  H HD22 . LEU A 1 22  ? 11.154  2.144   7.289   1.00 0.00 ? 22  LEU A HD22 5  
ATOM 8765  H HD23 . LEU A 1 22  ? 10.832  2.948   8.845   1.00 0.00 ? 22  LEU A HD23 5  
ATOM 8766  N N    . ASP A 1 23  ? 12.268  3.953   3.096   1.00 0.00 ? 23  ASP A N    5  
ATOM 8767  C CA   . ASP A 1 23  ? 12.606  4.465   1.779   1.00 0.00 ? 23  ASP A CA   5  
ATOM 8768  C C    . ASP A 1 23  ? 12.213  3.435   0.719   1.00 0.00 ? 23  ASP A C    5  
ATOM 8769  O O    . ASP A 1 23  ? 11.508  3.759   -0.235  1.00 0.00 ? 23  ASP A O    5  
ATOM 8770  C CB   . ASP A 1 23  ? 14.110  4.719   1.657   1.00 0.00 ? 23  ASP A CB   5  
ATOM 8771  C CG   . ASP A 1 23  ? 14.530  5.537   0.434   1.00 0.00 ? 23  ASP A CG   5  
ATOM 8772  O OD1  . ASP A 1 23  ? 13.708  6.372   -0.001  1.00 0.00 ? 23  ASP A OD1  5  
ATOM 8773  O OD2  . ASP A 1 23  ? 15.665  5.309   -0.039  1.00 0.00 ? 23  ASP A OD2  5  
ATOM 8774  H H    . ASP A 1 23  ? 13.036  3.882   3.732   1.00 0.00 ? 23  ASP A H    5  
ATOM 8775  H HA   . ASP A 1 23  ? 12.049  5.397   1.683   1.00 0.00 ? 23  ASP A HA   5  
ATOM 8776  H HB2  . ASP A 1 23  ? 14.451  5.235   2.555   1.00 0.00 ? 23  ASP A HB2  5  
ATOM 8777  H HB3  . ASP A 1 23  ? 14.624  3.759   1.627   1.00 0.00 ? 23  ASP A HB3  5  
ATOM 8778  N N    . ALA A 1 24  ? 12.686  2.214   0.922   1.00 0.00 ? 24  ALA A N    5  
ATOM 8779  C CA   . ALA A 1 24  ? 12.393  1.134   -0.005  1.00 0.00 ? 24  ALA A CA   5  
ATOM 8780  C C    . ALA A 1 24  ? 10.877  0.946   -0.099  1.00 0.00 ? 24  ALA A C    5  
ATOM 8781  O O    . ALA A 1 24  ? 10.300  1.052   -1.180  1.00 0.00 ? 24  ALA A O    5  
ATOM 8782  C CB   . ALA A 1 24  ? 13.112  -0.138  0.449   1.00 0.00 ? 24  ALA A CB   5  
ATOM 8783  H H    . ALA A 1 24  ? 13.259  1.959   1.700   1.00 0.00 ? 24  ALA A H    5  
ATOM 8784  H HA   . ALA A 1 24  ? 12.776  1.424   -0.984  1.00 0.00 ? 24  ALA A HA   5  
ATOM 8785  H HB1  . ALA A 1 24  ? 12.466  -1.000  0.280   1.00 0.00 ? 24  ALA A HB1  5  
ATOM 8786  H HB2  . ALA A 1 24  ? 14.033  -0.257  -0.121  1.00 0.00 ? 24  ALA A HB2  5  
ATOM 8787  H HB3  . ALA A 1 24  ? 13.348  -0.063  1.510   1.00 0.00 ? 24  ALA A HB3  5  
ATOM 8788  N N    . ILE A 1 25  ? 10.276  0.670   1.049   1.00 0.00 ? 25  ILE A N    5  
ATOM 8789  C CA   . ILE A 1 25  ? 8.838   0.466   1.110   1.00 0.00 ? 25  ILE A CA   5  
ATOM 8790  C C    . ILE A 1 25  ? 8.129   1.671   0.489   1.00 0.00 ? 25  ILE A C    5  
ATOM 8791  O O    . ILE A 1 25  ? 7.067   1.528   -0.114  1.00 0.00 ? 25  ILE A O    5  
ATOM 8792  C CB   . ILE A 1 25  ? 8.400   0.167   2.546   1.00 0.00 ? 25  ILE A CB   5  
ATOM 8793  C CG1  . ILE A 1 25  ? 8.979   -1.164  3.030   1.00 0.00 ? 25  ILE A CG1  5  
ATOM 8794  C CG2  . ILE A 1 25  ? 6.876   0.210   2.674   1.00 0.00 ? 25  ILE A CG2  5  
ATOM 8795  C CD1  . ILE A 1 25  ? 8.797   -1.324  4.540   1.00 0.00 ? 25  ILE A CD1  5  
ATOM 8796  H H    . ILE A 1 25  ? 10.752  0.586   1.924   1.00 0.00 ? 25  ILE A H    5  
ATOM 8797  H HA   . ILE A 1 25  ? 8.608   -0.416  0.513   1.00 0.00 ? 25  ILE A HA   5  
ATOM 8798  H HB   . ILE A 1 25  ? 8.800   0.947   3.194   1.00 0.00 ? 25  ILE A HB   5  
ATOM 8799  H HG12 . ILE A 1 25  ? 8.488   -1.988  2.511   1.00 0.00 ? 25  ILE A HG12 5  
ATOM 8800  H HG13 . ILE A 1 25  ? 10.039  -1.216  2.780   1.00 0.00 ? 25  ILE A HG13 5  
ATOM 8801  H HG21 . ILE A 1 25  ? 6.494   1.094   2.163   1.00 0.00 ? 25  ILE A HG21 5  
ATOM 8802  H HG22 . ILE A 1 25  ? 6.448   -0.685  2.223   1.00 0.00 ? 25  ILE A HG22 5  
ATOM 8803  H HG23 . ILE A 1 25  ? 6.602   0.253   3.728   1.00 0.00 ? 25  ILE A HG23 5  
ATOM 8804  H HD11 . ILE A 1 25  ? 9.498   -0.673  5.062   1.00 0.00 ? 25  ILE A HD11 5  
ATOM 8805  H HD12 . ILE A 1 25  ? 7.777   -1.053  4.814   1.00 0.00 ? 25  ILE A HD12 5  
ATOM 8806  H HD13 . ILE A 1 25  ? 8.985   -2.361  4.821   1.00 0.00 ? 25  ILE A HD13 5  
ATOM 8807  N N    . CYS A 1 26  ? 8.745   2.832   0.659   1.00 0.00 ? 26  CYS A N    5  
ATOM 8808  C CA   . CYS A 1 26  ? 8.187   4.061   0.123   1.00 0.00 ? 26  CYS A CA   5  
ATOM 8809  C C    . CYS A 1 26  ? 8.331   4.030   -1.400  1.00 0.00 ? 26  CYS A C    5  
ATOM 8810  O O    . CYS A 1 26  ? 7.337   4.071   -2.122  1.00 0.00 ? 26  CYS A O    5  
ATOM 8811  C CB   . CYS A 1 26  ? 8.849   5.297   0.734   1.00 0.00 ? 26  CYS A CB   5  
ATOM 8812  S SG   . CYS A 1 26  ? 8.091   5.676   2.357   1.00 0.00 ? 26  CYS A SG   5  
ATOM 8813  H H    . CYS A 1 26  ? 9.609   2.940   1.152   1.00 0.00 ? 26  CYS A H    5  
ATOM 8814  H HA   . CYS A 1 26  ? 7.136   4.079   0.412   1.00 0.00 ? 26  CYS A HA   5  
ATOM 8815  H HB2  . CYS A 1 26  ? 9.918   5.125   0.854   1.00 0.00 ? 26  CYS A HB2  5  
ATOM 8816  H HB3  . CYS A 1 26  ? 8.736   6.149   0.064   1.00 0.00 ? 26  CYS A HB3  5  
ATOM 8817  H HG   . CYS A 1 26  ? 7.680   6.899   2.036   1.00 0.00 ? 26  CYS A HG   5  
ATOM 8818  N N    . GLU A 1 27  ? 9.578   3.959   -1.843  1.00 0.00 ? 27  GLU A N    5  
ATOM 8819  C CA   . GLU A 1 27  ? 9.866   3.922   -3.266  1.00 0.00 ? 27  GLU A CA   5  
ATOM 8820  C C    . GLU A 1 27  ? 8.950   2.916   -3.967  1.00 0.00 ? 27  GLU A C    5  
ATOM 8821  O O    . GLU A 1 27  ? 8.646   3.067   -5.149  1.00 0.00 ? 27  GLU A O    5  
ATOM 8822  C CB   . GLU A 1 27  ? 11.338  3.593   -3.520  1.00 0.00 ? 27  GLU A CB   5  
ATOM 8823  C CG   . GLU A 1 27  ? 12.114  4.841   -3.945  1.00 0.00 ? 27  GLU A CG   5  
ATOM 8824  C CD   . GLU A 1 27  ? 13.099  4.518   -5.070  1.00 0.00 ? 27  GLU A CD   5  
ATOM 8825  O OE1  . GLU A 1 27  ? 12.613  4.190   -6.174  1.00 0.00 ? 27  GLU A OE1  5  
ATOM 8826  O OE2  . GLU A 1 27  ? 14.317  4.606   -4.801  1.00 0.00 ? 27  GLU A OE2  5  
ATOM 8827  H H    . GLU A 1 27  ? 10.381  3.926   -1.248  1.00 0.00 ? 27  GLU A H    5  
ATOM 8828  H HA   . GLU A 1 27  ? 9.657   4.928   -3.630  1.00 0.00 ? 27  GLU A HA   5  
ATOM 8829  H HB2  . GLU A 1 27  ? 11.782  3.175   -2.616  1.00 0.00 ? 27  GLU A HB2  5  
ATOM 8830  H HB3  . GLU A 1 27  ? 11.416  2.830   -4.295  1.00 0.00 ? 27  GLU A HB3  5  
ATOM 8831  H HG2  . GLU A 1 27  ? 11.417  5.611   -4.277  1.00 0.00 ? 27  GLU A HG2  5  
ATOM 8832  H HG3  . GLU A 1 27  ? 12.654  5.247   -3.090  1.00 0.00 ? 27  GLU A HG3  5  
ATOM 8833  N N    . ARG A 1 28  ? 8.536   1.912   -3.208  1.00 0.00 ? 28  ARG A N    5  
ATOM 8834  C CA   . ARG A 1 28  ? 7.662   0.882   -3.741  1.00 0.00 ? 28  ARG A CA   5  
ATOM 8835  C C    . ARG A 1 28  ? 6.260   1.447   -3.982  1.00 0.00 ? 28  ARG A C    5  
ATOM 8836  O O    . ARG A 1 28  ? 5.603   1.091   -4.958  1.00 0.00 ? 28  ARG A O    5  
ATOM 8837  C CB   . ARG A 1 28  ? 7.566   -0.309  -2.785  1.00 0.00 ? 28  ARG A CB   5  
ATOM 8838  C CG   . ARG A 1 28  ? 8.956   -0.850  -2.443  1.00 0.00 ? 28  ARG A CG   5  
ATOM 8839  C CD   . ARG A 1 28  ? 9.109   -2.300  -2.905  1.00 0.00 ? 28  ARG A CD   5  
ATOM 8840  N NE   . ARG A 1 28  ? 10.539  -2.618  -3.112  1.00 0.00 ? 28  ARG A NE   5  
ATOM 8841  C CZ   . ARG A 1 28  ? 11.258  -2.199  -4.163  1.00 0.00 ? 28  ARG A CZ   5  
ATOM 8842  N NH1  . ARG A 1 28  ? 10.683  -1.443  -5.108  1.00 0.00 ? 28  ARG A NH1  5  
ATOM 8843  N NH2  . ARG A 1 28  ? 12.551  -2.535  -4.268  1.00 0.00 ? 28  ARG A NH2  5  
ATOM 8844  H H    . ARG A 1 28  ? 8.788   1.797   -2.247  1.00 0.00 ? 28  ARG A H    5  
ATOM 8845  H HA   . ARG A 1 28  ? 8.128   0.578   -4.678  1.00 0.00 ? 28  ARG A HA   5  
ATOM 8846  H HB2  . ARG A 1 28  ? 7.055   -0.006  -1.871  1.00 0.00 ? 28  ARG A HB2  5  
ATOM 8847  H HB3  . ARG A 1 28  ? 6.967   -1.097  -3.239  1.00 0.00 ? 28  ARG A HB3  5  
ATOM 8848  H HG2  . ARG A 1 28  ? 9.718   -0.231  -2.917  1.00 0.00 ? 28  ARG A HG2  5  
ATOM 8849  H HG3  . ARG A 1 28  ? 9.119   -0.788  -1.367  1.00 0.00 ? 28  ARG A HG3  5  
ATOM 8850  H HD2  . ARG A 1 28  ? 8.682   -2.974  -2.163  1.00 0.00 ? 28  ARG A HD2  5  
ATOM 8851  H HD3  . ARG A 1 28  ? 8.556   -2.455  -3.832  1.00 0.00 ? 28  ARG A HD3  5  
ATOM 8852  H HE   . ARG A 1 28  ? 10.999  -3.180  -2.424  1.00 0.00 ? 28  ARG A HE   5  
ATOM 8853  H HH11 . ARG A 1 28  ? 9.719   -1.192  -5.030  1.00 0.00 ? 28  ARG A HH11 5  
ATOM 8854  H HH12 . ARG A 1 28  ? 11.219  -1.130  -5.893  1.00 0.00 ? 28  ARG A HH12 5  
ATOM 8855  H HH21 . ARG A 1 28  ? 12.979  -3.099  -3.562  1.00 0.00 ? 28  ARG A HH21 5  
ATOM 8856  H HH22 . ARG A 1 28  ? 13.087  -2.223  -5.052  1.00 0.00 ? 28  ARG A HH22 5  
ATOM 8857  N N    . LEU A 1 29  ? 5.845   2.319   -3.075  1.00 0.00 ? 29  LEU A N    5  
ATOM 8858  C CA   . LEU A 1 29  ? 4.534   2.937   -3.177  1.00 0.00 ? 29  LEU A CA   5  
ATOM 8859  C C    . LEU A 1 29  ? 4.229   3.237   -4.646  1.00 0.00 ? 29  LEU A C    5  
ATOM 8860  O O    . LEU A 1 29  ? 4.956   3.989   -5.293  1.00 0.00 ? 29  LEU A O    5  
ATOM 8861  C CB   . LEU A 1 29  ? 4.449   4.165   -2.268  1.00 0.00 ? 29  LEU A CB   5  
ATOM 8862  C CG   . LEU A 1 29  ? 4.716   3.919   -0.781  1.00 0.00 ? 29  LEU A CG   5  
ATOM 8863  C CD1  . LEU A 1 29  ? 5.088   5.221   -0.069  1.00 0.00 ? 29  LEU A CD1  5  
ATOM 8864  C CD2  . LEU A 1 29  ? 3.526   3.222   -0.118  1.00 0.00 ? 29  LEU A CD2  5  
ATOM 8865  H H    . LEU A 1 29  ? 6.386   2.604   -2.284  1.00 0.00 ? 29  LEU A H    5  
ATOM 8866  H HA   . LEU A 1 29  ? 3.803   2.215   -2.812  1.00 0.00 ? 29  LEU A HA   5  
ATOM 8867  H HB2  . LEU A 1 29  ? 5.160   4.909   -2.626  1.00 0.00 ? 29  LEU A HB2  5  
ATOM 8868  H HB3  . LEU A 1 29  ? 3.454   4.600   -2.371  1.00 0.00 ? 29  LEU A HB3  5  
ATOM 8869  H HG   . LEU A 1 29  ? 5.571   3.249   -0.694  1.00 0.00 ? 29  LEU A HG   5  
ATOM 8870  H HD11 . LEU A 1 29  ? 4.306   5.962   -0.234  1.00 0.00 ? 29  LEU A HD11 5  
ATOM 8871  H HD12 . LEU A 1 29  ? 5.191   5.033   1.000   1.00 0.00 ? 29  LEU A HD12 5  
ATOM 8872  H HD13 . LEU A 1 29  ? 6.032   5.595   -0.464  1.00 0.00 ? 29  LEU A HD13 5  
ATOM 8873  H HD21 . LEU A 1 29  ? 3.783   2.963   0.909   1.00 0.00 ? 29  LEU A HD21 5  
ATOM 8874  H HD22 . LEU A 1 29  ? 2.666   3.892   -0.119  1.00 0.00 ? 29  LEU A HD22 5  
ATOM 8875  H HD23 . LEU A 1 29  ? 3.282   2.316   -0.672  1.00 0.00 ? 29  LEU A HD23 5  
ATOM 8876  N N    . LYS A 1 30  ? 3.152   2.634   -5.128  1.00 0.00 ? 30  LYS A N    5  
ATOM 8877  C CA   . LYS A 1 30  ? 2.742   2.827   -6.509  1.00 0.00 ? 30  LYS A CA   5  
ATOM 8878  C C    . LYS A 1 30  ? 1.574   3.815   -6.556  1.00 0.00 ? 30  LYS A C    5  
ATOM 8879  O O    . LYS A 1 30  ? 0.809   3.924   -5.598  1.00 0.00 ? 30  LYS A O    5  
ATOM 8880  C CB   . LYS A 1 30  ? 2.436   1.482   -7.170  1.00 0.00 ? 30  LYS A CB   5  
ATOM 8881  C CG   . LYS A 1 30  ? 3.645   0.971   -7.957  1.00 0.00 ? 30  LYS A CG   5  
ATOM 8882  C CD   . LYS A 1 30  ? 3.289   0.753   -9.429  1.00 0.00 ? 30  LYS A CD   5  
ATOM 8883  C CE   . LYS A 1 30  ? 3.027   -0.726  -9.716  1.00 0.00 ? 30  LYS A CE   5  
ATOM 8884  N NZ   . LYS A 1 30  ? 2.527   -0.905  -11.098 1.00 0.00 ? 30  LYS A NZ   5  
ATOM 8885  H H    . LYS A 1 30  ? 2.566   2.025   -4.594  1.00 0.00 ? 30  LYS A H    5  
ATOM 8886  H HA   . LYS A 1 30  ? 3.586   3.265   -7.042  1.00 0.00 ? 30  LYS A HA   5  
ATOM 8887  H HB2  . LYS A 1 30  ? 2.158   0.753   -6.409  1.00 0.00 ? 30  LYS A HB2  5  
ATOM 8888  H HB3  . LYS A 1 30  ? 1.581   1.587   -7.838  1.00 0.00 ? 30  LYS A HB3  5  
ATOM 8889  H HG2  . LYS A 1 30  ? 4.463   1.687   -7.878  1.00 0.00 ? 30  LYS A HG2  5  
ATOM 8890  H HG3  . LYS A 1 30  ? 3.997   0.036   -7.522  1.00 0.00 ? 30  LYS A HG3  5  
ATOM 8891  H HD2  . LYS A 1 30  ? 2.406   1.339   -9.683  1.00 0.00 ? 30  LYS A HD2  5  
ATOM 8892  H HD3  . LYS A 1 30  ? 4.102   1.112   -10.060 1.00 0.00 ? 30  LYS A HD3  5  
ATOM 8893  H HE2  . LYS A 1 30  ? 3.945   -1.298  -9.579  1.00 0.00 ? 30  LYS A HE2  5  
ATOM 8894  H HE3  . LYS A 1 30  ? 2.298   -1.117  -9.006  1.00 0.00 ? 30  LYS A HE3  5  
ATOM 8895  H HZ1  . LYS A 1 30  ? 3.226   -0.606  -11.747 1.00 0.00 ? 30  LYS A HZ1  5  
ATOM 8896  H HZ2  . LYS A 1 30  ? 2.318   -1.870  -11.254 1.00 0.00 ? 30  LYS A HZ2  5  
ATOM 8897  H HZ3  . LYS A 1 30  ? 1.699   -0.359  -11.226 1.00 0.00 ? 30  LYS A HZ3  5  
ATOM 8898  N N    . PRO A 1 31  ? 1.470   4.528   -7.709  1.00 0.00 ? 31  PRO A N    5  
ATOM 8899  C CA   . PRO A 1 31  ? 0.409   5.503   -7.893  1.00 0.00 ? 31  PRO A CA   5  
ATOM 8900  C C    . PRO A 1 31  ? -0.930  4.812   -8.160  1.00 0.00 ? 31  PRO A C    5  
ATOM 8901  O O    . PRO A 1 31  ? -1.098  4.149   -9.182  1.00 0.00 ? 31  PRO A O    5  
ATOM 8902  C CB   . PRO A 1 31  ? 0.869   6.372   -9.052  1.00 0.00 ? 31  PRO A CB   5  
ATOM 8903  C CG   . PRO A 1 31  ? 1.943   5.572   -9.772  1.00 0.00 ? 31  PRO A CG   5  
ATOM 8904  C CD   . PRO A 1 31  ? 2.358   4.425   -8.864  1.00 0.00 ? 31  PRO A CD   5  
ATOM 8905  H HA   . PRO A 1 31  ? 0.279   6.037   -7.058  1.00 0.00 ? 31  PRO A HA   5  
ATOM 8906  H HB2  . PRO A 1 31  ? 0.040   6.602   -9.721  1.00 0.00 ? 31  PRO A HB2  5  
ATOM 8907  H HB3  . PRO A 1 31  ? 1.265   7.322   -8.695  1.00 0.00 ? 31  PRO A HB3  5  
ATOM 8908  H HG2  . PRO A 1 31  ? 1.564   5.190   -10.720 1.00 0.00 ? 31  PRO A HG2  5  
ATOM 8909  H HG3  . PRO A 1 31  ? 2.800   6.204   -10.003 1.00 0.00 ? 31  PRO A HG3  5  
ATOM 8910  H HD2  . PRO A 1 31  ? 2.247   3.463   -9.364  1.00 0.00 ? 31  PRO A HD2  5  
ATOM 8911  H HD3  . PRO A 1 31  ? 3.403   4.512   -8.569  1.00 0.00 ? 31  PRO A HD3  5  
ATOM 8912  N N    . CYS A 1 32  ? -1.849  4.990   -7.222  1.00 0.00 ? 32  CYS A N    5  
ATOM 8913  C CA   . CYS A 1 32  ? -3.167  4.392   -7.342  1.00 0.00 ? 32  CYS A CA   5  
ATOM 8914  C C    . CYS A 1 32  ? -4.177  5.312   -6.652  1.00 0.00 ? 32  CYS A C    5  
ATOM 8915  O O    . CYS A 1 32  ? -3.801  6.147   -5.832  1.00 0.00 ? 32  CYS A O    5  
ATOM 8916  C CB   . CYS A 1 32  ? -3.200  2.975   -6.766  1.00 0.00 ? 32  CYS A CB   5  
ATOM 8917  S SG   . CYS A 1 32  ? -2.028  1.902   -7.675  1.00 0.00 ? 32  CYS A SG   5  
ATOM 8918  H H    . CYS A 1 32  ? -1.704  5.530   -6.393  1.00 0.00 ? 32  CYS A H    5  
ATOM 8919  H HA   . CYS A 1 32  ? -3.380  4.314   -8.408  1.00 0.00 ? 32  CYS A HA   5  
ATOM 8920  H HB2  . CYS A 1 32  ? -2.940  2.997   -5.708  1.00 0.00 ? 32  CYS A HB2  5  
ATOM 8921  H HB3  . CYS A 1 32  ? -4.209  2.567   -6.838  1.00 0.00 ? 32  CYS A HB3  5  
ATOM 8922  H HG   . CYS A 1 32  ? -0.923  2.457   -7.184  1.00 0.00 ? 32  CYS A HG   5  
ATOM 8923  N N    . LEU A 1 33  ? -5.439  5.126   -7.010  1.00 0.00 ? 33  LEU A N    5  
ATOM 8924  C CA   . LEU A 1 33  ? -6.505  5.929   -6.436  1.00 0.00 ? 33  LEU A CA   5  
ATOM 8925  C C    . LEU A 1 33  ? -7.740  5.051   -6.222  1.00 0.00 ? 33  LEU A C    5  
ATOM 8926  O O    . LEU A 1 33  ? -7.927  4.056   -6.920  1.00 0.00 ? 33  LEU A O    5  
ATOM 8927  C CB   . LEU A 1 33  ? -6.771  7.163   -7.300  1.00 0.00 ? 33  LEU A CB   5  
ATOM 8928  C CG   . LEU A 1 33  ? -7.671  8.235   -6.681  1.00 0.00 ? 33  LEU A CG   5  
ATOM 8929  C CD1  . LEU A 1 33  ? -6.886  9.519   -6.409  1.00 0.00 ? 33  LEU A CD1  5  
ATOM 8930  C CD2  . LEU A 1 33  ? -8.902  8.488   -7.553  1.00 0.00 ? 33  LEU A CD2  5  
ATOM 8931  H H    . LEU A 1 33  ? -5.736  4.444   -7.678  1.00 0.00 ? 33  LEU A H    5  
ATOM 8932  H HA   . LEU A 1 33  ? -6.160  6.284   -5.465  1.00 0.00 ? 33  LEU A HA   5  
ATOM 8933  H HB2  . LEU A 1 33  ? -5.814  7.621   -7.550  1.00 0.00 ? 33  LEU A HB2  5  
ATOM 8934  H HB3  . LEU A 1 33  ? -7.222  6.836   -8.237  1.00 0.00 ? 33  LEU A HB3  5  
ATOM 8935  H HG   . LEU A 1 33  ? -8.029  7.866   -5.719  1.00 0.00 ? 33  LEU A HG   5  
ATOM 8936  H HD11 . LEU A 1 33  ? -6.258  9.382   -5.529  1.00 0.00 ? 33  LEU A HD11 5  
ATOM 8937  H HD12 . LEU A 1 33  ? -6.260  9.752   -7.270  1.00 0.00 ? 33  LEU A HD12 5  
ATOM 8938  H HD13 . LEU A 1 33  ? -7.582  10.340  -6.234  1.00 0.00 ? 33  LEU A HD13 5  
ATOM 8939  H HD21 . LEU A 1 33  ? -9.142  7.585   -8.114  1.00 0.00 ? 33  LEU A HD21 5  
ATOM 8940  H HD22 . LEU A 1 33  ? -9.747  8.758   -6.920  1.00 0.00 ? 33  LEU A HD22 5  
ATOM 8941  H HD23 . LEU A 1 33  ? -8.694  9.302   -8.247  1.00 0.00 ? 33  LEU A HD23 5  
ATOM 8942  N N    . PHE A 1 34  ? -8.550  5.451   -5.253  1.00 0.00 ? 34  PHE A N    5  
ATOM 8943  C CA   . PHE A 1 34  ? -9.761  4.713   -4.937  1.00 0.00 ? 34  PHE A CA   5  
ATOM 8944  C C    . PHE A 1 34  ? -11.007 5.535   -5.273  1.00 0.00 ? 34  PHE A C    5  
ATOM 8945  O O    . PHE A 1 34  ? -11.295 6.531   -4.612  1.00 0.00 ? 34  PHE A O    5  
ATOM 8946  C CB   . PHE A 1 34  ? -9.738  4.437   -3.433  1.00 0.00 ? 34  PHE A CB   5  
ATOM 8947  C CG   . PHE A 1 34  ? -8.420  3.844   -2.929  1.00 0.00 ? 34  PHE A CG   5  
ATOM 8948  C CD1  . PHE A 1 34  ? -7.988  2.645   -3.404  1.00 0.00 ? 34  PHE A CD1  5  
ATOM 8949  C CD2  . PHE A 1 34  ? -7.680  4.517   -2.007  1.00 0.00 ? 34  PHE A CD2  5  
ATOM 8950  C CE1  . PHE A 1 34  ? -6.765  2.095   -2.937  1.00 0.00 ? 34  PHE A CE1  5  
ATOM 8951  C CE2  . PHE A 1 34  ? -6.457  3.967   -1.540  1.00 0.00 ? 34  PHE A CE2  5  
ATOM 8952  C CZ   . PHE A 1 34  ? -6.025  2.768   -2.014  1.00 0.00 ? 34  PHE A CZ   5  
ATOM 8953  H H    . PHE A 1 34  ? -8.390  6.262   -4.689  1.00 0.00 ? 34  PHE A H    5  
ATOM 8954  H HA   . PHE A 1 34  ? -9.753  3.805   -5.541  1.00 0.00 ? 34  PHE A HA   5  
ATOM 8955  H HB2  . PHE A 1 34  ? -9.933  5.367   -2.899  1.00 0.00 ? 34  PHE A HB2  5  
ATOM 8956  H HB3  . PHE A 1 34  ? -10.549 3.752   -3.187  1.00 0.00 ? 34  PHE A HB3  5  
ATOM 8957  H HD1  . PHE A 1 34  ? -8.581  2.106   -4.143  1.00 0.00 ? 34  PHE A HD1  5  
ATOM 8958  H HD2  . PHE A 1 34  ? -8.026  5.478   -1.627  1.00 0.00 ? 34  PHE A HD2  5  
ATOM 8959  H HE1  . PHE A 1 34  ? -6.419  1.134   -3.317  1.00 0.00 ? 34  PHE A HE1  5  
ATOM 8960  H HE2  . PHE A 1 34  ? -5.864  4.506   -0.801  1.00 0.00 ? 34  PHE A HE2  5  
ATOM 8961  H HZ   . PHE A 1 34  ? -5.087  2.346   -1.656  1.00 0.00 ? 34  PHE A HZ   5  
ATOM 8962  N N    . THR A 1 35  ? -11.713 5.087   -6.301  1.00 0.00 ? 35  THR A N    5  
ATOM 8963  C CA   . THR A 1 35  ? -12.921 5.768   -6.733  1.00 0.00 ? 35  THR A CA   5  
ATOM 8964  C C    . THR A 1 35  ? -14.101 5.379   -5.841  1.00 0.00 ? 35  THR A C    5  
ATOM 8965  O O    . THR A 1 35  ? -13.914 4.767   -4.790  1.00 0.00 ? 35  THR A O    5  
ATOM 8966  C CB   . THR A 1 35  ? -13.145 5.443   -8.212  1.00 0.00 ? 35  THR A CB   5  
ATOM 8967  O OG1  . THR A 1 35  ? -12.692 4.098   -8.344  1.00 0.00 ? 35  THR A OG1  5  
ATOM 8968  C CG2  . THR A 1 35  ? -12.218 6.240   -9.133  1.00 0.00 ? 35  THR A CG2  5  
ATOM 8969  H H    . THR A 1 35  ? -11.472 4.275   -6.834  1.00 0.00 ? 35  THR A H    5  
ATOM 8970  H HA   . THR A 1 35  ? -12.772 6.841   -6.615  1.00 0.00 ? 35  THR A HA   5  
ATOM 8971  H HB   . THR A 1 35  ? -14.188 5.589   -8.489  1.00 0.00 ? 35  THR A HB   5  
ATOM 8972  H HG1  . THR A 1 35  ? -12.804 3.791   -9.289  1.00 0.00 ? 35  THR A HG1  5  
ATOM 8973  H HG21 . THR A 1 35  ? -12.546 7.278   -9.168  1.00 0.00 ? 35  THR A HG21 5  
ATOM 8974  H HG22 . THR A 1 35  ? -11.198 6.193   -8.750  1.00 0.00 ? 35  THR A HG22 5  
ATOM 8975  H HG23 . THR A 1 35  ? -12.250 5.814   -10.136 1.00 0.00 ? 35  THR A HG23 5  
ATOM 8976  N N    . GLU A 1 36  ? -15.291 5.749   -6.292  1.00 0.00 ? 36  GLU A N    5  
ATOM 8977  C CA   . GLU A 1 36  ? -16.501 5.446   -5.547  1.00 0.00 ? 36  GLU A CA   5  
ATOM 8978  C C    . GLU A 1 36  ? -16.786 3.943   -5.586  1.00 0.00 ? 36  GLU A C    5  
ATOM 8979  O O    . GLU A 1 36  ? -16.591 3.297   -6.615  1.00 0.00 ? 36  GLU A O    5  
ATOM 8980  C CB   . GLU A 1 36  ? -17.690 6.243   -6.086  1.00 0.00 ? 36  GLU A CB   5  
ATOM 8981  C CG   . GLU A 1 36  ? -18.259 5.594   -7.349  1.00 0.00 ? 36  GLU A CG   5  
ATOM 8982  C CD   . GLU A 1 36  ? -19.343 6.472   -7.977  1.00 0.00 ? 36  GLU A CD   5  
ATOM 8983  O OE1  . GLU A 1 36  ? -18.960 7.433   -8.678  1.00 0.00 ? 36  GLU A OE1  5  
ATOM 8984  O OE2  . GLU A 1 36  ? -20.531 6.163   -7.741  1.00 0.00 ? 36  GLU A OE2  5  
ATOM 8985  H H    . GLU A 1 36  ? -15.434 6.246   -7.148  1.00 0.00 ? 36  GLU A H    5  
ATOM 8986  H HA   . GLU A 1 36  ? -16.297 5.757   -4.523  1.00 0.00 ? 36  GLU A HA   5  
ATOM 8987  H HB2  . GLU A 1 36  ? -18.467 6.305   -5.323  1.00 0.00 ? 36  GLU A HB2  5  
ATOM 8988  H HB3  . GLU A 1 36  ? -17.378 7.264   -6.307  1.00 0.00 ? 36  GLU A HB3  5  
ATOM 8989  H HG2  . GLU A 1 36  ? -17.458 5.428   -8.069  1.00 0.00 ? 36  GLU A HG2  5  
ATOM 8990  H HG3  . GLU A 1 36  ? -18.675 4.616   -7.104  1.00 0.00 ? 36  GLU A HG3  5  
ATOM 8991  N N    . LYS A 1 37  ? -17.242 3.430   -4.453  1.00 0.00 ? 37  LYS A N    5  
ATOM 8992  C CA   . LYS A 1 37  ? -17.556 2.015   -4.344  1.00 0.00 ? 37  LYS A CA   5  
ATOM 8993  C C    . LYS A 1 37  ? -16.257 1.207   -4.359  1.00 0.00 ? 37  LYS A C    5  
ATOM 8994  O O    . LYS A 1 37  ? -16.237 0.066   -4.818  1.00 0.00 ? 37  LYS A O    5  
ATOM 8995  C CB   . LYS A 1 37  ? -18.550 1.602   -5.432  1.00 0.00 ? 37  LYS A CB   5  
ATOM 8996  C CG   . LYS A 1 37  ? -19.818 2.455   -5.368  1.00 0.00 ? 37  LYS A CG   5  
ATOM 8997  C CD   . LYS A 1 37  ? -21.054 1.626   -5.724  1.00 0.00 ? 37  LYS A CD   5  
ATOM 8998  C CE   . LYS A 1 37  ? -21.166 1.431   -7.238  1.00 0.00 ? 37  LYS A CE   5  
ATOM 8999  N NZ   . LYS A 1 37  ? -20.300 0.316   -7.682  1.00 0.00 ? 37  LYS A NZ   5  
ATOM 9000  H H    . LYS A 1 37  ? -17.398 3.962   -3.621  1.00 0.00 ? 37  LYS A H    5  
ATOM 9001  H HA   . LYS A 1 37  ? -18.047 1.863   -3.384  1.00 0.00 ? 37  LYS A HA   5  
ATOM 9002  H HB2  . LYS A 1 37  ? -18.086 1.707   -6.413  1.00 0.00 ? 37  LYS A HB2  5  
ATOM 9003  H HB3  . LYS A 1 37  ? -18.808 0.550   -5.313  1.00 0.00 ? 37  LYS A HB3  5  
ATOM 9004  H HG2  . LYS A 1 37  ? -19.931 2.871   -4.367  1.00 0.00 ? 37  LYS A HG2  5  
ATOM 9005  H HG3  . LYS A 1 37  ? -19.730 3.296   -6.055  1.00 0.00 ? 37  LYS A HG3  5  
ATOM 9006  H HD2  . LYS A 1 37  ? -21.000 0.655   -5.232  1.00 0.00 ? 37  LYS A HD2  5  
ATOM 9007  H HD3  . LYS A 1 37  ? -21.950 2.123   -5.351  1.00 0.00 ? 37  LYS A HD3  5  
ATOM 9008  H HE2  . LYS A 1 37  ? -22.202 1.225   -7.508  1.00 0.00 ? 37  LYS A HE2  5  
ATOM 9009  H HE3  . LYS A 1 37  ? -20.879 2.349   -7.751  1.00 0.00 ? 37  LYS A HE3  5  
ATOM 9010  H HZ1  . LYS A 1 37  ? -20.115 -0.291  -6.909  1.00 0.00 ? 37  LYS A HZ1  5  
ATOM 9011  H HZ2  . LYS A 1 37  ? -20.761 -0.196  -8.406  1.00 0.00 ? 37  LYS A HZ2  5  
ATOM 9012  H HZ3  . LYS A 1 37  ? -19.437 0.683   -8.030  1.00 0.00 ? 37  LYS A HZ3  5  
ATOM 9013  N N    . SER A 1 38  ? -15.204 1.830   -3.851  1.00 0.00 ? 38  SER A N    5  
ATOM 9014  C CA   . SER A 1 38  ? -13.904 1.183   -3.799  1.00 0.00 ? 38  SER A CA   5  
ATOM 9015  C C    . SER A 1 38  ? -13.679 0.569   -2.416  1.00 0.00 ? 38  SER A C    5  
ATOM 9016  O O    . SER A 1 38  ? -13.701 1.275   -1.409  1.00 0.00 ? 38  SER A O    5  
ATOM 9017  C CB   . SER A 1 38  ? -12.783 2.170   -4.130  1.00 0.00 ? 38  SER A CB   5  
ATOM 9018  O OG   . SER A 1 38  ? -12.646 2.371   -5.534  1.00 0.00 ? 38  SER A OG   5  
ATOM 9019  H H    . SER A 1 38  ? -15.229 2.758   -3.479  1.00 0.00 ? 38  SER A H    5  
ATOM 9020  H HA   . SER A 1 38  ? -13.939 0.405   -4.562  1.00 0.00 ? 38  SER A HA   5  
ATOM 9021  H HB2  . SER A 1 38  ? -12.987 3.125   -3.646  1.00 0.00 ? 38  SER A HB2  5  
ATOM 9022  H HB3  . SER A 1 38  ? -11.842 1.801   -3.723  1.00 0.00 ? 38  SER A HB3  5  
ATOM 9023  H HG   . SER A 1 38  ? -11.699 2.601   -5.756  1.00 0.00 ? 38  SER A HG   5  
ATOM 9024  N N    . TYR A 1 39  ? -13.469 -0.739  -2.411  1.00 0.00 ? 39  TYR A N    5  
ATOM 9025  C CA   . TYR A 1 39  ? -13.240 -1.456  -1.168  1.00 0.00 ? 39  TYR A CA   5  
ATOM 9026  C C    . TYR A 1 39  ? -11.754 -1.771  -0.982  1.00 0.00 ? 39  TYR A C    5  
ATOM 9027  O O    . TYR A 1 39  ? -11.218 -2.662  -1.638  1.00 0.00 ? 39  TYR A O    5  
ATOM 9028  C CB   . TYR A 1 39  ? -14.016 -2.768  -1.289  1.00 0.00 ? 39  TYR A CB   5  
ATOM 9029  C CG   . TYR A 1 39  ? -15.360 -2.767  -0.556  1.00 0.00 ? 39  TYR A CG   5  
ATOM 9030  C CD1  . TYR A 1 39  ? -16.314 -1.820  -0.868  1.00 0.00 ? 39  TYR A CD1  5  
ATOM 9031  C CD2  . TYR A 1 39  ? -15.617 -3.712  0.415   1.00 0.00 ? 39  TYR A CD2  5  
ATOM 9032  C CE1  . TYR A 1 39  ? -17.579 -1.818  -0.178  1.00 0.00 ? 39  TYR A CE1  5  
ATOM 9033  C CE2  . TYR A 1 39  ? -16.881 -3.711  1.105   1.00 0.00 ? 39  TYR A CE2  5  
ATOM 9034  C CZ   . TYR A 1 39  ? -17.800 -2.764  0.774   1.00 0.00 ? 39  TYR A CZ   5  
ATOM 9035  O OH   . TYR A 1 39  ? -18.994 -2.762  1.425   1.00 0.00 ? 39  TYR A OH   5  
ATOM 9036  H H    . TYR A 1 39  ? -13.453 -1.306  -3.235  1.00 0.00 ? 39  TYR A H    5  
ATOM 9037  H HA   . TYR A 1 39  ? -13.575 -0.821  -0.347  1.00 0.00 ? 39  TYR A HA   5  
ATOM 9038  H HB2  . TYR A 1 39  ? -14.190 -2.980  -2.344  1.00 0.00 ? 39  TYR A HB2  5  
ATOM 9039  H HB3  . TYR A 1 39  ? -13.402 -3.579  -0.898  1.00 0.00 ? 39  TYR A HB3  5  
ATOM 9040  H HD1  . TYR A 1 39  ? -16.111 -1.073  -1.635  1.00 0.00 ? 39  TYR A HD1  5  
ATOM 9041  H HD2  . TYR A 1 39  ? -14.863 -4.460  0.661   1.00 0.00 ? 39  TYR A HD2  5  
ATOM 9042  H HE1  . TYR A 1 39  ? -18.341 -1.076  -0.414  1.00 0.00 ? 39  TYR A HE1  5  
ATOM 9043  H HE2  . TYR A 1 39  ? -17.097 -4.452  1.874   1.00 0.00 ? 39  TYR A HE2  5  
ATOM 9044  H HH   . TYR A 1 39  ? -18.844 -2.786  2.414   1.00 0.00 ? 39  TYR A HH   5  
ATOM 9045  N N    . LEU A 1 40  ? -11.131 -1.022  -0.084  1.00 0.00 ? 40  LEU A N    5  
ATOM 9046  C CA   . LEU A 1 40  ? -9.718  -1.210  0.197   1.00 0.00 ? 40  LEU A CA   5  
ATOM 9047  C C    . LEU A 1 40  ? -9.507  -2.589  0.826   1.00 0.00 ? 40  LEU A C    5  
ATOM 9048  O O    . LEU A 1 40  ? -8.765  -3.412  0.292   1.00 0.00 ? 40  LEU A O    5  
ATOM 9049  C CB   . LEU A 1 40  ? -9.183  -0.057  1.048   1.00 0.00 ? 40  LEU A CB   5  
ATOM 9050  C CG   . LEU A 1 40  ? -9.011  1.283   0.330   1.00 0.00 ? 40  LEU A CG   5  
ATOM 9051  C CD1  . LEU A 1 40  ? -10.332 1.750   -0.283  1.00 0.00 ? 40  LEU A CD1  5  
ATOM 9052  C CD2  . LEU A 1 40  ? -8.411  2.333   1.267   1.00 0.00 ? 40  LEU A CD2  5  
ATOM 9053  H H    . LEU A 1 40  ? -11.575 -0.299  0.446   1.00 0.00 ? 40  LEU A H    5  
ATOM 9054  H HA   . LEU A 1 40  ? -9.189  -1.180  -0.756  1.00 0.00 ? 40  LEU A HA   5  
ATOM 9055  H HB2  . LEU A 1 40  ? -9.857  0.089   1.892   1.00 0.00 ? 40  LEU A HB2  5  
ATOM 9056  H HB3  . LEU A 1 40  ? -8.217  -0.353  1.459   1.00 0.00 ? 40  LEU A HB3  5  
ATOM 9057  H HG   . LEU A 1 40  ? -8.307  1.143   -0.490  1.00 0.00 ? 40  LEU A HG   5  
ATOM 9058  H HD11 . LEU A 1 40  ? -10.539 1.171   -1.184  1.00 0.00 ? 40  LEU A HD11 5  
ATOM 9059  H HD12 . LEU A 1 40  ? -11.138 1.603   0.436   1.00 0.00 ? 40  LEU A HD12 5  
ATOM 9060  H HD13 . LEU A 1 40  ? -10.261 2.807   -0.539  1.00 0.00 ? 40  LEU A HD13 5  
ATOM 9061  H HD21 . LEU A 1 40  ? -8.089  3.197   0.685   1.00 0.00 ? 40  LEU A HD21 5  
ATOM 9062  H HD22 . LEU A 1 40  ? -9.163  2.644   1.993   1.00 0.00 ? 40  LEU A HD22 5  
ATOM 9063  H HD23 . LEU A 1 40  ? -7.555  1.907   1.790   1.00 0.00 ? 40  LEU A HD23 5  
ATOM 9064  N N    . VAL A 1 41  ? -10.173 -2.799  1.952   1.00 0.00 ? 41  VAL A N    5  
ATOM 9065  C CA   . VAL A 1 41  ? -10.068 -4.064  2.659   1.00 0.00 ? 41  VAL A CA   5  
ATOM 9066  C C    . VAL A 1 41  ? -11.464 -4.524  3.084   1.00 0.00 ? 41  VAL A C    5  
ATOM 9067  O O    . VAL A 1 41  ? -12.365 -3.704  3.257   1.00 0.00 ? 41  VAL A O    5  
ATOM 9068  C CB   . VAL A 1 41  ? -9.100  -3.926  3.836   1.00 0.00 ? 41  VAL A CB   5  
ATOM 9069  C CG1  . VAL A 1 41  ? -7.718  -3.474  3.360   1.00 0.00 ? 41  VAL A CG1  5  
ATOM 9070  C CG2  . VAL A 1 41  ? -9.655  -2.970  4.894   1.00 0.00 ? 41  VAL A CG2  5  
ATOM 9071  H H    . VAL A 1 41  ? -10.775 -2.124  2.379   1.00 0.00 ? 41  VAL A H    5  
ATOM 9072  H HA   . VAL A 1 41  ? -9.653  -4.795  1.965   1.00 0.00 ? 41  VAL A HA   5  
ATOM 9073  H HB   . VAL A 1 41  ? -8.991  -4.908  4.297   1.00 0.00 ? 41  VAL A HB   5  
ATOM 9074  H HG11 . VAL A 1 41  ? -7.472  -3.980  2.426   1.00 0.00 ? 41  VAL A HG11 5  
ATOM 9075  H HG12 . VAL A 1 41  ? -7.724  -2.396  3.197   1.00 0.00 ? 41  VAL A HG12 5  
ATOM 9076  H HG13 . VAL A 1 41  ? -6.973  -3.723  4.116   1.00 0.00 ? 41  VAL A HG13 5  
ATOM 9077  H HG21 . VAL A 1 41  ? -10.623 -3.334  5.240   1.00 0.00 ? 41  VAL A HG21 5  
ATOM 9078  H HG22 . VAL A 1 41  ? -8.964  -2.917  5.735   1.00 0.00 ? 41  VAL A HG22 5  
ATOM 9079  H HG23 . VAL A 1 41  ? -9.775  -1.977  4.459   1.00 0.00 ? 41  VAL A HG23 5  
ATOM 9080  N N    . ARG A 1 42  ? -11.599 -5.832  3.238   1.00 0.00 ? 42  ARG A N    5  
ATOM 9081  C CA   . ARG A 1 42  ? -12.870 -6.411  3.639   1.00 0.00 ? 42  ARG A CA   5  
ATOM 9082  C C    . ARG A 1 42  ? -12.662 -7.412  4.778   1.00 0.00 ? 42  ARG A C    5  
ATOM 9083  O O    . ARG A 1 42  ? -11.532 -7.802  5.067   1.00 0.00 ? 42  ARG A O    5  
ATOM 9084  C CB   . ARG A 1 42  ? -13.548 -7.119  2.465   1.00 0.00 ? 42  ARG A CB   5  
ATOM 9085  C CG   . ARG A 1 42  ? -15.052 -6.839  2.450   1.00 0.00 ? 42  ARG A CG   5  
ATOM 9086  C CD   . ARG A 1 42  ? -15.623 -6.987  1.038   1.00 0.00 ? 42  ARG A CD   5  
ATOM 9087  N NE   . ARG A 1 42  ? -16.333 -8.280  0.912   1.00 0.00 ? 42  ARG A NE   5  
ATOM 9088  C CZ   . ARG A 1 42  ? -16.552 -8.906  -0.252  1.00 0.00 ? 42  ARG A CZ   5  
ATOM 9089  N NH1  . ARG A 1 42  ? -16.118 -8.363  -1.397  1.00 0.00 ? 42  ARG A NH1  5  
ATOM 9090  N NH2  . ARG A 1 42  ? -17.205 -10.076 -0.271  1.00 0.00 ? 42  ARG A NH2  5  
ATOM 9091  H H    . ARG A 1 42  ? -10.861 -6.492  3.095   1.00 0.00 ? 42  ARG A H    5  
ATOM 9092  H HA   . ARG A 1 42  ? -13.471 -5.563  3.967   1.00 0.00 ? 42  ARG A HA   5  
ATOM 9093  H HB2  . ARG A 1 42  ? -13.103 -6.784  1.528   1.00 0.00 ? 42  ARG A HB2  5  
ATOM 9094  H HB3  . ARG A 1 42  ? -13.375 -8.193  2.534   1.00 0.00 ? 42  ARG A HB3  5  
ATOM 9095  H HG2  . ARG A 1 42  ? -15.560 -7.527  3.125   1.00 0.00 ? 42  ARG A HG2  5  
ATOM 9096  H HG3  . ARG A 1 42  ? -15.242 -5.831  2.818   1.00 0.00 ? 42  ARG A HG3  5  
ATOM 9097  H HD2  . ARG A 1 42  ? -16.307 -6.165  0.825   1.00 0.00 ? 42  ARG A HD2  5  
ATOM 9098  H HD3  . ARG A 1 42  ? -14.819 -6.931  0.304   1.00 0.00 ? 42  ARG A HD3  5  
ATOM 9099  H HE   . ARG A 1 42  ? -16.670 -8.713  1.748   1.00 0.00 ? 42  ARG A HE   5  
ATOM 9100  H HH11 . ARG A 1 42  ? -15.630 -7.490  -1.383  1.00 0.00 ? 42  ARG A HH11 5  
ATOM 9101  H HH12 . ARG A 1 42  ? -16.281 -8.831  -2.266  1.00 0.00 ? 42  ARG A HH12 5  
ATOM 9102  H HH21 . ARG A 1 42  ? -17.529 -10.482 0.584   1.00 0.00 ? 42  ARG A HH21 5  
ATOM 9103  H HH22 . ARG A 1 42  ? -17.368 -10.544 -1.140  1.00 0.00 ? 42  ARG A HH22 5  
ATOM 9104  N N    . GLU A 1 43  ? -13.770 -7.798  5.393   1.00 0.00 ? 43  GLU A N    5  
ATOM 9105  C CA   . GLU A 1 43  ? -13.724 -8.746  6.493   1.00 0.00 ? 43  GLU A CA   5  
ATOM 9106  C C    . GLU A 1 43  ? -13.960 -10.168 5.980   1.00 0.00 ? 43  GLU A C    5  
ATOM 9107  O O    . GLU A 1 43  ? -15.093 -10.544 5.683   1.00 0.00 ? 43  GLU A O    5  
ATOM 9108  C CB   . GLU A 1 43  ? -14.739 -8.379  7.577   1.00 0.00 ? 43  GLU A CB   5  
ATOM 9109  C CG   . GLU A 1 43  ? -14.055 -8.205  8.934   1.00 0.00 ? 43  GLU A CG   5  
ATOM 9110  C CD   . GLU A 1 43  ? -14.282 -9.430  9.823   1.00 0.00 ? 43  GLU A CD   5  
ATOM 9111  O OE1  . GLU A 1 43  ? -14.016 -10.547 9.329   1.00 0.00 ? 43  GLU A OE1  5  
ATOM 9112  O OE2  . GLU A 1 43  ? -14.715 -9.221  10.977  1.00 0.00 ? 43  GLU A OE2  5  
ATOM 9113  H H    . GLU A 1 43  ? -14.685 -7.476  5.151   1.00 0.00 ? 43  GLU A H    5  
ATOM 9114  H HA   . GLU A 1 43  ? -12.717 -8.664  6.904   1.00 0.00 ? 43  GLU A HA   5  
ATOM 9115  H HB2  . GLU A 1 43  ? -15.251 -7.456  7.303   1.00 0.00 ? 43  GLU A HB2  5  
ATOM 9116  H HB3  . GLU A 1 43  ? -15.500 -9.156  7.646   1.00 0.00 ? 43  GLU A HB3  5  
ATOM 9117  H HG2  . GLU A 1 43  ? -12.986 -8.050  8.789   1.00 0.00 ? 43  GLU A HG2  5  
ATOM 9118  H HG3  . GLU A 1 43  ? -14.442 -7.315  9.430   1.00 0.00 ? 43  GLU A HG3  5  
ATOM 9119  N N    . GLY A 1 44  ? -12.872 -10.919 5.890   1.00 0.00 ? 44  GLY A N    5  
ATOM 9120  C CA   . GLY A 1 44  ? -12.946 -12.291 5.418   1.00 0.00 ? 44  GLY A CA   5  
ATOM 9121  C C    . GLY A 1 44  ? -12.058 -12.497 4.190   1.00 0.00 ? 44  GLY A C    5  
ATOM 9122  O O    . GLY A 1 44  ? -11.484 -13.569 4.007   1.00 0.00 ? 44  GLY A O    5  
ATOM 9123  H H    . GLY A 1 44  ? -11.954 -10.605 6.134   1.00 0.00 ? 44  GLY A H    5  
ATOM 9124  H HA2  . GLY A 1 44  ? -12.638 -12.970 6.212   1.00 0.00 ? 44  GLY A HA2  5  
ATOM 9125  H HA3  . GLY A 1 44  ? -13.979 -12.538 5.170   1.00 0.00 ? 44  GLY A HA3  5  
ATOM 9126  N N    . ASP A 1 45  ? -11.971 -11.452 3.379   1.00 0.00 ? 45  ASP A N    5  
ATOM 9127  C CA   . ASP A 1 45  ? -11.162 -11.505 2.174   1.00 0.00 ? 45  ASP A CA   5  
ATOM 9128  C C    . ASP A 1 45  ? -9.689  -11.320 2.545   1.00 0.00 ? 45  ASP A C    5  
ATOM 9129  O O    . ASP A 1 45  ? -9.374  -10.695 3.556   1.00 0.00 ? 45  ASP A O    5  
ATOM 9130  C CB   . ASP A 1 45  ? -11.548 -10.388 1.202   1.00 0.00 ? 45  ASP A CB   5  
ATOM 9131  C CG   . ASP A 1 45  ? -11.270 -8.970  1.703   1.00 0.00 ? 45  ASP A CG   5  
ATOM 9132  O OD1  . ASP A 1 45  ? -10.959 -8.844  2.907   1.00 0.00 ? 45  ASP A OD1  5  
ATOM 9133  O OD2  . ASP A 1 45  ? -11.374 -8.043  0.870   1.00 0.00 ? 45  ASP A OD2  5  
ATOM 9134  H H    . ASP A 1 45  ? -12.441 -10.583 3.535   1.00 0.00 ? 45  ASP A H    5  
ATOM 9135  H HA   . ASP A 1 45  ? -11.362 -12.483 1.737   1.00 0.00 ? 45  ASP A HA   5  
ATOM 9136  H HB2  . ASP A 1 45  ? -11.010 -10.539 0.266   1.00 0.00 ? 45  ASP A HB2  5  
ATOM 9137  H HB3  . ASP A 1 45  ? -12.611 -10.476 0.976   1.00 0.00 ? 45  ASP A HB3  5  
ATOM 9138  N N    . PRO A 1 46  ? -8.804  -11.891 1.685   1.00 0.00 ? 46  PRO A N    5  
ATOM 9139  C CA   . PRO A 1 46  ? -7.372  -11.795 1.912   1.00 0.00 ? 46  PRO A CA   5  
ATOM 9140  C C    . PRO A 1 46  ? -6.855  -10.396 1.571   1.00 0.00 ? 46  PRO A C    5  
ATOM 9141  O O    . PRO A 1 46  ? -7.579  -9.586  0.995   1.00 0.00 ? 46  PRO A O    5  
ATOM 9142  C CB   . PRO A 1 46  ? -6.762  -12.882 1.042   1.00 0.00 ? 46  PRO A CB   5  
ATOM 9143  C CG   . PRO A 1 46  ? -7.823  -13.236 0.012   1.00 0.00 ? 46  PRO A CG   5  
ATOM 9144  C CD   . PRO A 1 46  ? -9.141  -12.639 0.477   1.00 0.00 ? 46  PRO A CD   5  
ATOM 9145  H HA   . PRO A 1 46  ? -7.164  -11.935 2.880   1.00 0.00 ? 46  PRO A HA   5  
ATOM 9146  H HB2  . PRO A 1 46  ? -5.851  -12.530 0.558   1.00 0.00 ? 46  PRO A HB2  5  
ATOM 9147  H HB3  . PRO A 1 46  ? -6.490  -13.753 1.638   1.00 0.00 ? 46  PRO A HB3  5  
ATOM 9148  H HG2  . PRO A 1 46  ? -7.550  -12.843 -0.967  1.00 0.00 ? 46  PRO A HG2  5  
ATOM 9149  H HG3  . PRO A 1 46  ? -7.909  -14.318 -0.090  1.00 0.00 ? 46  PRO A HG3  5  
ATOM 9150  H HD2  . PRO A 1 46  ? -9.571  -11.988 -0.284  1.00 0.00 ? 46  PRO A HD2  5  
ATOM 9151  H HD3  . PRO A 1 46  ? -9.876  -13.416 0.685   1.00 0.00 ? 46  PRO A HD3  5  
ATOM 9152  N N    . VAL A 1 47  ? -5.606  -10.155 1.942   1.00 0.00 ? 47  VAL A N    5  
ATOM 9153  C CA   . VAL A 1 47  ? -4.983  -8.867  1.682   1.00 0.00 ? 47  VAL A CA   5  
ATOM 9154  C C    . VAL A 1 47  ? -3.789  -9.063  0.747   1.00 0.00 ? 47  VAL A C    5  
ATOM 9155  O O    . VAL A 1 47  ? -2.731  -9.523  1.174   1.00 0.00 ? 47  VAL A O    5  
ATOM 9156  C CB   . VAL A 1 47  ? -4.605  -8.194  3.003   1.00 0.00 ? 47  VAL A CB   5  
ATOM 9157  C CG1  . VAL A 1 47  ? -4.036  -6.794  2.761   1.00 0.00 ? 47  VAL A CG1  5  
ATOM 9158  C CG2  . VAL A 1 47  ? -5.802  -8.142  3.955   1.00 0.00 ? 47  VAL A CG2  5  
ATOM 9159  H H    . VAL A 1 47  ? -5.023  -10.819 2.410   1.00 0.00 ? 47  VAL A H    5  
ATOM 9160  H HA   . VAL A 1 47  ? -5.721  -8.240  1.183   1.00 0.00 ? 47  VAL A HA   5  
ATOM 9161  H HB   . VAL A 1 47  ? -3.828  -8.794  3.475   1.00 0.00 ? 47  VAL A HB   5  
ATOM 9162  H HG11 . VAL A 1 47  ? -4.596  -6.068  3.349   1.00 0.00 ? 47  VAL A HG11 5  
ATOM 9163  H HG12 . VAL A 1 47  ? -2.988  -6.772  3.059   1.00 0.00 ? 47  VAL A HG12 5  
ATOM 9164  H HG13 . VAL A 1 47  ? -4.119  -6.546  1.703   1.00 0.00 ? 47  VAL A HG13 5  
ATOM 9165  H HG21 . VAL A 1 47  ? -6.286  -9.118  3.983   1.00 0.00 ? 47  VAL A HG21 5  
ATOM 9166  H HG22 . VAL A 1 47  ? -5.459  -7.878  4.955   1.00 0.00 ? 47  VAL A HG22 5  
ATOM 9167  H HG23 . VAL A 1 47  ? -6.513  -7.394  3.605   1.00 0.00 ? 47  VAL A HG23 5  
ATOM 9168  N N    . ASN A 1 48  ? -3.997  -8.703  -0.511  1.00 0.00 ? 48  ASN A N    5  
ATOM 9169  C CA   . ASN A 1 48  ? -2.951  -8.833  -1.510  1.00 0.00 ? 48  ASN A CA   5  
ATOM 9170  C C    . ASN A 1 48  ? -1.965  -7.672  -1.364  1.00 0.00 ? 48  ASN A C    5  
ATOM 9171  O O    . ASN A 1 48  ? -0.752  -7.877  -1.383  1.00 0.00 ? 48  ASN A O    5  
ATOM 9172  C CB   . ASN A 1 48  ? -3.531  -8.785  -2.925  1.00 0.00 ? 48  ASN A CB   5  
ATOM 9173  C CG   . ASN A 1 48  ? -2.868  -9.830  -3.825  1.00 0.00 ? 48  ASN A CG   5  
ATOM 9174  O OD1  . ASN A 1 48  ? -1.659  -9.991  -3.847  1.00 0.00 ? 48  ASN A OD1  5  
ATOM 9175  N ND2  . ASN A 1 48  ? -3.725  -10.528 -4.565  1.00 0.00 ? 48  ASN A ND2  5  
ATOM 9176  H H    . ASN A 1 48  ? -4.861  -8.330  -0.850  1.00 0.00 ? 48  ASN A H    5  
ATOM 9177  H HA   . ASN A 1 48  ? -2.488  -9.800  -1.316  1.00 0.00 ? 48  ASN A HA   5  
ATOM 9178  H HB2  . ASN A 1 48  ? -4.606  -8.962  -2.887  1.00 0.00 ? 48  ASN A HB2  5  
ATOM 9179  H HB3  . ASN A 1 48  ? -3.386  -7.791  -3.348  1.00 0.00 ? 48  ASN A HB3  5  
ATOM 9180  H HD21 . ASN A 1 48  ? -4.706  -10.346 -4.500  1.00 0.00 ? 48  ASN A HD21 5  
ATOM 9181  H HD22 . ASN A 1 48  ? -3.388  -11.236 -5.186  1.00 0.00 ? 48  ASN A HD22 5  
ATOM 9182  N N    . GLU A 1 49  ? -2.522  -6.479  -1.220  1.00 0.00 ? 49  GLU A N    5  
ATOM 9183  C CA   . GLU A 1 49  ? -1.708  -5.285  -1.070  1.00 0.00 ? 49  GLU A CA   5  
ATOM 9184  C C    . GLU A 1 49  ? -2.331  -4.343  -0.039  1.00 0.00 ? 49  GLU A C    5  
ATOM 9185  O O    . GLU A 1 49  ? -3.551  -4.309  0.119   1.00 0.00 ? 49  GLU A O    5  
ATOM 9186  C CB   . GLU A 1 49  ? -1.517  -4.579  -2.414  1.00 0.00 ? 49  GLU A CB   5  
ATOM 9187  C CG   . GLU A 1 49  ? -2.865  -4.200  -3.030  1.00 0.00 ? 49  GLU A CG   5  
ATOM 9188  C CD   . GLU A 1 49  ? -3.549  -5.421  -3.648  1.00 0.00 ? 49  GLU A CD   5  
ATOM 9189  O OE1  . GLU A 1 49  ? -2.988  -5.949  -4.632  1.00 0.00 ? 49  GLU A OE1  5  
ATOM 9190  O OE2  . GLU A 1 49  ? -4.619  -5.799  -3.122  1.00 0.00 ? 49  GLU A OE2  5  
ATOM 9191  H H    . GLU A 1 49  ? -3.510  -6.321  -1.205  1.00 0.00 ? 49  GLU A H    5  
ATOM 9192  H HA   . GLU A 1 49  ? -0.740  -5.638  -0.712  1.00 0.00 ? 49  GLU A HA   5  
ATOM 9193  H HB2  . GLU A 1 49  ? -0.911  -3.684  -2.276  1.00 0.00 ? 49  GLU A HB2  5  
ATOM 9194  H HB3  . GLU A 1 49  ? -0.972  -5.231  -3.097  1.00 0.00 ? 49  GLU A HB3  5  
ATOM 9195  H HG2  . GLU A 1 49  ? -3.509  -3.766  -2.265  1.00 0.00 ? 49  GLU A HG2  5  
ATOM 9196  H HG3  . GLU A 1 49  ? -2.718  -3.436  -3.794  1.00 0.00 ? 49  GLU A HG3  5  
ATOM 9197  N N    . MET A 1 50  ? -1.466  -3.599  0.635   1.00 0.00 ? 50  MET A N    5  
ATOM 9198  C CA   . MET A 1 50  ? -1.917  -2.658  1.646   1.00 0.00 ? 50  MET A CA   5  
ATOM 9199  C C    . MET A 1 50  ? -2.051  -1.250  1.064   1.00 0.00 ? 50  MET A C    5  
ATOM 9200  O O    . MET A 1 50  ? -1.308  -0.876  0.158   1.00 0.00 ? 50  MET A O    5  
ATOM 9201  C CB   . MET A 1 50  ? -0.920  -2.639  2.807   1.00 0.00 ? 50  MET A CB   5  
ATOM 9202  C CG   . MET A 1 50  ? -1.607  -2.237  4.113   1.00 0.00 ? 50  MET A CG   5  
ATOM 9203  S SD   . MET A 1 50  ? -0.814  -0.794  4.801   1.00 0.00 ? 50  MET A SD   5  
ATOM 9204  C CE   . MET A 1 50  ? -0.229  -1.469  6.347   1.00 0.00 ? 50  MET A CE   5  
ATOM 9205  H H    . MET A 1 50  ? -0.476  -3.632  0.500   1.00 0.00 ? 50  MET A H    5  
ATOM 9206  H HA   . MET A 1 50  ? -2.894  -3.020  1.968   1.00 0.00 ? 50  MET A HA   5  
ATOM 9207  H HB2  . MET A 1 50  ? -0.467  -3.624  2.918   1.00 0.00 ? 50  MET A HB2  5  
ATOM 9208  H HB3  . MET A 1 50  ? -0.113  -1.940  2.586   1.00 0.00 ? 50  MET A HB3  5  
ATOM 9209  H HG2  . MET A 1 50  ? -2.662  -2.030  3.931   1.00 0.00 ? 50  MET A HG2  5  
ATOM 9210  H HG3  . MET A 1 50  ? -1.563  -3.061  4.826   1.00 0.00 ? 50  MET A HG3  5  
ATOM 9211  H HE1  . MET A 1 50  ? -0.864  -1.118  7.160   1.00 0.00 ? 50  MET A HE1  5  
ATOM 9212  H HE2  . MET A 1 50  ? -0.262  -2.557  6.304   1.00 0.00 ? 50  MET A HE2  5  
ATOM 9213  H HE3  . MET A 1 50  ? 0.797   -1.143  6.520   1.00 0.00 ? 50  MET A HE3  5  
ATOM 9214  N N    . LEU A 1 51  ? -3.004  -0.507  1.608   1.00 0.00 ? 51  LEU A N    5  
ATOM 9215  C CA   . LEU A 1 51  ? -3.244  0.852   1.154   1.00 0.00 ? 51  LEU A CA   5  
ATOM 9216  C C    . LEU A 1 51  ? -2.975  1.825   2.304   1.00 0.00 ? 51  LEU A C    5  
ATOM 9217  O O    . LEU A 1 51  ? -3.646  1.775   3.334   1.00 0.00 ? 51  LEU A O    5  
ATOM 9218  C CB   . LEU A 1 51  ? -4.648  0.977   0.559   1.00 0.00 ? 51  LEU A CB   5  
ATOM 9219  C CG   . LEU A 1 51  ? -4.937  0.108   -0.667  1.00 0.00 ? 51  LEU A CG   5  
ATOM 9220  C CD1  . LEU A 1 51  ? -3.726  0.057   -1.600  1.00 0.00 ? 51  LEU A CD1  5  
ATOM 9221  C CD2  . LEU A 1 51  ? -5.400  -1.289  -0.251  1.00 0.00 ? 51  LEU A CD2  5  
ATOM 9222  H H    . LEU A 1 51  ? -3.604  -0.819  2.345   1.00 0.00 ? 51  LEU A H    5  
ATOM 9223  H HA   . LEU A 1 51  ? -2.535  1.059   0.353   1.00 0.00 ? 51  LEU A HA   5  
ATOM 9224  H HB2  . LEU A 1 51  ? -5.373  0.730   1.334   1.00 0.00 ? 51  LEU A HB2  5  
ATOM 9225  H HB3  . LEU A 1 51  ? -4.814  2.020   0.288   1.00 0.00 ? 51  LEU A HB3  5  
ATOM 9226  H HG   . LEU A 1 51  ? -5.754  0.566   -1.225  1.00 0.00 ? 51  LEU A HG   5  
ATOM 9227  H HD11 . LEU A 1 51  ? -3.010  -0.675  -1.227  1.00 0.00 ? 51  LEU A HD11 5  
ATOM 9228  H HD12 . LEU A 1 51  ? -4.050  -0.229  -2.601  1.00 0.00 ? 51  LEU A HD12 5  
ATOM 9229  H HD13 . LEU A 1 51  ? -3.255  1.039   -1.638  1.00 0.00 ? 51  LEU A HD13 5  
ATOM 9230  H HD21 . LEU A 1 51  ? -5.239  -1.985  -1.075  1.00 0.00 ? 51  LEU A HD21 5  
ATOM 9231  H HD22 . LEU A 1 51  ? -4.830  -1.617  0.618   1.00 0.00 ? 51  LEU A HD22 5  
ATOM 9232  H HD23 . LEU A 1 51  ? -6.460  -1.261  -0.001  1.00 0.00 ? 51  LEU A HD23 5  
ATOM 9233  N N    . PHE A 1 52  ? -1.991  2.686   2.091   1.00 0.00 ? 52  PHE A N    5  
ATOM 9234  C CA   . PHE A 1 52  ? -1.624  3.668   3.097   1.00 0.00 ? 52  PHE A CA   5  
ATOM 9235  C C    . PHE A 1 52  ? -2.342  4.997   2.852   1.00 0.00 ? 52  PHE A C    5  
ATOM 9236  O O    . PHE A 1 52  ? -1.944  5.771   1.983   1.00 0.00 ? 52  PHE A O    5  
ATOM 9237  C CB   . PHE A 1 52  ? -0.115  3.888   2.978   1.00 0.00 ? 52  PHE A CB   5  
ATOM 9238  C CG   . PHE A 1 52  ? 0.723   2.656   3.326   1.00 0.00 ? 52  PHE A CG   5  
ATOM 9239  C CD1  . PHE A 1 52  ? 0.721   2.169   4.596   1.00 0.00 ? 52  PHE A CD1  5  
ATOM 9240  C CD2  . PHE A 1 52  ? 1.469   2.047   2.365   1.00 0.00 ? 52  PHE A CD2  5  
ATOM 9241  C CE1  . PHE A 1 52  ? 1.499   1.025   4.919   1.00 0.00 ? 52  PHE A CE1  5  
ATOM 9242  C CE2  . PHE A 1 52  ? 2.246   0.904   2.688   1.00 0.00 ? 52  PHE A CE2  5  
ATOM 9243  C CZ   . PHE A 1 52  ? 2.245   0.417   3.958   1.00 0.00 ? 52  PHE A CZ   5  
ATOM 9244  H H    . PHE A 1 52  ? -1.450  2.719   1.251   1.00 0.00 ? 52  PHE A H    5  
ATOM 9245  H HA   . PHE A 1 52  ? -1.925  3.267   4.065   1.00 0.00 ? 52  PHE A HA   5  
ATOM 9246  H HB2  . PHE A 1 52  ? 0.118   4.197   1.959   1.00 0.00 ? 52  PHE A HB2  5  
ATOM 9247  H HB3  . PHE A 1 52  ? 0.175   4.709   3.634   1.00 0.00 ? 52  PHE A HB3  5  
ATOM 9248  H HD1  . PHE A 1 52  ? 0.123   2.657   5.366   1.00 0.00 ? 52  PHE A HD1  5  
ATOM 9249  H HD2  . PHE A 1 52  ? 1.470   2.438   1.347   1.00 0.00 ? 52  PHE A HD2  5  
ATOM 9250  H HE1  . PHE A 1 52  ? 1.497   0.635   5.936   1.00 0.00 ? 52  PHE A HE1  5  
ATOM 9251  H HE2  . PHE A 1 52  ? 2.844   0.416   1.918   1.00 0.00 ? 52  PHE A HE2  5  
ATOM 9252  H HZ   . PHE A 1 52  ? 2.841   -0.461  4.206   1.00 0.00 ? 52  PHE A HZ   5  
ATOM 9253  N N    . ILE A 1 53  ? -3.388  5.221   3.635   1.00 0.00 ? 53  ILE A N    5  
ATOM 9254  C CA   . ILE A 1 53  ? -4.165  6.442   3.514   1.00 0.00 ? 53  ILE A CA   5  
ATOM 9255  C C    . ILE A 1 53  ? -3.247  7.648   3.723   1.00 0.00 ? 53  ILE A C    5  
ATOM 9256  O O    . ILE A 1 53  ? -2.624  7.784   4.775   1.00 0.00 ? 53  ILE A O    5  
ATOM 9257  C CB   . ILE A 1 53  ? -5.364  6.411   4.464   1.00 0.00 ? 53  ILE A CB   5  
ATOM 9258  C CG1  . ILE A 1 53  ? -6.379  5.351   4.030   1.00 0.00 ? 53  ILE A CG1  5  
ATOM 9259  C CG2  . ILE A 1 53  ? -6.000  7.796   4.590   1.00 0.00 ? 53  ILE A CG2  5  
ATOM 9260  C CD1  . ILE A 1 53  ? -6.936  5.662   2.639   1.00 0.00 ? 53  ILE A CD1  5  
ATOM 9261  H H    . ILE A 1 53  ? -3.705  4.586   4.339   1.00 0.00 ? 53  ILE A H    5  
ATOM 9262  H HA   . ILE A 1 53  ? -4.559  6.480   2.499   1.00 0.00 ? 53  ILE A HA   5  
ATOM 9263  H HB   . ILE A 1 53  ? -5.008  6.129   5.455   1.00 0.00 ? 53  ILE A HB   5  
ATOM 9264  H HG12 . ILE A 1 53  ? -5.906  4.369   4.026   1.00 0.00 ? 53  ILE A HG12 5  
ATOM 9265  H HG13 . ILE A 1 53  ? -7.195  5.308   4.751   1.00 0.00 ? 53  ILE A HG13 5  
ATOM 9266  H HG21 . ILE A 1 53  ? -6.198  8.197   3.596   1.00 0.00 ? 53  ILE A HG21 5  
ATOM 9267  H HG22 . ILE A 1 53  ? -6.936  7.717   5.143   1.00 0.00 ? 53  ILE A HG22 5  
ATOM 9268  H HG23 . ILE A 1 53  ? -5.320  8.462   5.122   1.00 0.00 ? 53  ILE A HG23 5  
ATOM 9269  H HD11 . ILE A 1 53  ? -6.164  5.481   1.891   1.00 0.00 ? 53  ILE A HD11 5  
ATOM 9270  H HD12 . ILE A 1 53  ? -7.793  5.020   2.439   1.00 0.00 ? 53  ILE A HD12 5  
ATOM 9271  H HD13 . ILE A 1 53  ? -7.245  6.706   2.597   1.00 0.00 ? 53  ILE A HD13 5  
ATOM 9272  N N    . ILE A 1 54  ? -3.191  8.493   2.704   1.00 0.00 ? 54  ILE A N    5  
ATOM 9273  C CA   . ILE A 1 54  ? -2.360  9.683   2.763   1.00 0.00 ? 54  ILE A CA   5  
ATOM 9274  C C    . ILE A 1 54  ? -3.227  10.889  3.130   1.00 0.00 ? 54  ILE A C    5  
ATOM 9275  O O    . ILE A 1 54  ? -2.937  11.597  4.093   1.00 0.00 ? 54  ILE A O    5  
ATOM 9276  C CB   . ILE A 1 54  ? -1.583  9.859   1.456   1.00 0.00 ? 54  ILE A CB   5  
ATOM 9277  C CG1  . ILE A 1 54  ? -0.928  8.545   1.026   1.00 0.00 ? 54  ILE A CG1  5  
ATOM 9278  C CG2  . ILE A 1 54  ? -0.565  10.996  1.572   1.00 0.00 ? 54  ILE A CG2  5  
ATOM 9279  C CD1  . ILE A 1 54  ? 0.212   8.165   1.974   1.00 0.00 ? 54  ILE A CD1  5  
ATOM 9280  H H    . ILE A 1 54  ? -3.701  8.375   1.852   1.00 0.00 ? 54  ILE A H    5  
ATOM 9281  H HA   . ILE A 1 54  ? -1.627  9.531   3.555   1.00 0.00 ? 54  ILE A HA   5  
ATOM 9282  H HB   . ILE A 1 54  ? -2.289  10.138  0.674   1.00 0.00 ? 54  ILE A HB   5  
ATOM 9283  H HG12 . ILE A 1 54  ? -1.674  7.750   1.012   1.00 0.00 ? 54  ILE A HG12 5  
ATOM 9284  H HG13 . ILE A 1 54  ? -0.545  8.641   0.011   1.00 0.00 ? 54  ILE A HG13 5  
ATOM 9285  H HG21 . ILE A 1 54  ? 0.149   10.929  0.752   1.00 0.00 ? 54  ILE A HG21 5  
ATOM 9286  H HG22 . ILE A 1 54  ? -1.084  11.954  1.525   1.00 0.00 ? 54  ILE A HG22 5  
ATOM 9287  H HG23 . ILE A 1 54  ? -0.037  10.915  2.522   1.00 0.00 ? 54  ILE A HG23 5  
ATOM 9288  H HD11 . ILE A 1 54  ? 0.002   7.194   2.423   1.00 0.00 ? 54  ILE A HD11 5  
ATOM 9289  H HD12 . ILE A 1 54  ? 1.146   8.112   1.416   1.00 0.00 ? 54  ILE A HD12 5  
ATOM 9290  H HD13 . ILE A 1 54  ? 0.298   8.917   2.758   1.00 0.00 ? 54  ILE A HD13 5  
ATOM 9291  N N    . ARG A 1 55  ? -4.275  11.085  2.343   1.00 0.00 ? 55  ARG A N    5  
ATOM 9292  C CA   . ARG A 1 55  ? -5.186  12.193  2.573   1.00 0.00 ? 55  ARG A CA   5  
ATOM 9293  C C    . ARG A 1 55  ? -6.521  11.937  1.869   1.00 0.00 ? 55  ARG A C    5  
ATOM 9294  O O    . ARG A 1 55  ? -6.551  11.647  0.674   1.00 0.00 ? 55  ARG A O    5  
ATOM 9295  C CB   . ARG A 1 55  ? -4.594  13.509  2.064   1.00 0.00 ? 55  ARG A CB   5  
ATOM 9296  C CG   . ARG A 1 55  ? -4.702  14.605  3.126   1.00 0.00 ? 55  ARG A CG   5  
ATOM 9297  C CD   . ARG A 1 55  ? -5.742  15.654  2.726   1.00 0.00 ? 55  ARG A CD   5  
ATOM 9298  N NE   . ARG A 1 55  ? -6.197  16.397  3.923   1.00 0.00 ? 55  ARG A NE   5  
ATOM 9299  C CZ   . ARG A 1 55  ? -7.185  17.301  3.915   1.00 0.00 ? 55  ARG A CZ   5  
ATOM 9300  N NH1  . ARG A 1 55  ? -7.828  17.581  2.773   1.00 0.00 ? 55  ARG A NH1  5  
ATOM 9301  N NH2  . ARG A 1 55  ? -7.531  17.927  5.048   1.00 0.00 ? 55  ARG A NH2  5  
ATOM 9302  H H    . ARG A 1 55  ? -4.504  10.504  1.561   1.00 0.00 ? 55  ARG A H    5  
ATOM 9303  H HA   . ARG A 1 55  ? -5.314  12.229  3.655   1.00 0.00 ? 55  ARG A HA   5  
ATOM 9304  H HB2  . ARG A 1 55  ? -3.548  13.360  1.795   1.00 0.00 ? 55  ARG A HB2  5  
ATOM 9305  H HB3  . ARG A 1 55  ? -5.115  13.821  1.159   1.00 0.00 ? 55  ARG A HB3  5  
ATOM 9306  H HG2  . ARG A 1 55  ? -4.976  14.163  4.084   1.00 0.00 ? 55  ARG A HG2  5  
ATOM 9307  H HG3  . ARG A 1 55  ? -3.732  15.083  3.261   1.00 0.00 ? 55  ARG A HG3  5  
ATOM 9308  H HD2  . ARG A 1 55  ? -5.313  16.345  2.001   1.00 0.00 ? 55  ARG A HD2  5  
ATOM 9309  H HD3  . ARG A 1 55  ? -6.591  15.171  2.243   1.00 0.00 ? 55  ARG A HD3  5  
ATOM 9310  H HE   . ARG A 1 55  ? -5.738  16.212  4.792   1.00 0.00 ? 55  ARG A HE   5  
ATOM 9311  H HH11 . ARG A 1 55  ? -7.570  17.115  1.927   1.00 0.00 ? 55  ARG A HH11 5  
ATOM 9312  H HH12 . ARG A 1 55  ? -8.566  18.257  2.767   1.00 0.00 ? 55  ARG A HH12 5  
ATOM 9313  H HH21 . ARG A 1 55  ? -7.051  17.718  5.901   1.00 0.00 ? 55  ARG A HH21 5  
ATOM 9314  H HH22 . ARG A 1 55  ? -8.269  18.602  5.042   1.00 0.00 ? 55  ARG A HH22 5  
ATOM 9315  N N    . GLY A 1 56  ? -7.592  12.054  2.641   1.00 0.00 ? 56  GLY A N    5  
ATOM 9316  C CA   . GLY A 1 56  ? -8.926  11.839  2.106   1.00 0.00 ? 56  GLY A CA   5  
ATOM 9317  C C    . GLY A 1 56  ? -9.910  11.472  3.219   1.00 0.00 ? 56  GLY A C    5  
ATOM 9318  O O    . GLY A 1 56  ? -9.749  11.901  4.361   1.00 0.00 ? 56  GLY A O    5  
ATOM 9319  H H    . GLY A 1 56  ? -7.558  12.290  3.612   1.00 0.00 ? 56  GLY A H    5  
ATOM 9320  H HA2  . GLY A 1 56  ? -9.267  12.740  1.597   1.00 0.00 ? 56  GLY A HA2  5  
ATOM 9321  H HA3  . GLY A 1 56  ? -8.899  11.042  1.363   1.00 0.00 ? 56  GLY A HA3  5  
ATOM 9322  N N    . ARG A 1 57  ? -10.907 10.683  2.848   1.00 0.00 ? 57  ARG A N    5  
ATOM 9323  C CA   . ARG A 1 57  ? -11.916 10.254  3.801   1.00 0.00 ? 57  ARG A CA   5  
ATOM 9324  C C    . ARG A 1 57  ? -12.482 8.891   3.397   1.00 0.00 ? 57  ARG A C    5  
ATOM 9325  O O    . ARG A 1 57  ? -12.590 8.587   2.210   1.00 0.00 ? 57  ARG A O    5  
ATOM 9326  C CB   . ARG A 1 57  ? -13.059 11.268  3.886   1.00 0.00 ? 57  ARG A CB   5  
ATOM 9327  C CG   . ARG A 1 57  ? -13.994 10.943  5.053   1.00 0.00 ? 57  ARG A CG   5  
ATOM 9328  C CD   . ARG A 1 57  ? -13.724 11.864  6.244   1.00 0.00 ? 57  ARG A CD   5  
ATOM 9329  N NE   . ARG A 1 57  ? -14.948 12.623  6.585   1.00 0.00 ? 57  ARG A NE   5  
ATOM 9330  C CZ   . ARG A 1 57  ? -15.300 13.780  6.007   1.00 0.00 ? 57  ARG A CZ   5  
ATOM 9331  N NH1  . ARG A 1 57  ? -14.524 14.318  5.057   1.00 0.00 ? 57  ARG A NH1  5  
ATOM 9332  N NH2  . ARG A 1 57  ? -16.429 14.398  6.380   1.00 0.00 ? 57  ARG A NH2  5  
ATOM 9333  H H    . ARG A 1 57  ? -11.030 10.338  1.917   1.00 0.00 ? 57  ARG A H    5  
ATOM 9334  H HA   . ARG A 1 57  ? -11.392 10.194  4.754   1.00 0.00 ? 57  ARG A HA   5  
ATOM 9335  H HB2  . ARG A 1 57  ? -12.651 12.271  4.010   1.00 0.00 ? 57  ARG A HB2  5  
ATOM 9336  H HB3  . ARG A 1 57  ? -13.622 11.266  2.953   1.00 0.00 ? 57  ARG A HB3  5  
ATOM 9337  H HG2  . ARG A 1 57  ? -15.031 11.050  4.734   1.00 0.00 ? 57  ARG A HG2  5  
ATOM 9338  H HG3  . ARG A 1 57  ? -13.859 9.904   5.354   1.00 0.00 ? 57  ARG A HG3  5  
ATOM 9339  H HD2  . ARG A 1 57  ? -13.400 11.276  7.103   1.00 0.00 ? 57  ARG A HD2  5  
ATOM 9340  H HD3  . ARG A 1 57  ? -12.914 12.553  6.006   1.00 0.00 ? 57  ARG A HD3  5  
ATOM 9341  H HE   . ARG A 1 57  ? -15.550 12.249  7.291   1.00 0.00 ? 57  ARG A HE   5  
ATOM 9342  H HH11 . ARG A 1 57  ? -13.681 13.856  4.779   1.00 0.00 ? 57  ARG A HH11 5  
ATOM 9343  H HH12 . ARG A 1 57  ? -14.786 15.181  4.626   1.00 0.00 ? 57  ARG A HH12 5  
ATOM 9344  H HH21 . ARG A 1 57  ? -17.009 13.997  7.089   1.00 0.00 ? 57  ARG A HH21 5  
ATOM 9345  H HH22 . ARG A 1 57  ? -16.692 15.262  5.949   1.00 0.00 ? 57  ARG A HH22 5  
ATOM 9346  N N    . LEU A 1 58  ? -12.829 8.107   4.407   1.00 0.00 ? 58  LEU A N    5  
ATOM 9347  C CA   . LEU A 1 58  ? -13.381 6.783   4.172   1.00 0.00 ? 58  LEU A CA   5  
ATOM 9348  C C    . LEU A 1 58  ? -14.385 6.451   5.277   1.00 0.00 ? 58  LEU A C    5  
ATOM 9349  O O    . LEU A 1 58  ? -14.498 7.183   6.259   1.00 0.00 ? 58  LEU A O    5  
ATOM 9350  C CB   . LEU A 1 58  ? -12.259 5.753   4.029   1.00 0.00 ? 58  LEU A CB   5  
ATOM 9351  C CG   . LEU A 1 58  ? -11.485 5.783   2.710   1.00 0.00 ? 58  LEU A CG   5  
ATOM 9352  C CD1  . LEU A 1 58  ? -10.227 6.645   2.832   1.00 0.00 ? 58  LEU A CD1  5  
ATOM 9353  C CD2  . LEU A 1 58  ? -11.164 4.366   2.229   1.00 0.00 ? 58  LEU A CD2  5  
ATOM 9354  H H    . LEU A 1 58  ? -12.738 8.362   5.369   1.00 0.00 ? 58  LEU A H    5  
ATOM 9355  H HA   . LEU A 1 58  ? -13.913 6.815   3.221   1.00 0.00 ? 58  LEU A HA   5  
ATOM 9356  H HB2  . LEU A 1 58  ? -11.553 5.898   4.846   1.00 0.00 ? 58  LEU A HB2  5  
ATOM 9357  H HB3  . LEU A 1 58  ? -12.689 4.758   4.152   1.00 0.00 ? 58  LEU A HB3  5  
ATOM 9358  H HG   . LEU A 1 58  ? -12.118 6.244   1.952   1.00 0.00 ? 58  LEU A HG   5  
ATOM 9359  H HD11 . LEU A 1 58  ? -9.382  6.016   3.113   1.00 0.00 ? 58  LEU A HD11 5  
ATOM 9360  H HD12 . LEU A 1 58  ? -10.021 7.125   1.875   1.00 0.00 ? 58  LEU A HD12 5  
ATOM 9361  H HD13 . LEU A 1 58  ? -10.382 7.408   3.595   1.00 0.00 ? 58  LEU A HD13 5  
ATOM 9362  H HD21 . LEU A 1 58  ? -12.093 3.836   2.017   1.00 0.00 ? 58  LEU A HD21 5  
ATOM 9363  H HD22 . LEU A 1 58  ? -10.560 4.417   1.324   1.00 0.00 ? 58  LEU A HD22 5  
ATOM 9364  H HD23 . LEU A 1 58  ? -10.612 3.836   3.005   1.00 0.00 ? 58  LEU A HD23 5  
ATOM 9365  N N    . GLU A 1 59  ? -15.088 5.345   5.081   1.00 0.00 ? 59  GLU A N    5  
ATOM 9366  C CA   . GLU A 1 59  ? -16.078 4.906   6.050   1.00 0.00 ? 59  GLU A CA   5  
ATOM 9367  C C    . GLU A 1 59  ? -15.791 3.468   6.488   1.00 0.00 ? 59  GLU A C    5  
ATOM 9368  O O    . GLU A 1 59  ? -15.700 2.568   5.654   1.00 0.00 ? 59  GLU A O    5  
ATOM 9369  C CB   . GLU A 1 59  ? -17.493 5.035   5.483   1.00 0.00 ? 59  GLU A CB   5  
ATOM 9370  C CG   . GLU A 1 59  ? -17.842 3.834   4.602   1.00 0.00 ? 59  GLU A CG   5  
ATOM 9371  C CD   . GLU A 1 59  ? -19.229 3.998   3.975   1.00 0.00 ? 59  GLU A CD   5  
ATOM 9372  O OE1  . GLU A 1 59  ? -20.099 4.573   4.665   1.00 0.00 ? 59  GLU A OE1  5  
ATOM 9373  O OE2  . GLU A 1 59  ? -19.388 3.544   2.822   1.00 0.00 ? 59  GLU A OE2  5  
ATOM 9374  H H    . GLU A 1 59  ? -14.989 4.754   4.280   1.00 0.00 ? 59  GLU A H    5  
ATOM 9375  H HA   . GLU A 1 59  ? -15.971 5.580   6.899   1.00 0.00 ? 59  GLU A HA   5  
ATOM 9376  H HB2  . GLU A 1 59  ? -18.211 5.111   6.300   1.00 0.00 ? 59  GLU A HB2  5  
ATOM 9377  H HB3  . GLU A 1 59  ? -17.574 5.953   4.901   1.00 0.00 ? 59  GLU A HB3  5  
ATOM 9378  H HG2  . GLU A 1 59  ? -17.095 3.725   3.816   1.00 0.00 ? 59  GLU A HG2  5  
ATOM 9379  H HG3  . GLU A 1 59  ? -17.814 2.921   5.197   1.00 0.00 ? 59  GLU A HG3  5  
ATOM 9380  N N    . SER A 1 60  ? -15.658 3.297   7.795   1.00 0.00 ? 60  SER A N    5  
ATOM 9381  C CA   . SER A 1 60  ? -15.384 1.984   8.353   1.00 0.00 ? 60  SER A CA   5  
ATOM 9382  C C    . SER A 1 60  ? -16.683 1.343   8.845   1.00 0.00 ? 60  SER A C    5  
ATOM 9383  O O    . SER A 1 60  ? -17.470 1.982   9.542   1.00 0.00 ? 60  SER A O    5  
ATOM 9384  C CB   . SER A 1 60  ? -14.370 2.072   9.496   1.00 0.00 ? 60  SER A CB   5  
ATOM 9385  O OG   . SER A 1 60  ? -14.393 0.911   10.321  1.00 0.00 ? 60  SER A OG   5  
ATOM 9386  H H    . SER A 1 60  ? -15.734 4.034   8.466   1.00 0.00 ? 60  SER A H    5  
ATOM 9387  H HA   . SER A 1 60  ? -14.958 1.405   7.534   1.00 0.00 ? 60  SER A HA   5  
ATOM 9388  H HB2  . SER A 1 60  ? -13.369 2.204   9.083   1.00 0.00 ? 60  SER A HB2  5  
ATOM 9389  H HB3  . SER A 1 60  ? -14.582 2.953   10.102  1.00 0.00 ? 60  SER A HB3  5  
ATOM 9390  H HG   . SER A 1 60  ? -13.549 0.854   10.854  1.00 0.00 ? 60  SER A HG   5  
ATOM 9391  N N    . VAL A 1 61  ? -16.867 0.088   8.464   1.00 0.00 ? 61  VAL A N    5  
ATOM 9392  C CA   . VAL A 1 61  ? -18.058 -0.647  8.858   1.00 0.00 ? 61  VAL A CA   5  
ATOM 9393  C C    . VAL A 1 61  ? -17.660 -2.061  9.287   1.00 0.00 ? 61  VAL A C    5  
ATOM 9394  O O    . VAL A 1 61  ? -16.626 -2.575  8.863   1.00 0.00 ? 61  VAL A O    5  
ATOM 9395  C CB   . VAL A 1 61  ? -19.081 -0.633  7.720   1.00 0.00 ? 61  VAL A CB   5  
ATOM 9396  C CG1  . VAL A 1 61  ? -20.001 -1.853  7.796   1.00 0.00 ? 61  VAL A CG1  5  
ATOM 9397  C CG2  . VAL A 1 61  ? -19.890 0.666   7.727   1.00 0.00 ? 61  VAL A CG2  5  
ATOM 9398  H H    . VAL A 1 61  ? -16.222 -0.425  7.897   1.00 0.00 ? 61  VAL A H    5  
ATOM 9399  H HA   . VAL A 1 61  ? -18.495 -0.131  9.712   1.00 0.00 ? 61  VAL A HA   5  
ATOM 9400  H HB   . VAL A 1 61  ? -18.536 -0.683  6.778   1.00 0.00 ? 61  VAL A HB   5  
ATOM 9401  H HG11 . VAL A 1 61  ? -20.720 -1.817  6.978   1.00 0.00 ? 61  VAL A HG11 5  
ATOM 9402  H HG12 . VAL A 1 61  ? -19.406 -2.763  7.717   1.00 0.00 ? 61  VAL A HG12 5  
ATOM 9403  H HG13 . VAL A 1 61  ? -20.533 -1.848  8.748   1.00 0.00 ? 61  VAL A HG13 5  
ATOM 9404  H HG21 . VAL A 1 61  ? -20.232 0.876   8.740   1.00 0.00 ? 61  VAL A HG21 5  
ATOM 9405  H HG22 . VAL A 1 61  ? -19.263 1.486   7.377   1.00 0.00 ? 61  VAL A HG22 5  
ATOM 9406  H HG23 . VAL A 1 61  ? -20.752 0.560   7.067   1.00 0.00 ? 61  VAL A HG23 5  
ATOM 9407  N N    . THR A 1 62  ? -18.503 -2.649  10.123  1.00 0.00 ? 62  THR A N    5  
ATOM 9408  C CA   . THR A 1 62  ? -18.253 -3.993  10.615  1.00 0.00 ? 62  THR A CA   5  
ATOM 9409  C C    . THR A 1 62  ? -19.532 -4.830  10.554  1.00 0.00 ? 62  THR A C    5  
ATOM 9410  O O    . THR A 1 62  ? -20.622 -4.323  10.812  1.00 0.00 ? 62  THR A O    5  
ATOM 9411  C CB   . THR A 1 62  ? -17.667 -3.880  12.024  1.00 0.00 ? 62  THR A CB   5  
ATOM 9412  O OG1  . THR A 1 62  ? -17.376 -5.227  12.388  1.00 0.00 ? 62  THR A OG1  5  
ATOM 9413  C CG2  . THR A 1 62  ? -18.704 -3.431  13.055  1.00 0.00 ? 62  THR A CG2  5  
ATOM 9414  H H    . THR A 1 62  ? -19.342 -2.224  10.463  1.00 0.00 ? 62  THR A H    5  
ATOM 9415  H HA   . THR A 1 62  ? -17.527 -4.471  9.956   1.00 0.00 ? 62  THR A HA   5  
ATOM 9416  H HB   . THR A 1 62  ? -16.798 -3.222  12.032  1.00 0.00 ? 62  THR A HB   5  
ATOM 9417  H HG1  . THR A 1 62  ? -16.765 -5.640  11.713  1.00 0.00 ? 62  THR A HG1  5  
ATOM 9418  H HG21 . THR A 1 62  ? -18.269 -3.478  14.053  1.00 0.00 ? 62  THR A HG21 5  
ATOM 9419  H HG22 . THR A 1 62  ? -19.010 -2.407  12.840  1.00 0.00 ? 62  THR A HG22 5  
ATOM 9420  H HG23 . THR A 1 62  ? -19.573 -4.087  13.006  1.00 0.00 ? 62  THR A HG23 5  
ATOM 9421  N N    . THR A 1 63  ? -19.356 -6.098  10.212  1.00 0.00 ? 63  THR A N    5  
ATOM 9422  C CA   . THR A 1 63  ? -20.483 -7.010  10.114  1.00 0.00 ? 63  THR A CA   5  
ATOM 9423  C C    . THR A 1 63  ? -19.992 -8.457  10.028  1.00 0.00 ? 63  THR A C    5  
ATOM 9424  O O    . THR A 1 63  ? -20.236 -9.141  9.035   1.00 0.00 ? 63  THR A O    5  
ATOM 9425  C CB   . THR A 1 63  ? -21.333 -6.585  8.915   1.00 0.00 ? 63  THR A CB   5  
ATOM 9426  O OG1  . THR A 1 63  ? -22.397 -7.532  8.890   1.00 0.00 ? 63  THR A OG1  5  
ATOM 9427  C CG2  . THR A 1 63  ? -20.613 -6.797  7.582   1.00 0.00 ? 63  THR A CG2  5  
ATOM 9428  H H    . THR A 1 63  ? -18.466 -6.503  10.003  1.00 0.00 ? 63  THR A H    5  
ATOM 9429  H HA   . THR A 1 63  ? -21.073 -6.926  11.026  1.00 0.00 ? 63  THR A HA   5  
ATOM 9430  H HB   . THR A 1 63  ? -21.662 -5.551  9.019   1.00 0.00 ? 63  THR A HB   5  
ATOM 9431  H HG1  . THR A 1 63  ? -22.031 -8.453  8.754   1.00 0.00 ? 63  THR A HG1  5  
ATOM 9432  H HG21 . THR A 1 63  ? -21.207 -7.456  6.949   1.00 0.00 ? 63  THR A HG21 5  
ATOM 9433  H HG22 . THR A 1 63  ? -20.480 -5.837  7.083   1.00 0.00 ? 63  THR A HG22 5  
ATOM 9434  H HG23 . THR A 1 63  ? -19.638 -7.250  7.763   1.00 0.00 ? 63  THR A HG23 5  
ATOM 9435  N N    . ASP A 1 64  ? -19.309 -8.880  11.082  1.00 0.00 ? 64  ASP A N    5  
ATOM 9436  C CA   . ASP A 1 64  ? -18.782 -10.233 11.138  1.00 0.00 ? 64  ASP A CA   5  
ATOM 9437  C C    . ASP A 1 64  ? -19.905 -11.226 10.833  1.00 0.00 ? 64  ASP A C    5  
ATOM 9438  O O    . ASP A 1 64  ? -21.078 -10.929 11.054  1.00 0.00 ? 64  ASP A O    5  
ATOM 9439  C CB   . ASP A 1 64  ? -18.233 -10.552 12.530  1.00 0.00 ? 64  ASP A CB   5  
ATOM 9440  C CG   . ASP A 1 64  ? -17.996 -12.038 12.805  1.00 0.00 ? 64  ASP A CG   5  
ATOM 9441  O OD1  . ASP A 1 64  ? -16.893 -12.511 12.456  1.00 0.00 ? 64  ASP A OD1  5  
ATOM 9442  O OD2  . ASP A 1 64  ? -18.922 -12.668 13.360  1.00 0.00 ? 64  ASP A OD2  5  
ATOM 9443  H H    . ASP A 1 64  ? -19.115 -8.317  11.885  1.00 0.00 ? 64  ASP A H    5  
ATOM 9444  H HA   . ASP A 1 64  ? -17.987 -10.261 10.393  1.00 0.00 ? 64  ASP A HA   5  
ATOM 9445  H HB2  . ASP A 1 64  ? -17.292 -10.018 12.664  1.00 0.00 ? 64  ASP A HB2  5  
ATOM 9446  H HB3  . ASP A 1 64  ? -18.928 -10.166 13.276  1.00 0.00 ? 64  ASP A HB3  5  
ATOM 9447  N N    . GLY A 1 65  ? -19.506 -12.385 10.331  1.00 0.00 ? 65  GLY A N    5  
ATOM 9448  C CA   . GLY A 1 65  ? -20.465 -13.424 9.993   1.00 0.00 ? 65  GLY A CA   5  
ATOM 9449  C C    . GLY A 1 65  ? -20.512 -14.500 11.080  1.00 0.00 ? 65  GLY A C    5  
ATOM 9450  O O    . GLY A 1 65  ? -19.586 -14.620 11.880  1.00 0.00 ? 65  GLY A O    5  
ATOM 9451  H H    . GLY A 1 65  ? -18.550 -12.619 10.154  1.00 0.00 ? 65  GLY A H    5  
ATOM 9452  H HA2  . GLY A 1 65  ? -21.454 -12.984 9.869   1.00 0.00 ? 65  GLY A HA2  5  
ATOM 9453  H HA3  . GLY A 1 65  ? -20.195 -13.877 9.039   1.00 0.00 ? 65  GLY A HA3  5  
ATOM 9454  N N    . GLY A 1 66  ? -21.601 -15.255 11.073  1.00 0.00 ? 66  GLY A N    5  
ATOM 9455  C CA   . GLY A 1 66  ? -21.781 -16.317 12.048  1.00 0.00 ? 66  GLY A CA   5  
ATOM 9456  C C    . GLY A 1 66  ? -22.742 -15.886 13.157  1.00 0.00 ? 66  GLY A C    5  
ATOM 9457  O O    . GLY A 1 66  ? -23.770 -16.526 13.377  1.00 0.00 ? 66  GLY A O    5  
ATOM 9458  H H    . GLY A 1 66  ? -22.349 -15.151 10.418  1.00 0.00 ? 66  GLY A H    5  
ATOM 9459  H HA2  . GLY A 1 66  ? -22.167 -17.208 11.553  1.00 0.00 ? 66  GLY A HA2  5  
ATOM 9460  H HA3  . GLY A 1 66  ? -20.817 -16.586 12.481  1.00 0.00 ? 66  GLY A HA3  5  
ATOM 9461  N N    . ARG A 1 67  ? -22.375 -14.804 13.828  1.00 0.00 ? 67  ARG A N    5  
ATOM 9462  C CA   . ARG A 1 67  ? -23.192 -14.279 14.909  1.00 0.00 ? 67  ARG A CA   5  
ATOM 9463  C C    . ARG A 1 67  ? -23.035 -12.760 15.003  1.00 0.00 ? 67  ARG A C    5  
ATOM 9464  O O    . ARG A 1 67  ? -22.086 -12.267 15.611  1.00 0.00 ? 67  ARG A O    5  
ATOM 9465  C CB   . ARG A 1 67  ? -22.804 -14.910 16.248  1.00 0.00 ? 67  ARG A CB   5  
ATOM 9466  C CG   . ARG A 1 67  ? -23.767 -16.039 16.621  1.00 0.00 ? 67  ARG A CG   5  
ATOM 9467  C CD   . ARG A 1 67  ? -25.129 -15.482 17.038  1.00 0.00 ? 67  ARG A CD   5  
ATOM 9468  N NE   . ARG A 1 67  ? -26.199 -16.438 16.676  1.00 0.00 ? 67  ARG A NE   5  
ATOM 9469  C CZ   . ARG A 1 67  ? -27.496 -16.115 16.583  1.00 0.00 ? 67  ARG A CZ   5  
ATOM 9470  N NH1  . ARG A 1 67  ? -27.892 -14.858 16.825  1.00 0.00 ? 67  ARG A NH1  5  
ATOM 9471  N NH2  . ARG A 1 67  ? -28.397 -17.049 16.248  1.00 0.00 ? 67  ARG A NH2  5  
ATOM 9472  H H    . ARG A 1 67  ? -21.537 -14.289 13.643  1.00 0.00 ? 67  ARG A H    5  
ATOM 9473  H HA   . ARG A 1 67  ? -24.213 -14.552 14.644  1.00 0.00 ? 67  ARG A HA   5  
ATOM 9474  H HB2  . ARG A 1 67  ? -21.787 -15.298 16.190  1.00 0.00 ? 67  ARG A HB2  5  
ATOM 9475  H HB3  . ARG A 1 67  ? -22.811 -14.148 17.028  1.00 0.00 ? 67  ARG A HB3  5  
ATOM 9476  H HG2  . ARG A 1 67  ? -23.889 -16.713 15.773  1.00 0.00 ? 67  ARG A HG2  5  
ATOM 9477  H HG3  . ARG A 1 67  ? -23.345 -16.626 17.437  1.00 0.00 ? 67  ARG A HG3  5  
ATOM 9478  H HD2  . ARG A 1 67  ? -25.143 -15.298 18.112  1.00 0.00 ? 67  ARG A HD2  5  
ATOM 9479  H HD3  . ARG A 1 67  ? -25.305 -14.524 16.548  1.00 0.00 ? 67  ARG A HD3  5  
ATOM 9480  H HE   . ARG A 1 67  ? -25.938 -17.386 16.490  1.00 0.00 ? 67  ARG A HE   5  
ATOM 9481  H HH11 . ARG A 1 67  ? -27.220 -14.161 17.074  1.00 0.00 ? 67  ARG A HH11 5  
ATOM 9482  H HH12 . ARG A 1 67  ? -28.860 -14.617 16.755  1.00 0.00 ? 67  ARG A HH12 5  
ATOM 9483  H HH21 . ARG A 1 67  ? -28.101 -17.987 16.068  1.00 0.00 ? 67  ARG A HH21 5  
ATOM 9484  H HH22 . ARG A 1 67  ? -29.365 -16.808 16.179  1.00 0.00 ? 67  ARG A HH22 5  
ATOM 9485  N N    . SER A 1 68  ? -23.981 -12.061 14.394  1.00 0.00 ? 68  SER A N    5  
ATOM 9486  C CA   . SER A 1 68  ? -23.960 -10.608 14.402  1.00 0.00 ? 68  SER A CA   5  
ATOM 9487  C C    . SER A 1 68  ? -25.389 -10.064 14.353  1.00 0.00 ? 68  SER A C    5  
ATOM 9488  O O    . SER A 1 68  ? -26.336 -10.815 14.125  1.00 0.00 ? 68  SER A O    5  
ATOM 9489  C CB   . SER A 1 68  ? -23.143 -10.062 13.229  1.00 0.00 ? 68  SER A CB   5  
ATOM 9490  O OG   . SER A 1 68  ? -22.795 -8.692  13.412  1.00 0.00 ? 68  SER A OG   5  
ATOM 9491  H H    . SER A 1 68  ? -24.750 -12.469 13.902  1.00 0.00 ? 68  SER A H    5  
ATOM 9492  H HA   . SER A 1 68  ? -23.478 -10.331 15.340  1.00 0.00 ? 68  SER A HA   5  
ATOM 9493  H HB2  . SER A 1 68  ? -22.235 -10.654 13.113  1.00 0.00 ? 68  SER A HB2  5  
ATOM 9494  H HB3  . SER A 1 68  ? -23.715 -10.171 12.308  1.00 0.00 ? 68  SER A HB3  5  
ATOM 9495  H HG   . SER A 1 68  ? -21.810 -8.571  13.292  1.00 0.00 ? 68  SER A HG   5  
ATOM 9496  N N    . GLY A 1 69  ? -25.500 -8.761  14.570  1.00 0.00 ? 69  GLY A N    5  
ATOM 9497  C CA   . GLY A 1 69  ? -26.798 -8.108  14.553  1.00 0.00 ? 69  GLY A CA   5  
ATOM 9498  C C    . GLY A 1 69  ? -26.778 -6.873  13.648  1.00 0.00 ? 69  GLY A C    5  
ATOM 9499  O O    . GLY A 1 69  ? -26.893 -6.991  12.429  1.00 0.00 ? 69  GLY A O    5  
ATOM 9500  H H    . GLY A 1 69  ? -24.725 -8.157  14.754  1.00 0.00 ? 69  GLY A H    5  
ATOM 9501  H HA2  . GLY A 1 69  ? -27.557 -8.807  14.203  1.00 0.00 ? 69  GLY A HA2  5  
ATOM 9502  H HA3  . GLY A 1 69  ? -27.075 -7.816  15.566  1.00 0.00 ? 69  GLY A HA3  5  
ATOM 9503  N N    . PHE A 1 70  ? -26.632 -5.718  14.281  1.00 0.00 ? 70  PHE A N    5  
ATOM 9504  C CA   . PHE A 1 70  ? -26.596 -4.464  13.549  1.00 0.00 ? 70  PHE A CA   5  
ATOM 9505  C C    . PHE A 1 70  ? -25.177 -4.150  13.068  1.00 0.00 ? 70  PHE A C    5  
ATOM 9506  O O    . PHE A 1 70  ? -24.214 -4.765  13.522  1.00 0.00 ? 70  PHE A O    5  
ATOM 9507  C CB   . PHE A 1 70  ? -27.048 -3.368  14.516  1.00 0.00 ? 70  PHE A CB   5  
ATOM 9508  C CG   . PHE A 1 70  ? -28.565 -3.180  14.578  1.00 0.00 ? 70  PHE A CG   5  
ATOM 9509  C CD1  . PHE A 1 70  ? -29.211 -2.530  13.574  1.00 0.00 ? 70  PHE A CD1  5  
ATOM 9510  C CD2  . PHE A 1 70  ? -29.267 -3.663  15.638  1.00 0.00 ? 70  PHE A CD2  5  
ATOM 9511  C CE1  . PHE A 1 70  ? -30.619 -2.355  13.632  1.00 0.00 ? 70  PHE A CE1  5  
ATOM 9512  C CE2  . PHE A 1 70  ? -30.675 -3.488  15.696  1.00 0.00 ? 70  PHE A CE2  5  
ATOM 9513  C CZ   . PHE A 1 70  ? -31.321 -2.838  14.692  1.00 0.00 ? 70  PHE A CZ   5  
ATOM 9514  H H    . PHE A 1 70  ? -26.539 -5.632  15.273  1.00 0.00 ? 70  PHE A H    5  
ATOM 9515  H HA   . PHE A 1 70  ? -27.254 -4.573  12.687  1.00 0.00 ? 70  PHE A HA   5  
ATOM 9516  H HB2  . PHE A 1 70  ? -26.680 -3.605  15.515  1.00 0.00 ? 70  PHE A HB2  5  
ATOM 9517  H HB3  . PHE A 1 70  ? -26.587 -2.425  14.222  1.00 0.00 ? 70  PHE A HB3  5  
ATOM 9518  H HD1  . PHE A 1 70  ? -28.648 -2.143  12.725  1.00 0.00 ? 70  PHE A HD1  5  
ATOM 9519  H HD2  . PHE A 1 70  ? -28.749 -4.184  16.444  1.00 0.00 ? 70  PHE A HD2  5  
ATOM 9520  H HE1  . PHE A 1 70  ? -31.137 -1.834  12.827  1.00 0.00 ? 70  PHE A HE1  5  
ATOM 9521  H HE2  . PHE A 1 70  ? -31.238 -3.875  16.546  1.00 0.00 ? 70  PHE A HE2  5  
ATOM 9522  H HZ   . PHE A 1 70  ? -32.402 -2.704  14.736  1.00 0.00 ? 70  PHE A HZ   5  
ATOM 9523  N N    . TYR A 1 71  ? -25.094 -3.193  12.155  1.00 0.00 ? 71  TYR A N    5  
ATOM 9524  C CA   . TYR A 1 71  ? -23.810 -2.790  11.608  1.00 0.00 ? 71  TYR A CA   5  
ATOM 9525  C C    . TYR A 1 71  ? -23.254 -1.574  12.352  1.00 0.00 ? 71  TYR A C    5  
ATOM 9526  O O    . TYR A 1 71  ? -23.879 -0.515  12.370  1.00 0.00 ? 71  TYR A O    5  
ATOM 9527  C CB   . TYR A 1 71  ? -24.074 -2.405  10.151  1.00 0.00 ? 71  TYR A CB   5  
ATOM 9528  C CG   . TYR A 1 71  ? -24.147 -3.598  9.196   1.00 0.00 ? 71  TYR A CG   5  
ATOM 9529  C CD1  . TYR A 1 71  ? -25.063 -4.606  9.419   1.00 0.00 ? 71  TYR A CD1  5  
ATOM 9530  C CD2  . TYR A 1 71  ? -23.298 -3.665  8.110   1.00 0.00 ? 71  TYR A CD2  5  
ATOM 9531  C CE1  . TYR A 1 71  ? -25.132 -5.729  8.520   1.00 0.00 ? 71  TYR A CE1  5  
ATOM 9532  C CE2  . TYR A 1 71  ? -23.366 -4.788  7.211   1.00 0.00 ? 71  TYR A CE2  5  
ATOM 9533  C CZ   . TYR A 1 71  ? -24.280 -5.764  7.460   1.00 0.00 ? 71  TYR A CZ   5  
ATOM 9534  O OH   . TYR A 1 71  ? -24.345 -6.824  6.611   1.00 0.00 ? 71  TYR A OH   5  
ATOM 9535  H H    . TYR A 1 71  ? -25.883 -2.698  11.791  1.00 0.00 ? 71  TYR A H    5  
ATOM 9536  H HA   . TYR A 1 71  ? -23.119 -3.625  11.724  1.00 0.00 ? 71  TYR A HA   5  
ATOM 9537  H HB2  . TYR A 1 71  ? -25.012 -1.851  10.097  1.00 0.00 ? 71  TYR A HB2  5  
ATOM 9538  H HB3  . TYR A 1 71  ? -23.286 -1.731  9.815   1.00 0.00 ? 71  TYR A HB3  5  
ATOM 9539  H HD1  . TYR A 1 71  ? -25.734 -4.553  10.276  1.00 0.00 ? 71  TYR A HD1  5  
ATOM 9540  H HD2  . TYR A 1 71  ? -22.575 -2.869  7.934   1.00 0.00 ? 71  TYR A HD2  5  
ATOM 9541  H HE1  . TYR A 1 71  ? -25.850 -6.532  8.685   1.00 0.00 ? 71  TYR A HE1  5  
ATOM 9542  H HE2  . TYR A 1 71  ? -22.701 -4.854  6.350   1.00 0.00 ? 71  TYR A HE2  5  
ATOM 9543  H HH   . TYR A 1 71  ? -25.149 -7.381  6.819   1.00 0.00 ? 71  TYR A HH   5  
ATOM 9544  N N    . ASN A 1 72  ? -22.087 -1.767  12.947  1.00 0.00 ? 72  ASN A N    5  
ATOM 9545  C CA   . ASN A 1 72  ? -21.440 -0.700  13.691  1.00 0.00 ? 72  ASN A CA   5  
ATOM 9546  C C    . ASN A 1 72  ? -20.621 0.163   12.728  1.00 0.00 ? 72  ASN A C    5  
ATOM 9547  O O    . ASN A 1 72  ? -19.492 -0.185  12.385  1.00 0.00 ? 72  ASN A O    5  
ATOM 9548  C CB   . ASN A 1 72  ? -20.487 -1.263  14.747  1.00 0.00 ? 72  ASN A CB   5  
ATOM 9549  C CG   . ASN A 1 72  ? -20.725 -0.603  16.107  1.00 0.00 ? 72  ASN A CG   5  
ATOM 9550  O OD1  . ASN A 1 72  ? -21.016 0.577   16.211  1.00 0.00 ? 72  ASN A OD1  5  
ATOM 9551  N ND2  . ASN A 1 72  ? -20.587 -1.429  17.141  1.00 0.00 ? 72  ASN A ND2  5  
ATOM 9552  H H    . ASN A 1 72  ? -21.585 -2.633  12.928  1.00 0.00 ? 72  ASN A H    5  
ATOM 9553  H HA   . ASN A 1 72  ? -22.252 -0.145  14.160  1.00 0.00 ? 72  ASN A HA   5  
ATOM 9554  H HB2  . ASN A 1 72  ? -20.629 -2.340  14.832  1.00 0.00 ? 72  ASN A HB2  5  
ATOM 9555  H HB3  . ASN A 1 72  ? -19.456 -1.100  14.436  1.00 0.00 ? 72  ASN A HB3  5  
ATOM 9556  H HD21 . ASN A 1 72  ? -20.347 -2.387  16.986  1.00 0.00 ? 72  ASN A HD21 5  
ATOM 9557  H HD22 . ASN A 1 72  ? -20.722 -1.091  18.072  1.00 0.00 ? 72  ASN A HD22 5  
ATOM 9558  N N    . ARG A 1 73  ? -21.222 1.270   12.319  1.00 0.00 ? 73  ARG A N    5  
ATOM 9559  C CA   . ARG A 1 73  ? -20.563 2.185   11.403  1.00 0.00 ? 73  ARG A CA   5  
ATOM 9560  C C    . ARG A 1 73  ? -19.509 3.011   12.143  1.00 0.00 ? 73  ARG A C    5  
ATOM 9561  O O    . ARG A 1 73  ? -19.655 3.287   13.333  1.00 0.00 ? 73  ARG A O    5  
ATOM 9562  C CB   . ARG A 1 73  ? -21.572 3.129   10.746  1.00 0.00 ? 73  ARG A CB   5  
ATOM 9563  C CG   . ARG A 1 73  ? -21.469 3.067   9.221   1.00 0.00 ? 73  ARG A CG   5  
ATOM 9564  C CD   . ARG A 1 73  ? -22.297 4.176   8.569   1.00 0.00 ? 73  ARG A CD   5  
ATOM 9565  N NE   . ARG A 1 73  ? -21.407 5.122   7.860   1.00 0.00 ? 73  ARG A NE   5  
ATOM 9566  C CZ   . ARG A 1 73  ? -21.789 6.330   7.425   1.00 0.00 ? 73  ARG A CZ   5  
ATOM 9567  N NH1  . ARG A 1 73  ? -23.047 6.748   7.624   1.00 0.00 ? 73  ARG A NH1  5  
ATOM 9568  N NH2  . ARG A 1 73  ? -20.913 7.122   6.790   1.00 0.00 ? 73  ARG A NH2  5  
ATOM 9569  H H    . ARG A 1 73  ? -22.141 1.545   12.603  1.00 0.00 ? 73  ARG A H    5  
ATOM 9570  H HA   . ARG A 1 73  ? -20.102 1.543   10.652  1.00 0.00 ? 73  ARG A HA   5  
ATOM 9571  H HB2  . ARG A 1 73  ? -22.582 2.862   11.057  1.00 0.00 ? 73  ARG A HB2  5  
ATOM 9572  H HB3  . ARG A 1 73  ? -21.394 4.150   11.084  1.00 0.00 ? 73  ARG A HB3  5  
ATOM 9573  H HG2  . ARG A 1 73  ? -20.426 3.162   8.919   1.00 0.00 ? 73  ARG A HG2  5  
ATOM 9574  H HG3  . ARG A 1 73  ? -21.815 2.095   8.869   1.00 0.00 ? 73  ARG A HG3  5  
ATOM 9575  H HD2  . ARG A 1 73  ? -23.014 3.744   7.871   1.00 0.00 ? 73  ARG A HD2  5  
ATOM 9576  H HD3  . ARG A 1 73  ? -22.872 4.706   9.329   1.00 0.00 ? 73  ARG A HD3  5  
ATOM 9577  H HE   . ARG A 1 73  ? -20.462 4.842   7.694   1.00 0.00 ? 73  ARG A HE   5  
ATOM 9578  H HH11 . ARG A 1 73  ? -23.700 6.157   8.097   1.00 0.00 ? 73  ARG A HH11 5  
ATOM 9579  H HH12 . ARG A 1 73  ? -23.332 7.650   7.299   1.00 0.00 ? 73  ARG A HH12 5  
ATOM 9580  H HH21 . ARG A 1 73  ? -19.975 6.810   6.641   1.00 0.00 ? 73  ARG A HH21 5  
ATOM 9581  H HH22 . ARG A 1 73  ? -21.198 8.024   6.465   1.00 0.00 ? 73  ARG A HH22 5  
ATOM 9582  N N    . SER A 1 74  ? -18.471 3.382   11.409  1.00 0.00 ? 74  SER A N    5  
ATOM 9583  C CA   . SER A 1 74  ? -17.393 4.170   11.981  1.00 0.00 ? 74  SER A CA   5  
ATOM 9584  C C    . SER A 1 74  ? -16.701 4.984   10.886  1.00 0.00 ? 74  SER A C    5  
ATOM 9585  O O    . SER A 1 74  ? -17.005 4.826   9.704   1.00 0.00 ? 74  SER A O    5  
ATOM 9586  C CB   . SER A 1 74  ? -16.379 3.278   12.700  1.00 0.00 ? 74  SER A CB   5  
ATOM 9587  O OG   . SER A 1 74  ? -16.038 2.129   11.929  1.00 0.00 ? 74  SER A OG   5  
ATOM 9588  H H    . SER A 1 74  ? -18.359 3.153   10.442  1.00 0.00 ? 74  SER A H    5  
ATOM 9589  H HA   . SER A 1 74  ? -17.871 4.831   12.704  1.00 0.00 ? 74  SER A HA   5  
ATOM 9590  H HB2  . SER A 1 74  ? -15.477 3.852   12.913  1.00 0.00 ? 74  SER A HB2  5  
ATOM 9591  H HB3  . SER A 1 74  ? -16.789 2.963   13.659  1.00 0.00 ? 74  SER A HB3  5  
ATOM 9592  H HG   . SER A 1 74  ? -16.516 1.325   12.284  1.00 0.00 ? 74  SER A HG   5  
ATOM 9593  N N    . LEU A 1 75  ? -15.784 5.838   11.317  1.00 0.00 ? 75  LEU A N    5  
ATOM 9594  C CA   . LEU A 1 75  ? -15.046 6.677   10.388  1.00 0.00 ? 75  LEU A CA   5  
ATOM 9595  C C    . LEU A 1 75  ? -13.562 6.658   10.758  1.00 0.00 ? 75  LEU A C    5  
ATOM 9596  O O    . LEU A 1 75  ? -13.209 6.411   11.910  1.00 0.00 ? 75  LEU A O    5  
ATOM 9597  C CB   . LEU A 1 75  ? -15.650 8.081   10.339  1.00 0.00 ? 75  LEU A CB   5  
ATOM 9598  C CG   . LEU A 1 75  ? -15.122 9.001   9.236   1.00 0.00 ? 75  LEU A CG   5  
ATOM 9599  C CD1  . LEU A 1 75  ? -15.892 8.791   7.931   1.00 0.00 ? 75  LEU A CD1  5  
ATOM 9600  C CD2  . LEU A 1 75  ? -15.141 10.463  9.685   1.00 0.00 ? 75  LEU A CD2  5  
ATOM 9601  H H    . LEU A 1 75  ? -15.543 5.960   12.280  1.00 0.00 ? 75  LEU A H    5  
ATOM 9602  H HA   . LEU A 1 75  ? -15.160 6.242   9.394   1.00 0.00 ? 75  LEU A HA   5  
ATOM 9603  H HB2  . LEU A 1 75  ? -16.730 7.987   10.220  1.00 0.00 ? 75  LEU A HB2  5  
ATOM 9604  H HB3  . LEU A 1 75  ? -15.477 8.564   11.301  1.00 0.00 ? 75  LEU A HB3  5  
ATOM 9605  H HG   . LEU A 1 75  ? -14.082 8.738   9.041   1.00 0.00 ? 75  LEU A HG   5  
ATOM 9606  H HD11 . LEU A 1 75  ? -15.333 9.230   7.105   1.00 0.00 ? 75  LEU A HD11 5  
ATOM 9607  H HD12 . LEU A 1 75  ? -16.024 7.724   7.754   1.00 0.00 ? 75  LEU A HD12 5  
ATOM 9608  H HD13 . LEU A 1 75  ? -16.868 9.271   8.005   1.00 0.00 ? 75  LEU A HD13 5  
ATOM 9609  H HD21 . LEU A 1 75  ? -14.133 10.874  9.631   1.00 0.00 ? 75  LEU A HD21 5  
ATOM 9610  H HD22 . LEU A 1 75  ? -15.801 11.035  9.033   1.00 0.00 ? 75  LEU A HD22 5  
ATOM 9611  H HD23 . LEU A 1 75  ? -15.504 10.523  10.711  1.00 0.00 ? 75  LEU A HD23 5  
ATOM 9612  N N    . LEU A 1 76  ? -12.732 6.921   9.759   1.00 0.00 ? 76  LEU A N    5  
ATOM 9613  C CA   . LEU A 1 76  ? -11.294 6.938   9.965   1.00 0.00 ? 76  LEU A CA   5  
ATOM 9614  C C    . LEU A 1 76  ? -10.752 8.330   9.634   1.00 0.00 ? 76  LEU A C    5  
ATOM 9615  O O    . LEU A 1 76  ? -11.387 9.090   8.906   1.00 0.00 ? 76  LEU A O    5  
ATOM 9616  C CB   . LEU A 1 76  ? -10.626 5.813   9.172   1.00 0.00 ? 76  LEU A CB   5  
ATOM 9617  C CG   . LEU A 1 76  ? -11.295 4.440   9.262   1.00 0.00 ? 76  LEU A CG   5  
ATOM 9618  C CD1  . LEU A 1 76  ? -10.760 3.497   8.183   1.00 0.00 ? 76  LEU A CD1  5  
ATOM 9619  C CD2  . LEU A 1 76  ? -11.146 3.848   10.665  1.00 0.00 ? 76  LEU A CD2  5  
ATOM 9620  H H    . LEU A 1 76  ? -13.028 7.121   8.825   1.00 0.00 ? 76  LEU A H    5  
ATOM 9621  H HA   . LEU A 1 76  ? -11.113 6.739   11.022  1.00 0.00 ? 76  LEU A HA   5  
ATOM 9622  H HB2  . LEU A 1 76  ? -10.587 6.108   8.124   1.00 0.00 ? 76  LEU A HB2  5  
ATOM 9623  H HB3  . LEU A 1 76  ? -9.596  5.716   9.515   1.00 0.00 ? 76  LEU A HB3  5  
ATOM 9624  H HG   . LEU A 1 76  ? -12.362 4.567   9.079   1.00 0.00 ? 76  LEU A HG   5  
ATOM 9625  H HD11 . LEU A 1 76  ? -9.687  3.361   8.319   1.00 0.00 ? 76  LEU A HD11 5  
ATOM 9626  H HD12 . LEU A 1 76  ? -11.262 2.533   8.261   1.00 0.00 ? 76  LEU A HD12 5  
ATOM 9627  H HD13 . LEU A 1 76  ? -10.950 3.927   7.199   1.00 0.00 ? 76  LEU A HD13 5  
ATOM 9628  H HD21 . LEU A 1 76  ? -10.131 4.019   11.026  1.00 0.00 ? 76  LEU A HD21 5  
ATOM 9629  H HD22 . LEU A 1 76  ? -11.856 4.327   11.339  1.00 0.00 ? 76  LEU A HD22 5  
ATOM 9630  H HD23 . LEU A 1 76  ? -11.343 2.777   10.631  1.00 0.00 ? 76  LEU A HD23 5  
ATOM 9631  N N    . LYS A 1 77  ? -9.583  8.621   10.185  1.00 0.00 ? 77  LYS A N    5  
ATOM 9632  C CA   . LYS A 1 77  ? -8.947  9.908   9.957   1.00 0.00 ? 77  LYS A CA   5  
ATOM 9633  C C    . LYS A 1 77  ? -7.556  9.686   9.360   1.00 0.00 ? 77  LYS A C    5  
ATOM 9634  O O    . LYS A 1 77  ? -7.197  8.562   9.014   1.00 0.00 ? 77  LYS A O    5  
ATOM 9635  C CB   . LYS A 1 77  ? -8.940  10.737  11.243  1.00 0.00 ? 77  LYS A CB   5  
ATOM 9636  C CG   . LYS A 1 77  ? -7.754  10.358  12.133  1.00 0.00 ? 77  LYS A CG   5  
ATOM 9637  C CD   . LYS A 1 77  ? -7.430  11.481  13.121  1.00 0.00 ? 77  LYS A CD   5  
ATOM 9638  C CE   . LYS A 1 77  ? -7.286  12.822  12.399  1.00 0.00 ? 77  LYS A CE   5  
ATOM 9639  N NZ   . LYS A 1 77  ? -8.552  13.586  12.469  1.00 0.00 ? 77  LYS A NZ   5  
ATOM 9640  H H    . LYS A 1 77  ? -9.072  7.996   10.776  1.00 0.00 ? 77  LYS A H    5  
ATOM 9641  H HA   . LYS A 1 77  ? -9.554  10.447  9.230   1.00 0.00 ? 77  LYS A HA   5  
ATOM 9642  H HB2  . LYS A 1 77  ? -8.891  11.797  10.997  1.00 0.00 ? 77  LYS A HB2  5  
ATOM 9643  H HB3  . LYS A 1 77  ? -9.872  10.579  11.787  1.00 0.00 ? 77  LYS A HB3  5  
ATOM 9644  H HG2  . LYS A 1 77  ? -7.982  9.443   12.679  1.00 0.00 ? 77  LYS A HG2  5  
ATOM 9645  H HG3  . LYS A 1 77  ? -6.882  10.151  11.513  1.00 0.00 ? 77  LYS A HG3  5  
ATOM 9646  H HD2  . LYS A 1 77  ? -8.218  11.549  13.870  1.00 0.00 ? 77  LYS A HD2  5  
ATOM 9647  H HD3  . LYS A 1 77  ? -6.506  11.248  13.650  1.00 0.00 ? 77  LYS A HD3  5  
ATOM 9648  H HE2  . LYS A 1 77  ? -6.480  13.400  12.850  1.00 0.00 ? 77  LYS A HE2  5  
ATOM 9649  H HE3  . LYS A 1 77  ? -7.014  12.654  11.357  1.00 0.00 ? 77  LYS A HE3  5  
ATOM 9650  H HZ1  . LYS A 1 77  ? -8.902  13.737  11.545  1.00 0.00 ? 77  LYS A HZ1  5  
ATOM 9651  H HZ2  . LYS A 1 77  ? -9.224  13.070  13.000  1.00 0.00 ? 77  LYS A HZ2  5  
ATOM 9652  H HZ3  . LYS A 1 77  ? -8.384  14.468  12.911  1.00 0.00 ? 77  LYS A HZ3  5  
ATOM 9653  N N    . GLU A 1 78  ? -6.811  10.777  9.258   1.00 0.00 ? 78  GLU A N    5  
ATOM 9654  C CA   . GLU A 1 78  ? -5.467  10.716  8.709   1.00 0.00 ? 78  GLU A CA   5  
ATOM 9655  C C    . GLU A 1 78  ? -4.525  10.010  9.687   1.00 0.00 ? 78  GLU A C    5  
ATOM 9656  O O    . GLU A 1 78  ? -4.372  10.442  10.828  1.00 0.00 ? 78  GLU A O    5  
ATOM 9657  C CB   . GLU A 1 78  ? -4.952  12.115  8.365   1.00 0.00 ? 78  GLU A CB   5  
ATOM 9658  C CG   . GLU A 1 78  ? -5.203  13.091  9.516   1.00 0.00 ? 78  GLU A CG   5  
ATOM 9659  C CD   . GLU A 1 78  ? -4.162  14.212  9.522   1.00 0.00 ? 78  GLU A CD   5  
ATOM 9660  O OE1  . GLU A 1 78  ? -4.261  15.083  8.632   1.00 0.00 ? 78  GLU A OE1  5  
ATOM 9661  O OE2  . GLU A 1 78  ? -3.290  14.171  10.417  1.00 0.00 ? 78  GLU A OE2  5  
ATOM 9662  H H    . GLU A 1 78  ? -7.111  11.688  9.542   1.00 0.00 ? 78  GLU A H    5  
ATOM 9663  H HA   . GLU A 1 78  ? -5.555  10.132  7.793   1.00 0.00 ? 78  GLU A HA   5  
ATOM 9664  H HB2  . GLU A 1 78  ? -3.884  12.070  8.148   1.00 0.00 ? 78  GLU A HB2  5  
ATOM 9665  H HB3  . GLU A 1 78  ? -5.445  12.477  7.463   1.00 0.00 ? 78  GLU A HB3  5  
ATOM 9666  H HG2  . GLU A 1 78  ? -6.202  13.518  9.424   1.00 0.00 ? 78  GLU A HG2  5  
ATOM 9667  H HG3  . GLU A 1 78  ? -5.172  12.555  10.465  1.00 0.00 ? 78  GLU A HG3  5  
ATOM 9668  N N    . GLY A 1 79  ? -3.919  8.936   9.203   1.00 0.00 ? 79  GLY A N    5  
ATOM 9669  C CA   . GLY A 1 79  ? -2.997  8.166   10.021  1.00 0.00 ? 79  GLY A CA   5  
ATOM 9670  C C    . GLY A 1 79  ? -3.419  6.697   10.087  1.00 0.00 ? 79  GLY A C    5  
ATOM 9671  O O    . GLY A 1 79  ? -2.576  5.810   10.214  1.00 0.00 ? 79  GLY A O    5  
ATOM 9672  H H    . GLY A 1 79  ? -4.050  8.591   8.274   1.00 0.00 ? 79  GLY A H    5  
ATOM 9673  H HA2  . GLY A 1 79  ? -1.991  8.240   9.608   1.00 0.00 ? 79  GLY A HA2  5  
ATOM 9674  H HA3  . GLY A 1 79  ? -2.961  8.584   11.027  1.00 0.00 ? 79  GLY A HA3  5  
ATOM 9675  N N    . ASP A 1 80  ? -4.724  6.484   9.999   1.00 0.00 ? 80  ASP A N    5  
ATOM 9676  C CA   . ASP A 1 80  ? -5.268  5.138   10.048  1.00 0.00 ? 80  ASP A CA   5  
ATOM 9677  C C    . ASP A 1 80  ? -5.005  4.437   8.714   1.00 0.00 ? 80  ASP A C    5  
ATOM 9678  O O    . ASP A 1 80  ? -5.115  5.052   7.654   1.00 0.00 ? 80  ASP A O    5  
ATOM 9679  C CB   . ASP A 1 80  ? -6.780  5.163   10.279  1.00 0.00 ? 80  ASP A CB   5  
ATOM 9680  C CG   . ASP A 1 80  ? -7.261  4.377   11.500  1.00 0.00 ? 80  ASP A CG   5  
ATOM 9681  O OD1  . ASP A 1 80  ? -6.860  4.764   12.619  1.00 0.00 ? 80  ASP A OD1  5  
ATOM 9682  O OD2  . ASP A 1 80  ? -8.020  3.406   11.288  1.00 0.00 ? 80  ASP A OD2  5  
ATOM 9683  H H    . ASP A 1 80  ? -5.403  7.211   9.897   1.00 0.00 ? 80  ASP A H    5  
ATOM 9684  H HA   . ASP A 1 80  ? -4.759  4.653   10.881  1.00 0.00 ? 80  ASP A HA   5  
ATOM 9685  H HB2  . ASP A 1 80  ? -7.100  6.200   10.385  1.00 0.00 ? 80  ASP A HB2  5  
ATOM 9686  H HB3  . ASP A 1 80  ? -7.275  4.766   9.393   1.00 0.00 ? 80  ASP A HB3  5  
ATOM 9687  N N    . PHE A 1 81  ? -4.663  3.161   8.809   1.00 0.00 ? 81  PHE A N    5  
ATOM 9688  C CA   . PHE A 1 81  ? -4.383  2.370   7.623   1.00 0.00 ? 81  PHE A CA   5  
ATOM 9689  C C    . PHE A 1 81  ? -5.348  1.188   7.512   1.00 0.00 ? 81  PHE A C    5  
ATOM 9690  O O    . PHE A 1 81  ? -6.278  1.064   8.308   1.00 0.00 ? 81  PHE A O    5  
ATOM 9691  C CB   . PHE A 1 81  ? -2.957  1.837   7.766   1.00 0.00 ? 81  PHE A CB   5  
ATOM 9692  C CG   . PHE A 1 81  ? -2.446  1.807   9.208   1.00 0.00 ? 81  PHE A CG   5  
ATOM 9693  C CD1  . PHE A 1 81  ? -2.789  0.779   10.030  1.00 0.00 ? 81  PHE A CD1  5  
ATOM 9694  C CD2  . PHE A 1 81  ? -1.648  2.808   9.668   1.00 0.00 ? 81  PHE A CD2  5  
ATOM 9695  C CE1  . PHE A 1 81  ? -2.315  0.751   11.368  1.00 0.00 ? 81  PHE A CE1  5  
ATOM 9696  C CE2  . PHE A 1 81  ? -1.174  2.779   11.007  1.00 0.00 ? 81  PHE A CE2  5  
ATOM 9697  C CZ   . PHE A 1 81  ? -1.518  1.751   11.828  1.00 0.00 ? 81  PHE A CZ   5  
ATOM 9698  H H    . PHE A 1 81  ? -4.576  2.669   9.675   1.00 0.00 ? 81  PHE A H    5  
ATOM 9699  H HA   . PHE A 1 81  ? -4.513  3.024   6.760   1.00 0.00 ? 81  PHE A HA   5  
ATOM 9700  H HB2  . PHE A 1 81  ? -2.913  0.829   7.355   1.00 0.00 ? 81  PHE A HB2  5  
ATOM 9701  H HB3  . PHE A 1 81  ? -2.287  2.455   7.167   1.00 0.00 ? 81  PHE A HB3  5  
ATOM 9702  H HD1  . PHE A 1 81  ? -3.429  -0.023  9.661   1.00 0.00 ? 81  PHE A HD1  5  
ATOM 9703  H HD2  . PHE A 1 81  ? -1.373  3.631   9.010   1.00 0.00 ? 81  PHE A HD2  5  
ATOM 9704  H HE1  . PHE A 1 81  ? -2.591  -0.073  12.026  1.00 0.00 ? 81  PHE A HE1  5  
ATOM 9705  H HE2  . PHE A 1 81  ? -0.535  3.581   11.375  1.00 0.00 ? 81  PHE A HE2  5  
ATOM 9706  H HZ   . PHE A 1 81  ? -1.154  1.730   12.855  1.00 0.00 ? 81  PHE A HZ   5  
ATOM 9707  N N    . CYS A 1 82  ? -5.094  0.349   6.519   1.00 0.00 ? 82  CYS A N    5  
ATOM 9708  C CA   . CYS A 1 82  ? -5.928  -0.819  6.294   1.00 0.00 ? 82  CYS A CA   5  
ATOM 9709  C C    . CYS A 1 82  ? -5.015  -2.032  6.103   1.00 0.00 ? 82  CYS A C    5  
ATOM 9710  O O    . CYS A 1 82  ? -3.820  -1.881  5.854   1.00 0.00 ? 82  CYS A O    5  
ATOM 9711  C CB   . CYS A 1 82  ? -6.869  -0.621  5.104   1.00 0.00 ? 82  CYS A CB   5  
ATOM 9712  S SG   . CYS A 1 82  ? -7.883  0.882   5.352   1.00 0.00 ? 82  CYS A SG   5  
ATOM 9713  H H    . CYS A 1 82  ? -4.335  0.457   5.876   1.00 0.00 ? 82  CYS A H    5  
ATOM 9714  H HA   . CYS A 1 82  ? -6.548  -0.937  7.182   1.00 0.00 ? 82  CYS A HA   5  
ATOM 9715  H HB2  . CYS A 1 82  ? -6.292  -0.534  4.184   1.00 0.00 ? 82  CYS A HB2  5  
ATOM 9716  H HB3  . CYS A 1 82  ? -7.516  -1.492  4.993   1.00 0.00 ? 82  CYS A HB3  5  
ATOM 9717  H HG   . CYS A 1 82  ? -7.776  1.329   4.103   1.00 0.00 ? 82  CYS A HG   5  
ATOM 9718  N N    . GLY A 1 83  ? -5.612  -3.208  6.228   1.00 0.00 ? 83  GLY A N    5  
ATOM 9719  C CA   . GLY A 1 83  ? -4.868  -4.446  6.072   1.00 0.00 ? 83  GLY A CA   5  
ATOM 9720  C C    . GLY A 1 83  ? -3.467  -4.323  6.674   1.00 0.00 ? 83  GLY A C    5  
ATOM 9721  O O    . GLY A 1 83  ? -2.496  -4.815  6.102   1.00 0.00 ? 83  GLY A O    5  
ATOM 9722  H H    . GLY A 1 83  ? -6.585  -3.322  6.431   1.00 0.00 ? 83  GLY A H    5  
ATOM 9723  H HA2  . GLY A 1 83  ? -5.406  -5.261  6.557   1.00 0.00 ? 83  GLY A HA2  5  
ATOM 9724  H HA3  . GLY A 1 83  ? -4.792  -4.699  5.015   1.00 0.00 ? 83  GLY A HA3  5  
ATOM 9725  N N    . ASP A 1 84  ? -3.407  -3.663  7.822   1.00 0.00 ? 84  ASP A N    5  
ATOM 9726  C CA   . ASP A 1 84  ? -2.141  -3.469  8.508   1.00 0.00 ? 84  ASP A CA   5  
ATOM 9727  C C    . ASP A 1 84  ? -1.517  -4.832  8.815   1.00 0.00 ? 84  ASP A C    5  
ATOM 9728  O O    . ASP A 1 84  ? -0.307  -5.009  8.685   1.00 0.00 ? 84  ASP A O    5  
ATOM 9729  C CB   . ASP A 1 84  ? -2.340  -2.731  9.833   1.00 0.00 ? 84  ASP A CB   5  
ATOM 9730  C CG   . ASP A 1 84  ? -3.664  -3.022  10.543  1.00 0.00 ? 84  ASP A CG   5  
ATOM 9731  O OD1  . ASP A 1 84  ? -4.701  -2.559  10.021  1.00 0.00 ? 84  ASP A OD1  5  
ATOM 9732  O OD2  . ASP A 1 84  ? -3.608  -3.700  11.591  1.00 0.00 ? 84  ASP A OD2  5  
ATOM 9733  H H    . ASP A 1 84  ? -4.201  -3.266  8.281   1.00 0.00 ? 84  ASP A H    5  
ATOM 9734  H HA   . ASP A 1 84  ? -1.532  -2.877  7.824   1.00 0.00 ? 84  ASP A HA   5  
ATOM 9735  H HB2  . ASP A 1 84  ? -1.521  -2.991  10.503  1.00 0.00 ? 84  ASP A HB2  5  
ATOM 9736  H HB3  . ASP A 1 84  ? -2.272  -1.659  9.648   1.00 0.00 ? 84  ASP A HB3  5  
ATOM 9737  N N    . GLU A 1 85  ? -2.373  -5.761  9.216   1.00 0.00 ? 85  GLU A N    5  
ATOM 9738  C CA   . GLU A 1 85  ? -1.921  -7.103  9.543   1.00 0.00 ? 85  GLU A CA   5  
ATOM 9739  C C    . GLU A 1 85  ? -0.940  -7.606  8.482   1.00 0.00 ? 85  GLU A C    5  
ATOM 9740  O O    . GLU A 1 85  ? -0.099  -8.458  8.764   1.00 0.00 ? 85  GLU A O    5  
ATOM 9741  C CB   . GLU A 1 85  ? -3.106  -8.059  9.691   1.00 0.00 ? 85  GLU A CB   5  
ATOM 9742  C CG   . GLU A 1 85  ? -3.840  -7.823  11.012  1.00 0.00 ? 85  GLU A CG   5  
ATOM 9743  C CD   . GLU A 1 85  ? -2.880  -7.922  12.199  1.00 0.00 ? 85  GLU A CD   5  
ATOM 9744  O OE1  . GLU A 1 85  ? -2.507  -9.067  12.533  1.00 0.00 ? 85  GLU A OE1  5  
ATOM 9745  O OE2  . GLU A 1 85  ? -2.540  -6.850  12.745  1.00 0.00 ? 85  GLU A OE2  5  
ATOM 9746  H H    . GLU A 1 85  ? -3.356  -5.609  9.319   1.00 0.00 ? 85  GLU A H    5  
ATOM 9747  H HA   . GLU A 1 85  ? -1.413  -7.012  10.503  1.00 0.00 ? 85  GLU A HA   5  
ATOM 9748  H HB2  . GLU A 1 85  ? -3.795  -7.922  8.858   1.00 0.00 ? 85  GLU A HB2  5  
ATOM 9749  H HB3  . GLU A 1 85  ? -2.754  -9.090  9.646   1.00 0.00 ? 85  GLU A HB3  5  
ATOM 9750  H HG2  . GLU A 1 85  ? -4.309  -6.839  11.000  1.00 0.00 ? 85  GLU A HG2  5  
ATOM 9751  H HG3  . GLU A 1 85  ? -4.640  -8.555  11.124  1.00 0.00 ? 85  GLU A HG3  5  
ATOM 9752  N N    . LEU A 1 86  ? -1.080  -7.056  7.285   1.00 0.00 ? 86  LEU A N    5  
ATOM 9753  C CA   . LEU A 1 86  ? -0.216  -7.438  6.180   1.00 0.00 ? 86  LEU A CA   5  
ATOM 9754  C C    . LEU A 1 86  ? 1.238   -7.136  6.548   1.00 0.00 ? 86  LEU A C    5  
ATOM 9755  O O    . LEU A 1 86  ? 2.121   -7.967  6.340   1.00 0.00 ? 86  LEU A O    5  
ATOM 9756  C CB   . LEU A 1 86  ? -0.675  -6.767  4.884   1.00 0.00 ? 86  LEU A CB   5  
ATOM 9757  C CG   . LEU A 1 86  ? 0.165   -7.066  3.640   1.00 0.00 ? 86  LEU A CG   5  
ATOM 9758  C CD1  . LEU A 1 86  ? -0.156  -8.455  3.084   1.00 0.00 ? 86  LEU A CD1  5  
ATOM 9759  C CD2  . LEU A 1 86  ? -0.009  -5.971  2.586   1.00 0.00 ? 86  LEU A CD2  5  
ATOM 9760  H H    . LEU A 1 86  ? -1.766  -6.363  7.064   1.00 0.00 ? 86  LEU A H    5  
ATOM 9761  H HA   . LEU A 1 86  ? -0.320  -8.514  6.041   1.00 0.00 ? 86  LEU A HA   5  
ATOM 9762  H HB2  . LEU A 1 86  ? -1.703  -7.070  4.686   1.00 0.00 ? 86  LEU A HB2  5  
ATOM 9763  H HB3  . LEU A 1 86  ? -0.685  -5.688  5.041   1.00 0.00 ? 86  LEU A HB3  5  
ATOM 9764  H HG   . LEU A 1 86  ? 1.216   -7.070  3.930   1.00 0.00 ? 86  LEU A HG   5  
ATOM 9765  H HD11 . LEU A 1 86  ? 0.304   -9.214  3.716   1.00 0.00 ? 86  LEU A HD11 5  
ATOM 9766  H HD12 . LEU A 1 86  ? -1.236  -8.599  3.068   1.00 0.00 ? 86  LEU A HD12 5  
ATOM 9767  H HD13 . LEU A 1 86  ? 0.237   -8.539  2.070   1.00 0.00 ? 86  LEU A HD13 5  
ATOM 9768  H HD21 . LEU A 1 86  ? 0.741   -5.195  2.740   1.00 0.00 ? 86  LEU A HD21 5  
ATOM 9769  H HD22 . LEU A 1 86  ? 0.114   -6.402  1.592   1.00 0.00 ? 86  LEU A HD22 5  
ATOM 9770  H HD23 . LEU A 1 86  ? -1.005  -5.537  2.673   1.00 0.00 ? 86  LEU A HD23 5  
ATOM 9771  N N    . LEU A 1 87  ? 1.443   -5.943  7.088   1.00 0.00 ? 87  LEU A N    5  
ATOM 9772  C CA   . LEU A 1 87  ? 2.775   -5.521  7.486   1.00 0.00 ? 87  LEU A CA   5  
ATOM 9773  C C    . LEU A 1 87  ? 3.425   -6.622  8.327   1.00 0.00 ? 87  LEU A C    5  
ATOM 9774  O O    . LEU A 1 87  ? 4.555   -7.028  8.059   1.00 0.00 ? 87  LEU A O    5  
ATOM 9775  C CB   . LEU A 1 87  ? 2.719   -4.163  8.189   1.00 0.00 ? 87  LEU A CB   5  
ATOM 9776  C CG   . LEU A 1 87  ? 3.584   -3.057  7.582   1.00 0.00 ? 87  LEU A CG   5  
ATOM 9777  C CD1  . LEU A 1 87  ? 3.002   -2.575  6.251   1.00 0.00 ? 87  LEU A CD1  5  
ATOM 9778  C CD2  . LEU A 1 87  ? 3.779   -1.907  8.572   1.00 0.00 ? 87  LEU A CD2  5  
ATOM 9779  H H    . LEU A 1 87  ? 0.720   -5.273  7.254   1.00 0.00 ? 87  LEU A H    5  
ATOM 9780  H HA   . LEU A 1 87  ? 3.362   -5.389  6.577   1.00 0.00 ? 87  LEU A HA   5  
ATOM 9781  H HB2  . LEU A 1 87  ? 1.683   -3.824  8.199   1.00 0.00 ? 87  LEU A HB2  5  
ATOM 9782  H HB3  . LEU A 1 87  ? 3.019   -4.302  9.228   1.00 0.00 ? 87  LEU A HB3  5  
ATOM 9783  H HG   . LEU A 1 87  ? 4.570   -3.471  7.371   1.00 0.00 ? 87  LEU A HG   5  
ATOM 9784  H HD11 . LEU A 1 87  ? 2.902   -1.490  6.270   1.00 0.00 ? 87  LEU A HD11 5  
ATOM 9785  H HD12 . LEU A 1 87  ? 3.668   -2.864  5.438   1.00 0.00 ? 87  LEU A HD12 5  
ATOM 9786  H HD13 . LEU A 1 87  ? 2.023   -3.028  6.098   1.00 0.00 ? 87  LEU A HD13 5  
ATOM 9787  H HD21 . LEU A 1 87  ? 3.648   -2.278  9.589   1.00 0.00 ? 87  LEU A HD21 5  
ATOM 9788  H HD22 . LEU A 1 87  ? 4.783   -1.498  8.460   1.00 0.00 ? 87  LEU A HD22 5  
ATOM 9789  H HD23 . LEU A 1 87  ? 3.044   -1.127  8.372   1.00 0.00 ? 87  LEU A HD23 5  
ATOM 9790  N N    . THR A 1 88  ? 2.682   -7.076  9.326   1.00 0.00 ? 88  THR A N    5  
ATOM 9791  C CA   . THR A 1 88  ? 3.171   -8.122  10.207  1.00 0.00 ? 88  THR A CA   5  
ATOM 9792  C C    . THR A 1 88  ? 3.340   -9.433  9.436   1.00 0.00 ? 88  THR A C    5  
ATOM 9793  O O    . THR A 1 88  ? 4.310   -10.160 9.645   1.00 0.00 ? 88  THR A O    5  
ATOM 9794  C CB   . THR A 1 88  ? 2.208   -8.233  11.390  1.00 0.00 ? 88  THR A CB   5  
ATOM 9795  O OG1  . THR A 1 88  ? 2.898   -7.594  12.461  1.00 0.00 ? 88  THR A OG1  5  
ATOM 9796  C CG2  . THR A 1 88  ? 2.031   -9.675  11.869  1.00 0.00 ? 88  THR A CG2  5  
ATOM 9797  H H    . THR A 1 88  ? 1.764   -6.741  9.537   1.00 0.00 ? 88  THR A H    5  
ATOM 9798  H HA   . THR A 1 88  ? 4.159   -7.834  10.568  1.00 0.00 ? 88  THR A HA   5  
ATOM 9799  H HB   . THR A 1 88  ? 1.245   -7.781  11.152  1.00 0.00 ? 88  THR A HB   5  
ATOM 9800  H HG1  . THR A 1 88  ? 3.370   -8.276  13.019  1.00 0.00 ? 88  THR A HG1  5  
ATOM 9801  H HG21 . THR A 1 88  ? 3.007   -10.104 12.097  1.00 0.00 ? 88  THR A HG21 5  
ATOM 9802  H HG22 . THR A 1 88  ? 1.411   -9.688  12.765  1.00 0.00 ? 88  THR A HG22 5  
ATOM 9803  H HG23 . THR A 1 88  ? 1.551   -10.262 11.086  1.00 0.00 ? 88  THR A HG23 5  
ATOM 9804  N N    . TRP A 1 89  ? 2.381   -9.695  8.561   1.00 0.00 ? 89  TRP A N    5  
ATOM 9805  C CA   . TRP A 1 89  ? 2.411   -10.905 7.758   1.00 0.00 ? 89  TRP A CA   5  
ATOM 9806  C C    . TRP A 1 89  ? 3.783   -10.993 7.085   1.00 0.00 ? 89  TRP A C    5  
ATOM 9807  O O    . TRP A 1 89  ? 4.477   -12.000 7.213   1.00 0.00 ? 89  TRP A O    5  
ATOM 9808  C CB   . TRP A 1 89  ? 1.253   -10.929 6.758   1.00 0.00 ? 89  TRP A CB   5  
ATOM 9809  C CG   . TRP A 1 89  ? 1.399   -11.986 5.661   1.00 0.00 ? 89  TRP A CG   5  
ATOM 9810  C CD1  . TRP A 1 89  ? 0.931   -13.241 5.657   1.00 0.00 ? 89  TRP A CD1  5  
ATOM 9811  C CD2  . TRP A 1 89  ? 2.081   -11.826 4.399   1.00 0.00 ? 89  TRP A CD2  5  
ATOM 9812  N NE1  . TRP A 1 89  ? 1.261   -13.900 4.490   1.00 0.00 ? 89  TRP A NE1  5  
ATOM 9813  C CE2  . TRP A 1 89  ? 1.982   -13.012 3.701   1.00 0.00 ? 89  TRP A CE2  5  
ATOM 9814  C CE3  . TRP A 1 89  ? 2.759   -10.716 3.866   1.00 0.00 ? 89  TRP A CE3  5  
ATOM 9815  C CZ2  . TRP A 1 89  ? 2.538   -13.202 2.430   1.00 0.00 ? 89  TRP A CZ2  5  
ATOM 9816  C CZ3  . TRP A 1 89  ? 3.309   -10.922 2.595   1.00 0.00 ? 89  TRP A CZ3  5  
ATOM 9817  C CH2  . TRP A 1 89  ? 3.218   -12.110 1.879   1.00 0.00 ? 89  TRP A CH2  5  
ATOM 9818  H H    . TRP A 1 89  ? 1.595   -9.099  8.397   1.00 0.00 ? 89  TRP A H    5  
ATOM 9819  H HA   . TRP A 1 89  ? 2.270   -11.754 8.428   1.00 0.00 ? 89  TRP A HA   5  
ATOM 9820  H HB2  . TRP A 1 89  ? 0.323   -11.108 7.299   1.00 0.00 ? 89  TRP A HB2  5  
ATOM 9821  H HB3  . TRP A 1 89  ? 1.167   -9.947  6.294   1.00 0.00 ? 89  TRP A HB3  5  
ATOM 9822  H HD1  . TRP A 1 89  ? 0.362   -13.687 6.473   1.00 0.00 ? 89  TRP A HD1  5  
ATOM 9823  H HE1  . TRP A 1 89  ? 1.003   -14.928 4.234   1.00 0.00 ? 89  TRP A HE1  5  
ATOM 9824  H HE3  . TRP A 1 89  ? 2.851   -9.769  4.397   1.00 0.00 ? 89  TRP A HE3  5  
ATOM 9825  H HZ2  . TRP A 1 89  ? 2.446   -14.149 1.899   1.00 0.00 ? 89  TRP A HZ2  5  
ATOM 9826  H HZ3  . TRP A 1 89  ? 3.846   -10.093 2.135   1.00 0.00 ? 89  TRP A HZ3  5  
ATOM 9827  H HH2  . TRP A 1 89  ? 3.675   -12.190 0.892   1.00 0.00 ? 89  TRP A HH2  5  
ATOM 9828  N N    . ALA A 1 90  ? 4.131   -9.924  6.384   1.00 0.00 ? 90  ALA A N    5  
ATOM 9829  C CA   . ALA A 1 90  ? 5.407   -9.867  5.691   1.00 0.00 ? 90  ALA A CA   5  
ATOM 9830  C C    . ALA A 1 90  ? 6.542   -9.899  6.718   1.00 0.00 ? 90  ALA A C    5  
ATOM 9831  O O    . ALA A 1 90  ? 7.618   -10.426 6.442   1.00 0.00 ? 90  ALA A O    5  
ATOM 9832  C CB   . ALA A 1 90  ? 5.454   -8.618  4.809   1.00 0.00 ? 90  ALA A CB   5  
ATOM 9833  H H    . ALA A 1 90  ? 3.560   -9.109  6.285   1.00 0.00 ? 90  ALA A H    5  
ATOM 9834  H HA   . ALA A 1 90  ? 5.479   -10.750 5.055   1.00 0.00 ? 90  ALA A HA   5  
ATOM 9835  H HB1  . ALA A 1 90  ? 5.977   -7.820  5.336   1.00 0.00 ? 90  ALA A HB1  5  
ATOM 9836  H HB2  . ALA A 1 90  ? 5.982   -8.848  3.883   1.00 0.00 ? 90  ALA A HB2  5  
ATOM 9837  H HB3  . ALA A 1 90  ? 4.438   -8.298  4.579   1.00 0.00 ? 90  ALA A HB3  5  
ATOM 9838  N N    . LEU A 1 91  ? 6.261   -9.328  7.880   1.00 0.00 ? 91  LEU A N    5  
ATOM 9839  C CA   . LEU A 1 91  ? 7.245   -9.285  8.949   1.00 0.00 ? 91  LEU A CA   5  
ATOM 9840  C C    . LEU A 1 91  ? 7.238   -10.620 9.697   1.00 0.00 ? 91  LEU A C    5  
ATOM 9841  O O    . LEU A 1 91  ? 7.953   -10.785 10.684  1.00 0.00 ? 91  LEU A O    5  
ATOM 9842  C CB   . LEU A 1 91  ? 7.002   -8.073  9.851   1.00 0.00 ? 91  LEU A CB   5  
ATOM 9843  C CG   . LEU A 1 91  ? 7.929   -6.876  9.630   1.00 0.00 ? 91  LEU A CG   5  
ATOM 9844  C CD1  . LEU A 1 91  ? 8.359   -6.779  8.165   1.00 0.00 ? 91  LEU A CD1  5  
ATOM 9845  C CD2  . LEU A 1 91  ? 7.280   -5.582  10.124  1.00 0.00 ? 91  LEU A CD2  5  
ATOM 9846  H H    . LEU A 1 91  ? 5.383   -8.902  8.096   1.00 0.00 ? 91  LEU A H    5  
ATOM 9847  H HA   . LEU A 1 91  ? 8.223   -9.152  8.487   1.00 0.00 ? 91  LEU A HA   5  
ATOM 9848  H HB2  . LEU A 1 91  ? 5.973   -7.742  9.711   1.00 0.00 ? 91  LEU A HB2  5  
ATOM 9849  H HB3  . LEU A 1 91  ? 7.096   -8.393  10.889  1.00 0.00 ? 91  LEU A HB3  5  
ATOM 9850  H HG   . LEU A 1 91  ? 8.832   -7.029  10.221  1.00 0.00 ? 91  LEU A HG   5  
ATOM 9851  H HD11 . LEU A 1 91  ? 8.585   -5.741  7.921   1.00 0.00 ? 91  LEU A HD11 5  
ATOM 9852  H HD12 . LEU A 1 91  ? 9.246   -7.392  8.005   1.00 0.00 ? 91  LEU A HD12 5  
ATOM 9853  H HD13 . LEU A 1 91  ? 7.551   -7.134  7.525   1.00 0.00 ? 91  LEU A HD13 5  
ATOM 9854  H HD21 . LEU A 1 91  ? 7.418   -5.494  11.202  1.00 0.00 ? 91  LEU A HD21 5  
ATOM 9855  H HD22 . LEU A 1 91  ? 7.744   -4.730  9.627   1.00 0.00 ? 91  LEU A HD22 5  
ATOM 9856  H HD23 . LEU A 1 91  ? 6.214   -5.599  9.895   1.00 0.00 ? 91  LEU A HD23 5  
ATOM 9857  N N    . ASP A 1 92  ? 6.423   -11.537 9.197   1.00 0.00 ? 92  ASP A N    5  
ATOM 9858  C CA   . ASP A 1 92  ? 6.314   -12.852 9.806   1.00 0.00 ? 92  ASP A CA   5  
ATOM 9859  C C    . ASP A 1 92  ? 6.368   -13.921 8.713   1.00 0.00 ? 92  ASP A C    5  
ATOM 9860  O O    . ASP A 1 92  ? 5.356   -14.217 8.079   1.00 0.00 ? 92  ASP A O    5  
ATOM 9861  C CB   . ASP A 1 92  ? 4.988   -13.005 10.553  1.00 0.00 ? 92  ASP A CB   5  
ATOM 9862  C CG   . ASP A 1 92  ? 5.035   -13.928 11.772  1.00 0.00 ? 92  ASP A CG   5  
ATOM 9863  O OD1  . ASP A 1 92  ? 5.198   -15.148 11.555  1.00 0.00 ? 92  ASP A OD1  5  
ATOM 9864  O OD2  . ASP A 1 92  ? 4.907   -13.393 12.894  1.00 0.00 ? 92  ASP A OD2  5  
ATOM 9865  H H    . ASP A 1 92  ? 5.845   -11.394 8.394   1.00 0.00 ? 92  ASP A H    5  
ATOM 9866  H HA   . ASP A 1 92  ? 7.155   -12.919 10.496  1.00 0.00 ? 92  ASP A HA   5  
ATOM 9867  H HB2  . ASP A 1 92  ? 4.654   -12.019 10.875  1.00 0.00 ? 92  ASP A HB2  5  
ATOM 9868  H HB3  . ASP A 1 92  ? 4.238   -13.384 9.858   1.00 0.00 ? 92  ASP A HB3  5  
ATOM 9869  N N    . PRO A 1 93  ? 7.590   -14.486 8.520   1.00 0.00 ? 93  PRO A N    5  
ATOM 9870  C CA   . PRO A 1 93  ? 7.788   -15.516 7.515   1.00 0.00 ? 93  PRO A CA   5  
ATOM 9871  C C    . PRO A 1 93  ? 7.205   -16.853 7.977   1.00 0.00 ? 93  PRO A C    5  
ATOM 9872  O O    . PRO A 1 93  ? 6.808   -17.678 7.155   1.00 0.00 ? 93  PRO A O    5  
ATOM 9873  C CB   . PRO A 1 93  ? 9.291   -15.568 7.296   1.00 0.00 ? 93  PRO A CB   5  
ATOM 9874  C CG   . PRO A 1 93  ? 9.913   -14.901 8.513   1.00 0.00 ? 93  PRO A CG   5  
ATOM 9875  C CD   . PRO A 1 93  ? 8.810   -14.160 9.252   1.00 0.00 ? 93  PRO A CD   5  
ATOM 9876  H HA   . PRO A 1 93  ? 7.299   -15.280 6.675   1.00 0.00 ? 93  PRO A HA   5  
ATOM 9877  H HB2  . PRO A 1 93  ? 9.636   -16.597 7.197   1.00 0.00 ? 93  PRO A HB2  5  
ATOM 9878  H HB3  . PRO A 1 93  ? 9.571   -15.048 6.380   1.00 0.00 ? 93  PRO A HB3  5  
ATOM 9879  H HG2  . PRO A 1 93  ? 10.375  -15.644 9.161   1.00 0.00 ? 93  PRO A HG2  5  
ATOM 9880  H HG3  . PRO A 1 93  ? 10.699  -14.210 8.209   1.00 0.00 ? 93  PRO A HG3  5  
ATOM 9881  H HD2  . PRO A 1 93  ? 8.746   -14.482 10.292  1.00 0.00 ? 93  PRO A HD2  5  
ATOM 9882  H HD3  . PRO A 1 93  ? 8.992   -13.086 9.261   1.00 0.00 ? 93  PRO A HD3  5  
ATOM 9883  N N    . LYS A 1 94  ? 7.171   -17.025 9.290   1.00 0.00 ? 94  LYS A N    5  
ATOM 9884  C CA   . LYS A 1 94  ? 6.642   -18.248 9.871   1.00 0.00 ? 94  LYS A CA   5  
ATOM 9885  C C    . LYS A 1 94  ? 5.164   -18.386 9.500   1.00 0.00 ? 94  LYS A C    5  
ATOM 9886  O O    . LYS A 1 94  ? 4.653   -19.499 9.378   1.00 0.00 ? 94  LYS A O    5  
ATOM 9887  C CB   . LYS A 1 94  ? 6.903   -18.281 11.378  1.00 0.00 ? 94  LYS A CB   5  
ATOM 9888  C CG   . LYS A 1 94  ? 8.389   -18.074 11.682  1.00 0.00 ? 94  LYS A CG   5  
ATOM 9889  C CD   . LYS A 1 94  ? 9.244   -19.133 10.984  1.00 0.00 ? 94  LYS A CD   5  
ATOM 9890  C CE   . LYS A 1 94  ? 10.269  -19.734 11.948  1.00 0.00 ? 94  LYS A CE   5  
ATOM 9891  N NZ   . LYS A 1 94  ? 11.197  -18.689 12.434  1.00 0.00 ? 94  LYS A NZ   5  
ATOM 9892  H H    . LYS A 1 94  ? 7.495   -16.349 9.951   1.00 0.00 ? 94  LYS A H    5  
ATOM 9893  H HA   . LYS A 1 94  ? 7.189   -19.082 9.430   1.00 0.00 ? 94  LYS A HA   5  
ATOM 9894  H HB2  . LYS A 1 94  ? 6.316   -17.506 11.870  1.00 0.00 ? 94  LYS A HB2  5  
ATOM 9895  H HB3  . LYS A 1 94  ? 6.575   -19.237 11.787  1.00 0.00 ? 94  LYS A HB3  5  
ATOM 9896  H HG2  . LYS A 1 94  ? 8.695   -17.081 11.355  1.00 0.00 ? 94  LYS A HG2  5  
ATOM 9897  H HG3  . LYS A 1 94  ? 8.553   -18.121 12.758  1.00 0.00 ? 94  LYS A HG3  5  
ATOM 9898  H HD2  . LYS A 1 94  ? 8.603   -19.923 10.591  1.00 0.00 ? 94  LYS A HD2  5  
ATOM 9899  H HD3  . LYS A 1 94  ? 9.758   -18.687 10.132  1.00 0.00 ? 94  LYS A HD3  5  
ATOM 9900  H HE2  . LYS A 1 94  ? 9.756   -20.194 12.792  1.00 0.00 ? 94  LYS A HE2  5  
ATOM 9901  H HE3  . LYS A 1 94  ? 10.830  -20.523 11.447  1.00 0.00 ? 94  LYS A HE3  5  
ATOM 9902  H HZ1  . LYS A 1 94  ? 11.885  -19.105 13.029  1.00 0.00 ? 94  LYS A HZ1  5  
ATOM 9903  H HZ2  . LYS A 1 94  ? 11.649  -18.256 11.655  1.00 0.00 ? 94  LYS A HZ2  5  
ATOM 9904  H HZ3  . LYS A 1 94  ? 10.685  -18.000 12.948  1.00 0.00 ? 94  LYS A HZ3  5  
ATOM 9905  N N    . SER A 1 95  ? 4.520   -17.241 9.330   1.00 0.00 ? 95  SER A N    5  
ATOM 9906  C CA   . SER A 1 95  ? 3.111   -17.221 8.975   1.00 0.00 ? 95  SER A CA   5  
ATOM 9907  C C    . SER A 1 95  ? 2.928   -17.698 7.533   1.00 0.00 ? 95  SER A C    5  
ATOM 9908  O O    . SER A 1 95  ? 3.902   -17.857 6.799   1.00 0.00 ? 95  SER A O    5  
ATOM 9909  C CB   . SER A 1 95  ? 2.519   -15.822 9.151   1.00 0.00 ? 95  SER A CB   5  
ATOM 9910  O OG   . SER A 1 95  ? 1.468   -15.804 10.113  1.00 0.00 ? 95  SER A OG   5  
ATOM 9911  H H    . SER A 1 95  ? 4.943   -16.341 9.431   1.00 0.00 ? 95  SER A H    5  
ATOM 9912  H HA   . SER A 1 95  ? 2.629   -17.909 9.669   1.00 0.00 ? 95  SER A HA   5  
ATOM 9913  H HB2  . SER A 1 95  ? 3.304   -15.132 9.459   1.00 0.00 ? 95  SER A HB2  5  
ATOM 9914  H HB3  . SER A 1 95  ? 2.140   -15.465 8.193   1.00 0.00 ? 95  SER A HB3  5  
ATOM 9915  H HG   . SER A 1 95  ? 1.163   -14.864 10.269  1.00 0.00 ? 95  SER A HG   5  
ATOM 9916  N N    . GLY A 1 96  ? 1.672   -17.912 7.169   1.00 0.00 ? 96  GLY A N    5  
ATOM 9917  C CA   . GLY A 1 96  ? 1.349   -18.367 5.827   1.00 0.00 ? 96  GLY A CA   5  
ATOM 9918  C C    . GLY A 1 96  ? -0.162  -18.532 5.654   1.00 0.00 ? 96  GLY A C    5  
ATOM 9919  O O    . GLY A 1 96  ? -0.911  -17.560 5.739   1.00 0.00 ? 96  GLY A O    5  
ATOM 9920  H H    . GLY A 1 96  ? 0.885   -17.780 7.771   1.00 0.00 ? 96  GLY A H    5  
ATOM 9921  H HA2  . GLY A 1 96  ? 1.726   -17.652 5.096   1.00 0.00 ? 96  GLY A HA2  5  
ATOM 9922  H HA3  . GLY A 1 96  ? 1.847   -19.316 5.631   1.00 0.00 ? 96  GLY A HA3  5  
ATOM 9923  N N    . SER A 1 97  ? -0.566  -19.771 5.413   1.00 0.00 ? 97  SER A N    5  
ATOM 9924  C CA   . SER A 1 97  ? -1.974  -20.077 5.227   1.00 0.00 ? 97  SER A CA   5  
ATOM 9925  C C    . SER A 1 97  ? -2.612  -19.053 4.285   1.00 0.00 ? 97  SER A C    5  
ATOM 9926  O O    . SER A 1 97  ? -3.697  -18.544 4.559   1.00 0.00 ? 97  SER A O    5  
ATOM 9927  C CB   . SER A 1 97  ? -2.715  -20.100 6.565   1.00 0.00 ? 97  SER A CB   5  
ATOM 9928  O OG   . SER A 1 97  ? -2.702  -21.394 7.160   1.00 0.00 ? 97  SER A OG   5  
ATOM 9929  H H    . SER A 1 97  ? 0.049   -20.556 5.345   1.00 0.00 ? 97  SER A H    5  
ATOM 9930  H HA   . SER A 1 97  ? -1.998  -21.071 4.782   1.00 0.00 ? 97  SER A HA   5  
ATOM 9931  H HB2  . SER A 1 97  ? -2.255  -19.383 7.246   1.00 0.00 ? 97  SER A HB2  5  
ATOM 9932  H HB3  . SER A 1 97  ? -3.746  -19.780 6.415   1.00 0.00 ? 97  SER A HB3  5  
ATOM 9933  H HG   . SER A 1 97  ? -2.369  -22.070 6.503   1.00 0.00 ? 97  SER A HG   5  
ATOM 9934  N N    . ASN A 1 98  ? -1.910  -18.781 3.195   1.00 0.00 ? 98  ASN A N    5  
ATOM 9935  C CA   . ASN A 1 98  ? -2.393  -17.827 2.211   1.00 0.00 ? 98  ASN A CA   5  
ATOM 9936  C C    . ASN A 1 98  ? -2.280  -16.412 2.781   1.00 0.00 ? 98  ASN A C    5  
ATOM 9937  O O    . ASN A 1 98  ? -1.911  -16.234 3.941   1.00 0.00 ? 98  ASN A O    5  
ATOM 9938  C CB   . ASN A 1 98  ? -3.863  -18.084 1.872   1.00 0.00 ? 98  ASN A CB   5  
ATOM 9939  C CG   . ASN A 1 98  ? -4.075  -18.136 0.357   1.00 0.00 ? 98  ASN A CG   5  
ATOM 9940  O OD1  . ASN A 1 98  ? -3.217  -18.557 -0.401  1.00 0.00 ? 98  ASN A OD1  5  
ATOM 9941  N ND2  . ASN A 1 98  ? -5.262  -17.685 -0.039  1.00 0.00 ? 98  ASN A ND2  5  
ATOM 9942  H H    . ASN A 1 98  ? -1.027  -19.200 2.979   1.00 0.00 ? 98  ASN A H    5  
ATOM 9943  H HA   . ASN A 1 98  ? -1.763  -17.976 1.335   1.00 0.00 ? 98  ASN A HA   5  
ATOM 9944  H HB2  . ASN A 1 98  ? -4.185  -19.024 2.320   1.00 0.00 ? 98  ASN A HB2  5  
ATOM 9945  H HB3  . ASN A 1 98  ? -4.482  -17.297 2.302   1.00 0.00 ? 98  ASN A HB3  5  
ATOM 9946  H HD21 . ASN A 1 98  ? -5.921  -17.353 0.636   1.00 0.00 ? 98  ASN A HD21 5  
ATOM 9947  H HD22 . ASN A 1 98  ? -5.495  -17.679 -1.011  1.00 0.00 ? 98  ASN A HD22 5  
ATOM 9948  N N    . LEU A 1 99  ? -2.603  -15.442 1.939   1.00 0.00 ? 99  LEU A N    5  
ATOM 9949  C CA   . LEU A 1 99  ? -2.542  -14.048 2.344   1.00 0.00 ? 99  LEU A CA   5  
ATOM 9950  C C    . LEU A 1 99  ? -3.410  -13.844 3.588   1.00 0.00 ? 99  LEU A C    5  
ATOM 9951  O O    . LEU A 1 99  ? -4.328  -14.623 3.843   1.00 0.00 ? 99  LEU A O    5  
ATOM 9952  C CB   . LEU A 1 99  ? -2.917  -13.133 1.177   1.00 0.00 ? 99  LEU A CB   5  
ATOM 9953  C CG   . LEU A 1 99  ? -2.140  -13.352 -0.123  1.00 0.00 ? 99  LEU A CG   5  
ATOM 9954  C CD1  . LEU A 1 99  ? -2.970  -12.929 -1.336  1.00 0.00 ? 99  LEU A CD1  5  
ATOM 9955  C CD2  . LEU A 1 99  ? -0.786  -12.641 -0.079  1.00 0.00 ? 99  LEU A CD2  5  
ATOM 9956  H H    . LEU A 1 99  ? -2.902  -15.595 0.997   1.00 0.00 ? 99  LEU A H    5  
ATOM 9957  H HA   . LEU A 1 99  ? -1.507  -13.829 2.606   1.00 0.00 ? 99  LEU A HA   5  
ATOM 9958  H HB2  . LEU A 1 99  ? -3.979  -13.261 0.967   1.00 0.00 ? 99  LEU A HB2  5  
ATOM 9959  H HB3  . LEU A 1 99  ? -2.776  -12.099 1.491   1.00 0.00 ? 99  LEU A HB3  5  
ATOM 9960  H HG   . LEU A 1 99  ? -1.940  -14.419 -0.226  1.00 0.00 ? 99  LEU A HG   5  
ATOM 9961  H HD11 . LEU A 1 99  ? -4.027  -13.088 -1.127  1.00 0.00 ? 99  LEU A HD11 5  
ATOM 9962  H HD12 . LEU A 1 99  ? -2.796  -11.873 -1.545  1.00 0.00 ? 99  LEU A HD12 5  
ATOM 9963  H HD13 . LEU A 1 99  ? -2.677  -13.523 -2.202  1.00 0.00 ? 99  LEU A HD13 5  
ATOM 9964  H HD21 . LEU A 1 99  ? -0.225  -12.982 0.792   1.00 0.00 ? 99  LEU A HD21 5  
ATOM 9965  H HD22 . LEU A 1 99  ? -0.225  -12.871 -0.985  1.00 0.00 ? 99  LEU A HD22 5  
ATOM 9966  H HD23 . LEU A 1 99  ? -0.942  -11.565 -0.011  1.00 0.00 ? 99  LEU A HD23 5  
ATOM 9967  N N    . PRO A 1 100 ? -3.081  -12.766 4.348   1.00 0.00 ? 100 PRO A N    5  
ATOM 9968  C CA   . PRO A 1 100 ? -3.820  -12.450 5.559   1.00 0.00 ? 100 PRO A CA   5  
ATOM 9969  C C    . PRO A 1 100 ? -5.184  -11.842 5.226   1.00 0.00 ? 100 PRO A C    5  
ATOM 9970  O O    . PRO A 1 100 ? -5.414  -11.403 4.100   1.00 0.00 ? 100 PRO A O    5  
ATOM 9971  C CB   . PRO A 1 100 ? -2.920  -11.501 6.333   1.00 0.00 ? 100 PRO A CB   5  
ATOM 9972  C CG   . PRO A 1 100 ? -1.923  -10.956 5.323   1.00 0.00 ? 100 PRO A CG   5  
ATOM 9973  C CD   . PRO A 1 100 ? -2.001  -11.822 4.077   1.00 0.00 ? 100 PRO A CD   5  
ATOM 9974  H HA   . PRO A 1 100 ? -4.011  -13.284 6.076   1.00 0.00 ? 100 PRO A HA   5  
ATOM 9975  H HB2  . PRO A 1 100 ? -3.499  -10.695 6.784   1.00 0.00 ? 100 PRO A HB2  5  
ATOM 9976  H HB3  . PRO A 1 100 ? -2.410  -12.020 7.144   1.00 0.00 ? 100 PRO A HB3  5  
ATOM 9977  H HG2  . PRO A 1 100 ? -2.152  -9.918  5.082   1.00 0.00 ? 100 PRO A HG2  5  
ATOM 9978  H HG3  . PRO A 1 100 ? -0.914  -10.971 5.737   1.00 0.00 ? 100 PRO A HG3  5  
ATOM 9979  H HD2  . PRO A 1 100 ? -2.212  -11.223 3.191   1.00 0.00 ? 100 PRO A HD2  5  
ATOM 9980  H HD3  . PRO A 1 100 ? -1.059  -12.340 3.895   1.00 0.00 ? 100 PRO A HD3  5  
ATOM 9981  N N    . SER A 1 101 ? -6.054  -11.836 6.225   1.00 0.00 ? 101 SER A N    5  
ATOM 9982  C CA   . SER A 1 101 ? -7.389  -11.290 6.053   1.00 0.00 ? 101 SER A CA   5  
ATOM 9983  C C    . SER A 1 101 ? -7.614  -10.138 7.034   1.00 0.00 ? 101 SER A C    5  
ATOM 9984  O O    . SER A 1 101 ? -7.349  -10.274 8.228   1.00 0.00 ? 101 SER A O    5  
ATOM 9985  C CB   . SER A 1 101 ? -8.455  -12.369 6.248   1.00 0.00 ? 101 SER A CB   5  
ATOM 9986  O OG   . SER A 1 101 ? -8.101  -13.592 5.607   1.00 0.00 ? 101 SER A OG   5  
ATOM 9987  H H    . SER A 1 101 ? -5.859  -12.195 7.138   1.00 0.00 ? 101 SER A H    5  
ATOM 9988  H HA   . SER A 1 101 ? -7.422  -10.929 5.025   1.00 0.00 ? 101 SER A HA   5  
ATOM 9989  H HB2  . SER A 1 101 ? -8.600  -12.547 7.313   1.00 0.00 ? 101 SER A HB2  5  
ATOM 9990  H HB3  . SER A 1 101 ? -9.407  -12.015 5.851   1.00 0.00 ? 101 SER A HB3  5  
ATOM 9991  H HG   . SER A 1 101 ? -8.601  -14.352 6.021   1.00 0.00 ? 101 SER A HG   5  
ATOM 9992  N N    . SER A 1 102 ? -8.100  -9.030  6.495   1.00 0.00 ? 102 SER A N    5  
ATOM 9993  C CA   . SER A 1 102 ? -8.363  -7.855  7.309   1.00 0.00 ? 102 SER A CA   5  
ATOM 9994  C C    . SER A 1 102 ? -9.491  -8.147  8.300   1.00 0.00 ? 102 SER A C    5  
ATOM 9995  O O    . SER A 1 102 ? -10.273 -9.076  8.100   1.00 0.00 ? 102 SER A O    5  
ATOM 9996  C CB   . SER A 1 102 ? -8.722  -6.650  6.436   1.00 0.00 ? 102 SER A CB   5  
ATOM 9997  O OG   . SER A 1 102 ? -8.565  -5.419  7.136   1.00 0.00 ? 102 SER A OG   5  
ATOM 9998  H H    . SER A 1 102 ? -8.312  -8.927  5.523   1.00 0.00 ? 102 SER A H    5  
ATOM 9999  H HA   . SER A 1 102 ? -7.431  -7.655  7.837   1.00 0.00 ? 102 SER A HA   5  
ATOM 10000 H HB2  . SER A 1 102 ? -8.090  -6.645  5.548   1.00 0.00 ? 102 SER A HB2  5  
ATOM 10001 H HB3  . SER A 1 102 ? -9.753  -6.744  6.094   1.00 0.00 ? 102 SER A HB3  5  
ATOM 10002 H HG   . SER A 1 102 ? -9.404  -4.878  7.068   1.00 0.00 ? 102 SER A HG   5  
ATOM 10003 N N    . THR A 1 103 ? -9.540  -7.337  9.347   1.00 0.00 ? 103 THR A N    5  
ATOM 10004 C CA   . THR A 1 103 ? -10.560 -7.497  10.370  1.00 0.00 ? 103 THR A CA   5  
ATOM 10005 C C    . THR A 1 103 ? -11.470 -6.269  10.412  1.00 0.00 ? 103 THR A C    5  
ATOM 10006 O O    . THR A 1 103 ? -11.977 -5.903  11.472  1.00 0.00 ? 103 THR A O    5  
ATOM 10007 C CB   . THR A 1 103 ? -9.856  -7.778  11.699  1.00 0.00 ? 103 THR A CB   5  
ATOM 10008 O OG1  . THR A 1 103 ? -9.214  -6.547  12.019  1.00 0.00 ? 103 THR A OG1  5  
ATOM 10009 C CG2  . THR A 1 103 ? -8.703  -8.773  11.552  1.00 0.00 ? 103 THR A CG2  5  
ATOM 10010 H H    . THR A 1 103 ? -8.901  -6.584  9.502   1.00 0.00 ? 103 THR A H    5  
ATOM 10011 H HA   . THR A 1 103 ? -11.185 -8.349  10.102  1.00 0.00 ? 103 THR A HA   5  
ATOM 10012 H HB   . THR A 1 103 ? -10.568 -8.116  12.453  1.00 0.00 ? 103 THR A HB   5  
ATOM 10013 H HG1  . THR A 1 103 ? -8.811  -6.599  12.933  1.00 0.00 ? 103 THR A HG1  5  
ATOM 10014 H HG21 . THR A 1 103 ? -8.585  -9.333  12.480  1.00 0.00 ? 103 THR A HG21 5  
ATOM 10015 H HG22 . THR A 1 103 ? -8.919  -9.462  10.737  1.00 0.00 ? 103 THR A HG22 5  
ATOM 10016 H HG23 . THR A 1 103 ? -7.782  -8.231  11.336  1.00 0.00 ? 103 THR A HG23 5  
ATOM 10017 N N    . ARG A 1 104 ? -11.650 -5.665  9.247   1.00 0.00 ? 104 ARG A N    5  
ATOM 10018 C CA   . ARG A 1 104 ? -12.491 -4.485  9.138   1.00 0.00 ? 104 ARG A CA   5  
ATOM 10019 C C    . ARG A 1 104 ? -12.753 -4.154  7.667   1.00 0.00 ? 104 ARG A C    5  
ATOM 10020 O O    . ARG A 1 104 ? -11.937 -4.468  6.802   1.00 0.00 ? 104 ARG A O    5  
ATOM 10021 C CB   . ARG A 1 104 ? -11.838 -3.279  9.816   1.00 0.00 ? 104 ARG A CB   5  
ATOM 10022 C CG   . ARG A 1 104 ? -10.647 -2.769  9.002   1.00 0.00 ? 104 ARG A CG   5  
ATOM 10023 C CD   . ARG A 1 104 ? -10.809 -1.286  8.662   1.00 0.00 ? 104 ARG A CD   5  
ATOM 10024 N NE   . ARG A 1 104 ? -9.875  -0.476  9.476   1.00 0.00 ? 104 ARG A NE   5  
ATOM 10025 C CZ   . ARG A 1 104 ? -10.153 -0.016  10.703  1.00 0.00 ? 104 ARG A CZ   5  
ATOM 10026 N NH1  . ARG A 1 104 ? -11.340 -0.283  11.266  1.00 0.00 ? 104 ARG A NH1  5  
ATOM 10027 N NH2  . ARG A 1 104 ? -9.245  0.712   11.368  1.00 0.00 ? 104 ARG A NH2  5  
ATOM 10028 H H    . ARG A 1 104 ? -11.234 -5.968  8.390   1.00 0.00 ? 104 ARG A H    5  
ATOM 10029 H HA   . ARG A 1 104 ? -13.415 -4.752  9.650   1.00 0.00 ? 104 ARG A HA   5  
ATOM 10030 H HB2  . ARG A 1 104 ? -12.572 -2.481  9.932   1.00 0.00 ? 104 ARG A HB2  5  
ATOM 10031 H HB3  . ARG A 1 104 ? -11.507 -3.555  10.817  1.00 0.00 ? 104 ARG A HB3  5  
ATOM 10032 H HG2  . ARG A 1 104 ? -9.726  -2.919  9.565   1.00 0.00 ? 104 ARG A HG2  5  
ATOM 10033 H HG3  . ARG A 1 104 ? -10.557 -3.348  8.083   1.00 0.00 ? 104 ARG A HG3  5  
ATOM 10034 H HD2  . ARG A 1 104 ? -10.616 -1.124  7.602   1.00 0.00 ? 104 ARG A HD2  5  
ATOM 10035 H HD3  . ARG A 1 104 ? -11.836 -0.971  8.851   1.00 0.00 ? 104 ARG A HD3  5  
ATOM 10036 H HE   . ARG A 1 104 ? -8.981  -0.258  9.085   1.00 0.00 ? 104 ARG A HE   5  
ATOM 10037 H HH11 . ARG A 1 104 ? -12.018 -0.826  10.770  1.00 0.00 ? 104 ARG A HH11 5  
ATOM 10038 H HH12 . ARG A 1 104 ? -11.547 0.061   12.182  1.00 0.00 ? 104 ARG A HH12 5  
ATOM 10039 H HH21 . ARG A 1 104 ? -8.360  0.911   10.948  1.00 0.00 ? 104 ARG A HH21 5  
ATOM 10040 H HH22 . ARG A 1 104 ? -9.452  1.055   12.284  1.00 0.00 ? 104 ARG A HH22 5  
ATOM 10041 N N    . THR A 1 105 ? -13.894 -3.525  7.429   1.00 0.00 ? 105 THR A N    5  
ATOM 10042 C CA   . THR A 1 105 ? -14.274 -3.148  6.078   1.00 0.00 ? 105 THR A CA   5  
ATOM 10043 C C    . THR A 1 105 ? -14.188 -1.630  5.903   1.00 0.00 ? 105 THR A C    5  
ATOM 10044 O O    . THR A 1 105 ? -14.319 -0.882  6.871   1.00 0.00 ? 105 THR A O    5  
ATOM 10045 C CB   . THR A 1 105 ? -15.669 -3.713  5.804   1.00 0.00 ? 105 THR A CB   5  
ATOM 10046 O OG1  . THR A 1 105 ? -15.509 -5.121  5.956   1.00 0.00 ? 105 THR A OG1  5  
ATOM 10047 C CG2  . THR A 1 105 ? -16.093 -3.543  4.343   1.00 0.00 ? 105 THR A CG2  5  
ATOM 10048 H H    . THR A 1 105 ? -14.553 -3.273  8.138   1.00 0.00 ? 105 THR A H    5  
ATOM 10049 H HA   . THR A 1 105 ? -13.559 -3.590  5.384   1.00 0.00 ? 105 THR A HA   5  
ATOM 10050 H HB   . THR A 1 105 ? -16.405 -3.275  6.477   1.00 0.00 ? 105 THR A HB   5  
ATOM 10051 H HG1  . THR A 1 105 ? -15.559 -5.368  6.924   1.00 0.00 ? 105 THR A HG1  5  
ATOM 10052 H HG21 . THR A 1 105 ? -15.374 -4.044  3.695   1.00 0.00 ? 105 THR A HG21 5  
ATOM 10053 H HG22 . THR A 1 105 ? -17.080 -3.981  4.198   1.00 0.00 ? 105 THR A HG22 5  
ATOM 10054 H HG23 . THR A 1 105 ? -16.127 -2.482  4.096   1.00 0.00 ? 105 THR A HG23 5  
ATOM 10055 N N    . VAL A 1 106 ? -13.968 -1.221  4.662   1.00 0.00 ? 106 VAL A N    5  
ATOM 10056 C CA   . VAL A 1 106 ? -13.864 0.194   4.349   1.00 0.00 ? 106 VAL A CA   5  
ATOM 10057 C C    . VAL A 1 106 ? -14.273 0.420   2.892   1.00 0.00 ? 106 VAL A C    5  
ATOM 10058 O O    . VAL A 1 106 ? -14.117 -0.467  2.054   1.00 0.00 ? 106 VAL A O    5  
ATOM 10059 C CB   . VAL A 1 106 ? -12.452 0.695   4.658   1.00 0.00 ? 106 VAL A CB   5  
ATOM 10060 C CG1  . VAL A 1 106 ? -12.222 2.087   4.066   1.00 0.00 ? 106 VAL A CG1  5  
ATOM 10061 C CG2  . VAL A 1 106 ? -12.185 0.689   6.164   1.00 0.00 ? 106 VAL A CG2  5  
ATOM 10062 H H    . VAL A 1 106 ? -13.863 -1.836  3.881   1.00 0.00 ? 106 VAL A H    5  
ATOM 10063 H HA   . VAL A 1 106 ? -14.560 0.727   4.996   1.00 0.00 ? 106 VAL A HA   5  
ATOM 10064 H HB   . VAL A 1 106 ? -11.743 0.012   4.190   1.00 0.00 ? 106 VAL A HB   5  
ATOM 10065 H HG11 . VAL A 1 106 ? -12.008 1.999   3.001   1.00 0.00 ? 106 VAL A HG11 5  
ATOM 10066 H HG12 . VAL A 1 106 ? -13.117 2.694   4.207   1.00 0.00 ? 106 VAL A HG12 5  
ATOM 10067 H HG13 . VAL A 1 106 ? -11.379 2.561   4.568   1.00 0.00 ? 106 VAL A HG13 5  
ATOM 10068 H HG21 . VAL A 1 106 ? -12.061 -0.338  6.507   1.00 0.00 ? 106 VAL A HG21 5  
ATOM 10069 H HG22 . VAL A 1 106 ? -11.277 1.254   6.375   1.00 0.00 ? 106 VAL A HG22 5  
ATOM 10070 H HG23 . VAL A 1 106 ? -13.027 1.147   6.684   1.00 0.00 ? 106 VAL A HG23 5  
ATOM 10071 N N    . LYS A 1 107 ? -14.789 1.613   2.634   1.00 0.00 ? 107 LYS A N    5  
ATOM 10072 C CA   . LYS A 1 107 ? -15.222 1.968   1.293   1.00 0.00 ? 107 LYS A CA   5  
ATOM 10073 C C    . LYS A 1 107 ? -14.926 3.448   1.041   1.00 0.00 ? 107 LYS A C    5  
ATOM 10074 O O    . LYS A 1 107 ? -15.003 4.265   1.958   1.00 0.00 ? 107 LYS A O    5  
ATOM 10075 C CB   . LYS A 1 107 ? -16.690 1.590   1.087   1.00 0.00 ? 107 LYS A CB   5  
ATOM 10076 C CG   . LYS A 1 107 ? -17.130 1.869   -0.352  1.00 0.00 ? 107 LYS A CG   5  
ATOM 10077 C CD   . LYS A 1 107 ? -18.489 2.572   -0.382  1.00 0.00 ? 107 LYS A CD   5  
ATOM 10078 C CE   . LYS A 1 107 ? -19.579 1.637   -0.908  1.00 0.00 ? 107 LYS A CE   5  
ATOM 10079 N NZ   . LYS A 1 107 ? -20.107 2.131   -2.199  1.00 0.00 ? 107 LYS A NZ   5  
ATOM 10080 H H    . LYS A 1 107 ? -14.912 2.329   3.321   1.00 0.00 ? 107 LYS A H    5  
ATOM 10081 H HA   . LYS A 1 107 ? -14.634 1.374   0.593   1.00 0.00 ? 107 LYS A HA   5  
ATOM 10082 H HB2  . LYS A 1 107 ? -16.833 0.534   1.316   1.00 0.00 ? 107 LYS A HB2  5  
ATOM 10083 H HB3  . LYS A 1 107 ? -17.315 2.154   1.779   1.00 0.00 ? 107 LYS A HB3  5  
ATOM 10084 H HG2  . LYS A 1 107 ? -16.385 2.488   -0.851  1.00 0.00 ? 107 LYS A HG2  5  
ATOM 10085 H HG3  . LYS A 1 107 ? -17.190 0.932   -0.906  1.00 0.00 ? 107 LYS A HG3  5  
ATOM 10086 H HD2  . LYS A 1 107 ? -18.749 2.912   0.620   1.00 0.00 ? 107 LYS A HD2  5  
ATOM 10087 H HD3  . LYS A 1 107 ? -18.429 3.459   -1.013  1.00 0.00 ? 107 LYS A HD3  5  
ATOM 10088 H HE2  . LYS A 1 107 ? -19.175 0.633   -1.034  1.00 0.00 ? 107 LYS A HE2  5  
ATOM 10089 H HE3  . LYS A 1 107 ? -20.388 1.566   -0.181  1.00 0.00 ? 107 LYS A HE3  5  
ATOM 10090 H HZ1  . LYS A 1 107 ? -19.953 1.443   -2.908  1.00 0.00 ? 107 LYS A HZ1  5  
ATOM 10091 H HZ2  . LYS A 1 107 ? -21.088 2.307   -2.113  1.00 0.00 ? 107 LYS A HZ2  5  
ATOM 10092 H HZ3  . LYS A 1 107 ? -19.638 2.978   -2.449  1.00 0.00 ? 107 LYS A HZ3  5  
ATOM 10093 N N    . ALA A 1 108 ? -14.595 3.748   -0.206  1.00 0.00 ? 108 ALA A N    5  
ATOM 10094 C CA   . ALA A 1 108 ? -14.288 5.115   -0.590  1.00 0.00 ? 108 ALA A CA   5  
ATOM 10095 C C    . ALA A 1 108 ? -15.579 5.829   -0.995  1.00 0.00 ? 108 ALA A C    5  
ATOM 10096 O O    . ALA A 1 108 ? -16.189 5.488   -2.008  1.00 0.00 ? 108 ALA A O    5  
ATOM 10097 C CB   . ALA A 1 108 ? -13.248 5.109   -1.713  1.00 0.00 ? 108 ALA A CB   5  
ATOM 10098 H H    . ALA A 1 108 ? -14.534 3.078   -0.945  1.00 0.00 ? 108 ALA A H    5  
ATOM 10099 H HA   . ALA A 1 108 ? -13.863 5.617   0.279   1.00 0.00 ? 108 ALA A HA   5  
ATOM 10100 H HB1  . ALA A 1 108 ? -13.689 4.682   -2.613  1.00 0.00 ? 108 ALA A HB1  5  
ATOM 10101 H HB2  . ALA A 1 108 ? -12.926 6.131   -1.915  1.00 0.00 ? 108 ALA A HB2  5  
ATOM 10102 H HB3  . ALA A 1 108 ? -12.389 4.511   -1.409  1.00 0.00 ? 108 ALA A HB3  5  
ATOM 10103 N N    . LEU A 1 109 ? -15.957 6.806   -0.184  1.00 0.00 ? 109 LEU A N    5  
ATOM 10104 C CA   . LEU A 1 109 ? -17.165 7.570   -0.445  1.00 0.00 ? 109 LEU A CA   5  
ATOM 10105 C C    . LEU A 1 109 ? -16.803 8.837   -1.224  1.00 0.00 ? 109 LEU A C    5  
ATOM 10106 O O    . LEU A 1 109 ? -17.652 9.419   -1.897  1.00 0.00 ? 109 LEU A O    5  
ATOM 10107 C CB   . LEU A 1 109 ? -17.919 7.843   0.858   1.00 0.00 ? 109 LEU A CB   5  
ATOM 10108 C CG   . LEU A 1 109 ? -17.837 6.747   1.923   1.00 0.00 ? 109 LEU A CG   5  
ATOM 10109 C CD1  . LEU A 1 109 ? -16.756 7.068   2.957   1.00 0.00 ? 109 LEU A CD1  5  
ATOM 10110 C CD2  . LEU A 1 109 ? -19.201 6.512   2.574   1.00 0.00 ? 109 LEU A CD2  5  
ATOM 10111 H H    . LEU A 1 109 ? -15.455 7.076   0.637   1.00 0.00 ? 109 LEU A H    5  
ATOM 10112 H HA   . LEU A 1 109 ? -17.813 6.954   -1.069  1.00 0.00 ? 109 LEU A HA   5  
ATOM 10113 H HB2  . LEU A 1 109 ? -17.537 8.769   1.288   1.00 0.00 ? 109 LEU A HB2  5  
ATOM 10114 H HB3  . LEU A 1 109 ? -18.969 8.012   0.619   1.00 0.00 ? 109 LEU A HB3  5  
ATOM 10115 H HG   . LEU A 1 109 ? -17.549 5.817   1.433   1.00 0.00 ? 109 LEU A HG   5  
ATOM 10116 H HD11 . LEU A 1 109 ? -16.291 6.141   3.295   1.00 0.00 ? 109 LEU A HD11 5  
ATOM 10117 H HD12 . LEU A 1 109 ? -15.999 7.710   2.505   1.00 0.00 ? 109 LEU A HD12 5  
ATOM 10118 H HD13 . LEU A 1 109 ? -17.206 7.580   3.807   1.00 0.00 ? 109 LEU A HD13 5  
ATOM 10119 H HD21 . LEU A 1 109 ? -19.840 7.378   2.400   1.00 0.00 ? 109 LEU A HD21 5  
ATOM 10120 H HD22 . LEU A 1 109 ? -19.663 5.626   2.139   1.00 0.00 ? 109 LEU A HD22 5  
ATOM 10121 H HD23 . LEU A 1 109 ? -19.071 6.366   3.646   1.00 0.00 ? 109 LEU A HD23 5  
ATOM 10122 N N    . THR A 1 110 ? -15.542 9.226   -1.105  1.00 0.00 ? 110 THR A N    5  
ATOM 10123 C CA   . THR A 1 110 ? -15.058 10.413  -1.789  1.00 0.00 ? 110 THR A CA   5  
ATOM 10124 C C    . THR A 1 110 ? -13.672 10.157  -2.384  1.00 0.00 ? 110 THR A C    5  
ATOM 10125 O O    . THR A 1 110 ? -13.043 9.142   -2.089  1.00 0.00 ? 110 THR A O    5  
ATOM 10126 C CB   . THR A 1 110 ? -15.087 11.576  -0.796  1.00 0.00 ? 110 THR A CB   5  
ATOM 10127 O OG1  . THR A 1 110 ? -14.354 12.609  -1.448  1.00 0.00 ? 110 THR A OG1  5  
ATOM 10128 C CG2  . THR A 1 110 ? -14.277 11.286  0.470   1.00 0.00 ? 110 THR A CG2  5  
ATOM 10129 H H    . THR A 1 110 ? -14.858 8.746   -0.555  1.00 0.00 ? 110 THR A H    5  
ATOM 10130 H HA   . THR A 1 110 ? -15.729 10.628  -2.621  1.00 0.00 ? 110 THR A HA   5  
ATOM 10131 H HB   . THR A 1 110 ? -16.113 11.850  -0.547  1.00 0.00 ? 110 THR A HB   5  
ATOM 10132 H HG1  . THR A 1 110 ? -13.385 12.364  -1.493  1.00 0.00 ? 110 THR A HG1  5  
ATOM 10133 H HG21 . THR A 1 110 ? -13.221 11.202  0.214   1.00 0.00 ? 110 THR A HG21 5  
ATOM 10134 H HG22 . THR A 1 110 ? -14.414 12.099  1.183   1.00 0.00 ? 110 THR A HG22 5  
ATOM 10135 H HG23 . THR A 1 110 ? -14.619 10.351  0.914   1.00 0.00 ? 110 THR A HG23 5  
ATOM 10136 N N    . GLU A 1 111 ? -13.236 11.095  -3.212  1.00 0.00 ? 111 GLU A N    5  
ATOM 10137 C CA   . GLU A 1 111 ? -11.936 10.984  -3.852  1.00 0.00 ? 111 GLU A CA   5  
ATOM 10138 C C    . GLU A 1 111 ? -10.841 10.798  -2.799  1.00 0.00 ? 111 GLU A C    5  
ATOM 10139 O O    . GLU A 1 111 ? -10.568 11.706  -2.016  1.00 0.00 ? 111 GLU A O    5  
ATOM 10140 C CB   . GLU A 1 111 ? -11.651 12.204  -4.730  1.00 0.00 ? 111 GLU A CB   5  
ATOM 10141 C CG   . GLU A 1 111 ? -10.577 11.890  -5.773  1.00 0.00 ? 111 GLU A CG   5  
ATOM 10142 C CD   . GLU A 1 111 ? -10.230 13.133  -6.595  1.00 0.00 ? 111 GLU A CD   5  
ATOM 10143 O OE1  . GLU A 1 111 ? -9.897  14.158  -5.961  1.00 0.00 ? 111 GLU A OE1  5  
ATOM 10144 O OE2  . GLU A 1 111 ? -10.307 13.031  -7.838  1.00 0.00 ? 111 GLU A OE2  5  
ATOM 10145 H H    . GLU A 1 111 ? -13.754 11.918  -3.447  1.00 0.00 ? 111 GLU A H    5  
ATOM 10146 H HA   . GLU A 1 111 ? -11.999 10.097  -4.482  1.00 0.00 ? 111 GLU A HA   5  
ATOM 10147 H HB2  . GLU A 1 111 ? -12.567 12.519  -5.230  1.00 0.00 ? 111 GLU A HB2  5  
ATOM 10148 H HB3  . GLU A 1 111 ? -11.326 13.037  -4.107  1.00 0.00 ? 111 GLU A HB3  5  
ATOM 10149 H HG2  . GLU A 1 111 ? -9.681  11.517  -5.276  1.00 0.00 ? 111 GLU A HG2  5  
ATOM 10150 H HG3  . GLU A 1 111 ? -10.928 11.098  -6.435  1.00 0.00 ? 111 GLU A HG3  5  
ATOM 10151 N N    . VAL A 1 112 ? -10.244 9.615   -2.816  1.00 0.00 ? 112 VAL A N    5  
ATOM 10152 C CA   . VAL A 1 112 ? -9.185  9.299   -1.873  1.00 0.00 ? 112 VAL A CA   5  
ATOM 10153 C C    . VAL A 1 112 ? -7.842  9.292   -2.605  1.00 0.00 ? 112 VAL A C    5  
ATOM 10154 O O    . VAL A 1 112 ? -7.757  8.850   -3.750  1.00 0.00 ? 112 VAL A O    5  
ATOM 10155 C CB   . VAL A 1 112 ? -9.490  7.975   -1.169  1.00 0.00 ? 112 VAL A CB   5  
ATOM 10156 C CG1  . VAL A 1 112 ? -8.545  7.753   0.014   1.00 0.00 ? 112 VAL A CG1  5  
ATOM 10157 C CG2  . VAL A 1 112 ? -10.952 7.915   -0.723  1.00 0.00 ? 112 VAL A CG2  5  
ATOM 10158 H H    . VAL A 1 112 ? -10.473 8.883   -3.457  1.00 0.00 ? 112 VAL A H    5  
ATOM 10159 H HA   . VAL A 1 112 ? -9.170  10.086  -1.119  1.00 0.00 ? 112 VAL A HA   5  
ATOM 10160 H HB   . VAL A 1 112 ? -9.325  7.169   -1.885  1.00 0.00 ? 112 VAL A HB   5  
ATOM 10161 H HG11 . VAL A 1 112 ? -8.750  8.495   0.786   1.00 0.00 ? 112 VAL A HG11 5  
ATOM 10162 H HG12 . VAL A 1 112 ? -8.701  6.754   0.420   1.00 0.00 ? 112 VAL A HG12 5  
ATOM 10163 H HG13 . VAL A 1 112 ? -7.513  7.853   -0.321  1.00 0.00 ? 112 VAL A HG13 5  
ATOM 10164 H HG21 . VAL A 1 112 ? -11.287 8.913   -0.440  1.00 0.00 ? 112 VAL A HG21 5  
ATOM 10165 H HG22 . VAL A 1 112 ? -11.567 7.544   -1.543  1.00 0.00 ? 112 VAL A HG22 5  
ATOM 10166 H HG23 . VAL A 1 112 ? -11.044 7.245   0.132   1.00 0.00 ? 112 VAL A HG23 5  
ATOM 10167 N N    . GLU A 1 113 ? -6.825  9.786   -1.914  1.00 0.00 ? 113 GLU A N    5  
ATOM 10168 C CA   . GLU A 1 113 ? -5.490  9.843   -2.484  1.00 0.00 ? 113 GLU A CA   5  
ATOM 10169 C C    . GLU A 1 113 ? -4.494  9.116   -1.577  1.00 0.00 ? 113 GLU A C    5  
ATOM 10170 O O    . GLU A 1 113 ? -4.196  9.582   -0.479  1.00 0.00 ? 113 GLU A O    5  
ATOM 10171 C CB   . GLU A 1 113 ? -5.057  11.290  -2.725  1.00 0.00 ? 113 GLU A CB   5  
ATOM 10172 C CG   . GLU A 1 113 ? -5.897  11.937  -3.828  1.00 0.00 ? 113 GLU A CG   5  
ATOM 10173 C CD   . GLU A 1 113 ? -7.008  12.804  -3.234  1.00 0.00 ? 113 GLU A CD   5  
ATOM 10174 O OE1  . GLU A 1 113 ? -7.746  12.272  -2.377  1.00 0.00 ? 113 GLU A OE1  5  
ATOM 10175 O OE2  . GLU A 1 113 ? -7.095  13.980  -3.650  1.00 0.00 ? 113 GLU A OE2  5  
ATOM 10176 H H    . GLU A 1 113 ? -6.903  10.144  -0.984  1.00 0.00 ? 113 GLU A H    5  
ATOM 10177 H HA   . GLU A 1 113 ? -5.562  9.327   -3.442  1.00 0.00 ? 113 GLU A HA   5  
ATOM 10178 H HB2  . GLU A 1 113 ? -5.158  11.862  -1.803  1.00 0.00 ? 113 GLU A HB2  5  
ATOM 10179 H HB3  . GLU A 1 113 ? -4.003  11.317  -3.003  1.00 0.00 ? 113 GLU A HB3  5  
ATOM 10180 H HG2  . GLU A 1 113 ? -5.257  12.547  -4.467  1.00 0.00 ? 113 GLU A HG2  5  
ATOM 10181 H HG3  . GLU A 1 113 ? -6.333  11.163  -4.460  1.00 0.00 ? 113 GLU A HG3  5  
ATOM 10182 N N    . ALA A 1 114 ? -4.008  7.987   -2.071  1.00 0.00 ? 114 ALA A N    5  
ATOM 10183 C CA   . ALA A 1 114 ? -3.052  7.192   -1.318  1.00 0.00 ? 114 ALA A CA   5  
ATOM 10184 C C    . ALA A 1 114 ? -2.310  6.256   -2.274  1.00 0.00 ? 114 ALA A C    5  
ATOM 10185 O O    . ALA A 1 114 ? -2.628  6.194   -3.461  1.00 0.00 ? 114 ALA A O    5  
ATOM 10186 C CB   . ALA A 1 114 ? -3.782  6.432   -0.208  1.00 0.00 ? 114 ALA A CB   5  
ATOM 10187 H H    . ALA A 1 114 ? -4.256  7.615   -2.965  1.00 0.00 ? 114 ALA A H    5  
ATOM 10188 H HA   . ALA A 1 114 ? -2.336  7.876   -0.863  1.00 0.00 ? 114 ALA A HA   5  
ATOM 10189 H HB1  . ALA A 1 114 ? -4.856  6.594   -0.302  1.00 0.00 ? 114 ALA A HB1  5  
ATOM 10190 H HB2  . ALA A 1 114 ? -3.566  5.367   -0.294  1.00 0.00 ? 114 ALA A HB2  5  
ATOM 10191 H HB3  . ALA A 1 114 ? -3.443  6.795   0.762   1.00 0.00 ? 114 ALA A HB3  5  
ATOM 10192 N N    . PHE A 1 115 ? -1.333  5.551   -1.721  1.00 0.00 ? 115 PHE A N    5  
ATOM 10193 C CA   . PHE A 1 115 ? -0.543  4.621   -2.510  1.00 0.00 ? 115 PHE A CA   5  
ATOM 10194 C C    . PHE A 1 115 ? -0.847  3.174   -2.119  1.00 0.00 ? 115 PHE A C    5  
ATOM 10195 O O    . PHE A 1 115 ? -1.463  2.923   -1.084  1.00 0.00 ? 115 PHE A O    5  
ATOM 10196 C CB   . PHE A 1 115 ? 0.928   4.920   -2.212  1.00 0.00 ? 115 PHE A CB   5  
ATOM 10197 C CG   . PHE A 1 115 ? 1.322   6.382   -2.427  1.00 0.00 ? 115 PHE A CG   5  
ATOM 10198 C CD1  . PHE A 1 115 ? 1.103   7.297   -1.445  1.00 0.00 ? 115 PHE A CD1  5  
ATOM 10199 C CD2  . PHE A 1 115 ? 1.892   6.767   -3.600  1.00 0.00 ? 115 PHE A CD2  5  
ATOM 10200 C CE1  . PHE A 1 115 ? 1.469   8.655   -1.645  1.00 0.00 ? 115 PHE A CE1  5  
ATOM 10201 C CE2  . PHE A 1 115 ? 2.258   8.124   -3.801  1.00 0.00 ? 115 PHE A CE2  5  
ATOM 10202 C CZ   . PHE A 1 115 ? 2.039   9.040   -2.819  1.00 0.00 ? 115 PHE A CZ   5  
ATOM 10203 H H    . PHE A 1 115 ? -1.081  5.607   -0.756  1.00 0.00 ? 115 PHE A H    5  
ATOM 10204 H HA   . PHE A 1 115 ? -0.809  4.776   -3.556  1.00 0.00 ? 115 PHE A HA   5  
ATOM 10205 H HB2  . PHE A 1 115 ? 1.141   4.645   -1.179  1.00 0.00 ? 115 PHE A HB2  5  
ATOM 10206 H HB3  . PHE A 1 115 ? 1.552   4.289   -2.845  1.00 0.00 ? 115 PHE A HB3  5  
ATOM 10207 H HD1  . PHE A 1 115 ? 0.647   6.989   -0.505  1.00 0.00 ? 115 PHE A HD1  5  
ATOM 10208 H HD2  . PHE A 1 115 ? 2.067   6.034   -4.387  1.00 0.00 ? 115 PHE A HD2  5  
ATOM 10209 H HE1  . PHE A 1 115 ? 1.293   9.388   -0.858  1.00 0.00 ? 115 PHE A HE1  5  
ATOM 10210 H HE2  . PHE A 1 115 ? 2.714   8.433   -4.741  1.00 0.00 ? 115 PHE A HE2  5  
ATOM 10211 H HZ   . PHE A 1 115 ? 2.320   10.081  -2.972  1.00 0.00 ? 115 PHE A HZ   5  
ATOM 10212 N N    . ALA A 1 116 ? -0.400  2.259   -2.967  1.00 0.00 ? 116 ALA A N    5  
ATOM 10213 C CA   . ALA A 1 116 ? -0.617  0.843   -2.722  1.00 0.00 ? 116 ALA A CA   5  
ATOM 10214 C C    . ALA A 1 116 ? 0.717   0.179   -2.377  1.00 0.00 ? 116 ALA A C    5  
ATOM 10215 O O    . ALA A 1 116 ? 1.778   0.681   -2.746  1.00 0.00 ? 116 ALA A O    5  
ATOM 10216 C CB   . ALA A 1 116 ? -1.283  0.210   -3.945  1.00 0.00 ? 116 ALA A CB   5  
ATOM 10217 H H    . ALA A 1 116 ? 0.100   2.471   -3.806  1.00 0.00 ? 116 ALA A H    5  
ATOM 10218 H HA   . ALA A 1 116 ? -1.290  0.752   -1.870  1.00 0.00 ? 116 ALA A HA   5  
ATOM 10219 H HB1  . ALA A 1 116 ? -2.205  0.745   -4.175  1.00 0.00 ? 116 ALA A HB1  5  
ATOM 10220 H HB2  . ALA A 1 116 ? -0.607  0.268   -4.798  1.00 0.00 ? 116 ALA A HB2  5  
ATOM 10221 H HB3  . ALA A 1 116 ? -1.513  -0.835  -3.734  1.00 0.00 ? 116 ALA A HB3  5  
ATOM 10222 N N    . LEU A 1 117 ? 0.621   -0.938  -1.672  1.00 0.00 ? 117 LEU A N    5  
ATOM 10223 C CA   . LEU A 1 117 ? 1.808   -1.676  -1.272  1.00 0.00 ? 117 LEU A CA   5  
ATOM 10224 C C    . LEU A 1 117 ? 1.528   -3.177  -1.373  1.00 0.00 ? 117 LEU A C    5  
ATOM 10225 O O    . LEU A 1 117 ? 0.626   -3.689  -0.712  1.00 0.00 ? 117 LEU A O    5  
ATOM 10226 C CB   . LEU A 1 117 ? 2.275   -1.228  0.114   1.00 0.00 ? 117 LEU A CB   5  
ATOM 10227 C CG   . LEU A 1 117 ? 3.788   -1.217  0.341   1.00 0.00 ? 117 LEU A CG   5  
ATOM 10228 C CD1  . LEU A 1 117 ? 4.422   -2.528  -0.127  1.00 0.00 ? 117 LEU A CD1  5  
ATOM 10229 C CD2  . LEU A 1 117 ? 4.432   0.001   -0.323  1.00 0.00 ? 117 LEU A CD2  5  
ATOM 10230 H H    . LEU A 1 117 ? -0.245  -1.340  -1.376  1.00 0.00 ? 117 LEU A H    5  
ATOM 10231 H HA   . LEU A 1 117 ? 2.601   -1.424  -1.976  1.00 0.00 ? 117 LEU A HA   5  
ATOM 10232 H HB2  . LEU A 1 117 ? 1.892   -0.225  0.299   1.00 0.00 ? 117 LEU A HB2  5  
ATOM 10233 H HB3  . LEU A 1 117 ? 1.821   -1.884  0.858   1.00 0.00 ? 117 LEU A HB3  5  
ATOM 10234 H HG   . LEU A 1 117 ? 3.972   -1.134  1.412   1.00 0.00 ? 117 LEU A HG   5  
ATOM 10235 H HD11 . LEU A 1 117 ? 4.946   -2.362  -1.069  1.00 0.00 ? 117 LEU A HD11 5  
ATOM 10236 H HD12 . LEU A 1 117 ? 5.130   -2.878  0.625   1.00 0.00 ? 117 LEU A HD12 5  
ATOM 10237 H HD13 . LEU A 1 117 ? 3.644   -3.277  -0.271  1.00 0.00 ? 117 LEU A HD13 5  
ATOM 10238 H HD21 . LEU A 1 117 ? 4.394   0.850   0.359   1.00 0.00 ? 117 LEU A HD21 5  
ATOM 10239 H HD22 . LEU A 1 117 ? 5.471   -0.224  -0.565  1.00 0.00 ? 117 LEU A HD22 5  
ATOM 10240 H HD23 . LEU A 1 117 ? 3.891   0.245   -1.238  1.00 0.00 ? 117 LEU A HD23 5  
ATOM 10241 N N    . ILE A 1 118 ? 2.318   -3.839  -2.205  1.00 0.00 ? 118 ILE A N    5  
ATOM 10242 C CA   . ILE A 1 118 ? 2.167   -5.271  -2.400  1.00 0.00 ? 118 ILE A CA   5  
ATOM 10243 C C    . ILE A 1 118 ? 2.949   -6.015  -1.315  1.00 0.00 ? 118 ILE A C    5  
ATOM 10244 O O    . ILE A 1 118 ? 4.026   -5.579  -0.912  1.00 0.00 ? 118 ILE A O    5  
ATOM 10245 C CB   . ILE A 1 118 ? 2.567   -5.662  -3.824  1.00 0.00 ? 118 ILE A CB   5  
ATOM 10246 C CG1  . ILE A 1 118 ? 2.632   -7.183  -3.976  1.00 0.00 ? 118 ILE A CG1  5  
ATOM 10247 C CG2  . ILE A 1 118 ? 3.880   -4.989  -4.230  1.00 0.00 ? 118 ILE A CG2  5  
ATOM 10248 C CD1  . ILE A 1 118 ? 2.707   -7.584  -5.451  1.00 0.00 ? 118 ILE A CD1  5  
ATOM 10249 H H    . ILE A 1 118 ? 3.050   -3.414  -2.738  1.00 0.00 ? 118 ILE A H    5  
ATOM 10250 H HA   . ILE A 1 118 ? 1.109   -5.506  -2.286  1.00 0.00 ? 118 ILE A HA   5  
ATOM 10251 H HB   . ILE A 1 118 ? 1.797   -5.303  -4.506  1.00 0.00 ? 118 ILE A HB   5  
ATOM 10252 H HG12 . ILE A 1 118 ? 3.503   -7.569  -3.446  1.00 0.00 ? 118 ILE A HG12 5  
ATOM 10253 H HG13 . ILE A 1 118 ? 1.754   -7.637  -3.517  1.00 0.00 ? 118 ILE A HG13 5  
ATOM 10254 H HG21 . ILE A 1 118 ? 3.665   -4.122  -4.855  1.00 0.00 ? 118 ILE A HG21 5  
ATOM 10255 H HG22 . ILE A 1 118 ? 4.415   -4.669  -3.336  1.00 0.00 ? 118 ILE A HG22 5  
ATOM 10256 H HG23 . ILE A 1 118 ? 4.494   -5.696  -4.787  1.00 0.00 ? 118 ILE A HG23 5  
ATOM 10257 H HD11 . ILE A 1 118 ? 1.754   -7.369  -5.935  1.00 0.00 ? 118 ILE A HD11 5  
ATOM 10258 H HD12 . ILE A 1 118 ? 3.499   -7.018  -5.941  1.00 0.00 ? 118 ILE A HD12 5  
ATOM 10259 H HD13 . ILE A 1 118 ? 2.921   -8.650  -5.528  1.00 0.00 ? 118 ILE A HD13 5  
ATOM 10260 N N    . ALA A 1 119 ? 2.375   -7.124  -0.873  1.00 0.00 ? 119 ALA A N    5  
ATOM 10261 C CA   . ALA A 1 119 ? 3.005   -7.932  0.157   1.00 0.00 ? 119 ALA A CA   5  
ATOM 10262 C C    . ALA A 1 119 ? 4.337   -8.472  -0.367  1.00 0.00 ? 119 ALA A C    5  
ATOM 10263 O O    . ALA A 1 119 ? 5.371   -8.323  0.284   1.00 0.00 ? 119 ALA A O    5  
ATOM 10264 C CB   . ALA A 1 119 ? 2.051   -9.050  0.584   1.00 0.00 ? 119 ALA A CB   5  
ATOM 10265 H H    . ALA A 1 119 ? 1.499   -7.472  -1.206  1.00 0.00 ? 119 ALA A H    5  
ATOM 10266 H HA   . ALA A 1 119 ? 3.196   -7.287  1.015   1.00 0.00 ? 119 ALA A HA   5  
ATOM 10267 H HB1  . ALA A 1 119 ? 2.358   -9.987  0.120   1.00 0.00 ? 119 ALA A HB1  5  
ATOM 10268 H HB2  . ALA A 1 119 ? 2.077   -9.155  1.669   1.00 0.00 ? 119 ALA A HB2  5  
ATOM 10269 H HB3  . ALA A 1 119 ? 1.037   -8.803  0.267   1.00 0.00 ? 119 ALA A HB3  5  
ATOM 10270 N N    . ASP A 1 120 ? 4.270   -9.088  -1.538  1.00 0.00 ? 120 ASP A N    5  
ATOM 10271 C CA   . ASP A 1 120 ? 5.458   -9.651  -2.157  1.00 0.00 ? 120 ASP A CA   5  
ATOM 10272 C C    . ASP A 1 120 ? 6.636   -8.697  -1.950  1.00 0.00 ? 120 ASP A C    5  
ATOM 10273 O O    . ASP A 1 120 ? 7.565   -9.004  -1.205  1.00 0.00 ? 120 ASP A O    5  
ATOM 10274 C CB   . ASP A 1 120 ? 5.259   -9.837  -3.662  1.00 0.00 ? 120 ASP A CB   5  
ATOM 10275 C CG   . ASP A 1 120 ? 5.293   -11.289 -4.144  1.00 0.00 ? 120 ASP A CG   5  
ATOM 10276 O OD1  . ASP A 1 120 ? 4.509   -12.089 -3.590  1.00 0.00 ? 120 ASP A OD1  5  
ATOM 10277 O OD2  . ASP A 1 120 ? 6.102   -11.565 -5.056  1.00 0.00 ? 120 ASP A OD2  5  
ATOM 10278 H H    . ASP A 1 120 ? 3.425   -9.206  -2.060  1.00 0.00 ? 120 ASP A H    5  
ATOM 10279 H HA   . ASP A 1 120 ? 5.609   -10.612 -1.666  1.00 0.00 ? 120 ASP A HA   5  
ATOM 10280 H HB2  . ASP A 1 120 ? 4.302   -9.399  -3.944  1.00 0.00 ? 120 ASP A HB2  5  
ATOM 10281 H HB3  . ASP A 1 120 ? 6.033   -9.278  -4.188  1.00 0.00 ? 120 ASP A HB3  5  
ATOM 10282 N N    . GLU A 1 121 ? 6.559   -7.558  -2.623  1.00 0.00 ? 121 GLU A N    5  
ATOM 10283 C CA   . GLU A 1 121 ? 7.607   -6.557  -2.522  1.00 0.00 ? 121 GLU A CA   5  
ATOM 10284 C C    . GLU A 1 121 ? 7.900   -6.240  -1.054  1.00 0.00 ? 121 GLU A C    5  
ATOM 10285 O O    . GLU A 1 121 ? 9.042   -5.963  -0.691  1.00 0.00 ? 121 GLU A O    5  
ATOM 10286 C CB   . GLU A 1 121 ? 7.231   -5.290  -3.292  1.00 0.00 ? 121 GLU A CB   5  
ATOM 10287 C CG   . GLU A 1 121 ? 6.990   -5.598  -4.771  1.00 0.00 ? 121 GLU A CG   5  
ATOM 10288 C CD   . GLU A 1 121 ? 8.297   -5.536  -5.564  1.00 0.00 ? 121 GLU A CD   5  
ATOM 10289 O OE1  . GLU A 1 121 ? 9.178   -6.374  -5.273  1.00 0.00 ? 121 GLU A OE1  5  
ATOM 10290 O OE2  . GLU A 1 121 ? 8.386   -4.653  -6.444  1.00 0.00 ? 121 GLU A OE2  5  
ATOM 10291 H H    . GLU A 1 121 ? 5.800   -7.316  -3.227  1.00 0.00 ? 121 GLU A H    5  
ATOM 10292 H HA   . GLU A 1 121 ? 8.485   -7.009  -2.985  1.00 0.00 ? 121 GLU A HA   5  
ATOM 10293 H HB2  . GLU A 1 121 ? 6.334   -4.849  -2.858  1.00 0.00 ? 121 GLU A HB2  5  
ATOM 10294 H HB3  . GLU A 1 121 ? 8.027   -4.551  -3.196  1.00 0.00 ? 121 GLU A HB3  5  
ATOM 10295 H HG2  . GLU A 1 121 ? 6.546   -6.588  -4.872  1.00 0.00 ? 121 GLU A HG2  5  
ATOM 10296 H HG3  . GLU A 1 121 ? 6.276   -4.885  -5.183  1.00 0.00 ? 121 GLU A HG3  5  
ATOM 10297 N N    . LEU A 1 122 ? 6.848   -6.292  -0.250  1.00 0.00 ? 122 LEU A N    5  
ATOM 10298 C CA   . LEU A 1 122 ? 6.977   -6.013  1.170   1.00 0.00 ? 122 LEU A CA   5  
ATOM 10299 C C    . LEU A 1 122 ? 7.832   -7.102  1.823   1.00 0.00 ? 122 LEU A C    5  
ATOM 10300 O O    . LEU A 1 122 ? 8.962   -6.844  2.237   1.00 0.00 ? 122 LEU A O    5  
ATOM 10301 C CB   . LEU A 1 122 ? 5.598   -5.848  1.812   1.00 0.00 ? 122 LEU A CB   5  
ATOM 10302 C CG   . LEU A 1 122 ? 5.553   -5.028  3.102   1.00 0.00 ? 122 LEU A CG   5  
ATOM 10303 C CD1  . LEU A 1 122 ? 4.184   -5.142  3.777   1.00 0.00 ? 122 LEU A CD1  5  
ATOM 10304 C CD2  . LEU A 1 122 ? 6.691   -5.425  4.045   1.00 0.00 ? 122 LEU A CD2  5  
ATOM 10305 H H    . LEU A 1 122 ? 5.922   -6.518  -0.554  1.00 0.00 ? 122 LEU A H    5  
ATOM 10306 H HA   . LEU A 1 122 ? 7.496   -5.060  1.270   1.00 0.00 ? 122 LEU A HA   5  
ATOM 10307 H HB2  . LEU A 1 122 ? 4.935   -5.380  1.084   1.00 0.00 ? 122 LEU A HB2  5  
ATOM 10308 H HB3  . LEU A 1 122 ? 5.195   -6.839  2.020   1.00 0.00 ? 122 LEU A HB3  5  
ATOM 10309 H HG   . LEU A 1 122 ? 5.699   -3.979  2.846   1.00 0.00 ? 122 LEU A HG   5  
ATOM 10310 H HD11 . LEU A 1 122 ? 4.299   -5.022  4.854   1.00 0.00 ? 122 LEU A HD11 5  
ATOM 10311 H HD12 . LEU A 1 122 ? 3.524   -4.364  3.393   1.00 0.00 ? 122 LEU A HD12 5  
ATOM 10312 H HD13 . LEU A 1 122 ? 3.755   -6.121  3.564   1.00 0.00 ? 122 LEU A HD13 5  
ATOM 10313 H HD21 . LEU A 1 122 ? 7.617   -4.953  3.716   1.00 0.00 ? 122 LEU A HD21 5  
ATOM 10314 H HD22 . LEU A 1 122 ? 6.456   -5.097  5.057   1.00 0.00 ? 122 LEU A HD22 5  
ATOM 10315 H HD23 . LEU A 1 122 ? 6.811   -6.509  4.033   1.00 0.00 ? 122 LEU A HD23 5  
ATOM 10316 N N    . LYS A 1 123 ? 7.261   -8.295  1.894   1.00 0.00 ? 123 LYS A N    5  
ATOM 10317 C CA   . LYS A 1 123 ? 7.957   -9.423  2.489   1.00 0.00 ? 123 LYS A CA   5  
ATOM 10318 C C    . LYS A 1 123 ? 9.417   -9.415  2.033   1.00 0.00 ? 123 LYS A C    5  
ATOM 10319 O O    . LYS A 1 123 ? 10.325  -9.593  2.843   1.00 0.00 ? 123 LYS A O    5  
ATOM 10320 C CB   . LYS A 1 123 ? 7.223   -10.729 2.179   1.00 0.00 ? 123 LYS A CB   5  
ATOM 10321 C CG   . LYS A 1 123 ? 7.561   -11.807 3.211   1.00 0.00 ? 123 LYS A CG   5  
ATOM 10322 C CD   . LYS A 1 123 ? 6.297   -12.524 3.689   1.00 0.00 ? 123 LYS A CD   5  
ATOM 10323 C CE   . LYS A 1 123 ? 6.230   -13.947 3.131   1.00 0.00 ? 123 LYS A CE   5  
ATOM 10324 N NZ   . LYS A 1 123 ? 7.327   -14.773 3.682   1.00 0.00 ? 123 LYS A NZ   5  
ATOM 10325 H H    . LYS A 1 123 ? 6.342   -8.496  1.555   1.00 0.00 ? 123 LYS A H    5  
ATOM 10326 H HA   . LYS A 1 123 ? 7.932   -9.289  3.571   1.00 0.00 ? 123 LYS A HA   5  
ATOM 10327 H HB2  . LYS A 1 123 ? 6.147   -10.554 2.170   1.00 0.00 ? 123 LYS A HB2  5  
ATOM 10328 H HB3  . LYS A 1 123 ? 7.497   -11.076 1.182   1.00 0.00 ? 123 LYS A HB3  5  
ATOM 10329 H HG2  . LYS A 1 123 ? 8.250   -12.530 2.774   1.00 0.00 ? 123 LYS A HG2  5  
ATOM 10330 H HG3  . LYS A 1 123 ? 8.071   -11.354 4.061   1.00 0.00 ? 123 LYS A HG3  5  
ATOM 10331 H HD2  . LYS A 1 123 ? 6.283   -12.556 4.779   1.00 0.00 ? 123 LYS A HD2  5  
ATOM 10332 H HD3  . LYS A 1 123 ? 5.416   -11.964 3.375   1.00 0.00 ? 123 LYS A HD3  5  
ATOM 10333 H HE2  . LYS A 1 123 ? 5.268   -14.397 3.380   1.00 0.00 ? 123 LYS A HE2  5  
ATOM 10334 H HE3  . LYS A 1 123 ? 6.297   -13.921 2.044   1.00 0.00 ? 123 LYS A HE3  5  
ATOM 10335 H HZ1  . LYS A 1 123 ? 7.355   -14.670 4.677   1.00 0.00 ? 123 LYS A HZ1  5  
ATOM 10336 H HZ2  . LYS A 1 123 ? 7.171   -15.733 3.451   1.00 0.00 ? 123 LYS A HZ2  5  
ATOM 10337 H HZ3  . LYS A 1 123 ? 8.198   -14.473 3.292   1.00 0.00 ? 123 LYS A HZ3  5  
ATOM 10338 N N    . PHE A 1 124 ? 9.598   -9.206  0.737   1.00 0.00 ? 124 PHE A N    5  
ATOM 10339 C CA   . PHE A 1 124 ? 10.932  -9.172  0.163   1.00 0.00 ? 124 PHE A CA   5  
ATOM 10340 C C    . PHE A 1 124 ? 11.831  -8.194  0.923   1.00 0.00 ? 124 PHE A C    5  
ATOM 10341 O O    . PHE A 1 124 ? 12.724  -8.609  1.659   1.00 0.00 ? 124 PHE A O    5  
ATOM 10342 C CB   . PHE A 1 124 ? 10.785  -8.694  -1.282  1.00 0.00 ? 124 PHE A CB   5  
ATOM 10343 C CG   . PHE A 1 124 ? 12.117  -8.445  -1.994  1.00 0.00 ? 124 PHE A CG   5  
ATOM 10344 C CD1  . PHE A 1 124 ? 12.739  -9.463  -2.648  1.00 0.00 ? 124 PHE A CD1  5  
ATOM 10345 C CD2  . PHE A 1 124 ? 12.679  -7.207  -1.972  1.00 0.00 ? 124 PHE A CD2  5  
ATOM 10346 C CE1  . PHE A 1 124 ? 13.974  -9.232  -3.308  1.00 0.00 ? 124 PHE A CE1  5  
ATOM 10347 C CE2  . PHE A 1 124 ? 13.915  -6.976  -2.632  1.00 0.00 ? 124 PHE A CE2  5  
ATOM 10348 C CZ   . PHE A 1 124 ? 14.537  -7.994  -3.286  1.00 0.00 ? 124 PHE A CZ   5  
ATOM 10349 H H    . PHE A 1 124 ? 8.853   -9.062  0.085   1.00 0.00 ? 124 PHE A H    5  
ATOM 10350 H HA   . PHE A 1 124 ? 11.344  -10.178 0.243   1.00 0.00 ? 124 PHE A HA   5  
ATOM 10351 H HB2  . PHE A 1 124 ? 10.218  -9.435  -1.844  1.00 0.00 ? 124 PHE A HB2  5  
ATOM 10352 H HB3  . PHE A 1 124 ? 10.203  -7.772  -1.292  1.00 0.00 ? 124 PHE A HB3  5  
ATOM 10353 H HD1  . PHE A 1 124 ? 12.288  -10.455 -2.665  1.00 0.00 ? 124 PHE A HD1  5  
ATOM 10354 H HD2  . PHE A 1 124 ? 12.181  -6.392  -1.448  1.00 0.00 ? 124 PHE A HD2  5  
ATOM 10355 H HE1  . PHE A 1 124 ? 14.473  -10.048 -3.833  1.00 0.00 ? 124 PHE A HE1  5  
ATOM 10356 H HE2  . PHE A 1 124 ? 14.365  -5.984  -2.615  1.00 0.00 ? 124 PHE A HE2  5  
ATOM 10357 H HZ   . PHE A 1 124 ? 15.485  -7.817  -3.793  1.00 0.00 ? 124 PHE A HZ   5  
ATOM 10358 N N    . VAL A 1 125 ? 11.563  -6.913  0.718   1.00 0.00 ? 125 VAL A N    5  
ATOM 10359 C CA   . VAL A 1 125 ? 12.336  -5.872  1.374   1.00 0.00 ? 125 VAL A CA   5  
ATOM 10360 C C    . VAL A 1 125 ? 12.441  -6.186  2.868   1.00 0.00 ? 125 VAL A C    5  
ATOM 10361 O O    . VAL A 1 125 ? 13.490  -5.981  3.477   1.00 0.00 ? 125 VAL A O    5  
ATOM 10362 C CB   . VAL A 1 125 ? 11.714  -4.502  1.093   1.00 0.00 ? 125 VAL A CB   5  
ATOM 10363 C CG1  . VAL A 1 125 ? 10.676  -4.143  2.158   1.00 0.00 ? 125 VAL A CG1  5  
ATOM 10364 C CG2  . VAL A 1 125 ? 12.792  -3.421  0.992   1.00 0.00 ? 125 VAL A CG2  5  
ATOM 10365 H H    . VAL A 1 125 ? 10.834  -6.583  0.117   1.00 0.00 ? 125 VAL A H    5  
ATOM 10366 H HA   . VAL A 1 125 ? 13.336  -5.883  0.942   1.00 0.00 ? 125 VAL A HA   5  
ATOM 10367 H HB   . VAL A 1 125 ? 11.203  -4.557  0.132   1.00 0.00 ? 125 VAL A HB   5  
ATOM 10368 H HG11 . VAL A 1 125 ? 11.128  -4.216  3.147   1.00 0.00 ? 125 VAL A HG11 5  
ATOM 10369 H HG12 . VAL A 1 125 ? 10.325  -3.124  1.994   1.00 0.00 ? 125 VAL A HG12 5  
ATOM 10370 H HG13 . VAL A 1 125 ? 9.834   -4.832  2.092   1.00 0.00 ? 125 VAL A HG13 5  
ATOM 10371 H HG21 . VAL A 1 125 ? 13.727  -3.800  1.406   1.00 0.00 ? 125 VAL A HG21 5  
ATOM 10372 H HG22 . VAL A 1 125 ? 12.940  -3.153  -0.054  1.00 0.00 ? 125 VAL A HG22 5  
ATOM 10373 H HG23 . VAL A 1 125 ? 12.478  -2.541  1.552   1.00 0.00 ? 125 VAL A HG23 5  
ATOM 10374 N N    . ALA A 1 126 ? 11.339  -6.679  3.415   1.00 0.00 ? 126 ALA A N    5  
ATOM 10375 C CA   . ALA A 1 126 ? 11.294  -7.023  4.826   1.00 0.00 ? 126 ALA A CA   5  
ATOM 10376 C C    . ALA A 1 126 ? 12.343  -8.098  5.118   1.00 0.00 ? 126 ALA A C    5  
ATOM 10377 O O    . ALA A 1 126 ? 13.163  -7.941  6.022   1.00 0.00 ? 126 ALA A O    5  
ATOM 10378 C CB   . ALA A 1 126 ? 9.880   -7.472  5.197   1.00 0.00 ? 126 ALA A CB   5  
ATOM 10379 H H    . ALA A 1 126 ? 10.490  -6.843  2.913   1.00 0.00 ? 126 ALA A H    5  
ATOM 10380 H HA   . ALA A 1 126 ? 11.538  -6.125  5.395   1.00 0.00 ? 126 ALA A HA   5  
ATOM 10381 H HB1  . ALA A 1 126 ? 9.926   -8.434  5.708   1.00 0.00 ? 126 ALA A HB1  5  
ATOM 10382 H HB2  . ALA A 1 126 ? 9.425   -6.733  5.856   1.00 0.00 ? 126 ALA A HB2  5  
ATOM 10383 H HB3  . ALA A 1 126 ? 9.280   -7.570  4.292   1.00 0.00 ? 126 ALA A HB3  5  
ATOM 10384 N N    . SER A 1 127 ? 12.282  -9.166  4.336   1.00 0.00 ? 127 SER A N    5  
ATOM 10385 C CA   . SER A 1 127 ? 13.217  -10.267 4.500   1.00 0.00 ? 127 SER A CA   5  
ATOM 10386 C C    . SER A 1 127 ? 14.637  -9.800  4.175   1.00 0.00 ? 127 SER A C    5  
ATOM 10387 O O    . SER A 1 127 ? 15.561  -10.021 4.956   1.00 0.00 ? 127 SER A O    5  
ATOM 10388 C CB   . SER A 1 127 ? 12.831  -11.452 3.613   1.00 0.00 ? 127 SER A CB   5  
ATOM 10389 O OG   . SER A 1 127 ? 13.103  -12.701 4.243   1.00 0.00 ? 127 SER A OG   5  
ATOM 10390 H H    . SER A 1 127 ? 11.612  -9.286  3.604   1.00 0.00 ? 127 SER A H    5  
ATOM 10391 H HA   . SER A 1 127 ? 13.140  -10.558 5.547   1.00 0.00 ? 127 SER A HA   5  
ATOM 10392 H HB2  . SER A 1 127 ? 11.770  -11.393 3.369   1.00 0.00 ? 127 SER A HB2  5  
ATOM 10393 H HB3  . SER A 1 127 ? 13.378  -11.394 2.672   1.00 0.00 ? 127 SER A HB3  5  
ATOM 10394 H HG   . SER A 1 127 ? 13.754  -12.572 4.991   1.00 0.00 ? 127 SER A HG   5  
ATOM 10395 N N    . GLN A 1 128 ? 14.767  -9.165  3.019   1.00 0.00 ? 128 GLN A N    5  
ATOM 10396 C CA   . GLN A 1 128 ? 16.059  -8.665  2.581   1.00 0.00 ? 128 GLN A CA   5  
ATOM 10397 C C    . GLN A 1 128 ? 16.837  -8.093  3.768   1.00 0.00 ? 128 GLN A C    5  
ATOM 10398 O O    . GLN A 1 128 ? 18.015  -8.397  3.947   1.00 0.00 ? 128 GLN A O    5  
ATOM 10399 C CB   . GLN A 1 128 ? 15.897  -7.620  1.476   1.00 0.00 ? 128 GLN A CB   5  
ATOM 10400 C CG   . GLN A 1 128 ? 16.161  -8.232  0.099   1.00 0.00 ? 128 GLN A CG   5  
ATOM 10401 C CD   . GLN A 1 128 ? 17.654  -8.209  -0.234  1.00 0.00 ? 128 GLN A CD   5  
ATOM 10402 O OE1  . GLN A 1 128 ? 18.490  -8.698  0.509   1.00 0.00 ? 128 GLN A OE1  5  
ATOM 10403 N NE2  . GLN A 1 128 ? 17.942  -7.615  -1.389  1.00 0.00 ? 128 GLN A NE2  5  
ATOM 10404 H H    . GLN A 1 128 ? 14.011  -8.990  2.389   1.00 0.00 ? 128 GLN A H    5  
ATOM 10405 H HA   . GLN A 1 128 ? 16.583  -9.532  2.179   1.00 0.00 ? 128 GLN A HA   5  
ATOM 10406 H HB2  . GLN A 1 128 ? 14.889  -7.206  1.507   1.00 0.00 ? 128 GLN A HB2  5  
ATOM 10407 H HB3  . GLN A 1 128 ? 16.586  -6.793  1.649   1.00 0.00 ? 128 GLN A HB3  5  
ATOM 10408 H HG2  . GLN A 1 128 ? 15.795  -9.258  0.078   1.00 0.00 ? 128 GLN A HG2  5  
ATOM 10409 H HG3  . GLN A 1 128 ? 15.607  -7.680  -0.660  1.00 0.00 ? 128 GLN A HG3  5  
ATOM 10410 H HE21 . GLN A 1 128 ? 17.209  -7.234  -1.951  1.00 0.00 ? 128 GLN A HE21 5  
ATOM 10411 H HE22 . GLN A 1 128 ? 18.892  -7.550  -1.694  1.00 0.00 ? 128 GLN A HE22 5  
ATOM 10412 N N    . PHE A 1 129 ? 16.147  -7.274  4.548   1.00 0.00 ? 129 PHE A N    5  
ATOM 10413 C CA   . PHE A 1 129 ? 16.758  -6.656  5.712   1.00 0.00 ? 129 PHE A CA   5  
ATOM 10414 C C    . PHE A 1 129 ? 16.844  -7.646  6.876   1.00 0.00 ? 129 PHE A C    5  
ATOM 10415 O O    . PHE A 1 129 ? 17.865  -7.719  7.559   1.00 0.00 ? 129 PHE A O    5  
ATOM 10416 C CB   . PHE A 1 129 ? 15.862  -5.485  6.120   1.00 0.00 ? 129 PHE A CB   5  
ATOM 10417 C CG   . PHE A 1 129 ? 16.621  -4.184  6.388   1.00 0.00 ? 129 PHE A CG   5  
ATOM 10418 C CD1  . PHE A 1 129 ? 16.995  -3.389  5.350   1.00 0.00 ? 129 PHE A CD1  5  
ATOM 10419 C CD2  . PHE A 1 129 ? 16.922  -3.823  7.664   1.00 0.00 ? 129 PHE A CD2  5  
ATOM 10420 C CE1  . PHE A 1 129 ? 17.700  -2.181  5.598   1.00 0.00 ? 129 PHE A CE1  5  
ATOM 10421 C CE2  . PHE A 1 129 ? 17.627  -2.616  7.913   1.00 0.00 ? 129 PHE A CE2  5  
ATOM 10422 C CZ   . PHE A 1 129 ? 18.001  -1.820  6.875   1.00 0.00 ? 129 PHE A CZ   5  
ATOM 10423 H H    . PHE A 1 129 ? 15.188  -7.032  4.395   1.00 0.00 ? 129 PHE A H    5  
ATOM 10424 H HA   . PHE A 1 129 ? 17.763  -6.348  5.424   1.00 0.00 ? 129 PHE A HA   5  
ATOM 10425 H HB2  . PHE A 1 129 ? 15.129  -5.310  5.332   1.00 0.00 ? 129 PHE A HB2  5  
ATOM 10426 H HB3  . PHE A 1 129 ? 15.306  -5.761  7.016   1.00 0.00 ? 129 PHE A HB3  5  
ATOM 10427 H HD1  . PHE A 1 129 ? 16.753  -3.678  4.327   1.00 0.00 ? 129 PHE A HD1  5  
ATOM 10428 H HD2  . PHE A 1 129 ? 16.623  -4.461  8.496   1.00 0.00 ? 129 PHE A HD2  5  
ATOM 10429 H HE1  . PHE A 1 129 ? 17.999  -1.544  4.767   1.00 0.00 ? 129 PHE A HE1  5  
ATOM 10430 H HE2  . PHE A 1 129 ? 17.869  -2.327  8.935   1.00 0.00 ? 129 PHE A HE2  5  
ATOM 10431 H HZ   . PHE A 1 129 ? 18.542  -0.894  7.066   1.00 0.00 ? 129 PHE A HZ   5  
ATOM 10432 N N    . ARG A 1 130 ? 15.760  -8.383  7.066   1.00 0.00 ? 130 ARG A N    5  
ATOM 10433 C CA   . ARG A 1 130 ? 15.700  -9.365  8.135   1.00 0.00 ? 130 ARG A CA   5  
ATOM 10434 C C    . ARG A 1 130 ? 16.890  -10.322 8.044   1.00 0.00 ? 130 ARG A C    5  
ATOM 10435 O O    . ARG A 1 130 ? 17.359  -10.633 6.950   1.00 0.00 ? 130 ARG A O    5  
ATOM 10436 C CB   . ARG A 1 130 ? 14.401  -10.170 8.072   1.00 0.00 ? 130 ARG A CB   5  
ATOM 10437 C CG   . ARG A 1 130 ? 13.675  -10.147 9.418   1.00 0.00 ? 130 ARG A CG   5  
ATOM 10438 C CD   . ARG A 1 130 ? 13.496  -11.563 9.969   1.00 0.00 ? 130 ARG A CD   5  
ATOM 10439 N NE   . ARG A 1 130 ? 12.138  -11.717 10.537  1.00 0.00 ? 130 ARG A NE   5  
ATOM 10440 C CZ   . ARG A 1 130 ? 11.799  -12.659 11.428  1.00 0.00 ? 130 ARG A CZ   5  
ATOM 10441 N NH1  . ARG A 1 130 ? 12.716  -13.537 11.856  1.00 0.00 ? 130 ARG A NH1  5  
ATOM 10442 N NH2  . ARG A 1 130 ? 10.542  -12.724 11.889  1.00 0.00 ? 130 ARG A NH2  5  
ATOM 10443 H H    . ARG A 1 130 ? 14.934  -8.317  6.506   1.00 0.00 ? 130 ARG A H    5  
ATOM 10444 H HA   . ARG A 1 130 ? 15.737  -8.779  9.054   1.00 0.00 ? 130 ARG A HA   5  
ATOM 10445 H HB2  . ARG A 1 130 ? 13.752  -9.760  7.297   1.00 0.00 ? 130 ARG A HB2  5  
ATOM 10446 H HB3  . ARG A 1 130 ? 14.621  -11.200 7.791   1.00 0.00 ? 130 ARG A HB3  5  
ATOM 10447 H HG2  . ARG A 1 130 ? 14.240  -9.544  10.129  1.00 0.00 ? 130 ARG A HG2  5  
ATOM 10448 H HG3  . ARG A 1 130 ? 12.700  -9.672  9.301   1.00 0.00 ? 130 ARG A HG3  5  
ATOM 10449 H HD2  . ARG A 1 130 ? 13.652  -12.293 9.176   1.00 0.00 ? 130 ARG A HD2  5  
ATOM 10450 H HD3  . ARG A 1 130 ? 14.245  -11.761 10.736  1.00 0.00 ? 130 ARG A HD3  5  
ATOM 10451 H HE   . ARG A 1 130 ? 11.429  -11.078 10.238  1.00 0.00 ? 130 ARG A HE   5  
ATOM 10452 H HH11 . ARG A 1 130 ? 13.654  -13.489 11.512  1.00 0.00 ? 130 ARG A HH11 5  
ATOM 10453 H HH12 . ARG A 1 130 ? 12.463  -14.241 12.521  1.00 0.00 ? 130 ARG A HH12 5  
ATOM 10454 H HH21 . ARG A 1 130 ? 9.858   -12.069 11.569  1.00 0.00 ? 130 ARG A HH21 5  
ATOM 10455 H HH22 . ARG A 1 130 ? 10.289  -13.428 12.553  1.00 0.00 ? 130 ARG A HH22 5  
ATOM 10456 N N    . ARG A 1 131 ? 17.346  -10.762 9.208   1.00 0.00 ? 131 ARG A N    5  
ATOM 10457 C CA   . ARG A 1 131 ? 18.472  -11.677 9.273   1.00 0.00 ? 131 ARG A CA   5  
ATOM 10458 C C    . ARG A 1 131 ? 18.113  -12.902 10.117  1.00 0.00 ? 131 ARG A C    5  
ATOM 10459 O O    . ARG A 1 131 ? 18.253  -14.036 9.662   1.00 0.00 ? 131 ARG A O    5  
ATOM 10460 C CB   . ARG A 1 131 ? 19.702  -10.995 9.874   1.00 0.00 ? 131 ARG A CB   5  
ATOM 10461 C CG   . ARG A 1 131 ? 20.661  -10.527 8.777   1.00 0.00 ? 131 ARG A CG   5  
ATOM 10462 C CD   . ARG A 1 131 ? 22.118  -10.694 9.214   1.00 0.00 ? 131 ARG A CD   5  
ATOM 10463 N NE   . ARG A 1 131 ? 22.973  -10.950 8.034   1.00 0.00 ? 131 ARG A NE   5  
ATOM 10464 C CZ   . ARG A 1 131 ? 23.008  -12.112 7.369   1.00 0.00 ? 131 ARG A CZ   5  
ATOM 10465 N NH1  . ARG A 1 131 ? 22.235  -13.133 7.763   1.00 0.00 ? 131 ARG A NH1  5  
ATOM 10466 N NH2  . ARG A 1 131 ? 23.815  -12.254 6.309   1.00 0.00 ? 131 ARG A NH2  5  
ATOM 10467 H H    . ARG A 1 131 ? 16.959  -10.504 10.093  1.00 0.00 ? 131 ARG A H    5  
ATOM 10468 H HA   . ARG A 1 131 ? 18.664  -11.958 8.237   1.00 0.00 ? 131 ARG A HA   5  
ATOM 10469 H HB2  . ARG A 1 131 ? 19.391  -10.142 10.478  1.00 0.00 ? 131 ARG A HB2  5  
ATOM 10470 H HB3  . ARG A 1 131 ? 20.217  -11.687 10.541  1.00 0.00 ? 131 ARG A HB3  5  
ATOM 10471 H HG2  . ARG A 1 131 ? 20.483  -11.097 7.866   1.00 0.00 ? 131 ARG A HG2  5  
ATOM 10472 H HG3  . ARG A 1 131 ? 20.466  -9.480  8.542   1.00 0.00 ? 131 ARG A HG3  5  
ATOM 10473 H HD2  . ARG A 1 131 ? 22.456  -9.797  9.732   1.00 0.00 ? 131 ARG A HD2  5  
ATOM 10474 H HD3  . ARG A 1 131 ? 22.201  -11.520 9.920   1.00 0.00 ? 131 ARG A HD3  5  
ATOM 10475 H HE   . ARG A 1 131 ? 23.563  -10.209 7.713   1.00 0.00 ? 131 ARG A HE   5  
ATOM 10476 H HH11 . ARG A 1 131 ? 21.632  -13.028 8.554   1.00 0.00 ? 131 ARG A HH11 5  
ATOM 10477 H HH12 . ARG A 1 131 ? 22.261  -14.001 7.267   1.00 0.00 ? 131 ARG A HH12 5  
ATOM 10478 H HH21 . ARG A 1 131 ? 24.392  -11.492 6.014   1.00 0.00 ? 131 ARG A HH21 5  
ATOM 10479 H HH22 . ARG A 1 131 ? 23.841  -13.122 5.812   1.00 0.00 ? 131 ARG A HH22 5  
ATOM 10480 N N    . SER A 1 132 ? 17.658  -12.631 11.331  1.00 0.00 ? 132 SER A N    5  
ATOM 10481 C CA   . SER A 1 132 ? 17.278  -13.696 12.243  1.00 0.00 ? 132 SER A CA   5  
ATOM 10482 C C    . SER A 1 132 ? 18.528  -14.360 12.823  1.00 0.00 ? 132 SER A C    5  
ATOM 10483 O O    . SER A 1 132 ? 18.722  -14.373 14.038  1.00 0.00 ? 132 SER A O    5  
ATOM 10484 C CB   . SER A 1 132 ? 16.402  -14.736 11.541  1.00 0.00 ? 132 SER A CB   5  
ATOM 10485 O OG   . SER A 1 132 ? 15.679  -15.540 12.469  1.00 0.00 ? 132 SER A OG   5  
ATOM 10486 H H    . SER A 1 132 ? 17.547  -11.705 11.694  1.00 0.00 ? 132 SER A H    5  
ATOM 10487 H HA   . SER A 1 132 ? 16.702  -13.210 13.031  1.00 0.00 ? 132 SER A HA   5  
ATOM 10488 H HB2  . SER A 1 132 ? 15.702  -14.231 10.876  1.00 0.00 ? 132 SER A HB2  5  
ATOM 10489 H HB3  . SER A 1 132 ? 17.028  -15.376 10.918  1.00 0.00 ? 132 SER A HB3  5  
ATOM 10490 H HG   . SER A 1 132 ? 15.398  -14.987 13.254  1.00 0.00 ? 132 SER A HG   5  
ATOM 10491 N N    . GLY A 1 133 ? 19.345  -14.895 11.927  1.00 0.00 ? 133 GLY A N    5  
ATOM 10492 C CA   . GLY A 1 133 ? 20.572  -15.558 12.335  1.00 0.00 ? 133 GLY A CA   5  
ATOM 10493 C C    . GLY A 1 133 ? 20.270  -16.875 13.054  1.00 0.00 ? 133 GLY A C    5  
ATOM 10494 O O    . GLY A 1 133 ? 19.475  -17.681 12.573  1.00 0.00 ? 133 GLY A O    5  
ATOM 10495 H H    . GLY A 1 133 ? 19.180  -14.880 10.941  1.00 0.00 ? 133 GLY A H    5  
ATOM 10496 H HA2  . GLY A 1 133 ? 21.193  -15.751 11.460  1.00 0.00 ? 133 GLY A HA2  5  
ATOM 10497 H HA3  . GLY A 1 133 ? 21.142  -14.903 12.993  1.00 0.00 ? 133 GLY A HA3  5  
ATOM 10498 N N    . PRO A 1 134 ? 20.938  -17.057 14.224  1.00 0.00 ? 134 PRO A N    5  
ATOM 10499 C CA   . PRO A 1 134 ? 20.750  -18.261 15.014  1.00 0.00 ? 134 PRO A CA   5  
ATOM 10500 C C    . PRO A 1 134 ? 19.406  -18.233 15.746  1.00 0.00 ? 134 PRO A C    5  
ATOM 10501 O O    . PRO A 1 134 ? 19.350  -17.930 16.936  1.00 0.00 ? 134 PRO A O    5  
ATOM 10502 C CB   . PRO A 1 134 ? 21.940  -18.303 15.959  1.00 0.00 ? 134 PRO A CB   5  
ATOM 10503 C CG   . PRO A 1 134 ? 22.500  -16.890 15.985  1.00 0.00 ? 134 PRO A CG   5  
ATOM 10504 C CD   . PRO A 1 134 ? 21.887  -16.124 14.824  1.00 0.00 ? 134 PRO A CD   5  
ATOM 10505 H HA   . PRO A 1 134 ? 20.720  -19.065 14.420  1.00 0.00 ? 134 PRO A HA   5  
ATOM 10506 H HB2  . PRO A 1 134 ? 21.636  -18.621 16.956  1.00 0.00 ? 134 PRO A HB2  5  
ATOM 10507 H HB3  . PRO A 1 134 ? 22.690  -19.014 15.612  1.00 0.00 ? 134 PRO A HB3  5  
ATOM 10508 H HG2  . PRO A 1 134 ? 22.263  -16.403 16.931  1.00 0.00 ? 134 PRO A HG2  5  
ATOM 10509 H HG3  . PRO A 1 134 ? 23.586  -16.908 15.900  1.00 0.00 ? 134 PRO A HG3  5  
ATOM 10510 H HD2  . PRO A 1 134 ? 21.389  -15.217 15.167  1.00 0.00 ? 134 PRO A HD2  5  
ATOM 10511 H HD3  . PRO A 1 134 ? 22.649  -15.817 14.107  1.00 0.00 ? 134 PRO A HD3  5  
ATOM 10512 N N    . SER A 1 135 ? 18.357  -18.553 15.002  1.00 0.00 ? 135 SER A N    5  
ATOM 10513 C CA   . SER A 1 135 ? 17.018  -18.568 15.565  1.00 0.00 ? 135 SER A CA   5  
ATOM 10514 C C    . SER A 1 135 ? 16.350  -19.917 15.291  1.00 0.00 ? 135 SER A C    5  
ATOM 10515 O O    . SER A 1 135 ? 16.079  -20.257 14.140  1.00 0.00 ? 135 SER A O    5  
ATOM 10516 C CB   . SER A 1 135 ? 16.169  -17.430 14.996  1.00 0.00 ? 135 SER A CB   5  
ATOM 10517 O OG   . SER A 1 135 ? 14.867  -17.394 15.574  1.00 0.00 ? 135 SER A OG   5  
ATOM 10518 H H    . SER A 1 135 ? 18.412  -18.799 14.034  1.00 0.00 ? 135 SER A H    5  
ATOM 10519 H HA   . SER A 1 135 ? 17.153  -18.419 16.636  1.00 0.00 ? 135 SER A HA   5  
ATOM 10520 H HB2  . SER A 1 135 ? 16.670  -16.479 15.175  1.00 0.00 ? 135 SER A HB2  5  
ATOM 10521 H HB3  . SER A 1 135 ? 16.083  -17.546 13.916  1.00 0.00 ? 135 SER A HB3  5  
ATOM 10522 H HG   . SER A 1 135 ? 14.297  -16.728 15.093  1.00 0.00 ? 135 SER A HG   5  
ATOM 10523 N N    . SER A 1 136 ? 16.103  -20.649 16.367  1.00 0.00 ? 136 SER A N    5  
ATOM 10524 C CA   . SER A 1 136 ? 15.472  -21.953 16.256  1.00 0.00 ? 136 SER A CA   5  
ATOM 10525 C C    . SER A 1 136 ? 14.092  -21.924 16.917  1.00 0.00 ? 136 SER A C    5  
ATOM 10526 O O    . SER A 1 136 ? 13.856  -21.141 17.836  1.00 0.00 ? 136 SER A O    5  
ATOM 10527 C CB   . SER A 1 136 ? 16.341  -23.041 16.890  1.00 0.00 ? 136 SER A CB   5  
ATOM 10528 O OG   . SER A 1 136 ? 16.072  -24.327 16.339  1.00 0.00 ? 136 SER A OG   5  
ATOM 10529 H H    . SER A 1 136 ? 16.326  -20.365 17.299  1.00 0.00 ? 136 SER A H    5  
ATOM 10530 H HA   . SER A 1 136 ? 15.379  -22.139 15.186  1.00 0.00 ? 136 SER A HA   5  
ATOM 10531 H HB2  . SER A 1 136 ? 17.393  -22.796 16.742  1.00 0.00 ? 136 SER A HB2  5  
ATOM 10532 H HB3  . SER A 1 136 ? 16.168  -23.064 17.965  1.00 0.00 ? 136 SER A HB3  5  
ATOM 10533 H HG   . SER A 1 136 ? 15.652  -24.232 15.436  1.00 0.00 ? 136 SER A HG   5  
ATOM 10534 N N    . GLY A 1 137 ? 13.217  -22.788 16.424  1.00 0.00 ? 137 GLY A N    5  
ATOM 10535 C CA   . GLY A 1 137 ? 11.867  -22.871 16.955  1.00 0.00 ? 137 GLY A CA   5  
ATOM 10536 C C    . GLY A 1 137 ? 11.854  -23.583 18.309  1.00 0.00 ? 137 GLY A C    5  
ATOM 10537 O O    . GLY A 1 137 ? 12.129  -22.971 19.340  1.00 0.00 ? 137 GLY A O    5  
ATOM 10538 H H    . GLY A 1 137 ? 13.417  -23.421 15.677  1.00 0.00 ? 137 GLY A H    5  
ATOM 10539 H HA2  . GLY A 1 137 ? 11.452  -21.869 17.064  1.00 0.00 ? 137 GLY A HA2  5  
ATOM 10540 H HA3  . GLY A 1 137 ? 11.228  -23.406 16.253  1.00 0.00 ? 137 GLY A HA3  5  
ATOM 10541 N N    . GLY A 1 1   ? 19.776  12.953  -0.789  1.00 0.00 ? 1   GLY A N    6  
ATOM 10542 C CA   . GLY A 1 1   ? 19.275  14.242  -0.340  1.00 0.00 ? 1   GLY A CA   6  
ATOM 10543 C C    . GLY A 1 1   ? 19.234  14.312  1.187   1.00 0.00 ? 1   GLY A C    6  
ATOM 10544 O O    . GLY A 1 1   ? 19.937  13.566  1.866   1.00 0.00 ? 1   GLY A O    6  
ATOM 10545 H H1   . GLY A 1 1   ? 20.446  12.995  -1.529  1.00 0.00 ? 1   GLY A H1   6  
ATOM 10546 H HA2  . GLY A 1 1   ? 19.911  15.038  -0.728  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 10547 H HA3  . GLY A 1 1   ? 18.276  14.407  -0.743  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 10548 N N    . SER A 1 2   ? 18.402  15.217  1.684   1.00 0.00 ? 2   SER A N    6  
ATOM 10549 C CA   . SER A 1 2   ? 18.259  15.395  3.119   1.00 0.00 ? 2   SER A CA   6  
ATOM 10550 C C    . SER A 1 2   ? 17.553  14.182  3.729   1.00 0.00 ? 2   SER A C    6  
ATOM 10551 O O    . SER A 1 2   ? 18.087  13.538  4.631   1.00 0.00 ? 2   SER A O    6  
ATOM 10552 C CB   . SER A 1 2   ? 17.488  16.676  3.441   1.00 0.00 ? 2   SER A CB   6  
ATOM 10553 O OG   . SER A 1 2   ? 18.356  17.744  3.808   1.00 0.00 ? 2   SER A OG   6  
ATOM 10554 H H    . SER A 1 2   ? 17.833  15.820  1.125   1.00 0.00 ? 2   SER A H    6  
ATOM 10555 H HA   . SER A 1 2   ? 19.277  15.478  3.502   1.00 0.00 ? 2   SER A HA   6  
ATOM 10556 H HB2  . SER A 1 2   ? 16.897  16.971  2.574   1.00 0.00 ? 2   SER A HB2  6  
ATOM 10557 H HB3  . SER A 1 2   ? 16.787  16.483  4.253   1.00 0.00 ? 2   SER A HB3  6  
ATOM 10558 H HG   . SER A 1 2   ? 17.820  18.549  4.063   1.00 0.00 ? 2   SER A HG   6  
ATOM 10559 N N    . SER A 1 3   ? 16.364  13.908  3.213   1.00 0.00 ? 3   SER A N    6  
ATOM 10560 C CA   . SER A 1 3   ? 15.580  12.784  3.695   1.00 0.00 ? 3   SER A CA   6  
ATOM 10561 C C    . SER A 1 3   ? 14.300  12.646  2.869   1.00 0.00 ? 3   SER A C    6  
ATOM 10562 O O    . SER A 1 3   ? 14.007  11.572  2.347   1.00 0.00 ? 3   SER A O    6  
ATOM 10563 C CB   . SER A 1 3   ? 15.240  12.947  5.178   1.00 0.00 ? 3   SER A CB   6  
ATOM 10564 O OG   . SER A 1 3   ? 14.346  11.935  5.635   1.00 0.00 ? 3   SER A OG   6  
ATOM 10565 H H    . SER A 1 3   ? 15.938  14.437  2.479   1.00 0.00 ? 3   SER A H    6  
ATOM 10566 H HA   . SER A 1 3   ? 16.217  11.910  3.563   1.00 0.00 ? 3   SER A HA   6  
ATOM 10567 H HB2  . SER A 1 3   ? 16.157  12.913  5.766   1.00 0.00 ? 3   SER A HB2  6  
ATOM 10568 H HB3  . SER A 1 3   ? 14.792  13.927  5.342   1.00 0.00 ? 3   SER A HB3  6  
ATOM 10569 H HG   . SER A 1 3   ? 14.856  11.215  6.105   1.00 0.00 ? 3   SER A HG   6  
ATOM 10570 N N    . GLY A 1 4   ? 13.572  13.749  2.776   1.00 0.00 ? 4   GLY A N    6  
ATOM 10571 C CA   . GLY A 1 4   ? 12.330  13.765  2.022   1.00 0.00 ? 4   GLY A CA   6  
ATOM 10572 C C    . GLY A 1 4   ? 11.131  13.497  2.934   1.00 0.00 ? 4   GLY A C    6  
ATOM 10573 O O    . GLY A 1 4   ? 11.294  13.293  4.136   1.00 0.00 ? 4   GLY A O    6  
ATOM 10574 H H    . GLY A 1 4   ? 13.817  14.619  3.203   1.00 0.00 ? 4   GLY A H    6  
ATOM 10575 H HA2  . GLY A 1 4   ? 12.210  14.731  1.532   1.00 0.00 ? 4   GLY A HA2  6  
ATOM 10576 H HA3  . GLY A 1 4   ? 12.368  13.011  1.235   1.00 0.00 ? 4   GLY A HA3  6  
ATOM 10577 N N    . SER A 1 5   ? 9.953   13.506  2.328   1.00 0.00 ? 5   SER A N    6  
ATOM 10578 C CA   . SER A 1 5   ? 8.727   13.266  3.070   1.00 0.00 ? 5   SER A CA   6  
ATOM 10579 C C    . SER A 1 5   ? 8.668   11.807  3.526   1.00 0.00 ? 5   SER A C    6  
ATOM 10580 O O    . SER A 1 5   ? 8.980   10.900  2.756   1.00 0.00 ? 5   SER A O    6  
ATOM 10581 C CB   . SER A 1 5   ? 7.497   13.610  2.228   1.00 0.00 ? 5   SER A CB   6  
ATOM 10582 O OG   . SER A 1 5   ? 7.382   12.769  1.083   1.00 0.00 ? 5   SER A OG   6  
ATOM 10583 H H    . SER A 1 5   ? 9.829   13.672  1.349   1.00 0.00 ? 5   SER A H    6  
ATOM 10584 H HA   . SER A 1 5   ? 8.776   13.934  3.930   1.00 0.00 ? 5   SER A HA   6  
ATOM 10585 H HB2  . SER A 1 5   ? 6.600   13.514  2.840   1.00 0.00 ? 5   SER A HB2  6  
ATOM 10586 H HB3  . SER A 1 5   ? 7.555   14.651  1.909   1.00 0.00 ? 5   SER A HB3  6  
ATOM 10587 H HG   . SER A 1 5   ? 8.011   11.996  1.162   1.00 0.00 ? 5   SER A HG   6  
ATOM 10588 N N    . SER A 1 6   ? 8.265   11.626  4.775   1.00 0.00 ? 6   SER A N    6  
ATOM 10589 C CA   . SER A 1 6   ? 8.161   10.292  5.342   1.00 0.00 ? 6   SER A CA   6  
ATOM 10590 C C    . SER A 1 6   ? 6.695   9.954   5.618   1.00 0.00 ? 6   SER A C    6  
ATOM 10591 O O    . SER A 1 6   ? 5.966   10.760  6.195   1.00 0.00 ? 6   SER A O    6  
ATOM 10592 C CB   . SER A 1 6   ? 8.984   10.174  6.626   1.00 0.00 ? 6   SER A CB   6  
ATOM 10593 O OG   . SER A 1 6   ? 8.265   10.639  7.765   1.00 0.00 ? 6   SER A OG   6  
ATOM 10594 H H    . SER A 1 6   ? 8.013   12.370  5.394   1.00 0.00 ? 6   SER A H    6  
ATOM 10595 H HA   . SER A 1 6   ? 8.572   9.624   4.585   1.00 0.00 ? 6   SER A HA   6  
ATOM 10596 H HB2  . SER A 1 6   ? 9.271   9.134   6.778   1.00 0.00 ? 6   SER A HB2  6  
ATOM 10597 H HB3  . SER A 1 6   ? 9.905   10.747  6.521   1.00 0.00 ? 6   SER A HB3  6  
ATOM 10598 H HG   . SER A 1 6   ? 8.903   10.968  8.462   1.00 0.00 ? 6   SER A HG   6  
ATOM 10599 N N    . GLY A 1 7   ? 6.305   8.761   5.192   1.00 0.00 ? 7   GLY A N    6  
ATOM 10600 C CA   . GLY A 1 7   ? 4.939   8.307   5.386   1.00 0.00 ? 7   GLY A CA   6  
ATOM 10601 C C    . GLY A 1 7   ? 4.836   7.382   6.601   1.00 0.00 ? 7   GLY A C    6  
ATOM 10602 O O    . GLY A 1 7   ? 4.767   6.163   6.454   1.00 0.00 ? 7   GLY A O    6  
ATOM 10603 H H    . GLY A 1 7   ? 6.904   8.112   4.724   1.00 0.00 ? 7   GLY A H    6  
ATOM 10604 H HA2  . GLY A 1 7   ? 4.282   9.166   5.522   1.00 0.00 ? 7   GLY A HA2  6  
ATOM 10605 H HA3  . GLY A 1 7   ? 4.597   7.781   4.495   1.00 0.00 ? 7   GLY A HA3  6  
ATOM 10606 N N    . VAL A 1 8   ? 4.829   7.998   7.774   1.00 0.00 ? 8   VAL A N    6  
ATOM 10607 C CA   . VAL A 1 8   ? 4.735   7.246   9.014   1.00 0.00 ? 8   VAL A CA   6  
ATOM 10608 C C    . VAL A 1 8   ? 4.383   8.199   10.158  1.00 0.00 ? 8   VAL A C    6  
ATOM 10609 O O    . VAL A 1 8   ? 3.498   7.909   10.961  1.00 0.00 ? 8   VAL A O    6  
ATOM 10610 C CB   . VAL A 1 8   ? 6.034   6.474   9.257   1.00 0.00 ? 8   VAL A CB   6  
ATOM 10611 C CG1  . VAL A 1 8   ? 7.232   7.216   8.661   1.00 0.00 ? 8   VAL A CG1  6  
ATOM 10612 C CG2  . VAL A 1 8   ? 6.241   6.206   10.748  1.00 0.00 ? 8   VAL A CG2  6  
ATOM 10613 H H    . VAL A 1 8   ? 4.885   8.990   7.885   1.00 0.00 ? 8   VAL A H    6  
ATOM 10614 H HA   . VAL A 1 8   ? 3.929   6.522   8.899   1.00 0.00 ? 8   VAL A HA   6  
ATOM 10615 H HB   . VAL A 1 8   ? 5.951   5.511   8.752   1.00 0.00 ? 8   VAL A HB   6  
ATOM 10616 H HG11 . VAL A 1 8   ? 7.096   8.289   8.791   1.00 0.00 ? 8   VAL A HG11 6  
ATOM 10617 H HG12 . VAL A 1 8   ? 8.144   6.901   9.168   1.00 0.00 ? 8   VAL A HG12 6  
ATOM 10618 H HG13 . VAL A 1 8   ? 7.310   6.985   7.598   1.00 0.00 ? 8   VAL A HG13 6  
ATOM 10619 H HG21 . VAL A 1 8   ? 5.273   6.097   11.236  1.00 0.00 ? 8   VAL A HG21 6  
ATOM 10620 H HG22 . VAL A 1 8   ? 6.818   5.290   10.876  1.00 0.00 ? 8   VAL A HG22 6  
ATOM 10621 H HG23 . VAL A 1 8   ? 6.782   7.040   11.196  1.00 0.00 ? 8   VAL A HG23 6  
ATOM 10622 N N    . ARG A 1 9   ? 5.095   9.316   10.196  1.00 0.00 ? 9   ARG A N    6  
ATOM 10623 C CA   . ARG A 1 9   ? 4.869   10.312  11.228  1.00 0.00 ? 9   ARG A CA   6  
ATOM 10624 C C    . ARG A 1 9   ? 5.138   9.715   12.611  1.00 0.00 ? 9   ARG A C    6  
ATOM 10625 O O    . ARG A 1 9   ? 6.265   9.757   13.101  1.00 0.00 ? 9   ARG A O    6  
ATOM 10626 C CB   . ARG A 1 9   ? 3.434   10.841  11.179  1.00 0.00 ? 9   ARG A CB   6  
ATOM 10627 C CG   . ARG A 1 9   ? 3.242   11.798  10.002  1.00 0.00 ? 9   ARG A CG   6  
ATOM 10628 C CD   . ARG A 1 9   ? 1.779   12.229  9.877   1.00 0.00 ? 9   ARG A CD   6  
ATOM 10629 N NE   . ARG A 1 9   ? 1.625   13.632  10.320  1.00 0.00 ? 9   ARG A NE   6  
ATOM 10630 C CZ   . ARG A 1 9   ? 1.994   14.695  9.592   1.00 0.00 ? 9   ARG A CZ   6  
ATOM 10631 N NH1  . ARG A 1 9   ? 2.542   14.520  8.382   1.00 0.00 ? 9   ARG A NH1  6  
ATOM 10632 N NH2  . ARG A 1 9   ? 1.816   15.932  10.075  1.00 0.00 ? 9   ARG A NH2  6  
ATOM 10633 H H    . ARG A 1 9   ? 5.813   9.543   9.539   1.00 0.00 ? 9   ARG A H    6  
ATOM 10634 H HA   . ARG A 1 9   ? 5.574   11.112  11.003  1.00 0.00 ? 9   ARG A HA   6  
ATOM 10635 H HB2  . ARG A 1 9   ? 2.738   10.006  11.091  1.00 0.00 ? 9   ARG A HB2  6  
ATOM 10636 H HB3  . ARG A 1 9   ? 3.199   11.354  12.112  1.00 0.00 ? 9   ARG A HB3  6  
ATOM 10637 H HG2  . ARG A 1 9   ? 3.873   12.677  10.136  1.00 0.00 ? 9   ARG A HG2  6  
ATOM 10638 H HG3  . ARG A 1 9   ? 3.562   11.314  9.079   1.00 0.00 ? 9   ARG A HG3  6  
ATOM 10639 H HD2  . ARG A 1 9   ? 1.448   12.126  8.844   1.00 0.00 ? 9   ARG A HD2  6  
ATOM 10640 H HD3  . ARG A 1 9   ? 1.147   11.577  10.480  1.00 0.00 ? 9   ARG A HD3  6  
ATOM 10641 H HE   . ARG A 1 9   ? 1.220   13.798  11.220  1.00 0.00 ? 9   ARG A HE   6  
ATOM 10642 H HH11 . ARG A 1 9   ? 2.674   13.597  8.022   1.00 0.00 ? 9   ARG A HH11 6  
ATOM 10643 H HH12 . ARG A 1 9   ? 2.817   15.313  7.839   1.00 0.00 ? 9   ARG A HH12 6  
ATOM 10644 H HH21 . ARG A 1 9   ? 1.408   16.063  10.978  1.00 0.00 ? 9   ARG A HH21 6  
ATOM 10645 H HH22 . ARG A 1 9   ? 2.092   16.725  9.532   1.00 0.00 ? 9   ARG A HH22 6  
ATOM 10646 N N    . ARG A 1 10  ? 4.083   9.172   13.202  1.00 0.00 ? 10  ARG A N    6  
ATOM 10647 C CA   . ARG A 1 10  ? 4.191   8.567   14.518  1.00 0.00 ? 10  ARG A CA   6  
ATOM 10648 C C    . ARG A 1 10  ? 3.432   7.240   14.556  1.00 0.00 ? 10  ARG A C    6  
ATOM 10649 O O    . ARG A 1 10  ? 2.809   6.905   15.563  1.00 0.00 ? 10  ARG A O    6  
ATOM 10650 C CB   . ARG A 1 10  ? 3.635   9.496   15.599  1.00 0.00 ? 10  ARG A CB   6  
ATOM 10651 C CG   . ARG A 1 10  ? 3.778   8.869   16.987  1.00 0.00 ? 10  ARG A CG   6  
ATOM 10652 C CD   . ARG A 1 10  ? 4.145   9.926   18.031  1.00 0.00 ? 10  ARG A CD   6  
ATOM 10653 N NE   . ARG A 1 10  ? 2.940   10.689  18.425  1.00 0.00 ? 10  ARG A NE   6  
ATOM 10654 C CZ   . ARG A 1 10  ? 2.896   11.546  19.454  1.00 0.00 ? 10  ARG A CZ   6  
ATOM 10655 N NH1  . ARG A 1 10  ? 3.991   11.756  20.198  1.00 0.00 ? 10  ARG A NH1  6  
ATOM 10656 N NH2  . ARG A 1 10  ? 1.758   12.194  19.739  1.00 0.00 ? 10  ARG A NH2  6  
ATOM 10657 H H    . ARG A 1 10  ? 3.169   9.142   12.796  1.00 0.00 ? 10  ARG A H    6  
ATOM 10658 H HA   . ARG A 1 10  ? 5.260   8.412   14.666  1.00 0.00 ? 10  ARG A HA   6  
ATOM 10659 H HB2  . ARG A 1 10  ? 4.162   10.450  15.570  1.00 0.00 ? 10  ARG A HB2  6  
ATOM 10660 H HB3  . ARG A 1 10  ? 2.585   9.707   15.397  1.00 0.00 ? 10  ARG A HB3  6  
ATOM 10661 H HG2  . ARG A 1 10  ? 2.843   8.384   17.269  1.00 0.00 ? 10  ARG A HG2  6  
ATOM 10662 H HG3  . ARG A 1 10  ? 4.544   8.095   16.963  1.00 0.00 ? 10  ARG A HG3  6  
ATOM 10663 H HD2  . ARG A 1 10  ? 4.586   9.448   18.906  1.00 0.00 ? 10  ARG A HD2  6  
ATOM 10664 H HD3  . ARG A 1 10  ? 4.897   10.604  17.625  1.00 0.00 ? 10  ARG A HD3  6  
ATOM 10665 H HE   . ARG A 1 10  ? 2.105   10.556  17.891  1.00 0.00 ? 10  ARG A HE   6  
ATOM 10666 H HH11 . ARG A 1 10  ? 4.840   11.272  19.986  1.00 0.00 ? 10  ARG A HH11 6  
ATOM 10667 H HH12 . ARG A 1 10  ? 3.958   12.396  20.966  1.00 0.00 ? 10  ARG A HH12 6  
ATOM 10668 H HH21 . ARG A 1 10  ? 0.941   12.038  19.184  1.00 0.00 ? 10  ARG A HH21 6  
ATOM 10669 H HH22 . ARG A 1 10  ? 1.726   12.834  20.507  1.00 0.00 ? 10  ARG A HH22 6  
ATOM 10670 N N    . VAL A 1 11  ? 3.508   6.519   13.447  1.00 0.00 ? 11  VAL A N    6  
ATOM 10671 C CA   . VAL A 1 11  ? 2.835   5.235   13.340  1.00 0.00 ? 11  VAL A CA   6  
ATOM 10672 C C    . VAL A 1 11  ? 3.646   4.176   14.090  1.00 0.00 ? 11  VAL A C    6  
ATOM 10673 O O    . VAL A 1 11  ? 4.875   4.173   14.030  1.00 0.00 ? 11  VAL A O    6  
ATOM 10674 C CB   . VAL A 1 11  ? 2.608   4.884   11.869  1.00 0.00 ? 11  VAL A CB   6  
ATOM 10675 C CG1  . VAL A 1 11  ? 2.688   3.372   11.647  1.00 0.00 ? 11  VAL A CG1  6  
ATOM 10676 C CG2  . VAL A 1 11  ? 1.272   5.441   11.373  1.00 0.00 ? 11  VAL A CG2  6  
ATOM 10677 H H    . VAL A 1 11  ? 4.016   6.798   12.632  1.00 0.00 ? 11  VAL A H    6  
ATOM 10678 H HA   . VAL A 1 11  ? 1.861   5.334   13.818  1.00 0.00 ? 11  VAL A HA   6  
ATOM 10679 H HB   . VAL A 1 11  ? 3.402   5.351   11.286  1.00 0.00 ? 11  VAL A HB   6  
ATOM 10680 H HG11 . VAL A 1 11  ? 3.623   2.994   12.061  1.00 0.00 ? 11  VAL A HG11 6  
ATOM 10681 H HG12 . VAL A 1 11  ? 1.848   2.887   12.144  1.00 0.00 ? 11  VAL A HG12 6  
ATOM 10682 H HG13 . VAL A 1 11  ? 2.652   3.159   10.579  1.00 0.00 ? 11  VAL A HG13 6  
ATOM 10683 H HG21 . VAL A 1 11  ? 1.098   5.110   10.348  1.00 0.00 ? 11  VAL A HG21 6  
ATOM 10684 H HG22 . VAL A 1 11  ? 0.467   5.078   12.012  1.00 0.00 ? 11  VAL A HG22 6  
ATOM 10685 H HG23 . VAL A 1 11  ? 1.298   6.530   11.403  1.00 0.00 ? 11  VAL A HG23 6  
ATOM 10686 N N    . PRO A 1 12  ? 2.907   3.279   14.796  1.00 0.00 ? 12  PRO A N    6  
ATOM 10687 C CA   . PRO A 1 12  ? 3.544   2.217   15.556  1.00 0.00 ? 12  PRO A CA   6  
ATOM 10688 C C    . PRO A 1 12  ? 4.060   1.114   14.630  1.00 0.00 ? 12  PRO A C    6  
ATOM 10689 O O    . PRO A 1 12  ? 5.053   0.457   14.935  1.00 0.00 ? 12  PRO A O    6  
ATOM 10690 C CB   . PRO A 1 12  ? 2.477   1.730   16.522  1.00 0.00 ? 12  PRO A CB   6  
ATOM 10691 C CG   . PRO A 1 12  ? 1.151   2.213   15.957  1.00 0.00 ? 12  PRO A CG   6  
ATOM 10692 C CD   . PRO A 1 12  ? 1.450   3.253   14.890  1.00 0.00 ? 12  PRO A CD   6  
ATOM 10693 H HA   . PRO A 1 12  ? 4.347   2.569   16.037  1.00 0.00 ? 12  PRO A HA   6  
ATOM 10694 H HB2  . PRO A 1 12  ? 2.493   0.644   16.607  1.00 0.00 ? 12  PRO A HB2  6  
ATOM 10695 H HB3  . PRO A 1 12  ? 2.643   2.130   17.522  1.00 0.00 ? 12  PRO A HB3  6  
ATOM 10696 H HG2  . PRO A 1 12  ? 0.591   1.380   15.532  1.00 0.00 ? 12  PRO A HG2  6  
ATOM 10697 H HG3  . PRO A 1 12  ? 0.533   2.642   16.746  1.00 0.00 ? 12  PRO A HG3  6  
ATOM 10698 H HD2  . PRO A 1 12  ? 0.997   2.983   13.936  1.00 0.00 ? 12  PRO A HD2  6  
ATOM 10699 H HD3  . PRO A 1 12  ? 1.053   4.230   15.166  1.00 0.00 ? 12  PRO A HD3  6  
ATOM 10700 N N    . LEU A 1 13  ? 3.362   0.946   13.516  1.00 0.00 ? 13  LEU A N    6  
ATOM 10701 C CA   . LEU A 1 13  ? 3.737   -0.066  12.543  1.00 0.00 ? 13  LEU A CA   6  
ATOM 10702 C C    . LEU A 1 13  ? 5.257   -0.055  12.363  1.00 0.00 ? 13  LEU A C    6  
ATOM 10703 O O    . LEU A 1 13  ? 5.910   -1.087  12.511  1.00 0.00 ? 13  LEU A O    6  
ATOM 10704 C CB   . LEU A 1 13  ? 2.962   0.131   11.239  1.00 0.00 ? 13  LEU A CB   6  
ATOM 10705 C CG   . LEU A 1 13  ? 1.439   0.019   11.341  1.00 0.00 ? 13  LEU A CG   6  
ATOM 10706 C CD1  . LEU A 1 13  ? 0.753   0.998   10.387  1.00 0.00 ? 13  LEU A CD1  6  
ATOM 10707 C CD2  . LEU A 1 13  ? 0.979   -1.423  11.112  1.00 0.00 ? 13  LEU A CD2  6  
ATOM 10708 H H    . LEU A 1 13  ? 2.555   1.485   13.275  1.00 0.00 ? 13  LEU A H    6  
ATOM 10709 H HA   . LEU A 1 13  ? 3.445   -1.034  12.950  1.00 0.00 ? 13  LEU A HA   6  
ATOM 10710 H HB2  . LEU A 1 13  ? 3.208   1.114   10.838  1.00 0.00 ? 13  LEU A HB2  6  
ATOM 10711 H HB3  . LEU A 1 13  ? 3.313   -0.605  10.516  1.00 0.00 ? 13  LEU A HB3  6  
ATOM 10712 H HG   . LEU A 1 13  ? 1.143   0.294   12.353  1.00 0.00 ? 13  LEU A HG   6  
ATOM 10713 H HD11 . LEU A 1 13  ? -0.033  0.479   9.838   1.00 0.00 ? 13  LEU A HD11 6  
ATOM 10714 H HD12 . LEU A 1 13  ? 0.317   1.817   10.959  1.00 0.00 ? 13  LEU A HD12 6  
ATOM 10715 H HD13 . LEU A 1 13  ? 1.486   1.395   9.684   1.00 0.00 ? 13  LEU A HD13 6  
ATOM 10716 H HD21 . LEU A 1 13  ? 1.699   -1.937  10.474  1.00 0.00 ? 13  LEU A HD21 6  
ATOM 10717 H HD22 . LEU A 1 13  ? 0.909   -1.938  12.069  1.00 0.00 ? 13  LEU A HD22 6  
ATOM 10718 H HD23 . LEU A 1 13  ? 0.002   -1.420  10.628  1.00 0.00 ? 13  LEU A HD23 6  
ATOM 10719 N N    . PHE A 1 14  ? 5.775   1.122   12.046  1.00 0.00 ? 14  PHE A N    6  
ATOM 10720 C CA   . PHE A 1 14  ? 7.205   1.281   11.844  1.00 0.00 ? 14  PHE A CA   6  
ATOM 10721 C C    . PHE A 1 14  ? 7.930   1.462   13.179  1.00 0.00 ? 14  PHE A C    6  
ATOM 10722 O O    . PHE A 1 14  ? 8.656   2.437   13.368  1.00 0.00 ? 14  PHE A O    6  
ATOM 10723 C CB   . PHE A 1 14  ? 7.400   2.540   10.997  1.00 0.00 ? 14  PHE A CB   6  
ATOM 10724 C CG   . PHE A 1 14  ? 6.451   2.637   9.800   1.00 0.00 ? 14  PHE A CG   6  
ATOM 10725 C CD1  . PHE A 1 14  ? 6.716   1.939   8.663   1.00 0.00 ? 14  PHE A CD1  6  
ATOM 10726 C CD2  . PHE A 1 14  ? 5.343   3.422   9.873   1.00 0.00 ? 14  PHE A CD2  6  
ATOM 10727 C CE1  . PHE A 1 14  ? 5.836   2.030   7.553   1.00 0.00 ? 14  PHE A CE1  6  
ATOM 10728 C CE2  . PHE A 1 14  ? 4.463   3.513   8.763   1.00 0.00 ? 14  PHE A CE2  6  
ATOM 10729 C CZ   . PHE A 1 14  ? 4.728   2.815   7.626   1.00 0.00 ? 14  PHE A CZ   6  
ATOM 10730 H H    . PHE A 1 14  ? 5.236   1.957   11.928  1.00 0.00 ? 14  PHE A H    6  
ATOM 10731 H HA   . PHE A 1 14  ? 7.565   0.375   11.357  1.00 0.00 ? 14  PHE A HA   6  
ATOM 10732 H HB2  . PHE A 1 14  ? 7.262   3.416   11.629  1.00 0.00 ? 14  PHE A HB2  6  
ATOM 10733 H HB3  . PHE A 1 14  ? 8.428   2.566   10.635  1.00 0.00 ? 14  PHE A HB3  6  
ATOM 10734 H HD1  . PHE A 1 14  ? 7.605   1.310   8.605   1.00 0.00 ? 14  PHE A HD1  6  
ATOM 10735 H HD2  . PHE A 1 14  ? 5.131   3.982   10.784  1.00 0.00 ? 14  PHE A HD2  6  
ATOM 10736 H HE1  . PHE A 1 14  ? 6.048   1.470   6.642   1.00 0.00 ? 14  PHE A HE1  6  
ATOM 10737 H HE2  . PHE A 1 14  ? 3.575   4.142   8.822   1.00 0.00 ? 14  PHE A HE2  6  
ATOM 10738 H HZ   . PHE A 1 14  ? 4.052   2.884   6.774   1.00 0.00 ? 14  PHE A HZ   6  
ATOM 10739 N N    . GLU A 1 15  ? 7.709   0.507   14.071  1.00 0.00 ? 15  GLU A N    6  
ATOM 10740 C CA   . GLU A 1 15  ? 8.333   0.549   15.382  1.00 0.00 ? 15  GLU A CA   6  
ATOM 10741 C C    . GLU A 1 15  ? 9.717   -0.103  15.333  1.00 0.00 ? 15  GLU A C    6  
ATOM 10742 O O    . GLU A 1 15  ? 10.704  0.497   15.754  1.00 0.00 ? 15  GLU A O    6  
ATOM 10743 C CB   . GLU A 1 15  ? 7.447   -0.124  16.432  1.00 0.00 ? 15  GLU A CB   6  
ATOM 10744 C CG   . GLU A 1 15  ? 6.724   0.917   17.289  1.00 0.00 ? 15  GLU A CG   6  
ATOM 10745 C CD   . GLU A 1 15  ? 6.936   0.644   18.779  1.00 0.00 ? 15  GLU A CD   6  
ATOM 10746 O OE1  . GLU A 1 15  ? 6.482   -0.430  19.230  1.00 0.00 ? 15  GLU A OE1  6  
ATOM 10747 O OE2  . GLU A 1 15  ? 7.548   1.515   19.434  1.00 0.00 ? 15  GLU A OE2  6  
ATOM 10748 H H    . GLU A 1 15  ? 7.118   -0.283  13.909  1.00 0.00 ? 15  GLU A H    6  
ATOM 10749 H HA   . GLU A 1 15  ? 8.431   1.607   15.623  1.00 0.00 ? 15  GLU A HA   6  
ATOM 10750 H HB2  . GLU A 1 15  ? 6.716   -0.766  15.940  1.00 0.00 ? 15  GLU A HB2  6  
ATOM 10751 H HB3  . GLU A 1 15  ? 8.056   -0.766  17.070  1.00 0.00 ? 15  GLU A HB3  6  
ATOM 10752 H HG2  . GLU A 1 15  ? 7.090   1.914   17.042  1.00 0.00 ? 15  GLU A HG2  6  
ATOM 10753 H HG3  . GLU A 1 15  ? 5.658   0.904   17.061  1.00 0.00 ? 15  GLU A HG3  6  
ATOM 10754 N N    . ASN A 1 16  ? 9.743   -1.322  14.816  1.00 0.00 ? 16  ASN A N    6  
ATOM 10755 C CA   . ASN A 1 16  ? 10.989  -2.062  14.706  1.00 0.00 ? 16  ASN A CA   6  
ATOM 10756 C C    . ASN A 1 16  ? 11.458  -2.050  13.250  1.00 0.00 ? 16  ASN A C    6  
ATOM 10757 O O    . ASN A 1 16  ? 12.343  -2.816  12.873  1.00 0.00 ? 16  ASN A O    6  
ATOM 10758 C CB   . ASN A 1 16  ? 10.804  -3.520  15.131  1.00 0.00 ? 16  ASN A CB   6  
ATOM 10759 C CG   . ASN A 1 16  ? 9.903   -4.268  14.146  1.00 0.00 ? 16  ASN A CG   6  
ATOM 10760 O OD1  . ASN A 1 16  ? 8.718   -4.456  14.368  1.00 0.00 ? 16  ASN A OD1  6  
ATOM 10761 N ND2  . ASN A 1 16  ? 10.529  -4.683  13.049  1.00 0.00 ? 16  ASN A ND2  6  
ATOM 10762 H H    . ASN A 1 16  ? 8.935   -1.803  14.476  1.00 0.00 ? 16  ASN A H    6  
ATOM 10763 H HA   . ASN A 1 16  ? 11.685  -1.551  15.372  1.00 0.00 ? 16  ASN A HA   6  
ATOM 10764 H HB2  . ASN A 1 16  ? 11.775  -4.012  15.188  1.00 0.00 ? 16  ASN A HB2  6  
ATOM 10765 H HB3  . ASN A 1 16  ? 10.368  -3.558  16.130  1.00 0.00 ? 16  ASN A HB3  6  
ATOM 10766 H HD21 . ASN A 1 16  ? 11.504  -4.496  12.928  1.00 0.00 ? 16  ASN A HD21 6  
ATOM 10767 H HD22 . ASN A 1 16  ? 10.025  -5.182  12.344  1.00 0.00 ? 16  ASN A HD22 6  
ATOM 10768 N N    . MET A 1 17  ? 10.843  -1.172  12.471  1.00 0.00 ? 17  MET A N    6  
ATOM 10769 C CA   . MET A 1 17  ? 11.186  -1.051  11.064  1.00 0.00 ? 17  MET A CA   6  
ATOM 10770 C C    . MET A 1 17  ? 12.227  0.049   10.847  1.00 0.00 ? 17  MET A C    6  
ATOM 10771 O O    . MET A 1 17  ? 11.972  1.217   11.138  1.00 0.00 ? 17  MET A O    6  
ATOM 10772 C CB   . MET A 1 17  ? 9.927   -0.728  10.257  1.00 0.00 ? 17  MET A CB   6  
ATOM 10773 C CG   . MET A 1 17  ? 8.958   -1.912  10.257  1.00 0.00 ? 17  MET A CG   6  
ATOM 10774 S SD   . MET A 1 17  ? 7.411   -1.435  9.505   1.00 0.00 ? 17  MET A SD   6  
ATOM 10775 C CE   . MET A 1 17  ? 7.906   -1.372  7.791   1.00 0.00 ? 17  MET A CE   6  
ATOM 10776 H H    . MET A 1 17  ? 10.124  -0.553  12.785  1.00 0.00 ? 17  MET A H    6  
ATOM 10777 H HA   . MET A 1 17  ? 11.603  -2.017  10.780  1.00 0.00 ? 17  MET A HA   6  
ATOM 10778 H HB2  . MET A 1 17  ? 9.435   0.148   10.678  1.00 0.00 ? 17  MET A HB2  6  
ATOM 10779 H HB3  . MET A 1 17  ? 10.201  -0.478  9.232   1.00 0.00 ? 17  MET A HB3  6  
ATOM 10780 H HG2  . MET A 1 17  ? 9.393   -2.750  9.712   1.00 0.00 ? 17  MET A HG2  6  
ATOM 10781 H HG3  . MET A 1 17  ? 8.785   -2.252  11.278  1.00 0.00 ? 17  MET A HG3  6  
ATOM 10782 H HE1  . MET A 1 17  ? 7.797   -0.354  7.419   1.00 0.00 ? 17  MET A HE1  6  
ATOM 10783 H HE2  . MET A 1 17  ? 8.947   -1.683  7.702   1.00 0.00 ? 17  MET A HE2  6  
ATOM 10784 H HE3  . MET A 1 17  ? 7.276   -2.042  7.206   1.00 0.00 ? 17  MET A HE3  6  
ATOM 10785 N N    . ASP A 1 18  ? 13.379  -0.362  10.337  1.00 0.00 ? 18  ASP A N    6  
ATOM 10786 C CA   . ASP A 1 18  ? 14.459  0.573   10.077  1.00 0.00 ? 18  ASP A CA   6  
ATOM 10787 C C    . ASP A 1 18  ? 14.007  1.589   9.026   1.00 0.00 ? 18  ASP A C    6  
ATOM 10788 O O    . ASP A 1 18  ? 13.087  1.322   8.255   1.00 0.00 ? 18  ASP A O    6  
ATOM 10789 C CB   . ASP A 1 18  ? 15.695  -0.148  9.535   1.00 0.00 ? 18  ASP A CB   6  
ATOM 10790 C CG   . ASP A 1 18  ? 16.262  -1.235  10.451  1.00 0.00 ? 18  ASP A CG   6  
ATOM 10791 O OD1  . ASP A 1 18  ? 16.137  -1.061  11.683  1.00 0.00 ? 18  ASP A OD1  6  
ATOM 10792 O OD2  . ASP A 1 18  ? 16.809  -2.214  9.899   1.00 0.00 ? 18  ASP A OD2  6  
ATOM 10793 H H    . ASP A 1 18  ? 13.578  -1.314  10.103  1.00 0.00 ? 18  ASP A H    6  
ATOM 10794 H HA   . ASP A 1 18  ? 14.675  1.037   11.040  1.00 0.00 ? 18  ASP A HA   6  
ATOM 10795 H HB2  . ASP A 1 18  ? 15.442  -0.599  8.576   1.00 0.00 ? 18  ASP A HB2  6  
ATOM 10796 H HB3  . ASP A 1 18  ? 16.474  0.589   9.345   1.00 0.00 ? 18  ASP A HB3  6  
ATOM 10797 N N    . GLU A 1 19  ? 14.675  2.734   9.030   1.00 0.00 ? 19  GLU A N    6  
ATOM 10798 C CA   . GLU A 1 19  ? 14.353  3.791   8.087   1.00 0.00 ? 19  GLU A CA   6  
ATOM 10799 C C    . GLU A 1 19  ? 14.458  3.272   6.651   1.00 0.00 ? 19  GLU A C    6  
ATOM 10800 O O    . GLU A 1 19  ? 13.564  3.500   5.838   1.00 0.00 ? 19  GLU A O    6  
ATOM 10801 C CB   . GLU A 1 19  ? 15.256  5.008   8.298   1.00 0.00 ? 19  GLU A CB   6  
ATOM 10802 C CG   . GLU A 1 19  ? 15.043  5.615   9.686   1.00 0.00 ? 19  GLU A CG   6  
ATOM 10803 C CD   . GLU A 1 19  ? 16.368  6.093   10.284  1.00 0.00 ? 19  GLU A CD   6  
ATOM 10804 O OE1  . GLU A 1 19  ? 17.246  5.227   10.483  1.00 0.00 ? 19  GLU A OE1  6  
ATOM 10805 O OE2  . GLU A 1 19  ? 16.471  7.315   10.529  1.00 0.00 ? 19  GLU A OE2  6  
ATOM 10806 H H    . GLU A 1 19  ? 15.422  2.943   9.661   1.00 0.00 ? 19  GLU A H    6  
ATOM 10807 H HA   . GLU A 1 19  ? 13.322  4.070   8.305   1.00 0.00 ? 19  GLU A HA   6  
ATOM 10808 H HB2  . GLU A 1 19  ? 16.300  4.715   8.181   1.00 0.00 ? 19  GLU A HB2  6  
ATOM 10809 H HB3  . GLU A 1 19  ? 15.048  5.757   7.534   1.00 0.00 ? 19  GLU A HB3  6  
ATOM 10810 H HG2  . GLU A 1 19  ? 14.348  6.451   9.618   1.00 0.00 ? 19  GLU A HG2  6  
ATOM 10811 H HG3  . GLU A 1 19  ? 14.589  4.875   10.345  1.00 0.00 ? 19  GLU A HG3  6  
ATOM 10812 N N    . ARG A 1 20  ? 15.558  2.584   6.384   1.00 0.00 ? 20  ARG A N    6  
ATOM 10813 C CA   . ARG A 1 20  ? 15.792  2.031   5.061   1.00 0.00 ? 20  ARG A CA   6  
ATOM 10814 C C    . ARG A 1 20  ? 14.562  1.255   4.585   1.00 0.00 ? 20  ARG A C    6  
ATOM 10815 O O    . ARG A 1 20  ? 14.298  1.177   3.386   1.00 0.00 ? 20  ARG A O    6  
ATOM 10816 C CB   . ARG A 1 20  ? 17.006  1.099   5.060   1.00 0.00 ? 20  ARG A CB   6  
ATOM 10817 C CG   . ARG A 1 20  ? 18.276  1.854   5.458   1.00 0.00 ? 20  ARG A CG   6  
ATOM 10818 C CD   . ARG A 1 20  ? 18.936  2.500   4.238   1.00 0.00 ? 20  ARG A CD   6  
ATOM 10819 N NE   . ARG A 1 20  ? 20.059  1.660   3.767   1.00 0.00 ? 20  ARG A NE   6  
ATOM 10820 C CZ   . ARG A 1 20  ? 20.889  2.006   2.773   1.00 0.00 ? 20  ARG A CZ   6  
ATOM 10821 N NH1  . ARG A 1 20  ? 20.727  3.175   2.140   1.00 0.00 ? 20  ARG A NH1  6  
ATOM 10822 N NH2  . ARG A 1 20  ? 21.882  1.181   2.412   1.00 0.00 ? 20  ARG A NH2  6  
ATOM 10823 H H    . ARG A 1 20  ? 16.281  2.403   7.052   1.00 0.00 ? 20  ARG A H    6  
ATOM 10824 H HA   . ARG A 1 20  ? 15.979  2.897   4.426   1.00 0.00 ? 20  ARG A HA   6  
ATOM 10825 H HB2  . ARG A 1 20  ? 16.837  0.275   5.752   1.00 0.00 ? 20  ARG A HB2  6  
ATOM 10826 H HB3  . ARG A 1 20  ? 17.133  0.663   4.069   1.00 0.00 ? 20  ARG A HB3  6  
ATOM 10827 H HG2  . ARG A 1 20  ? 18.032  2.621   6.193   1.00 0.00 ? 20  ARG A HG2  6  
ATOM 10828 H HG3  . ARG A 1 20  ? 18.977  1.168   5.934   1.00 0.00 ? 20  ARG A HG3  6  
ATOM 10829 H HD2  . ARG A 1 20  ? 18.203  2.623   3.441   1.00 0.00 ? 20  ARG A HD2  6  
ATOM 10830 H HD3  . ARG A 1 20  ? 19.297  3.496   4.495   1.00 0.00 ? 20  ARG A HD3  6  
ATOM 10831 H HE   . ARG A 1 20  ? 20.209  0.781   4.218   1.00 0.00 ? 20  ARG A HE   6  
ATOM 10832 H HH11 . ARG A 1 20  ? 19.986  3.791   2.409   1.00 0.00 ? 20  ARG A HH11 6  
ATOM 10833 H HH12 . ARG A 1 20  ? 21.346  3.433   1.398   1.00 0.00 ? 20  ARG A HH12 6  
ATOM 10834 H HH21 . ARG A 1 20  ? 22.003  0.308   2.884   1.00 0.00 ? 20  ARG A HH21 6  
ATOM 10835 H HH22 . ARG A 1 20  ? 22.501  1.438   1.670   1.00 0.00 ? 20  ARG A HH22 6  
ATOM 10836 N N    . LEU A 1 21  ? 13.842  0.700   5.550   1.00 0.00 ? 21  LEU A N    6  
ATOM 10837 C CA   . LEU A 1 21  ? 12.647  -0.067  5.244   1.00 0.00 ? 21  LEU A CA   6  
ATOM 10838 C C    . LEU A 1 21  ? 11.525  0.888   4.831   1.00 0.00 ? 21  LEU A C    6  
ATOM 10839 O O    . LEU A 1 21  ? 10.723  0.567   3.955   1.00 0.00 ? 21  LEU A O    6  
ATOM 10840 C CB   . LEU A 1 21  ? 12.279  -0.975  6.419   1.00 0.00 ? 21  LEU A CB   6  
ATOM 10841 C CG   . LEU A 1 21  ? 11.477  -2.231  6.070   1.00 0.00 ? 21  LEU A CG   6  
ATOM 10842 C CD1  . LEU A 1 21  ? 12.211  -3.078  5.029   1.00 0.00 ? 21  LEU A CD1  6  
ATOM 10843 C CD2  . LEU A 1 21  ? 11.139  -3.033  7.328   1.00 0.00 ? 21  LEU A CD2  6  
ATOM 10844 H H    . LEU A 1 21  ? 14.064  0.769   6.522   1.00 0.00 ? 21  LEU A H    6  
ATOM 10845 H HA   . LEU A 1 21  ? 12.880  -0.713  4.398   1.00 0.00 ? 21  LEU A HA   6  
ATOM 10846 H HB2  . LEU A 1 21  ? 13.198  -1.283  6.917   1.00 0.00 ? 21  LEU A HB2  6  
ATOM 10847 H HB3  . LEU A 1 21  ? 11.706  -0.391  7.139   1.00 0.00 ? 21  LEU A HB3  6  
ATOM 10848 H HG   . LEU A 1 21  ? 10.532  -1.920  5.624   1.00 0.00 ? 21  LEU A HG   6  
ATOM 10849 H HD11 . LEU A 1 21  ? 12.164  -2.583  4.059   1.00 0.00 ? 21  LEU A HD11 6  
ATOM 10850 H HD12 . LEU A 1 21  ? 13.252  -3.198  5.327   1.00 0.00 ? 21  LEU A HD12 6  
ATOM 10851 H HD13 . LEU A 1 21  ? 11.738  -4.058  4.960   1.00 0.00 ? 21  LEU A HD13 6  
ATOM 10852 H HD21 . LEU A 1 21  ? 12.008  -3.619  7.629   1.00 0.00 ? 21  LEU A HD21 6  
ATOM 10853 H HD22 . LEU A 1 21  ? 10.866  -2.350  8.132   1.00 0.00 ? 21  LEU A HD22 6  
ATOM 10854 H HD23 . LEU A 1 21  ? 10.304  -3.702  7.120   1.00 0.00 ? 21  LEU A HD23 6  
ATOM 10855 N N    . LEU A 1 22  ? 11.505  2.043   5.480   1.00 0.00 ? 22  LEU A N    6  
ATOM 10856 C CA   . LEU A 1 22  ? 10.495  3.047   5.190   1.00 0.00 ? 22  LEU A CA   6  
ATOM 10857 C C    . LEU A 1 22  ? 10.649  3.516   3.742   1.00 0.00 ? 22  LEU A C    6  
ATOM 10858 O O    . LEU A 1 22  ? 9.739   3.349   2.932   1.00 0.00 ? 22  LEU A O    6  
ATOM 10859 C CB   . LEU A 1 22  ? 10.558  4.182   6.215   1.00 0.00 ? 22  LEU A CB   6  
ATOM 10860 C CG   . LEU A 1 22  ? 9.766   3.965   7.506   1.00 0.00 ? 22  LEU A CG   6  
ATOM 10861 C CD1  . LEU A 1 22  ? 8.263   3.917   7.225   1.00 0.00 ? 22  LEU A CD1  6  
ATOM 10862 C CD2  . LEU A 1 22  ? 10.251  2.715   8.243   1.00 0.00 ? 22  LEU A CD2  6  
ATOM 10863 H H    . LEU A 1 22  ? 12.161  2.296   6.191   1.00 0.00 ? 22  LEU A H    6  
ATOM 10864 H HA   . LEU A 1 22  ? 9.521   2.570   5.297   1.00 0.00 ? 22  LEU A HA   6  
ATOM 10865 H HB2  . LEU A 1 22  ? 11.603  4.350   6.477   1.00 0.00 ? 22  LEU A HB2  6  
ATOM 10866 H HB3  . LEU A 1 22  ? 10.198  5.094   5.739   1.00 0.00 ? 22  LEU A HB3  6  
ATOM 10867 H HG   . LEU A 1 22  ? 9.944   4.816   8.163   1.00 0.00 ? 22  LEU A HG   6  
ATOM 10868 H HD11 . LEU A 1 22  ? 8.006   4.683   6.493   1.00 0.00 ? 22  LEU A HD11 6  
ATOM 10869 H HD12 . LEU A 1 22  ? 7.997   2.936   6.832   1.00 0.00 ? 22  LEU A HD12 6  
ATOM 10870 H HD13 . LEU A 1 22  ? 7.715   4.099   8.149   1.00 0.00 ? 22  LEU A HD13 6  
ATOM 10871 H HD21 . LEU A 1 22  ? 9.934   2.762   9.285   1.00 0.00 ? 22  LEU A HD21 6  
ATOM 10872 H HD22 . LEU A 1 22  ? 9.826   1.828   7.774   1.00 0.00 ? 22  LEU A HD22 6  
ATOM 10873 H HD23 . LEU A 1 22  ? 11.339  2.665   8.196   1.00 0.00 ? 22  LEU A HD23 6  
ATOM 10874 N N    . ASP A 1 23  ? 11.808  4.095   3.461   1.00 0.00 ? 23  ASP A N    6  
ATOM 10875 C CA   . ASP A 1 23  ? 12.093  4.589   2.125   1.00 0.00 ? 23  ASP A CA   6  
ATOM 10876 C C    . ASP A 1 23  ? 11.819  3.481   1.107   1.00 0.00 ? 23  ASP A C    6  
ATOM 10877 O O    . ASP A 1 23  ? 11.195  3.723   0.074   1.00 0.00 ? 23  ASP A O    6  
ATOM 10878 C CB   . ASP A 1 23  ? 13.560  5.002   1.992   1.00 0.00 ? 23  ASP A CB   6  
ATOM 10879 C CG   . ASP A 1 23  ? 13.852  5.997   0.867   1.00 0.00 ? 23  ASP A CG   6  
ATOM 10880 O OD1  . ASP A 1 23  ? 13.083  6.976   0.761   1.00 0.00 ? 23  ASP A OD1  6  
ATOM 10881 O OD2  . ASP A 1 23  ? 14.839  5.756   0.138   1.00 0.00 ? 23  ASP A OD2  6  
ATOM 10882 H H    . ASP A 1 23  ? 12.542  4.227   4.127   1.00 0.00 ? 23  ASP A H    6  
ATOM 10883 H HA   . ASP A 1 23  ? 11.437  5.450   1.993   1.00 0.00 ? 23  ASP A HA   6  
ATOM 10884 H HB2  . ASP A 1 23  ? 13.887  5.438   2.936   1.00 0.00 ? 23  ASP A HB2  6  
ATOM 10885 H HB3  . ASP A 1 23  ? 14.160  4.107   1.830   1.00 0.00 ? 23  ASP A HB3  6  
ATOM 10886 N N    . ALA A 1 24  ? 12.298  2.290   1.433   1.00 0.00 ? 24  ALA A N    6  
ATOM 10887 C CA   . ALA A 1 24  ? 12.112  1.144   0.559   1.00 0.00 ? 24  ALA A CA   6  
ATOM 10888 C C    . ALA A 1 24  ? 10.617  0.938   0.306   1.00 0.00 ? 24  ALA A C    6  
ATOM 10889 O O    . ALA A 1 24  ? 10.174  0.929   -0.842  1.00 0.00 ? 24  ALA A O    6  
ATOM 10890 C CB   . ALA A 1 24  ? 12.773  -0.087  1.184   1.00 0.00 ? 24  ALA A CB   6  
ATOM 10891 H H    . ALA A 1 24  ? 12.804  2.102   2.275   1.00 0.00 ? 24  ALA A H    6  
ATOM 10892 H HA   . ALA A 1 24  ? 12.606  1.365   -0.387  1.00 0.00 ? 24  ALA A HA   6  
ATOM 10893 H HB1  . ALA A 1 24  ? 13.853  0.055   1.210   1.00 0.00 ? 24  ALA A HB1  6  
ATOM 10894 H HB2  . ALA A 1 24  ? 12.399  -0.224  2.198   1.00 0.00 ? 24  ALA A HB2  6  
ATOM 10895 H HB3  . ALA A 1 24  ? 12.536  -0.968  0.587   1.00 0.00 ? 24  ALA A HB3  6  
ATOM 10896 N N    . ILE A 1 25  ? 9.882   0.778   1.396   1.00 0.00 ? 25  ILE A N    6  
ATOM 10897 C CA   . ILE A 1 25  ? 8.446   0.573   1.306   1.00 0.00 ? 25  ILE A CA   6  
ATOM 10898 C C    . ILE A 1 25  ? 7.797   1.807   0.676   1.00 0.00 ? 25  ILE A C    6  
ATOM 10899 O O    . ILE A 1 25  ? 6.703   1.722   0.121   1.00 0.00 ? 25  ILE A O    6  
ATOM 10900 C CB   . ILE A 1 25  ? 7.870   0.207   2.675   1.00 0.00 ? 25  ILE A CB   6  
ATOM 10901 C CG1  . ILE A 1 25  ? 8.413   -1.141  3.156   1.00 0.00 ? 25  ILE A CG1  6  
ATOM 10902 C CG2  . ILE A 1 25  ? 6.341   0.233   2.652   1.00 0.00 ? 25  ILE A CG2  6  
ATOM 10903 C CD1  . ILE A 1 25  ? 8.337   -1.251  4.680   1.00 0.00 ? 25  ILE A CD1  6  
ATOM 10904 H H    . ILE A 1 25  ? 10.250  0.787   2.325   1.00 0.00 ? 25  ILE A H    6  
ATOM 10905 H HA   . ILE A 1 25  ? 8.278   -0.280  0.647   1.00 0.00 ? 25  ILE A HA   6  
ATOM 10906 H HB   . ILE A 1 25  ? 8.194   0.959   3.394   1.00 0.00 ? 25  ILE A HB   6  
ATOM 10907 H HG12 . ILE A 1 25  ? 7.842   -1.950  2.700   1.00 0.00 ? 25  ILE A HG12 6  
ATOM 10908 H HG13 . ILE A 1 25  ? 9.446   -1.258  2.830   1.00 0.00 ? 25  ILE A HG13 6  
ATOM 10909 H HG21 . ILE A 1 25  ? 5.961   0.183   3.673   1.00 0.00 ? 25  ILE A HG21 6  
ATOM 10910 H HG22 . ILE A 1 25  ? 6.001   1.157   2.184   1.00 0.00 ? 25  ILE A HG22 6  
ATOM 10911 H HG23 . ILE A 1 25  ? 5.971   -0.620  2.084   1.00 0.00 ? 25  ILE A HG23 6  
ATOM 10912 H HD11 . ILE A 1 25  ? 8.646   -2.250  4.988   1.00 0.00 ? 25  ILE A HD11 6  
ATOM 10913 H HD12 . ILE A 1 25  ? 8.997   -0.511  5.131   1.00 0.00 ? 25  ILE A HD12 6  
ATOM 10914 H HD13 . ILE A 1 25  ? 7.312   -1.071  5.006   1.00 0.00 ? 25  ILE A HD13 6  
ATOM 10915 N N    . CYS A 1 26  ? 8.499   2.925   0.784   1.00 0.00 ? 26  CYS A N    6  
ATOM 10916 C CA   . CYS A 1 26  ? 8.005   4.175   0.232   1.00 0.00 ? 26  CYS A CA   6  
ATOM 10917 C C    . CYS A 1 26  ? 8.185   4.134   -1.287  1.00 0.00 ? 26  CYS A C    6  
ATOM 10918 O O    . CYS A 1 26  ? 7.215   4.256   -2.034  1.00 0.00 ? 26  CYS A O    6  
ATOM 10919 C CB   . CYS A 1 26  ? 8.704   5.385   0.857   1.00 0.00 ? 26  CYS A CB   6  
ATOM 10920 S SG   . CYS A 1 26  ? 7.816   6.921   0.409   1.00 0.00 ? 26  CYS A SG   6  
ATOM 10921 H H    . CYS A 1 26  ? 9.388   2.986   1.238   1.00 0.00 ? 26  CYS A H    6  
ATOM 10922 H HA   . CYS A 1 26  ? 6.949   4.238   0.495   1.00 0.00 ? 26  CYS A HA   6  
ATOM 10923 H HB2  . CYS A 1 26  ? 8.736   5.277   1.941   1.00 0.00 ? 26  CYS A HB2  6  
ATOM 10924 H HB3  . CYS A 1 26  ? 9.736   5.438   0.511   1.00 0.00 ? 26  CYS A HB3  6  
ATOM 10925 H HG   . CYS A 1 26  ? 7.677   7.369   1.653   1.00 0.00 ? 26  CYS A HG   6  
ATOM 10926 N N    . GLU A 1 27  ? 9.432   3.962   -1.698  1.00 0.00 ? 27  GLU A N    6  
ATOM 10927 C CA   . GLU A 1 27  ? 9.752   3.903   -3.115  1.00 0.00 ? 27  GLU A CA   6  
ATOM 10928 C C    . GLU A 1 27  ? 8.860   2.877   -3.818  1.00 0.00 ? 27  GLU A C    6  
ATOM 10929 O O    . GLU A 1 27  ? 8.606   2.988   -5.016  1.00 0.00 ? 27  GLU A O    6  
ATOM 10930 C CB   . GLU A 1 27  ? 11.232  3.582   -3.330  1.00 0.00 ? 27  GLU A CB   6  
ATOM 10931 C CG   . GLU A 1 27  ? 12.076  4.858   -3.325  1.00 0.00 ? 27  GLU A CG   6  
ATOM 10932 C CD   . GLU A 1 27  ? 12.479  5.255   -4.747  1.00 0.00 ? 27  GLU A CD   6  
ATOM 10933 O OE1  . GLU A 1 27  ? 13.519  4.737   -5.208  1.00 0.00 ? 27  GLU A OE1  6  
ATOM 10934 O OE2  . GLU A 1 27  ? 11.737  6.067   -5.341  1.00 0.00 ? 27  GLU A OE2  6  
ATOM 10935 H H    . GLU A 1 27  ? 10.215  3.863   -1.084  1.00 0.00 ? 27  GLU A H    6  
ATOM 10936 H HA   . GLU A 1 27  ? 9.543   4.901   -3.500  1.00 0.00 ? 27  GLU A HA   6  
ATOM 10937 H HB2  . GLU A 1 27  ? 11.579  2.908   -2.547  1.00 0.00 ? 27  GLU A HB2  6  
ATOM 10938 H HB3  . GLU A 1 27  ? 11.360  3.060   -4.279  1.00 0.00 ? 27  GLU A HB3  6  
ATOM 10939 H HG2  . GLU A 1 27  ? 11.513  5.669   -2.863  1.00 0.00 ? 27  GLU A HG2  6  
ATOM 10940 H HG3  . GLU A 1 27  ? 12.970  4.704   -2.720  1.00 0.00 ? 27  GLU A HG3  6  
ATOM 10941 N N    . ARG A 1 28  ? 8.409   1.903   -3.042  1.00 0.00 ? 28  ARG A N    6  
ATOM 10942 C CA   . ARG A 1 28  ? 7.551   0.858   -3.575  1.00 0.00 ? 28  ARG A CA   6  
ATOM 10943 C C    . ARG A 1 28  ? 6.160   1.418   -3.880  1.00 0.00 ? 28  ARG A C    6  
ATOM 10944 O O    . ARG A 1 28  ? 5.548   1.057   -4.884  1.00 0.00 ? 28  ARG A O    6  
ATOM 10945 C CB   . ARG A 1 28  ? 7.420   -0.304  -2.589  1.00 0.00 ? 28  ARG A CB   6  
ATOM 10946 C CG   . ARG A 1 28  ? 8.794   -0.869  -2.222  1.00 0.00 ? 28  ARG A CG   6  
ATOM 10947 C CD   . ARG A 1 28  ? 8.973   -2.282  -2.780  1.00 0.00 ? 28  ARG A CD   6  
ATOM 10948 N NE   . ARG A 1 28  ? 10.237  -2.366  -3.546  1.00 0.00 ? 28  ARG A NE   6  
ATOM 10949 C CZ   . ARG A 1 28  ? 11.431  -2.633  -2.999  1.00 0.00 ? 28  ARG A CZ   6  
ATOM 10950 N NH1  . ARG A 1 28  ? 11.531  -2.841  -1.679  1.00 0.00 ? 28  ARG A NH1  6  
ATOM 10951 N NH2  . ARG A 1 28  ? 12.524  -2.690  -3.772  1.00 0.00 ? 28  ARG A NH2  6  
ATOM 10952 H H    . ARG A 1 28  ? 8.620   1.820   -2.068  1.00 0.00 ? 28  ARG A H    6  
ATOM 10953 H HA   . ARG A 1 28  ? 8.049   0.527   -4.486  1.00 0.00 ? 28  ARG A HA   6  
ATOM 10954 H HB2  . ARG A 1 28  ? 6.909   0.035   -1.688  1.00 0.00 ? 28  ARG A HB2  6  
ATOM 10955 H HB3  . ARG A 1 28  ? 6.805   -1.090  -3.027  1.00 0.00 ? 28  ARG A HB3  6  
ATOM 10956 H HG2  . ARG A 1 28  ? 9.575   -0.217  -2.613  1.00 0.00 ? 28  ARG A HG2  6  
ATOM 10957 H HG3  . ARG A 1 28  ? 8.906   -0.885  -1.137  1.00 0.00 ? 28  ARG A HG3  6  
ATOM 10958 H HD2  . ARG A 1 28  ? 8.983   -3.005  -1.965  1.00 0.00 ? 28  ARG A HD2  6  
ATOM 10959 H HD3  . ARG A 1 28  ? 8.131   -2.537  -3.423  1.00 0.00 ? 28  ARG A HD3  6  
ATOM 10960 H HE   . ARG A 1 28  ? 10.197  -2.215  -4.534  1.00 0.00 ? 28  ARG A HE   6  
ATOM 10961 H HH11 . ARG A 1 28  ? 10.715  -2.799  -1.103  1.00 0.00 ? 28  ARG A HH11 6  
ATOM 10962 H HH12 . ARG A 1 28  ? 12.422  -3.040  -1.271  1.00 0.00 ? 28  ARG A HH12 6  
ATOM 10963 H HH21 . ARG A 1 28  ? 12.449  -2.534  -4.757  1.00 0.00 ? 28  ARG A HH21 6  
ATOM 10964 H HH22 . ARG A 1 28  ? 13.415  -2.888  -3.363  1.00 0.00 ? 28  ARG A HH22 6  
ATOM 10965 N N    . LEU A 1 29  ? 5.701   2.291   -2.996  1.00 0.00 ? 29  LEU A N    6  
ATOM 10966 C CA   . LEU A 1 29  ? 4.394   2.904   -3.158  1.00 0.00 ? 29  LEU A CA   6  
ATOM 10967 C C    . LEU A 1 29  ? 4.150   3.190   -4.641  1.00 0.00 ? 29  LEU A C    6  
ATOM 10968 O O    . LEU A 1 29  ? 4.937   3.885   -5.281  1.00 0.00 ? 29  LEU A O    6  
ATOM 10969 C CB   . LEU A 1 29  ? 4.268   4.140   -2.265  1.00 0.00 ? 29  LEU A CB   6  
ATOM 10970 C CG   . LEU A 1 29  ? 4.475   3.910   -0.767  1.00 0.00 ? 29  LEU A CG   6  
ATOM 10971 C CD1  . LEU A 1 29  ? 4.819   5.218   -0.053  1.00 0.00 ? 29  LEU A CD1  6  
ATOM 10972 C CD2  . LEU A 1 29  ? 3.259   3.220   -0.145  1.00 0.00 ? 29  LEU A CD2  6  
ATOM 10973 H H    . LEU A 1 29  ? 6.205   2.580   -2.182  1.00 0.00 ? 29  LEU A H    6  
ATOM 10974 H HA   . LEU A 1 29  ? 3.651   2.184   -2.817  1.00 0.00 ? 29  LEU A HA   6  
ATOM 10975 H HB2  . LEU A 1 29  ? 4.991   4.883   -2.602  1.00 0.00 ? 29  LEU A HB2  6  
ATOM 10976 H HB3  . LEU A 1 29  ? 3.277   4.571   -2.412  1.00 0.00 ? 29  LEU A HB3  6  
ATOM 10977 H HG   . LEU A 1 29  ? 5.326   3.240   -0.639  1.00 0.00 ? 29  LEU A HG   6  
ATOM 10978 H HD11 . LEU A 1 29  ? 4.932   5.031   1.015   1.00 0.00 ? 29  LEU A HD11 6  
ATOM 10979 H HD12 . LEU A 1 29  ? 5.752   5.616   -0.452  1.00 0.00 ? 29  LEU A HD12 6  
ATOM 10980 H HD13 . LEU A 1 29  ? 4.018   5.941   -0.212  1.00 0.00 ? 29  LEU A HD13 6  
ATOM 10981 H HD21 . LEU A 1 29  ? 3.503   2.898   0.868   1.00 0.00 ? 29  LEU A HD21 6  
ATOM 10982 H HD22 . LEU A 1 29  ? 2.423   3.917   -0.113  1.00 0.00 ? 29  LEU A HD22 6  
ATOM 10983 H HD23 . LEU A 1 29  ? 2.987   2.352   -0.746  1.00 0.00 ? 29  LEU A HD23 6  
ATOM 10984 N N    . LYS A 1 30  ? 3.056   2.638   -5.144  1.00 0.00 ? 30  LYS A N    6  
ATOM 10985 C CA   . LYS A 1 30  ? 2.698   2.824   -6.540  1.00 0.00 ? 30  LYS A CA   6  
ATOM 10986 C C    . LYS A 1 30  ? 1.562   3.844   -6.639  1.00 0.00 ? 30  LYS A C    6  
ATOM 10987 O O    . LYS A 1 30  ? 0.734   3.946   -5.736  1.00 0.00 ? 30  LYS A O    6  
ATOM 10988 C CB   . LYS A 1 30  ? 2.375   1.479   -7.195  1.00 0.00 ? 30  LYS A CB   6  
ATOM 10989 C CG   . LYS A 1 30  ? 3.636   0.836   -7.777  1.00 0.00 ? 30  LYS A CG   6  
ATOM 10990 C CD   . LYS A 1 30  ? 3.322   0.091   -9.075  1.00 0.00 ? 30  LYS A CD   6  
ATOM 10991 C CE   . LYS A 1 30  ? 4.599   -0.450  -9.719  1.00 0.00 ? 30  LYS A CE   6  
ATOM 10992 N NZ   . LYS A 1 30  ? 4.308   -1.012  -11.058 1.00 0.00 ? 30  LYS A NZ   6  
ATOM 10993 H H    . LYS A 1 30  ? 2.421   2.073   -4.617  1.00 0.00 ? 30  LYS A H    6  
ATOM 10994 H HA   . LYS A 1 30  ? 3.572   3.229   -7.050  1.00 0.00 ? 30  LYS A HA   6  
ATOM 10995 H HB2  . LYS A 1 30  ? 1.928   0.810   -6.460  1.00 0.00 ? 30  LYS A HB2  6  
ATOM 10996 H HB3  . LYS A 1 30  ? 1.638   1.623   -7.985  1.00 0.00 ? 30  LYS A HB3  6  
ATOM 10997 H HG2  . LYS A 1 30  ? 4.386   1.604   -7.966  1.00 0.00 ? 30  LYS A HG2  6  
ATOM 10998 H HG3  . LYS A 1 30  ? 4.064   0.145   -7.051  1.00 0.00 ? 30  LYS A HG3  6  
ATOM 10999 H HD2  . LYS A 1 30  ? 2.637   -0.733  -8.870  1.00 0.00 ? 30  LYS A HD2  6  
ATOM 11000 H HD3  . LYS A 1 30  ? 2.815   0.760   -9.770  1.00 0.00 ? 30  LYS A HD3  6  
ATOM 11001 H HE2  . LYS A 1 30  ? 5.336   0.348   -9.806  1.00 0.00 ? 30  LYS A HE2  6  
ATOM 11002 H HE3  . LYS A 1 30  ? 5.037   -1.220  -9.083  1.00 0.00 ? 30  LYS A HE3  6  
ATOM 11003 H HZ1  . LYS A 1 30  ? 3.370   -1.359  -11.076 1.00 0.00 ? 30  LYS A HZ1  6  
ATOM 11004 H HZ2  . LYS A 1 30  ? 4.413   -0.297  -11.749 1.00 0.00 ? 30  LYS A HZ2  6  
ATOM 11005 H HZ3  . LYS A 1 30  ? 4.943   -1.759  -11.251 1.00 0.00 ? 30  LYS A HZ3  6  
ATOM 11006 N N    . PRO A 1 31  ? 1.559   4.593   -7.775  1.00 0.00 ? 31  PRO A N    6  
ATOM 11007 C CA   . PRO A 1 31  ? 0.539   5.602   -8.003  1.00 0.00 ? 31  PRO A CA   6  
ATOM 11008 C C    . PRO A 1 31  ? -0.795  4.956   -8.385  1.00 0.00 ? 31  PRO A C    6  
ATOM 11009 O O    . PRO A 1 31  ? -0.916  4.360   -9.454  1.00 0.00 ? 31  PRO A O    6  
ATOM 11010 C CB   . PRO A 1 31  ? 1.103   6.491   -9.099  1.00 0.00 ? 31  PRO A CB   6  
ATOM 11011 C CG   . PRO A 1 31  ? 2.205   5.683   -9.765  1.00 0.00 ? 31  PRO A CG   6  
ATOM 11012 C CD   . PRO A 1 31  ? 2.524   4.500   -8.866  1.00 0.00 ? 31  PRO A CD   6  
ATOM 11013 H HA   . PRO A 1 31  ? 0.363   6.115   -7.163  1.00 0.00 ? 31  PRO A HA   6  
ATOM 11014 H HB2  . PRO A 1 31  ? 0.330   6.764   -9.818  1.00 0.00 ? 31  PRO A HB2  6  
ATOM 11015 H HB3  . PRO A 1 31  ? 1.496   7.420   -8.685  1.00 0.00 ? 31  PRO A HB3  6  
ATOM 11016 H HG2  . PRO A 1 31  ? 1.885   5.340   -10.749 1.00 0.00 ? 31  PRO A HG2  6  
ATOM 11017 H HG3  . PRO A 1 31  ? 3.092   6.298   -9.916  1.00 0.00 ? 31  PRO A HG3  6  
ATOM 11018 H HD2  . PRO A 1 31  ? 2.425   3.556   -9.403  1.00 0.00 ? 31  PRO A HD2  6  
ATOM 11019 H HD3  . PRO A 1 31  ? 3.548   4.549   -8.495  1.00 0.00 ? 31  PRO A HD3  6  
ATOM 11020 N N    . CYS A 1 32  ? -1.761  5.096   -7.490  1.00 0.00 ? 32  CYS A N    6  
ATOM 11021 C CA   . CYS A 1 32  ? -3.081  4.534   -7.719  1.00 0.00 ? 32  CYS A CA   6  
ATOM 11022 C C    . CYS A 1 32  ? -4.112  5.429   -7.028  1.00 0.00 ? 32  CYS A C    6  
ATOM 11023 O O    . CYS A 1 32  ? -3.751  6.306   -6.245  1.00 0.00 ? 32  CYS A O    6  
ATOM 11024 C CB   . CYS A 1 32  ? -3.170  3.084   -7.239  1.00 0.00 ? 32  CYS A CB   6  
ATOM 11025 S SG   . CYS A 1 32  ? -2.615  2.967   -5.499  1.00 0.00 ? 32  CYS A SG   6  
ATOM 11026 H H    . CYS A 1 32  ? -1.654  5.582   -6.623  1.00 0.00 ? 32  CYS A H    6  
ATOM 11027 H HA   . CYS A 1 32  ? -3.236  4.528   -8.798  1.00 0.00 ? 32  CYS A HA   6  
ATOM 11028 H HB2  . CYS A 1 32  ? -4.195  2.725   -7.327  1.00 0.00 ? 32  CYS A HB2  6  
ATOM 11029 H HB3  . CYS A 1 32  ? -2.553  2.444   -7.870  1.00 0.00 ? 32  CYS A HB3  6  
ATOM 11030 H HG   . CYS A 1 32  ? -1.324  2.807   -5.775  1.00 0.00 ? 32  CYS A HG   6  
ATOM 11031 N N    . LEU A 1 33  ? -5.374  5.175   -7.342  1.00 0.00 ? 33  LEU A N    6  
ATOM 11032 C CA   . LEU A 1 33  ? -6.459  5.947   -6.760  1.00 0.00 ? 33  LEU A CA   6  
ATOM 11033 C C    . LEU A 1 33  ? -7.646  5.022   -6.485  1.00 0.00 ? 33  LEU A C    6  
ATOM 11034 O O    . LEU A 1 33  ? -7.706  3.911   -7.009  1.00 0.00 ? 33  LEU A O    6  
ATOM 11035 C CB   . LEU A 1 33  ? -6.803  7.143   -7.651  1.00 0.00 ? 33  LEU A CB   6  
ATOM 11036 C CG   . LEU A 1 33  ? -7.399  8.359   -6.939  1.00 0.00 ? 33  LEU A CG   6  
ATOM 11037 C CD1  . LEU A 1 33  ? -6.385  9.502   -6.866  1.00 0.00 ? 33  LEU A CD1  6  
ATOM 11038 C CD2  . LEU A 1 33  ? -8.708  8.795   -7.602  1.00 0.00 ? 33  LEU A CD2  6  
ATOM 11039 H H    . LEU A 1 33  ? -5.658  4.460   -7.979  1.00 0.00 ? 33  LEU A H    6  
ATOM 11040 H HA   . LEU A 1 33  ? -6.104  6.345   -5.809  1.00 0.00 ? 33  LEU A HA   6  
ATOM 11041 H HB2  . LEU A 1 33  ? -5.898  7.457   -8.169  1.00 0.00 ? 33  LEU A HB2  6  
ATOM 11042 H HB3  . LEU A 1 33  ? -7.508  6.811   -8.413  1.00 0.00 ? 33  LEU A HB3  6  
ATOM 11043 H HG   . LEU A 1 33  ? -7.637  8.073   -5.914  1.00 0.00 ? 33  LEU A HG   6  
ATOM 11044 H HD11 . LEU A 1 33  ? -6.444  9.978   -5.887  1.00 0.00 ? 33  LEU A HD11 6  
ATOM 11045 H HD12 . LEU A 1 33  ? -5.380  9.107   -7.018  1.00 0.00 ? 33  LEU A HD12 6  
ATOM 11046 H HD13 . LEU A 1 33  ? -6.608  10.236  -7.640  1.00 0.00 ? 33  LEU A HD13 6  
ATOM 11047 H HD21 . LEU A 1 33  ? -8.543  8.942   -8.669  1.00 0.00 ? 33  LEU A HD21 6  
ATOM 11048 H HD22 . LEU A 1 33  ? -9.464  8.025   -7.453  1.00 0.00 ? 33  LEU A HD22 6  
ATOM 11049 H HD23 . LEU A 1 33  ? -9.047  9.729   -7.154  1.00 0.00 ? 33  LEU A HD23 6  
ATOM 11050 N N    . PHE A 1 34  ? -8.562  5.515   -5.664  1.00 0.00 ? 34  PHE A N    6  
ATOM 11051 C CA   . PHE A 1 34  ? -9.744  4.747   -5.314  1.00 0.00 ? 34  PHE A CA   6  
ATOM 11052 C C    . PHE A 1 34  ? -11.020 5.533   -5.623  1.00 0.00 ? 34  PHE A C    6  
ATOM 11053 O O    . PHE A 1 34  ? -11.298 6.548   -4.987  1.00 0.00 ? 34  PHE A O    6  
ATOM 11054 C CB   . PHE A 1 34  ? -9.675  4.482   -3.808  1.00 0.00 ? 34  PHE A CB   6  
ATOM 11055 C CG   . PHE A 1 34  ? -8.385  3.794   -3.356  1.00 0.00 ? 34  PHE A CG   6  
ATOM 11056 C CD1  . PHE A 1 34  ? -8.059  2.569   -3.849  1.00 0.00 ? 34  PHE A CD1  6  
ATOM 11057 C CD2  . PHE A 1 34  ? -7.565  4.408   -2.462  1.00 0.00 ? 34  PHE A CD2  6  
ATOM 11058 C CE1  . PHE A 1 34  ? -6.862  1.931   -3.429  1.00 0.00 ? 34  PHE A CE1  6  
ATOM 11059 C CE2  . PHE A 1 34  ? -6.368  3.770   -2.042  1.00 0.00 ? 34  PHE A CE2  6  
ATOM 11060 C CZ   . PHE A 1 34  ? -6.042  2.545   -2.534  1.00 0.00 ? 34  PHE A CZ   6  
ATOM 11061 H H    . PHE A 1 34  ? -8.505  6.420   -5.243  1.00 0.00 ? 34  PHE A H    6  
ATOM 11062 H HA   . PHE A 1 34  ? -9.727  3.836   -5.911  1.00 0.00 ? 34  PHE A HA   6  
ATOM 11063 H HB2  . PHE A 1 34  ? -9.775  5.429   -3.278  1.00 0.00 ? 34  PHE A HB2  6  
ATOM 11064 H HB3  . PHE A 1 34  ? -10.525 3.863   -3.520  1.00 0.00 ? 34  PHE A HB3  6  
ATOM 11065 H HD1  . PHE A 1 34  ? -8.716  2.078   -4.566  1.00 0.00 ? 34  PHE A HD1  6  
ATOM 11066 H HD2  . PHE A 1 34  ? -7.827  5.390   -2.067  1.00 0.00 ? 34  PHE A HD2  6  
ATOM 11067 H HE1  . PHE A 1 34  ? -6.600  0.950   -3.824  1.00 0.00 ? 34  PHE A HE1  6  
ATOM 11068 H HE2  . PHE A 1 34  ? -5.711  4.262   -1.325  1.00 0.00 ? 34  PHE A HE2  6  
ATOM 11069 H HZ   . PHE A 1 34  ? -5.123  2.055   -2.212  1.00 0.00 ? 34  PHE A HZ   6  
ATOM 11070 N N    . THR A 1 35  ? -11.762 5.033   -6.600  1.00 0.00 ? 35  THR A N    6  
ATOM 11071 C CA   . THR A 1 35  ? -13.002 5.676   -7.002  1.00 0.00 ? 35  THR A CA   6  
ATOM 11072 C C    . THR A 1 35  ? -14.126 5.323   -6.025  1.00 0.00 ? 35  THR A C    6  
ATOM 11073 O O    . THR A 1 35  ? -13.873 4.771   -4.956  1.00 0.00 ? 35  THR A O    6  
ATOM 11074 C CB   . THR A 1 35  ? -13.301 5.266   -8.446  1.00 0.00 ? 35  THR A CB   6  
ATOM 11075 O OG1  . THR A 1 35  ? -12.839 3.920   -8.527  1.00 0.00 ? 35  THR A OG1  6  
ATOM 11076 C CG2  . THR A 1 35  ? -12.437 6.019   -9.459  1.00 0.00 ? 35  THR A CG2  6  
ATOM 11077 H H    . THR A 1 35  ? -11.529 4.207   -7.113  1.00 0.00 ? 35  THR A H    6  
ATOM 11078 H HA   . THR A 1 35  ? -12.862 6.755   -6.952  1.00 0.00 ? 35  THR A HA   6  
ATOM 11079 H HB   . THR A 1 35  ? -14.360 5.385   -8.673  1.00 0.00 ? 35  THR A HB   6  
ATOM 11080 H HG1  . THR A 1 35  ? -13.041 3.544   -9.431  1.00 0.00 ? 35  THR A HG1  6  
ATOM 11081 H HG21 . THR A 1 35  ? -12.393 5.454   -10.390 1.00 0.00 ? 35  THR A HG21 6  
ATOM 11082 H HG22 . THR A 1 35  ? -12.872 7.000   -9.649  1.00 0.00 ? 35  THR A HG22 6  
ATOM 11083 H HG23 . THR A 1 35  ? -11.430 6.139   -9.059  1.00 0.00 ? 35  THR A HG23 6  
ATOM 11084 N N    . GLU A 1 36  ? -15.343 5.657   -6.428  1.00 0.00 ? 36  GLU A N    6  
ATOM 11085 C CA   . GLU A 1 36  ? -16.507 5.383   -5.602  1.00 0.00 ? 36  GLU A CA   6  
ATOM 11086 C C    . GLU A 1 36  ? -16.804 3.882   -5.586  1.00 0.00 ? 36  GLU A C    6  
ATOM 11087 O O    . GLU A 1 36  ? -16.609 3.196   -6.588  1.00 0.00 ? 36  GLU A O    6  
ATOM 11088 C CB   . GLU A 1 36  ? -17.722 6.177   -6.085  1.00 0.00 ? 36  GLU A CB   6  
ATOM 11089 C CG   . GLU A 1 36  ? -18.456 5.432   -7.202  1.00 0.00 ? 36  GLU A CG   6  
ATOM 11090 C CD   . GLU A 1 36  ? -19.572 6.294   -7.795  1.00 0.00 ? 36  GLU A CD   6  
ATOM 11091 O OE1  . GLU A 1 36  ? -20.532 6.575   -7.046  1.00 0.00 ? 36  GLU A OE1  6  
ATOM 11092 O OE2  . GLU A 1 36  ? -19.439 6.653   -8.985  1.00 0.00 ? 36  GLU A OE2  6  
ATOM 11093 H H    . GLU A 1 36  ? -15.540 6.106   -7.300  1.00 0.00 ? 36  GLU A H    6  
ATOM 11094 H HA   . GLU A 1 36  ? -16.236 5.718   -4.601  1.00 0.00 ? 36  GLU A HA   6  
ATOM 11095 H HB2  . GLU A 1 36  ? -18.402 6.352   -5.251  1.00 0.00 ? 36  GLU A HB2  6  
ATOM 11096 H HB3  . GLU A 1 36  ? -17.402 7.155   -6.445  1.00 0.00 ? 36  GLU A HB3  6  
ATOM 11097 H HG2  . GLU A 1 36  ? -17.749 5.155   -7.985  1.00 0.00 ? 36  GLU A HG2  6  
ATOM 11098 H HG3  . GLU A 1 36  ? -18.876 4.506   -6.810  1.00 0.00 ? 36  GLU A HG3  6  
ATOM 11099 N N    . LYS A 1 37  ? -17.272 3.417   -4.437  1.00 0.00 ? 37  LYS A N    6  
ATOM 11100 C CA   . LYS A 1 37  ? -17.598 2.010   -4.277  1.00 0.00 ? 37  LYS A CA   6  
ATOM 11101 C C    . LYS A 1 37  ? -16.310 1.185   -4.311  1.00 0.00 ? 37  LYS A C    6  
ATOM 11102 O O    . LYS A 1 37  ? -16.320 0.029   -4.731  1.00 0.00 ? 37  LYS A O    6  
ATOM 11103 C CB   . LYS A 1 37  ? -18.633 1.578   -5.317  1.00 0.00 ? 37  LYS A CB   6  
ATOM 11104 C CG   . LYS A 1 37  ? -19.956 2.320   -5.116  1.00 0.00 ? 37  LYS A CG   6  
ATOM 11105 C CD   . LYS A 1 37  ? -21.133 1.494   -5.640  1.00 0.00 ? 37  LYS A CD   6  
ATOM 11106 C CE   . LYS A 1 37  ? -21.057 1.335   -7.159  1.00 0.00 ? 37  LYS A CE   6  
ATOM 11107 N NZ   . LYS A 1 37  ? -22.375 0.939   -7.705  1.00 0.00 ? 37  LYS A NZ   6  
ATOM 11108 H H    . LYS A 1 37  ? -17.428 3.982   -3.627  1.00 0.00 ? 37  LYS A H    6  
ATOM 11109 H HA   . LYS A 1 37  ? -18.058 1.891   -3.296  1.00 0.00 ? 37  LYS A HA   6  
ATOM 11110 H HB2  . LYS A 1 37  ? -18.251 1.774   -6.319  1.00 0.00 ? 37  LYS A HB2  6  
ATOM 11111 H HB3  . LYS A 1 37  ? -18.800 0.503   -5.245  1.00 0.00 ? 37  LYS A HB3  6  
ATOM 11112 H HG2  . LYS A 1 37  ? -20.099 2.534   -4.057  1.00 0.00 ? 37  LYS A HG2  6  
ATOM 11113 H HG3  . LYS A 1 37  ? -19.921 3.279   -5.633  1.00 0.00 ? 37  LYS A HG3  6  
ATOM 11114 H HD2  . LYS A 1 37  ? -21.132 0.512   -5.167  1.00 0.00 ? 37  LYS A HD2  6  
ATOM 11115 H HD3  . LYS A 1 37  ? -22.071 1.978   -5.367  1.00 0.00 ? 37  LYS A HD3  6  
ATOM 11116 H HE2  . LYS A 1 37  ? -20.735 2.271   -7.614  1.00 0.00 ? 37  LYS A HE2  6  
ATOM 11117 H HE3  . LYS A 1 37  ? -20.311 0.583   -7.415  1.00 0.00 ? 37  LYS A HE3  6  
ATOM 11118 H HZ1  . LYS A 1 37  ? -22.261 0.599   -8.638  1.00 0.00 ? 37  LYS A HZ1  6  
ATOM 11119 H HZ2  . LYS A 1 37  ? -22.770 0.219   -7.134  1.00 0.00 ? 37  LYS A HZ2  6  
ATOM 11120 H HZ3  . LYS A 1 37  ? -22.985 1.732   -7.711  1.00 0.00 ? 37  LYS A HZ3  6  
ATOM 11121 N N    . SER A 1 38  ? -15.232 1.811   -3.863  1.00 0.00 ? 38  SER A N    6  
ATOM 11122 C CA   . SER A 1 38  ? -13.938 1.150   -3.837  1.00 0.00 ? 38  SER A CA   6  
ATOM 11123 C C    . SER A 1 38  ? -13.677 0.566   -2.447  1.00 0.00 ? 38  SER A C    6  
ATOM 11124 O O    . SER A 1 38  ? -13.595 1.303   -1.466  1.00 0.00 ? 38  SER A O    6  
ATOM 11125 C CB   . SER A 1 38  ? -12.818 2.115   -4.227  1.00 0.00 ? 38  SER A CB   6  
ATOM 11126 O OG   . SER A 1 38  ? -12.874 2.470   -5.606  1.00 0.00 ? 38  SER A OG   6  
ATOM 11127 H H    . SER A 1 38  ? -15.232 2.752   -3.523  1.00 0.00 ? 38  SER A H    6  
ATOM 11128 H HA   . SER A 1 38  ? -14.006 0.354   -4.580  1.00 0.00 ? 38  SER A HA   6  
ATOM 11129 H HB2  . SER A 1 38  ? -12.888 3.017   -3.618  1.00 0.00 ? 38  SER A HB2  6  
ATOM 11130 H HB3  . SER A 1 38  ? -11.853 1.658   -4.009  1.00 0.00 ? 38  SER A HB3  6  
ATOM 11131 H HG   . SER A 1 38  ? -12.671 3.442   -5.718  1.00 0.00 ? 38  SER A HG   6  
ATOM 11132 N N    . TYR A 1 39  ? -13.552 -0.752  -2.408  1.00 0.00 ? 39  TYR A N    6  
ATOM 11133 C CA   . TYR A 1 39  ? -13.302 -1.443  -1.155  1.00 0.00 ? 39  TYR A CA   6  
ATOM 11134 C C    . TYR A 1 39  ? -11.816 -1.774  -0.999  1.00 0.00 ? 39  TYR A C    6  
ATOM 11135 O O    . TYR A 1 39  ? -11.312 -2.698  -1.635  1.00 0.00 ? 39  TYR A O    6  
ATOM 11136 C CB   . TYR A 1 39  ? -14.098 -2.748  -1.225  1.00 0.00 ? 39  TYR A CB   6  
ATOM 11137 C CG   . TYR A 1 39  ? -15.522 -2.638  -0.677  1.00 0.00 ? 39  TYR A CG   6  
ATOM 11138 C CD1  . TYR A 1 39  ? -16.393 -1.705  -1.201  1.00 0.00 ? 39  TYR A CD1  6  
ATOM 11139 C CD2  . TYR A 1 39  ? -15.935 -3.473  0.341   1.00 0.00 ? 39  TYR A CD2  6  
ATOM 11140 C CE1  . TYR A 1 39  ? -17.734 -1.602  -0.685  1.00 0.00 ? 39  TYR A CE1  6  
ATOM 11141 C CE2  . TYR A 1 39  ? -17.276 -3.370  0.858   1.00 0.00 ? 39  TYR A CE2  6  
ATOM 11142 C CZ   . TYR A 1 39  ? -18.109 -2.439  0.319   1.00 0.00 ? 39  TYR A CZ   6  
ATOM 11143 O OH   . TYR A 1 39  ? -19.375 -2.342  0.806   1.00 0.00 ? 39  TYR A OH   6  
ATOM 11144 H H    . TYR A 1 39  ? -13.620 -1.345  -3.211  1.00 0.00 ? 39  TYR A H    6  
ATOM 11145 H HA   . TYR A 1 39  ? -13.607 -0.785  -0.341  1.00 0.00 ? 39  TYR A HA   6  
ATOM 11146 H HB2  . TYR A 1 39  ? -14.143 -3.078  -2.263  1.00 0.00 ? 39  TYR A HB2  6  
ATOM 11147 H HB3  . TYR A 1 39  ? -13.564 -3.518  -0.669  1.00 0.00 ? 39  TYR A HB3  6  
ATOM 11148 H HD1  . TYR A 1 39  ? -16.067 -1.046  -2.005  1.00 0.00 ? 39  TYR A HD1  6  
ATOM 11149 H HD2  . TYR A 1 39  ? -15.247 -4.210  0.755   1.00 0.00 ? 39  TYR A HD2  6  
ATOM 11150 H HE1  . TYR A 1 39  ? -18.432 -0.869  -1.090  1.00 0.00 ? 39  TYR A HE1  6  
ATOM 11151 H HE2  . TYR A 1 39  ? -17.615 -4.023  1.662   1.00 0.00 ? 39  TYR A HE2  6  
ATOM 11152 H HH   . TYR A 1 39  ? -19.537 -1.419  1.155   1.00 0.00 ? 39  TYR A HH   6  
ATOM 11153 N N    . LEU A 1 40  ? -11.156 -1.001  -0.149  1.00 0.00 ? 40  LEU A N    6  
ATOM 11154 C CA   . LEU A 1 40  ? -9.738  -1.200  0.099   1.00 0.00 ? 40  LEU A CA   6  
ATOM 11155 C C    . LEU A 1 40  ? -9.521  -2.588  0.705   1.00 0.00 ? 40  LEU A C    6  
ATOM 11156 O O    . LEU A 1 40  ? -8.745  -3.384  0.180   1.00 0.00 ? 40  LEU A O    6  
ATOM 11157 C CB   . LEU A 1 40  ? -9.179  -0.061  0.954   1.00 0.00 ? 40  LEU A CB   6  
ATOM 11158 C CG   . LEU A 1 40  ? -9.053  1.298   0.261   1.00 0.00 ? 40  LEU A CG   6  
ATOM 11159 C CD1  . LEU A 1 40  ? -10.426 1.827   -0.158  1.00 0.00 ? 40  LEU A CD1  6  
ATOM 11160 C CD2  . LEU A 1 40  ? -8.299  2.295   1.143   1.00 0.00 ? 40  LEU A CD2  6  
ATOM 11161 H H    . LEU A 1 40  ? -11.574 -0.251  0.365   1.00 0.00 ? 40  LEU A H    6  
ATOM 11162 H HA   . LEU A 1 40  ? -9.230  -1.160  -0.864  1.00 0.00 ? 40  LEU A HA   6  
ATOM 11163 H HB2  . LEU A 1 40  ? -9.816  0.057   1.830   1.00 0.00 ? 40  LEU A HB2  6  
ATOM 11164 H HB3  . LEU A 1 40  ? -8.193  -0.355  1.314   1.00 0.00 ? 40  LEU A HB3  6  
ATOM 11165 H HG   . LEU A 1 40  ? -8.468  1.165   -0.648  1.00 0.00 ? 40  LEU A HG   6  
ATOM 11166 H HD11 . LEU A 1 40  ? -10.773 1.282   -1.036  1.00 0.00 ? 40  LEU A HD11 6  
ATOM 11167 H HD12 . LEU A 1 40  ? -11.134 1.689   0.659   1.00 0.00 ? 40  LEU A HD12 6  
ATOM 11168 H HD13 . LEU A 1 40  ? -10.349 2.888   -0.396  1.00 0.00 ? 40  LEU A HD13 6  
ATOM 11169 H HD21 . LEU A 1 40  ? -8.963  2.661   1.927   1.00 0.00 ? 40  LEU A HD21 6  
ATOM 11170 H HD22 . LEU A 1 40  ? -7.440  1.801   1.597   1.00 0.00 ? 40  LEU A HD22 6  
ATOM 11171 H HD23 . LEU A 1 40  ? -7.958  3.132   0.535   1.00 0.00 ? 40  LEU A HD23 6  
ATOM 11172 N N    . VAL A 1 41  ? -10.221 -2.835  1.803   1.00 0.00 ? 41  VAL A N    6  
ATOM 11173 C CA   . VAL A 1 41  ? -10.114 -4.113  2.487   1.00 0.00 ? 41  VAL A CA   6  
ATOM 11174 C C    . VAL A 1 41  ? -11.512 -4.593  2.882   1.00 0.00 ? 41  VAL A C    6  
ATOM 11175 O O    . VAL A 1 41  ? -12.425 -3.786  3.052   1.00 0.00 ? 41  VAL A O    6  
ATOM 11176 C CB   . VAL A 1 41  ? -9.165  -3.991  3.680   1.00 0.00 ? 41  VAL A CB   6  
ATOM 11177 C CG1  . VAL A 1 41  ? -7.774  -3.538  3.230   1.00 0.00 ? 41  VAL A CG1  6  
ATOM 11178 C CG2  . VAL A 1 41  ? -9.734  -3.044  4.739   1.00 0.00 ? 41  VAL A CG2  6  
ATOM 11179 H H    . VAL A 1 41  ? -10.850 -2.182  2.224   1.00 0.00 ? 41  VAL A H    6  
ATOM 11180 H HA   . VAL A 1 41  ? -9.684  -4.827  1.784   1.00 0.00 ? 41  VAL A HA   6  
ATOM 11181 H HB   . VAL A 1 41  ? -9.065  -4.978  4.132   1.00 0.00 ? 41  VAL A HB   6  
ATOM 11182 H HG11 . VAL A 1 41  ? -7.028  -4.246  3.589   1.00 0.00 ? 41  VAL A HG11 6  
ATOM 11183 H HG12 . VAL A 1 41  ? -7.741  -3.495  2.141   1.00 0.00 ? 41  VAL A HG12 6  
ATOM 11184 H HG13 . VAL A 1 41  ? -7.564  -2.549  3.639   1.00 0.00 ? 41  VAL A HG13 6  
ATOM 11185 H HG21 . VAL A 1 41  ? -9.717  -2.022  4.359   1.00 0.00 ? 41  VAL A HG21 6  
ATOM 11186 H HG22 . VAL A 1 41  ? -10.760 -3.330  4.968   1.00 0.00 ? 41  VAL A HG22 6  
ATOM 11187 H HG23 . VAL A 1 41  ? -9.129  -3.105  5.643   1.00 0.00 ? 41  VAL A HG23 6  
ATOM 11188 N N    . ARG A 1 42  ? -11.636 -5.905  3.017   1.00 0.00 ? 42  ARG A N    6  
ATOM 11189 C CA   . ARG A 1 42  ? -12.907 -6.503  3.389   1.00 0.00 ? 42  ARG A CA   6  
ATOM 11190 C C    . ARG A 1 42  ? -12.724 -7.440  4.585   1.00 0.00 ? 42  ARG A C    6  
ATOM 11191 O O    . ARG A 1 42  ? -11.600 -7.812  4.920   1.00 0.00 ? 42  ARG A O    6  
ATOM 11192 C CB   . ARG A 1 42  ? -13.510 -7.288  2.222   1.00 0.00 ? 42  ARG A CB   6  
ATOM 11193 C CG   . ARG A 1 42  ? -14.908 -6.772  1.878   1.00 0.00 ? 42  ARG A CG   6  
ATOM 11194 C CD   . ARG A 1 42  ? -15.974 -7.824  2.193   1.00 0.00 ? 42  ARG A CD   6  
ATOM 11195 N NE   . ARG A 1 42  ? -15.928 -8.908  1.186   1.00 0.00 ? 42  ARG A NE   6  
ATOM 11196 C CZ   . ARG A 1 42  ? -16.461 -10.124 1.367   1.00 0.00 ? 42  ARG A CZ   6  
ATOM 11197 N NH1  . ARG A 1 42  ? -17.085 -10.418 2.516   1.00 0.00 ? 42  ARG A NH1  6  
ATOM 11198 N NH2  . ARG A 1 42  ? -16.372 -11.045 0.398   1.00 0.00 ? 42  ARG A NH2  6  
ATOM 11199 H H    . ARG A 1 42  ? -10.889 -6.555  2.877   1.00 0.00 ? 42  ARG A H    6  
ATOM 11200 H HA   . ARG A 1 42  ? -13.547 -5.659  3.647   1.00 0.00 ? 42  ARG A HA   6  
ATOM 11201 H HB2  . ARG A 1 42  ? -12.862 -7.204  1.350   1.00 0.00 ? 42  ARG A HB2  6  
ATOM 11202 H HB3  . ARG A 1 42  ? -13.561 -8.346  2.479   1.00 0.00 ? 42  ARG A HB3  6  
ATOM 11203 H HG2  . ARG A 1 42  ? -15.113 -5.862  2.442   1.00 0.00 ? 42  ARG A HG2  6  
ATOM 11204 H HG3  . ARG A 1 42  ? -14.953 -6.510  0.821   1.00 0.00 ? 42  ARG A HG3  6  
ATOM 11205 H HD2  . ARG A 1 42  ? -15.808 -8.234  3.189   1.00 0.00 ? 42  ARG A HD2  6  
ATOM 11206 H HD3  . ARG A 1 42  ? -16.961 -7.363  2.198   1.00 0.00 ? 42  ARG A HD3  6  
ATOM 11207 H HE   . ARG A 1 42  ? -15.470 -8.722  0.317   1.00 0.00 ? 42  ARG A HE   6  
ATOM 11208 H HH11 . ARG A 1 42  ? -17.151 -9.731  3.239   1.00 0.00 ? 42  ARG A HH11 6  
ATOM 11209 H HH12 . ARG A 1 42  ? -17.483 -11.326 2.651   1.00 0.00 ? 42  ARG A HH12 6  
ATOM 11210 H HH21 . ARG A 1 42  ? -15.907 -10.826 -0.459  1.00 0.00 ? 42  ARG A HH21 6  
ATOM 11211 H HH22 . ARG A 1 42  ? -16.770 -11.953 0.533   1.00 0.00 ? 42  ARG A HH22 6  
ATOM 11212 N N    . GLU A 1 43  ? -13.845 -7.794  5.196   1.00 0.00 ? 43  GLU A N    6  
ATOM 11213 C CA   . GLU A 1 43  ? -13.822 -8.680  6.347   1.00 0.00 ? 43  GLU A CA   6  
ATOM 11214 C C    . GLU A 1 43  ? -14.052 -10.127 5.907   1.00 0.00 ? 43  GLU A C    6  
ATOM 11215 O O    . GLU A 1 43  ? -15.189 -10.534 5.670   1.00 0.00 ? 43  GLU A O    6  
ATOM 11216 C CB   . GLU A 1 43  ? -14.857 -8.252  7.389   1.00 0.00 ? 43  GLU A CB   6  
ATOM 11217 C CG   . GLU A 1 43  ? -14.176 -7.780  8.676   1.00 0.00 ? 43  GLU A CG   6  
ATOM 11218 C CD   . GLU A 1 43  ? -14.627 -8.618  9.874   1.00 0.00 ? 43  GLU A CD   6  
ATOM 11219 O OE1  . GLU A 1 43  ? -14.495 -9.858  9.781   1.00 0.00 ? 43  GLU A OE1  6  
ATOM 11220 O OE2  . GLU A 1 43  ? -15.094 -8.001  10.855  1.00 0.00 ? 43  GLU A OE2  6  
ATOM 11221 H H    . GLU A 1 43  ? -14.755 -7.487  4.917   1.00 0.00 ? 43  GLU A H    6  
ATOM 11222 H HA   . GLU A 1 43  ? -12.823 -8.577  6.772   1.00 0.00 ? 43  GLU A HA   6  
ATOM 11223 H HB2  . GLU A 1 43  ? -15.475 -7.450  6.985   1.00 0.00 ? 43  GLU A HB2  6  
ATOM 11224 H HB3  . GLU A 1 43  ? -15.522 -9.087  7.611   1.00 0.00 ? 43  GLU A HB3  6  
ATOM 11225 H HG2  . GLU A 1 43  ? -13.094 -7.850  8.566   1.00 0.00 ? 43  GLU A HG2  6  
ATOM 11226 H HG3  . GLU A 1 43  ? -14.412 -6.731  8.852   1.00 0.00 ? 43  GLU A HG3  6  
ATOM 11227 N N    . GLY A 1 44  ? -12.956 -10.865 5.812   1.00 0.00 ? 44  GLY A N    6  
ATOM 11228 C CA   . GLY A 1 44  ? -13.025 -12.259 5.405   1.00 0.00 ? 44  GLY A CA   6  
ATOM 11229 C C    . GLY A 1 44  ? -12.174 -12.508 4.158   1.00 0.00 ? 44  GLY A C    6  
ATOM 11230 O O    . GLY A 1 44  ? -11.650 -13.605 3.969   1.00 0.00 ? 44  GLY A O    6  
ATOM 11231 H H    . GLY A 1 44  ? -12.036 -10.527 6.007   1.00 0.00 ? 44  GLY A H    6  
ATOM 11232 H HA2  . GLY A 1 44  ? -12.679 -12.896 6.219   1.00 0.00 ? 44  GLY A HA2  6  
ATOM 11233 H HA3  . GLY A 1 44  ? -14.061 -12.532 5.204   1.00 0.00 ? 44  GLY A HA3  6  
ATOM 11234 N N    . ASP A 1 45  ? -12.064 -11.472 3.339   1.00 0.00 ? 45  ASP A N    6  
ATOM 11235 C CA   . ASP A 1 45  ? -11.286 -11.565 2.115   1.00 0.00 ? 45  ASP A CA   6  
ATOM 11236 C C    . ASP A 1 45  ? -9.805  -11.364 2.441   1.00 0.00 ? 45  ASP A C    6  
ATOM 11237 O O    . ASP A 1 45  ? -9.466  -10.737 3.443   1.00 0.00 ? 45  ASP A O    6  
ATOM 11238 C CB   . ASP A 1 45  ? -11.702 -10.485 1.115   1.00 0.00 ? 45  ASP A CB   6  
ATOM 11239 C CG   . ASP A 1 45  ? -11.335 -9.055  1.518   1.00 0.00 ? 45  ASP A CG   6  
ATOM 11240 O OD1  . ASP A 1 45  ? -11.399 -8.774  2.734   1.00 0.00 ? 45  ASP A OD1  6  
ATOM 11241 O OD2  . ASP A 1 45  ? -10.997 -8.276  0.601   1.00 0.00 ? 45  ASP A OD2  6  
ATOM 11242 H H    . ASP A 1 45  ? -12.494 -10.584 3.500   1.00 0.00 ? 45  ASP A H    6  
ATOM 11243 H HA   . ASP A 1 45  ? -11.495 -12.559 1.718   1.00 0.00 ? 45  ASP A HA   6  
ATOM 11244 H HB2  . ASP A 1 45  ? -11.240 -10.705 0.153   1.00 0.00 ? 45  ASP A HB2  6  
ATOM 11245 H HB3  . ASP A 1 45  ? -12.781 -10.540 0.971   1.00 0.00 ? 45  ASP A HB3  6  
ATOM 11246 N N    . PRO A 1 46  ? -8.940  -11.922 1.552   1.00 0.00 ? 46  PRO A N    6  
ATOM 11247 C CA   . PRO A 1 46  ? -7.503  -11.810 1.735   1.00 0.00 ? 46  PRO A CA   6  
ATOM 11248 C C    . PRO A 1 46  ? -7.013  -10.404 1.382   1.00 0.00 ? 46  PRO A C    6  
ATOM 11249 O O    . PRO A 1 46  ? -7.780  -9.584  0.878   1.00 0.00 ? 46  PRO A O    6  
ATOM 11250 C CB   . PRO A 1 46  ? -6.908  -12.888 0.845   1.00 0.00 ? 46  PRO A CB   6  
ATOM 11251 C CG   . PRO A 1 46  ? -7.996  -13.253 -0.152  1.00 0.00 ? 46  PRO A CG   6  
ATOM 11252 C CD   . PRO A 1 46  ? -9.306  -12.672 0.354   1.00 0.00 ? 46  PRO A CD   6  
ATOM 11253 H HA   . PRO A 1 46  ? -7.264  -11.949 2.696   1.00 0.00 ? 46  PRO A HA   6  
ATOM 11254 H HB2  . PRO A 1 46  ? -6.016  -12.524 0.334   1.00 0.00 ? 46  PRO A HB2  6  
ATOM 11255 H HB3  . PRO A 1 46  ? -6.607  -13.757 1.430   1.00 0.00 ? 46  PRO A HB3  6  
ATOM 11256 H HG2  . PRO A 1 46  ? -7.758  -12.855 -1.139  1.00 0.00 ? 46  PRO A HG2  6  
ATOM 11257 H HG3  . PRO A 1 46  ? -8.072  -14.335 -0.255  1.00 0.00 ? 46  PRO A HG3  6  
ATOM 11258 H HD2  . PRO A 1 46  ? -9.767  -12.026 -0.392  1.00 0.00 ? 46  PRO A HD2  6  
ATOM 11259 H HD3  . PRO A 1 46  ? -10.025 -13.458 0.584   1.00 0.00 ? 46  PRO A HD3  6  
ATOM 11260 N N    . VAL A 1 47  ? -5.739  -10.169 1.659   1.00 0.00 ? 47  VAL A N    6  
ATOM 11261 C CA   . VAL A 1 47  ? -5.138  -8.877  1.376   1.00 0.00 ? 47  VAL A CA   6  
ATOM 11262 C C    . VAL A 1 47  ? -3.977  -9.062  0.398   1.00 0.00 ? 47  VAL A C    6  
ATOM 11263 O O    . VAL A 1 47  ? -2.889  -9.479  0.793   1.00 0.00 ? 47  VAL A O    6  
ATOM 11264 C CB   . VAL A 1 47  ? -4.718  -8.198  2.682   1.00 0.00 ? 47  VAL A CB   6  
ATOM 11265 C CG1  . VAL A 1 47  ? -4.251  -6.763  2.428   1.00 0.00 ? 47  VAL A CG1  6  
ATOM 11266 C CG2  . VAL A 1 47  ? -5.853  -8.232  3.707   1.00 0.00 ? 47  VAL A CG2  6  
ATOM 11267 H H    . VAL A 1 47  ? -5.123  -10.841 2.068   1.00 0.00 ? 47  VAL A H    6  
ATOM 11268 H HA   . VAL A 1 47  ? -5.900  -8.256  0.903   1.00 0.00 ? 47  VAL A HA   6  
ATOM 11269 H HB   . VAL A 1 47  ? -3.878  -8.756  3.094   1.00 0.00 ? 47  VAL A HB   6  
ATOM 11270 H HG11 . VAL A 1 47  ? -4.527  -6.465  1.417   1.00 0.00 ? 47  VAL A HG11 6  
ATOM 11271 H HG12 . VAL A 1 47  ? -4.725  -6.095  3.147   1.00 0.00 ? 47  VAL A HG12 6  
ATOM 11272 H HG13 . VAL A 1 47  ? -3.168  -6.709  2.540   1.00 0.00 ? 47  VAL A HG13 6  
ATOM 11273 H HG21 . VAL A 1 47  ? -6.594  -7.474  3.454   1.00 0.00 ? 47  VAL A HG21 6  
ATOM 11274 H HG22 . VAL A 1 47  ? -6.322  -9.216  3.698   1.00 0.00 ? 47  VAL A HG22 6  
ATOM 11275 H HG23 . VAL A 1 47  ? -5.452  -8.030  4.700   1.00 0.00 ? 47  VAL A HG23 6  
ATOM 11276 N N    . ASN A 1 48  ? -4.247  -8.744  -0.859  1.00 0.00 ? 48  ASN A N    6  
ATOM 11277 C CA   . ASN A 1 48  ? -3.237  -8.870  -1.896  1.00 0.00 ? 48  ASN A CA   6  
ATOM 11278 C C    . ASN A 1 48  ? -2.208  -7.749  -1.740  1.00 0.00 ? 48  ASN A C    6  
ATOM 11279 O O    . ASN A 1 48  ? -1.004  -7.995  -1.786  1.00 0.00 ? 48  ASN A O    6  
ATOM 11280 C CB   . ASN A 1 48  ? -3.860  -8.750  -3.289  1.00 0.00 ? 48  ASN A CB   6  
ATOM 11281 C CG   . ASN A 1 48  ? -3.317  -9.828  -4.228  1.00 0.00 ? 48  ASN A CG   6  
ATOM 11282 O OD1  . ASN A 1 48  ? -2.139  -9.877  -4.543  1.00 0.00 ? 48  ASN A OD1  6  
ATOM 11283 N ND2  . ASN A 1 48  ? -4.237  -10.686 -4.657  1.00 0.00 ? 48  ASN A ND2  6  
ATOM 11284 H H    . ASN A 1 48  ? -5.134  -8.405  -1.172  1.00 0.00 ? 48  ASN A H    6  
ATOM 11285 H HA   . ASN A 1 48  ? -2.802  -9.859  -1.753  1.00 0.00 ? 48  ASN A HA   6  
ATOM 11286 H HB2  . ASN A 1 48  ? -4.944  -8.839  -3.215  1.00 0.00 ? 48  ASN A HB2  6  
ATOM 11287 H HB3  . ASN A 1 48  ? -3.650  -7.763  -3.701  1.00 0.00 ? 48  ASN A HB3  6  
ATOM 11288 H HD21 . ASN A 1 48  ? -5.188  -10.590 -4.360  1.00 0.00 ? 48  ASN A HD21 6  
ATOM 11289 H HD22 . ASN A 1 48  ? -3.980  -11.428 -5.276  1.00 0.00 ? 48  ASN A HD22 6  
ATOM 11290 N N    . GLU A 1 49  ? -2.720  -6.540  -1.559  1.00 0.00 ? 49  GLU A N    6  
ATOM 11291 C CA   . GLU A 1 49  ? -1.861  -5.380  -1.396  1.00 0.00 ? 49  GLU A CA   6  
ATOM 11292 C C    . GLU A 1 49  ? -2.392  -4.479  -0.279  1.00 0.00 ? 49  GLU A C    6  
ATOM 11293 O O    . GLU A 1 49  ? -3.590  -4.469  -0.002  1.00 0.00 ? 49  GLU A O    6  
ATOM 11294 C CB   . GLU A 1 49  ? -1.730  -4.606  -2.709  1.00 0.00 ? 49  GLU A CB   6  
ATOM 11295 C CG   . GLU A 1 49  ? -3.075  -4.012  -3.133  1.00 0.00 ? 49  GLU A CG   6  
ATOM 11296 C CD   . GLU A 1 49  ? -3.904  -5.034  -3.913  1.00 0.00 ? 49  GLU A CD   6  
ATOM 11297 O OE1  . GLU A 1 49  ? -3.546  -5.279  -5.085  1.00 0.00 ? 49  GLU A OE1  6  
ATOM 11298 O OE2  . GLU A 1 49  ? -4.877  -5.547  -3.319  1.00 0.00 ? 49  GLU A OE2  6  
ATOM 11299 H H    . GLU A 1 49  ? -3.701  -6.348  -1.524  1.00 0.00 ? 49  GLU A H    6  
ATOM 11300 H HA   . GLU A 1 49  ? -0.886  -5.779  -1.118  1.00 0.00 ? 49  GLU A HA   6  
ATOM 11301 H HB2  . GLU A 1 49  ? -0.996  -3.808  -2.594  1.00 0.00 ? 49  GLU A HB2  6  
ATOM 11302 H HB3  . GLU A 1 49  ? -1.359  -5.269  -3.491  1.00 0.00 ? 49  GLU A HB3  6  
ATOM 11303 H HG2  . GLU A 1 49  ? -3.627  -3.687  -2.251  1.00 0.00 ? 49  GLU A HG2  6  
ATOM 11304 H HG3  . GLU A 1 49  ? -2.908  -3.128  -3.748  1.00 0.00 ? 49  GLU A HG3  6  
ATOM 11305 N N    . MET A 1 50  ? -1.474  -3.744  0.331   1.00 0.00 ? 50  MET A N    6  
ATOM 11306 C CA   . MET A 1 50  ? -1.835  -2.842  1.411   1.00 0.00 ? 50  MET A CA   6  
ATOM 11307 C C    . MET A 1 50  ? -1.997  -1.409  0.899   1.00 0.00 ? 50  MET A C    6  
ATOM 11308 O O    . MET A 1 50  ? -1.288  -0.990  -0.015  1.00 0.00 ? 50  MET A O    6  
ATOM 11309 C CB   . MET A 1 50  ? -0.751  -2.878  2.491   1.00 0.00 ? 50  MET A CB   6  
ATOM 11310 C CG   . MET A 1 50  ? -1.137  -2.004  3.686   1.00 0.00 ? 50  MET A CG   6  
ATOM 11311 S SD   . MET A 1 50  ? -0.273  -2.552  5.148   1.00 0.00 ? 50  MET A SD   6  
ATOM 11312 C CE   . MET A 1 50  ? -0.201  -1.018  6.058   1.00 0.00 ? 50  MET A CE   6  
ATOM 11313 H H    . MET A 1 50  ? -0.501  -3.758  0.099   1.00 0.00 ? 50  MET A H    6  
ATOM 11314 H HA   . MET A 1 50  ? -2.788  -3.208  1.793   1.00 0.00 ? 50  MET A HA   6  
ATOM 11315 H HB2  . MET A 1 50  ? -0.597  -3.906  2.822   1.00 0.00 ? 50  MET A HB2  6  
ATOM 11316 H HB3  . MET A 1 50  ? 0.195   -2.533  2.074   1.00 0.00 ? 50  MET A HB3  6  
ATOM 11317 H HG2  . MET A 1 50  ? -0.894  -0.962  3.478   1.00 0.00 ? 50  MET A HG2  6  
ATOM 11318 H HG3  . MET A 1 50  ? -2.214  -2.053  3.850   1.00 0.00 ? 50  MET A HG3  6  
ATOM 11319 H HE1  . MET A 1 50  ? -0.414  -1.210  7.110   1.00 0.00 ? 50  MET A HE1  6  
ATOM 11320 H HE2  . MET A 1 50  ? 0.795   -0.585  5.962   1.00 0.00 ? 50  MET A HE2  6  
ATOM 11321 H HE3  . MET A 1 50  ? -0.939  -0.324  5.659   1.00 0.00 ? 50  MET A HE3  6  
ATOM 11322 N N    . LEU A 1 51  ? -2.933  -0.698  1.509   1.00 0.00 ? 51  LEU A N    6  
ATOM 11323 C CA   . LEU A 1 51  ? -3.197  0.678   1.126   1.00 0.00 ? 51  LEU A CA   6  
ATOM 11324 C C    . LEU A 1 51  ? -2.774  1.610   2.264   1.00 0.00 ? 51  LEU A C    6  
ATOM 11325 O O    . LEU A 1 51  ? -3.146  1.396   3.417   1.00 0.00 ? 51  LEU A O    6  
ATOM 11326 C CB   . LEU A 1 51  ? -4.658  0.846   0.704   1.00 0.00 ? 51  LEU A CB   6  
ATOM 11327 C CG   . LEU A 1 51  ? -5.073  0.122   -0.578  1.00 0.00 ? 51  LEU A CG   6  
ATOM 11328 C CD1  . LEU A 1 51  ? -3.923  0.089   -1.586  1.00 0.00 ? 51  LEU A CD1  6  
ATOM 11329 C CD2  . LEU A 1 51  ? -5.605  -1.279  -0.268  1.00 0.00 ? 51  LEU A CD2  6  
ATOM 11330 H H    . LEU A 1 51  ? -3.505  -1.047  2.252   1.00 0.00 ? 51  LEU A H    6  
ATOM 11331 H HA   . LEU A 1 51  ? -2.582  0.898   0.253   1.00 0.00 ? 51  LEU A HA   6  
ATOM 11332 H HB2  . LEU A 1 51  ? -5.293  0.496   1.518   1.00 0.00 ? 51  LEU A HB2  6  
ATOM 11333 H HB3  . LEU A 1 51  ? -4.859  1.910   0.578   1.00 0.00 ? 51  LEU A HB3  6  
ATOM 11334 H HG   . LEU A 1 51  ? -5.888  0.681   -1.037  1.00 0.00 ? 51  LEU A HG   6  
ATOM 11335 H HD11 . LEU A 1 51  ? -4.307  -0.196  -2.566  1.00 0.00 ? 51  LEU A HD11 6  
ATOM 11336 H HD12 . LEU A 1 51  ? -3.466  1.076   -1.648  1.00 0.00 ? 51  LEU A HD12 6  
ATOM 11337 H HD13 . LEU A 1 51  ? -3.177  -0.637  -1.263  1.00 0.00 ? 51  LEU A HD13 6  
ATOM 11338 H HD21 . LEU A 1 51  ? -5.146  -1.647  0.650   1.00 0.00 ? 51  LEU A HD21 6  
ATOM 11339 H HD22 . LEU A 1 51  ? -6.687  -1.238  -0.142  1.00 0.00 ? 51  LEU A HD22 6  
ATOM 11340 H HD23 . LEU A 1 51  ? -5.360  -1.951  -1.091  1.00 0.00 ? 51  LEU A HD23 6  
ATOM 11341 N N    . PHE A 1 52  ? -2.002  2.624   1.900   1.00 0.00 ? 52  PHE A N    6  
ATOM 11342 C CA   . PHE A 1 52  ? -1.525  3.589   2.876   1.00 0.00 ? 52  PHE A CA   6  
ATOM 11343 C C    . PHE A 1 52  ? -2.171  4.958   2.654   1.00 0.00 ? 52  PHE A C    6  
ATOM 11344 O O    . PHE A 1 52  ? -1.766  5.702   1.762   1.00 0.00 ? 52  PHE A O    6  
ATOM 11345 C CB   . PHE A 1 52  ? -0.013  3.713   2.679   1.00 0.00 ? 52  PHE A CB   6  
ATOM 11346 C CG   . PHE A 1 52  ? 0.770   2.453   3.055   1.00 0.00 ? 52  PHE A CG   6  
ATOM 11347 C CD1  . PHE A 1 52  ? 0.647   1.327   2.303   1.00 0.00 ? 52  PHE A CD1  6  
ATOM 11348 C CD2  . PHE A 1 52  ? 1.588   2.460   4.142   1.00 0.00 ? 52  PHE A CD2  6  
ATOM 11349 C CE1  . PHE A 1 52  ? 1.373   0.158   2.652   1.00 0.00 ? 52  PHE A CE1  6  
ATOM 11350 C CE2  . PHE A 1 52  ? 2.314   1.291   4.490   1.00 0.00 ? 52  PHE A CE2  6  
ATOM 11351 C CZ   . PHE A 1 52  ? 2.191   0.164   3.738   1.00 0.00 ? 52  PHE A CZ   6  
ATOM 11352 H H    . PHE A 1 52  ? -1.704  2.790   0.960   1.00 0.00 ? 52  PHE A H    6  
ATOM 11353 H HA   . PHE A 1 52  ? -1.800  3.215   3.862   1.00 0.00 ? 52  PHE A HA   6  
ATOM 11354 H HB2  . PHE A 1 52  ? 0.189   3.956   1.636   1.00 0.00 ? 52  PHE A HB2  6  
ATOM 11355 H HB3  . PHE A 1 52  ? 0.353   4.548   3.277   1.00 0.00 ? 52  PHE A HB3  6  
ATOM 11356 H HD1  . PHE A 1 52  ? -0.009  1.322   1.432   1.00 0.00 ? 52  PHE A HD1  6  
ATOM 11357 H HD2  . PHE A 1 52  ? 1.686   3.363   4.744   1.00 0.00 ? 52  PHE A HD2  6  
ATOM 11358 H HE1  . PHE A 1 52  ? 1.275   -0.745  2.049   1.00 0.00 ? 52  PHE A HE1  6  
ATOM 11359 H HE2  . PHE A 1 52  ? 2.970   1.296   5.361   1.00 0.00 ? 52  PHE A HE2  6  
ATOM 11360 H HZ   . PHE A 1 52  ? 2.749   -0.733  4.006   1.00 0.00 ? 52  PHE A HZ   6  
ATOM 11361 N N    . ILE A 1 53  ? -3.164  5.249   3.481   1.00 0.00 ? 53  ILE A N    6  
ATOM 11362 C CA   . ILE A 1 53  ? -3.870  6.516   3.387   1.00 0.00 ? 53  ILE A CA   6  
ATOM 11363 C C    . ILE A 1 53  ? -2.863  7.664   3.481   1.00 0.00 ? 53  ILE A C    6  
ATOM 11364 O O    . ILE A 1 53  ? -2.094  7.742   4.438   1.00 0.00 ? 53  ILE A O    6  
ATOM 11365 C CB   . ILE A 1 53  ? -4.985  6.587   4.432   1.00 0.00 ? 53  ILE A CB   6  
ATOM 11366 C CG1  . ILE A 1 53  ? -6.091  5.576   4.124   1.00 0.00 ? 53  ILE A CG1  6  
ATOM 11367 C CG2  . ILE A 1 53  ? -5.528  8.012   4.557   1.00 0.00 ? 53  ILE A CG2  6  
ATOM 11368 C CD1  . ILE A 1 53  ? -6.944  6.040   2.942   1.00 0.00 ? 53  ILE A CD1  6  
ATOM 11369 H H    . ILE A 1 53  ? -3.487  4.638   4.204   1.00 0.00 ? 53  ILE A H    6  
ATOM 11370 H HA   . ILE A 1 53  ? -4.345  6.552   2.406   1.00 0.00 ? 53  ILE A HA   6  
ATOM 11371 H HB   . ILE A 1 53  ? -4.563  6.317   5.400   1.00 0.00 ? 53  ILE A HB   6  
ATOM 11372 H HG12 . ILE A 1 53  ? -5.649  4.605   3.900   1.00 0.00 ? 53  ILE A HG12 6  
ATOM 11373 H HG13 . ILE A 1 53  ? -6.723  5.444   5.003   1.00 0.00 ? 53  ILE A HG13 6  
ATOM 11374 H HG21 . ILE A 1 53  ? -6.129  8.093   5.463   1.00 0.00 ? 53  ILE A HG21 6  
ATOM 11375 H HG22 . ILE A 1 53  ? -4.697  8.715   4.608   1.00 0.00 ? 53  ILE A HG22 6  
ATOM 11376 H HG23 . ILE A 1 53  ? -6.146  8.242   3.690   1.00 0.00 ? 53  ILE A HG23 6  
ATOM 11377 H HD11 . ILE A 1 53  ? -7.364  5.172   2.434   1.00 0.00 ? 53  ILE A HD11 6  
ATOM 11378 H HD12 . ILE A 1 53  ? -7.752  6.675   3.304   1.00 0.00 ? 53  ILE A HD12 6  
ATOM 11379 H HD13 . ILE A 1 53  ? -6.323  6.604   2.245   1.00 0.00 ? 53  ILE A HD13 6  
ATOM 11380 N N    . ILE A 1 54  ? -2.901  8.526   2.476   1.00 0.00 ? 54  ILE A N    6  
ATOM 11381 C CA   . ILE A 1 54  ? -2.001  9.666   2.434   1.00 0.00 ? 54  ILE A CA   6  
ATOM 11382 C C    . ILE A 1 54  ? -2.752  10.919  2.890   1.00 0.00 ? 54  ILE A C    6  
ATOM 11383 O O    . ILE A 1 54  ? -2.231  11.706  3.679   1.00 0.00 ? 54  ILE A O    6  
ATOM 11384 C CB   . ILE A 1 54  ? -1.369  9.799   1.047   1.00 0.00 ? 54  ILE A CB   6  
ATOM 11385 C CG1  . ILE A 1 54  ? -0.734  8.479   0.606   1.00 0.00 ? 54  ILE A CG1  6  
ATOM 11386 C CG2  . ILE A 1 54  ? -0.370  10.957  1.009   1.00 0.00 ? 54  ILE A CG2  6  
ATOM 11387 C CD1  . ILE A 1 54  ? 0.588   8.235   1.336   1.00 0.00 ? 54  ILE A CD1  6  
ATOM 11388 H H    . ILE A 1 54  ? -3.530  8.455   1.702   1.00 0.00 ? 54  ILE A H    6  
ATOM 11389 H HA   . ILE A 1 54  ? -1.194  9.471   3.140   1.00 0.00 ? 54  ILE A HA   6  
ATOM 11390 H HB   . ILE A 1 54  ? -2.158  10.031  0.333   1.00 0.00 ? 54  ILE A HB   6  
ATOM 11391 H HG12 . ILE A 1 54  ? -1.421  7.656   0.805   1.00 0.00 ? 54  ILE A HG12 6  
ATOM 11392 H HG13 . ILE A 1 54  ? -0.561  8.497   -0.470  1.00 0.00 ? 54  ILE A HG13 6  
ATOM 11393 H HG21 . ILE A 1 54  ? -0.901  11.889  0.817   1.00 0.00 ? 54  ILE A HG21 6  
ATOM 11394 H HG22 . ILE A 1 54  ? 0.146   11.024  1.967   1.00 0.00 ? 54  ILE A HG22 6  
ATOM 11395 H HG23 . ILE A 1 54  ? 0.357   10.783  0.216   1.00 0.00 ? 54  ILE A HG23 6  
ATOM 11396 H HD11 . ILE A 1 54  ? 0.694   8.956   2.147   1.00 0.00 ? 54  ILE A HD11 6  
ATOM 11397 H HD12 . ILE A 1 54  ? 0.596   7.225   1.746   1.00 0.00 ? 54  ILE A HD12 6  
ATOM 11398 H HD13 . ILE A 1 54  ? 1.416   8.350   0.637   1.00 0.00 ? 54  ILE A HD13 6  
ATOM 11399 N N    . ARG A 1 55  ? -3.963  11.065  2.374   1.00 0.00 ? 55  ARG A N    6  
ATOM 11400 C CA   . ARG A 1 55  ? -4.790  12.209  2.719   1.00 0.00 ? 55  ARG A CA   6  
ATOM 11401 C C    . ARG A 1 55  ? -6.159  12.097  2.045   1.00 0.00 ? 55  ARG A C    6  
ATOM 11402 O O    . ARG A 1 55  ? -6.309  12.439  0.873   1.00 0.00 ? 55  ARG A O    6  
ATOM 11403 C CB   . ARG A 1 55  ? -4.125  13.519  2.291   1.00 0.00 ? 55  ARG A CB   6  
ATOM 11404 C CG   . ARG A 1 55  ? -3.962  14.466  3.481   1.00 0.00 ? 55  ARG A CG   6  
ATOM 11405 C CD   . ARG A 1 55  ? -4.044  15.927  3.035   1.00 0.00 ? 55  ARG A CD   6  
ATOM 11406 N NE   . ARG A 1 55  ? -3.475  16.808  4.080   1.00 0.00 ? 55  ARG A NE   6  
ATOM 11407 C CZ   . ARG A 1 55  ? -3.488  18.147  4.022   1.00 0.00 ? 55  ARG A CZ   6  
ATOM 11408 N NH1  . ARG A 1 55  ? -4.041  18.767  2.971   1.00 0.00 ? 55  ARG A NH1  6  
ATOM 11409 N NH2  . ARG A 1 55  ? -2.949  18.865  5.016   1.00 0.00 ? 55  ARG A NH2  6  
ATOM 11410 H H    . ARG A 1 55  ? -4.380  10.421  1.733   1.00 0.00 ? 55  ARG A H    6  
ATOM 11411 H HA   . ARG A 1 55  ? -4.883  12.170  3.804   1.00 0.00 ? 55  ARG A HA   6  
ATOM 11412 H HB2  . ARG A 1 55  ? -3.150  13.309  1.852   1.00 0.00 ? 55  ARG A HB2  6  
ATOM 11413 H HB3  . ARG A 1 55  ? -4.725  14.000  1.518   1.00 0.00 ? 55  ARG A HB3  6  
ATOM 11414 H HG2  . ARG A 1 55  ? -4.737  14.263  4.221   1.00 0.00 ? 55  ARG A HG2  6  
ATOM 11415 H HG3  . ARG A 1 55  ? -3.003  14.283  3.967   1.00 0.00 ? 55  ARG A HG3  6  
ATOM 11416 H HD2  . ARG A 1 55  ? -3.501  16.061  2.100   1.00 0.00 ? 55  ARG A HD2  6  
ATOM 11417 H HD3  . ARG A 1 55  ? -5.082  16.199  2.844   1.00 0.00 ? 55  ARG A HD3  6  
ATOM 11418 H HE   . ARG A 1 55  ? -3.055  16.377  4.878   1.00 0.00 ? 55  ARG A HE   6  
ATOM 11419 H HH11 . ARG A 1 55  ? -4.444  18.230  2.229   1.00 0.00 ? 55  ARG A HH11 6  
ATOM 11420 H HH12 . ARG A 1 55  ? -4.051  19.766  2.928   1.00 0.00 ? 55  ARG A HH12 6  
ATOM 11421 H HH21 . ARG A 1 55  ? -2.536  18.402  5.801   1.00 0.00 ? 55  ARG A HH21 6  
ATOM 11422 H HH22 . ARG A 1 55  ? -2.958  19.864  4.973   1.00 0.00 ? 55  ARG A HH22 6  
ATOM 11423 N N    . GLY A 1 56  ? -7.124  11.615  2.815   1.00 0.00 ? 56  GLY A N    6  
ATOM 11424 C CA   . GLY A 1 56  ? -8.476  11.453  2.307   1.00 0.00 ? 56  GLY A CA   6  
ATOM 11425 C C    . GLY A 1 56  ? -9.441  11.069  3.430   1.00 0.00 ? 56  GLY A C    6  
ATOM 11426 O O    . GLY A 1 56  ? -9.248  11.460  4.581   1.00 0.00 ? 56  GLY A O    6  
ATOM 11427 H H    . GLY A 1 56  ? -6.995  11.339  3.767   1.00 0.00 ? 56  GLY A H    6  
ATOM 11428 H HA2  . GLY A 1 56  ? -8.807  12.381  1.840   1.00 0.00 ? 56  GLY A HA2  6  
ATOM 11429 H HA3  . GLY A 1 56  ? -8.488  10.685  1.534   1.00 0.00 ? 56  GLY A HA3  6  
ATOM 11430 N N    . ARG A 1 57  ? -10.460 10.307  3.057   1.00 0.00 ? 57  ARG A N    6  
ATOM 11431 C CA   . ARG A 1 57  ? -11.455 9.866   4.019   1.00 0.00 ? 57  ARG A CA   6  
ATOM 11432 C C    . ARG A 1 57  ? -12.032 8.511   3.602   1.00 0.00 ? 57  ARG A C    6  
ATOM 11433 O O    . ARG A 1 57  ? -11.949 8.130   2.435   1.00 0.00 ? 57  ARG A O    6  
ATOM 11434 C CB   . ARG A 1 57  ? -12.593 10.882  4.140   1.00 0.00 ? 57  ARG A CB   6  
ATOM 11435 C CG   . ARG A 1 57  ? -12.270 11.945  5.191   1.00 0.00 ? 57  ARG A CG   6  
ATOM 11436 C CD   . ARG A 1 57  ? -13.259 11.883  6.356   1.00 0.00 ? 57  ARG A CD   6  
ATOM 11437 N NE   . ARG A 1 57  ? -13.962 13.178  6.494   1.00 0.00 ? 57  ARG A NE   6  
ATOM 11438 C CZ   . ARG A 1 57  ? -13.534 14.186  7.265   1.00 0.00 ? 57  ARG A CZ   6  
ATOM 11439 N NH1  . ARG A 1 57  ? -12.405 14.056  7.974   1.00 0.00 ? 57  ARG A NH1  6  
ATOM 11440 N NH2  . ARG A 1 57  ? -14.237 15.326  7.328   1.00 0.00 ? 57  ARG A NH2  6  
ATOM 11441 H H    . ARG A 1 57  ? -10.609 9.994   2.120   1.00 0.00 ? 57  ARG A H    6  
ATOM 11442 H HA   . ARG A 1 57  ? -10.916 9.788   4.963   1.00 0.00 ? 57  ARG A HA   6  
ATOM 11443 H HB2  . ARG A 1 57  ? -12.763 11.359  3.175   1.00 0.00 ? 57  ARG A HB2  6  
ATOM 11444 H HB3  . ARG A 1 57  ? -13.516 10.369  4.408   1.00 0.00 ? 57  ARG A HB3  6  
ATOM 11445 H HG2  . ARG A 1 57  ? -11.255 11.798  5.562   1.00 0.00 ? 57  ARG A HG2  6  
ATOM 11446 H HG3  . ARG A 1 57  ? -12.302 12.934  4.735   1.00 0.00 ? 57  ARG A HG3  6  
ATOM 11447 H HD2  . ARG A 1 57  ? -13.981 11.084  6.189   1.00 0.00 ? 57  ARG A HD2  6  
ATOM 11448 H HD3  . ARG A 1 57  ? -12.731 11.647  7.280   1.00 0.00 ? 57  ARG A HD3  6  
ATOM 11449 H HE   . ARG A 1 57  ? -14.809 13.308  5.978   1.00 0.00 ? 57  ARG A HE   6  
ATOM 11450 H HH11 . ARG A 1 57  ? -11.880 13.206  7.927   1.00 0.00 ? 57  ARG A HH11 6  
ATOM 11451 H HH12 . ARG A 1 57  ? -12.086 14.809  8.550   1.00 0.00 ? 57  ARG A HH12 6  
ATOM 11452 H HH21 . ARG A 1 57  ? -15.080 15.423  6.800   1.00 0.00 ? 57  ARG A HH21 6  
ATOM 11453 H HH22 . ARG A 1 57  ? -13.918 16.079  7.904   1.00 0.00 ? 57  ARG A HH22 6  
ATOM 11454 N N    . LEU A 1 58  ? -12.604 7.821   4.578   1.00 0.00 ? 58  LEU A N    6  
ATOM 11455 C CA   . LEU A 1 58  ? -13.194 6.518   4.327   1.00 0.00 ? 58  LEU A CA   6  
ATOM 11456 C C    . LEU A 1 58  ? -14.140 6.161   5.475   1.00 0.00 ? 58  LEU A C    6  
ATOM 11457 O O    . LEU A 1 58  ? -14.190 6.864   6.483   1.00 0.00 ? 58  LEU A O    6  
ATOM 11458 C CB   . LEU A 1 58  ? -12.103 5.474   4.082   1.00 0.00 ? 58  LEU A CB   6  
ATOM 11459 C CG   . LEU A 1 58  ? -11.456 5.491   2.696   1.00 0.00 ? 58  LEU A CG   6  
ATOM 11460 C CD1  . LEU A 1 58  ? -10.151 6.290   2.710   1.00 0.00 ? 58  LEU A CD1  6  
ATOM 11461 C CD2  . LEU A 1 58  ? -11.252 4.070   2.168   1.00 0.00 ? 58  LEU A CD2  6  
ATOM 11462 H H    . LEU A 1 58  ? -12.667 8.139   5.524   1.00 0.00 ? 58  LEU A H    6  
ATOM 11463 H HA   . LEU A 1 58  ? -13.777 6.595   3.409   1.00 0.00 ? 58  LEU A HA   6  
ATOM 11464 H HB2  . LEU A 1 58  ? -11.320 5.613   4.828   1.00 0.00 ? 58  LEU A HB2  6  
ATOM 11465 H HB3  . LEU A 1 58  ? -12.530 4.485   4.250   1.00 0.00 ? 58  LEU A HB3  6  
ATOM 11466 H HG   . LEU A 1 58  ? -12.134 5.996   2.009   1.00 0.00 ? 58  LEU A HG   6  
ATOM 11467 H HD11 . LEU A 1 58  ? -10.130 6.967   1.856   1.00 0.00 ? 58  LEU A HD11 6  
ATOM 11468 H HD12 . LEU A 1 58  ? -10.088 6.867   3.633   1.00 0.00 ? 58  LEU A HD12 6  
ATOM 11469 H HD13 . LEU A 1 58  ? -9.305  5.605   2.652   1.00 0.00 ? 58  LEU A HD13 6  
ATOM 11470 H HD21 . LEU A 1 58  ? -10.583 3.527   2.834   1.00 0.00 ? 58  LEU A HD21 6  
ATOM 11471 H HD22 . LEU A 1 58  ? -12.214 3.558   2.122   1.00 0.00 ? 58  LEU A HD22 6  
ATOM 11472 H HD23 . LEU A 1 58  ? -10.816 4.112   1.170   1.00 0.00 ? 58  LEU A HD23 6  
ATOM 11473 N N    . GLU A 1 59  ? -14.867 5.070   5.283   1.00 0.00 ? 59  GLU A N    6  
ATOM 11474 C CA   . GLU A 1 59  ? -15.809 4.612   6.291   1.00 0.00 ? 59  GLU A CA   6  
ATOM 11475 C C    . GLU A 1 59  ? -15.426 3.213   6.778   1.00 0.00 ? 59  GLU A C    6  
ATOM 11476 O O    . GLU A 1 59  ? -15.254 2.297   5.975   1.00 0.00 ? 59  GLU A O    6  
ATOM 11477 C CB   . GLU A 1 59  ? -17.240 4.632   5.752   1.00 0.00 ? 59  GLU A CB   6  
ATOM 11478 C CG   . GLU A 1 59  ? -17.589 3.306   5.071   1.00 0.00 ? 59  GLU A CG   6  
ATOM 11479 C CD   . GLU A 1 59  ? -19.043 3.300   4.595   1.00 0.00 ? 59  GLU A CD   6  
ATOM 11480 O OE1  . GLU A 1 59  ? -19.804 4.163   5.083   1.00 0.00 ? 59  GLU A OE1  6  
ATOM 11481 O OE2  . GLU A 1 59  ? -19.360 2.432   3.753   1.00 0.00 ? 59  GLU A OE2  6  
ATOM 11482 H H    . GLU A 1 59  ? -14.820 4.504   4.460   1.00 0.00 ? 59  GLU A H    6  
ATOM 11483 H HA   . GLU A 1 59  ? -15.726 5.325   7.111   1.00 0.00 ? 59  GLU A HA   6  
ATOM 11484 H HB2  . GLU A 1 59  ? -17.937 4.820   6.568   1.00 0.00 ? 59  GLU A HB2  6  
ATOM 11485 H HB3  . GLU A 1 59  ? -17.354 5.450   5.041   1.00 0.00 ? 59  GLU A HB3  6  
ATOM 11486 H HG2  . GLU A 1 59  ? -16.924 3.143   4.223   1.00 0.00 ? 59  GLU A HG2  6  
ATOM 11487 H HG3  . GLU A 1 59  ? -17.426 2.483   5.767   1.00 0.00 ? 59  GLU A HG3  6  
ATOM 11488 N N    . SER A 1 60  ? -15.302 3.092   8.092   1.00 0.00 ? 60  SER A N    6  
ATOM 11489 C CA   . SER A 1 60  ? -14.943 1.821   8.696   1.00 0.00 ? 60  SER A CA   6  
ATOM 11490 C C    . SER A 1 60  ? -16.188 1.144   9.272   1.00 0.00 ? 60  SER A C    6  
ATOM 11491 O O    . SER A 1 60  ? -16.923 1.749   10.051  1.00 0.00 ? 60  SER A O    6  
ATOM 11492 C CB   . SER A 1 60  ? -13.888 2.008   9.788   1.00 0.00 ? 60  SER A CB   6  
ATOM 11493 O OG   . SER A 1 60  ? -13.767 0.856   10.617  1.00 0.00 ? 60  SER A OG   6  
ATOM 11494 H H    . SER A 1 60  ? -15.443 3.842   8.738   1.00 0.00 ? 60  SER A H    6  
ATOM 11495 H HA   . SER A 1 60  ? -14.524 1.224   7.885   1.00 0.00 ? 60  SER A HA   6  
ATOM 11496 H HB2  . SER A 1 60  ? -12.924 2.226   9.327   1.00 0.00 ? 60  SER A HB2  6  
ATOM 11497 H HB3  . SER A 1 60  ? -14.150 2.870   10.401  1.00 0.00 ? 60  SER A HB3  6  
ATOM 11498 H HG   . SER A 1 60  ? -13.391 0.093   10.091  1.00 0.00 ? 60  SER A HG   6  
ATOM 11499 N N    . VAL A 1 61  ? -16.387 -0.101  8.866   1.00 0.00 ? 61  VAL A N    6  
ATOM 11500 C CA   . VAL A 1 61  ? -17.531 -0.867  9.332   1.00 0.00 ? 61  VAL A CA   6  
ATOM 11501 C C    . VAL A 1 61  ? -17.067 -2.261  9.757   1.00 0.00 ? 61  VAL A C    6  
ATOM 11502 O O    . VAL A 1 61  ? -16.060 -2.762  9.260   1.00 0.00 ? 61  VAL A O    6  
ATOM 11503 C CB   . VAL A 1 61  ? -18.614 -0.900  8.252   1.00 0.00 ? 61  VAL A CB   6  
ATOM 11504 C CG1  . VAL A 1 61  ? -19.505 -2.134  8.406   1.00 0.00 ? 61  VAL A CG1  6  
ATOM 11505 C CG2  . VAL A 1 61  ? -19.446 0.384   8.270   1.00 0.00 ? 61  VAL A CG2  6  
ATOM 11506 H H    . VAL A 1 61  ? -15.785 -0.586  8.232   1.00 0.00 ? 61  VAL A H    6  
ATOM 11507 H HA   . VAL A 1 61  ? -17.938 -0.352  10.203  1.00 0.00 ? 61  VAL A HA   6  
ATOM 11508 H HB   . VAL A 1 61  ? -18.119 -0.963  7.283   1.00 0.00 ? 61  VAL A HB   6  
ATOM 11509 H HG11 . VAL A 1 61  ? -18.956 -3.020  8.090   1.00 0.00 ? 61  VAL A HG11 6  
ATOM 11510 H HG12 . VAL A 1 61  ? -19.799 -2.241  9.451   1.00 0.00 ? 61  VAL A HG12 6  
ATOM 11511 H HG13 . VAL A 1 61  ? -20.396 -2.018  7.789   1.00 0.00 ? 61  VAL A HG13 6  
ATOM 11512 H HG21 . VAL A 1 61  ? -19.160 1.015   7.429   1.00 0.00 ? 61  VAL A HG21 6  
ATOM 11513 H HG22 . VAL A 1 61  ? -20.504 0.132   8.193   1.00 0.00 ? 61  VAL A HG22 6  
ATOM 11514 H HG23 . VAL A 1 61  ? -19.268 0.919   9.203   1.00 0.00 ? 61  VAL A HG23 6  
ATOM 11515 N N    . THR A 1 62  ? -17.825 -2.849  10.671  1.00 0.00 ? 62  THR A N    6  
ATOM 11516 C CA   . THR A 1 62  ? -17.505 -4.177  11.168  1.00 0.00 ? 62  THR A CA   6  
ATOM 11517 C C    . THR A 1 62  ? -18.763 -5.045  11.220  1.00 0.00 ? 62  THR A C    6  
ATOM 11518 O O    . THR A 1 62  ? -19.866 -4.534  11.409  1.00 0.00 ? 62  THR A O    6  
ATOM 11519 C CB   . THR A 1 62  ? -16.817 -4.020  12.526  1.00 0.00 ? 62  THR A CB   6  
ATOM 11520 O OG1  . THR A 1 62  ? -16.514 -5.356  12.918  1.00 0.00 ? 62  THR A OG1  6  
ATOM 11521 C CG2  . THR A 1 62  ? -17.773 -3.521  13.611  1.00 0.00 ? 62  THR A CG2  6  
ATOM 11522 H H    . THR A 1 62  ? -18.643 -2.435  11.070  1.00 0.00 ? 62  THR A H    6  
ATOM 11523 H HA   . THR A 1 62  ? -16.819 -4.650  10.465  1.00 0.00 ? 62  THR A HA   6  
ATOM 11524 H HB   . THR A 1 62  ? -15.944 -3.372  12.447  1.00 0.00 ? 62  THR A HB   6  
ATOM 11525 H HG1  . THR A 1 62  ? -16.006 -5.352  13.779  1.00 0.00 ? 62  THR A HG1  6  
ATOM 11526 H HG21 . THR A 1 62  ? -17.475 -2.520  13.925  1.00 0.00 ? 62  THR A HG21 6  
ATOM 11527 H HG22 . THR A 1 62  ? -18.788 -3.490  13.216  1.00 0.00 ? 62  THR A HG22 6  
ATOM 11528 H HG23 . THR A 1 62  ? -17.736 -4.196  14.466  1.00 0.00 ? 62  THR A HG23 6  
ATOM 11529 N N    . THR A 1 63  ? -18.556 -6.342  11.050  1.00 0.00 ? 63  THR A N    6  
ATOM 11530 C CA   . THR A 1 63  ? -19.660 -7.286  11.076  1.00 0.00 ? 63  THR A CA   6  
ATOM 11531 C C    . THR A 1 63  ? -19.471 -8.297  12.209  1.00 0.00 ? 63  THR A C    6  
ATOM 11532 O O    . THR A 1 63  ? -20.433 -8.673  12.877  1.00 0.00 ? 63  THR A O    6  
ATOM 11533 C CB   . THR A 1 63  ? -19.761 -7.934  9.694   1.00 0.00 ? 63  THR A CB   6  
ATOM 11534 O OG1  . THR A 1 63  ? -18.482 -8.532  9.497   1.00 0.00 ? 63  THR A OG1  6  
ATOM 11535 C CG2  . THR A 1 63  ? -19.866 -6.902  8.569   1.00 0.00 ? 63  THR A CG2  6  
ATOM 11536 H H    . THR A 1 63  ? -17.656 -6.749  10.897  1.00 0.00 ? 63  THR A H    6  
ATOM 1153