data_1WH6
# 
_entry.id   1WH6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1WH6         
RCSB  RCSB023576   
WWPDB D_1000023576 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002100285.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WH6 
_pdbx_database_status.recvd_initial_deposition_date   2004-05-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nameki, N.'                                             1 
'Tochio, N.'                                             2 
'Koshiba, S.'                                            3 
'Kigawa, T.'                                             4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the second CUT domain of human Homeobox protein Cux-2' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nameki, N.'   1 
primary 'Tochio, N.'   2 
primary 'Koshiba, S.'  3 
primary 'Kigawa, T.'   4 
primary 'Yokoyama, S.' 5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Homeobox protein Cux-2' 
_entity.formula_weight             11076.532 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'CUT domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cut-like 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGQYELYMYREVDTLELTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWL
SDQLGQAVGQQPGASSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGQYELYMYREVDTLELTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWL
SDQLGQAVGQQPGASSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002100285.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   GLN n 
1 9   TYR n 
1 10  GLU n 
1 11  LEU n 
1 12  TYR n 
1 13  MET n 
1 14  TYR n 
1 15  ARG n 
1 16  GLU n 
1 17  VAL n 
1 18  ASP n 
1 19  THR n 
1 20  LEU n 
1 21  GLU n 
1 22  LEU n 
1 23  THR n 
1 24  ARG n 
1 25  GLN n 
1 26  VAL n 
1 27  LYS n 
1 28  GLU n 
1 29  LYS n 
1 30  LEU n 
1 31  ALA n 
1 32  LYS n 
1 33  ASN n 
1 34  GLY n 
1 35  ILE n 
1 36  CYS n 
1 37  GLN n 
1 38  ARG n 
1 39  ILE n 
1 40  PHE n 
1 41  GLY n 
1 42  GLU n 
1 43  LYS n 
1 44  VAL n 
1 45  LEU n 
1 46  GLY n 
1 47  LEU n 
1 48  SER n 
1 49  GLN n 
1 50  GLY n 
1 51  SER n 
1 52  VAL n 
1 53  SER n 
1 54  ASP n 
1 55  MET n 
1 56  LEU n 
1 57  SER n 
1 58  ARG n 
1 59  PRO n 
1 60  LYS n 
1 61  PRO n 
1 62  TRP n 
1 63  SER n 
1 64  LYS n 
1 65  LEU n 
1 66  THR n 
1 67  GLN n 
1 68  LYS n 
1 69  GLY n 
1 70  ARG n 
1 71  GLU n 
1 72  PRO n 
1 73  PHE n 
1 74  ILE n 
1 75  ARG n 
1 76  MET n 
1 77  GLN n 
1 78  LEU n 
1 79  TRP n 
1 80  LEU n 
1 81  SER n 
1 82  ASP n 
1 83  GLN n 
1 84  LEU n 
1 85  GLY n 
1 86  GLN n 
1 87  ALA n 
1 88  VAL n 
1 89  GLY n 
1 90  GLN n 
1 91  GLN n 
1 92  PRO n 
1 93  GLY n 
1 94  ALA n 
1 95  SER n 
1 96  SER n 
1 97  GLY n 
1 98  PRO n 
1 99  SER n 
1 100 SER n 
1 101 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'KAZUSA cDNA hg03205' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040114-61 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CUTL2_HUMAN 
_struct_ref.pdbx_db_accession          O14529 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QYELYMYREVDTLELTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLSDQLGQA
VGQQPGAS
;
_struct_ref.pdbx_align_begin           906 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WH6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 95 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O14529 
_struct_ref_seq.db_align_beg                  906 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  993 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       95 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WH6 GLY A 1   ? UNP O14529 ? ? 'CLONING ARTIFACT' 1   1  
1 1WH6 SER A 2   ? UNP O14529 ? ? 'CLONING ARTIFACT' 2   2  
1 1WH6 SER A 3   ? UNP O14529 ? ? 'CLONING ARTIFACT' 3   3  
1 1WH6 GLY A 4   ? UNP O14529 ? ? 'CLONING ARTIFACT' 4   4  
1 1WH6 SER A 5   ? UNP O14529 ? ? 'CLONING ARTIFACT' 5   5  
1 1WH6 SER A 6   ? UNP O14529 ? ? 'CLONING ARTIFACT' 6   6  
1 1WH6 GLY A 7   ? UNP O14529 ? ? 'CLONING ARTIFACT' 7   7  
1 1WH6 SER A 96  ? UNP O14529 ? ? 'CLONING ARTIFACT' 96  8  
1 1WH6 GLY A 97  ? UNP O14529 ? ? 'CLONING ARTIFACT' 97  9  
1 1WH6 PRO A 98  ? UNP O14529 ? ? 'CLONING ARTIFACT' 98  10 
1 1WH6 SER A 99  ? UNP O14529 ? ? 'CLONING ARTIFACT' 99  11 
1 1WH6 SER A 100 ? UNP O14529 ? ? 'CLONING ARTIFACT' 100 12 
1 1WH6 GLY A 101 ? UNP O14529 ? ? 'CLONING ARTIFACT' 101 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
2 1 1 3D_13C-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         296 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'0.3mM CUT domain U-15N, 13C; 20mM phosphate buffer NA (pH 6.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.field_strength    700 
# 
_pdbx_nmr_refine.entry_id           1WH6 
_pdbx_nmr_refine.method             'torsion angle dynamics, restrained molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1WH6 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1WH6 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 3.5      collection      Bruker                                 1 
NMRPipe 20020425 processing      'Delaglio, F.'                         2 
NMRView 5.0.4    'data analysis' 'Johnson, B.A.'                        3 
Kujira  0.901    'data analysis' 'Kobayashi, N.'                        4 
CYANA   1.0.7    'data analysis' 'Guentert, P.'                         5 
OPALp   ?        refinement      'Koradi, R.,Billeter, M.,Guentert, P.' 6 
# 
_exptl.entry_id          1WH6 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1WH6 
_struct.title                     'Solution structure of the second CUT domain of human Homeobox protein Cux-2' 
_struct.pdbx_descriptor           'Homeobox protein Cux-2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WH6 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
'CUT domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 TYR A 9  ? ARG A 15 ? TYR A 9  ARG A 15 1 ? 7  
HELX_P HELX_P2 2 ASP A 18 ? LYS A 32 ? ASP A 18 LYS A 32 1 ? 15 
HELX_P HELX_P3 3 CYS A 36 ? VAL A 44 ? CYS A 36 VAL A 44 1 ? 9  
HELX_P HELX_P4 4 SER A 48 ? ARG A 58 ? SER A 48 ARG A 58 1 ? 11 
HELX_P HELX_P5 5 THR A 66 ? GLN A 83 ? THR A 66 GLN A 83 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1WH6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WH6 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 0.758   -18.078 -24.414 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 2.106   -17.687 -23.990 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 2.054   -16.547 -22.994 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 1.596   -16.745 -21.871 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 0.158   -18.393 -23.678 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 2.582   -18.543 -23.518 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 2.689   -17.392 -24.861 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 2.546   -15.363 -23.357 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 2.473   -14.168 -22.522 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 1.006   -13.770 -22.307 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 0.295   -13.505 -23.279 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 3.273   -13.060 -23.203 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 4.634   -13.458 -23.299 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 2.947   -15.232 -24.278 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 2.931   -14.379 -21.554 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 2.867   -12.876 -24.200 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 3.191   -12.143 -22.619 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 5.086   -13.102 -22.517 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 0.553   -13.783 -21.052 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -0.849  -13.760 -20.667 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -1.002  -13.140 -19.271 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -1.105  -13.863 -18.277 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -1.377  -15.202 -20.671 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -1.386  -15.798 -21.960 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 1.213   -13.891 -20.287 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -1.424  -13.166 -21.378 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -0.765  -15.811 -20.007 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -2.389  -15.194 -20.272 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -1.733  -16.703 -21.825 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -1.052  -11.811 -19.176 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -1.372  -11.114 -17.934 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -0.929  -9.664  -18.043 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -1.754  -8.763  -18.194 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -0.947  -11.229 -19.998 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -2.448  -11.153 -17.768 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -0.868  -11.589 -17.091 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 0.388   -9.458  -18.025 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 1.087   -8.255  -18.468 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 0.977   -7.087  -17.483 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 2.003   -6.644  -16.953 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 0.648   -7.874  -19.888 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 0.700   -8.991  -20.763 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 0.975   -10.269 -17.856 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 2.141   -8.520  -18.518 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -0.366  -7.474  -19.873 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 1.317   -7.099  -20.258 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 1.270   -8.720  -21.510 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -0.236  -6.624  -17.170 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -0.459  -5.655  -16.101 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -0.006  -6.206  -14.739 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 0.285   -5.424  -13.829 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -1.936  -5.263  -16.053 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -2.406  -4.791  -17.303 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -1.047  -7.048  -17.614 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 0.127   -4.762  -16.318 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -2.533  -6.115  -15.736 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -2.055  -4.466  -15.325 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -2.675  -3.859  -17.150 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 0.108   -7.536  -14.614 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 0.655   -8.218  -13.454 1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -0.208  -7.943  -12.234 1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 0.235   -7.250  -11.315 1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -0.168  -8.107  -15.400 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 0.686   -9.293  -13.640 1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 1.668   -7.867  -13.262 1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . GLN A 1 8   ? -1.433  -8.479  -12.244 1.00 0.00 ? 8   GLN A N    1  
ATOM 67    C CA   . GLN A 1 8   ? -2.337  -8.444  -11.101 1.00 0.00 ? 8   GLN A CA   1  
ATOM 68    C C    . GLN A 1 8   ? -1.652  -9.061  -9.879  1.00 0.00 ? 8   GLN A C    1  
ATOM 69    O O    . GLN A 1 8   ? -0.739  -9.885  -10.008 1.00 0.00 ? 8   GLN A O    1  
ATOM 70    C CB   . GLN A 1 8   ? -3.618  -9.228  -11.422 1.00 0.00 ? 8   GLN A CB   1  
ATOM 71    C CG   . GLN A 1 8   ? -4.648  -8.440  -12.255 1.00 0.00 ? 8   GLN A CG   1  
ATOM 72    C CD   . GLN A 1 8   ? -5.514  -9.362  -13.121 1.00 0.00 ? 8   GLN A CD   1  
ATOM 73    O OE1  . GLN A 1 8   ? -5.613  -10.565 -12.870 1.00 0.00 ? 8   GLN A OE1  1  
ATOM 74    N NE2  . GLN A 1 8   ? -6.184  -8.835  -14.135 1.00 0.00 ? 8   GLN A NE2  1  
ATOM 75    H H    . GLN A 1 8   ? -1.674  -9.079  -13.021 1.00 0.00 ? 8   GLN A H    1  
ATOM 76    H HA   . GLN A 1 8   ? -2.581  -7.405  -10.880 1.00 0.00 ? 8   GLN A HA   1  
ATOM 77    H HB2  . GLN A 1 8   ? -3.320  -10.142 -11.936 1.00 0.00 ? 8   GLN A HB2  1  
ATOM 78    H HB3  . GLN A 1 8   ? -4.103  -9.524  -10.489 1.00 0.00 ? 8   GLN A HB3  1  
ATOM 79    H HG2  . GLN A 1 8   ? -5.293  -7.893  -11.557 1.00 0.00 ? 8   GLN A HG2  1  
ATOM 80    H HG3  . GLN A 1 8   ? -4.124  -7.733  -12.905 1.00 0.00 ? 8   GLN A HG3  1  
ATOM 81    H HE21 . GLN A 1 8   ? -6.083  -7.851  -14.382 1.00 0.00 ? 8   GLN A HE21 1  
ATOM 82    H HE22 . GLN A 1 8   ? -6.636  -9.468  -14.778 1.00 0.00 ? 8   GLN A HE22 1  
ATOM 83    N N    . TYR A 1 9   ? -2.167  -8.722  -8.695  1.00 0.00 ? 9   TYR A N    1  
ATOM 84    C CA   . TYR A 1 9   ? -1.562  -9.056  -7.410  1.00 0.00 ? 9   TYR A CA   1  
ATOM 85    C C    . TYR A 1 9   ? -1.325  -10.540 -7.182  1.00 0.00 ? 9   TYR A C    1  
ATOM 86    O O    . TYR A 1 9   ? -0.532  -10.888 -6.314  1.00 0.00 ? 9   TYR A O    1  
ATOM 87    C CB   . TYR A 1 9   ? -2.407  -8.526  -6.254  1.00 0.00 ? 9   TYR A CB   1  
ATOM 88    C CG   . TYR A 1 9   ? -3.837  -9.018  -6.250  1.00 0.00 ? 9   TYR A CG   1  
ATOM 89    C CD1  . TYR A 1 9   ? -4.195  -10.254 -5.677  1.00 0.00 ? 9   TYR A CD1  1  
ATOM 90    C CD2  . TYR A 1 9   ? -4.816  -8.221  -6.855  1.00 0.00 ? 9   TYR A CD2  1  
ATOM 91    C CE1  . TYR A 1 9   ? -5.531  -10.692 -5.718  1.00 0.00 ? 9   TYR A CE1  1  
ATOM 92    C CE2  . TYR A 1 9   ? -6.139  -8.660  -6.921  1.00 0.00 ? 9   TYR A CE2  1  
ATOM 93    C CZ   . TYR A 1 9   ? -6.513  -9.897  -6.352  1.00 0.00 ? 9   TYR A CZ   1  
ATOM 94    O OH   . TYR A 1 9   ? -7.806  -10.313 -6.425  1.00 0.00 ? 9   TYR A OH   1  
ATOM 95    H H    . TYR A 1 9   ? -2.947  -8.076  -8.701  1.00 0.00 ? 9   TYR A H    1  
ATOM 96    H HA   . TYR A 1 9   ? -0.597  -8.564  -7.386  1.00 0.00 ? 9   TYR A HA   1  
ATOM 97    H HB2  . TYR A 1 9   ? -1.931  -8.800  -5.312  1.00 0.00 ? 9   TYR A HB2  1  
ATOM 98    H HB3  . TYR A 1 9   ? -2.421  -7.444  -6.323  1.00 0.00 ? 9   TYR A HB3  1  
ATOM 99    H HD1  . TYR A 1 9   ? -3.457  -10.902 -5.227  1.00 0.00 ? 9   TYR A HD1  1  
ATOM 100   H HD2  . TYR A 1 9   ? -4.559  -7.260  -7.276  1.00 0.00 ? 9   TYR A HD2  1  
ATOM 101   H HE1  . TYR A 1 9   ? -5.790  -11.646 -5.278  1.00 0.00 ? 9   TYR A HE1  1  
ATOM 102   H HE2  . TYR A 1 9   ? -6.840  -8.025  -7.430  1.00 0.00 ? 9   TYR A HE2  1  
ATOM 103   H HH   . TYR A 1 9   ? -8.010  -10.952 -5.734  1.00 0.00 ? 9   TYR A HH   1  
ATOM 104   N N    . GLU A 1 10  ? -1.993  -11.417 -7.922  1.00 0.00 ? 10  GLU A N    1  
ATOM 105   C CA   . GLU A 1 10  ? -1.821  -12.840 -7.870  1.00 0.00 ? 10  GLU A CA   1  
ATOM 106   C C    . GLU A 1 10  ? -0.361  -13.255 -8.066  1.00 0.00 ? 10  GLU A C    1  
ATOM 107   O O    . GLU A 1 10  ? 0.048   -14.258 -7.500  1.00 0.00 ? 10  GLU A O    1  
ATOM 108   C CB   . GLU A 1 10  ? -2.762  -13.430 -8.921  1.00 0.00 ? 10  GLU A CB   1  
ATOM 109   C CG   . GLU A 1 10  ? -2.985  -14.905 -8.627  1.00 0.00 ? 10  GLU A CG   1  
ATOM 110   C CD   . GLU A 1 10  ? -4.224  -15.410 -9.360  1.00 0.00 ? 10  GLU A CD   1  
ATOM 111   O OE1  . GLU A 1 10  ? -5.355  -15.059 -8.931  1.00 0.00 ? 10  GLU A OE1  1  
ATOM 112   O OE2  . GLU A 1 10  ? -4.050  -16.077 -10.407 1.00 0.00 ? 10  GLU A OE2  1  
ATOM 113   H H    . GLU A 1 10  ? -2.697  -11.108 -8.562  1.00 0.00 ? 10  GLU A H    1  
ATOM 114   H HA   . GLU A 1 10  ? -2.142  -13.166 -6.884  1.00 0.00 ? 10  GLU A HA   1  
ATOM 115   H HB2  . GLU A 1 10  ? -3.722  -12.907 -8.863  1.00 0.00 ? 10  GLU A HB2  1  
ATOM 116   H HB3  . GLU A 1 10  ? -2.344  -13.299 -9.921  1.00 0.00 ? 10  GLU A HB3  1  
ATOM 117   H HG2  . GLU A 1 10  ? -2.096  -15.459 -8.924  1.00 0.00 ? 10  GLU A HG2  1  
ATOM 118   H HG3  . GLU A 1 10  ? -3.120  -15.007 -7.553  1.00 0.00 ? 10  GLU A HG3  1  
ATOM 119   N N    . LEU A 1 11  ? 0.448   -12.494 -8.810  1.00 0.00 ? 11  LEU A N    1  
ATOM 120   C CA   . LEU A 1 11  ? 1.892   -12.723 -8.901  1.00 0.00 ? 11  LEU A CA   1  
ATOM 121   C C    . LEU A 1 11  ? 2.514   -12.612 -7.494  1.00 0.00 ? 11  LEU A C    1  
ATOM 122   O O    . LEU A 1 11  ? 3.190   -13.527 -7.008  1.00 0.00 ? 11  LEU A O    1  
ATOM 123   C CB   . LEU A 1 11  ? 2.471   -11.695 -9.899  1.00 0.00 ? 11  LEU A CB   1  
ATOM 124   C CG   . LEU A 1 11  ? 3.862   -11.982 -10.503 1.00 0.00 ? 11  LEU A CG   1  
ATOM 125   C CD1  . LEU A 1 11  ? 4.992   -12.159 -9.483  1.00 0.00 ? 11  LEU A CD1  1  
ATOM 126   C CD2  . LEU A 1 11  ? 3.826   -13.197 -11.435 1.00 0.00 ? 11  LEU A CD2  1  
ATOM 127   H H    . LEU A 1 11  ? 0.061   -11.654 -9.231  1.00 0.00 ? 11  LEU A H    1  
ATOM 128   H HA   . LEU A 1 11  ? 2.056   -13.730 -9.283  1.00 0.00 ? 11  LEU A HA   1  
ATOM 129   H HB2  . LEU A 1 11  ? 1.779   -11.607 -10.738 1.00 0.00 ? 11  LEU A HB2  1  
ATOM 130   H HB3  . LEU A 1 11  ? 2.495   -10.716 -9.423  1.00 0.00 ? 11  LEU A HB3  1  
ATOM 131   H HG   . LEU A 1 11  ? 4.117   -11.116 -11.115 1.00 0.00 ? 11  LEU A HG   1  
ATOM 132   H HD11 . LEU A 1 11  ? 4.994   -11.328 -8.780  1.00 0.00 ? 11  LEU A HD11 1  
ATOM 133   H HD12 . LEU A 1 11  ? 4.884   -13.097 -8.943  1.00 0.00 ? 11  LEU A HD12 1  
ATOM 134   H HD13 . LEU A 1 11  ? 5.950   -12.168 -10.002 1.00 0.00 ? 11  LEU A HD13 1  
ATOM 135   H HD21 . LEU A 1 11  ? 4.763   -13.261 -11.983 1.00 0.00 ? 11  LEU A HD21 1  
ATOM 136   H HD22 . LEU A 1 11  ? 3.670   -14.117 -10.873 1.00 0.00 ? 11  LEU A HD22 1  
ATOM 137   H HD23 . LEU A 1 11  ? 3.019   -13.081 -12.160 1.00 0.00 ? 11  LEU A HD23 1  
ATOM 138   N N    . TYR A 1 12  ? 2.222   -11.490 -6.834  1.00 0.00 ? 12  TYR A N    1  
ATOM 139   C CA   . TYR A 1 12  ? 2.732   -11.043 -5.539  1.00 0.00 ? 12  TYR A CA   1  
ATOM 140   C C    . TYR A 1 12  ? 2.114   -11.821 -4.370  1.00 0.00 ? 12  TYR A C    1  
ATOM 141   O O    . TYR A 1 12  ? 2.635   -11.784 -3.258  1.00 0.00 ? 12  TYR A O    1  
ATOM 142   C CB   . TYR A 1 12  ? 2.448   -9.530  -5.383  1.00 0.00 ? 12  TYR A CB   1  
ATOM 143   C CG   . TYR A 1 12  ? 2.665   -8.687  -6.637  1.00 0.00 ? 12  TYR A CG   1  
ATOM 144   C CD1  . TYR A 1 12  ? 3.732   -8.959  -7.516  1.00 0.00 ? 12  TYR A CD1  1  
ATOM 145   C CD2  . TYR A 1 12  ? 1.732   -7.688  -6.977  1.00 0.00 ? 12  TYR A CD2  1  
ATOM 146   C CE1  . TYR A 1 12  ? 3.794   -8.348  -8.780  1.00 0.00 ? 12  TYR A CE1  1  
ATOM 147   C CE2  . TYR A 1 12  ? 1.783   -7.072  -8.240  1.00 0.00 ? 12  TYR A CE2  1  
ATOM 148   C CZ   . TYR A 1 12  ? 2.793   -7.430  -9.160  1.00 0.00 ? 12  TYR A CZ   1  
ATOM 149   O OH   . TYR A 1 12  ? 2.773   -6.933  -10.426 1.00 0.00 ? 12  TYR A OH   1  
ATOM 150   H H    . TYR A 1 12  ? 1.593   -10.844 -7.289  1.00 0.00 ? 12  TYR A H    1  
ATOM 151   H HA   . TYR A 1 12  ? 3.812   -11.200 -5.522  1.00 0.00 ? 12  TYR A HA   1  
ATOM 152   H HB2  . TYR A 1 12  ? 1.407   -9.418  -5.076  1.00 0.00 ? 12  TYR A HB2  1  
ATOM 153   H HB3  . TYR A 1 12  ? 3.054   -9.132  -4.572  1.00 0.00 ? 12  TYR A HB3  1  
ATOM 154   H HD1  . TYR A 1 12  ? 4.481   -9.686  -7.244  1.00 0.00 ? 12  TYR A HD1  1  
ATOM 155   H HD2  . TYR A 1 12  ? 0.947   -7.424  -6.285  1.00 0.00 ? 12  TYR A HD2  1  
ATOM 156   H HE1  . TYR A 1 12  ? 4.580   -8.618  -9.471  1.00 0.00 ? 12  TYR A HE1  1  
ATOM 157   H HE2  . TYR A 1 12  ? 1.035   -6.347  -8.519  1.00 0.00 ? 12  TYR A HE2  1  
ATOM 158   H HH   . TYR A 1 12  ? 1.854   -6.777  -10.707 1.00 0.00 ? 12  TYR A HH   1  
ATOM 159   N N    . MET A 1 13  ? 1.026   -12.571 -4.584  1.00 0.00 ? 13  MET A N    1  
ATOM 160   C CA   . MET A 1 13  ? 0.511   -13.469 -3.551  1.00 0.00 ? 13  MET A CA   1  
ATOM 161   C C    . MET A 1 13  ? 1.595   -14.481 -3.166  1.00 0.00 ? 13  MET A C    1  
ATOM 162   O O    . MET A 1 13  ? 1.692   -14.874 -2.001  1.00 0.00 ? 13  MET A O    1  
ATOM 163   C CB   . MET A 1 13  ? -0.748  -14.214 -4.020  1.00 0.00 ? 13  MET A CB   1  
ATOM 164   C CG   . MET A 1 13  ? -1.988  -13.337 -4.223  1.00 0.00 ? 13  MET A CG   1  
ATOM 165   S SD   . MET A 1 13  ? -2.796  -12.717 -2.721  1.00 0.00 ? 13  MET A SD   1  
ATOM 166   C CE   . MET A 1 13  ? -2.013  -11.093 -2.555  1.00 0.00 ? 13  MET A CE   1  
ATOM 167   H H    . MET A 1 13  ? 0.580   -12.529 -5.492  1.00 0.00 ? 13  MET A H    1  
ATOM 168   H HA   . MET A 1 13  ? 0.267   -12.875 -2.671  1.00 0.00 ? 13  MET A HA   1  
ATOM 169   H HB2  . MET A 1 13  ? -0.527  -14.735 -4.952  1.00 0.00 ? 13  MET A HB2  1  
ATOM 170   H HB3  . MET A 1 13  ? -0.996  -14.965 -3.272  1.00 0.00 ? 13  MET A HB3  1  
ATOM 171   H HG2  . MET A 1 13  ? -1.732  -12.494 -4.858  1.00 0.00 ? 13  MET A HG2  1  
ATOM 172   H HG3  . MET A 1 13  ? -2.724  -13.943 -4.752  1.00 0.00 ? 13  MET A HG3  1  
ATOM 173   H HE1  . MET A 1 13  ? -2.446  -10.578 -1.698  1.00 0.00 ? 13  MET A HE1  1  
ATOM 174   H HE2  . MET A 1 13  ? -0.941  -11.198 -2.408  1.00 0.00 ? 13  MET A HE2  1  
ATOM 175   H HE3  . MET A 1 13  ? -2.192  -10.506 -3.455  1.00 0.00 ? 13  MET A HE3  1  
ATOM 176   N N    . TYR A 1 14  ? 2.426   -14.894 -4.124  1.00 0.00 ? 14  TYR A N    1  
ATOM 177   C CA   . TYR A 1 14  ? 3.462   -15.898 -3.928  1.00 0.00 ? 14  TYR A CA   1  
ATOM 178   C C    . TYR A 1 14  ? 4.807   -15.221 -3.686  1.00 0.00 ? 14  TYR A C    1  
ATOM 179   O O    . TYR A 1 14  ? 5.431   -15.469 -2.651  1.00 0.00 ? 14  TYR A O    1  
ATOM 180   C CB   . TYR A 1 14  ? 3.497   -16.835 -5.144  1.00 0.00 ? 14  TYR A CB   1  
ATOM 181   C CG   . TYR A 1 14  ? 2.130   -17.385 -5.478  1.00 0.00 ? 14  TYR A CG   1  
ATOM 182   C CD1  . TYR A 1 14  ? 1.559   -18.393 -4.682  1.00 0.00 ? 14  TYR A CD1  1  
ATOM 183   C CD2  . TYR A 1 14  ? 1.377   -16.785 -6.501  1.00 0.00 ? 14  TYR A CD2  1  
ATOM 184   C CE1  . TYR A 1 14  ? 0.209   -18.743 -4.848  1.00 0.00 ? 14  TYR A CE1  1  
ATOM 185   C CE2  . TYR A 1 14  ? 0.029   -17.141 -6.678  1.00 0.00 ? 14  TYR A CE2  1  
ATOM 186   C CZ   . TYR A 1 14  ? -0.575  -18.079 -5.816  1.00 0.00 ? 14  TYR A CZ   1  
ATOM 187   O OH   . TYR A 1 14  ? -1.914  -18.303 -5.896  1.00 0.00 ? 14  TYR A OH   1  
ATOM 188   H H    . TYR A 1 14  ? 2.290   -14.532 -5.059  1.00 0.00 ? 14  TYR A H    1  
ATOM 189   H HA   . TYR A 1 14  ? 3.214   -16.507 -3.056  1.00 0.00 ? 14  TYR A HA   1  
ATOM 190   H HB2  . TYR A 1 14  ? 3.874   -16.289 -6.008  1.00 0.00 ? 14  TYR A HB2  1  
ATOM 191   H HB3  . TYR A 1 14  ? 4.176   -17.661 -4.943  1.00 0.00 ? 14  TYR A HB3  1  
ATOM 192   H HD1  . TYR A 1 14  ? 2.139   -18.861 -3.901  1.00 0.00 ? 14  TYR A HD1  1  
ATOM 193   H HD2  . TYR A 1 14  ? 1.827   -16.011 -7.111  1.00 0.00 ? 14  TYR A HD2  1  
ATOM 194   H HE1  . TYR A 1 14  ? -0.237  -19.490 -4.205  1.00 0.00 ? 14  TYR A HE1  1  
ATOM 195   H HE2  . TYR A 1 14  ? -0.569  -16.656 -7.433  1.00 0.00 ? 14  TYR A HE2  1  
ATOM 196   H HH   . TYR A 1 14  ? -2.120  -18.664 -6.784  1.00 0.00 ? 14  TYR A HH   1  
ATOM 197   N N    . ARG A 1 15  ? 5.245   -14.395 -4.638  1.00 0.00 ? 15  ARG A N    1  
ATOM 198   C CA   . ARG A 1 15  ? 6.615   -13.906 -4.773  1.00 0.00 ? 15  ARG A CA   1  
ATOM 199   C C    . ARG A 1 15  ? 6.866   -12.717 -3.831  1.00 0.00 ? 15  ARG A C    1  
ATOM 200   O O    . ARG A 1 15  ? 5.928   -12.030 -3.424  1.00 0.00 ? 15  ARG A O    1  
ATOM 201   C CB   . ARG A 1 15  ? 6.800   -13.549 -6.267  1.00 0.00 ? 15  ARG A CB   1  
ATOM 202   C CG   . ARG A 1 15  ? 8.108   -14.024 -6.923  1.00 0.00 ? 15  ARG A CG   1  
ATOM 203   C CD   . ARG A 1 15  ? 9.377   -13.382 -6.346  1.00 0.00 ? 15  ARG A CD   1  
ATOM 204   N NE   . ARG A 1 15  ? 10.446  -13.265 -7.350  1.00 0.00 ? 15  ARG A NE   1  
ATOM 205   C CZ   . ARG A 1 15  ? 11.229  -14.220 -7.853  1.00 0.00 ? 15  ARG A CZ   1  
ATOM 206   N NH1  . ARG A 1 15  ? 11.161  -15.472 -7.423  1.00 0.00 ? 15  ARG A NH1  1  
ATOM 207   N NH2  . ARG A 1 15  ? 12.107  -13.908 -8.796  1.00 0.00 ? 15  ARG A NH2  1  
ATOM 208   H H    . ARG A 1 15  ? 4.610   -14.178 -5.396  1.00 0.00 ? 15  ARG A H    1  
ATOM 209   H HA   . ARG A 1 15  ? 7.285   -14.724 -4.502  1.00 0.00 ? 15  ARG A HA   1  
ATOM 210   H HB2  . ARG A 1 15  ? 5.988   -14.008 -6.846  1.00 0.00 ? 15  ARG A HB2  1  
ATOM 211   H HB3  . ARG A 1 15  ? 6.702   -12.473 -6.394  1.00 0.00 ? 15  ARG A HB3  1  
ATOM 212   H HG2  . ARG A 1 15  ? 8.187   -15.107 -6.840  1.00 0.00 ? 15  ARG A HG2  1  
ATOM 213   H HG3  . ARG A 1 15  ? 8.038   -13.776 -7.983  1.00 0.00 ? 15  ARG A HG3  1  
ATOM 214   H HD2  . ARG A 1 15  ? 9.138   -12.370 -6.022  1.00 0.00 ? 15  ARG A HD2  1  
ATOM 215   H HD3  . ARG A 1 15  ? 9.729   -13.955 -5.488  1.00 0.00 ? 15  ARG A HD3  1  
ATOM 216   H HE   . ARG A 1 15  ? 10.583  -12.316 -7.693  1.00 0.00 ? 15  ARG A HE   1  
ATOM 217   H HH11 . ARG A 1 15  ? 10.492  -15.740 -6.698  1.00 0.00 ? 15  ARG A HH11 1  
ATOM 218   H HH12 . ARG A 1 15  ? 11.678  -16.219 -7.879  1.00 0.00 ? 15  ARG A HH12 1  
ATOM 219   H HH21 . ARG A 1 15  ? 12.055  -12.991 -9.237  1.00 0.00 ? 15  ARG A HH21 1  
ATOM 220   H HH22 . ARG A 1 15  ? 12.734  -14.587 -9.201  1.00 0.00 ? 15  ARG A HH22 1  
ATOM 221   N N    . GLU A 1 16  ? 8.133   -12.433 -3.520  1.00 0.00 ? 16  GLU A N    1  
ATOM 222   C CA   . GLU A 1 16  ? 8.562   -11.323 -2.665  1.00 0.00 ? 16  GLU A CA   1  
ATOM 223   C C    . GLU A 1 16  ? 9.017   -10.112 -3.491  1.00 0.00 ? 16  GLU A C    1  
ATOM 224   O O    . GLU A 1 16  ? 9.320   -10.205 -4.683  1.00 0.00 ? 16  GLU A O    1  
ATOM 225   C CB   . GLU A 1 16  ? 9.697   -11.808 -1.737  1.00 0.00 ? 16  GLU A CB   1  
ATOM 226   C CG   . GLU A 1 16  ? 9.162   -12.498 -0.469  1.00 0.00 ? 16  GLU A CG   1  
ATOM 227   C CD   . GLU A 1 16  ? 10.108  -13.501 0.204   1.00 0.00 ? 16  GLU A CD   1  
ATOM 228   O OE1  . GLU A 1 16  ? 10.692  -14.360 -0.487  1.00 0.00 ? 16  GLU A OE1  1  
ATOM 229   O OE2  . GLU A 1 16  ? 10.238  -13.460 1.455   1.00 0.00 ? 16  GLU A OE2  1  
ATOM 230   H H    . GLU A 1 16  ? 8.874   -12.985 -3.918  1.00 0.00 ? 16  GLU A H    1  
ATOM 231   H HA   . GLU A 1 16  ? 7.725   -10.978 -2.057  1.00 0.00 ? 16  GLU A HA   1  
ATOM 232   H HB2  . GLU A 1 16  ? 10.341  -12.478 -2.304  1.00 0.00 ? 16  GLU A HB2  1  
ATOM 233   H HB3  . GLU A 1 16  ? 10.284  -10.944 -1.416  1.00 0.00 ? 16  GLU A HB3  1  
ATOM 234   H HG2  . GLU A 1 16  ? 8.987   -11.701 0.247   1.00 0.00 ? 16  GLU A HG2  1  
ATOM 235   H HG3  . GLU A 1 16  ? 8.219   -13.005 -0.686  1.00 0.00 ? 16  GLU A HG3  1  
ATOM 236   N N    . VAL A 1 17  ? 9.106   -8.964  -2.820  1.00 0.00 ? 17  VAL A N    1  
ATOM 237   C CA   . VAL A 1 17  ? 9.461   -7.652  -3.352  1.00 0.00 ? 17  VAL A CA   1  
ATOM 238   C C    . VAL A 1 17  ? 10.344  -6.956  -2.307  1.00 0.00 ? 17  VAL A C    1  
ATOM 239   O O    . VAL A 1 17  ? 10.328  -7.353  -1.136  1.00 0.00 ? 17  VAL A O    1  
ATOM 240   C CB   . VAL A 1 17  ? 8.150   -6.890  -3.679  1.00 0.00 ? 17  VAL A CB   1  
ATOM 241   C CG1  . VAL A 1 17  ? 7.234   -6.780  -2.448  1.00 0.00 ? 17  VAL A CG1  1  
ATOM 242   C CG2  . VAL A 1 17  ? 8.380   -5.493  -4.273  1.00 0.00 ? 17  VAL A CG2  1  
ATOM 243   H H    . VAL A 1 17  ? 8.889   -8.941  -1.833  1.00 0.00 ? 17  VAL A H    1  
ATOM 244   H HA   . VAL A 1 17  ? 10.030  -7.795  -4.269  1.00 0.00 ? 17  VAL A HA   1  
ATOM 245   H HB   . VAL A 1 17  ? 7.615   -7.469  -4.433  1.00 0.00 ? 17  VAL A HB   1  
ATOM 246   H HG11 . VAL A 1 17  ? 7.743   -6.271  -1.630  1.00 0.00 ? 17  VAL A HG11 1  
ATOM 247   H HG12 . VAL A 1 17  ? 6.331   -6.227  -2.707  1.00 0.00 ? 17  VAL A HG12 1  
ATOM 248   H HG13 . VAL A 1 17  ? 6.930   -7.776  -2.124  1.00 0.00 ? 17  VAL A HG13 1  
ATOM 249   H HG21 . VAL A 1 17  ? 8.796   -4.815  -3.528  1.00 0.00 ? 17  VAL A HG21 1  
ATOM 250   H HG22 . VAL A 1 17  ? 9.057   -5.555  -5.126  1.00 0.00 ? 17  VAL A HG22 1  
ATOM 251   H HG23 . VAL A 1 17  ? 7.431   -5.085  -4.622  1.00 0.00 ? 17  VAL A HG23 1  
ATOM 252   N N    . ASP A 1 18  ? 11.129  -5.951  -2.702  1.00 0.00 ? 18  ASP A N    1  
ATOM 253   C CA   . ASP A 1 18  ? 11.877  -5.119  -1.770  1.00 0.00 ? 18  ASP A CA   1  
ATOM 254   C C    . ASP A 1 18  ? 10.977  -3.964  -1.362  1.00 0.00 ? 18  ASP A C    1  
ATOM 255   O O    . ASP A 1 18  ? 10.846  -2.996  -2.108  1.00 0.00 ? 18  ASP A O    1  
ATOM 256   C CB   . ASP A 1 18  ? 13.193  -4.611  -2.380  1.00 0.00 ? 18  ASP A CB   1  
ATOM 257   C CG   . ASP A 1 18  ? 14.362  -5.503  -1.995  1.00 0.00 ? 18  ASP A CG   1  
ATOM 258   O OD1  . ASP A 1 18  ? 14.610  -5.628  -0.770  1.00 0.00 ? 18  ASP A OD1  1  
ATOM 259   O OD2  . ASP A 1 18  ? 15.031  -6.072  -2.878  1.00 0.00 ? 18  ASP A OD2  1  
ATOM 260   H H    . ASP A 1 18  ? 11.104  -5.634  -3.665  1.00 0.00 ? 18  ASP A H    1  
ATOM 261   H HA   . ASP A 1 18  ? 12.112  -5.699  -0.883  1.00 0.00 ? 18  ASP A HA   1  
ATOM 262   H HB2  . ASP A 1 18  ? 13.115  -4.526  -3.462  1.00 0.00 ? 18  ASP A HB2  1  
ATOM 263   H HB3  . ASP A 1 18  ? 13.415  -3.623  -1.983  1.00 0.00 ? 18  ASP A HB3  1  
ATOM 264   N N    . THR A 1 19  ? 10.323  -4.029  -0.198  1.00 0.00 ? 19  THR A N    1  
ATOM 265   C CA   . THR A 1 19  ? 9.373   -2.988  0.201   1.00 0.00 ? 19  THR A CA   1  
ATOM 266   C C    . THR A 1 19  ? 10.048  -1.611  0.351   1.00 0.00 ? 19  THR A C    1  
ATOM 267   O O    . THR A 1 19  ? 9.395   -0.573  0.205   1.00 0.00 ? 19  THR A O    1  
ATOM 268   C CB   . THR A 1 19  ? 8.613   -3.393  1.477   1.00 0.00 ? 19  THR A CB   1  
ATOM 269   O OG1  . THR A 1 19  ? 9.486   -3.844  2.491   1.00 0.00 ? 19  THR A OG1  1  
ATOM 270   C CG2  . THR A 1 19  ? 7.617   -4.520  1.200   1.00 0.00 ? 19  THR A CG2  1  
ATOM 271   H H    . THR A 1 19  ? 10.460  -4.794  0.448   1.00 0.00 ? 19  THR A H    1  
ATOM 272   H HA   . THR A 1 19  ? 8.637   -2.894  -0.597  1.00 0.00 ? 19  THR A HA   1  
ATOM 273   H HB   . THR A 1 19  ? 8.060   -2.529  1.847   1.00 0.00 ? 19  THR A HB   1  
ATOM 274   H HG1  . THR A 1 19  ? 8.991   -3.827  3.327   1.00 0.00 ? 19  THR A HG1  1  
ATOM 275   H HG21 . THR A 1 19  ? 8.137   -5.409  0.846   1.00 0.00 ? 19  THR A HG21 1  
ATOM 276   H HG22 . THR A 1 19  ? 7.074   -4.762  2.112   1.00 0.00 ? 19  THR A HG22 1  
ATOM 277   H HG23 . THR A 1 19  ? 6.901   -4.203  0.440   1.00 0.00 ? 19  THR A HG23 1  
ATOM 278   N N    . LEU A 1 20  ? 11.361  -1.568  0.597   1.00 0.00 ? 20  LEU A N    1  
ATOM 279   C CA   . LEU A 1 20  ? 12.093  -0.322  0.720   1.00 0.00 ? 20  LEU A CA   1  
ATOM 280   C C    . LEU A 1 20  ? 12.324  0.313   -0.653  1.00 0.00 ? 20  LEU A C    1  
ATOM 281   O O    . LEU A 1 20  ? 12.179  1.531   -0.752  1.00 0.00 ? 20  LEU A O    1  
ATOM 282   C CB   . LEU A 1 20  ? 13.405  -0.556  1.492   1.00 0.00 ? 20  LEU A CB   1  
ATOM 283   C CG   . LEU A 1 20  ? 13.319  -0.270  3.008   1.00 0.00 ? 20  LEU A CG   1  
ATOM 284   C CD1  . LEU A 1 20  ? 12.974  1.192   3.319   1.00 0.00 ? 20  LEU A CD1  1  
ATOM 285   C CD2  . LEU A 1 20  ? 12.374  -1.223  3.751   1.00 0.00 ? 20  LEU A CD2  1  
ATOM 286   H H    . LEU A 1 20  ? 11.886  -2.423  0.705   1.00 0.00 ? 20  LEU A H    1  
ATOM 287   H HA   . LEU A 1 20  ? 11.474  0.378   1.277   1.00 0.00 ? 20  LEU A HA   1  
ATOM 288   H HB2  . LEU A 1 20  ? 13.751  -1.579  1.333   1.00 0.00 ? 20  LEU A HB2  1  
ATOM 289   H HB3  . LEU A 1 20  ? 14.164  0.090   1.064   1.00 0.00 ? 20  LEU A HB3  1  
ATOM 290   H HG   . LEU A 1 20  ? 14.310  -0.427  3.420   1.00 0.00 ? 20  LEU A HG   1  
ATOM 291   H HD11 . LEU A 1 20  ? 11.965  1.447   3.012   1.00 0.00 ? 20  LEU A HD11 1  
ATOM 292   H HD12 . LEU A 1 20  ? 13.078  1.374   4.387   1.00 0.00 ? 20  LEU A HD12 1  
ATOM 293   H HD13 . LEU A 1 20  ? 13.653  1.841   2.776   1.00 0.00 ? 20  LEU A HD13 1  
ATOM 294   H HD21 . LEU A 1 20  ? 12.741  -2.243  3.656   1.00 0.00 ? 20  LEU A HD21 1  
ATOM 295   H HD22 . LEU A 1 20  ? 12.338  -0.969  4.810   1.00 0.00 ? 20  LEU A HD22 1  
ATOM 296   H HD23 . LEU A 1 20  ? 11.374  -1.197  3.332   1.00 0.00 ? 20  LEU A HD23 1  
ATOM 297   N N    . GLU A 1 21  ? 12.653  -0.463  -1.693  1.00 0.00 ? 21  GLU A N    1  
ATOM 298   C CA   . GLU A 1 21  ? 12.813  0.066   -3.051  1.00 0.00 ? 21  GLU A CA   1  
ATOM 299   C C    . GLU A 1 21  ? 11.443  0.355   -3.666  1.00 0.00 ? 21  GLU A C    1  
ATOM 300   O O    . GLU A 1 21  ? 11.283  1.331   -4.387  1.00 0.00 ? 21  GLU A O    1  
ATOM 301   C CB   . GLU A 1 21  ? 13.608  -0.891  -3.954  1.00 0.00 ? 21  GLU A CB   1  
ATOM 302   C CG   . GLU A 1 21  ? 14.801  -0.203  -4.636  1.00 0.00 ? 21  GLU A CG   1  
ATOM 303   C CD   . GLU A 1 21  ? 14.454  0.925   -5.622  1.00 0.00 ? 21  GLU A CD   1  
ATOM 304   O OE1  . GLU A 1 21  ? 14.456  2.110   -5.213  1.00 0.00 ? 21  GLU A OE1  1  
ATOM 305   O OE2  . GLU A 1 21  ? 14.428  0.668   -6.847  1.00 0.00 ? 21  GLU A OE2  1  
ATOM 306   H H    . GLU A 1 21  ? 12.716  -1.465  -1.592  1.00 0.00 ? 21  GLU A H    1  
ATOM 307   H HA   . GLU A 1 21  ? 13.370  0.998   -2.981  1.00 0.00 ? 21  GLU A HA   1  
ATOM 308   H HB2  . GLU A 1 21  ? 13.995  -1.716  -3.353  1.00 0.00 ? 21  GLU A HB2  1  
ATOM 309   H HB3  . GLU A 1 21  ? 12.951  -1.311  -4.716  1.00 0.00 ? 21  GLU A HB3  1  
ATOM 310   H HG2  . GLU A 1 21  ? 15.463  0.193   -3.862  1.00 0.00 ? 21  GLU A HG2  1  
ATOM 311   H HG3  . GLU A 1 21  ? 15.352  -0.973  -5.173  1.00 0.00 ? 21  GLU A HG3  1  
ATOM 312   N N    . LEU A 1 22  ? 10.428  -0.452  -3.344  1.00 0.00 ? 22  LEU A N    1  
ATOM 313   C CA   . LEU A 1 22  ? 9.053   -0.239  -3.783  1.00 0.00 ? 22  LEU A CA   1  
ATOM 314   C C    . LEU A 1 22  ? 8.581   1.150   -3.364  1.00 0.00 ? 22  LEU A C    1  
ATOM 315   O O    . LEU A 1 22  ? 8.147   1.944   -4.193  1.00 0.00 ? 22  LEU A O    1  
ATOM 316   C CB   . LEU A 1 22  ? 8.155   -1.322  -3.169  1.00 0.00 ? 22  LEU A CB   1  
ATOM 317   C CG   . LEU A 1 22  ? 6.650   -1.029  -3.308  1.00 0.00 ? 22  LEU A CG   1  
ATOM 318   C CD1  . LEU A 1 22  ? 6.214   -1.047  -4.767  1.00 0.00 ? 22  LEU A CD1  1  
ATOM 319   C CD2  . LEU A 1 22  ? 5.867   -2.042  -2.485  1.00 0.00 ? 22  LEU A CD2  1  
ATOM 320   H H    . LEU A 1 22  ? 10.639  -1.294  -2.816  1.00 0.00 ? 22  LEU A H    1  
ATOM 321   H HA   . LEU A 1 22  ? 9.014   -0.306  -4.873  1.00 0.00 ? 22  LEU A HA   1  
ATOM 322   H HB2  . LEU A 1 22  ? 8.393   -2.284  -3.626  1.00 0.00 ? 22  LEU A HB2  1  
ATOM 323   H HB3  . LEU A 1 22  ? 8.388   -1.379  -2.110  1.00 0.00 ? 22  LEU A HB3  1  
ATOM 324   H HG   . LEU A 1 22  ? 6.415   -0.053  -2.888  1.00 0.00 ? 22  LEU A HG   1  
ATOM 325   H HD11 . LEU A 1 22  ? 6.710   -0.244  -5.306  1.00 0.00 ? 22  LEU A HD11 1  
ATOM 326   H HD12 . LEU A 1 22  ? 6.473   -1.998  -5.231  1.00 0.00 ? 22  LEU A HD12 1  
ATOM 327   H HD13 . LEU A 1 22  ? 5.142   -0.886  -4.825  1.00 0.00 ? 22  LEU A HD13 1  
ATOM 328   H HD21 . LEU A 1 22  ? 4.816   -1.748  -2.471  1.00 0.00 ? 22  LEU A HD21 1  
ATOM 329   H HD22 . LEU A 1 22  ? 5.977   -3.041  -2.902  1.00 0.00 ? 22  LEU A HD22 1  
ATOM 330   H HD23 . LEU A 1 22  ? 6.259   -2.053  -1.476  1.00 0.00 ? 22  LEU A HD23 1  
ATOM 331   N N    . THR A 1 23  ? 8.633   1.439   -2.063  1.00 0.00 ? 23  THR A N    1  
ATOM 332   C CA   . THR A 1 23  ? 8.199   2.728   -1.537  1.00 0.00 ? 23  THR A CA   1  
ATOM 333   C C    . THR A 1 23  ? 9.009   3.846   -2.185  1.00 0.00 ? 23  THR A C    1  
ATOM 334   O O    . THR A 1 23  ? 8.465   4.899   -2.493  1.00 0.00 ? 23  THR A O    1  
ATOM 335   C CB   . THR A 1 23  ? 8.309   2.736   -0.006  1.00 0.00 ? 23  THR A CB   1  
ATOM 336   O OG1  . THR A 1 23  ? 9.553   2.252   0.451   1.00 0.00 ? 23  THR A OG1  1  
ATOM 337   C CG2  . THR A 1 23  ? 7.226   1.837   0.565   1.00 0.00 ? 23  THR A CG2  1  
ATOM 338   H H    . THR A 1 23  ? 9.017   0.752   -1.428  1.00 0.00 ? 23  THR A H    1  
ATOM 339   H HA   . THR A 1 23  ? 7.150   2.891   -1.803  1.00 0.00 ? 23  THR A HA   1  
ATOM 340   H HB   . THR A 1 23  ? 8.153   3.748   0.365   1.00 0.00 ? 23  THR A HB   1  
ATOM 341   H HG1  . THR A 1 23  ? 9.539   1.281   0.415   1.00 0.00 ? 23  THR A HG1  1  
ATOM 342   H HG21 . THR A 1 23  ? 7.377   0.831   0.188   1.00 0.00 ? 23  THR A HG21 1  
ATOM 343   H HG22 . THR A 1 23  ? 7.251   1.853   1.651   1.00 0.00 ? 23  THR A HG22 1  
ATOM 344   H HG23 . THR A 1 23  ? 6.265   2.199   0.226   1.00 0.00 ? 23  THR A HG23 1  
ATOM 345   N N    . ARG A 1 24  ? 10.302  3.617   -2.402  1.00 0.00 ? 24  ARG A N    1  
ATOM 346   C CA   . ARG A 1 24  ? 11.184  4.514   -3.164  1.00 0.00 ? 24  ARG A CA   1  
ATOM 347   C C    . ARG A 1 24  ? 10.641  4.825   -4.557  1.00 0.00 ? 24  ARG A C    1  
ATOM 348   O O    . ARG A 1 24  ? 10.359  5.995   -4.827  1.00 0.00 ? 24  ARG A O    1  
ATOM 349   C CB   . ARG A 1 24  ? 12.613  3.970   -3.227  1.00 0.00 ? 24  ARG A CB   1  
ATOM 350   C CG   . ARG A 1 24  ? 13.463  4.731   -2.210  1.00 0.00 ? 24  ARG A CG   1  
ATOM 351   C CD   . ARG A 1 24  ? 14.552  3.884   -1.593  1.00 0.00 ? 24  ARG A CD   1  
ATOM 352   N NE   . ARG A 1 24  ? 15.612  3.528   -2.537  1.00 0.00 ? 24  ARG A NE   1  
ATOM 353   C CZ   . ARG A 1 24  ? 16.826  3.096   -2.192  1.00 0.00 ? 24  ARG A CZ   1  
ATOM 354   N NH1  . ARG A 1 24  ? 17.107  2.897   -0.902  1.00 0.00 ? 24  ARG A NH1  1  
ATOM 355   N NH2  . ARG A 1 24  ? 17.736  2.873   -3.132  1.00 0.00 ? 24  ARG A NH2  1  
ATOM 356   H H    . ARG A 1 24  ? 10.594  2.707   -2.050  1.00 0.00 ? 24  ARG A H    1  
ATOM 357   H HA   . ARG A 1 24  ? 11.251  5.463   -2.642  1.00 0.00 ? 24  ARG A HA   1  
ATOM 358   H HB2  . ARG A 1 24  ? 12.612  2.912   -3.004  1.00 0.00 ? 24  ARG A HB2  1  
ATOM 359   H HB3  . ARG A 1 24  ? 13.035  4.104   -4.223  1.00 0.00 ? 24  ARG A HB3  1  
ATOM 360   H HG2  . ARG A 1 24  ? 13.903  5.611   -2.677  1.00 0.00 ? 24  ARG A HG2  1  
ATOM 361   H HG3  . ARG A 1 24  ? 12.842  5.066   -1.381  1.00 0.00 ? 24  ARG A HG3  1  
ATOM 362   H HD2  . ARG A 1 24  ? 14.950  4.510   -0.807  1.00 0.00 ? 24  ARG A HD2  1  
ATOM 363   H HD3  . ARG A 1 24  ? 14.132  2.978   -1.162  1.00 0.00 ? 24  ARG A HD3  1  
ATOM 364   H HE   . ARG A 1 24  ? 15.431  3.747   -3.523  1.00 0.00 ? 24  ARG A HE   1  
ATOM 365   H HH11 . ARG A 1 24  ? 16.393  3.049   -0.198  1.00 0.00 ? 24  ARG A HH11 1  
ATOM 366   H HH12 . ARG A 1 24  ? 18.025  2.629   -0.547  1.00 0.00 ? 24  ARG A HH12 1  
ATOM 367   H HH21 . ARG A 1 24  ? 17.482  3.003   -4.116  1.00 0.00 ? 24  ARG A HH21 1  
ATOM 368   H HH22 . ARG A 1 24  ? 18.707  2.653   -2.952  1.00 0.00 ? 24  ARG A HH22 1  
ATOM 369   N N    . GLN A 1 25  ? 10.476  3.811   -5.408  1.00 0.00 ? 25  GLN A N    1  
ATOM 370   C CA   . GLN A 1 25  ? 9.938   3.917   -6.762  1.00 0.00 ? 25  GLN A CA   1  
ATOM 371   C C    . GLN A 1 25  ? 8.635   4.722   -6.739  1.00 0.00 ? 25  GLN A C    1  
ATOM 372   O O    . GLN A 1 25  ? 8.478   5.667   -7.512  1.00 0.00 ? 25  GLN A O    1  
ATOM 373   C CB   . GLN A 1 25  ? 9.694   2.502   -7.314  1.00 0.00 ? 25  GLN A CB   1  
ATOM 374   C CG   . GLN A 1 25  ? 10.968  1.713   -7.615  1.00 0.00 ? 25  GLN A CG   1  
ATOM 375   C CD   . GLN A 1 25  ? 11.450  1.906   -9.048  1.00 0.00 ? 25  GLN A CD   1  
ATOM 376   O OE1  . GLN A 1 25  ? 10.849  1.431   -10.007 1.00 0.00 ? 25  GLN A OE1  1  
ATOM 377   N NE2  . GLN A 1 25  ? 12.537  2.631   -9.219  1.00 0.00 ? 25  GLN A NE2  1  
ATOM 378   H H    . GLN A 1 25  ? 10.744  2.881   -5.095  1.00 0.00 ? 25  GLN A H    1  
ATOM 379   H HA   . GLN A 1 25  ? 10.665  4.423   -7.402  1.00 0.00 ? 25  GLN A HA   1  
ATOM 380   H HB2  . GLN A 1 25  ? 9.110   1.936   -6.588  1.00 0.00 ? 25  GLN A HB2  1  
ATOM 381   H HB3  . GLN A 1 25  ? 9.118   2.570   -8.231  1.00 0.00 ? 25  GLN A HB3  1  
ATOM 382   H HG2  . GLN A 1 25  ? 11.738  2.018   -6.922  1.00 0.00 ? 25  GLN A HG2  1  
ATOM 383   H HG3  . GLN A 1 25  ? 10.782  0.660   -7.434  1.00 0.00 ? 25  GLN A HG3  1  
ATOM 384   H HE21 . GLN A 1 25  ? 12.967  3.030   -8.387  1.00 0.00 ? 25  GLN A HE21 1  
ATOM 385   H HE22 . GLN A 1 25  ? 12.876  2.825   -10.149 1.00 0.00 ? 25  GLN A HE22 1  
ATOM 386   N N    . VAL A 1 26  ? 7.731   4.374   -5.819  1.00 0.00 ? 26  VAL A N    1  
ATOM 387   C CA   . VAL A 1 26  ? 6.457   5.037   -5.628  1.00 0.00 ? 26  VAL A CA   1  
ATOM 388   C C    . VAL A 1 26  ? 6.705   6.524   -5.319  1.00 0.00 ? 26  VAL A C    1  
ATOM 389   O O    . VAL A 1 26  ? 6.184   7.383   -6.026  1.00 0.00 ? 26  VAL A O    1  
ATOM 390   C CB   . VAL A 1 26  ? 5.664   4.281   -4.542  1.00 0.00 ? 26  VAL A CB   1  
ATOM 391   C CG1  . VAL A 1 26  ? 4.409   5.026   -4.079  1.00 0.00 ? 26  VAL A CG1  1  
ATOM 392   C CG2  . VAL A 1 26  ? 5.265   2.883   -5.044  1.00 0.00 ? 26  VAL A CG2  1  
ATOM 393   H H    . VAL A 1 26  ? 7.942   3.564   -5.242  1.00 0.00 ? 26  VAL A H    1  
ATOM 394   H HA   . VAL A 1 26  ? 5.915   4.952   -6.570  1.00 0.00 ? 26  VAL A HA   1  
ATOM 395   H HB   . VAL A 1 26  ? 6.307   4.152   -3.675  1.00 0.00 ? 26  VAL A HB   1  
ATOM 396   H HG11 . VAL A 1 26  ? 4.688   5.968   -3.619  1.00 0.00 ? 26  VAL A HG11 1  
ATOM 397   H HG12 . VAL A 1 26  ? 3.747   5.217   -4.923  1.00 0.00 ? 26  VAL A HG12 1  
ATOM 398   H HG13 . VAL A 1 26  ? 3.886   4.447   -3.329  1.00 0.00 ? 26  VAL A HG13 1  
ATOM 399   H HG21 . VAL A 1 26  ? 5.092   2.227   -4.198  1.00 0.00 ? 26  VAL A HG21 1  
ATOM 400   H HG22 . VAL A 1 26  ? 4.383   2.932   -5.685  1.00 0.00 ? 26  VAL A HG22 1  
ATOM 401   H HG23 . VAL A 1 26  ? 6.072   2.432   -5.611  1.00 0.00 ? 26  VAL A HG23 1  
ATOM 402   N N    . LYS A 1 27  ? 7.442   6.850   -4.248  1.00 0.00 ? 27  LYS A N    1  
ATOM 403   C CA   . LYS A 1 27  ? 7.742   8.221   -3.837  1.00 0.00 ? 27  LYS A CA   1  
ATOM 404   C C    . LYS A 1 27  ? 8.304   9.042   -4.999  1.00 0.00 ? 27  LYS A C    1  
ATOM 405   O O    . LYS A 1 27  ? 7.875   10.180  -5.177  1.00 0.00 ? 27  LYS A O    1  
ATOM 406   C CB   . LYS A 1 27  ? 8.716   8.201   -2.645  1.00 0.00 ? 27  LYS A CB   1  
ATOM 407   C CG   . LYS A 1 27  ? 8.043   7.802   -1.317  1.00 0.00 ? 27  LYS A CG   1  
ATOM 408   C CD   . LYS A 1 27  ? 9.065   7.584   -0.186  1.00 0.00 ? 27  LYS A CD   1  
ATOM 409   C CE   . LYS A 1 27  ? 9.785   6.232   -0.209  1.00 0.00 ? 27  LYS A CE   1  
ATOM 410   N NZ   . LYS A 1 27  ? 10.740  6.043   0.912   1.00 0.00 ? 27  LYS A NZ   1  
ATOM 411   H H    . LYS A 1 27  ? 7.883   6.122   -3.693  1.00 0.00 ? 27  LYS A H    1  
ATOM 412   H HA   . LYS A 1 27  ? 6.814   8.698   -3.530  1.00 0.00 ? 27  LYS A HA   1  
ATOM 413   H HB2  . LYS A 1 27  ? 9.537   7.517   -2.860  1.00 0.00 ? 27  LYS A HB2  1  
ATOM 414   H HB3  . LYS A 1 27  ? 9.142   9.198   -2.521  1.00 0.00 ? 27  LYS A HB3  1  
ATOM 415   H HG2  . LYS A 1 27  ? 7.381   8.617   -1.021  1.00 0.00 ? 27  LYS A HG2  1  
ATOM 416   H HG3  . LYS A 1 27  ? 7.429   6.909   -1.434  1.00 0.00 ? 27  LYS A HG3  1  
ATOM 417   H HD2  . LYS A 1 27  ? 9.810   8.359   -0.271  1.00 0.00 ? 27  LYS A HD2  1  
ATOM 418   H HD3  . LYS A 1 27  ? 8.552   7.689   0.766   1.00 0.00 ? 27  LYS A HD3  1  
ATOM 419   H HE2  . LYS A 1 27  ? 9.032   5.446   -0.165  1.00 0.00 ? 27  LYS A HE2  1  
ATOM 420   H HE3  . LYS A 1 27  ? 10.322  6.145   -1.153  1.00 0.00 ? 27  LYS A HE3  1  
ATOM 421   H HZ1  . LYS A 1 27  ? 10.261  6.117   1.807   1.00 0.00 ? 27  LYS A HZ1  1  
ATOM 422   H HZ2  . LYS A 1 27  ? 11.167  5.116   0.875   1.00 0.00 ? 27  LYS A HZ2  1  
ATOM 423   H HZ3  . LYS A 1 27  ? 11.513  6.701   0.855   1.00 0.00 ? 27  LYS A HZ3  1  
ATOM 424   N N    . GLU A 1 28  ? 9.214   8.479   -5.792  1.00 0.00 ? 28  GLU A N    1  
ATOM 425   C CA   . GLU A 1 28  ? 9.780   9.146   -6.958  1.00 0.00 ? 28  GLU A CA   1  
ATOM 426   C C    . GLU A 1 28  ? 8.711   9.396   -8.018  1.00 0.00 ? 28  GLU A C    1  
ATOM 427   O O    . GLU A 1 28  ? 8.554   10.538  -8.442  1.00 0.00 ? 28  GLU A O    1  
ATOM 428   C CB   . GLU A 1 28  ? 10.952  8.328   -7.520  1.00 0.00 ? 28  GLU A CB   1  
ATOM 429   C CG   . GLU A 1 28  ? 12.256  8.721   -6.819  1.00 0.00 ? 28  GLU A CG   1  
ATOM 430   C CD   . GLU A 1 28  ? 13.325  7.636   -6.981  1.00 0.00 ? 28  GLU A CD   1  
ATOM 431   O OE1  . GLU A 1 28  ? 13.326  6.667   -6.189  1.00 0.00 ? 28  GLU A OE1  1  
ATOM 432   O OE2  . GLU A 1 28  ? 14.110  7.731   -7.960  1.00 0.00 ? 28  GLU A OE2  1  
ATOM 433   H H    . GLU A 1 28  ? 9.501   7.525   -5.602  1.00 0.00 ? 28  GLU A H    1  
ATOM 434   H HA   . GLU A 1 28  ? 10.155  10.124  -6.648  1.00 0.00 ? 28  GLU A HA   1  
ATOM 435   H HB2  . GLU A 1 28  ? 10.753  7.264   -7.392  1.00 0.00 ? 28  GLU A HB2  1  
ATOM 436   H HB3  . GLU A 1 28  ? 11.064  8.529   -8.587  1.00 0.00 ? 28  GLU A HB3  1  
ATOM 437   H HG2  . GLU A 1 28  ? 12.608  9.662   -7.244  1.00 0.00 ? 28  GLU A HG2  1  
ATOM 438   H HG3  . GLU A 1 28  ? 12.063  8.897   -5.764  1.00 0.00 ? 28  GLU A HG3  1  
ATOM 439   N N    . LYS A 1 29  ? 7.973   8.370   -8.455  1.00 0.00 ? 29  LYS A N    1  
ATOM 440   C CA   . LYS A 1 29  ? 6.952   8.517   -9.496  1.00 0.00 ? 29  LYS A CA   1  
ATOM 441   C C    . LYS A 1 29  ? 5.888   9.543   -9.102  1.00 0.00 ? 29  LYS A C    1  
ATOM 442   O O    . LYS A 1 29  ? 5.390   10.280  -9.955  1.00 0.00 ? 29  LYS A O    1  
ATOM 443   C CB   . LYS A 1 29  ? 6.359   7.161   -9.828  1.00 0.00 ? 29  LYS A CB   1  
ATOM 444   C CG   . LYS A 1 29  ? 5.556   7.233   -11.142 1.00 0.00 ? 29  LYS A CG   1  
ATOM 445   C CD   . LYS A 1 29  ? 5.497   5.830   -11.721 1.00 0.00 ? 29  LYS A CD   1  
ATOM 446   C CE   . LYS A 1 29  ? 4.449   5.614   -12.821 1.00 0.00 ? 29  LYS A CE   1  
ATOM 447   N NZ   . LYS A 1 29  ? 4.693   6.447   -14.018 1.00 0.00 ? 29  LYS A NZ   1  
ATOM 448   H H    . LYS A 1 29  ? 8.144   7.443   -8.076  1.00 0.00 ? 29  LYS A H    1  
ATOM 449   H HA   . LYS A 1 29  ? 7.427   8.807   -10.427 1.00 0.00 ? 29  LYS A HA   1  
ATOM 450   H HB2  . LYS A 1 29  ? 7.181   6.452   -9.951  1.00 0.00 ? 29  LYS A HB2  1  
ATOM 451   H HB3  . LYS A 1 29  ? 5.731   6.822   -9.009  1.00 0.00 ? 29  LYS A HB3  1  
ATOM 452   H HG2  . LYS A 1 29  ? 4.550   7.607   -10.947 1.00 0.00 ? 29  LYS A HG2  1  
ATOM 453   H HG3  . LYS A 1 29  ? 6.053   7.874   -11.869 1.00 0.00 ? 29  LYS A HG3  1  
ATOM 454   H HD2  . LYS A 1 29  ? 6.477   5.560   -12.108 1.00 0.00 ? 29  LYS A HD2  1  
ATOM 455   H HD3  . LYS A 1 29  ? 5.291   5.188   -10.878 1.00 0.00 ? 29  LYS A HD3  1  
ATOM 456   H HE2  . LYS A 1 29  ? 4.481   4.565   -13.116 1.00 0.00 ? 29  LYS A HE2  1  
ATOM 457   H HE3  . LYS A 1 29  ? 3.454   5.829   -12.426 1.00 0.00 ? 29  LYS A HE3  1  
ATOM 458   H HZ1  . LYS A 1 29  ? 4.403   7.407   -13.859 1.00 0.00 ? 29  LYS A HZ1  1  
ATOM 459   H HZ2  . LYS A 1 29  ? 5.676   6.453   -14.287 1.00 0.00 ? 29  LYS A HZ2  1  
ATOM 460   H HZ3  . LYS A 1 29  ? 4.160   6.101   -14.810 1.00 0.00 ? 29  LYS A HZ3  1  
ATOM 461   N N    . LEU A 1 30  ? 5.533   9.594   -7.815  1.00 0.00 ? 30  LEU A N    1  
ATOM 462   C CA   . LEU A 1 30  ? 4.619   10.583  -7.260  1.00 0.00 ? 30  LEU A CA   1  
ATOM 463   C C    . LEU A 1 30  ? 5.253   11.973  -7.334  1.00 0.00 ? 30  LEU A C    1  
ATOM 464   O O    . LEU A 1 30  ? 4.622   12.901  -7.843  1.00 0.00 ? 30  LEU A O    1  
ATOM 465   C CB   . LEU A 1 30  ? 4.247   10.222  -5.808  1.00 0.00 ? 30  LEU A CB   1  
ATOM 466   C CG   . LEU A 1 30  ? 3.397   8.941   -5.680  1.00 0.00 ? 30  LEU A CG   1  
ATOM 467   C CD1  . LEU A 1 30  ? 3.371   8.459   -4.228  1.00 0.00 ? 30  LEU A CD1  1  
ATOM 468   C CD2  . LEU A 1 30  ? 1.949   9.152   -6.125  1.00 0.00 ? 30  LEU A CD2  1  
ATOM 469   H H    . LEU A 1 30  ? 5.971   8.922   -7.192  1.00 0.00 ? 30  LEU A H    1  
ATOM 470   H HA   . LEU A 1 30  ? 3.719   10.598  -7.872  1.00 0.00 ? 30  LEU A HA   1  
ATOM 471   H HB2  . LEU A 1 30  ? 5.170   10.096  -5.242  1.00 0.00 ? 30  LEU A HB2  1  
ATOM 472   H HB3  . LEU A 1 30  ? 3.699   11.054  -5.365  1.00 0.00 ? 30  LEU A HB3  1  
ATOM 473   H HG   . LEU A 1 30  ? 3.826   8.154   -6.293  1.00 0.00 ? 30  LEU A HG   1  
ATOM 474   H HD11 . LEU A 1 30  ? 2.848   7.505   -4.180  1.00 0.00 ? 30  LEU A HD11 1  
ATOM 475   H HD12 . LEU A 1 30  ? 4.391   8.321   -3.871  1.00 0.00 ? 30  LEU A HD12 1  
ATOM 476   H HD13 . LEU A 1 30  ? 2.853   9.178   -3.600  1.00 0.00 ? 30  LEU A HD13 1  
ATOM 477   H HD21 . LEU A 1 30  ? 1.429   8.195   -6.096  1.00 0.00 ? 30  LEU A HD21 1  
ATOM 478   H HD22 . LEU A 1 30  ? 1.461   9.851   -5.451  1.00 0.00 ? 30  LEU A HD22 1  
ATOM 479   H HD23 . LEU A 1 30  ? 1.919   9.530   -7.145  1.00 0.00 ? 30  LEU A HD23 1  
ATOM 480   N N    . ALA A 1 31  ? 6.484   12.132  -6.835  1.00 0.00 ? 31  ALA A N    1  
ATOM 481   C CA   . ALA A 1 31  ? 7.188   13.412  -6.802  1.00 0.00 ? 31  ALA A CA   1  
ATOM 482   C C    . ALA A 1 31  ? 7.397   13.981  -8.208  1.00 0.00 ? 31  ALA A C    1  
ATOM 483   O O    . ALA A 1 31  ? 7.173   15.170  -8.418  1.00 0.00 ? 31  ALA A O    1  
ATOM 484   C CB   . ALA A 1 31  ? 8.527   13.257  -6.075  1.00 0.00 ? 31  ALA A CB   1  
ATOM 485   H H    . ALA A 1 31  ? 6.961   11.331  -6.434  1.00 0.00 ? 31  ALA A H    1  
ATOM 486   H HA   . ALA A 1 31  ? 6.577   14.120  -6.239  1.00 0.00 ? 31  ALA A HA   1  
ATOM 487   H HB1  . ALA A 1 31  ? 9.163   12.544  -6.600  1.00 0.00 ? 31  ALA A HB1  1  
ATOM 488   H HB2  . ALA A 1 31  ? 9.030   14.223  -6.038  1.00 0.00 ? 31  ALA A HB2  1  
ATOM 489   H HB3  . ALA A 1 31  ? 8.360   12.909  -5.057  1.00 0.00 ? 31  ALA A HB3  1  
ATOM 490   N N    . LYS A 1 32  ? 7.743   13.140  -9.189  1.00 0.00 ? 32  LYS A N    1  
ATOM 491   C CA   . LYS A 1 32  ? 7.916   13.465  -10.605 1.00 0.00 ? 32  LYS A CA   1  
ATOM 492   C C    . LYS A 1 32  ? 6.659   13.987  -11.287 1.00 0.00 ? 32  LYS A C    1  
ATOM 493   O O    . LYS A 1 32  ? 6.689   14.392  -12.449 1.00 0.00 ? 32  LYS A O    1  
ATOM 494   C CB   . LYS A 1 32  ? 8.369   12.176  -11.302 1.00 0.00 ? 32  LYS A CB   1  
ATOM 495   C CG   . LYS A 1 32  ? 9.872   11.933  -11.126 1.00 0.00 ? 32  LYS A CG   1  
ATOM 496   C CD   . LYS A 1 32  ? 10.722  12.830  -12.042 1.00 0.00 ? 32  LYS A CD   1  
ATOM 497   C CE   . LYS A 1 32  ? 12.227  12.584  -11.865 1.00 0.00 ? 32  LYS A CE   1  
ATOM 498   N NZ   . LYS A 1 32  ? 13.041  13.513  -12.684 1.00 0.00 ? 32  LYS A NZ   1  
ATOM 499   H H    . LYS A 1 32  ? 7.918   12.166  -8.963  1.00 0.00 ? 32  LYS A H    1  
ATOM 500   H HA   . LYS A 1 32  ? 8.671   14.241  -10.702 1.00 0.00 ? 32  LYS A HA   1  
ATOM 501   H HB2  . LYS A 1 32  ? 7.827   11.328  -10.885 1.00 0.00 ? 32  LYS A HB2  1  
ATOM 502   H HB3  . LYS A 1 32  ? 8.100   12.216  -12.348 1.00 0.00 ? 32  LYS A HB3  1  
ATOM 503   H HG2  . LYS A 1 32  ? 10.100  12.136  -10.079 1.00 0.00 ? 32  LYS A HG2  1  
ATOM 504   H HG3  . LYS A 1 32  ? 10.092  10.887  -11.348 1.00 0.00 ? 32  LYS A HG3  1  
ATOM 505   H HD2  . LYS A 1 32  ? 10.450  12.633  -13.081 1.00 0.00 ? 32  LYS A HD2  1  
ATOM 506   H HD3  . LYS A 1 32  ? 10.508  13.872  -11.816 1.00 0.00 ? 32  LYS A HD3  1  
ATOM 507   H HE2  . LYS A 1 32  ? 12.488  12.712  -10.812 1.00 0.00 ? 32  LYS A HE2  1  
ATOM 508   H HE3  . LYS A 1 32  ? 12.453  11.558  -12.160 1.00 0.00 ? 32  LYS A HE3  1  
ATOM 509   H HZ1  . LYS A 1 32  ? 12.778  13.459  -13.664 1.00 0.00 ? 32  LYS A HZ1  1  
ATOM 510   H HZ2  . LYS A 1 32  ? 12.918  14.472  -12.385 1.00 0.00 ? 32  LYS A HZ2  1  
ATOM 511   H HZ3  . LYS A 1 32  ? 14.035  13.294  -12.619 1.00 0.00 ? 32  LYS A HZ3  1  
ATOM 512   N N    . ASN A 1 33  ? 5.538   13.910  -10.594 1.00 0.00 ? 33  ASN A N    1  
ATOM 513   C CA   . ASN A 1 33  ? 4.214   14.308  -11.056 1.00 0.00 ? 33  ASN A CA   1  
ATOM 514   C C    . ASN A 1 33  ? 3.558   15.302  -10.095 1.00 0.00 ? 33  ASN A C    1  
ATOM 515   O O    . ASN A 1 33  ? 2.424   15.707  -10.338 1.00 0.00 ? 33  ASN A O    1  
ATOM 516   C CB   . ASN A 1 33  ? 3.362   13.038  -11.244 1.00 0.00 ? 33  ASN A CB   1  
ATOM 517   C CG   . ASN A 1 33  ? 3.259   12.538  -12.676 1.00 0.00 ? 33  ASN A CG   1  
ATOM 518   O OD1  . ASN A 1 33  ? 2.301   11.841  -13.002 1.00 0.00 ? 33  ASN A OD1  1  
ATOM 519   N ND2  . ASN A 1 33  ? 4.231   12.796  -13.537 1.00 0.00 ? 33  ASN A ND2  1  
ATOM 520   H H    . ASN A 1 33  ? 5.662   13.461  -9.697  1.00 0.00 ? 33  ASN A H    1  
ATOM 521   H HA   . ASN A 1 33  ? 4.290   14.833  -12.010 1.00 0.00 ? 33  ASN A HA   1  
ATOM 522   H HB2  . ASN A 1 33  ? 3.765   12.232  -10.631 1.00 0.00 ? 33  ASN A HB2  1  
ATOM 523   H HB3  . ASN A 1 33  ? 2.345   13.239  -10.910 1.00 0.00 ? 33  ASN A HB3  1  
ATOM 524   H HD21 . ASN A 1 33  ? 5.049   13.322  -13.255 1.00 0.00 ? 33  ASN A HD21 1  
ATOM 525   H HD22 . ASN A 1 33  ? 4.133   12.519  -14.500 1.00 0.00 ? 33  ASN A HD22 1  
ATOM 526   N N    . GLY A 1 34  ? 4.238   15.717  -9.021  1.00 0.00 ? 34  GLY A N    1  
ATOM 527   C CA   . GLY A 1 34  ? 3.685   16.617  -8.017  1.00 0.00 ? 34  GLY A CA   1  
ATOM 528   C C    . GLY A 1 34  ? 2.444   16.038  -7.343  1.00 0.00 ? 34  GLY A C    1  
ATOM 529   O O    . GLY A 1 34  ? 1.495   16.773  -7.067  1.00 0.00 ? 34  GLY A O    1  
ATOM 530   H H    . GLY A 1 34  ? 5.192   15.406  -8.893  1.00 0.00 ? 34  GLY A H    1  
ATOM 531   H HA2  . GLY A 1 34  ? 4.438   16.800  -7.253  1.00 0.00 ? 34  GLY A HA2  1  
ATOM 532   H HA3  . GLY A 1 34  ? 3.428   17.567  -8.485  1.00 0.00 ? 34  GLY A HA3  1  
ATOM 533   N N    . ILE A 1 35  ? 2.402   14.724  -7.123  1.00 0.00 ? 35  ILE A N    1  
ATOM 534   C CA   . ILE A 1 35  ? 1.309   14.079  -6.415  1.00 0.00 ? 35  ILE A CA   1  
ATOM 535   C C    . ILE A 1 35  ? 1.690   14.088  -4.938  1.00 0.00 ? 35  ILE A C    1  
ATOM 536   O O    . ILE A 1 35  ? 2.731   13.546  -4.564  1.00 0.00 ? 35  ILE A O    1  
ATOM 537   C CB   . ILE A 1 35  ? 1.046   12.669  -6.960  1.00 0.00 ? 35  ILE A CB   1  
ATOM 538   C CG1  . ILE A 1 35  ? 0.576   12.774  -8.424  1.00 0.00 ? 35  ILE A CG1  1  
ATOM 539   C CG2  . ILE A 1 35  ? -0.062  11.991  -6.132  1.00 0.00 ? 35  ILE A CG2  1  
ATOM 540   C CD1  . ILE A 1 35  ? 0.771   11.471  -9.186  1.00 0.00 ? 35  ILE A CD1  1  
ATOM 541   H H    . ILE A 1 35  ? 3.212   14.163  -7.364  1.00 0.00 ? 35  ILE A H    1  
ATOM 542   H HA   . ILE A 1 35  ? 0.391   14.634  -6.580  1.00 0.00 ? 35  ILE A HA   1  
ATOM 543   H HB   . ILE A 1 35  ? 1.966   12.089  -6.900  1.00 0.00 ? 35  ILE A HB   1  
ATOM 544   H HG12 . ILE A 1 35  ? -0.478  13.044  -8.437  1.00 0.00 ? 35  ILE A HG12 1  
ATOM 545   H HG13 . ILE A 1 35  ? 1.126   13.547  -8.958  1.00 0.00 ? 35  ILE A HG13 1  
ATOM 546   H HG21 . ILE A 1 35  ? 0.266   11.833  -5.105  1.00 0.00 ? 35  ILE A HG21 1  
ATOM 547   H HG22 . ILE A 1 35  ? -0.958  12.614  -6.120  1.00 0.00 ? 35  ILE A HG22 1  
ATOM 548   H HG23 . ILE A 1 35  ? -0.313  11.024  -6.557  1.00 0.00 ? 35  ILE A HG23 1  
ATOM 549   H HD11 . ILE A 1 35  ? 0.427   11.613  -10.208 1.00 0.00 ? 35  ILE A HD11 1  
ATOM 550   H HD12 . ILE A 1 35  ? 1.827   11.212  -9.184  1.00 0.00 ? 35  ILE A HD12 1  
ATOM 551   H HD13 . ILE A 1 35  ? 0.191   10.684  -8.716  1.00 0.00 ? 35  ILE A HD13 1  
ATOM 552   N N    . CYS A 1 36  ? 0.830   14.653  -4.089  1.00 0.00 ? 36  CYS A N    1  
ATOM 553   C CA   . CYS A 1 36  ? 0.925   14.526  -2.639  1.00 0.00 ? 36  CYS A CA   1  
ATOM 554   C C    . CYS A 1 36  ? 0.769   13.048  -2.286  1.00 0.00 ? 36  CYS A C    1  
ATOM 555   O O    . CYS A 1 36  ? -0.305  12.474  -2.516  1.00 0.00 ? 36  CYS A O    1  
ATOM 556   C CB   . CYS A 1 36  ? -0.176  15.348  -1.962  1.00 0.00 ? 36  CYS A CB   1  
ATOM 557   S SG   . CYS A 1 36  ? -0.206  17.026  -2.640  1.00 0.00 ? 36  CYS A SG   1  
ATOM 558   H H    . CYS A 1 36  ? 0.020   15.136  -4.448  1.00 0.00 ? 36  CYS A H    1  
ATOM 559   H HA   . CYS A 1 36  ? 1.901   14.893  -2.305  1.00 0.00 ? 36  CYS A HA   1  
ATOM 560   H HB2  . CYS A 1 36  ? -1.143  14.879  -2.150  1.00 0.00 ? 36  CYS A HB2  1  
ATOM 561   H HB3  . CYS A 1 36  ? -0.005  15.389  -0.883  1.00 0.00 ? 36  CYS A HB3  1  
ATOM 562   H HG   . CYS A 1 36  ? 0.777   17.532  -1.878  1.00 0.00 ? 36  CYS A HG   1  
ATOM 563   N N    . GLN A 1 37  ? 1.811   12.427  -1.733  1.00 0.00 ? 37  GLN A N    1  
ATOM 564   C CA   . GLN A 1 37  ? 1.763   11.026  -1.338  1.00 0.00 ? 37  GLN A CA   1  
ATOM 565   C C    . GLN A 1 37  ? 0.638   10.773  -0.326  1.00 0.00 ? 37  GLN A C    1  
ATOM 566   O O    . GLN A 1 37  ? 0.112   9.664   -0.276  1.00 0.00 ? 37  GLN A O    1  
ATOM 567   C CB   . GLN A 1 37  ? 3.104   10.530  -0.778  1.00 0.00 ? 37  GLN A CB   1  
ATOM 568   C CG   . GLN A 1 37  ? 4.337   10.831  -1.646  1.00 0.00 ? 37  GLN A CG   1  
ATOM 569   C CD   . GLN A 1 37  ? 5.041   12.103  -1.192  1.00 0.00 ? 37  GLN A CD   1  
ATOM 570   O OE1  . GLN A 1 37  ? 4.639   13.208  -1.545  1.00 0.00 ? 37  GLN A OE1  1  
ATOM 571   N NE2  . GLN A 1 37  ? 6.066   11.991  -0.369  1.00 0.00 ? 37  GLN A NE2  1  
ATOM 572   H H    . GLN A 1 37  ? 2.649   12.961  -1.528  1.00 0.00 ? 37  GLN A H    1  
ATOM 573   H HA   . GLN A 1 37  ? 1.545   10.448  -2.233  1.00 0.00 ? 37  GLN A HA   1  
ATOM 574   H HB2  . GLN A 1 37  ? 3.257   10.934  0.224   1.00 0.00 ? 37  GLN A HB2  1  
ATOM 575   H HB3  . GLN A 1 37  ? 3.017   9.449   -0.686  1.00 0.00 ? 37  GLN A HB3  1  
ATOM 576   H HG2  . GLN A 1 37  ? 5.033   9.997   -1.567  1.00 0.00 ? 37  GLN A HG2  1  
ATOM 577   H HG3  . GLN A 1 37  ? 4.052   10.934  -2.693  1.00 0.00 ? 37  GLN A HG3  1  
ATOM 578   H HE21 . GLN A 1 37  ? 6.337   11.105  0.043   1.00 0.00 ? 37  GLN A HE21 1  
ATOM 579   H HE22 . GLN A 1 37  ? 6.417   12.845  0.045   1.00 0.00 ? 37  GLN A HE22 1  
ATOM 580   N N    . ARG A 1 38  ? 0.222   11.791  0.437   1.00 0.00 ? 38  ARG A N    1  
ATOM 581   C CA   . ARG A 1 38  ? -0.919  11.708  1.341   1.00 0.00 ? 38  ARG A CA   1  
ATOM 582   C C    . ARG A 1 38  ? -2.196  11.348  0.592   1.00 0.00 ? 38  ARG A C    1  
ATOM 583   O O    . ARG A 1 38  ? -2.837  10.363  0.932   1.00 0.00 ? 38  ARG A O    1  
ATOM 584   C CB   . ARG A 1 38  ? -1.094  13.034  2.090   1.00 0.00 ? 38  ARG A CB   1  
ATOM 585   C CG   . ARG A 1 38  ? -2.054  12.867  3.277   1.00 0.00 ? 38  ARG A CG   1  
ATOM 586   C CD   . ARG A 1 38  ? -2.967  14.079  3.446   1.00 0.00 ? 38  ARG A CD   1  
ATOM 587   N NE   . ARG A 1 38  ? -4.100  14.093  2.500   1.00 0.00 ? 38  ARG A NE   1  
ATOM 588   C CZ   . ARG A 1 38  ? -4.995  15.086  2.456   1.00 0.00 ? 38  ARG A CZ   1  
ATOM 589   N NH1  . ARG A 1 38  ? -4.726  16.241  3.046   1.00 0.00 ? 38  ARG A NH1  1  
ATOM 590   N NH2  . ARG A 1 38  ? -6.141  14.934  1.814   1.00 0.00 ? 38  ARG A NH2  1  
ATOM 591   H H    . ARG A 1 38  ? 0.751   12.658  0.389   1.00 0.00 ? 38  ARG A H    1  
ATOM 592   H HA   . ARG A 1 38  ? -0.716  10.915  2.061   1.00 0.00 ? 38  ARG A HA   1  
ATOM 593   H HB2  . ARG A 1 38  ? -0.130  13.374  2.467   1.00 0.00 ? 38  ARG A HB2  1  
ATOM 594   H HB3  . ARG A 1 38  ? -1.463  13.797  1.405   1.00 0.00 ? 38  ARG A HB3  1  
ATOM 595   H HG2  . ARG A 1 38  ? -2.668  11.970  3.195   1.00 0.00 ? 38  ARG A HG2  1  
ATOM 596   H HG3  . ARG A 1 38  ? -1.436  12.755  4.166   1.00 0.00 ? 38  ARG A HG3  1  
ATOM 597   H HD2  . ARG A 1 38  ? -3.369  14.065  4.459   1.00 0.00 ? 38  ARG A HD2  1  
ATOM 598   H HD3  . ARG A 1 38  ? -2.374  14.986  3.336   1.00 0.00 ? 38  ARG A HD3  1  
ATOM 599   H HE   . ARG A 1 38  ? -4.307  13.244  1.989   1.00 0.00 ? 38  ARG A HE   1  
ATOM 600   H HH11 . ARG A 1 38  ? -3.786  16.469  3.355   1.00 0.00 ? 38  ARG A HH11 1  
ATOM 601   H HH12 . ARG A 1 38  ? -5.467  16.912  3.213   1.00 0.00 ? 38  ARG A HH12 1  
ATOM 602   H HH21 . ARG A 1 38  ? -6.477  14.005  1.530   1.00 0.00 ? 38  ARG A HH21 1  
ATOM 603   H HH22 . ARG A 1 38  ? -6.811  15.695  1.723   1.00 0.00 ? 38  ARG A HH22 1  
ATOM 604   N N    . ILE A 1 39  ? -2.599  12.160  -0.387  1.00 0.00 ? 39  ILE A N    1  
ATOM 605   C CA   . ILE A 1 39  ? -3.846  11.972  -1.134  1.00 0.00 ? 39  ILE A CA   1  
ATOM 606   C C    . ILE A 1 39  ? -3.750  10.673  -1.946  1.00 0.00 ? 39  ILE A C    1  
ATOM 607   O O    . ILE A 1 39  ? -4.740  9.950   -2.056  1.00 0.00 ? 39  ILE A O    1  
ATOM 608   C CB   . ILE A 1 39  ? -4.099  13.197  -2.046  1.00 0.00 ? 39  ILE A CB   1  
ATOM 609   C CG1  . ILE A 1 39  ? -4.352  14.470  -1.209  1.00 0.00 ? 39  ILE A CG1  1  
ATOM 610   C CG2  . ILE A 1 39  ? -5.267  12.941  -3.024  1.00 0.00 ? 39  ILE A CG2  1  
ATOM 611   C CD1  . ILE A 1 39  ? -4.248  15.760  -2.029  1.00 0.00 ? 39  ILE A CD1  1  
ATOM 612   H H    . ILE A 1 39  ? -1.988  12.909  -0.675  1.00 0.00 ? 39  ILE A H    1  
ATOM 613   H HA   . ILE A 1 39  ? -4.675  11.870  -0.423  1.00 0.00 ? 39  ILE A HA   1  
ATOM 614   H HB   . ILE A 1 39  ? -3.195  13.356  -2.630  1.00 0.00 ? 39  ILE A HB   1  
ATOM 615   H HG12 . ILE A 1 39  ? -5.339  14.408  -0.753  1.00 0.00 ? 39  ILE A HG12 1  
ATOM 616   H HG13 . ILE A 1 39  ? -3.614  14.539  -0.410  1.00 0.00 ? 39  ILE A HG13 1  
ATOM 617   H HG21 . ILE A 1 39  ? -6.183  12.747  -2.458  1.00 0.00 ? 39  ILE A HG21 1  
ATOM 618   H HG22 . ILE A 1 39  ? -5.420  13.808  -3.669  1.00 0.00 ? 39  ILE A HG22 1  
ATOM 619   H HG23 . ILE A 1 39  ? -5.056  12.079  -3.669  1.00 0.00 ? 39  ILE A HG23 1  
ATOM 620   H HD11 . ILE A 1 39  ? -4.303  16.616  -1.358  1.00 0.00 ? 39  ILE A HD11 1  
ATOM 621   H HD12 . ILE A 1 39  ? -3.300  15.778  -2.565  1.00 0.00 ? 39  ILE A HD12 1  
ATOM 622   H HD13 . ILE A 1 39  ? -5.067  15.827  -2.742  1.00 0.00 ? 39  ILE A HD13 1  
ATOM 623   N N    . PHE A 1 40  ? -2.570  10.355  -2.492  1.00 0.00 ? 40  PHE A N    1  
ATOM 624   C CA   . PHE A 1 40  ? -2.335  9.050   -3.098  1.00 0.00 ? 40  PHE A CA   1  
ATOM 625   C C    . PHE A 1 40  ? -2.694  7.950   -2.094  1.00 0.00 ? 40  PHE A C    1  
ATOM 626   O O    . PHE A 1 40  ? -3.465  7.052   -2.416  1.00 0.00 ? 40  PHE A O    1  
ATOM 627   C CB   . PHE A 1 40  ? -0.883  8.947   -3.583  1.00 0.00 ? 40  PHE A CB   1  
ATOM 628   C CG   . PHE A 1 40  ? -0.322  7.542   -3.687  1.00 0.00 ? 40  PHE A CG   1  
ATOM 629   C CD1  . PHE A 1 40  ? -0.598  6.756   -4.818  1.00 0.00 ? 40  PHE A CD1  1  
ATOM 630   C CD2  . PHE A 1 40  ? 0.476   7.014   -2.651  1.00 0.00 ? 40  PHE A CD2  1  
ATOM 631   C CE1  . PHE A 1 40  ? -0.092  5.450   -4.911  1.00 0.00 ? 40  PHE A CE1  1  
ATOM 632   C CE2  . PHE A 1 40  ? 0.998   5.712   -2.755  1.00 0.00 ? 40  PHE A CE2  1  
ATOM 633   C CZ   . PHE A 1 40  ? 0.701   4.923   -3.882  1.00 0.00 ? 40  PHE A CZ   1  
ATOM 634   H H    . PHE A 1 40  ? -1.813  11.028  -2.443  1.00 0.00 ? 40  PHE A H    1  
ATOM 635   H HA   . PHE A 1 40  ? -3.006  8.968   -3.954  1.00 0.00 ? 40  PHE A HA   1  
ATOM 636   H HB2  . PHE A 1 40  ? -0.802  9.444   -4.546  1.00 0.00 ? 40  PHE A HB2  1  
ATOM 637   H HB3  . PHE A 1 40  ? -0.259  9.500   -2.897  1.00 0.00 ? 40  PHE A HB3  1  
ATOM 638   H HD1  . PHE A 1 40  ? -1.199  7.146   -5.621  1.00 0.00 ? 40  PHE A HD1  1  
ATOM 639   H HD2  . PHE A 1 40  ? 0.693   7.599   -1.768  1.00 0.00 ? 40  PHE A HD2  1  
ATOM 640   H HE1  . PHE A 1 40  ? -0.311  4.846   -5.779  1.00 0.00 ? 40  PHE A HE1  1  
ATOM 641   H HE2  . PHE A 1 40  ? 1.622   5.317   -1.966  1.00 0.00 ? 40  PHE A HE2  1  
ATOM 642   H HZ   . PHE A 1 40  ? 1.070   3.911   -3.977  1.00 0.00 ? 40  PHE A HZ   1  
ATOM 643   N N    . GLY A 1 41  ? -2.172  8.017   -0.871  1.00 0.00 ? 41  GLY A N    1  
ATOM 644   C CA   . GLY A 1 41  ? -2.458  7.037   0.154   1.00 0.00 ? 41  GLY A CA   1  
ATOM 645   C C    . GLY A 1 41  ? -3.936  6.958   0.493   1.00 0.00 ? 41  GLY A C    1  
ATOM 646   O O    . GLY A 1 41  ? -4.479  5.868   0.597   1.00 0.00 ? 41  GLY A O    1  
ATOM 647   H H    . GLY A 1 41  ? -1.532  8.763   -0.626  1.00 0.00 ? 41  GLY A H    1  
ATOM 648   H HA2  . GLY A 1 41  ? -2.121  6.066   -0.197  1.00 0.00 ? 41  GLY A HA2  1  
ATOM 649   H HA3  . GLY A 1 41  ? -1.917  7.315   1.050   1.00 0.00 ? 41  GLY A HA3  1  
ATOM 650   N N    . GLU A 1 42  ? -4.598  8.096   0.634   1.00 0.00 ? 42  GLU A N    1  
ATOM 651   C CA   . GLU A 1 42  ? -5.977  8.245   0.987   1.00 0.00 ? 42  GLU A CA   1  
ATOM 652   C C    . GLU A 1 42  ? -6.916  7.623   -0.052  1.00 0.00 ? 42  GLU A C    1  
ATOM 653   O O    . GLU A 1 42  ? -7.816  6.852   0.288   1.00 0.00 ? 42  GLU A O    1  
ATOM 654   C CB   . GLU A 1 42  ? -6.100  9.766   1.097   1.00 0.00 ? 42  GLU A CB   1  
ATOM 655   C CG   . GLU A 1 42  ? -7.408  10.169  1.702   1.00 0.00 ? 42  GLU A CG   1  
ATOM 656   C CD   . GLU A 1 42  ? -7.412  11.655  2.046   1.00 0.00 ? 42  GLU A CD   1  
ATOM 657   O OE1  . GLU A 1 42  ? -7.143  12.477  1.147   1.00 0.00 ? 42  GLU A OE1  1  
ATOM 658   O OE2  . GLU A 1 42  ? -7.652  11.991  3.234   1.00 0.00 ? 42  GLU A OE2  1  
ATOM 659   H H    . GLU A 1 42  ? -4.165  9.010   0.623   1.00 0.00 ? 42  GLU A H    1  
ATOM 660   H HA   . GLU A 1 42  ? -6.167  7.778   1.951   1.00 0.00 ? 42  GLU A HA   1  
ATOM 661   H HB2  . GLU A 1 42  ? -5.307  10.152  1.741   1.00 0.00 ? 42  GLU A HB2  1  
ATOM 662   H HB3  . GLU A 1 42  ? -6.018  10.229  0.120   1.00 0.00 ? 42  GLU A HB3  1  
ATOM 663   H HG2  . GLU A 1 42  ? -8.197  9.912   0.997   1.00 0.00 ? 42  GLU A HG2  1  
ATOM 664   H HG3  . GLU A 1 42  ? -7.475  9.583   2.609   1.00 0.00 ? 42  GLU A HG3  1  
ATOM 665   N N    . LYS A 1 43  ? -6.709  7.946   -1.329  1.00 0.00 ? 43  LYS A N    1  
ATOM 666   C CA   . LYS A 1 43  ? -7.581  7.543   -2.423  1.00 0.00 ? 43  LYS A CA   1  
ATOM 667   C C    . LYS A 1 43  ? -7.121  6.211   -3.007  1.00 0.00 ? 43  LYS A C    1  
ATOM 668   O O    . LYS A 1 43  ? -7.868  5.231   -2.965  1.00 0.00 ? 43  LYS A O    1  
ATOM 669   C CB   . LYS A 1 43  ? -7.652  8.684   -3.460  1.00 0.00 ? 43  LYS A CB   1  
ATOM 670   C CG   . LYS A 1 43  ? -8.203  9.971   -2.815  1.00 0.00 ? 43  LYS A CG   1  
ATOM 671   C CD   . LYS A 1 43  ? -9.202  10.751  -3.674  1.00 0.00 ? 43  LYS A CD   1  
ATOM 672   C CE   . LYS A 1 43  ? -8.581  11.643  -4.761  1.00 0.00 ? 43  LYS A CE   1  
ATOM 673   N NZ   . LYS A 1 43  ? -9.593  12.554  -5.341  1.00 0.00 ? 43  LYS A NZ   1  
ATOM 674   H H    . LYS A 1 43  ? -5.974  8.612   -1.532  1.00 0.00 ? 43  LYS A H    1  
ATOM 675   H HA   . LYS A 1 43  ? -8.586  7.389   -2.021  1.00 0.00 ? 43  LYS A HA   1  
ATOM 676   H HB2  . LYS A 1 43  ? -6.666  8.886   -3.880  1.00 0.00 ? 43  LYS A HB2  1  
ATOM 677   H HB3  . LYS A 1 43  ? -8.303  8.377   -4.275  1.00 0.00 ? 43  LYS A HB3  1  
ATOM 678   H HG2  . LYS A 1 43  ? -8.735  9.702   -1.901  1.00 0.00 ? 43  LYS A HG2  1  
ATOM 679   H HG3  . LYS A 1 43  ? -7.382  10.625  -2.528  1.00 0.00 ? 43  LYS A HG3  1  
ATOM 680   H HD2  . LYS A 1 43  ? -9.901  10.047  -4.119  1.00 0.00 ? 43  LYS A HD2  1  
ATOM 681   H HD3  . LYS A 1 43  ? -9.765  11.379  -2.988  1.00 0.00 ? 43  LYS A HD3  1  
ATOM 682   H HE2  . LYS A 1 43  ? -7.793  12.251  -4.311  1.00 0.00 ? 43  LYS A HE2  1  
ATOM 683   H HE3  . LYS A 1 43  ? -8.156  11.017  -5.545  1.00 0.00 ? 43  LYS A HE3  1  
ATOM 684   H HZ1  . LYS A 1 43  ? -9.988  13.128  -4.598  1.00 0.00 ? 43  LYS A HZ1  1  
ATOM 685   H HZ2  . LYS A 1 43  ? -9.200  13.210  -6.011  1.00 0.00 ? 43  LYS A HZ2  1  
ATOM 686   H HZ3  . LYS A 1 43  ? -10.341 12.048  -5.803  1.00 0.00 ? 43  LYS A HZ3  1  
ATOM 687   N N    . VAL A 1 44  ? -5.900  6.167   -3.545  1.00 0.00 ? 44  VAL A N    1  
ATOM 688   C CA   . VAL A 1 44  ? -5.351  4.990   -4.213  1.00 0.00 ? 44  VAL A CA   1  
ATOM 689   C C    . VAL A 1 44  ? -5.205  3.857   -3.201  1.00 0.00 ? 44  VAL A C    1  
ATOM 690   O O    . VAL A 1 44  ? -5.801  2.800   -3.400  1.00 0.00 ? 44  VAL A O    1  
ATOM 691   C CB   . VAL A 1 44  ? -4.011  5.295   -4.927  1.00 0.00 ? 44  VAL A CB   1  
ATOM 692   C CG1  . VAL A 1 44  ? -3.555  4.114   -5.792  1.00 0.00 ? 44  VAL A CG1  1  
ATOM 693   C CG2  . VAL A 1 44  ? -4.091  6.564   -5.793  1.00 0.00 ? 44  VAL A CG2  1  
ATOM 694   H H    . VAL A 1 44  ? -5.292  6.963   -3.411  1.00 0.00 ? 44  VAL A H    1  
ATOM 695   H HA   . VAL A 1 44  ? -6.078  4.675   -4.964  1.00 0.00 ? 44  VAL A HA   1  
ATOM 696   H HB   . VAL A 1 44  ? -3.226  5.441   -4.192  1.00 0.00 ? 44  VAL A HB   1  
ATOM 697   H HG11 . VAL A 1 44  ? -4.235  3.981   -6.632  1.00 0.00 ? 44  VAL A HG11 1  
ATOM 698   H HG12 . VAL A 1 44  ? -2.544  4.300   -6.151  1.00 0.00 ? 44  VAL A HG12 1  
ATOM 699   H HG13 . VAL A 1 44  ? -3.515  3.196   -5.205  1.00 0.00 ? 44  VAL A HG13 1  
ATOM 700   H HG21 . VAL A 1 44  ? -4.145  7.448   -5.157  1.00 0.00 ? 44  VAL A HG21 1  
ATOM 701   H HG22 . VAL A 1 44  ? -3.204  6.648   -6.420  1.00 0.00 ? 44  VAL A HG22 1  
ATOM 702   H HG23 . VAL A 1 44  ? -4.971  6.522   -6.434  1.00 0.00 ? 44  VAL A HG23 1  
ATOM 703   N N    . LEU A 1 45  ? -4.383  4.033   -2.159  1.00 0.00 ? 45  LEU A N    1  
ATOM 704   C CA   . LEU A 1 45  ? -4.097  2.925   -1.243  1.00 0.00 ? 45  LEU A CA   1  
ATOM 705   C C    . LEU A 1 45  ? -5.316  2.639   -0.371  1.00 0.00 ? 45  LEU A C    1  
ATOM 706   O O    . LEU A 1 45  ? -5.625  1.476   -0.123  1.00 0.00 ? 45  LEU A O    1  
ATOM 707   C CB   . LEU A 1 45  ? -2.830  3.164   -0.397  1.00 0.00 ? 45  LEU A CB   1  
ATOM 708   C CG   . LEU A 1 45  ? -1.554  3.393   -1.231  1.00 0.00 ? 45  LEU A CG   1  
ATOM 709   C CD1  . LEU A 1 45  ? -0.349  3.676   -0.329  1.00 0.00 ? 45  LEU A CD1  1  
ATOM 710   C CD2  . LEU A 1 45  ? -1.221  2.161   -2.058  1.00 0.00 ? 45  LEU A CD2  1  
ATOM 711   H H    . LEU A 1 45  ? -3.967  4.947   -2.011  1.00 0.00 ? 45  LEU A H    1  
ATOM 712   H HA   . LEU A 1 45  ? -3.940  2.027   -1.838  1.00 0.00 ? 45  LEU A HA   1  
ATOM 713   H HB2  . LEU A 1 45  ? -2.982  4.009   0.264   1.00 0.00 ? 45  LEU A HB2  1  
ATOM 714   H HB3  . LEU A 1 45  ? -2.684  2.289   0.239   1.00 0.00 ? 45  LEU A HB3  1  
ATOM 715   H HG   . LEU A 1 45  ? -1.691  4.241   -1.901  1.00 0.00 ? 45  LEU A HG   1  
ATOM 716   H HD11 . LEU A 1 45  ? -0.391  4.709   -0.002  1.00 0.00 ? 45  LEU A HD11 1  
ATOM 717   H HD12 . LEU A 1 45  ? -0.345  3.005   0.531   1.00 0.00 ? 45  LEU A HD12 1  
ATOM 718   H HD13 . LEU A 1 45  ? 0.580   3.551   -0.879  1.00 0.00 ? 45  LEU A HD13 1  
ATOM 719   H HD21 . LEU A 1 45  ? -0.289  2.315   -2.591  1.00 0.00 ? 45  LEU A HD21 1  
ATOM 720   H HD22 . LEU A 1 45  ? -1.123  1.324   -1.376  1.00 0.00 ? 45  LEU A HD22 1  
ATOM 721   H HD23 . LEU A 1 45  ? -2.001  1.968   -2.792  1.00 0.00 ? 45  LEU A HD23 1  
ATOM 722   N N    . GLY A 1 46  ? -6.030  3.686   0.035   1.00 0.00 ? 46  GLY A N    1  
ATOM 723   C CA   . GLY A 1 46  ? -7.209  3.636   0.878   1.00 0.00 ? 46  GLY A CA   1  
ATOM 724   C C    . GLY A 1 46  ? -6.892  3.866   2.355   1.00 0.00 ? 46  GLY A C    1  
ATOM 725   O O    . GLY A 1 46  ? -7.760  3.632   3.196   1.00 0.00 ? 46  GLY A O    1  
ATOM 726   H H    . GLY A 1 46  ? -5.666  4.610   -0.166  1.00 0.00 ? 46  GLY A H    1  
ATOM 727   H HA2  . GLY A 1 46  ? -7.881  4.424   0.553   1.00 0.00 ? 46  GLY A HA2  1  
ATOM 728   H HA3  . GLY A 1 46  ? -7.710  2.671   0.773   1.00 0.00 ? 46  GLY A HA3  1  
ATOM 729   N N    . LEU A 1 47  ? -5.679  4.284   2.725   1.00 0.00 ? 47  LEU A N    1  
ATOM 730   C CA   . LEU A 1 47  ? -5.217  4.322   4.113   1.00 0.00 ? 47  LEU A CA   1  
ATOM 731   C C    . LEU A 1 47  ? -5.298  5.721   4.714   1.00 0.00 ? 47  LEU A C    1  
ATOM 732   O O    . LEU A 1 47  ? -5.369  6.720   4.004   1.00 0.00 ? 47  LEU A O    1  
ATOM 733   C CB   . LEU A 1 47  ? -3.771  3.809   4.213   1.00 0.00 ? 47  LEU A CB   1  
ATOM 734   C CG   . LEU A 1 47  ? -3.617  2.291   4.017   1.00 0.00 ? 47  LEU A CG   1  
ATOM 735   C CD1  . LEU A 1 47  ? -2.146  1.946   4.253   1.00 0.00 ? 47  LEU A CD1  1  
ATOM 736   C CD2  . LEU A 1 47  ? -4.478  1.470   4.988   1.00 0.00 ? 47  LEU A CD2  1  
ATOM 737   H H    . LEU A 1 47  ? -5.070  4.639   2.000   1.00 0.00 ? 47  LEU A H    1  
ATOM 738   H HA   . LEU A 1 47  ? -5.860  3.685   4.718   1.00 0.00 ? 47  LEU A HA   1  
ATOM 739   H HB2  . LEU A 1 47  ? -3.159  4.336   3.479   1.00 0.00 ? 47  LEU A HB2  1  
ATOM 740   H HB3  . LEU A 1 47  ? -3.381  4.064   5.199   1.00 0.00 ? 47  LEU A HB3  1  
ATOM 741   H HG   . LEU A 1 47  ? -3.883  2.020   2.995   1.00 0.00 ? 47  LEU A HG   1  
ATOM 742   H HD11 . LEU A 1 47  ? -2.015  0.868   4.241   1.00 0.00 ? 47  LEU A HD11 1  
ATOM 743   H HD12 . LEU A 1 47  ? -1.539  2.365   3.451   1.00 0.00 ? 47  LEU A HD12 1  
ATOM 744   H HD13 . LEU A 1 47  ? -1.801  2.338   5.211   1.00 0.00 ? 47  LEU A HD13 1  
ATOM 745   H HD21 . LEU A 1 47  ? -5.525  1.544   4.693   1.00 0.00 ? 47  LEU A HD21 1  
ATOM 746   H HD22 . LEU A 1 47  ? -4.217  0.411   4.923   1.00 0.00 ? 47  LEU A HD22 1  
ATOM 747   H HD23 . LEU A 1 47  ? -4.373  1.835   6.009   1.00 0.00 ? 47  LEU A HD23 1  
ATOM 748   N N    . SER A 1 48  ? -5.235  5.780   6.046   1.00 0.00 ? 48  SER A N    1  
ATOM 749   C CA   . SER A 1 48  ? -5.172  7.012   6.802   1.00 0.00 ? 48  SER A CA   1  
ATOM 750   C C    . SER A 1 48  ? -3.901  7.780   6.441   1.00 0.00 ? 48  SER A C    1  
ATOM 751   O O    . SER A 1 48  ? -2.853  7.200   6.134   1.00 0.00 ? 48  SER A O    1  
ATOM 752   C CB   . SER A 1 48  ? -5.202  6.688   8.298   1.00 0.00 ? 48  SER A CB   1  
ATOM 753   O OG   . SER A 1 48  ? -5.662  7.793   9.051   1.00 0.00 ? 48  SER A OG   1  
ATOM 754   H H    . SER A 1 48  ? -5.158  4.927   6.571   1.00 0.00 ? 48  SER A H    1  
ATOM 755   H HA   . SER A 1 48  ? -6.052  7.601   6.541   1.00 0.00 ? 48  SER A HA   1  
ATOM 756   H HB2  . SER A 1 48  ? -5.862  5.845   8.490   1.00 0.00 ? 48  SER A HB2  1  
ATOM 757   H HB3  . SER A 1 48  ? -4.198  6.424   8.622   1.00 0.00 ? 48  SER A HB3  1  
ATOM 758   H HG   . SER A 1 48  ? -6.637  7.705   9.139   1.00 0.00 ? 48  SER A HG   1  
ATOM 759   N N    . GLN A 1 49  ? -3.999  9.103   6.531   1.00 0.00 ? 49  GLN A N    1  
ATOM 760   C CA   . GLN A 1 49  ? -2.961  10.042  6.125   1.00 0.00 ? 49  GLN A CA   1  
ATOM 761   C C    . GLN A 1 49  ? -1.662  9.884   6.926   1.00 0.00 ? 49  GLN A C    1  
ATOM 762   O O    . GLN A 1 49  ? -0.586  10.105  6.363   1.00 0.00 ? 49  GLN A O    1  
ATOM 763   C CB   . GLN A 1 49  ? -3.509  11.483  6.158   1.00 0.00 ? 49  GLN A CB   1  
ATOM 764   C CG   . GLN A 1 49  ? -4.044  12.000  7.505   1.00 0.00 ? 49  GLN A CG   1  
ATOM 765   C CD   . GLN A 1 49  ? -5.179  13.012  7.323   1.00 0.00 ? 49  GLN A CD   1  
ATOM 766   O OE1  . GLN A 1 49  ? -6.303  12.632  7.008   1.00 0.00 ? 49  GLN A OE1  1  
ATOM 767   N NE2  . GLN A 1 49  ? -4.959  14.304  7.501   1.00 0.00 ? 49  GLN A NE2  1  
ATOM 768   H H    . GLN A 1 49  ? -4.896  9.444   6.841   1.00 0.00 ? 49  GLN A H    1  
ATOM 769   H HA   . GLN A 1 49  ? -2.721  9.814   5.084   1.00 0.00 ? 49  GLN A HA   1  
ATOM 770   H HB2  . GLN A 1 49  ? -2.709  12.153  5.859   1.00 0.00 ? 49  GLN A HB2  1  
ATOM 771   H HB3  . GLN A 1 49  ? -4.306  11.548  5.415   1.00 0.00 ? 49  GLN A HB3  1  
ATOM 772   H HG2  . GLN A 1 49  ? -4.438  11.172  8.093   1.00 0.00 ? 49  GLN A HG2  1  
ATOM 773   H HG3  . GLN A 1 49  ? -3.222  12.451  8.061   1.00 0.00 ? 49  GLN A HG3  1  
ATOM 774   H HE21 . GLN A 1 49  ? -4.033  14.707  7.648   1.00 0.00 ? 49  GLN A HE21 1  
ATOM 775   H HE22 . GLN A 1 49  ? -5.749  14.941  7.422   1.00 0.00 ? 49  GLN A HE22 1  
ATOM 776   N N    . GLY A 1 50  ? -1.743  9.488   8.200   1.00 0.00 ? 50  GLY A N    1  
ATOM 777   C CA   . GLY A 1 50  ? -0.581  9.219   9.028   1.00 0.00 ? 50  GLY A CA   1  
ATOM 778   C C    . GLY A 1 50  ? -0.078  7.796   8.816   1.00 0.00 ? 50  GLY A C    1  
ATOM 779   O O    . GLY A 1 50  ? 1.127   7.616   8.665   1.00 0.00 ? 50  GLY A O    1  
ATOM 780   H H    . GLY A 1 50  ? -2.642  9.258   8.612   1.00 0.00 ? 50  GLY A H    1  
ATOM 781   H HA2  . GLY A 1 50  ? 0.202   9.934   8.778   1.00 0.00 ? 50  GLY A HA2  1  
ATOM 782   H HA3  . GLY A 1 50  ? -0.847  9.340   10.076  1.00 0.00 ? 50  GLY A HA3  1  
ATOM 783   N N    . SER A 1 51  ? -0.970  6.805   8.713   1.00 0.00 ? 51  SER A N    1  
ATOM 784   C CA   . SER A 1 51  ? -0.572  5.420   8.485   1.00 0.00 ? 51  SER A CA   1  
ATOM 785   C C    . SER A 1 51  ? 0.292   5.292   7.229   1.00 0.00 ? 51  SER A C    1  
ATOM 786   O O    . SER A 1 51  ? 1.342   4.653   7.277   1.00 0.00 ? 51  SER A O    1  
ATOM 787   C CB   . SER A 1 51  ? -1.800  4.509   8.394   1.00 0.00 ? 51  SER A CB   1  
ATOM 788   O OG   . SER A 1 51  ? -2.635  4.619   9.539   1.00 0.00 ? 51  SER A OG   1  
ATOM 789   H H    . SER A 1 51  ? -1.941  7.011   8.912   1.00 0.00 ? 51  SER A H    1  
ATOM 790   H HA   . SER A 1 51  ? 0.040   5.101   9.330   1.00 0.00 ? 51  SER A HA   1  
ATOM 791   H HB2  . SER A 1 51  ? -2.375  4.758   7.502   1.00 0.00 ? 51  SER A HB2  1  
ATOM 792   H HB3  . SER A 1 51  ? -1.459  3.477   8.299   1.00 0.00 ? 51  SER A HB3  1  
ATOM 793   H HG   . SER A 1 51  ? -2.052  4.624   10.333  1.00 0.00 ? 51  SER A HG   1  
ATOM 794   N N    . VAL A 1 52  ? -0.129  5.888   6.109   1.00 0.00 ? 52  VAL A N    1  
ATOM 795   C CA   . VAL A 1 52  ? 0.622   5.857   4.868   1.00 0.00 ? 52  VAL A CA   1  
ATOM 796   C C    . VAL A 1 52  ? 1.945   6.629   4.977   1.00 0.00 ? 52  VAL A C    1  
ATOM 797   O O    . VAL A 1 52  ? 2.921   6.243   4.334   1.00 0.00 ? 52  VAL A O    1  
ATOM 798   C CB   . VAL A 1 52  ? -0.311  6.349   3.734   1.00 0.00 ? 52  VAL A CB   1  
ATOM 799   C CG1  . VAL A 1 52  ? -0.017  7.774   3.237   1.00 0.00 ? 52  VAL A CG1  1  
ATOM 800   C CG2  . VAL A 1 52  ? -0.301  5.309   2.614   1.00 0.00 ? 52  VAL A CG2  1  
ATOM 801   H H    . VAL A 1 52  ? -1.040  6.337   6.061   1.00 0.00 ? 52  VAL A H    1  
ATOM 802   H HA   . VAL A 1 52  ? 0.880   4.810   4.693   1.00 0.00 ? 52  VAL A HA   1  
ATOM 803   H HB   . VAL A 1 52  ? -1.335  6.368   4.107   1.00 0.00 ? 52  VAL A HB   1  
ATOM 804   H HG11 . VAL A 1 52  ? -0.804  8.117   2.570   1.00 0.00 ? 52  VAL A HG11 1  
ATOM 805   H HG12 . VAL A 1 52  ? -0.013  8.453   4.088   1.00 0.00 ? 52  VAL A HG12 1  
ATOM 806   H HG13 . VAL A 1 52  ? 0.944   7.806   2.717   1.00 0.00 ? 52  VAL A HG13 1  
ATOM 807   H HG21 . VAL A 1 52  ? 0.648   5.322   2.073   1.00 0.00 ? 52  VAL A HG21 1  
ATOM 808   H HG22 . VAL A 1 52  ? -0.474  4.322   3.039   1.00 0.00 ? 52  VAL A HG22 1  
ATOM 809   H HG23 . VAL A 1 52  ? -1.131  5.486   1.939   1.00 0.00 ? 52  VAL A HG23 1  
ATOM 810   N N    . SER A 1 53  ? 1.992   7.696   5.784   1.00 0.00 ? 53  SER A N    1  
ATOM 811   C CA   . SER A 1 53  ? 3.202   8.471   6.027   1.00 0.00 ? 53  SER A CA   1  
ATOM 812   C C    . SER A 1 53  ? 4.224   7.553   6.691   1.00 0.00 ? 53  SER A C    1  
ATOM 813   O O    . SER A 1 53  ? 5.331   7.392   6.176   1.00 0.00 ? 53  SER A O    1  
ATOM 814   C CB   . SER A 1 53  ? 2.849   9.700   6.880   1.00 0.00 ? 53  SER A CB   1  
ATOM 815   O OG   . SER A 1 53  ? 3.972   10.462  7.272   1.00 0.00 ? 53  SER A OG   1  
ATOM 816   H H    . SER A 1 53  ? 1.173   7.906   6.338   1.00 0.00 ? 53  SER A H    1  
ATOM 817   H HA   . SER A 1 53  ? 3.606   8.804   5.070   1.00 0.00 ? 53  SER A HA   1  
ATOM 818   H HB2  . SER A 1 53  ? 2.163   10.333  6.320   1.00 0.00 ? 53  SER A HB2  1  
ATOM 819   H HB3  . SER A 1 53  ? 2.349   9.377   7.786   1.00 0.00 ? 53  SER A HB3  1  
ATOM 820   H HG   . SER A 1 53  ? 4.335   10.914  6.474   1.00 0.00 ? 53  SER A HG   1  
ATOM 821   N N    . ASP A 1 54  ? 3.843   6.906   7.799   1.00 0.00 ? 54  ASP A N    1  
ATOM 822   C CA   . ASP A 1 54  ? 4.704   5.948   8.486   1.00 0.00 ? 54  ASP A CA   1  
ATOM 823   C C    . ASP A 1 54  ? 5.133   4.846   7.519   1.00 0.00 ? 54  ASP A C    1  
ATOM 824   O O    . ASP A 1 54  ? 6.262   4.370   7.600   1.00 0.00 ? 54  ASP A O    1  
ATOM 825   C CB   . ASP A 1 54  ? 3.998   5.290   9.684   1.00 0.00 ? 54  ASP A CB   1  
ATOM 826   C CG   . ASP A 1 54  ? 3.936   6.133   10.954  1.00 0.00 ? 54  ASP A CG   1  
ATOM 827   O OD1  . ASP A 1 54  ? 4.930   6.777   11.353  1.00 0.00 ? 54  ASP A OD1  1  
ATOM 828   O OD2  . ASP A 1 54  ? 2.914   6.031   11.672  1.00 0.00 ? 54  ASP A OD2  1  
ATOM 829   H H    . ASP A 1 54  ? 2.905   7.053   8.163   1.00 0.00 ? 54  ASP A H    1  
ATOM 830   H HA   . ASP A 1 54  ? 5.598   6.461   8.845   1.00 0.00 ? 54  ASP A HA   1  
ATOM 831   H HB2  . ASP A 1 54  ? 2.989   4.998   9.392   1.00 0.00 ? 54  ASP A HB2  1  
ATOM 832   H HB3  . ASP A 1 54  ? 4.544   4.382   9.945   1.00 0.00 ? 54  ASP A HB3  1  
ATOM 833   N N    . MET A 1 55  ? 4.251   4.418   6.613   1.00 0.00 ? 55  MET A N    1  
ATOM 834   C CA   . MET A 1 55  ? 4.514   3.363   5.636   1.00 0.00 ? 55  MET A CA   1  
ATOM 835   C C    . MET A 1 55  ? 5.664   3.756   4.722   1.00 0.00 ? 55  MET A C    1  
ATOM 836   O O    . MET A 1 55  ? 6.689   3.081   4.683   1.00 0.00 ? 55  MET A O    1  
ATOM 837   C CB   . MET A 1 55  ? 3.245   3.067   4.818   1.00 0.00 ? 55  MET A CB   1  
ATOM 838   C CG   . MET A 1 55  ? 3.098   1.574   4.542   1.00 0.00 ? 55  MET A CG   1  
ATOM 839   S SD   . MET A 1 55  ? 1.428   1.030   4.112   1.00 0.00 ? 55  MET A SD   1  
ATOM 840   C CE   . MET A 1 55  ? 0.722   0.932   5.782   1.00 0.00 ? 55  MET A CE   1  
ATOM 841   H H    . MET A 1 55  ? 3.334   4.853   6.630   1.00 0.00 ? 55  MET A H    1  
ATOM 842   H HA   . MET A 1 55  ? 4.806   2.470   6.187   1.00 0.00 ? 55  MET A HA   1  
ATOM 843   H HB2  . MET A 1 55  ? 2.394   3.426   5.371   1.00 0.00 ? 55  MET A HB2  1  
ATOM 844   H HB3  . MET A 1 55  ? 3.235   3.598   3.867   1.00 0.00 ? 55  MET A HB3  1  
ATOM 845   H HG2  . MET A 1 55  ? 3.774   1.309   3.729   1.00 0.00 ? 55  MET A HG2  1  
ATOM 846   H HG3  . MET A 1 55  ? 3.394   1.028   5.433   1.00 0.00 ? 55  MET A HG3  1  
ATOM 847   H HE1  . MET A 1 55  ? -0.256  0.455   5.735   1.00 0.00 ? 55  MET A HE1  1  
ATOM 848   H HE2  . MET A 1 55  ? 1.368   0.329   6.421   1.00 0.00 ? 55  MET A HE2  1  
ATOM 849   H HE3  . MET A 1 55  ? 0.614   1.933   6.201   1.00 0.00 ? 55  MET A HE3  1  
ATOM 850   N N    . LEU A 1 56  ? 5.468   4.838   3.974   1.00 0.00 ? 56  LEU A N    1  
ATOM 851   C CA   . LEU A 1 56  ? 6.438   5.326   2.995   1.00 0.00 ? 56  LEU A CA   1  
ATOM 852   C C    . LEU A 1 56  ? 7.755   5.784   3.632   1.00 0.00 ? 56  LEU A C    1  
ATOM 853   O O    . LEU A 1 56  ? 8.794   5.709   2.969   1.00 0.00 ? 56  LEU A O    1  
ATOM 854   C CB   . LEU A 1 56  ? 5.839   6.468   2.156   1.00 0.00 ? 56  LEU A CB   1  
ATOM 855   C CG   . LEU A 1 56  ? 4.653   6.079   1.252   1.00 0.00 ? 56  LEU A CG   1  
ATOM 856   C CD1  . LEU A 1 56  ? 4.292   7.259   0.352   1.00 0.00 ? 56  LEU A CD1  1  
ATOM 857   C CD2  . LEU A 1 56  ? 4.954   4.878   0.352   1.00 0.00 ? 56  LEU A CD2  1  
ATOM 858   H H    . LEU A 1 56  ? 4.531   5.234   4.043   1.00 0.00 ? 56  LEU A H    1  
ATOM 859   H HA   . LEU A 1 56  ? 6.692   4.498   2.335   1.00 0.00 ? 56  LEU A HA   1  
ATOM 860   H HB2  . LEU A 1 56  ? 5.526   7.271   2.828   1.00 0.00 ? 56  LEU A HB2  1  
ATOM 861   H HB3  . LEU A 1 56  ? 6.629   6.861   1.519   1.00 0.00 ? 56  LEU A HB3  1  
ATOM 862   H HG   . LEU A 1 56  ? 3.787   5.842   1.869   1.00 0.00 ? 56  LEU A HG   1  
ATOM 863   H HD11 . LEU A 1 56  ? 3.399   7.022   -0.226  1.00 0.00 ? 56  LEU A HD11 1  
ATOM 864   H HD12 . LEU A 1 56  ? 4.099   8.139   0.966   1.00 0.00 ? 56  LEU A HD12 1  
ATOM 865   H HD13 . LEU A 1 56  ? 5.113   7.467   -0.336  1.00 0.00 ? 56  LEU A HD13 1  
ATOM 866   H HD21 . LEU A 1 56  ? 5.032   3.979   0.958   1.00 0.00 ? 56  LEU A HD21 1  
ATOM 867   H HD22 . LEU A 1 56  ? 4.139   4.737   -0.359  1.00 0.00 ? 56  LEU A HD22 1  
ATOM 868   H HD23 . LEU A 1 56  ? 5.881   5.037   -0.200  1.00 0.00 ? 56  LEU A HD23 1  
ATOM 869   N N    . SER A 1 57  ? 7.740   6.266   4.879   1.00 0.00 ? 57  SER A N    1  
ATOM 870   C CA   . SER A 1 57  ? 8.952   6.681   5.577   1.00 0.00 ? 57  SER A CA   1  
ATOM 871   C C    . SER A 1 57  ? 9.723   5.471   6.120   1.00 0.00 ? 57  SER A C    1  
ATOM 872   O O    . SER A 1 57  ? 10.932  5.362   5.907   1.00 0.00 ? 57  SER A O    1  
ATOM 873   C CB   . SER A 1 57  ? 8.606   7.689   6.689   1.00 0.00 ? 57  SER A CB   1  
ATOM 874   O OG   . SER A 1 57  ? 9.398   8.854   6.567   1.00 0.00 ? 57  SER A OG   1  
ATOM 875   H H    . SER A 1 57  ? 6.846   6.394   5.345   1.00 0.00 ? 57  SER A H    1  
ATOM 876   H HA   . SER A 1 57  ? 9.594   7.177   4.851   1.00 0.00 ? 57  SER A HA   1  
ATOM 877   H HB2  . SER A 1 57  ? 7.568   7.995   6.617   1.00 0.00 ? 57  SER A HB2  1  
ATOM 878   H HB3  . SER A 1 57  ? 8.764   7.244   7.671   1.00 0.00 ? 57  SER A HB3  1  
ATOM 879   H HG   . SER A 1 57  ? 10.311  8.602   6.844   1.00 0.00 ? 57  SER A HG   1  
ATOM 880   N N    . ARG A 1 58  ? 9.049   4.550   6.815   1.00 0.00 ? 58  ARG A N    1  
ATOM 881   C CA   . ARG A 1 58  ? 9.679   3.442   7.534   1.00 0.00 ? 58  ARG A CA   1  
ATOM 882   C C    . ARG A 1 58  ? 8.848   2.166   7.364   1.00 0.00 ? 58  ARG A C    1  
ATOM 883   O O    . ARG A 1 58  ? 8.161   1.746   8.299   1.00 0.00 ? 58  ARG A O    1  
ATOM 884   C CB   . ARG A 1 58  ? 9.943   3.838   9.003   1.00 0.00 ? 58  ARG A CB   1  
ATOM 885   C CG   . ARG A 1 58  ? 8.735   4.444   9.739   1.00 0.00 ? 58  ARG A CG   1  
ATOM 886   C CD   . ARG A 1 58  ? 9.075   4.739   11.198  1.00 0.00 ? 58  ARG A CD   1  
ATOM 887   N NE   . ARG A 1 58  ? 7.882   5.240   11.907  1.00 0.00 ? 58  ARG A NE   1  
ATOM 888   C CZ   . ARG A 1 58  ? 7.271   4.674   12.956  1.00 0.00 ? 58  ARG A CZ   1  
ATOM 889   N NH1  . ARG A 1 58  ? 7.854   3.679   13.618  1.00 0.00 ? 58  ARG A NH1  1  
ATOM 890   N NH2  . ARG A 1 58  ? 6.065   5.104   13.316  1.00 0.00 ? 58  ARG A NH2  1  
ATOM 891   H H    . ARG A 1 58  ? 8.039   4.629   6.899   1.00 0.00 ? 58  ARG A H    1  
ATOM 892   H HA   . ARG A 1 58  ? 10.650  3.240   7.089   1.00 0.00 ? 58  ARG A HA   1  
ATOM 893   H HB2  . ARG A 1 58  ? 10.292  2.959   9.548   1.00 0.00 ? 58  ARG A HB2  1  
ATOM 894   H HB3  . ARG A 1 58  ? 10.745  4.576   9.024   1.00 0.00 ? 58  ARG A HB3  1  
ATOM 895   H HG2  . ARG A 1 58  ? 8.436   5.379   9.263   1.00 0.00 ? 58  ARG A HG2  1  
ATOM 896   H HG3  . ARG A 1 58  ? 7.892   3.756   9.722   1.00 0.00 ? 58  ARG A HG3  1  
ATOM 897   H HD2  . ARG A 1 58  ? 9.454   3.831   11.668  1.00 0.00 ? 58  ARG A HD2  1  
ATOM 898   H HD3  . ARG A 1 58  ? 9.858   5.494   11.231  1.00 0.00 ? 58  ARG A HD3  1  
ATOM 899   H HE   . ARG A 1 58  ? 7.472   6.076   11.493  1.00 0.00 ? 58  ARG A HE   1  
ATOM 900   H HH11 . ARG A 1 58  ? 8.814   3.437   13.426  1.00 0.00 ? 58  ARG A HH11 1  
ATOM 901   H HH12 . ARG A 1 58  ? 7.347   3.056   14.256  1.00 0.00 ? 58  ARG A HH12 1  
ATOM 902   H HH21 . ARG A 1 58  ? 5.608   5.831   12.758  1.00 0.00 ? 58  ARG A HH21 1  
ATOM 903   H HH22 . ARG A 1 58  ? 5.581   4.770   14.144  1.00 0.00 ? 58  ARG A HH22 1  
ATOM 904   N N    . PRO A 1 59  ? 8.846   1.554   6.170   1.00 0.00 ? 59  PRO A N    1  
ATOM 905   C CA   . PRO A 1 59  ? 8.060   0.355   5.913   1.00 0.00 ? 59  PRO A CA   1  
ATOM 906   C C    . PRO A 1 59  ? 8.550   -0.826  6.766   1.00 0.00 ? 59  PRO A C    1  
ATOM 907   O O    . PRO A 1 59  ? 9.592   -0.757  7.420   1.00 0.00 ? 59  PRO A O    1  
ATOM 908   C CB   . PRO A 1 59  ? 8.164   0.076   4.410   1.00 0.00 ? 59  PRO A CB   1  
ATOM 909   C CG   . PRO A 1 59  ? 9.213   1.042   3.864   1.00 0.00 ? 59  PRO A CG   1  
ATOM 910   C CD   . PRO A 1 59  ? 9.675   1.904   5.031   1.00 0.00 ? 59  PRO A CD   1  
ATOM 911   H HA   . PRO A 1 59  ? 7.014   0.567   6.138   1.00 0.00 ? 59  PRO A HA   1  
ATOM 912   H HB2  . PRO A 1 59  ? 8.454   -0.957  4.206   1.00 0.00 ? 59  PRO A HB2  1  
ATOM 913   H HB3  . PRO A 1 59  ? 7.207   0.297   3.942   1.00 0.00 ? 59  PRO A HB3  1  
ATOM 914   H HG2  . PRO A 1 59  ? 10.041  0.491   3.433   1.00 0.00 ? 59  PRO A HG2  1  
ATOM 915   H HG3  . PRO A 1 59  ? 8.781   1.693   3.109   1.00 0.00 ? 59  PRO A HG3  1  
ATOM 916   H HD2  . PRO A 1 59  ? 10.720  1.692   5.260   1.00 0.00 ? 59  PRO A HD2  1  
ATOM 917   H HD3  . PRO A 1 59  ? 9.552   2.954   4.763   1.00 0.00 ? 59  PRO A HD3  1  
ATOM 918   N N    . LYS A 1 60  ? 7.806   -1.937  6.754   1.00 0.00 ? 60  LYS A N    1  
ATOM 919   C CA   . LYS A 1 60  ? 8.288   -3.222  7.268   1.00 0.00 ? 60  LYS A CA   1  
ATOM 920   C C    . LYS A 1 60  ? 8.682   -4.102  6.069   1.00 0.00 ? 60  LYS A C    1  
ATOM 921   O O    . LYS A 1 60  ? 8.196   -3.842  4.960   1.00 0.00 ? 60  LYS A O    1  
ATOM 922   C CB   . LYS A 1 60  ? 7.207   -3.889  8.143   1.00 0.00 ? 60  LYS A CB   1  
ATOM 923   C CG   . LYS A 1 60  ? 6.904   -3.145  9.462   1.00 0.00 ? 60  LYS A CG   1  
ATOM 924   C CD   . LYS A 1 60  ? 6.355   -4.113  10.528  1.00 0.00 ? 60  LYS A CD   1  
ATOM 925   C CE   . LYS A 1 60  ? 5.765   -3.462  11.793  1.00 0.00 ? 60  LYS A CE   1  
ATOM 926   N NZ   . LYS A 1 60  ? 6.700   -2.582  12.526  1.00 0.00 ? 60  LYS A NZ   1  
ATOM 927   H H    . LYS A 1 60  ? 7.039   -1.985  6.098   1.00 0.00 ? 60  LYS A H    1  
ATOM 928   H HA   . LYS A 1 60  ? 9.182   -3.055  7.875   1.00 0.00 ? 60  LYS A HA   1  
ATOM 929   H HB2  . LYS A 1 60  ? 6.285   -4.000  7.572   1.00 0.00 ? 60  LYS A HB2  1  
ATOM 930   H HB3  . LYS A 1 60  ? 7.550   -4.888  8.393   1.00 0.00 ? 60  LYS A HB3  1  
ATOM 931   H HG2  . LYS A 1 60  ? 7.817   -2.695  9.846   1.00 0.00 ? 60  LYS A HG2  1  
ATOM 932   H HG3  . LYS A 1 60  ? 6.178   -2.356  9.274   1.00 0.00 ? 60  LYS A HG3  1  
ATOM 933   H HD2  . LYS A 1 60  ? 5.565   -4.713  10.075  1.00 0.00 ? 60  LYS A HD2  1  
ATOM 934   H HD3  . LYS A 1 60  ? 7.155   -4.792  10.827  1.00 0.00 ? 60  LYS A HD3  1  
ATOM 935   H HE2  . LYS A 1 60  ? 4.875   -2.887  11.529  1.00 0.00 ? 60  LYS A HE2  1  
ATOM 936   H HE3  . LYS A 1 60  ? 5.457   -4.262  12.471  1.00 0.00 ? 60  LYS A HE3  1  
ATOM 937   H HZ1  . LYS A 1 60  ? 6.439   -2.525  13.511  1.00 0.00 ? 60  LYS A HZ1  1  
ATOM 938   H HZ2  . LYS A 1 60  ? 7.659   -2.910  12.474  1.00 0.00 ? 60  LYS A HZ2  1  
ATOM 939   H HZ3  . LYS A 1 60  ? 6.652   -1.624  12.192  1.00 0.00 ? 60  LYS A HZ3  1  
ATOM 940   N N    . PRO A 1 61  ? 9.532   -5.129  6.249   1.00 0.00 ? 61  PRO A N    1  
ATOM 941   C CA   . PRO A 1 61  ? 9.887   -6.051  5.172   1.00 0.00 ? 61  PRO A CA   1  
ATOM 942   C C    . PRO A 1 61  ? 8.680   -6.908  4.779   1.00 0.00 ? 61  PRO A C    1  
ATOM 943   O O    . PRO A 1 61  ? 7.790   -7.142  5.603   1.00 0.00 ? 61  PRO A O    1  
ATOM 944   C CB   . PRO A 1 61  ? 11.022  -6.904  5.741   1.00 0.00 ? 61  PRO A CB   1  
ATOM 945   C CG   . PRO A 1 61  ? 10.739  -6.915  7.235   1.00 0.00 ? 61  PRO A CG   1  
ATOM 946   C CD   . PRO A 1 61  ? 10.227  -5.499  7.476   1.00 0.00 ? 61  PRO A CD   1  
ATOM 947   H HA   . PRO A 1 61  ? 10.247  -5.501  4.303   1.00 0.00 ? 61  PRO A HA   1  
ATOM 948   H HB2  . PRO A 1 61  ? 11.041  -7.912  5.328   1.00 0.00 ? 61  PRO A HB2  1  
ATOM 949   H HB3  . PRO A 1 61  ? 11.963  -6.391  5.567   1.00 0.00 ? 61  PRO A HB3  1  
ATOM 950   H HG2  . PRO A 1 61  ? 9.954   -7.638  7.433   1.00 0.00 ? 61  PRO A HG2  1  
ATOM 951   H HG3  . PRO A 1 61  ? 11.623  -7.134  7.828   1.00 0.00 ? 61  PRO A HG3  1  
ATOM 952   H HD2  . PRO A 1 61  ? 9.586   -5.480  8.355   1.00 0.00 ? 61  PRO A HD2  1  
ATOM 953   H HD3  . PRO A 1 61  ? 11.071  -4.825  7.616   1.00 0.00 ? 61  PRO A HD3  1  
ATOM 954   N N    . TRP A 1 62  ? 8.677   -7.467  3.565   1.00 0.00 ? 62  TRP A N    1  
ATOM 955   C CA   . TRP A 1 62  ? 7.569   -8.295  3.072   1.00 0.00 ? 62  TRP A CA   1  
ATOM 956   C C    . TRP A 1 62  ? 7.289   -9.482  3.999   1.00 0.00 ? 62  TRP A C    1  
ATOM 957   O O    . TRP A 1 62  ? 6.140   -9.842  4.255   1.00 0.00 ? 62  TRP A O    1  
ATOM 958   C CB   . TRP A 1 62  ? 7.902   -8.788  1.666   1.00 0.00 ? 62  TRP A CB   1  
ATOM 959   C CG   . TRP A 1 62  ? 6.761   -9.366  0.894   1.00 0.00 ? 62  TRP A CG   1  
ATOM 960   C CD1  . TRP A 1 62  ? 6.550   -10.673 0.623   1.00 0.00 ? 62  TRP A CD1  1  
ATOM 961   C CD2  . TRP A 1 62  ? 5.671   -8.654  0.247   1.00 0.00 ? 62  TRP A CD2  1  
ATOM 962   N NE1  . TRP A 1 62  ? 5.533   -10.796 -0.300  1.00 0.00 ? 62  TRP A NE1  1  
ATOM 963   C CE2  . TRP A 1 62  ? 4.944   -9.582  -0.552  1.00 0.00 ? 62  TRP A CE2  1  
ATOM 964   C CE3  . TRP A 1 62  ? 5.248   -7.311  0.226   1.00 0.00 ? 62  TRP A CE3  1  
ATOM 965   C CZ2  . TRP A 1 62  ? 3.903   -9.186  -1.395  1.00 0.00 ? 62  TRP A CZ2  1  
ATOM 966   C CZ3  . TRP A 1 62  ? 4.192   -6.907  -0.608  1.00 0.00 ? 62  TRP A CZ3  1  
ATOM 967   C CH2  . TRP A 1 62  ? 3.549   -7.834  -1.442  1.00 0.00 ? 62  TRP A CH2  1  
ATOM 968   H H    . TRP A 1 62  ? 9.450   -7.282  2.929   1.00 0.00 ? 62  TRP A H    1  
ATOM 969   H HA   . TRP A 1 62  ? 6.674   -7.677  3.023   1.00 0.00 ? 62  TRP A HA   1  
ATOM 970   H HB2  . TRP A 1 62  ? 8.275   -7.945  1.084   1.00 0.00 ? 62  TRP A HB2  1  
ATOM 971   H HB3  . TRP A 1 62  ? 8.708   -9.522  1.720   1.00 0.00 ? 62  TRP A HB3  1  
ATOM 972   H HD1  . TRP A 1 62  ? 7.131   -11.497 1.002   1.00 0.00 ? 62  TRP A HD1  1  
ATOM 973   H HE1  . TRP A 1 62  ? 5.295   -11.650 -0.794  1.00 0.00 ? 62  TRP A HE1  1  
ATOM 974   H HE3  . TRP A 1 62  ? 5.777   -6.575  0.807   1.00 0.00 ? 62  TRP A HE3  1  
ATOM 975   H HZ2  . TRP A 1 62  ? 3.419   -9.891  -2.048  1.00 0.00 ? 62  TRP A HZ2  1  
ATOM 976   H HZ3  . TRP A 1 62  ? 3.928   -5.865  -0.681  1.00 0.00 ? 62  TRP A HZ3  1  
ATOM 977   H HH2  . TRP A 1 62  ? 2.825   -7.500  -2.166  1.00 0.00 ? 62  TRP A HH2  1  
ATOM 978   N N    . SER A 1 63  ? 8.350   -10.044 4.571   1.00 0.00 ? 63  SER A N    1  
ATOM 979   C CA   . SER A 1 63  ? 8.337   -11.156 5.506   1.00 0.00 ? 63  SER A CA   1  
ATOM 980   C C    . SER A 1 63  ? 7.580   -10.856 6.815   1.00 0.00 ? 63  SER A C    1  
ATOM 981   O O    . SER A 1 63  ? 7.092   -11.770 7.488   1.00 0.00 ? 63  SER A O    1  
ATOM 982   C CB   . SER A 1 63  ? 9.808   -11.466 5.790   1.00 0.00 ? 63  SER A CB   1  
ATOM 983   O OG   . SER A 1 63  ? 10.514  -11.647 4.571   1.00 0.00 ? 63  SER A OG   1  
ATOM 984   H H    . SER A 1 63  ? 9.268   -9.749  4.263   1.00 0.00 ? 63  SER A H    1  
ATOM 985   H HA   . SER A 1 63  ? 7.868   -12.015 5.025   1.00 0.00 ? 63  SER A HA   1  
ATOM 986   H HB2  . SER A 1 63  ? 10.252  -10.629 6.332   1.00 0.00 ? 63  SER A HB2  1  
ATOM 987   H HB3  . SER A 1 63  ? 9.886   -12.351 6.407   1.00 0.00 ? 63  SER A HB3  1  
ATOM 988   H HG   . SER A 1 63  ? 10.421  -12.583 4.294   1.00 0.00 ? 63  SER A HG   1  
ATOM 989   N N    . LYS A 1 64  ? 7.487   -9.586  7.206   1.00 0.00 ? 64  LYS A N    1  
ATOM 990   C CA   . LYS A 1 64  ? 6.693   -9.165  8.361   1.00 0.00 ? 64  LYS A CA   1  
ATOM 991   C C    . LYS A 1 64  ? 5.223   -8.999  8.009   1.00 0.00 ? 64  LYS A C    1  
ATOM 992   O O    . LYS A 1 64  ? 4.372   -9.206  8.880   1.00 0.00 ? 64  LYS A O    1  
ATOM 993   C CB   . LYS A 1 64  ? 7.232   -7.835  8.917   1.00 0.00 ? 64  LYS A CB   1  
ATOM 994   C CG   . LYS A 1 64  ? 8.444   -8.032  9.825   1.00 0.00 ? 64  LYS A CG   1  
ATOM 995   C CD   . LYS A 1 64  ? 8.073   -8.797  11.100  1.00 0.00 ? 64  LYS A CD   1  
ATOM 996   C CE   . LYS A 1 64  ? 8.872   -10.100 11.175  1.00 0.00 ? 64  LYS A CE   1  
ATOM 997   N NZ   . LYS A 1 64  ? 8.305   -11.043 12.151  1.00 0.00 ? 64  LYS A NZ   1  
ATOM 998   H H    . LYS A 1 64  ? 7.895   -8.889  6.593   1.00 0.00 ? 64  LYS A H    1  
ATOM 999   H HA   . LYS A 1 64  ? 6.741   -9.940  9.123   1.00 0.00 ? 64  LYS A HA   1  
ATOM 1000  H HB2  . LYS A 1 64  ? 7.517   -7.179  8.097   1.00 0.00 ? 64  LYS A HB2  1  
ATOM 1001  H HB3  . LYS A 1 64  ? 6.449   -7.334  9.489   1.00 0.00 ? 64  LYS A HB3  1  
ATOM 1002  H HG2  . LYS A 1 64  ? 9.223   -8.563  9.278   1.00 0.00 ? 64  LYS A HG2  1  
ATOM 1003  H HG3  . LYS A 1 64  ? 8.831   -7.051  10.104  1.00 0.00 ? 64  LYS A HG3  1  
ATOM 1004  H HD2  . LYS A 1 64  ? 8.300   -8.168  11.955  1.00 0.00 ? 64  LYS A HD2  1  
ATOM 1005  H HD3  . LYS A 1 64  ? 7.004   -9.014  11.122  1.00 0.00 ? 64  LYS A HD3  1  
ATOM 1006  H HE2  . LYS A 1 64  ? 8.871   -10.577 10.195  1.00 0.00 ? 64  LYS A HE2  1  
ATOM 1007  H HE3  . LYS A 1 64  ? 9.907   -9.874  11.440  1.00 0.00 ? 64  LYS A HE3  1  
ATOM 1008  H HZ1  . LYS A 1 64  ? 7.424   -11.411 11.803  1.00 0.00 ? 64  LYS A HZ1  1  
ATOM 1009  H HZ2  . LYS A 1 64  ? 8.953   -11.818 12.269  1.00 0.00 ? 64  LYS A HZ2  1  
ATOM 1010  H HZ3  . LYS A 1 64  ? 8.171   -10.589 13.049  1.00 0.00 ? 64  LYS A HZ3  1  
ATOM 1011  N N    . LEU A 1 65  ? 4.935   -8.557  6.785   1.00 0.00 ? 65  LEU A N    1  
ATOM 1012  C CA   . LEU A 1 65  ? 3.600   -8.161  6.386   1.00 0.00 ? 65  LEU A CA   1  
ATOM 1013  C C    . LEU A 1 65  ? 2.768   -9.422  6.171   1.00 0.00 ? 65  LEU A C    1  
ATOM 1014  O O    . LEU A 1 65  ? 3.150   -10.261 5.357   1.00 0.00 ? 65  LEU A O    1  
ATOM 1015  C CB   . LEU A 1 65  ? 3.657   -7.311  5.108   1.00 0.00 ? 65  LEU A CB   1  
ATOM 1016  C CG   . LEU A 1 65  ? 4.427   -5.983  5.240   1.00 0.00 ? 65  LEU A CG   1  
ATOM 1017  C CD1  . LEU A 1 65  ? 4.579   -5.369  3.848   1.00 0.00 ? 65  LEU A CD1  1  
ATOM 1018  C CD2  . LEU A 1 65  ? 3.718   -4.995  6.172   1.00 0.00 ? 65  LEU A CD2  1  
ATOM 1019  H H    . LEU A 1 65  ? 5.676   -8.483  6.101   1.00 0.00 ? 65  LEU A H    1  
ATOM 1020  H HA   . LEU A 1 65  ? 3.165   -7.564  7.181   1.00 0.00 ? 65  LEU A HA   1  
ATOM 1021  H HB2  . LEU A 1 65  ? 4.119   -7.908  4.321   1.00 0.00 ? 65  LEU A HB2  1  
ATOM 1022  H HB3  . LEU A 1 65  ? 2.636   -7.077  4.811   1.00 0.00 ? 65  LEU A HB3  1  
ATOM 1023  H HG   . LEU A 1 65  ? 5.422   -6.169  5.635   1.00 0.00 ? 65  LEU A HG   1  
ATOM 1024  H HD11 . LEU A 1 65  ? 5.128   -4.428  3.913   1.00 0.00 ? 65  LEU A HD11 1  
ATOM 1025  H HD12 . LEU A 1 65  ? 5.134   -6.044  3.200   1.00 0.00 ? 65  LEU A HD12 1  
ATOM 1026  H HD13 . LEU A 1 65  ? 3.599   -5.189  3.410   1.00 0.00 ? 65  LEU A HD13 1  
ATOM 1027  H HD21 . LEU A 1 65  ? 3.699   -5.380  7.191   1.00 0.00 ? 65  LEU A HD21 1  
ATOM 1028  H HD22 . LEU A 1 65  ? 4.250   -4.044  6.176   1.00 0.00 ? 65  LEU A HD22 1  
ATOM 1029  H HD23 . LEU A 1 65  ? 2.698   -4.818  5.835   1.00 0.00 ? 65  LEU A HD23 1  
ATOM 1030  N N    . THR A 1 66  ? 1.638   -9.568  6.860   1.00 0.00 ? 66  THR A N    1  
ATOM 1031  C CA   . THR A 1 66  ? 0.665   -10.621 6.559   1.00 0.00 ? 66  THR A CA   1  
ATOM 1032  C C    . THR A 1 66  ? -0.154  -10.215 5.328   1.00 0.00 ? 66  THR A C    1  
ATOM 1033  O O    . THR A 1 66  ? -0.001  -9.098  4.836   1.00 0.00 ? 66  THR A O    1  
ATOM 1034  C CB   . THR A 1 66  ? -0.231  -10.892 7.778   1.00 0.00 ? 66  THR A CB   1  
ATOM 1035  O OG1  . THR A 1 66  ? -1.050  -9.788  8.127   1.00 0.00 ? 66  THR A OG1  1  
ATOM 1036  C CG2  . THR A 1 66  ? 0.592   -11.273 9.008   1.00 0.00 ? 66  THR A CG2  1  
ATOM 1037  H H    . THR A 1 66  ? 1.366   -8.852  7.526   1.00 0.00 ? 66  THR A H    1  
ATOM 1038  H HA   . THR A 1 66  ? 1.204   -11.540 6.322   1.00 0.00 ? 66  THR A HA   1  
ATOM 1039  H HB   . THR A 1 66  ? -0.884  -11.730 7.534   1.00 0.00 ? 66  THR A HB   1  
ATOM 1040  H HG1  . THR A 1 66  ? -1.725  -10.190 8.712   1.00 0.00 ? 66  THR A HG1  1  
ATOM 1041  H HG21 . THR A 1 66  ? 1.266   -12.090 8.749   1.00 0.00 ? 66  THR A HG21 1  
ATOM 1042  H HG22 . THR A 1 66  ? 1.174   -10.421 9.358   1.00 0.00 ? 66  THR A HG22 1  
ATOM 1043  H HG23 . THR A 1 66  ? -0.074  -11.607 9.802   1.00 0.00 ? 66  THR A HG23 1  
ATOM 1044  N N    . GLN A 1 67  ? -1.077  -11.049 4.836   1.00 0.00 ? 67  GLN A N    1  
ATOM 1045  C CA   . GLN A 1 67  ? -1.910  -10.703 3.683   1.00 0.00 ? 67  GLN A CA   1  
ATOM 1046  C C    . GLN A 1 67  ? -2.625  -9.356  3.861   1.00 0.00 ? 67  GLN A C    1  
ATOM 1047  O O    . GLN A 1 67  ? -2.591  -8.541  2.936   1.00 0.00 ? 67  GLN A O    1  
ATOM 1048  C CB   . GLN A 1 67  ? -2.907  -11.824 3.349   1.00 0.00 ? 67  GLN A CB   1  
ATOM 1049  C CG   . GLN A 1 67  ? -2.231  -13.055 2.731   1.00 0.00 ? 67  GLN A CG   1  
ATOM 1050  C CD   . GLN A 1 67  ? -1.875  -14.137 3.742   1.00 0.00 ? 67  GLN A CD   1  
ATOM 1051  O OE1  . GLN A 1 67  ? -1.700  -13.878 4.935   1.00 0.00 ? 67  GLN A OE1  1  
ATOM 1052  N NE2  . GLN A 1 67  ? -1.755  -15.369 3.291   1.00 0.00 ? 67  GLN A NE2  1  
ATOM 1053  H H    . GLN A 1 67  ? -1.187  -11.976 5.232   1.00 0.00 ? 67  GLN A H    1  
ATOM 1054  H HA   . GLN A 1 67  ? -1.251  -10.596 2.821   1.00 0.00 ? 67  GLN A HA   1  
ATOM 1055  H HB2  . GLN A 1 67  ? -3.493  -12.097 4.227   1.00 0.00 ? 67  GLN A HB2  1  
ATOM 1056  H HB3  . GLN A 1 67  ? -3.601  -11.454 2.601   1.00 0.00 ? 67  GLN A HB3  1  
ATOM 1057  H HG2  . GLN A 1 67  ? -2.925  -13.476 2.004   1.00 0.00 ? 67  GLN A HG2  1  
ATOM 1058  H HG3  . GLN A 1 67  ? -1.333  -12.760 2.189   1.00 0.00 ? 67  GLN A HG3  1  
ATOM 1059  H HE21 . GLN A 1 67  ? -1.876  -15.579 2.307   1.00 0.00 ? 67  GLN A HE21 1  
ATOM 1060  H HE22 . GLN A 1 67  ? -1.458  -16.116 3.903   1.00 0.00 ? 67  GLN A HE22 1  
ATOM 1061  N N    . LYS A 1 68  ? -3.218  -9.074  5.034   1.00 0.00 ? 68  LYS A N    1  
ATOM 1062  C CA   . LYS A 1 68  ? -3.897  -7.781  5.238   1.00 0.00 ? 68  LYS A CA   1  
ATOM 1063  C C    . LYS A 1 68  ? -2.894  -6.631  5.392   1.00 0.00 ? 68  LYS A C    1  
ATOM 1064  O O    . LYS A 1 68  ? -3.245  -5.479  5.156   1.00 0.00 ? 68  LYS A O    1  
ATOM 1065  C CB   . LYS A 1 68  ? -4.875  -7.832  6.430   1.00 0.00 ? 68  LYS A CB   1  
ATOM 1066  C CG   . LYS A 1 68  ? -6.053  -6.837  6.289   1.00 0.00 ? 68  LYS A CG   1  
ATOM 1067  C CD   . LYS A 1 68  ? -6.149  -5.783  7.406   1.00 0.00 ? 68  LYS A CD   1  
ATOM 1068  C CE   . LYS A 1 68  ? -6.599  -6.340  8.768   1.00 0.00 ? 68  LYS A CE   1  
ATOM 1069  N NZ   . LYS A 1 68  ? -8.040  -6.685  8.824   1.00 0.00 ? 68  LYS A NZ   1  
ATOM 1070  H H    . LYS A 1 68  ? -3.161  -9.748  5.788   1.00 0.00 ? 68  LYS A H    1  
ATOM 1071  H HA   . LYS A 1 68  ? -4.485  -7.586  4.336   1.00 0.00 ? 68  LYS A HA   1  
ATOM 1072  H HB2  . LYS A 1 68  ? -5.300  -8.830  6.484   1.00 0.00 ? 68  LYS A HB2  1  
ATOM 1073  H HB3  . LYS A 1 68  ? -4.327  -7.649  7.356   1.00 0.00 ? 68  LYS A HB3  1  
ATOM 1074  H HG2  . LYS A 1 68  ? -5.972  -6.304  5.341   1.00 0.00 ? 68  LYS A HG2  1  
ATOM 1075  H HG3  . LYS A 1 68  ? -6.986  -7.399  6.256   1.00 0.00 ? 68  LYS A HG3  1  
ATOM 1076  H HD2  . LYS A 1 68  ? -5.171  -5.313  7.521   1.00 0.00 ? 68  LYS A HD2  1  
ATOM 1077  H HD3  . LYS A 1 68  ? -6.847  -5.003  7.092   1.00 0.00 ? 68  LYS A HD3  1  
ATOM 1078  H HE2  . LYS A 1 68  ? -6.000  -7.215  9.027   1.00 0.00 ? 68  LYS A HE2  1  
ATOM 1079  H HE3  . LYS A 1 68  ? -6.409  -5.578  9.527   1.00 0.00 ? 68  LYS A HE3  1  
ATOM 1080  H HZ1  . LYS A 1 68  ? -8.299  -7.423  8.188   1.00 0.00 ? 68  LYS A HZ1  1  
ATOM 1081  H HZ2  . LYS A 1 68  ? -8.305  -6.973  9.762   1.00 0.00 ? 68  LYS A HZ2  1  
ATOM 1082  H HZ3  . LYS A 1 68  ? -8.627  -5.874  8.632   1.00 0.00 ? 68  LYS A HZ3  1  
ATOM 1083  N N    . GLY A 1 69  ? -1.643  -6.923  5.757   1.00 0.00 ? 69  GLY A N    1  
ATOM 1084  C CA   . GLY A 1 69  ? -0.578  -5.932  5.824   1.00 0.00 ? 69  GLY A CA   1  
ATOM 1085  C C    . GLY A 1 69  ? 0.048   -5.669  4.454   1.00 0.00 ? 69  GLY A C    1  
ATOM 1086  O O    . GLY A 1 69  ? 0.564   -4.578  4.225   1.00 0.00 ? 69  GLY A O    1  
ATOM 1087  H H    . GLY A 1 69  ? -1.385  -7.892  5.887   1.00 0.00 ? 69  GLY A H    1  
ATOM 1088  H HA2  . GLY A 1 69  ? -0.973  -4.996  6.224   1.00 0.00 ? 69  GLY A HA2  1  
ATOM 1089  H HA3  . GLY A 1 69  ? 0.200   -6.291  6.496   1.00 0.00 ? 69  GLY A HA3  1  
ATOM 1090  N N    . ARG A 1 70  ? 0.029   -6.648  3.543   1.00 0.00 ? 70  ARG A N    1  
ATOM 1091  C CA   . ARG A 1 70  ? 0.569   -6.532  2.190   1.00 0.00 ? 70  ARG A CA   1  
ATOM 1092  C C    . ARG A 1 70  ? -0.382  -5.781  1.273   1.00 0.00 ? 70  ARG A C    1  
ATOM 1093  O O    . ARG A 1 70  ? 0.093   -5.191  0.316   1.00 0.00 ? 70  ARG A O    1  
ATOM 1094  C CB   . ARG A 1 70  ? 0.839   -7.926  1.595   1.00 0.00 ? 70  ARG A CB   1  
ATOM 1095  C CG   . ARG A 1 70  ? 2.033   -8.619  2.259   1.00 0.00 ? 70  ARG A CG   1  
ATOM 1096  C CD   . ARG A 1 70  ? 2.100   -10.096 1.885   1.00 0.00 ? 70  ARG A CD   1  
ATOM 1097  N NE   . ARG A 1 70  ? 3.191   -10.757 2.626   1.00 0.00 ? 70  ARG A NE   1  
ATOM 1098  C CZ   . ARG A 1 70  ? 3.883   -11.846 2.279   1.00 0.00 ? 70  ARG A CZ   1  
ATOM 1099  N NH1  . ARG A 1 70  ? 3.479   -12.592 1.257   1.00 0.00 ? 70  ARG A NH1  1  
ATOM 1100  N NH2  . ARG A 1 70  ? 4.979   -12.154 2.969   1.00 0.00 ? 70  ARG A NH2  1  
ATOM 1101  H H    . ARG A 1 70  ? -0.333  -7.555  3.820   1.00 0.00 ? 70  ARG A H    1  
ATOM 1102  H HA   . ARG A 1 70  ? 1.507   -5.973  2.221   1.00 0.00 ? 70  ARG A HA   1  
ATOM 1103  H HB2  . ARG A 1 70  ? -0.057  -8.541  1.700   1.00 0.00 ? 70  ARG A HB2  1  
ATOM 1104  H HB3  . ARG A 1 70  ? 1.062   -7.824  0.532   1.00 0.00 ? 70  ARG A HB3  1  
ATOM 1105  H HG2  . ARG A 1 70  ? 2.955   -8.118  1.965   1.00 0.00 ? 70  ARG A HG2  1  
ATOM 1106  H HG3  . ARG A 1 70  ? 1.926   -8.558  3.335   1.00 0.00 ? 70  ARG A HG3  1  
ATOM 1107  H HD2  . ARG A 1 70  ? 1.136   -10.542 2.139   1.00 0.00 ? 70  ARG A HD2  1  
ATOM 1108  H HD3  . ARG A 1 70  ? 2.264   -10.184 0.812   1.00 0.00 ? 70  ARG A HD3  1  
ATOM 1109  H HE   . ARG A 1 70  ? 3.423   -10.330 3.522   1.00 0.00 ? 70  ARG A HE   1  
ATOM 1110  H HH11 . ARG A 1 70  ? 2.590   -12.373 0.812   1.00 0.00 ? 70  ARG A HH11 1  
ATOM 1111  H HH12 . ARG A 1 70  ? 3.935   -13.443 0.930   1.00 0.00 ? 70  ARG A HH12 1  
ATOM 1112  H HH21 . ARG A 1 70  ? 5.315   -11.475 3.651   1.00 0.00 ? 70  ARG A HH21 1  
ATOM 1113  H HH22 . ARG A 1 70  ? 5.612   -12.909 2.726   1.00 0.00 ? 70  ARG A HH22 1  
ATOM 1114  N N    . GLU A 1 71  ? -1.689  -5.770  1.543   1.00 0.00 ? 71  GLU A N    1  
ATOM 1115  C CA   . GLU A 1 71  ? -2.694  -5.096  0.724   1.00 0.00 ? 71  GLU A CA   1  
ATOM 1116  C C    . GLU A 1 71  ? -2.285  -3.697  0.226   1.00 0.00 ? 71  GLU A C    1  
ATOM 1117  O O    . GLU A 1 71  ? -2.356  -3.467  -0.982  1.00 0.00 ? 71  GLU A O    1  
ATOM 1118  C CB   . GLU A 1 71  ? -4.031  -5.045  1.474   1.00 0.00 ? 71  GLU A CB   1  
ATOM 1119  C CG   . GLU A 1 71  ? -4.820  -6.352  1.337   1.00 0.00 ? 71  GLU A CG   1  
ATOM 1120  C CD   . GLU A 1 71  ? -6.330  -6.136  1.419   1.00 0.00 ? 71  GLU A CD   1  
ATOM 1121  O OE1  . GLU A 1 71  ? -6.854  -5.407  0.546   1.00 0.00 ? 71  GLU A OE1  1  
ATOM 1122  O OE2  . GLU A 1 71  ? -6.975  -6.751  2.301   1.00 0.00 ? 71  GLU A OE2  1  
ATOM 1123  H H    . GLU A 1 71  ? -2.034  -6.287  2.336   1.00 0.00 ? 71  GLU A H    1  
ATOM 1124  H HA   . GLU A 1 71  ? -2.835  -5.694  -0.177  1.00 0.00 ? 71  GLU A HA   1  
ATOM 1125  H HB2  . GLU A 1 71  ? -3.874  -4.823  2.530   1.00 0.00 ? 71  GLU A HB2  1  
ATOM 1126  H HB3  . GLU A 1 71  ? -4.607  -4.230  1.054   1.00 0.00 ? 71  GLU A HB3  1  
ATOM 1127  H HG2  . GLU A 1 71  ? -4.604  -6.812  0.371   1.00 0.00 ? 71  GLU A HG2  1  
ATOM 1128  H HG3  . GLU A 1 71  ? -4.498  -7.035  2.121   1.00 0.00 ? 71  GLU A HG3  1  
ATOM 1129  N N    . PRO A 1 72  ? -1.856  -2.752  1.080   1.00 0.00 ? 72  PRO A N    1  
ATOM 1130  C CA   . PRO A 1 72  ? -1.458  -1.432  0.608   1.00 0.00 ? 72  PRO A CA   1  
ATOM 1131  C C    . PRO A 1 72  ? -0.184  -1.507  -0.241  1.00 0.00 ? 72  PRO A C    1  
ATOM 1132  O O    . PRO A 1 72  ? -0.094  -0.853  -1.275  1.00 0.00 ? 72  PRO A O    1  
ATOM 1133  C CB   . PRO A 1 72  ? -1.299  -0.574  1.865   1.00 0.00 ? 72  PRO A CB   1  
ATOM 1134  C CG   . PRO A 1 72  ? -1.024  -1.590  2.975   1.00 0.00 ? 72  PRO A CG   1  
ATOM 1135  C CD   . PRO A 1 72  ? -1.814  -2.815  2.530   1.00 0.00 ? 72  PRO A CD   1  
ATOM 1136  H HA   . PRO A 1 72  ? -2.254  -1.009  -0.007  1.00 0.00 ? 72  PRO A HA   1  
ATOM 1137  H HB2  . PRO A 1 72  ? -0.491  0.152   1.770   1.00 0.00 ? 72  PRO A HB2  1  
ATOM 1138  H HB3  . PRO A 1 72  ? -2.245  -0.068  2.062   1.00 0.00 ? 72  PRO A HB3  1  
ATOM 1139  H HG2  . PRO A 1 72  ? 0.038   -1.831  2.998   1.00 0.00 ? 72  PRO A HG2  1  
ATOM 1140  H HG3  . PRO A 1 72  ? -1.354  -1.241  3.952   1.00 0.00 ? 72  PRO A HG3  1  
ATOM 1141  H HD2  . PRO A 1 72  ? -1.324  -3.713  2.883   1.00 0.00 ? 72  PRO A HD2  1  
ATOM 1142  H HD3  . PRO A 1 72  ? -2.829  -2.789  2.918   1.00 0.00 ? 72  PRO A HD3  1  
ATOM 1143  N N    . PHE A 1 73  ? 0.795   -2.327  0.146   1.00 0.00 ? 73  PHE A N    1  
ATOM 1144  C CA   . PHE A 1 73  ? 2.029   -2.501  -0.619  1.00 0.00 ? 73  PHE A CA   1  
ATOM 1145  C C    . PHE A 1 73  ? 1.754   -3.072  -2.013  1.00 0.00 ? 73  PHE A C    1  
ATOM 1146  O O    . PHE A 1 73  ? 2.292   -2.559  -2.988  1.00 0.00 ? 73  PHE A O    1  
ATOM 1147  C CB   . PHE A 1 73  ? 3.007   -3.373  0.171   1.00 0.00 ? 73  PHE A CB   1  
ATOM 1148  C CG   . PHE A 1 73  ? 3.573   -2.660  1.387   1.00 0.00 ? 73  PHE A CG   1  
ATOM 1149  C CD1  . PHE A 1 73  ? 2.917   -2.718  2.630   1.00 0.00 ? 73  PHE A CD1  1  
ATOM 1150  C CD2  . PHE A 1 73  ? 4.735   -1.880  1.257   1.00 0.00 ? 73  PHE A CD2  1  
ATOM 1151  C CE1  . PHE A 1 73  ? 3.450   -2.047  3.746   1.00 0.00 ? 73  PHE A CE1  1  
ATOM 1152  C CE2  . PHE A 1 73  ? 5.272   -1.210  2.367   1.00 0.00 ? 73  PHE A CE2  1  
ATOM 1153  C CZ   . PHE A 1 73  ? 4.636   -1.305  3.618   1.00 0.00 ? 73  PHE A CZ   1  
ATOM 1154  H H    . PHE A 1 73  ? 0.626   -2.950  0.920   1.00 0.00 ? 73  PHE A H    1  
ATOM 1155  H HA   . PHE A 1 73  ? 2.489   -1.520  -0.748  1.00 0.00 ? 73  PHE A HA   1  
ATOM 1156  H HB2  . PHE A 1 73  ? 2.517   -4.310  0.457   1.00 0.00 ? 73  PHE A HB2  1  
ATOM 1157  H HB3  . PHE A 1 73  ? 3.839   -3.622  -0.490  1.00 0.00 ? 73  PHE A HB3  1  
ATOM 1158  H HD1  . PHE A 1 73  ? 2.008   -3.288  2.728   1.00 0.00 ? 73  PHE A HD1  1  
ATOM 1159  H HD2  . PHE A 1 73  ? 5.209   -1.781  0.295   1.00 0.00 ? 73  PHE A HD2  1  
ATOM 1160  H HE1  . PHE A 1 73  ? 2.944   -2.105  4.699   1.00 0.00 ? 73  PHE A HE1  1  
ATOM 1161  H HE2  . PHE A 1 73  ? 6.164   -0.621  2.233   1.00 0.00 ? 73  PHE A HE2  1  
ATOM 1162  H HZ   . PHE A 1 73  ? 5.039   -0.793  4.478   1.00 0.00 ? 73  PHE A HZ   1  
ATOM 1163  N N    . ILE A 1 74  ? 0.852   -4.045  -2.124  1.00 0.00 ? 74  ILE A N    1  
ATOM 1164  C CA   . ILE A 1 74  ? 0.376   -4.615  -3.373  1.00 0.00 ? 74  ILE A CA   1  
ATOM 1165  C C    . ILE A 1 74  ? -0.184  -3.498  -4.248  1.00 0.00 ? 74  ILE A C    1  
ATOM 1166  O O    . ILE A 1 74  ? 0.158   -3.409  -5.425  1.00 0.00 ? 74  ILE A O    1  
ATOM 1167  C CB   . ILE A 1 74  ? -0.668  -5.706  -3.022  1.00 0.00 ? 74  ILE A CB   1  
ATOM 1168  C CG1  . ILE A 1 74  ? 0.086   -6.987  -2.619  1.00 0.00 ? 74  ILE A CG1  1  
ATOM 1169  C CG2  . ILE A 1 74  ? -1.681  -5.946  -4.148  1.00 0.00 ? 74  ILE A CG2  1  
ATOM 1170  C CD1  . ILE A 1 74  ? -0.753  -7.989  -1.827  1.00 0.00 ? 74  ILE A CD1  1  
ATOM 1171  H H    . ILE A 1 74  ? 0.469   -4.417  -1.263  1.00 0.00 ? 74  ILE A H    1  
ATOM 1172  H HA   . ILE A 1 74  ? 1.231   -5.057  -3.904  1.00 0.00 ? 74  ILE A HA   1  
ATOM 1173  H HB   . ILE A 1 74  ? -1.240  -5.373  -2.159  1.00 0.00 ? 74  ILE A HB   1  
ATOM 1174  H HG12 . ILE A 1 74  ? 0.498   -7.465  -3.507  1.00 0.00 ? 74  ILE A HG12 1  
ATOM 1175  H HG13 . ILE A 1 74  ? 0.906   -6.700  -1.965  1.00 0.00 ? 74  ILE A HG13 1  
ATOM 1176  H HG21 . ILE A 1 74  ? -1.147  -6.134  -5.077  1.00 0.00 ? 74  ILE A HG21 1  
ATOM 1177  H HG22 . ILE A 1 74  ? -2.331  -6.783  -3.907  1.00 0.00 ? 74  ILE A HG22 1  
ATOM 1178  H HG23 . ILE A 1 74  ? -2.324  -5.068  -4.274  1.00 0.00 ? 74  ILE A HG23 1  
ATOM 1179  H HD11 . ILE A 1 74  ? -1.057  -7.529  -0.888  1.00 0.00 ? 74  ILE A HD11 1  
ATOM 1180  H HD12 . ILE A 1 74  ? -1.630  -8.289  -2.396  1.00 0.00 ? 74  ILE A HD12 1  
ATOM 1181  H HD13 . ILE A 1 74  ? -0.151  -8.874  -1.616  1.00 0.00 ? 74  ILE A HD13 1  
ATOM 1182  N N    . ARG A 1 75  ? -1.081  -2.657  -3.723  1.00 0.00 ? 75  ARG A N    1  
ATOM 1183  C CA   . ARG A 1 75  ? -1.656  -1.572  -4.488  1.00 0.00 ? 75  ARG A CA   1  
ATOM 1184  C C    . ARG A 1 75  ? -0.580  -0.581  -4.922  1.00 0.00 ? 75  ARG A C    1  
ATOM 1185  O O    . ARG A 1 75  ? -0.646  -0.078  -6.039  1.00 0.00 ? 75  ARG A O    1  
ATOM 1186  C CB   . ARG A 1 75  ? -2.762  -0.941  -3.645  1.00 0.00 ? 75  ARG A CB   1  
ATOM 1187  C CG   . ARG A 1 75  ? -3.968  -1.886  -3.544  1.00 0.00 ? 75  ARG A CG   1  
ATOM 1188  C CD   . ARG A 1 75  ? -5.149  -1.187  -2.863  1.00 0.00 ? 75  ARG A CD   1  
ATOM 1189  N NE   . ARG A 1 75  ? -6.387  -1.954  -3.048  1.00 0.00 ? 75  ARG A NE   1  
ATOM 1190  C CZ   . ARG A 1 75  ? -6.794  -3.009  -2.335  1.00 0.00 ? 75  ARG A CZ   1  
ATOM 1191  N NH1  . ARG A 1 75  ? -6.105  -3.435  -1.279  1.00 0.00 ? 75  ARG A NH1  1  
ATOM 1192  N NH2  . ARG A 1 75  ? -7.881  -3.658  -2.714  1.00 0.00 ? 75  ARG A NH2  1  
ATOM 1193  H H    . ARG A 1 75  ? -1.400  -2.735  -2.766  1.00 0.00 ? 75  ARG A H    1  
ATOM 1194  H HA   . ARG A 1 75  ? -2.096  -1.978  -5.401  1.00 0.00 ? 75  ARG A HA   1  
ATOM 1195  H HB2  . ARG A 1 75  ? -2.393  -0.697  -2.648  1.00 0.00 ? 75  ARG A HB2  1  
ATOM 1196  H HB3  . ARG A 1 75  ? -3.063  -0.029  -4.135  1.00 0.00 ? 75  ARG A HB3  1  
ATOM 1197  H HG2  . ARG A 1 75  ? -4.249  -2.219  -4.546  1.00 0.00 ? 75  ARG A HG2  1  
ATOM 1198  H HG3  . ARG A 1 75  ? -3.706  -2.777  -2.977  1.00 0.00 ? 75  ARG A HG3  1  
ATOM 1199  H HD2  . ARG A 1 75  ? -4.938  -1.047  -1.802  1.00 0.00 ? 75  ARG A HD2  1  
ATOM 1200  H HD3  . ARG A 1 75  ? -5.287  -0.204  -3.310  1.00 0.00 ? 75  ARG A HD3  1  
ATOM 1201  H HE   . ARG A 1 75  ? -6.940  -1.663  -3.855  1.00 0.00 ? 75  ARG A HE   1  
ATOM 1202  H HH11 . ARG A 1 75  ? -5.271  -2.958  -0.985  1.00 0.00 ? 75  ARG A HH11 1  
ATOM 1203  H HH12 . ARG A 1 75  ? -6.431  -4.220  -0.698  1.00 0.00 ? 75  ARG A HH12 1  
ATOM 1204  H HH21 . ARG A 1 75  ? -8.350  -3.450  -3.589  1.00 0.00 ? 75  ARG A HH21 1  
ATOM 1205  H HH22 . ARG A 1 75  ? -8.105  -4.559  -2.295  1.00 0.00 ? 75  ARG A HH22 1  
ATOM 1206  N N    . MET A 1 76  ? 0.435   -0.350  -4.088  1.00 0.00 ? 76  MET A N    1  
ATOM 1207  C CA   . MET A 1 76  ? 1.634   0.400   -4.434  1.00 0.00 ? 76  MET A CA   1  
ATOM 1208  C C    . MET A 1 76  ? 2.346   -0.225  -5.648  1.00 0.00 ? 76  MET A C    1  
ATOM 1209  O O    . MET A 1 76  ? 2.660   0.485   -6.602  1.00 0.00 ? 76  MET A O    1  
ATOM 1210  C CB   . MET A 1 76  ? 2.554   0.450   -3.195  1.00 0.00 ? 76  MET A CB   1  
ATOM 1211  C CG   . MET A 1 76  ? 2.792   1.861   -2.691  1.00 0.00 ? 76  MET A CG   1  
ATOM 1212  S SD   . MET A 1 76  ? 4.082   2.002   -1.425  1.00 0.00 ? 76  MET A SD   1  
ATOM 1213  C CE   . MET A 1 76  ? 3.158   1.659   0.097   1.00 0.00 ? 76  MET A CE   1  
ATOM 1214  H H    . MET A 1 76  ? 0.397   -0.775  -3.167  1.00 0.00 ? 76  MET A H    1  
ATOM 1215  H HA   . MET A 1 76  ? 1.322   1.410   -4.709  1.00 0.00 ? 76  MET A HA   1  
ATOM 1216  H HB2  . MET A 1 76  ? 2.123   -0.107  -2.371  1.00 0.00 ? 76  MET A HB2  1  
ATOM 1217  H HB3  . MET A 1 76  ? 3.519   0.010   -3.439  1.00 0.00 ? 76  MET A HB3  1  
ATOM 1218  H HG2  . MET A 1 76  ? 3.103   2.433   -3.554  1.00 0.00 ? 76  MET A HG2  1  
ATOM 1219  H HG3  . MET A 1 76  ? 1.864   2.277   -2.309  1.00 0.00 ? 76  MET A HG3  1  
ATOM 1220  H HE1  . MET A 1 76  ? 2.370   2.401   0.222   1.00 0.00 ? 76  MET A HE1  1  
ATOM 1221  H HE2  . MET A 1 76  ? 2.719   0.663   0.046   1.00 0.00 ? 76  MET A HE2  1  
ATOM 1222  H HE3  . MET A 1 76  ? 3.836   1.727   0.952   1.00 0.00 ? 76  MET A HE3  1  
ATOM 1223  N N    . GLN A 1 77  ? 2.605   -1.537  -5.613  1.00 0.00 ? 77  GLN A N    1  
ATOM 1224  C CA   . GLN A 1 77  ? 3.303   -2.294  -6.655  1.00 0.00 ? 77  GLN A CA   1  
ATOM 1225  C C    . GLN A 1 77  ? 2.552   -2.229  -7.974  1.00 0.00 ? 77  GLN A C    1  
ATOM 1226  O O    . GLN A 1 77  ? 3.162   -2.089  -9.034  1.00 0.00 ? 77  GLN A O    1  
ATOM 1227  C CB   . GLN A 1 77  ? 3.413   -3.772  -6.245  1.00 0.00 ? 77  GLN A CB   1  
ATOM 1228  C CG   . GLN A 1 77  ? 4.402   -3.991  -5.104  1.00 0.00 ? 77  GLN A CG   1  
ATOM 1229  C CD   . GLN A 1 77  ? 4.180   -5.290  -4.349  1.00 0.00 ? 77  GLN A CD   1  
ATOM 1230  O OE1  . GLN A 1 77  ? 3.845   -5.269  -3.172  1.00 0.00 ? 77  GLN A OE1  1  
ATOM 1231  N NE2  . GLN A 1 77  ? 4.392   -6.423  -4.994  1.00 0.00 ? 77  GLN A NE2  1  
ATOM 1232  H H    . GLN A 1 77  ? 2.315   -2.053  -4.787  1.00 0.00 ? 77  GLN A H    1  
ATOM 1233  H HA   . GLN A 1 77  ? 4.297   -1.870  -6.811  1.00 0.00 ? 77  GLN A HA   1  
ATOM 1234  H HB2  . GLN A 1 77  ? 2.438   -4.147  -5.949  1.00 0.00 ? 77  GLN A HB2  1  
ATOM 1235  H HB3  . GLN A 1 77  ? 3.738   -4.351  -7.105  1.00 0.00 ? 77  GLN A HB3  1  
ATOM 1236  H HG2  . GLN A 1 77  ? 5.412   -3.986  -5.504  1.00 0.00 ? 77  GLN A HG2  1  
ATOM 1237  H HG3  . GLN A 1 77  ? 4.304   -3.175  -4.397  1.00 0.00 ? 77  GLN A HG3  1  
ATOM 1238  H HE21 . GLN A 1 77  ? 4.581   -6.392  -5.985  1.00 0.00 ? 77  GLN A HE21 1  
ATOM 1239  H HE22 . GLN A 1 77  ? 4.418   -7.311  -4.506  1.00 0.00 ? 77  GLN A HE22 1  
ATOM 1240  N N    . LEU A 1 78  ? 1.232   -2.372  -7.912  1.00 0.00 ? 78  LEU A N    1  
ATOM 1241  C CA   . LEU A 1 78  ? 0.383   -2.294  -9.080  1.00 0.00 ? 78  LEU A CA   1  
ATOM 1242  C C    . LEU A 1 78  ? 0.452   -0.896  -9.628  1.00 0.00 ? 78  LEU A C    1  
ATOM 1243  O O    . LEU A 1 78  ? 0.832   -0.739  -10.779 1.00 0.00 ? 78  LEU A O    1  
ATOM 1244  C CB   . LEU A 1 78  ? -1.058  -2.695  -8.722  1.00 0.00 ? 78  LEU A CB   1  
ATOM 1245  C CG   . LEU A 1 78  ? -1.194  -4.194  -8.403  1.00 0.00 ? 78  LEU A CG   1  
ATOM 1246  C CD1  . LEU A 1 78  ? -2.451  -4.466  -7.577  1.00 0.00 ? 78  LEU A CD1  1  
ATOM 1247  C CD2  . LEU A 1 78  ? -1.248  -5.017  -9.688  1.00 0.00 ? 78  LEU A CD2  1  
ATOM 1248  H H    . LEU A 1 78  ? 0.809   -2.550  -7.006  1.00 0.00 ? 78  LEU A H    1  
ATOM 1249  H HA   . LEU A 1 78  ? 0.811   -2.912  -9.869  1.00 0.00 ? 78  LEU A HA   1  
ATOM 1250  H HB2  . LEU A 1 78  ? -1.375  -2.111  -7.857  1.00 0.00 ? 78  LEU A HB2  1  
ATOM 1251  H HB3  . LEU A 1 78  ? -1.722  -2.440  -9.550  1.00 0.00 ? 78  LEU A HB3  1  
ATOM 1252  H HG   . LEU A 1 78  ? -0.339  -4.527  -7.816  1.00 0.00 ? 78  LEU A HG   1  
ATOM 1253  H HD11 . LEU A 1 78  ? -2.541  -5.535  -7.401  1.00 0.00 ? 78  LEU A HD11 1  
ATOM 1254  H HD12 . LEU A 1 78  ? -2.383  -3.940  -6.625  1.00 0.00 ? 78  LEU A HD12 1  
ATOM 1255  H HD13 . LEU A 1 78  ? -3.328  -4.123  -8.123  1.00 0.00 ? 78  LEU A HD13 1  
ATOM 1256  H HD21 . LEU A 1 78  ? -1.287  -6.075  -9.441  1.00 0.00 ? 78  LEU A HD21 1  
ATOM 1257  H HD22 . LEU A 1 78  ? -2.137  -4.755  -10.263 1.00 0.00 ? 78  LEU A HD22 1  
ATOM 1258  H HD23 . LEU A 1 78  ? -0.363  -4.836  -10.297 1.00 0.00 ? 78  LEU A HD23 1  
ATOM 1259  N N    . TRP A 1 79  ? 0.155   0.113   -8.816  1.00 0.00 ? 79  TRP A N    1  
ATOM 1260  C CA   . TRP A 1 79  ? 0.065   1.495   -9.247  1.00 0.00 ? 79  TRP A CA   1  
ATOM 1261  C C    . TRP A 1 79  ? 1.283   1.962   -10.042 1.00 0.00 ? 79  TRP A C    1  
ATOM 1262  O O    . TRP A 1 79  ? 1.125   2.759   -10.965 1.00 0.00 ? 79  TRP A O    1  
ATOM 1263  C CB   . TRP A 1 79  ? -0.152  2.362   -8.003  1.00 0.00 ? 79  TRP A CB   1  
ATOM 1264  C CG   . TRP A 1 79  ? -0.186  3.829   -8.249  1.00 0.00 ? 79  TRP A CG   1  
ATOM 1265  C CD1  . TRP A 1 79  ? -1.284  4.575   -8.496  1.00 0.00 ? 79  TRP A CD1  1  
ATOM 1266  C CD2  . TRP A 1 79  ? 0.953   4.736   -8.294  1.00 0.00 ? 79  TRP A CD2  1  
ATOM 1267  N NE1  . TRP A 1 79  ? -0.899  5.891   -8.653  1.00 0.00 ? 79  TRP A NE1  1  
ATOM 1268  C CE2  . TRP A 1 79  ? 0.474   6.036   -8.613  1.00 0.00 ? 79  TRP A CE2  1  
ATOM 1269  C CE3  . TRP A 1 79  ? 2.342   4.578   -8.107  1.00 0.00 ? 79  TRP A CE3  1  
ATOM 1270  C CZ2  . TRP A 1 79  ? 1.339   7.125   -8.796  1.00 0.00 ? 79  TRP A CZ2  1  
ATOM 1271  C CZ3  . TRP A 1 79  ? 3.216   5.667   -8.261  1.00 0.00 ? 79  TRP A CZ3  1  
ATOM 1272  C CH2  . TRP A 1 79  ? 2.721   6.933   -8.623  1.00 0.00 ? 79  TRP A CH2  1  
ATOM 1273  H H    . TRP A 1 79  ? -0.099  -0.087  -7.853  1.00 0.00 ? 79  TRP A H    1  
ATOM 1274  H HA   . TRP A 1 79  ? -0.788  1.568   -9.917  1.00 0.00 ? 79  TRP A HA   1  
ATOM 1275  H HB2  . TRP A 1 79  ? -1.072  2.067   -7.505  1.00 0.00 ? 79  TRP A HB2  1  
ATOM 1276  H HB3  . TRP A 1 79  ? 0.659   2.168   -7.302  1.00 0.00 ? 79  TRP A HB3  1  
ATOM 1277  H HD1  . TRP A 1 79  ? -2.304  4.198   -8.528  1.00 0.00 ? 79  TRP A HD1  1  
ATOM 1278  H HE1  . TRP A 1 79  ? -1.557  6.657   -8.767  1.00 0.00 ? 79  TRP A HE1  1  
ATOM 1279  H HE3  . TRP A 1 79  ? 2.740   3.604   -7.856  1.00 0.00 ? 79  TRP A HE3  1  
ATOM 1280  H HZ2  . TRP A 1 79  ? 0.952   8.097   -9.061  1.00 0.00 ? 79  TRP A HZ2  1  
ATOM 1281  H HZ3  . TRP A 1 79  ? 4.272   5.516   -8.106  1.00 0.00 ? 79  TRP A HZ3  1  
ATOM 1282  H HH2  . TRP A 1 79  ? 3.397   7.766   -8.750  1.00 0.00 ? 79  TRP A HH2  1  
ATOM 1283  N N    . LEU A 1 80  ? 2.466   1.433   -9.732  1.00 0.00 ? 80  LEU A N    1  
ATOM 1284  C CA   . LEU A 1 80  ? 3.704   1.724   -10.440 1.00 0.00 ? 80  LEU A CA   1  
ATOM 1285  C C    . LEU A 1 80  ? 3.553   1.491   -11.941 1.00 0.00 ? 80  LEU A C    1  
ATOM 1286  O O    . LEU A 1 80  ? 3.877   2.376   -12.737 1.00 0.00 ? 80  LEU A O    1  
ATOM 1287  C CB   . LEU A 1 80  ? 4.833   0.857   -9.850  1.00 0.00 ? 80  LEU A CB   1  
ATOM 1288  C CG   . LEU A 1 80  ? 5.719   1.691   -8.909  1.00 0.00 ? 80  LEU A CG   1  
ATOM 1289  C CD1  . LEU A 1 80  ? 6.427   0.792   -7.905  1.00 0.00 ? 80  LEU A CD1  1  
ATOM 1290  C CD2  . LEU A 1 80  ? 6.762   2.536   -9.647  1.00 0.00 ? 80  LEU A CD2  1  
ATOM 1291  H H    . LEU A 1 80  ? 2.471   0.706   -9.028  1.00 0.00 ? 80  LEU A H    1  
ATOM 1292  H HA   . LEU A 1 80  ? 3.937   2.780   -10.303 1.00 0.00 ? 80  LEU A HA   1  
ATOM 1293  H HB2  . LEU A 1 80  ? 4.396   0.035   -9.283  1.00 0.00 ? 80  LEU A HB2  1  
ATOM 1294  H HB3  . LEU A 1 80  ? 5.420   0.401   -10.652 1.00 0.00 ? 80  LEU A HB3  1  
ATOM 1295  H HG   . LEU A 1 80  ? 5.077   2.357   -8.333  1.00 0.00 ? 80  LEU A HG   1  
ATOM 1296  H HD11 . LEU A 1 80  ? 7.064   0.072   -8.421  1.00 0.00 ? 80  LEU A HD11 1  
ATOM 1297  H HD12 . LEU A 1 80  ? 7.028   1.412   -7.245  1.00 0.00 ? 80  LEU A HD12 1  
ATOM 1298  H HD13 . LEU A 1 80  ? 5.679   0.265   -7.315  1.00 0.00 ? 80  LEU A HD13 1  
ATOM 1299  H HD21 . LEU A 1 80  ? 6.300   3.056   -10.484 1.00 0.00 ? 80  LEU A HD21 1  
ATOM 1300  H HD22 . LEU A 1 80  ? 7.195   3.268   -8.964  1.00 0.00 ? 80  LEU A HD22 1  
ATOM 1301  H HD23 . LEU A 1 80  ? 7.567   1.899   -10.024 1.00 0.00 ? 80  LEU A HD23 1  
ATOM 1302  N N    . SER A 1 81  ? 3.085   0.303   -12.319 1.00 0.00 ? 81  SER A N    1  
ATOM 1303  C CA   . SER A 1 81  ? 2.943   -0.117  -13.702 1.00 0.00 ? 81  SER A CA   1  
ATOM 1304  C C    . SER A 1 81  ? 1.509   0.131   -14.186 1.00 0.00 ? 81  SER A C    1  
ATOM 1305  O O    . SER A 1 81  ? 1.284   0.780   -15.220 1.00 0.00 ? 81  SER A O    1  
ATOM 1306  C CB   . SER A 1 81  ? 3.296   -1.605  -13.727 1.00 0.00 ? 81  SER A CB   1  
ATOM 1307  O OG   . SER A 1 81  ? 4.676   -1.828  -13.936 1.00 0.00 ? 81  SER A OG   1  
ATOM 1308  H H    . SER A 1 81  ? 2.745   -0.354  -11.621 1.00 0.00 ? 81  SER A H    1  
ATOM 1309  H HA   . SER A 1 81  ? 3.628   0.430   -14.345 1.00 0.00 ? 81  SER A HA   1  
ATOM 1310  H HB2  . SER A 1 81  ? 3.042   -2.033  -12.758 1.00 0.00 ? 81  SER A HB2  1  
ATOM 1311  H HB3  . SER A 1 81  ? 2.718   -2.094  -14.509 1.00 0.00 ? 81  SER A HB3  1  
ATOM 1312  H HG   . SER A 1 81  ? 4.736   -2.731  -14.291 1.00 0.00 ? 81  SER A HG   1  
ATOM 1313  N N    . ASP A 1 82  ? 0.537   -0.392  -13.448 1.00 0.00 ? 82  ASP A N    1  
ATOM 1314  C CA   . ASP A 1 82  ? -0.900  -0.445  -13.722 1.00 0.00 ? 82  ASP A CA   1  
ATOM 1315  C C    . ASP A 1 82  ? -1.494  0.952   -13.838 1.00 0.00 ? 82  ASP A C    1  
ATOM 1316  O O    . ASP A 1 82  ? -2.362  1.179   -14.679 1.00 0.00 ? 82  ASP A O    1  
ATOM 1317  C CB   . ASP A 1 82  ? -1.617  -1.180  -12.575 1.00 0.00 ? 82  ASP A CB   1  
ATOM 1318  C CG   . ASP A 1 82  ? -3.026  -1.648  -12.941 1.00 0.00 ? 82  ASP A CG   1  
ATOM 1319  O OD1  . ASP A 1 82  ? -3.153  -2.451  -13.894 1.00 0.00 ? 82  ASP A OD1  1  
ATOM 1320  O OD2  . ASP A 1 82  ? -3.989  -1.287  -12.228 1.00 0.00 ? 82  ASP A OD2  1  
ATOM 1321  H H    . ASP A 1 82  ? 0.811   -0.834  -12.572 1.00 0.00 ? 82  ASP A H    1  
ATOM 1322  H HA   . ASP A 1 82  ? -1.066  -1.000  -14.648 1.00 0.00 ? 82  ASP A HA   1  
ATOM 1323  H HB2  . ASP A 1 82  ? -1.033  -2.047  -12.272 1.00 0.00 ? 82  ASP A HB2  1  
ATOM 1324  H HB3  . ASP A 1 82  ? -1.678  -0.524  -11.706 1.00 0.00 ? 82  ASP A HB3  1  
ATOM 1325  N N    . GLN A 1 83  ? -0.992  1.892   -13.030 1.00 0.00 ? 83  GLN A N    1  
ATOM 1326  C CA   . GLN A 1 83  ? -1.493  3.247   -12.808 1.00 0.00 ? 83  GLN A CA   1  
ATOM 1327  C C    . GLN A 1 83  ? -2.927  3.331   -12.268 1.00 0.00 ? 83  GLN A C    1  
ATOM 1328  O O    . GLN A 1 83  ? -3.364  4.441   -11.949 1.00 0.00 ? 83  GLN A O    1  
ATOM 1329  C CB   . GLN A 1 83  ? -1.312  4.116   -14.057 1.00 0.00 ? 83  GLN A CB   1  
ATOM 1330  C CG   . GLN A 1 83  ? 0.148   4.247   -14.495 1.00 0.00 ? 83  GLN A CG   1  
ATOM 1331  C CD   . GLN A 1 83  ? 0.231   5.240   -15.642 1.00 0.00 ? 83  GLN A CD   1  
ATOM 1332  O OE1  . GLN A 1 83  ? 0.325   6.446   -15.422 1.00 0.00 ? 83  GLN A OE1  1  
ATOM 1333  N NE2  . GLN A 1 83  ? 0.177   4.781   -16.878 1.00 0.00 ? 83  GLN A NE2  1  
ATOM 1334  H H    . GLN A 1 83  ? -0.199  1.627   -12.458 1.00 0.00 ? 83  GLN A H    1  
ATOM 1335  H HA   . GLN A 1 83  ? -0.869  3.685   -12.034 1.00 0.00 ? 83  GLN A HA   1  
ATOM 1336  H HB2  . GLN A 1 83  ? -1.896  3.707   -14.880 1.00 0.00 ? 83  GLN A HB2  1  
ATOM 1337  H HB3  . GLN A 1 83  ? -1.686  5.118   -13.845 1.00 0.00 ? 83  GLN A HB3  1  
ATOM 1338  H HG2  . GLN A 1 83  ? 0.753   4.612   -13.665 1.00 0.00 ? 83  GLN A HG2  1  
ATOM 1339  H HG3  . GLN A 1 83  ? 0.540   3.283   -14.814 1.00 0.00 ? 83  GLN A HG3  1  
ATOM 1340  H HE21 . GLN A 1 83  ? 0.061   3.792   -17.039 1.00 0.00 ? 83  GLN A HE21 1  
ATOM 1341  H HE22 . GLN A 1 83  ? 0.058   5.405   -17.676 1.00 0.00 ? 83  GLN A HE22 1  
ATOM 1342  N N    . LEU A 1 84  ? -3.623  2.199   -12.113 1.00 0.00 ? 84  LEU A N    1  
ATOM 1343  C CA   . LEU A 1 84  ? -5.034  2.052   -11.768 1.00 0.00 ? 84  LEU A CA   1  
ATOM 1344  C C    . LEU A 1 84  ? -5.903  3.085   -12.471 1.00 0.00 ? 84  LEU A C    1  
ATOM 1345  O O    . LEU A 1 84  ? -6.420  4.021   -11.846 1.00 0.00 ? 84  LEU A O    1  
ATOM 1346  C CB   . LEU A 1 84  ? -5.266  2.096   -10.262 1.00 0.00 ? 84  LEU A CB   1  
ATOM 1347  C CG   . LEU A 1 84  ? -4.612  0.937   -9.494  1.00 0.00 ? 84  LEU A CG   1  
ATOM 1348  C CD1  . LEU A 1 84  ? -3.387  1.423   -8.724  1.00 0.00 ? 84  LEU A CD1  1  
ATOM 1349  C CD2  . LEU A 1 84  ? -5.598  0.366   -8.492  1.00 0.00 ? 84  LEU A CD2  1  
ATOM 1350  H H    . LEU A 1 84  ? -3.186  1.339   -12.401 1.00 0.00 ? 84  LEU A H    1  
ATOM 1351  H HA   . LEU A 1 84  ? -5.357  1.065   -12.105 1.00 0.00 ? 84  LEU A HA   1  
ATOM 1352  H HB2  . LEU A 1 84  ? -4.922  3.054   -9.870  1.00 0.00 ? 84  LEU A HB2  1  
ATOM 1353  H HB3  . LEU A 1 84  ? -6.350  2.054   -10.157 1.00 0.00 ? 84  LEU A HB3  1  
ATOM 1354  H HG   . LEU A 1 84  ? -4.305  0.148   -10.175 1.00 0.00 ? 84  LEU A HG   1  
ATOM 1355  H HD11 . LEU A 1 84  ? -2.764  2.012   -9.390  1.00 0.00 ? 84  LEU A HD11 1  
ATOM 1356  H HD12 . LEU A 1 84  ? -3.688  2.039   -7.880  1.00 0.00 ? 84  LEU A HD12 1  
ATOM 1357  H HD13 . LEU A 1 84  ? -2.832  0.563   -8.344  1.00 0.00 ? 84  LEU A HD13 1  
ATOM 1358  H HD21 . LEU A 1 84  ? -6.381  -0.167  -9.031  1.00 0.00 ? 84  LEU A HD21 1  
ATOM 1359  H HD22 . LEU A 1 84  ? -5.081  -0.322  -7.826  1.00 0.00 ? 84  LEU A HD22 1  
ATOM 1360  H HD23 . LEU A 1 84  ? -6.031  1.178   -7.917  1.00 0.00 ? 84  LEU A HD23 1  
ATOM 1361  N N    . GLY A 1 85  ? -6.060  2.927   -13.778 1.00 0.00 ? 85  GLY A N    1  
ATOM 1362  C CA   . GLY A 1 85  ? -6.756  3.893   -14.596 1.00 0.00 ? 85  GLY A CA   1  
ATOM 1363  C C    . GLY A 1 85  ? -8.260  3.680   -14.562 1.00 0.00 ? 85  GLY A C    1  
ATOM 1364  O O    . GLY A 1 85  ? -8.870  3.421   -15.601 1.00 0.00 ? 85  GLY A O    1  
ATOM 1365  H H    . GLY A 1 85  ? -5.676  2.101   -14.226 1.00 0.00 ? 85  GLY A H    1  
ATOM 1366  H HA2  . GLY A 1 85  ? -6.544  4.878   -14.188 1.00 0.00 ? 85  GLY A HA2  1  
ATOM 1367  H HA3  . GLY A 1 85  ? -6.393  3.833   -15.619 1.00 0.00 ? 85  GLY A HA3  1  
ATOM 1368  N N    . GLN A 1 86  ? -8.858  3.784   -13.371 1.00 0.00 ? 86  GLN A N    1  
ATOM 1369  C CA   . GLN A 1 86  ? -10.274 4.036   -13.203 1.00 0.00 ? 86  GLN A CA   1  
ATOM 1370  C C    . GLN A 1 86  ? -10.554 5.435   -13.749 1.00 0.00 ? 86  GLN A C    1  
ATOM 1371  O O    . GLN A 1 86  ? -11.111 5.601   -14.830 1.00 0.00 ? 86  GLN A O    1  
ATOM 1372  C CB   . GLN A 1 86  ? -10.651 3.971   -11.709 1.00 0.00 ? 86  GLN A CB   1  
ATOM 1373  C CG   . GLN A 1 86  ? -11.009 2.572   -11.208 1.00 0.00 ? 86  GLN A CG   1  
ATOM 1374  C CD   . GLN A 1 86  ? -11.479 2.567   -9.748  1.00 0.00 ? 86  GLN A CD   1  
ATOM 1375  O OE1  . GLN A 1 86  ? -11.529 3.596   -9.063  1.00 0.00 ? 86  GLN A OE1  1  
ATOM 1376  N NE2  . GLN A 1 86  ? -11.869 1.417   -9.230  1.00 0.00 ? 86  GLN A NE2  1  
ATOM 1377  H H    . GLN A 1 86  ? -8.275  3.979   -12.569 1.00 0.00 ? 86  GLN A H    1  
ATOM 1378  H HA   . GLN A 1 86  ? -10.859 3.317   -13.774 1.00 0.00 ? 86  GLN A HA   1  
ATOM 1379  H HB2  . GLN A 1 86  ? -9.840  4.383   -11.105 1.00 0.00 ? 86  GLN A HB2  1  
ATOM 1380  H HB3  . GLN A 1 86  ? -11.522 4.600   -11.560 1.00 0.00 ? 86  GLN A HB3  1  
ATOM 1381  H HG2  . GLN A 1 86  ? -11.824 2.201   -11.830 1.00 0.00 ? 86  GLN A HG2  1  
ATOM 1382  H HG3  . GLN A 1 86  ? -10.142 1.921   -11.321 1.00 0.00 ? 86  GLN A HG3  1  
ATOM 1383  H HE21 . GLN A 1 86  ? -11.861 0.592   -9.833  1.00 0.00 ? 86  GLN A HE21 1  
ATOM 1384  H HE22 . GLN A 1 86  ? -12.248 1.344   -8.300  1.00 0.00 ? 86  GLN A HE22 1  
ATOM 1385  N N    . ALA A 1 87  ? -10.175 6.450   -12.975 1.00 0.00 ? 87  ALA A N    1  
ATOM 1386  C CA   . ALA A 1 87  ? -10.711 7.786   -13.059 1.00 0.00 ? 87  ALA A CA   1  
ATOM 1387  C C    . ALA A 1 87  ? -9.700  8.727   -12.422 1.00 0.00 ? 87  ALA A C    1  
ATOM 1388  O O    . ALA A 1 87  ? -9.196  8.437   -11.331 1.00 0.00 ? 87  ALA A O    1  
ATOM 1389  C CB   . ALA A 1 87  ? -12.023 7.825   -12.269 1.00 0.00 ? 87  ALA A CB   1  
ATOM 1390  H H    . ALA A 1 87  ? -9.617  6.285   -12.153 1.00 0.00 ? 87  ALA A H    1  
ATOM 1391  H HA   . ALA A 1 87  ? -10.894 8.053   -14.098 1.00 0.00 ? 87  ALA A HA   1  
ATOM 1392  H HB1  . ALA A 1 87  ? -12.441 8.830   -12.305 1.00 0.00 ? 87  ALA A HB1  1  
ATOM 1393  H HB2  . ALA A 1 87  ? -12.729 7.116   -12.703 1.00 0.00 ? 87  ALA A HB2  1  
ATOM 1394  H HB3  . ALA A 1 87  ? -11.843 7.546   -11.229 1.00 0.00 ? 87  ALA A HB3  1  
ATOM 1395  N N    . VAL A 1 88  ? -9.441  9.850   -13.079 1.00 0.00 ? 88  VAL A N    1  
ATOM 1396  C CA   . VAL A 1 88  ? -8.689  10.975  -12.543 1.00 0.00 ? 88  VAL A CA   1  
ATOM 1397  C C    . VAL A 1 88  ? -9.488  12.232  -12.896 1.00 0.00 ? 88  VAL A C    1  
ATOM 1398  O O    . VAL A 1 88  ? -10.160 12.266  -13.929 1.00 0.00 ? 88  VAL A O    1  
ATOM 1399  C CB   . VAL A 1 88  ? -7.261  10.985  -13.143 1.00 0.00 ? 88  VAL A CB   1  
ATOM 1400  C CG1  . VAL A 1 88  ? -6.421  12.161  -12.618 1.00 0.00 ? 88  VAL A CG1  1  
ATOM 1401  C CG2  . VAL A 1 88  ? -6.497  9.688   -12.827 1.00 0.00 ? 88  VAL A CG2  1  
ATOM 1402  H H    . VAL A 1 88  ? -9.880  10.007  -13.981 1.00 0.00 ? 88  VAL A H    1  
ATOM 1403  H HA   . VAL A 1 88  ? -8.625  10.885  -11.458 1.00 0.00 ? 88  VAL A HA   1  
ATOM 1404  H HB   . VAL A 1 88  ? -7.332  11.079  -14.227 1.00 0.00 ? 88  VAL A HB   1  
ATOM 1405  H HG11 . VAL A 1 88  ? -6.376  12.139  -11.528 1.00 0.00 ? 88  VAL A HG11 1  
ATOM 1406  H HG12 . VAL A 1 88  ? -5.411  12.104  -13.021 1.00 0.00 ? 88  VAL A HG12 1  
ATOM 1407  H HG13 . VAL A 1 88  ? -6.855  13.106  -12.944 1.00 0.00 ? 88  VAL A HG13 1  
ATOM 1408  H HG21 . VAL A 1 88  ? -5.471  9.752   -13.191 1.00 0.00 ? 88  VAL A HG21 1  
ATOM 1409  H HG22 . VAL A 1 88  ? -6.496  9.511   -11.751 1.00 0.00 ? 88  VAL A HG22 1  
ATOM 1410  H HG23 . VAL A 1 88  ? -6.968  8.839   -13.324 1.00 0.00 ? 88  VAL A HG23 1  
ATOM 1411  N N    . GLY A 1 89  ? -9.411  13.270  -12.065 1.00 0.00 ? 89  GLY A N    1  
ATOM 1412  C CA   . GLY A 1 89  ? -9.938  14.584  -12.397 1.00 0.00 ? 89  GLY A CA   1  
ATOM 1413  C C    . GLY A 1 89  ? -10.639 15.291  -11.247 1.00 0.00 ? 89  GLY A C    1  
ATOM 1414  O O    . GLY A 1 89  ? -11.435 16.185  -11.528 1.00 0.00 ? 89  GLY A O    1  
ATOM 1415  H H    . GLY A 1 89  ? -8.929  13.143  -11.181 1.00 0.00 ? 89  GLY A H    1  
ATOM 1416  H HA2  . GLY A 1 89  ? -9.111  15.208  -12.731 1.00 0.00 ? 89  GLY A HA2  1  
ATOM 1417  H HA3  . GLY A 1 89  ? -10.649 14.506  -13.220 1.00 0.00 ? 89  GLY A HA3  1  
ATOM 1418  N N    . GLN A 1 90  ? -10.397 14.936  -9.982  1.00 0.00 ? 90  GLN A N    1  
ATOM 1419  C CA   . GLN A 1 90  ? -11.076 15.573  -8.863  1.00 0.00 ? 90  GLN A CA   1  
ATOM 1420  C C    . GLN A 1 90  ? -10.142 15.748  -7.669  1.00 0.00 ? 90  GLN A C    1  
ATOM 1421  O O    . GLN A 1 90  ? -9.836  14.786  -6.962  1.00 0.00 ? 90  GLN A O    1  
ATOM 1422  C CB   . GLN A 1 90  ? -12.328 14.765  -8.504  1.00 0.00 ? 90  GLN A CB   1  
ATOM 1423  C CG   . GLN A 1 90  ? -13.288 15.591  -7.636  1.00 0.00 ? 90  GLN A CG   1  
ATOM 1424  C CD   . GLN A 1 90  ? -13.709 14.857  -6.373  1.00 0.00 ? 90  GLN A CD   1  
ATOM 1425  O OE1  . GLN A 1 90  ? -14.309 13.781  -6.439  1.00 0.00 ? 90  GLN A OE1  1  
ATOM 1426  N NE2  . GLN A 1 90  ? -13.381 15.384  -5.208  1.00 0.00 ? 90  GLN A NE2  1  
ATOM 1427  H H    . GLN A 1 90  ? -9.753  14.181  -9.768  1.00 0.00 ? 90  GLN A H    1  
ATOM 1428  H HA   . GLN A 1 90  ? -11.409 16.562  -9.175  1.00 0.00 ? 90  GLN A HA   1  
ATOM 1429  H HB2  . GLN A 1 90  ? -12.848 14.501  -9.425  1.00 0.00 ? 90  GLN A HB2  1  
ATOM 1430  H HB3  . GLN A 1 90  ? -12.041 13.840  -8.002  1.00 0.00 ? 90  GLN A HB3  1  
ATOM 1431  H HG2  . GLN A 1 90  ? -12.847 16.553  -7.372  1.00 0.00 ? 90  GLN A HG2  1  
ATOM 1432  H HG3  . GLN A 1 90  ? -14.185 15.793  -8.217  1.00 0.00 ? 90  GLN A HG3  1  
ATOM 1433  H HE21 . GLN A 1 90  ? -12.866 16.260  -5.179  1.00 0.00 ? 90  GLN A HE21 1  
ATOM 1434  H HE22 . GLN A 1 90  ? -13.813 15.034  -4.362  1.00 0.00 ? 90  GLN A HE22 1  
ATOM 1435  N N    . GLN A 1 91  ? -9.717  16.987  -7.419  1.00 0.00 ? 91  GLN A N    1  
ATOM 1436  C CA   . GLN A 1 91  ? -9.086  17.372  -6.162  1.00 0.00 ? 91  GLN A CA   1  
ATOM 1437  C C    . GLN A 1 91  ? -10.112 17.421  -5.019  1.00 0.00 ? 91  GLN A C    1  
ATOM 1438  O O    . GLN A 1 91  ? -11.301 17.654  -5.283  1.00 0.00 ? 91  GLN A O    1  
ATOM 1439  C CB   . GLN A 1 91  ? -8.444  18.762  -6.302  1.00 0.00 ? 91  GLN A CB   1  
ATOM 1440  C CG   . GLN A 1 91  ? -7.043  18.676  -6.906  1.00 0.00 ? 91  GLN A CG   1  
ATOM 1441  C CD   . GLN A 1 91  ? -6.315  20.017  -6.920  1.00 0.00 ? 91  GLN A CD   1  
ATOM 1442  O OE1  . GLN A 1 91  ? -6.820  21.054  -6.485  1.00 0.00 ? 91  GLN A OE1  1  
ATOM 1443  N NE2  . GLN A 1 91  ? -5.082  20.019  -7.397  1.00 0.00 ? 91  GLN A NE2  1  
ATOM 1444  H H    . GLN A 1 91  ? -9.987  17.718  -8.070  1.00 0.00 ? 91  GLN A H    1  
ATOM 1445  H HA   . GLN A 1 91  ? -8.324  16.633  -5.918  1.00 0.00 ? 91  GLN A HA   1  
ATOM 1446  H HB2  . GLN A 1 91  ? -9.073  19.413  -6.910  1.00 0.00 ? 91  GLN A HB2  1  
ATOM 1447  H HB3  . GLN A 1 91  ? -8.351  19.206  -5.312  1.00 0.00 ? 91  GLN A HB3  1  
ATOM 1448  H HG2  . GLN A 1 91  ? -6.456  17.986  -6.303  1.00 0.00 ? 91  GLN A HG2  1  
ATOM 1449  H HG3  . GLN A 1 91  ? -7.111  18.291  -7.924  1.00 0.00 ? 91  GLN A HG3  1  
ATOM 1450  H HE21 . GLN A 1 91  ? -4.681  19.135  -7.700  1.00 0.00 ? 91  GLN A HE21 1  
ATOM 1451  H HE22 . GLN A 1 91  ? -4.607  20.898  -7.588  1.00 0.00 ? 91  GLN A HE22 1  
ATOM 1452  N N    . PRO A 1 92  ? -9.662  17.322  -3.754  1.00 0.00 ? 92  PRO A N    1  
ATOM 1453  C CA   . PRO A 1 92  ? -10.470 17.615  -2.579  1.00 0.00 ? 92  PRO A CA   1  
ATOM 1454  C C    . PRO A 1 92  ? -10.673 19.131  -2.418  1.00 0.00 ? 92  PRO A C    1  
ATOM 1455  O O    . PRO A 1 92  ? -9.942  19.804  -1.681  1.00 0.00 ? 92  PRO A O    1  
ATOM 1456  C CB   . PRO A 1 92  ? -9.718  16.989  -1.401  1.00 0.00 ? 92  PRO A CB   1  
ATOM 1457  C CG   . PRO A 1 92  ? -8.253  17.041  -1.839  1.00 0.00 ? 92  PRO A CG   1  
ATOM 1458  C CD   . PRO A 1 92  ? -8.324  16.896  -3.357  1.00 0.00 ? 92  PRO A CD   1  
ATOM 1459  H HA   . PRO A 1 92  ? -11.443 17.130  -2.671  1.00 0.00 ? 92  PRO A HA   1  
ATOM 1460  H HB2  . PRO A 1 92  ? -9.887  17.523  -0.466  1.00 0.00 ? 92  PRO A HB2  1  
ATOM 1461  H HB3  . PRO A 1 92  ? -10.031 15.955  -1.282  1.00 0.00 ? 92  PRO A HB3  1  
ATOM 1462  H HG2  . PRO A 1 92  ? -7.826  18.012  -1.590  1.00 0.00 ? 92  PRO A HG2  1  
ATOM 1463  H HG3  . PRO A 1 92  ? -7.666  16.240  -1.388  1.00 0.00 ? 92  PRO A HG3  1  
ATOM 1464  H HD2  . PRO A 1 92  ? -7.552  17.510  -3.821  1.00 0.00 ? 92  PRO A HD2  1  
ATOM 1465  H HD3  . PRO A 1 92  ? -8.182  15.850  -3.633  1.00 0.00 ? 92  PRO A HD3  1  
ATOM 1466  N N    . GLY A 1 93  ? -11.690 19.673  -3.091  1.00 0.00 ? 93  GLY A N    1  
ATOM 1467  C CA   . GLY A 1 93  ? -12.249 20.976  -2.760  1.00 0.00 ? 93  GLY A CA   1  
ATOM 1468  C C    . GLY A 1 93  ? -12.672 20.948  -1.293  1.00 0.00 ? 93  GLY A C    1  
ATOM 1469  O O    . GLY A 1 93  ? -13.399 20.032  -0.893  1.00 0.00 ? 93  GLY A O    1  
ATOM 1470  H H    . GLY A 1 93  ? -12.258 19.062  -3.664  1.00 0.00 ? 93  GLY A H    1  
ATOM 1471  H HA2  . GLY A 1 93  ? -11.501 21.750  -2.931  1.00 0.00 ? 93  GLY A HA2  1  
ATOM 1472  H HA3  . GLY A 1 93  ? -13.120 21.178  -3.384  1.00 0.00 ? 93  GLY A HA3  1  
ATOM 1473  N N    . ALA A 1 94  ? -12.181 21.917  -0.523  1.00 0.00 ? 94  ALA A N    1  
ATOM 1474  C CA   . ALA A 1 94  ? -12.149 22.085  0.930   1.00 0.00 ? 94  ALA A CA   1  
ATOM 1475  C C    . ALA A 1 94  ? -10.789 22.677  1.301   1.00 0.00 ? 94  ALA A C    1  
ATOM 1476  O O    . ALA A 1 94  ? -9.830  22.563  0.530   1.00 0.00 ? 94  ALA A O    1  
ATOM 1477  C CB   . ALA A 1 94  ? -12.360 20.778  1.705   1.00 0.00 ? 94  ALA A CB   1  
ATOM 1478  H H    . ALA A 1 94  ? -11.663 22.641  -1.008  1.00 0.00 ? 94  ALA A H    1  
ATOM 1479  H HA   . ALA A 1 94  ? -12.929 22.794  1.211   1.00 0.00 ? 94  ALA A HA   1  
ATOM 1480  H HB1  . ALA A 1 94  ? -11.640 20.028  1.379   1.00 0.00 ? 94  ALA A HB1  1  
ATOM 1481  H HB2  . ALA A 1 94  ? -12.229 20.956  2.772   1.00 0.00 ? 94  ALA A HB2  1  
ATOM 1482  H HB3  . ALA A 1 94  ? -13.371 20.410  1.550   1.00 0.00 ? 94  ALA A HB3  1  
ATOM 1483  N N    . SER A 1 95  ? -10.698 23.276  2.489   1.00 0.00 ? 95  SER A N    1  
ATOM 1484  C CA   . SER A 1 95  ? -9.495  23.703  3.205   1.00 0.00 ? 95  SER A CA   1  
ATOM 1485  C C    . SER A 1 95  ? -9.919  24.189  4.603   1.00 0.00 ? 95  SER A C    1  
ATOM 1486  O O    . SER A 1 95  ? -11.110 24.299  4.895   1.00 0.00 ? 95  SER A O    1  
ATOM 1487  C CB   . SER A 1 95  ? -8.793  24.844  2.452   1.00 0.00 ? 95  SER A CB   1  
ATOM 1488  O OG   . SER A 1 95  ? -8.096  24.345  1.329   1.00 0.00 ? 95  SER A OG   1  
ATOM 1489  H H    . SER A 1 95  ? -11.537 23.366  3.051   1.00 0.00 ? 95  SER A H    1  
ATOM 1490  H HA   . SER A 1 95  ? -8.808  22.861  3.318   1.00 0.00 ? 95  SER A HA   1  
ATOM 1491  H HB2  . SER A 1 95  ? -9.534  25.579  2.138   1.00 0.00 ? 95  SER A HB2  1  
ATOM 1492  H HB3  . SER A 1 95  ? -8.073  25.331  3.110   1.00 0.00 ? 95  SER A HB3  1  
ATOM 1493  H HG   . SER A 1 95  ? -8.707  23.731  0.874   1.00 0.00 ? 95  SER A HG   1  
ATOM 1494  N N    . SER A 1 96  ? -8.947  24.502  5.458   1.00 0.00 ? 96  SER A N    1  
ATOM 1495  C CA   . SER A 1 96  ? -9.110  25.272  6.683   1.00 0.00 ? 96  SER A CA   1  
ATOM 1496  C C    . SER A 1 96  ? -7.783  25.958  6.999   1.00 0.00 ? 96  SER A C    1  
ATOM 1497  O O    . SER A 1 96  ? -6.710  25.436  6.668   1.00 0.00 ? 96  SER A O    1  
ATOM 1498  C CB   . SER A 1 96  ? -9.510  24.348  7.844   1.00 0.00 ? 96  SER A CB   1  
ATOM 1499  O OG   . SER A 1 96  ? -10.914 24.337  8.013   1.00 0.00 ? 96  SER A OG   1  
ATOM 1500  H H    . SER A 1 96  ? -7.985  24.393  5.168   1.00 0.00 ? 96  SER A H    1  
ATOM 1501  H HA   . SER A 1 96  ? -9.868  26.042  6.534   1.00 0.00 ? 96  SER A HA   1  
ATOM 1502  H HB2  . SER A 1 96  ? -9.145  23.335  7.668   1.00 0.00 ? 96  SER A HB2  1  
ATOM 1503  H HB3  . SER A 1 96  ? -9.068  24.715  8.772   1.00 0.00 ? 96  SER A HB3  1  
ATOM 1504  H HG   . SER A 1 96  ? -11.096 25.118  8.587   1.00 0.00 ? 96  SER A HG   1  
ATOM 1505  N N    . GLY A 1 97  ? -7.856  27.088  7.695   1.00 0.00 ? 97  GLY A N    1  
ATOM 1506  C CA   . GLY A 1 97  ? -6.750  27.703  8.406   1.00 0.00 ? 97  GLY A CA   1  
ATOM 1507  C C    . GLY A 1 97  ? -7.107  27.748  9.894   1.00 0.00 ? 97  GLY A C    1  
ATOM 1508  O O    . GLY A 1 97  ? -8.283  27.571  10.238  1.00 0.00 ? 97  GLY A O    1  
ATOM 1509  H H    . GLY A 1 97  ? -8.765  27.449  7.953   1.00 0.00 ? 97  GLY A H    1  
ATOM 1510  H HA2  . GLY A 1 97  ? -5.835  27.130  8.258   1.00 0.00 ? 97  GLY A HA2  1  
ATOM 1511  H HA3  . GLY A 1 97  ? -6.605  28.721  8.041   1.00 0.00 ? 97  GLY A HA3  1  
ATOM 1512  N N    . PRO A 1 98  ? -6.118  27.972  10.774  1.00 0.00 ? 98  PRO A N    1  
ATOM 1513  C CA   . PRO A 1 98  ? -6.362  28.125  12.199  1.00 0.00 ? 98  PRO A CA   1  
ATOM 1514  C C    . PRO A 1 98  ? -7.092  29.446  12.466  1.00 0.00 ? 98  PRO A C    1  
ATOM 1515  O O    . PRO A 1 98  ? -7.042  30.370  11.654  1.00 0.00 ? 98  PRO A O    1  
ATOM 1516  C CB   . PRO A 1 98  ? -4.972  28.101  12.843  1.00 0.00 ? 98  PRO A CB   1  
ATOM 1517  C CG   . PRO A 1 98  ? -4.084  28.712  11.759  1.00 0.00 ? 98  PRO A CG   1  
ATOM 1518  C CD   . PRO A 1 98  ? -4.711  28.188  10.467  1.00 0.00 ? 98  PRO A CD   1  
ATOM 1519  H HA   . PRO A 1 98  ? -6.959  27.292  12.574  1.00 0.00 ? 98  PRO A HA   1  
ATOM 1520  H HB2  . PRO A 1 98  ? -4.930  28.672  13.771  1.00 0.00 ? 98  PRO A HB2  1  
ATOM 1521  H HB3  . PRO A 1 98  ? -4.670  27.067  13.018  1.00 0.00 ? 98  PRO A HB3  1  
ATOM 1522  H HG2  . PRO A 1 98  ? -4.161  29.801  11.791  1.00 0.00 ? 98  PRO A HG2  1  
ATOM 1523  H HG3  . PRO A 1 98  ? -3.047  28.399  11.859  1.00 0.00 ? 98  PRO A HG3  1  
ATOM 1524  H HD2  . PRO A 1 98  ? -4.587  28.919  9.666   1.00 0.00 ? 98  PRO A HD2  1  
ATOM 1525  H HD3  . PRO A 1 98  ? -4.253  27.237  10.191  1.00 0.00 ? 98  PRO A HD3  1  
ATOM 1526  N N    . SER A 1 99  ? -7.726  29.537  13.628  1.00 0.00 ? 99  SER A N    1  
ATOM 1527  C CA   . SER A 1 99  ? -8.344  30.734  14.166  1.00 0.00 ? 99  SER A CA   1  
ATOM 1528  C C    . SER A 1 99  ? -8.278  30.589  15.688  1.00 0.00 ? 99  SER A C    1  
ATOM 1529  O O    . SER A 1 99  ? -8.206  29.470  16.214  1.00 0.00 ? 99  SER A O    1  
ATOM 1530  C CB   . SER A 1 99  ? -9.777  30.841  13.613  1.00 0.00 ? 99  SER A CB   1  
ATOM 1531  O OG   . SER A 1 99  ? -10.590 31.810  14.247  1.00 0.00 ? 99  SER A OG   1  
ATOM 1532  H H    . SER A 1 99  ? -7.691  28.780  14.298  1.00 0.00 ? 99  SER A H    1  
ATOM 1533  H HA   . SER A 1 99  ? -7.775  31.614  13.860  1.00 0.00 ? 99  SER A HA   1  
ATOM 1534  H HB2  . SER A 1 99  ? -9.719  31.079  12.550  1.00 0.00 ? 99  SER A HB2  1  
ATOM 1535  H HB3  . SER A 1 99  ? -10.269 29.874  13.720  1.00 0.00 ? 99  SER A HB3  1  
ATOM 1536  H HG   . SER A 1 99  ? -10.108 32.673  14.327  1.00 0.00 ? 99  SER A HG   1  
ATOM 1537  N N    . SER A 1 100 ? -8.318  31.731  16.363  1.00 0.00 ? 100 SER A N    1  
ATOM 1538  C CA   . SER A 1 100 ? -8.315  31.916  17.808  1.00 0.00 ? 100 SER A CA   1  
ATOM 1539  C C    . SER A 1 100 ? -9.385  32.950  18.198  1.00 0.00 ? 100 SER A C    1  
ATOM 1540  O O    . SER A 1 100 ? -9.331  33.521  19.289  1.00 0.00 ? 100 SER A O    1  
ATOM 1541  C CB   . SER A 1 100 ? -6.922  32.393  18.239  1.00 0.00 ? 100 SER A CB   1  
ATOM 1542  O OG   . SER A 1 100 ? -5.898  31.517  17.799  1.00 0.00 ? 100 SER A OG   1  
ATOM 1543  H H    . SER A 1 100 ? -8.430  32.592  15.827  1.00 0.00 ? 100 SER A H    1  
ATOM 1544  H HA   . SER A 1 100 ? -8.541  30.970  18.299  1.00 0.00 ? 100 SER A HA   1  
ATOM 1545  H HB2  . SER A 1 100 ? -6.743  33.383  17.819  1.00 0.00 ? 100 SER A HB2  1  
ATOM 1546  H HB3  . SER A 1 100 ? -6.888  32.465  19.326  1.00 0.00 ? 100 SER A HB3  1  
ATOM 1547  H HG   . SER A 1 100 ? -5.051  31.932  17.969  1.00 0.00 ? 100 SER A HG   1  
ATOM 1548  N N    . GLY A 1 101 ? -10.310 33.254  17.281  1.00 0.00 ? 101 GLY A N    1  
ATOM 1549  C CA   . GLY A 1 101 ? -10.599 34.628  16.914  1.00 0.00 ? 101 GLY A CA   1  
ATOM 1550  C C    . GLY A 1 101 ? -9.812  34.935  15.641  1.00 0.00 ? 101 GLY A C    1  
ATOM 1551  O O    . GLY A 1 101 ? -9.361  33.955  14.991  1.00 0.00 ? 101 GLY A O    1  
ATOM 1552  H H    . GLY A 1 101 ? -10.269 32.709  16.427  1.00 0.00 ? 101 GLY A H    1  
ATOM 1553  H HA2  . GLY A 1 101 ? -11.662 34.753  16.714  1.00 0.00 ? 101 GLY A HA2  1  
ATOM 1554  H HA3  . GLY A 1 101 ? -10.290 35.313  17.707  1.00 0.00 ? 101 GLY A HA3  1  
ATOM 1555  N N    . GLY A 1 1   ? 15.799  -22.444 -13.789 1.00 0.00 ? 1   GLY A N    2  
ATOM 1556  C CA   . GLY A 1 1   ? 14.996  -21.357 -13.223 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1557  C C    . GLY A 1 1   ? 14.588  -20.399 -14.321 1.00 0.00 ? 1   GLY A C    2  
ATOM 1558  O O    . GLY A 1 1   ? 15.448  -19.770 -14.935 1.00 0.00 ? 1   GLY A O    2  
ATOM 1559  H H1   . GLY A 1 1   ? 16.606  -22.151 -14.303 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1560  H HA2  . GLY A 1 1   ? 14.114  -21.773 -12.740 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1561  H HA3  . GLY A 1 1   ? 15.592  -20.818 -12.487 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1562  N N    . SER A 1 2   ? 13.291  -20.305 -14.597 1.00 0.00 ? 2   SER A N    2  
ATOM 1563  C CA   . SER A 1 2   ? 12.686  -19.334 -15.499 1.00 0.00 ? 2   SER A CA   2  
ATOM 1564  C C    . SER A 1 2   ? 11.176  -19.448 -15.308 1.00 0.00 ? 2   SER A C    2  
ATOM 1565  O O    . SER A 1 2   ? 10.677  -20.533 -14.992 1.00 0.00 ? 2   SER A O    2  
ATOM 1566  C CB   . SER A 1 2   ? 13.082  -19.605 -16.965 1.00 0.00 ? 2   SER A CB   2  
ATOM 1567  O OG   . SER A 1 2   ? 13.256  -20.989 -17.234 1.00 0.00 ? 2   SER A OG   2  
ATOM 1568  H H    . SER A 1 2   ? 12.603  -20.895 -14.145 1.00 0.00 ? 2   SER A H    2  
ATOM 1569  H HA   . SER A 1 2   ? 13.011  -18.331 -15.221 1.00 0.00 ? 2   SER A HA   2  
ATOM 1570  H HB2  . SER A 1 2   ? 12.321  -19.194 -17.631 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1571  H HB3  . SER A 1 2   ? 14.019  -19.091 -17.174 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1572  H HG   . SER A 1 2   ? 13.456  -21.075 -18.191 1.00 0.00 ? 2   SER A HG   2  
ATOM 1573  N N    . SER A 1 3   ? 10.438  -18.357 -15.489 1.00 0.00 ? 3   SER A N    2  
ATOM 1574  C CA   . SER A 1 3   ? 8.978   -18.335 -15.512 1.00 0.00 ? 3   SER A CA   2  
ATOM 1575  C C    . SER A 1 3   ? 8.519   -16.956 -15.989 1.00 0.00 ? 3   SER A C    2  
ATOM 1576  O O    . SER A 1 3   ? 9.311   -16.012 -16.035 1.00 0.00 ? 3   SER A O    2  
ATOM 1577  C CB   . SER A 1 3   ? 8.399   -18.665 -14.121 1.00 0.00 ? 3   SER A CB   2  
ATOM 1578  O OG   . SER A 1 3   ? 9.122   -18.064 -13.050 1.00 0.00 ? 3   SER A OG   2  
ATOM 1579  H H    . SER A 1 3   ? 10.887  -17.474 -15.722 1.00 0.00 ? 3   SER A H    2  
ATOM 1580  H HA   . SER A 1 3   ? 8.622   -19.080 -16.226 1.00 0.00 ? 3   SER A HA   2  
ATOM 1581  H HB2  . SER A 1 3   ? 7.357   -18.344 -14.077 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1582  H HB3  . SER A 1 3   ? 8.415   -19.746 -13.980 1.00 0.00 ? 3   SER A HB3  2  
ATOM 1583  H HG   . SER A 1 3   ? 9.800   -18.722 -12.780 1.00 0.00 ? 3   SER A HG   2  
ATOM 1584  N N    . GLY A 1 4   ? 7.238   -16.801 -16.301 1.00 0.00 ? 4   GLY A N    2  
ATOM 1585  C CA   . GLY A 1 4   ? 6.637   -15.517 -16.604 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1586  C C    . GLY A 1 4   ? 5.195   -15.747 -17.028 1.00 0.00 ? 4   GLY A C    2  
ATOM 1587  O O    . GLY A 1 4   ? 4.844   -16.858 -17.426 1.00 0.00 ? 4   GLY A O    2  
ATOM 1588  H H    . GLY A 1 4   ? 6.590   -17.577 -16.372 1.00 0.00 ? 4   GLY A H    2  
ATOM 1589  H HA2  . GLY A 1 4   ? 6.672   -14.875 -15.724 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1590  H HA3  . GLY A 1 4   ? 7.183   -15.050 -17.423 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1591  N N    . SER A 1 5   ? 4.370   -14.708 -16.935 1.00 0.00 ? 5   SER A N    2  
ATOM 1592  C CA   . SER A 1 5   ? 3.030   -14.687 -17.489 1.00 0.00 ? 5   SER A CA   2  
ATOM 1593  C C    . SER A 1 5   ? 2.601   -13.222 -17.547 1.00 0.00 ? 5   SER A C    2  
ATOM 1594  O O    . SER A 1 5   ? 2.628   -12.621 -18.624 1.00 0.00 ? 5   SER A O    2  
ATOM 1595  C CB   . SER A 1 5   ? 2.090   -15.595 -16.666 1.00 0.00 ? 5   SER A CB   2  
ATOM 1596  O OG   . SER A 1 5   ? 0.892   -15.862 -17.366 1.00 0.00 ? 5   SER A OG   2  
ATOM 1597  H H    . SER A 1 5   ? 4.743   -13.824 -16.622 1.00 0.00 ? 5   SER A H    2  
ATOM 1598  H HA   . SER A 1 5   ? 3.095   -15.070 -18.507 1.00 0.00 ? 5   SER A HA   2  
ATOM 1599  H HB2  . SER A 1 5   ? 2.577   -16.550 -16.476 1.00 0.00 ? 5   SER A HB2  2  
ATOM 1600  H HB3  . SER A 1 5   ? 1.854   -15.137 -15.706 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1601  H HG   . SER A 1 5   ? 0.608   -16.774 -17.135 1.00 0.00 ? 5   SER A HG   2  
ATOM 1602  N N    . SER A 1 6   ? 2.311   -12.629 -16.387 1.00 0.00 ? 6   SER A N    2  
ATOM 1603  C CA   . SER A 1 6   ? 1.910   -11.241 -16.232 1.00 0.00 ? 6   SER A CA   2  
ATOM 1604  C C    . SER A 1 6   ? 2.531   -10.703 -14.936 1.00 0.00 ? 6   SER A C    2  
ATOM 1605  O O    . SER A 1 6   ? 3.643   -10.179 -14.953 1.00 0.00 ? 6   SER A O    2  
ATOM 1606  C CB   . SER A 1 6   ? 0.382   -11.140 -16.205 1.00 0.00 ? 6   SER A CB   2  
ATOM 1607  O OG   . SER A 1 6   ? -0.274  -11.528 -17.391 1.00 0.00 ? 6   SER A OG   2  
ATOM 1608  H H    . SER A 1 6   ? 2.430   -13.162 -15.533 1.00 0.00 ? 6   SER A H    2  
ATOM 1609  H HA   . SER A 1 6   ? 2.285   -10.653 -17.070 1.00 0.00 ? 6   SER A HA   2  
ATOM 1610  H HB2  . SER A 1 6   ? -0.002  -11.767 -15.403 1.00 0.00 ? 6   SER A HB2  2  
ATOM 1611  H HB3  . SER A 1 6   ? 0.109   -10.109 -15.994 1.00 0.00 ? 6   SER A HB3  2  
ATOM 1612  H HG   . SER A 1 6   ? -1.211  -11.323 -17.214 1.00 0.00 ? 6   SER A HG   2  
ATOM 1613  N N    . GLY A 1 7   ? 1.867   -10.872 -13.791 1.00 0.00 ? 7   GLY A N    2  
ATOM 1614  C CA   . GLY A 1 7   ? 2.293   -10.364 -12.497 1.00 0.00 ? 7   GLY A CA   2  
ATOM 1615  C C    . GLY A 1 7   ? 1.050   -10.247 -11.632 1.00 0.00 ? 7   GLY A C    2  
ATOM 1616  O O    . GLY A 1 7   ? 0.420   -11.266 -11.338 1.00 0.00 ? 7   GLY A O    2  
ATOM 1617  H H    . GLY A 1 7   ? 0.964   -11.325 -13.798 1.00 0.00 ? 7   GLY A H    2  
ATOM 1618  H HA2  . GLY A 1 7   ? 2.998   -11.055 -12.038 1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1619  H HA3  . GLY A 1 7   ? 2.771   -9.390  -12.614 1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1620  N N    . GLN A 1 8   ? 0.638   -9.013  -11.338 1.00 0.00 ? 8   GLN A N    2  
ATOM 1621  C CA   . GLN A 1 8   ? -0.492  -8.675  -10.477 1.00 0.00 ? 8   GLN A CA   2  
ATOM 1622  C C    . GLN A 1 8   ? -0.320  -9.243  -9.062  1.00 0.00 ? 8   GLN A C    2  
ATOM 1623  O O    . GLN A 1 8   ? 0.617   -9.975  -8.747  1.00 0.00 ? 8   GLN A O    2  
ATOM 1624  C CB   . GLN A 1 8   ? -1.857  -9.079  -11.095 1.00 0.00 ? 8   GLN A CB   2  
ATOM 1625  C CG   . GLN A 1 8   ? -2.256  -8.361  -12.393 1.00 0.00 ? 8   GLN A CG   2  
ATOM 1626  C CD   . GLN A 1 8   ? -1.424  -8.777  -13.601 1.00 0.00 ? 8   GLN A CD   2  
ATOM 1627  O OE1  . GLN A 1 8   ? -1.278  -9.968  -13.878 1.00 0.00 ? 8   GLN A OE1  2  
ATOM 1628  N NE2  . GLN A 1 8   ? -0.862  -7.828  -14.330 1.00 0.00 ? 8   GLN A NE2  2  
ATOM 1629  H H    . GLN A 1 8   ? 1.271   -8.263  -11.581 1.00 0.00 ? 8   GLN A H    2  
ATOM 1630  H HA   . GLN A 1 8   ? -0.483  -7.593  -10.370 1.00 0.00 ? 8   GLN A HA   2  
ATOM 1631  H HB2  . GLN A 1 8   ? -1.890  -10.157 -11.254 1.00 0.00 ? 8   GLN A HB2  2  
ATOM 1632  H HB3  . GLN A 1 8   ? -2.642  -8.852  -10.374 1.00 0.00 ? 8   GLN A HB3  2  
ATOM 1633  H HG2  . GLN A 1 8   ? -3.296  -8.612  -12.601 1.00 0.00 ? 8   GLN A HG2  2  
ATOM 1634  H HG3  . GLN A 1 8   ? -2.203  -7.284  -12.238 1.00 0.00 ? 8   GLN A HG3  2  
ATOM 1635  H HE21 . GLN A 1 8   ? -1.145  -6.860  -14.191 1.00 0.00 ? 8   GLN A HE21 2  
ATOM 1636  H HE22 . GLN A 1 8   ? -0.259  -8.067  -15.111 1.00 0.00 ? 8   GLN A HE22 2  
ATOM 1637  N N    . TYR A 1 9   ? -1.267  -8.885  -8.194  1.00 0.00 ? 9   TYR A N    2  
ATOM 1638  C CA   . TYR A 1 9   ? -1.316  -9.308  -6.805  1.00 0.00 ? 9   TYR A CA   2  
ATOM 1639  C C    . TYR A 1 9   ? -1.255  -10.827 -6.660  1.00 0.00 ? 9   TYR A C    2  
ATOM 1640  O O    . TYR A 1 9   ? -0.753  -11.297 -5.645  1.00 0.00 ? 9   TYR A O    2  
ATOM 1641  C CB   . TYR A 1 9   ? -2.578  -8.725  -6.152  1.00 0.00 ? 9   TYR A CB   2  
ATOM 1642  C CG   . TYR A 1 9   ? -3.875  -8.948  -6.903  1.00 0.00 ? 9   TYR A CG   2  
ATOM 1643  C CD1  . TYR A 1 9   ? -4.535  -10.186 -6.814  1.00 0.00 ? 9   TYR A CD1  2  
ATOM 1644  C CD2  . TYR A 1 9   ? -4.433  -7.910  -7.679  1.00 0.00 ? 9   TYR A CD2  2  
ATOM 1645  C CE1  . TYR A 1 9   ? -5.733  -10.395 -7.512  1.00 0.00 ? 9   TYR A CE1  2  
ATOM 1646  C CE2  . TYR A 1 9   ? -5.633  -8.117  -8.380  1.00 0.00 ? 9   TYR A CE2  2  
ATOM 1647  C CZ   . TYR A 1 9   ? -6.284  -9.366  -8.303  1.00 0.00 ? 9   TYR A CZ   2  
ATOM 1648  O OH   . TYR A 1 9   ? -7.443  -9.580  -8.978  1.00 0.00 ? 9   TYR A OH   2  
ATOM 1649  H H    . TYR A 1 9   ? -2.031  -8.312  -8.515  1.00 0.00 ? 9   TYR A H    2  
ATOM 1650  H HA   . TYR A 1 9   ? -0.445  -8.899  -6.294  1.00 0.00 ? 9   TYR A HA   2  
ATOM 1651  H HB2  . TYR A 1 9   ? -2.673  -9.121  -5.140  1.00 0.00 ? 9   TYR A HB2  2  
ATOM 1652  H HB3  . TYR A 1 9   ? -2.441  -7.653  -6.077  1.00 0.00 ? 9   TYR A HB3  2  
ATOM 1653  H HD1  . TYR A 1 9   ? -4.132  -10.991 -6.214  1.00 0.00 ? 9   TYR A HD1  2  
ATOM 1654  H HD2  . TYR A 1 9   ? -3.969  -6.934  -7.723  1.00 0.00 ? 9   TYR A HD2  2  
ATOM 1655  H HE1  . TYR A 1 9   ? -6.221  -11.354 -7.440  1.00 0.00 ? 9   TYR A HE1  2  
ATOM 1656  H HE2  . TYR A 1 9   ? -6.070  -7.312  -8.955  1.00 0.00 ? 9   TYR A HE2  2  
ATOM 1657  H HH   . TYR A 1 9   ? -7.570  -8.947  -9.710  1.00 0.00 ? 9   TYR A HH   2  
ATOM 1658  N N    . GLU A 1 10  ? -1.730  -11.578 -7.655  1.00 0.00 ? 10  GLU A N    2  
ATOM 1659  C CA   . GLU A 1 10  ? -1.697  -13.033 -7.701  1.00 0.00 ? 10  GLU A CA   2  
ATOM 1660  C C    . GLU A 1 10  ? -0.252  -13.532 -7.621  1.00 0.00 ? 10  GLU A C    2  
ATOM 1661  O O    . GLU A 1 10  ? 0.079   -14.269 -6.697  1.00 0.00 ? 10  GLU A O    2  
ATOM 1662  C CB   . GLU A 1 10  ? -2.400  -13.507 -8.990  1.00 0.00 ? 10  GLU A CB   2  
ATOM 1663  C CG   . GLU A 1 10  ? -3.918  -13.245 -9.010  1.00 0.00 ? 10  GLU A CG   2  
ATOM 1664  C CD   . GLU A 1 10  ? -4.725  -14.202 -8.124  1.00 0.00 ? 10  GLU A CD   2  
ATOM 1665  O OE1  . GLU A 1 10  ? -4.459  -14.289 -6.905  1.00 0.00 ? 10  GLU A OE1  2  
ATOM 1666  O OE2  . GLU A 1 10  ? -5.616  -14.906 -8.656  1.00 0.00 ? 10  GLU A OE2  2  
ATOM 1667  H H    . GLU A 1 10  ? -2.138  -11.109 -8.446  1.00 0.00 ? 10  GLU A H    2  
ATOM 1668  H HA   . GLU A 1 10  ? -2.217  -13.428 -6.823  1.00 0.00 ? 10  GLU A HA   2  
ATOM 1669  H HB2  . GLU A 1 10  ? -1.954  -12.980 -9.836  1.00 0.00 ? 10  GLU A HB2  2  
ATOM 1670  H HB3  . GLU A 1 10  ? -2.221  -14.570 -9.142  1.00 0.00 ? 10  GLU A HB3  2  
ATOM 1671  H HG2  . GLU A 1 10  ? -4.117  -12.217 -8.718  1.00 0.00 ? 10  GLU A HG2  2  
ATOM 1672  H HG3  . GLU A 1 10  ? -4.266  -13.356 -10.036 1.00 0.00 ? 10  GLU A HG3  2  
ATOM 1673  N N    . LEU A 1 11  ? 0.632   -13.088 -8.524  1.00 0.00 ? 11  LEU A N    2  
ATOM 1674  C CA   . LEU A 1 11  ? 2.047   -13.476 -8.522  1.00 0.00 ? 11  LEU A CA   2  
ATOM 1675  C C    . LEU A 1 11  ? 2.662   -13.143 -7.165  1.00 0.00 ? 11  LEU A C    2  
ATOM 1676  O O    . LEU A 1 11  ? 3.299   -13.980 -6.518  1.00 0.00 ? 11  LEU A O    2  
ATOM 1677  C CB   . LEU A 1 11  ? 2.759   -12.741 -9.678  1.00 0.00 ? 11  LEU A CB   2  
ATOM 1678  C CG   . LEU A 1 11  ? 4.198   -13.148 -10.050 1.00 0.00 ? 11  LEU A CG   2  
ATOM 1679  C CD1  . LEU A 1 11  ? 5.306   -12.828 -9.047  1.00 0.00 ? 11  LEU A CD1  2  
ATOM 1680  C CD2  . LEU A 1 11  ? 4.268   -14.628 -10.390 1.00 0.00 ? 11  LEU A CD2  2  
ATOM 1681  H H    . LEU A 1 11  ? 0.330   -12.405 -9.207  1.00 0.00 ? 11  LEU A H    2  
ATOM 1682  H HA   . LEU A 1 11  ? 2.101   -14.554 -8.676  1.00 0.00 ? 11  LEU A HA   2  
ATOM 1683  H HB2  . LEU A 1 11  ? 2.163   -12.913 -10.574 1.00 0.00 ? 11  LEU A HB2  2  
ATOM 1684  H HB3  . LEU A 1 11  ? 2.743   -11.669 -9.482  1.00 0.00 ? 11  LEU A HB3  2  
ATOM 1685  H HG   . LEU A 1 11  ? 4.445   -12.604 -10.961 1.00 0.00 ? 11  LEU A HG   2  
ATOM 1686  H HD11 . LEU A 1 11  ? 6.258   -13.172 -9.447  1.00 0.00 ? 11  LEU A HD11 2  
ATOM 1687  H HD12 . LEU A 1 11  ? 5.393   -11.754 -8.927  1.00 0.00 ? 11  LEU A HD12 2  
ATOM 1688  H HD13 . LEU A 1 11  ? 5.135   -13.307 -8.086  1.00 0.00 ? 11  LEU A HD13 2  
ATOM 1689  H HD21 . LEU A 1 11  ? 5.246   -14.845 -10.817 1.00 0.00 ? 11  LEU A HD21 2  
ATOM 1690  H HD22 . LEU A 1 11  ? 4.114   -15.231 -9.498  1.00 0.00 ? 11  LEU A HD22 2  
ATOM 1691  H HD23 . LEU A 1 11  ? 3.504   -14.856 -11.128 1.00 0.00 ? 11  LEU A HD23 2  
ATOM 1692  N N    . TYR A 1 12  ? 2.428   -11.908 -6.724  1.00 0.00 ? 12  TYR A N    2  
ATOM 1693  C CA   . TYR A 1 12  ? 2.997   -11.359 -5.503  1.00 0.00 ? 12  TYR A CA   2  
ATOM 1694  C C    . TYR A 1 12  ? 2.363   -11.993 -4.265  1.00 0.00 ? 12  TYR A C    2  
ATOM 1695  O O    . TYR A 1 12  ? 2.764   -11.677 -3.151  1.00 0.00 ? 12  TYR A O    2  
ATOM 1696  C CB   . TYR A 1 12  ? 2.826   -9.824  -5.482  1.00 0.00 ? 12  TYR A CB   2  
ATOM 1697  C CG   . TYR A 1 12  ? 3.071   -9.101  -6.800  1.00 0.00 ? 12  TYR A CG   2  
ATOM 1698  C CD1  . TYR A 1 12  ? 3.967   -9.636  -7.743  1.00 0.00 ? 12  TYR A CD1  2  
ATOM 1699  C CD2  . TYR A 1 12  ? 2.337   -7.943  -7.124  1.00 0.00 ? 12  TYR A CD2  2  
ATOM 1700  C CE1  . TYR A 1 12  ? 4.033   -9.131  -9.049  1.00 0.00 ? 12  TYR A CE1  2  
ATOM 1701  C CE2  . TYR A 1 12  ? 2.452   -7.372  -8.406  1.00 0.00 ? 12  TYR A CE2  2  
ATOM 1702  C CZ   . TYR A 1 12  ? 3.274   -7.986  -9.379  1.00 0.00 ? 12  TYR A CZ   2  
ATOM 1703  O OH   . TYR A 1 12  ? 3.384   -7.433  -10.614 1.00 0.00 ? 12  TYR A OH   2  
ATOM 1704  H H    . TYR A 1 12  ? 1.884   -11.288 -7.316  1.00 0.00 ? 12  TYR A H    2  
ATOM 1705  H HA   . TYR A 1 12  ? 4.064   -11.587 -5.487  1.00 0.00 ? 12  TYR A HA   2  
ATOM 1706  H HB2  . TYR A 1 12  ? 1.804   -9.604  -5.176  1.00 0.00 ? 12  TYR A HB2  2  
ATOM 1707  H HB3  . TYR A 1 12  ? 3.491   -9.417  -4.722  1.00 0.00 ? 12  TYR A HB3  2  
ATOM 1708  H HD1  . TYR A 1 12  ? 4.580   -10.478 -7.471  1.00 0.00 ? 12  TYR A HD1  2  
ATOM 1709  H HD2  . TYR A 1 12  ? 1.678   -7.498  -6.396  1.00 0.00 ? 12  TYR A HD2  2  
ATOM 1710  H HE1  . TYR A 1 12  ? 4.661   -9.643  -9.772  1.00 0.00 ? 12  TYR A HE1  2  
ATOM 1711  H HE2  . TYR A 1 12  ? 1.906   -6.476  -8.652  1.00 0.00 ? 12  TYR A HE2  2  
ATOM 1712  H HH   . TYR A 1 12  ? 4.288   -7.072  -10.661 1.00 0.00 ? 12  TYR A HH   2  
ATOM 1713  N N    . MET A 1 13  ? 1.330   -12.831 -4.391  1.00 0.00 ? 13  MET A N    2  
ATOM 1714  C CA   . MET A 1 13  ? 0.651   -13.392 -3.246  1.00 0.00 ? 13  MET A CA   2  
ATOM 1715  C C    . MET A 1 13  ? 1.595   -14.328 -2.497  1.00 0.00 ? 13  MET A C    2  
ATOM 1716  O O    . MET A 1 13  ? 1.625   -14.280 -1.267  1.00 0.00 ? 13  MET A O    2  
ATOM 1717  C CB   . MET A 1 13  ? -0.645  -14.082 -3.694  1.00 0.00 ? 13  MET A CB   2  
ATOM 1718  C CG   . MET A 1 13  ? -1.589  -14.204 -2.504  1.00 0.00 ? 13  MET A CG   2  
ATOM 1719  S SD   . MET A 1 13  ? -3.312  -13.665 -2.730  1.00 0.00 ? 13  MET A SD   2  
ATOM 1720  C CE   . MET A 1 13  ? -3.135  -11.975 -3.379  1.00 0.00 ? 13  MET A CE   2  
ATOM 1721  H H    . MET A 1 13  ? 0.937   -13.073 -5.292  1.00 0.00 ? 13  MET A H    2  
ATOM 1722  H HA   . MET A 1 13  ? 0.397   -12.565 -2.583  1.00 0.00 ? 13  MET A HA   2  
ATOM 1723  H HB2  . MET A 1 13  ? -1.130  -13.498 -4.469  1.00 0.00 ? 13  MET A HB2  2  
ATOM 1724  H HB3  . MET A 1 13  ? -0.430  -15.069 -4.099  1.00 0.00 ? 13  MET A HB3  2  
ATOM 1725  H HG2  . MET A 1 13  ? -1.581  -15.246 -2.197  1.00 0.00 ? 13  MET A HG2  2  
ATOM 1726  H HG3  . MET A 1 13  ? -1.174  -13.616 -1.693  1.00 0.00 ? 13  MET A HG3  2  
ATOM 1727  H HE1  . MET A 1 13  ? -4.092  -11.457 -3.314  1.00 0.00 ? 13  MET A HE1  2  
ATOM 1728  H HE2  . MET A 1 13  ? -2.386  -11.419 -2.817  1.00 0.00 ? 13  MET A HE2  2  
ATOM 1729  H HE3  . MET A 1 13  ? -2.841  -12.014 -4.427  1.00 0.00 ? 13  MET A HE3  2  
ATOM 1730  N N    . TYR A 1 14  ? 2.412   -15.089 -3.231  1.00 0.00 ? 14  TYR A N    2  
ATOM 1731  C CA   . TYR A 1 14  ? 3.274   -16.142 -2.699  1.00 0.00 ? 14  TYR A CA   2  
ATOM 1732  C C    . TYR A 1 14  ? 4.721   -15.676 -2.580  1.00 0.00 ? 14  TYR A C    2  
ATOM 1733  O O    . TYR A 1 14  ? 5.390   -16.020 -1.604  1.00 0.00 ? 14  TYR A O    2  
ATOM 1734  C CB   . TYR A 1 14  ? 3.203   -17.380 -3.611  1.00 0.00 ? 14  TYR A CB   2  
ATOM 1735  C CG   . TYR A 1 14  ? 1.801   -17.656 -4.102  1.00 0.00 ? 14  TYR A CG   2  
ATOM 1736  C CD1  . TYR A 1 14  ? 0.866   -18.258 -3.241  1.00 0.00 ? 14  TYR A CD1  2  
ATOM 1737  C CD2  . TYR A 1 14  ? 1.395   -17.158 -5.355  1.00 0.00 ? 14  TYR A CD2  2  
ATOM 1738  C CE1  . TYR A 1 14  ? -0.487  -18.336 -3.613  1.00 0.00 ? 14  TYR A CE1  2  
ATOM 1739  C CE2  . TYR A 1 14  ? 0.044   -17.236 -5.725  1.00 0.00 ? 14  TYR A CE2  2  
ATOM 1740  C CZ   . TYR A 1 14  ? -0.908  -17.804 -4.850  1.00 0.00 ? 14  TYR A CZ   2  
ATOM 1741  O OH   . TYR A 1 14  ? -2.227  -17.810 -5.186  1.00 0.00 ? 14  TYR A OH   2  
ATOM 1742  H H    . TYR A 1 14  ? 2.309   -15.035 -4.237  1.00 0.00 ? 14  TYR A H    2  
ATOM 1743  H HA   . TYR A 1 14  ? 2.912   -16.427 -1.708  1.00 0.00 ? 14  TYR A HA   2  
ATOM 1744  H HB2  . TYR A 1 14  ? 3.851   -17.234 -4.477  1.00 0.00 ? 14  TYR A HB2  2  
ATOM 1745  H HB3  . TYR A 1 14  ? 3.573   -18.249 -3.063  1.00 0.00 ? 14  TYR A HB3  2  
ATOM 1746  H HD1  . TYR A 1 14  ? 1.172   -18.626 -2.269  1.00 0.00 ? 14  TYR A HD1  2  
ATOM 1747  H HD2  . TYR A 1 14  ? 2.096   -16.652 -6.015  1.00 0.00 ? 14  TYR A HD2  2  
ATOM 1748  H HE1  . TYR A 1 14  ? -1.192  -18.781 -2.929  1.00 0.00 ? 14  TYR A HE1  2  
ATOM 1749  H HE2  . TYR A 1 14  ? -0.260  -16.799 -6.662  1.00 0.00 ? 14  TYR A HE2  2  
ATOM 1750  H HH   . TYR A 1 14  ? -2.361  -17.297 -6.014  1.00 0.00 ? 14  TYR A HH   2  
ATOM 1751  N N    . ARG A 1 15  ? 5.217   -14.926 -3.572  1.00 0.00 ? 15  ARG A N    2  
ATOM 1752  C CA   . ARG A 1 15  ? 6.613   -14.496 -3.636  1.00 0.00 ? 15  ARG A CA   2  
ATOM 1753  C C    . ARG A 1 15  ? 6.759   -13.071 -3.108  1.00 0.00 ? 15  ARG A C    2  
ATOM 1754  O O    . ARG A 1 15  ? 5.784   -12.321 -3.077  1.00 0.00 ? 15  ARG A O    2  
ATOM 1755  C CB   . ARG A 1 15  ? 7.136   -14.626 -5.084  1.00 0.00 ? 15  ARG A CB   2  
ATOM 1756  C CG   . ARG A 1 15  ? 8.305   -15.615 -5.227  1.00 0.00 ? 15  ARG A CG   2  
ATOM 1757  C CD   . ARG A 1 15  ? 9.524   -15.178 -4.408  1.00 0.00 ? 15  ARG A CD   2  
ATOM 1758  N NE   . ARG A 1 15  ? 10.660  -16.104 -4.510  1.00 0.00 ? 15  ARG A NE   2  
ATOM 1759  C CZ   . ARG A 1 15  ? 11.879  -15.830 -4.031  1.00 0.00 ? 15  ARG A CZ   2  
ATOM 1760  N NH1  . ARG A 1 15  ? 12.068  -14.845 -3.158  1.00 0.00 ? 15  ARG A NH1  2  
ATOM 1761  N NH2  . ARG A 1 15  ? 12.938  -16.495 -4.471  1.00 0.00 ? 15  ARG A NH2  2  
ATOM 1762  H H    . ARG A 1 15  ? 4.595   -14.615 -4.307  1.00 0.00 ? 15  ARG A H    2  
ATOM 1763  H HA   . ARG A 1 15  ? 7.182   -15.154 -2.979  1.00 0.00 ? 15  ARG A HA   2  
ATOM 1764  H HB2  . ARG A 1 15  ? 6.328   -14.957 -5.738  1.00 0.00 ? 15  ARG A HB2  2  
ATOM 1765  H HB3  . ARG A 1 15  ? 7.453   -13.649 -5.448  1.00 0.00 ? 15  ARG A HB3  2  
ATOM 1766  H HG2  . ARG A 1 15  ? 7.974   -16.600 -4.909  1.00 0.00 ? 15  ARG A HG2  2  
ATOM 1767  H HG3  . ARG A 1 15  ? 8.592   -15.679 -6.276  1.00 0.00 ? 15  ARG A HG3  2  
ATOM 1768  H HD2  . ARG A 1 15  ? 9.841   -14.190 -4.748  1.00 0.00 ? 15  ARG A HD2  2  
ATOM 1769  H HD3  . ARG A 1 15  ? 9.240   -15.115 -3.365  1.00 0.00 ? 15  ARG A HD3  2  
ATOM 1770  H HE   . ARG A 1 15  ? 10.502  -16.968 -5.026  1.00 0.00 ? 15  ARG A HE   2  
ATOM 1771  H HH11 . ARG A 1 15  ? 11.279  -14.541 -2.571  1.00 0.00 ? 15  ARG A HH11 2  
ATOM 1772  H HH12 . ARG A 1 15  ? 13.001  -14.616 -2.829  1.00 0.00 ? 15  ARG A HH12 2  
ATOM 1773  H HH21 . ARG A 1 15  ? 12.836  -17.380 -4.969  1.00 0.00 ? 15  ARG A HH21 2  
ATOM 1774  H HH22 . ARG A 1 15  ? 13.863  -16.266 -4.116  1.00 0.00 ? 15  ARG A HH22 2  
ATOM 1775  N N    . GLU A 1 16  ? 7.974   -12.706 -2.701  1.00 0.00 ? 16  GLU A N    2  
ATOM 1776  C CA   . GLU A 1 16  ? 8.269   -11.424 -2.078  1.00 0.00 ? 16  GLU A CA   2  
ATOM 1777  C C    . GLU A 1 16  ? 8.582   -10.329 -3.088  1.00 0.00 ? 16  GLU A C    2  
ATOM 1778  O O    . GLU A 1 16  ? 8.670   -10.563 -4.294  1.00 0.00 ? 16  GLU A O    2  
ATOM 1779  C CB   . GLU A 1 16  ? 9.422   -11.582 -1.072  1.00 0.00 ? 16  GLU A CB   2  
ATOM 1780  C CG   . GLU A 1 16  ? 9.124   -12.627 0.010   1.00 0.00 ? 16  GLU A CG   2  
ATOM 1781  C CD   . GLU A 1 16  ? 9.974   -13.883 -0.125  1.00 0.00 ? 16  GLU A CD   2  
ATOM 1782  O OE1  . GLU A 1 16  ? 10.035  -14.460 -1.236  1.00 0.00 ? 16  GLU A OE1  2  
ATOM 1783  O OE2  . GLU A 1 16  ? 10.523  -14.319 0.911   1.00 0.00 ? 16  GLU A OE2  2  
ATOM 1784  H H    . GLU A 1 16  ? 8.735   -13.370 -2.723  1.00 0.00 ? 16  GLU A H    2  
ATOM 1785  H HA   . GLU A 1 16  ? 7.387   -11.077 -1.550  1.00 0.00 ? 16  GLU A HA   2  
ATOM 1786  H HB2  . GLU A 1 16  ? 10.344  -11.831 -1.602  1.00 0.00 ? 16  GLU A HB2  2  
ATOM 1787  H HB3  . GLU A 1 16  ? 9.579   -10.629 -0.569  1.00 0.00 ? 16  GLU A HB3  2  
ATOM 1788  H HG2  . GLU A 1 16  ? 9.311   -12.171 0.982   1.00 0.00 ? 16  GLU A HG2  2  
ATOM 1789  H HG3  . GLU A 1 16  ? 8.072   -12.913 -0.011  1.00 0.00 ? 16  GLU A HG3  2  
ATOM 1790  N N    . VAL A 1 17  ? 8.752   -9.129  -2.542  1.00 0.00 ? 17  VAL A N    2  
ATOM 1791  C CA   . VAL A 1 17  ? 9.228   -7.918  -3.174  1.00 0.00 ? 17  VAL A CA   2  
ATOM 1792  C C    . VAL A 1 17  ? 10.030  -7.155  -2.104  1.00 0.00 ? 17  VAL A C    2  
ATOM 1793  O O    . VAL A 1 17  ? 9.875   -7.414  -0.902  1.00 0.00 ? 17  VAL A O    2  
ATOM 1794  C CB   . VAL A 1 17  ? 8.019   -7.128  -3.726  1.00 0.00 ? 17  VAL A CB   2  
ATOM 1795  C CG1  . VAL A 1 17  ? 6.916   -6.986  -2.672  1.00 0.00 ? 17  VAL A CG1  2  
ATOM 1796  C CG2  . VAL A 1 17  ? 8.357   -5.708  -4.203  1.00 0.00 ? 17  VAL A CG2  2  
ATOM 1797  H H    . VAL A 1 17  ? 8.669   -9.035  -1.542  1.00 0.00 ? 17  VAL A H    2  
ATOM 1798  H HA   . VAL A 1 17  ? 9.883   -8.211  -3.991  1.00 0.00 ? 17  VAL A HA   2  
ATOM 1799  H HB   . VAL A 1 17  ? 7.612   -7.674  -4.578  1.00 0.00 ? 17  VAL A HB   2  
ATOM 1800  H HG11 . VAL A 1 17  ? 7.340   -6.585  -1.753  1.00 0.00 ? 17  VAL A HG11 2  
ATOM 1801  H HG12 . VAL A 1 17  ? 6.167   -6.306  -3.051  1.00 0.00 ? 17  VAL A HG12 2  
ATOM 1802  H HG13 . VAL A 1 17  ? 6.439   -7.951  -2.487  1.00 0.00 ? 17  VAL A HG13 2  
ATOM 1803  H HG21 . VAL A 1 17  ? 8.560   -5.053  -3.354  1.00 0.00 ? 17  VAL A HG21 2  
ATOM 1804  H HG22 . VAL A 1 17  ? 9.224   -5.729  -4.860  1.00 0.00 ? 17  VAL A HG22 2  
ATOM 1805  H HG23 . VAL A 1 17  ? 7.522   -5.296  -4.767  1.00 0.00 ? 17  VAL A HG23 2  
ATOM 1806  N N    . ASP A 1 18  ? 10.874  -6.210  -2.513  1.00 0.00 ? 18  ASP A N    2  
ATOM 1807  C CA   . ASP A 1 18  ? 11.652  -5.348  -1.629  1.00 0.00 ? 18  ASP A CA   2  
ATOM 1808  C C    . ASP A 1 18  ? 10.832  -4.106  -1.309  1.00 0.00 ? 18  ASP A C    2  
ATOM 1809  O O    . ASP A 1 18  ? 10.764  -3.173  -2.107  1.00 0.00 ? 18  ASP A O    2  
ATOM 1810  C CB   . ASP A 1 18  ? 12.990  -4.971  -2.276  1.00 0.00 ? 18  ASP A CB   2  
ATOM 1811  C CG   . ASP A 1 18  ? 13.892  -6.185  -2.434  1.00 0.00 ? 18  ASP A CG   2  
ATOM 1812  O OD1  . ASP A 1 18  ? 13.952  -7.033  -1.513  1.00 0.00 ? 18  ASP A OD1  2  
ATOM 1813  O OD2  . ASP A 1 18  ? 14.472  -6.349  -3.529  1.00 0.00 ? 18  ASP A OD2  2  
ATOM 1814  H H    . ASP A 1 18  ? 10.990  -6.073  -3.511  1.00 0.00 ? 18  ASP A H    2  
ATOM 1815  H HA   . ASP A 1 18  ? 11.869  -5.883  -0.705  1.00 0.00 ? 18  ASP A HA   2  
ATOM 1816  H HB2  . ASP A 1 18  ? 12.802  -4.533  -3.258  1.00 0.00 ? 18  ASP A HB2  2  
ATOM 1817  H HB3  . ASP A 1 18  ? 13.498  -4.230  -1.657  1.00 0.00 ? 18  ASP A HB3  2  
ATOM 1818  N N    . THR A 1 19  ? 10.178  -4.078  -0.150  1.00 0.00 ? 19  THR A N    2  
ATOM 1819  C CA   . THR A 1 19  ? 9.343   -2.961  0.277   1.00 0.00 ? 19  THR A CA   2  
ATOM 1820  C C    . THR A 1 19  ? 10.120  -1.634  0.332   1.00 0.00 ? 19  THR A C    2  
ATOM 1821  O O    . THR A 1 19  ? 9.527   -0.576  0.102   1.00 0.00 ? 19  THR A O    2  
ATOM 1822  C CB   . THR A 1 19  ? 8.704   -3.309  1.637   1.00 0.00 ? 19  THR A CB   2  
ATOM 1823  O OG1  . THR A 1 19  ? 9.641   -3.875  2.533   1.00 0.00 ? 19  THR A OG1  2  
ATOM 1824  C CG2  . THR A 1 19  ? 7.580   -4.333  1.474   1.00 0.00 ? 19  THR A CG2  2  
ATOM 1825  H H    . THR A 1 19  ? 10.268  -4.838  0.509   1.00 0.00 ? 19  THR A H    2  
ATOM 1826  H HA   . THR A 1 19  ? 8.545   -2.833  -0.460  1.00 0.00 ? 19  THR A HA   2  
ATOM 1827  H HB   . THR A 1 19  ? 8.288   -2.404  2.084   1.00 0.00 ? 19  THR A HB   2  
ATOM 1828  H HG1  . THR A 1 19  ? 9.228   -3.839  3.414   1.00 0.00 ? 19  THR A HG1  2  
ATOM 1829  H HG21 . THR A 1 19  ? 7.279   -4.720  2.446   1.00 0.00 ? 19  THR A HG21 2  
ATOM 1830  H HG22 . THR A 1 19  ? 6.722   -3.834  1.030   1.00 0.00 ? 19  THR A HG22 2  
ATOM 1831  H HG23 . THR A 1 19  ? 7.895   -5.160  0.830   1.00 0.00 ? 19  THR A HG23 2  
ATOM 1832  N N    . LEU A 1 20  ? 11.429  -1.647  0.612   1.00 0.00 ? 20  LEU A N    2  
ATOM 1833  C CA   . LEU A 1 20  ? 12.227  -0.427  0.659   1.00 0.00 ? 20  LEU A CA   2  
ATOM 1834  C C    . LEU A 1 20  ? 12.404  0.176   -0.731  1.00 0.00 ? 20  LEU A C    2  
ATOM 1835  O O    . LEU A 1 20  ? 12.387  1.401   -0.853  1.00 0.00 ? 20  LEU A O    2  
ATOM 1836  C CB   . LEU A 1 20  ? 13.608  -0.706  1.283   1.00 0.00 ? 20  LEU A CB   2  
ATOM 1837  C CG   . LEU A 1 20  ? 13.749  -0.295  2.757   1.00 0.00 ? 20  LEU A CG   2  
ATOM 1838  C CD1  . LEU A 1 20  ? 13.644  1.225   2.957   1.00 0.00 ? 20  LEU A CD1  2  
ATOM 1839  C CD2  . LEU A 1 20  ? 12.735  -1.033  3.634   1.00 0.00 ? 20  LEU A CD2  2  
ATOM 1840  H H    . LEU A 1 20  ? 11.905  -2.528  0.778   1.00 0.00 ? 20  LEU A H    2  
ATOM 1841  H HA   . LEU A 1 20  ? 11.689  0.306   1.261   1.00 0.00 ? 20  LEU A HA   2  
ATOM 1842  H HB2  . LEU A 1 20  ? 13.851  -1.762  1.182   1.00 0.00 ? 20  LEU A HB2  2  
ATOM 1843  H HB3  . LEU A 1 20  ? 14.364  -0.175  0.713   1.00 0.00 ? 20  LEU A HB3  2  
ATOM 1844  H HG   . LEU A 1 20  ? 14.740  -0.599  3.089   1.00 0.00 ? 20  LEU A HG   2  
ATOM 1845  H HD11 . LEU A 1 20  ? 14.470  1.712   2.438   1.00 0.00 ? 20  LEU A HD11 2  
ATOM 1846  H HD12 . LEU A 1 20  ? 12.705  1.619   2.575   1.00 0.00 ? 20  LEU A HD12 2  
ATOM 1847  H HD13 . LEU A 1 20  ? 13.724  1.454   4.018   1.00 0.00 ? 20  LEU A HD13 2  
ATOM 1848  H HD21 . LEU A 1 20  ? 12.853  -2.106  3.494   1.00 0.00 ? 20  LEU A HD21 2  
ATOM 1849  H HD22 . LEU A 1 20  ? 12.918  -0.796  4.680   1.00 0.00 ? 20  LEU A HD22 2  
ATOM 1850  H HD23 . LEU A 1 20  ? 11.718  -0.766  3.370   1.00 0.00 ? 20  LEU A HD23 2  
ATOM 1851  N N    . GLU A 1 21  ? 12.581  -0.661  -1.754  1.00 0.00 ? 21  GLU A N    2  
ATOM 1852  C CA   . GLU A 1 21  ? 12.785  -0.228  -3.124  1.00 0.00 ? 21  GLU A CA   2  
ATOM 1853  C C    . GLU A 1 21  ? 11.448  0.116   -3.779  1.00 0.00 ? 21  GLU A C    2  
ATOM 1854  O O    . GLU A 1 21  ? 11.331  1.113   -4.489  1.00 0.00 ? 21  GLU A O    2  
ATOM 1855  C CB   . GLU A 1 21  ? 13.540  -1.324  -3.884  1.00 0.00 ? 21  GLU A CB   2  
ATOM 1856  C CG   . GLU A 1 21  ? 15.046  -1.030  -3.959  1.00 0.00 ? 21  GLU A CG   2  
ATOM 1857  C CD   . GLU A 1 21  ? 15.419  0.118   -4.906  1.00 0.00 ? 21  GLU A CD   2  
ATOM 1858  O OE1  . GLU A 1 21  ? 14.745  1.174   -4.933  1.00 0.00 ? 21  GLU A OE1  2  
ATOM 1859  O OE2  . GLU A 1 21  ? 16.434  -0.012  -5.620  1.00 0.00 ? 21  GLU A OE2  2  
ATOM 1860  H H    . GLU A 1 21  ? 12.534  -1.664  -1.643  1.00 0.00 ? 21  GLU A H    2  
ATOM 1861  H HA   . GLU A 1 21  ? 13.393  0.669   -3.106  1.00 0.00 ? 21  GLU A HA   2  
ATOM 1862  H HB2  . GLU A 1 21  ? 13.398  -2.279  -3.380  1.00 0.00 ? 21  GLU A HB2  2  
ATOM 1863  H HB3  . GLU A 1 21  ? 13.129  -1.428  -4.880  1.00 0.00 ? 21  GLU A HB3  2  
ATOM 1864  H HG2  . GLU A 1 21  ? 15.413  -0.789  -2.961  1.00 0.00 ? 21  GLU A HG2  2  
ATOM 1865  H HG3  . GLU A 1 21  ? 15.553  -1.939  -4.290  1.00 0.00 ? 21  GLU A HG3  2  
ATOM 1866  N N    . LEU A 1 22  ? 10.403  -0.650  -3.459  1.00 0.00 ? 22  LEU A N    2  
ATOM 1867  C CA   . LEU A 1 22  ? 9.040   -0.332  -3.856  1.00 0.00 ? 22  LEU A CA   2  
ATOM 1868  C C    . LEU A 1 22  ? 8.671   1.082   -3.402  1.00 0.00 ? 22  LEU A C    2  
ATOM 1869  O O    . LEU A 1 22  ? 8.241   1.904   -4.205  1.00 0.00 ? 22  LEU A O    2  
ATOM 1870  C CB   . LEU A 1 22  ? 8.086   -1.390  -3.279  1.00 0.00 ? 22  LEU A CB   2  
ATOM 1871  C CG   . LEU A 1 22  ? 6.616   -0.941  -3.316  1.00 0.00 ? 22  LEU A CG   2  
ATOM 1872  C CD1  . LEU A 1 22  ? 6.139   -0.814  -4.756  1.00 0.00 ? 22  LEU A CD1  2  
ATOM 1873  C CD2  . LEU A 1 22  ? 5.783   -1.961  -2.559  1.00 0.00 ? 22  LEU A CD2  2  
ATOM 1874  H H    . LEU A 1 22  ? 10.579  -1.497  -2.925  1.00 0.00 ? 22  LEU A H    2  
ATOM 1875  H HA   . LEU A 1 22  ? 8.983   -0.359  -4.947  1.00 0.00 ? 22  LEU A HA   2  
ATOM 1876  H HB2  . LEU A 1 22  ? 8.207   -2.310  -3.850  1.00 0.00 ? 22  LEU A HB2  2  
ATOM 1877  H HB3  . LEU A 1 22  ? 8.357   -1.626  -2.253  1.00 0.00 ? 22  LEU A HB3  2  
ATOM 1878  H HG   . LEU A 1 22  ? 6.479   0.008   -2.802  1.00 0.00 ? 22  LEU A HG   2  
ATOM 1879  H HD11 . LEU A 1 22  ? 6.336   -1.736  -5.300  1.00 0.00 ? 22  LEU A HD11 2  
ATOM 1880  H HD12 . LEU A 1 22  ? 5.081   -0.580  -4.778  1.00 0.00 ? 22  LEU A HD12 2  
ATOM 1881  H HD13 . LEU A 1 22  ? 6.676   -0.004  -5.246  1.00 0.00 ? 22  LEU A HD13 2  
ATOM 1882  H HD21 . LEU A 1 22  ? 4.746   -1.635  -2.537  1.00 0.00 ? 22  LEU A HD21 2  
ATOM 1883  H HD22 . LEU A 1 22  ? 5.859   -2.921  -3.058  1.00 0.00 ? 22  LEU A HD22 2  
ATOM 1884  H HD23 . LEU A 1 22  ? 6.148   -2.038  -1.538  1.00 0.00 ? 22  LEU A HD23 2  
ATOM 1885  N N    . THR A 1 23  ? 8.791   1.366   -2.103  1.00 0.00 ? 23  THR A N    2  
ATOM 1886  C CA   . THR A 1 23  ? 8.425   2.674   -1.567  1.00 0.00 ? 23  THR A CA   2  
ATOM 1887  C C    . THR A 1 23  ? 9.264   3.761   -2.238  1.00 0.00 ? 23  THR A C    2  
ATOM 1888  O O    . THR A 1 23  ? 8.717   4.778   -2.662  1.00 0.00 ? 23  THR A O    2  
ATOM 1889  C CB   . THR A 1 23  ? 8.569   2.691   -0.041  1.00 0.00 ? 23  THR A CB   2  
ATOM 1890  O OG1  . THR A 1 23  ? 9.785   2.123   0.400   1.00 0.00 ? 23  THR A OG1  2  
ATOM 1891  C CG2  . THR A 1 23  ? 7.452   1.873   0.585   1.00 0.00 ? 23  THR A CG2  2  
ATOM 1892  H H    . THR A 1 23  ? 9.181   0.667   -1.485  1.00 0.00 ? 23  THR A H    2  
ATOM 1893  H HA   . THR A 1 23  ? 7.376   2.872   -1.807  1.00 0.00 ? 23  THR A HA   2  
ATOM 1894  H HB   . THR A 1 23  ? 8.498   3.719   0.317   1.00 0.00 ? 23  THR A HB   2  
ATOM 1895  H HG1  . THR A 1 23  ? 9.730   1.153   0.306   1.00 0.00 ? 23  THR A HG1  2  
ATOM 1896  H HG21 . THR A 1 23  ? 7.550   0.839   0.271   1.00 0.00 ? 23  THR A HG21 2  
ATOM 1897  H HG22 . THR A 1 23  ? 7.517   1.950   1.668   1.00 0.00 ? 23  THR A HG22 2  
ATOM 1898  H HG23 . THR A 1 23  ? 6.496   2.247   0.233   1.00 0.00 ? 23  THR A HG23 2  
ATOM 1899  N N    . ARG A 1 24  ? 10.571  3.516   -2.367  1.00 0.00 ? 24  ARG A N    2  
ATOM 1900  C CA   . ARG A 1 24  ? 11.519  4.362   -3.104  1.00 0.00 ? 24  ARG A CA   2  
ATOM 1901  C C    . ARG A 1 24  ? 10.947  4.791   -4.457  1.00 0.00 ? 24  ARG A C    2  
ATOM 1902  O O    . ARG A 1 24  ? 10.801  5.994   -4.690  1.00 0.00 ? 24  ARG A O    2  
ATOM 1903  C CB   . ARG A 1 24  ? 12.874  3.670   -3.273  1.00 0.00 ? 24  ARG A CB   2  
ATOM 1904  C CG   . ARG A 1 24  ? 13.880  4.150   -2.224  1.00 0.00 ? 24  ARG A CG   2  
ATOM 1905  C CD   . ARG A 1 24  ? 15.088  3.226   -2.268  1.00 0.00 ? 24  ARG A CD   2  
ATOM 1906  N NE   . ARG A 1 24  ? 16.155  3.675   -1.358  1.00 0.00 ? 24  ARG A NE   2  
ATOM 1907  C CZ   . ARG A 1 24  ? 16.577  3.104   -0.225  1.00 0.00 ? 24  ARG A CZ   2  
ATOM 1908  N NH1  . ARG A 1 24  ? 16.157  1.892   0.126   1.00 0.00 ? 24  ARG A NH1  2  
ATOM 1909  N NH2  . ARG A 1 24  ? 17.412  3.766   0.566   1.00 0.00 ? 24  ARG A NH2  2  
ATOM 1910  H H    . ARG A 1 24  ? 10.867  2.642   -1.940  1.00 0.00 ? 24  ARG A H    2  
ATOM 1911  H HA   . ARG A 1 24  ? 11.725  5.239   -2.504  1.00 0.00 ? 24  ARG A HA   2  
ATOM 1912  H HB2  . ARG A 1 24  ? 12.741  2.604   -3.177  1.00 0.00 ? 24  ARG A HB2  2  
ATOM 1913  H HB3  . ARG A 1 24  ? 13.284  3.862   -4.267  1.00 0.00 ? 24  ARG A HB3  2  
ATOM 1914  H HG2  . ARG A 1 24  ? 14.174  5.175   -2.435  1.00 0.00 ? 24  ARG A HG2  2  
ATOM 1915  H HG3  . ARG A 1 24  ? 13.435  4.101   -1.231  1.00 0.00 ? 24  ARG A HG3  2  
ATOM 1916  H HD2  . ARG A 1 24  ? 14.697  2.256   -1.990  1.00 0.00 ? 24  ARG A HD2  2  
ATOM 1917  H HD3  . ARG A 1 24  ? 15.484  3.179   -3.284  1.00 0.00 ? 24  ARG A HD3  2  
ATOM 1918  H HE   . ARG A 1 24  ? 16.680  4.482   -1.689  1.00 0.00 ? 24  ARG A HE   2  
ATOM 1919  H HH11 . ARG A 1 24  ? 15.633  1.325   -0.521  1.00 0.00 ? 24  ARG A HH11 2  
ATOM 1920  H HH12 . ARG A 1 24  ? 16.547  1.407   0.941   1.00 0.00 ? 24  ARG A HH12 2  
ATOM 1921  H HH21 . ARG A 1 24  ? 17.790  4.686   0.334   1.00 0.00 ? 24  ARG A HH21 2  
ATOM 1922  H HH22 . ARG A 1 24  ? 17.643  3.420   1.498   1.00 0.00 ? 24  ARG A HH22 2  
ATOM 1923  N N    . GLN A 1 25  ? 10.638  3.825   -5.325  1.00 0.00 ? 25  GLN A N    2  
ATOM 1924  C CA   . GLN A 1 25  ? 10.034  4.014   -6.642  1.00 0.00 ? 25  GLN A CA   2  
ATOM 1925  C C    . GLN A 1 25  ? 8.753   4.834   -6.550  1.00 0.00 ? 25  GLN A C    2  
ATOM 1926  O O    . GLN A 1 25  ? 8.613   5.836   -7.248  1.00 0.00 ? 25  GLN A O    2  
ATOM 1927  C CB   . GLN A 1 25  ? 9.767   2.634   -7.264  1.00 0.00 ? 25  GLN A CB   2  
ATOM 1928  C CG   . GLN A 1 25  ? 10.909  2.170   -8.171  1.00 0.00 ? 25  GLN A CG   2  
ATOM 1929  C CD   . GLN A 1 25  ? 10.567  2.420   -9.637  1.00 0.00 ? 25  GLN A CD   2  
ATOM 1930  O OE1  . GLN A 1 25  ? 10.650  3.539   -10.134 1.00 0.00 ? 25  GLN A OE1  2  
ATOM 1931  N NE2  . GLN A 1 25  ? 10.110  1.398   -10.338 1.00 0.00 ? 25  GLN A NE2  2  
ATOM 1932  H H    . GLN A 1 25  ? 10.826  2.863   -5.052  1.00 0.00 ? 25  GLN A H    2  
ATOM 1933  H HA   . GLN A 1 25  ? 10.707  4.566   -7.298  1.00 0.00 ? 25  GLN A HA   2  
ATOM 1934  H HB2  . GLN A 1 25  ? 9.609   1.891   -6.483  1.00 0.00 ? 25  GLN A HB2  2  
ATOM 1935  H HB3  . GLN A 1 25  ? 8.861   2.670   -7.861  1.00 0.00 ? 25  GLN A HB3  2  
ATOM 1936  H HG2  . GLN A 1 25  ? 11.838  2.684   -7.919  1.00 0.00 ? 25  GLN A HG2  2  
ATOM 1937  H HG3  . GLN A 1 25  ? 11.065  1.103   -8.016  1.00 0.00 ? 25  GLN A HG3  2  
ATOM 1938  H HE21 . GLN A 1 25  ? 10.006  0.504   -9.872  1.00 0.00 ? 25  GLN A HE21 2  
ATOM 1939  H HE22 . GLN A 1 25  ? 10.102  1.444   -11.355 1.00 0.00 ? 25  GLN A HE22 2  
ATOM 1940  N N    . VAL A 1 26  ? 7.816   4.430   -5.695  1.00 0.00 ? 26  VAL A N    2  
ATOM 1941  C CA   . VAL A 1 26  ? 6.521   5.086   -5.554  1.00 0.00 ? 26  VAL A CA   2  
ATOM 1942  C C    . VAL A 1 26  ? 6.722   6.572   -5.244  1.00 0.00 ? 26  VAL A C    2  
ATOM 1943  O O    . VAL A 1 26  ? 6.143   7.422   -5.916  1.00 0.00 ? 26  VAL A O    2  
ATOM 1944  C CB   . VAL A 1 26  ? 5.698   4.341   -4.486  1.00 0.00 ? 26  VAL A CB   2  
ATOM 1945  C CG1  . VAL A 1 26  ? 4.418   5.085   -4.089  1.00 0.00 ? 26  VAL A CG1  2  
ATOM 1946  C CG2  . VAL A 1 26  ? 5.331   2.935   -4.982  1.00 0.00 ? 26  VAL A CG2  2  
ATOM 1947  H H    . VAL A 1 26  ? 7.997   3.596   -5.143  1.00 0.00 ? 26  VAL A H    2  
ATOM 1948  H HA   . VAL A 1 26  ? 6.001   5.016   -6.508  1.00 0.00 ? 26  VAL A HA   2  
ATOM 1949  H HB   . VAL A 1 26  ? 6.307   4.234   -3.588  1.00 0.00 ? 26  VAL A HB   2  
ATOM 1950  H HG11 . VAL A 1 26  ? 3.863   4.511   -3.355  1.00 0.00 ? 26  VAL A HG11 2  
ATOM 1951  H HG12 . VAL A 1 26  ? 4.671   6.039   -3.632  1.00 0.00 ? 26  VAL A HG12 2  
ATOM 1952  H HG13 . VAL A 1 26  ? 3.792   5.262   -4.964  1.00 0.00 ? 26  VAL A HG13 2  
ATOM 1953  H HG21 . VAL A 1 26  ? 5.129   2.286   -4.137  1.00 0.00 ? 26  VAL A HG21 2  
ATOM 1954  H HG22 . VAL A 1 26  ? 4.474   2.966   -5.654  1.00 0.00 ? 26  VAL A HG22 2  
ATOM 1955  H HG23 . VAL A 1 26  ? 6.163   2.486   -5.506  1.00 0.00 ? 26  VAL A HG23 2  
ATOM 1956  N N    . LYS A 1 27  ? 7.547   6.898   -4.244  1.00 0.00 ? 27  LYS A N    2  
ATOM 1957  C CA   . LYS A 1 27  ? 7.795   8.275   -3.820  1.00 0.00 ? 27  LYS A CA   2  
ATOM 1958  C C    . LYS A 1 27  ? 8.312   9.123   -4.988  1.00 0.00 ? 27  LYS A C    2  
ATOM 1959  O O    . LYS A 1 27  ? 7.900   10.280  -5.110  1.00 0.00 ? 27  LYS A O    2  
ATOM 1960  C CB   . LYS A 1 27  ? 8.761   8.267   -2.621  1.00 0.00 ? 27  LYS A CB   2  
ATOM 1961  C CG   . LYS A 1 27  ? 8.083   7.774   -1.329  1.00 0.00 ? 27  LYS A CG   2  
ATOM 1962  C CD   . LYS A 1 27  ? 9.012   7.059   -0.340  1.00 0.00 ? 27  LYS A CD   2  
ATOM 1963  C CE   . LYS A 1 27  ? 10.171  7.863   0.239   1.00 0.00 ? 27  LYS A CE   2  
ATOM 1964  N NZ   . LYS A 1 27  ? 9.786   8.988   1.115   1.00 0.00 ? 27  LYS A NZ   2  
ATOM 1965  H H    . LYS A 1 27  ? 8.030   6.143   -3.763  1.00 0.00 ? 27  LYS A H    2  
ATOM 1966  H HA   . LYS A 1 27  ? 6.849   8.715   -3.505  1.00 0.00 ? 27  LYS A HA   2  
ATOM 1967  H HB2  . LYS A 1 27  ? 9.600   7.619   -2.865  1.00 0.00 ? 27  LYS A HB2  2  
ATOM 1968  H HB3  . LYS A 1 27  ? 9.135   9.276   -2.453  1.00 0.00 ? 27  LYS A HB3  2  
ATOM 1969  H HG2  . LYS A 1 27  ? 7.615   8.619   -0.831  1.00 0.00 ? 27  LYS A HG2  2  
ATOM 1970  H HG3  . LYS A 1 27  ? 7.297   7.065   -1.590  1.00 0.00 ? 27  LYS A HG3  2  
ATOM 1971  H HD2  . LYS A 1 27  ? 8.421   6.661   0.479   1.00 0.00 ? 27  LYS A HD2  2  
ATOM 1972  H HD3  . LYS A 1 27  ? 9.461   6.207   -0.840  1.00 0.00 ? 27  LYS A HD3  2  
ATOM 1973  H HE2  . LYS A 1 27  ? 10.756  7.156   0.827   1.00 0.00 ? 27  LYS A HE2  2  
ATOM 1974  H HE3  . LYS A 1 27  ? 10.799  8.236   -0.572  1.00 0.00 ? 27  LYS A HE3  2  
ATOM 1975  H HZ1  . LYS A 1 27  ? 10.630  9.366   1.536   1.00 0.00 ? 27  LYS A HZ1  2  
ATOM 1976  H HZ2  . LYS A 1 27  ? 9.371   9.758   0.601   1.00 0.00 ? 27  LYS A HZ2  2  
ATOM 1977  H HZ3  . LYS A 1 27  ? 9.159   8.714   1.864   1.00 0.00 ? 27  LYS A HZ3  2  
ATOM 1978  N N    . GLU A 1 28  ? 9.144   8.556   -5.864  1.00 0.00 ? 28  GLU A N    2  
ATOM 1979  C CA   . GLU A 1 28  ? 9.673   9.253   -7.033  1.00 0.00 ? 28  GLU A CA   2  
ATOM 1980  C C    . GLU A 1 28  ? 8.590   9.413   -8.096  1.00 0.00 ? 28  GLU A C    2  
ATOM 1981  O O    . GLU A 1 28  ? 8.344   10.532  -8.525  1.00 0.00 ? 28  GLU A O    2  
ATOM 1982  C CB   . GLU A 1 28  ? 10.894  8.521   -7.606  1.00 0.00 ? 28  GLU A CB   2  
ATOM 1983  C CG   . GLU A 1 28  ? 12.067  8.473   -6.621  1.00 0.00 ? 28  GLU A CG   2  
ATOM 1984  C CD   . GLU A 1 28  ? 12.913  9.743   -6.563  1.00 0.00 ? 28  GLU A CD   2  
ATOM 1985  O OE1  . GLU A 1 28  ? 12.362  10.855  -6.405  1.00 0.00 ? 28  GLU A OE1  2  
ATOM 1986  O OE2  . GLU A 1 28  ? 14.161  9.611   -6.611  1.00 0.00 ? 28  GLU A OE2  2  
ATOM 1987  H H    . GLU A 1 28  ? 9.400   7.585   -5.748  1.00 0.00 ? 28  GLU A H    2  
ATOM 1988  H HA   . GLU A 1 28  ? 9.983   10.255  -6.729  1.00 0.00 ? 28  GLU A HA   2  
ATOM 1989  H HB2  . GLU A 1 28  ? 10.609  7.498   -7.850  1.00 0.00 ? 28  GLU A HB2  2  
ATOM 1990  H HB3  . GLU A 1 28  ? 11.219  9.009   -8.526  1.00 0.00 ? 28  GLU A HB3  2  
ATOM 1991  H HG2  . GLU A 1 28  ? 11.697  8.276   -5.616  1.00 0.00 ? 28  GLU A HG2  2  
ATOM 1992  H HG3  . GLU A 1 28  ? 12.709  7.646   -6.923  1.00 0.00 ? 28  GLU A HG3  2  
ATOM 1993  N N    . LYS A 1 29  ? 7.888   8.351   -8.511  1.00 0.00 ? 29  LYS A N    2  
ATOM 1994  C CA   . LYS A 1 29  ? 6.844   8.472   -9.538  1.00 0.00 ? 29  LYS A CA   2  
ATOM 1995  C C    . LYS A 1 29  ? 5.748   9.448   -9.104  1.00 0.00 ? 29  LYS A C    2  
ATOM 1996  O O    . LYS A 1 29  ? 5.167   10.150  -9.936  1.00 0.00 ? 29  LYS A O    2  
ATOM 1997  C CB   . LYS A 1 29  ? 6.283   7.088   -9.882  1.00 0.00 ? 29  LYS A CB   2  
ATOM 1998  C CG   . LYS A 1 29  ? 5.384   7.130   -11.132 1.00 0.00 ? 29  LYS A CG   2  
ATOM 1999  C CD   . LYS A 1 29  ? 4.938   5.712   -11.478 1.00 0.00 ? 29  LYS A CD   2  
ATOM 2000  C CE   . LYS A 1 29  ? 4.068   5.619   -12.734 1.00 0.00 ? 29  LYS A CE   2  
ATOM 2001  N NZ   . LYS A 1 29  ? 4.854   5.383   -13.962 1.00 0.00 ? 29  LYS A NZ   2  
ATOM 2002  H H    . LYS A 1 29  ? 8.129   7.432   -8.150  1.00 0.00 ? 29  LYS A H    2  
ATOM 2003  H HA   . LYS A 1 29  ? 7.312   8.863   -10.441 1.00 0.00 ? 29  LYS A HA   2  
ATOM 2004  H HB2  . LYS A 1 29  ? 7.119   6.413   -10.078 1.00 0.00 ? 29  LYS A HB2  2  
ATOM 2005  H HB3  . LYS A 1 29  ? 5.724   6.702   -9.030  1.00 0.00 ? 29  LYS A HB3  2  
ATOM 2006  H HG2  . LYS A 1 29  ? 4.501   7.734   -10.935 1.00 0.00 ? 29  LYS A HG2  2  
ATOM 2007  H HG3  . LYS A 1 29  ? 5.935   7.556   -11.972 1.00 0.00 ? 29  LYS A HG3  2  
ATOM 2008  H HD2  . LYS A 1 29  ? 5.831   5.104   -11.599 1.00 0.00 ? 29  LYS A HD2  2  
ATOM 2009  H HD3  . LYS A 1 29  ? 4.351   5.329   -10.644 1.00 0.00 ? 29  LYS A HD3  2  
ATOM 2010  H HE2  . LYS A 1 29  ? 3.380   4.782   -12.603 1.00 0.00 ? 29  LYS A HE2  2  
ATOM 2011  H HE3  . LYS A 1 29  ? 3.474   6.525   -12.837 1.00 0.00 ? 29  LYS A HE3  2  
ATOM 2012  H HZ1  . LYS A 1 29  ? 5.320   6.219   -14.290 1.00 0.00 ? 29  LYS A HZ1  2  
ATOM 2013  H HZ2  . LYS A 1 29  ? 5.583   4.689   -13.823 1.00 0.00 ? 29  LYS A HZ2  2  
ATOM 2014  H HZ3  . LYS A 1 29  ? 4.252   5.044   -14.707 1.00 0.00 ? 29  LYS A HZ3  2  
ATOM 2015  N N    . LEU A 1 30  ? 5.447   9.506   -7.806  1.00 0.00 ? 30  LEU A N    2  
ATOM 2016  C CA   . LEU A 1 30  ? 4.559   10.507  -7.234  1.00 0.00 ? 30  LEU A CA   2  
ATOM 2017  C C    . LEU A 1 30  ? 5.165   11.893  -7.421  1.00 0.00 ? 30  LEU A C    2  
ATOM 2018  O O    . LEU A 1 30  ? 4.523   12.744  -8.038  1.00 0.00 ? 30  LEU A O    2  
ATOM 2019  C CB   . LEU A 1 30  ? 4.290   10.213  -5.750  1.00 0.00 ? 30  LEU A CB   2  
ATOM 2020  C CG   . LEU A 1 30  ? 3.408   8.971   -5.535  1.00 0.00 ? 30  LEU A CG   2  
ATOM 2021  C CD1  . LEU A 1 30  ? 3.422   8.582   -4.058  1.00 0.00 ? 30  LEU A CD1  2  
ATOM 2022  C CD2  . LEU A 1 30  ? 1.962   9.218   -5.951  1.00 0.00 ? 30  LEU A CD2  2  
ATOM 2023  H H    . LEU A 1 30  ? 5.934   8.873   -7.179  1.00 0.00 ? 30  LEU A H    2  
ATOM 2024  H HA   . LEU A 1 30  ? 3.620   10.490  -7.783  1.00 0.00 ? 30  LEU A HA   2  
ATOM 2025  H HB2  . LEU A 1 30  ? 5.244   10.072  -5.242  1.00 0.00 ? 30  LEU A HB2  2  
ATOM 2026  H HB3  . LEU A 1 30  ? 3.803   11.077  -5.298  1.00 0.00 ? 30  LEU A HB3  2  
ATOM 2027  H HG   . LEU A 1 30  ? 3.786   8.136   -6.118  1.00 0.00 ? 30  LEU A HG   2  
ATOM 2028  H HD11 . LEU A 1 30  ? 2.949   9.361   -3.464  1.00 0.00 ? 30  LEU A HD11 2  
ATOM 2029  H HD12 . LEU A 1 30  ? 2.878   7.649   -3.935  1.00 0.00 ? 30  LEU A HD12 2  
ATOM 2030  H HD13 . LEU A 1 30  ? 4.449   8.436   -3.728  1.00 0.00 ? 30  LEU A HD13 2  
ATOM 2031  H HD21 . LEU A 1 30  ? 1.389   8.307   -5.804  1.00 0.00 ? 30  LEU A HD21 2  
ATOM 2032  H HD22 . LEU A 1 30  ? 1.549   10.022  -5.346  1.00 0.00 ? 30  LEU A HD22 2  
ATOM 2033  H HD23 . LEU A 1 30  ? 1.900   9.471   -7.005  1.00 0.00 ? 30  LEU A HD23 2  
ATOM 2034  N N    . ALA A 1 31  ? 6.394   12.109  -6.936  1.00 0.00 ? 31  ALA A N    2  
ATOM 2035  C CA   . ALA A 1 31  ? 7.108   13.378  -7.042  1.00 0.00 ? 31  ALA A CA   2  
ATOM 2036  C C    . ALA A 1 31  ? 7.169   13.864  -8.493  1.00 0.00 ? 31  ALA A C    2  
ATOM 2037  O O    . ALA A 1 31  ? 6.956   15.048  -8.747  1.00 0.00 ? 31  ALA A O    2  
ATOM 2038  C CB   . ALA A 1 31  ? 8.521   13.244  -6.457  1.00 0.00 ? 31  ALA A CB   2  
ATOM 2039  H H    . ALA A 1 31  ? 6.893   11.333  -6.516  1.00 0.00 ? 31  ALA A H    2  
ATOM 2040  H HA   . ALA A 1 31  ? 6.563   14.123  -6.460  1.00 0.00 ? 31  ALA A HA   2  
ATOM 2041  H HB1  . ALA A 1 31  ? 9.021   14.211  -6.520  1.00 0.00 ? 31  ALA A HB1  2  
ATOM 2042  H HB2  . ALA A 1 31  ? 8.485   12.940  -5.413  1.00 0.00 ? 31  ALA A HB2  2  
ATOM 2043  H HB3  . ALA A 1 31  ? 9.109   12.510  -7.012  1.00 0.00 ? 31  ALA A HB3  2  
ATOM 2044  N N    . LYS A 1 32  ? 7.394   12.959  -9.447  1.00 0.00 ? 32  LYS A N    2  
ATOM 2045  C CA   . LYS A 1 32  ? 7.492   13.247  -10.870 1.00 0.00 ? 32  LYS A CA   2  
ATOM 2046  C C    . LYS A 1 32  ? 6.230   13.938  -11.393 1.00 0.00 ? 32  LYS A C    2  
ATOM 2047  O O    . LYS A 1 32  ? 6.337   14.864  -12.188 1.00 0.00 ? 32  LYS A O    2  
ATOM 2048  C CB   . LYS A 1 32  ? 7.811   11.946  -11.634 1.00 0.00 ? 32  LYS A CB   2  
ATOM 2049  C CG   . LYS A 1 32  ? 8.496   12.262  -12.968 1.00 0.00 ? 32  LYS A CG   2  
ATOM 2050  C CD   . LYS A 1 32  ? 8.772   11.031  -13.841 1.00 0.00 ? 32  LYS A CD   2  
ATOM 2051  C CE   . LYS A 1 32  ? 9.972   10.213  -13.347 1.00 0.00 ? 32  LYS A CE   2  
ATOM 2052  N NZ   . LYS A 1 32  ? 10.403  9.238   -14.370 1.00 0.00 ? 32  LYS A NZ   2  
ATOM 2053  H H    . LYS A 1 32  ? 7.619   12.018  -9.142  1.00 0.00 ? 32  LYS A H    2  
ATOM 2054  H HA   . LYS A 1 32  ? 8.327   13.936  -10.998 1.00 0.00 ? 32  LYS A HA   2  
ATOM 2055  H HB2  . LYS A 1 32  ? 8.492   11.329  -11.045 1.00 0.00 ? 32  LYS A HB2  2  
ATOM 2056  H HB3  . LYS A 1 32  ? 6.891   11.385  -11.810 1.00 0.00 ? 32  LYS A HB3  2  
ATOM 2057  H HG2  . LYS A 1 32  ? 7.861   12.944  -13.534 1.00 0.00 ? 32  LYS A HG2  2  
ATOM 2058  H HG3  . LYS A 1 32  ? 9.441   12.766  -12.769 1.00 0.00 ? 32  LYS A HG3  2  
ATOM 2059  H HD2  . LYS A 1 32  ? 7.885   10.398  -13.886 1.00 0.00 ? 32  LYS A HD2  2  
ATOM 2060  H HD3  . LYS A 1 32  ? 8.989   11.392  -14.847 1.00 0.00 ? 32  LYS A HD3  2  
ATOM 2061  H HE2  . LYS A 1 32  ? 10.802  10.893  -13.141 1.00 0.00 ? 32  LYS A HE2  2  
ATOM 2062  H HE3  . LYS A 1 32  ? 9.710   9.695   -12.423 1.00 0.00 ? 32  LYS A HE3  2  
ATOM 2063  H HZ1  . LYS A 1 32  ? 9.686   8.547   -14.569 1.00 0.00 ? 32  LYS A HZ1  2  
ATOM 2064  H HZ2  . LYS A 1 32  ? 10.650  9.735   -15.223 1.00 0.00 ? 32  LYS A HZ2  2  
ATOM 2065  H HZ3  . LYS A 1 32  ? 11.256  8.763   -14.092 1.00 0.00 ? 32  LYS A HZ3  2  
ATOM 2066  N N    . ASN A 1 33  ? 5.039   13.551  -10.922 1.00 0.00 ? 33  ASN A N    2  
ATOM 2067  C CA   . ASN A 1 33  ? 3.784   14.235  -11.267 1.00 0.00 ? 33  ASN A CA   2  
ATOM 2068  C C    . ASN A 1 33  ? 3.370   15.276  -10.213 1.00 0.00 ? 33  ASN A C    2  
ATOM 2069  O O    . ASN A 1 33  ? 2.291   15.858  -10.320 1.00 0.00 ? 33  ASN A O    2  
ATOM 2070  C CB   . ASN A 1 33  ? 2.656   13.225  -11.558 1.00 0.00 ? 33  ASN A CB   2  
ATOM 2071  C CG   . ASN A 1 33  ? 2.551   12.895  -13.039 1.00 0.00 ? 33  ASN A CG   2  
ATOM 2072  O OD1  . ASN A 1 33  ? 2.236   13.757  -13.854 1.00 0.00 ? 33  ASN A OD1  2  
ATOM 2073  N ND2  . ASN A 1 33  ? 2.823   11.666  -13.439 1.00 0.00 ? 33  ASN A ND2  2  
ATOM 2074  H H    . ASN A 1 33  ? 5.027   12.845  -10.197 1.00 0.00 ? 33  ASN A H    2  
ATOM 2075  H HA   . ASN A 1 33  ? 3.947   14.797  -12.183 1.00 0.00 ? 33  ASN A HA   2  
ATOM 2076  H HB2  . ASN A 1 33  ? 2.796   12.329  -10.959 1.00 0.00 ? 33  ASN A HB2  2  
ATOM 2077  H HB3  . ASN A 1 33  ? 1.694   13.658  -11.280 1.00 0.00 ? 33  ASN A HB3  2  
ATOM 2078  H HD21 . ASN A 1 33  ? 2.890   10.926  -12.741 1.00 0.00 ? 33  ASN A HD21 2  
ATOM 2079  H HD22 . ASN A 1 33  ? 2.550   11.412  -14.377 1.00 0.00 ? 33  ASN A HD22 2  
ATOM 2080  N N    . GLY A 1 34  ? 4.192   15.520  -9.190  1.00 0.00 ? 34  GLY A N    2  
ATOM 2081  C CA   . GLY A 1 34  ? 3.883   16.422  -8.089  1.00 0.00 ? 34  GLY A CA   2  
ATOM 2082  C C    . GLY A 1 34  ? 2.750   15.899  -7.201  1.00 0.00 ? 34  GLY A C    2  
ATOM 2083  O O    . GLY A 1 34  ? 2.081   16.689  -6.534  1.00 0.00 ? 34  GLY A O    2  
ATOM 2084  H H    . GLY A 1 34  ? 5.098   15.071  -9.164  1.00 0.00 ? 34  GLY A H    2  
ATOM 2085  H HA2  . GLY A 1 34  ? 4.778   16.551  -7.480  1.00 0.00 ? 34  GLY A HA2  2  
ATOM 2086  H HA3  . GLY A 1 34  ? 3.604   17.394  -8.498  1.00 0.00 ? 34  GLY A HA3  2  
ATOM 2087  N N    . ILE A 1 35  ? 2.480   14.595  -7.215  1.00 0.00 ? 35  ILE A N    2  
ATOM 2088  C CA   . ILE A 1 35  ? 1.361   14.002  -6.496  1.00 0.00 ? 35  ILE A CA   2  
ATOM 2089  C C    . ILE A 1 35  ? 1.706   14.018  -5.011  1.00 0.00 ? 35  ILE A C    2  
ATOM 2090  O O    . ILE A 1 35  ? 2.722   13.459  -4.592  1.00 0.00 ? 35  ILE A O    2  
ATOM 2091  C CB   . ILE A 1 35  ? 1.044   12.588  -7.014  1.00 0.00 ? 35  ILE A CB   2  
ATOM 2092  C CG1  . ILE A 1 35  ? 0.756   12.672  -8.527  1.00 0.00 ? 35  ILE A CG1  2  
ATOM 2093  C CG2  . ILE A 1 35  ? -0.153  11.996  -6.241  1.00 0.00 ? 35  ILE A CG2  2  
ATOM 2094  C CD1  . ILE A 1 35  ? 0.441   11.328  -9.172  1.00 0.00 ? 35  ILE A CD1  2  
ATOM 2095  H H    . ILE A 1 35  ? 3.116   13.976  -7.704  1.00 0.00 ? 35  ILE A H    2  
ATOM 2096  H HA   . ILE A 1 35  ? 0.476   14.611  -6.678  1.00 0.00 ? 35  ILE A HA   2  
ATOM 2097  H HB   . ILE A 1 35  ? 1.915   11.954  -6.857  1.00 0.00 ? 35  ILE A HB   2  
ATOM 2098  H HG12 . ILE A 1 35  ? -0.073  13.357  -8.709  1.00 0.00 ? 35  ILE A HG12 2  
ATOM 2099  H HG13 . ILE A 1 35  ? 1.635   13.064  -9.029  1.00 0.00 ? 35  ILE A HG13 2  
ATOM 2100  H HG21 . ILE A 1 35  ? 0.072   11.926  -5.177  1.00 0.00 ? 35  ILE A HG21 2  
ATOM 2101  H HG22 . ILE A 1 35  ? -1.034  12.621  -6.373  1.00 0.00 ? 35  ILE A HG22 2  
ATOM 2102  H HG23 . ILE A 1 35  ? -0.383  10.990  -6.589  1.00 0.00 ? 35  ILE A HG23 2  
ATOM 2103  H HD11 . ILE A 1 35  ? 1.215   10.606  -8.921  1.00 0.00 ? 35  ILE A HD11 2  
ATOM 2104  H HD12 . ILE A 1 35  ? -0.527  10.981  -8.820  1.00 0.00 ? 35  ILE A HD12 2  
ATOM 2105  H HD13 . ILE A 1 35  ? 0.402   11.453  -10.252 1.00 0.00 ? 35  ILE A HD13 2  
ATOM 2106  N N    . CYS A 1 36  ? 0.851   14.649  -4.210  1.00 0.00 ? 36  CYS A N    2  
ATOM 2107  C CA   . CYS A 1 36  ? 0.972   14.630  -2.767  1.00 0.00 ? 36  CYS A CA   2  
ATOM 2108  C C    . CYS A 1 36  ? 0.797   13.193  -2.268  1.00 0.00 ? 36  CYS A C    2  
ATOM 2109  O O    . CYS A 1 36  ? -0.252  12.586  -2.497  1.00 0.00 ? 36  CYS A O    2  
ATOM 2110  C CB   . CYS A 1 36  ? -0.093  15.537  -2.149  1.00 0.00 ? 36  CYS A CB   2  
ATOM 2111  S SG   . CYS A 1 36  ? -0.035  17.212  -2.842  1.00 0.00 ? 36  CYS A SG   2  
ATOM 2112  H H    . CYS A 1 36  ? 0.057   15.111  -4.623  1.00 0.00 ? 36  CYS A H    2  
ATOM 2113  H HA   . CYS A 1 36  ? 1.963   15.000  -2.497  1.00 0.00 ? 36  CYS A HA   2  
ATOM 2114  H HB2  . CYS A 1 36  ? -1.080  15.105  -2.315  1.00 0.00 ? 36  CYS A HB2  2  
ATOM 2115  H HB3  . CYS A 1 36  ? 0.099   15.588  -1.081  1.00 0.00 ? 36  CYS A HB3  2  
ATOM 2116  H HG   . CYS A 1 36  ? 1.283   17.412  -2.660  1.00 0.00 ? 36  CYS A HG   2  
ATOM 2117  N N    . GLN A 1 37  ? 1.778   12.672  -1.532  1.00 0.00 ? 37  GLN A N    2  
ATOM 2118  C CA   . GLN A 1 37  ? 1.734   11.350  -0.917  1.00 0.00 ? 37  GLN A CA   2  
ATOM 2119  C C    . GLN A 1 37  ? 0.520   11.184  0.003   1.00 0.00 ? 37  GLN A C    2  
ATOM 2120  O O    . GLN A 1 37  ? -0.054  10.095  0.045   1.00 0.00 ? 37  GLN A O    2  
ATOM 2121  C CB   . GLN A 1 37  ? 3.035   11.110  -0.141  1.00 0.00 ? 37  GLN A CB   2  
ATOM 2122  C CG   . GLN A 1 37  ? 4.168   10.635  -1.059  1.00 0.00 ? 37  GLN A CG   2  
ATOM 2123  C CD   . GLN A 1 37  ? 5.506   10.637  -0.329  1.00 0.00 ? 37  GLN A CD   2  
ATOM 2124  O OE1  . GLN A 1 37  ? 5.603   10.263  0.836   1.00 0.00 ? 37  GLN A OE1  2  
ATOM 2125  N NE2  . GLN A 1 37  ? 6.569   11.058  -0.980  1.00 0.00 ? 37  GLN A NE2  2  
ATOM 2126  H H    . GLN A 1 37  ? 2.573   13.260  -1.317  1.00 0.00 ? 37  GLN A H    2  
ATOM 2127  H HA   . GLN A 1 37  ? 1.655   10.601  -1.705  1.00 0.00 ? 37  GLN A HA   2  
ATOM 2128  H HB2  . GLN A 1 37  ? 3.333   12.022  0.379   1.00 0.00 ? 37  GLN A HB2  2  
ATOM 2129  H HB3  . GLN A 1 37  ? 2.866   10.340  0.610   1.00 0.00 ? 37  GLN A HB3  2  
ATOM 2130  H HG2  . GLN A 1 37  ? 3.956   9.616   -1.379  1.00 0.00 ? 37  GLN A HG2  2  
ATOM 2131  H HG3  . GLN A 1 37  ? 4.218   11.272  -1.946  1.00 0.00 ? 37  GLN A HG3  2  
ATOM 2132  H HE21 . GLN A 1 37  ? 6.507   11.425  -1.931  1.00 0.00 ? 37  GLN A HE21 2  
ATOM 2133  H HE22 . GLN A 1 37  ? 7.425   11.168  -0.449  1.00 0.00 ? 37  GLN A HE22 2  
ATOM 2134  N N    . ARG A 1 38  ? 0.098   12.249  0.699   1.00 0.00 ? 38  ARG A N    2  
ATOM 2135  C CA   . ARG A 1 38  ? -1.142  12.245  1.482   1.00 0.00 ? 38  ARG A CA   2  
ATOM 2136  C C    . ARG A 1 38  ? -2.331  11.771  0.641   1.00 0.00 ? 38  ARG A C    2  
ATOM 2137  O O    . ARG A 1 38  ? -3.047  10.857  1.038   1.00 0.00 ? 38  ARG A O    2  
ATOM 2138  C CB   . ARG A 1 38  ? -1.430  13.627  2.110   1.00 0.00 ? 38  ARG A CB   2  
ATOM 2139  C CG   . ARG A 1 38  ? -1.162  14.851  1.223   1.00 0.00 ? 38  ARG A CG   2  
ATOM 2140  C CD   . ARG A 1 38  ? -2.025  16.051  1.627   1.00 0.00 ? 38  ARG A CD   2  
ATOM 2141  N NE   . ARG A 1 38  ? -1.860  17.159  0.673   1.00 0.00 ? 38  ARG A NE   2  
ATOM 2142  C CZ   . ARG A 1 38  ? -2.489  18.340  0.738   1.00 0.00 ? 38  ARG A CZ   2  
ATOM 2143  N NH1  . ARG A 1 38  ? -3.377  18.602  1.686   1.00 0.00 ? 38  ARG A NH1  2  
ATOM 2144  N NH2  . ARG A 1 38  ? -2.229  19.276  -0.162  1.00 0.00 ? 38  ARG A NH2  2  
ATOM 2145  H H    . ARG A 1 38  ? 0.660   13.088  0.649   1.00 0.00 ? 38  ARG A H    2  
ATOM 2146  H HA   . ARG A 1 38  ? -1.031  11.521  2.292   1.00 0.00 ? 38  ARG A HA   2  
ATOM 2147  H HB2  . ARG A 1 38  ? -2.488  13.643  2.379   1.00 0.00 ? 38  ARG A HB2  2  
ATOM 2148  H HB3  . ARG A 1 38  ? -0.837  13.736  3.020   1.00 0.00 ? 38  ARG A HB3  2  
ATOM 2149  H HG2  . ARG A 1 38  ? -0.108  15.124  1.295   1.00 0.00 ? 38  ARG A HG2  2  
ATOM 2150  H HG3  . ARG A 1 38  ? -1.391  14.606  0.192   1.00 0.00 ? 38  ARG A HG3  2  
ATOM 2151  H HD2  . ARG A 1 38  ? -3.077  15.755  1.636   1.00 0.00 ? 38  ARG A HD2  2  
ATOM 2152  H HD3  . ARG A 1 38  ? -1.743  16.385  2.627   1.00 0.00 ? 38  ARG A HD3  2  
ATOM 2153  H HE   . ARG A 1 38  ? -1.217  16.989  -0.090  1.00 0.00 ? 38  ARG A HE   2  
ATOM 2154  H HH11 . ARG A 1 38  ? -3.631  17.907  2.389   1.00 0.00 ? 38  ARG A HH11 2  
ATOM 2155  H HH12 . ARG A 1 38  ? -3.959  19.444  1.659   1.00 0.00 ? 38  ARG A HH12 2  
ATOM 2156  H HH21 . ARG A 1 38  ? -1.618  19.126  -0.952  1.00 0.00 ? 38  ARG A HH21 2  
ATOM 2157  H HH22 . ARG A 1 38  ? -2.693  20.178  -0.140  1.00 0.00 ? 38  ARG A HH22 2  
ATOM 2158  N N    . ILE A 1 39  ? -2.528  12.399  -0.514  1.00 0.00 ? 39  ILE A N    2  
ATOM 2159  C CA   . ILE A 1 39  ? -3.661  12.183  -1.395  1.00 0.00 ? 39  ILE A CA   2  
ATOM 2160  C C    . ILE A 1 39  ? -3.508  10.813  -2.043  1.00 0.00 ? 39  ILE A C    2  
ATOM 2161  O O    . ILE A 1 39  ? -4.480  10.072  -2.080  1.00 0.00 ? 39  ILE A O    2  
ATOM 2162  C CB   . ILE A 1 39  ? -3.729  13.345  -2.412  1.00 0.00 ? 39  ILE A CB   2  
ATOM 2163  C CG1  . ILE A 1 39  ? -4.058  14.664  -1.677  1.00 0.00 ? 39  ILE A CG1  2  
ATOM 2164  C CG2  . ILE A 1 39  ? -4.756  13.046  -3.517  1.00 0.00 ? 39  ILE A CG2  2  
ATOM 2165  C CD1  . ILE A 1 39  ? -4.002  15.885  -2.596  1.00 0.00 ? 39  ILE A CD1  2  
ATOM 2166  H H    . ILE A 1 39  ? -1.827  13.047  -0.831  1.00 0.00 ? 39  ILE A H    2  
ATOM 2167  H HA   . ILE A 1 39  ? -4.585  12.161  -0.802  1.00 0.00 ? 39  ILE A HA   2  
ATOM 2168  H HB   . ILE A 1 39  ? -2.747  13.466  -2.873  1.00 0.00 ? 39  ILE A HB   2  
ATOM 2169  H HG12 . ILE A 1 39  ? -5.037  14.595  -1.202  1.00 0.00 ? 39  ILE A HG12 2  
ATOM 2170  H HG13 . ILE A 1 39  ? -3.330  14.829  -0.886  1.00 0.00 ? 39  ILE A HG13 2  
ATOM 2171  H HG21 . ILE A 1 39  ? -4.508  12.120  -4.040  1.00 0.00 ? 39  ILE A HG21 2  
ATOM 2172  H HG22 . ILE A 1 39  ? -5.747  12.942  -3.076  1.00 0.00 ? 39  ILE A HG22 2  
ATOM 2173  H HG23 . ILE A 1 39  ? -4.773  13.841  -4.261  1.00 0.00 ? 39  ILE A HG23 2  
ATOM 2174  H HD11 . ILE A 1 39  ? -4.024  16.790  -1.989  1.00 0.00 ? 39  ILE A HD11 2  
ATOM 2175  H HD12 . ILE A 1 39  ? -3.080  15.860  -3.180  1.00 0.00 ? 39  ILE A HD12 2  
ATOM 2176  H HD13 . ILE A 1 39  ? -4.862  15.887  -3.266  1.00 0.00 ? 39  ILE A HD13 2  
ATOM 2177  N N    . PHE A 1 40  ? -2.311  10.441  -2.506  1.00 0.00 ? 40  PHE A N    2  
ATOM 2178  C CA   . PHE A 1 40  ? -2.066  9.092   -3.021  1.00 0.00 ? 40  PHE A CA   2  
ATOM 2179  C C    . PHE A 1 40  ? -2.536  8.027   -2.030  1.00 0.00 ? 40  PHE A C    2  
ATOM 2180  O O    . PHE A 1 40  ? -3.237  7.088   -2.401  1.00 0.00 ? 40  PHE A O    2  
ATOM 2181  C CB   . PHE A 1 40  ? -0.576  8.908   -3.302  1.00 0.00 ? 40  PHE A CB   2  
ATOM 2182  C CG   . PHE A 1 40  ? -0.170  7.479   -3.626  1.00 0.00 ? 40  PHE A CG   2  
ATOM 2183  C CD1  . PHE A 1 40  ? -0.596  6.860   -4.816  1.00 0.00 ? 40  PHE A CD1  2  
ATOM 2184  C CD2  . PHE A 1 40  ? 0.634   6.759   -2.723  1.00 0.00 ? 40  PHE A CD2  2  
ATOM 2185  C CE1  . PHE A 1 40  ? -0.201  5.540   -5.101  1.00 0.00 ? 40  PHE A CE1  2  
ATOM 2186  C CE2  . PHE A 1 40  ? 1.050   5.452   -3.023  1.00 0.00 ? 40  PHE A CE2  2  
ATOM 2187  C CZ   . PHE A 1 40  ? 0.624   4.834   -4.209  1.00 0.00 ? 40  PHE A CZ   2  
ATOM 2188  H H    . PHE A 1 40  ? -1.578  11.142  -2.529  1.00 0.00 ? 40  PHE A H    2  
ATOM 2189  H HA   . PHE A 1 40  ? -2.624  8.962   -3.951  1.00 0.00 ? 40  PHE A HA   2  
ATOM 2190  H HB2  . PHE A 1 40  ? -0.311  9.561   -4.122  1.00 0.00 ? 40  PHE A HB2  2  
ATOM 2191  H HB3  . PHE A 1 40  ? -0.009  9.238   -2.434  1.00 0.00 ? 40  PHE A HB3  2  
ATOM 2192  H HD1  . PHE A 1 40  ? -1.218  7.394   -5.521  1.00 0.00 ? 40  PHE A HD1  2  
ATOM 2193  H HD2  . PHE A 1 40  ? 0.949   7.214   -1.799  1.00 0.00 ? 40  PHE A HD2  2  
ATOM 2194  H HE1  . PHE A 1 40  ? -0.531  5.078   -6.019  1.00 0.00 ? 40  PHE A HE1  2  
ATOM 2195  H HE2  . PHE A 1 40  ? 1.701   4.929   -2.341  1.00 0.00 ? 40  PHE A HE2  2  
ATOM 2196  H HZ   . PHE A 1 40  ? 0.936   3.824   -4.439  1.00 0.00 ? 40  PHE A HZ   2  
ATOM 2197  N N    . GLY A 1 41  ? -2.148  8.176   -0.765  1.00 0.00 ? 41  GLY A N    2  
ATOM 2198  C CA   . GLY A 1 41  ? -2.551  7.263   0.291   1.00 0.00 ? 41  GLY A CA   2  
ATOM 2199  C C    . GLY A 1 41  ? -4.063  7.164   0.388   1.00 0.00 ? 41  GLY A C    2  
ATOM 2200  O O    . GLY A 1 41  ? -4.621  6.072   0.280   1.00 0.00 ? 41  GLY A O    2  
ATOM 2201  H H    . GLY A 1 41  ? -1.558  8.975   -0.561  1.00 0.00 ? 41  GLY A H    2  
ATOM 2202  H HA2  . GLY A 1 41  ? -2.164  6.277   0.047   1.00 0.00 ? 41  GLY A HA2  2  
ATOM 2203  H HA3  . GLY A 1 41  ? -2.162  7.610   1.247   1.00 0.00 ? 41  GLY A HA3  2  
ATOM 2204  N N    . GLU A 1 42  ? -4.715  8.309   0.539   1.00 0.00 ? 42  GLU A N    2  
ATOM 2205  C CA   . GLU A 1 42  ? -6.158  8.421   0.661   1.00 0.00 ? 42  GLU A CA   2  
ATOM 2206  C C    . GLU A 1 42  ? -6.880  7.818   -0.557  1.00 0.00 ? 42  GLU A C    2  
ATOM 2207  O O    . GLU A 1 42  ? -7.834  7.050   -0.405  1.00 0.00 ? 42  GLU A O    2  
ATOM 2208  C CB   . GLU A 1 42  ? -6.472  9.916   0.842   1.00 0.00 ? 42  GLU A CB   2  
ATOM 2209  C CG   . GLU A 1 42  ? -6.188  10.411  2.274   1.00 0.00 ? 42  GLU A CG   2  
ATOM 2210  C CD   . GLU A 1 42  ? -7.447  10.855  3.018   1.00 0.00 ? 42  GLU A CD   2  
ATOM 2211  O OE1  . GLU A 1 42  ? -8.126  11.790  2.538   1.00 0.00 ? 42  GLU A OE1  2  
ATOM 2212  O OE2  . GLU A 1 42  ? -7.703  10.385  4.152   1.00 0.00 ? 42  GLU A OE2  2  
ATOM 2213  H H    . GLU A 1 42  ? -4.176  9.164   0.629   1.00 0.00 ? 42  GLU A H    2  
ATOM 2214  H HA   . GLU A 1 42  ? -6.482  7.874   1.550   1.00 0.00 ? 42  GLU A HA   2  
ATOM 2215  H HB2  . GLU A 1 42  ? -5.861  10.495  0.151   1.00 0.00 ? 42  GLU A HB2  2  
ATOM 2216  H HB3  . GLU A 1 42  ? -7.498  10.120  0.562   1.00 0.00 ? 42  GLU A HB3  2  
ATOM 2217  H HG2  . GLU A 1 42  ? -5.680  9.640   2.855   1.00 0.00 ? 42  GLU A HG2  2  
ATOM 2218  H HG3  . GLU A 1 42  ? -5.515  11.268  2.216   1.00 0.00 ? 42  GLU A HG3  2  
ATOM 2219  N N    . LYS A 1 43  ? -6.449  8.163   -1.771  1.00 0.00 ? 43  LYS A N    2  
ATOM 2220  C CA   . LYS A 1 43  ? -7.167  7.902   -3.017  1.00 0.00 ? 43  LYS A CA   2  
ATOM 2221  C C    . LYS A 1 43  ? -6.867  6.520   -3.580  1.00 0.00 ? 43  LYS A C    2  
ATOM 2222  O O    . LYS A 1 43  ? -7.786  5.915   -4.132  1.00 0.00 ? 43  LYS A O    2  
ATOM 2223  C CB   . LYS A 1 43  ? -6.811  8.978   -4.063  1.00 0.00 ? 43  LYS A CB   2  
ATOM 2224  C CG   . LYS A 1 43  ? -7.273  10.394  -3.675  1.00 0.00 ? 43  LYS A CG   2  
ATOM 2225  C CD   . LYS A 1 43  ? -8.779  10.629  -3.853  1.00 0.00 ? 43  LYS A CD   2  
ATOM 2226  C CE   . LYS A 1 43  ? -9.086  11.127  -5.268  1.00 0.00 ? 43  LYS A CE   2  
ATOM 2227  N NZ   . LYS A 1 43  ? -10.522 11.417  -5.455  1.00 0.00 ? 43  LYS A NZ   2  
ATOM 2228  H H    . LYS A 1 43  ? -5.636  8.769   -1.812  1.00 0.00 ? 43  LYS A H    2  
ATOM 2229  H HA   . LYS A 1 43  ? -8.236  7.946   -2.812  1.00 0.00 ? 43  LYS A HA   2  
ATOM 2230  H HB2  . LYS A 1 43  ? -5.729  8.988   -4.205  1.00 0.00 ? 43  LYS A HB2  2  
ATOM 2231  H HB3  . LYS A 1 43  ? -7.262  8.718   -5.020  1.00 0.00 ? 43  LYS A HB3  2  
ATOM 2232  H HG2  . LYS A 1 43  ? -7.011  10.593  -2.636  1.00 0.00 ? 43  LYS A HG2  2  
ATOM 2233  H HG3  . LYS A 1 43  ? -6.733  11.112  -4.291  1.00 0.00 ? 43  LYS A HG3  2  
ATOM 2234  H HD2  . LYS A 1 43  ? -9.334  9.716   -3.646  1.00 0.00 ? 43  LYS A HD2  2  
ATOM 2235  H HD3  . LYS A 1 43  ? -9.090  11.390  -3.138  1.00 0.00 ? 43  LYS A HD3  2  
ATOM 2236  H HE2  . LYS A 1 43  ? -8.515  12.041  -5.444  1.00 0.00 ? 43  LYS A HE2  2  
ATOM 2237  H HE3  . LYS A 1 43  ? -8.769  10.374  -5.989  1.00 0.00 ? 43  LYS A HE3  2  
ATOM 2238  H HZ1  . LYS A 1 43  ? -10.843 12.089  -4.765  1.00 0.00 ? 43  LYS A HZ1  2  
ATOM 2239  H HZ2  . LYS A 1 43  ? -10.702 11.774  -6.389  1.00 0.00 ? 43  LYS A HZ2  2  
ATOM 2240  H HZ3  . LYS A 1 43  ? -11.074 10.570  -5.362  1.00 0.00 ? 43  LYS A HZ3  2  
ATOM 2241  N N    . VAL A 1 44  ? -5.625  6.043   -3.503  1.00 0.00 ? 44  VAL A N    2  
ATOM 2242  C CA   . VAL A 1 44  ? -5.199  4.792   -4.137  1.00 0.00 ? 44  VAL A CA   2  
ATOM 2243  C C    . VAL A 1 44  ? -5.115  3.671   -3.108  1.00 0.00 ? 44  VAL A C    2  
ATOM 2244  O O    . VAL A 1 44  ? -5.661  2.585   -3.318  1.00 0.00 ? 44  VAL A O    2  
ATOM 2245  C CB   . VAL A 1 44  ? -3.853  4.986   -4.871  1.00 0.00 ? 44  VAL A CB   2  
ATOM 2246  C CG1  . VAL A 1 44  ? -3.344  3.658   -5.451  1.00 0.00 ? 44  VAL A CG1  2  
ATOM 2247  C CG2  . VAL A 1 44  ? -3.995  6.011   -6.007  1.00 0.00 ? 44  VAL A CG2  2  
ATOM 2248  H H    . VAL A 1 44  ? -4.911  6.625   -3.075  1.00 0.00 ? 44  VAL A H    2  
ATOM 2249  H HA   . VAL A 1 44  ? -5.943  4.492   -4.872  1.00 0.00 ? 44  VAL A HA   2  
ATOM 2250  H HB   . VAL A 1 44  ? -3.104  5.345   -4.165  1.00 0.00 ? 44  VAL A HB   2  
ATOM 2251  H HG11 . VAL A 1 44  ? -2.977  3.015   -4.650  1.00 0.00 ? 44  VAL A HG11 2  
ATOM 2252  H HG12 . VAL A 1 44  ? -4.159  3.149   -5.964  1.00 0.00 ? 44  VAL A HG12 2  
ATOM 2253  H HG13 . VAL A 1 44  ? -2.525  3.831   -6.147  1.00 0.00 ? 44  VAL A HG13 2  
ATOM 2254  H HG21 . VAL A 1 44  ? -4.770  5.683   -6.700  1.00 0.00 ? 44  VAL A HG21 2  
ATOM 2255  H HG22 . VAL A 1 44  ? -4.257  6.990   -5.609  1.00 0.00 ? 44  VAL A HG22 2  
ATOM 2256  H HG23 . VAL A 1 44  ? -3.055  6.099   -6.552  1.00 0.00 ? 44  VAL A HG23 2  
ATOM 2257  N N    . LEU A 1 45  ? -4.371  3.907   -2.026  1.00 0.00 ? 45  LEU A N    2  
ATOM 2258  C CA   . LEU A 1 45  ? -4.075  2.859   -1.057  1.00 0.00 ? 45  LEU A CA   2  
ATOM 2259  C C    . LEU A 1 45  ? -5.277  2.626   -0.148  1.00 0.00 ? 45  LEU A C    2  
ATOM 2260  O O    . LEU A 1 45  ? -5.495  1.496   0.289   1.00 0.00 ? 45  LEU A O    2  
ATOM 2261  C CB   . LEU A 1 45  ? -2.807  3.207   -0.254  1.00 0.00 ? 45  LEU A CB   2  
ATOM 2262  C CG   . LEU A 1 45  ? -1.543  3.329   -1.134  1.00 0.00 ? 45  LEU A CG   2  
ATOM 2263  C CD1  . LEU A 1 45  ? -0.354  3.856   -0.330  1.00 0.00 ? 45  LEU A CD1  2  
ATOM 2264  C CD2  . LEU A 1 45  ? -1.130  1.972   -1.692  1.00 0.00 ? 45  LEU A CD2  2  
ATOM 2265  H H    . LEU A 1 45  ? -3.983  4.834   -1.895  1.00 0.00 ? 45  LEU A H    2  
ATOM 2266  H HA   . LEU A 1 45  ? -3.907  1.926   -1.593  1.00 0.00 ? 45  LEU A HA   2  
ATOM 2267  H HB2  . LEU A 1 45  ? -2.967  4.141   0.281   1.00 0.00 ? 45  LEU A HB2  2  
ATOM 2268  H HB3  . LEU A 1 45  ? -2.647  2.426   0.490   1.00 0.00 ? 45  LEU A HB3  2  
ATOM 2269  H HG   . LEU A 1 45  ? -1.725  4.013   -1.963  1.00 0.00 ? 45  LEU A HG   2  
ATOM 2270  H HD11 . LEU A 1 45  ? 0.571   3.694   -0.878  1.00 0.00 ? 45  LEU A HD11 2  
ATOM 2271  H HD12 . LEU A 1 45  ? -0.471  4.926   -0.195  1.00 0.00 ? 45  LEU A HD12 2  
ATOM 2272  H HD13 . LEU A 1 45  ? -0.281  3.349   0.630   1.00 0.00 ? 45  LEU A HD13 2  
ATOM 2273  H HD21 . LEU A 1 45  ? -0.275  2.095   -2.351  1.00 0.00 ? 45  LEU A HD21 2  
ATOM 2274  H HD22 . LEU A 1 45  ? -0.865  1.323   -0.860  1.00 0.00 ? 45  LEU A HD22 2  
ATOM 2275  H HD23 . LEU A 1 45  ? -1.933  1.533   -2.277  1.00 0.00 ? 45  LEU A HD23 2  
ATOM 2276  N N    . GLY A 1 46  ? -6.070  3.671   0.096   1.00 0.00 ? 46  GLY A N    2  
ATOM 2277  C CA   . GLY A 1 46  ? -7.131  3.674   1.082   1.00 0.00 ? 46  GLY A CA   2  
ATOM 2278  C C    . GLY A 1 46  ? -6.555  3.767   2.493   1.00 0.00 ? 46  GLY A C    2  
ATOM 2279  O O    . GLY A 1 46  ? -7.105  3.149   3.408   1.00 0.00 ? 46  GLY A O    2  
ATOM 2280  H H    . GLY A 1 46  ? -5.771  4.574   -0.256  1.00 0.00 ? 46  GLY A H    2  
ATOM 2281  H HA2  . GLY A 1 46  ? -7.779  4.533   0.911   1.00 0.00 ? 46  GLY A HA2  2  
ATOM 2282  H HA3  . GLY A 1 46  ? -7.718  2.760   0.989   1.00 0.00 ? 46  GLY A HA3  2  
ATOM 2283  N N    . LEU A 1 47  ? -5.445  4.490   2.679   1.00 0.00 ? 47  LEU A N    2  
ATOM 2284  C CA   . LEU A 1 47  ? -4.783  4.660   3.967   1.00 0.00 ? 47  LEU A CA   2  
ATOM 2285  C C    . LEU A 1 47  ? -4.804  6.130   4.359   1.00 0.00 ? 47  LEU A C    2  
ATOM 2286  O O    . LEU A 1 47  ? -4.611  7.003   3.513   1.00 0.00 ? 47  LEU A O    2  
ATOM 2287  C CB   . LEU A 1 47  ? -3.319  4.193   3.894   1.00 0.00 ? 47  LEU A CB   2  
ATOM 2288  C CG   . LEU A 1 47  ? -3.108  2.679   3.722   1.00 0.00 ? 47  LEU A CG   2  
ATOM 2289  C CD1  . LEU A 1 47  ? -1.607  2.412   3.567   1.00 0.00 ? 47  LEU A CD1  2  
ATOM 2290  C CD2  . LEU A 1 47  ? -3.601  1.868   4.923   1.00 0.00 ? 47  LEU A CD2  2  
ATOM 2291  H H    . LEU A 1 47  ? -5.105  5.062   1.912   1.00 0.00 ? 47  LEU A H    2  
ATOM 2292  H HA   . LEU A 1 47  ? -5.315  4.098   4.733   1.00 0.00 ? 47  LEU A HA   2  
ATOM 2293  H HB2  . LEU A 1 47  ? -2.847  4.712   3.058   1.00 0.00 ? 47  LEU A HB2  2  
ATOM 2294  H HB3  . LEU A 1 47  ? -2.812  4.514   4.806   1.00 0.00 ? 47  LEU A HB3  2  
ATOM 2295  H HG   . LEU A 1 47  ? -3.624  2.332   2.827   1.00 0.00 ? 47  LEU A HG   2  
ATOM 2296  H HD11 . LEU A 1 47  ? -1.044  2.945   4.333   1.00 0.00 ? 47  LEU A HD11 2  
ATOM 2297  H HD12 . LEU A 1 47  ? -1.399  1.350   3.662   1.00 0.00 ? 47  LEU A HD12 2  
ATOM 2298  H HD13 . LEU A 1 47  ? -1.283  2.745   2.584   1.00 0.00 ? 47  LEU A HD13 2  
ATOM 2299  H HD21 . LEU A 1 47  ? -4.656  2.067   5.112   1.00 0.00 ? 47  LEU A HD21 2  
ATOM 2300  H HD22 . LEU A 1 47  ? -3.517  0.810   4.689   1.00 0.00 ? 47  LEU A HD22 2  
ATOM 2301  H HD23 . LEU A 1 47  ? -2.991  2.084   5.799   1.00 0.00 ? 47  LEU A HD23 2  
ATOM 2302  N N    . SER A 1 48  ? -4.952  6.375   5.658   1.00 0.00 ? 48  SER A N    2  
ATOM 2303  C CA   . SER A 1 48  ? -4.907  7.680   6.278   1.00 0.00 ? 48  SER A CA   2  
ATOM 2304  C C    . SER A 1 48  ? -3.572  8.375   6.026   1.00 0.00 ? 48  SER A C    2  
ATOM 2305  O O    . SER A 1 48  ? -2.543  7.724   5.831   1.00 0.00 ? 48  SER A O    2  
ATOM 2306  C CB   . SER A 1 48  ? -5.133  7.490   7.784   1.00 0.00 ? 48  SER A CB   2  
ATOM 2307  O OG   . SER A 1 48  ? -6.268  6.680   8.034   1.00 0.00 ? 48  SER A OG   2  
ATOM 2308  H H    . SER A 1 48  ? -5.198  5.629   6.287   1.00 0.00 ? 48  SER A H    2  
ATOM 2309  H HA   . SER A 1 48  ? -5.701  8.286   5.847   1.00 0.00 ? 48  SER A HA   2  
ATOM 2310  H HB2  . SER A 1 48  ? -4.258  7.003   8.216   1.00 0.00 ? 48  SER A HB2  2  
ATOM 2311  H HB3  . SER A 1 48  ? -5.260  8.455   8.270   1.00 0.00 ? 48  SER A HB3  2  
ATOM 2312  H HG   . SER A 1 48  ? -6.969  6.948   7.418   1.00 0.00 ? 48  SER A HG   2  
ATOM 2313  N N    . GLN A 1 49  ? -3.589  9.704   6.138   1.00 0.00 ? 49  GLN A N    2  
ATOM 2314  C CA   . GLN A 1 49  ? -2.434  10.578  5.970   1.00 0.00 ? 49  GLN A CA   2  
ATOM 2315  C C    . GLN A 1 49  ? -1.260  10.100  6.812   1.00 0.00 ? 49  GLN A C    2  
ATOM 2316  O O    . GLN A 1 49  ? -0.152  9.977   6.293   1.00 0.00 ? 49  GLN A O    2  
ATOM 2317  C CB   . GLN A 1 49  ? -2.780  12.022  6.372   1.00 0.00 ? 49  GLN A CB   2  
ATOM 2318  C CG   . GLN A 1 49  ? -3.222  12.859  5.171   1.00 0.00 ? 49  GLN A CG   2  
ATOM 2319  C CD   . GLN A 1 49  ? -3.533  14.304  5.557   1.00 0.00 ? 49  GLN A CD   2  
ATOM 2320  O OE1  . GLN A 1 49  ? -4.570  14.853  5.202   1.00 0.00 ? 49  GLN A OE1  2  
ATOM 2321  N NE2  . GLN A 1 49  ? -2.645  14.990  6.254   1.00 0.00 ? 49  GLN A NE2  2  
ATOM 2322  H H    . GLN A 1 49  ? -4.485  10.117  6.370   1.00 0.00 ? 49  GLN A H    2  
ATOM 2323  H HA   . GLN A 1 49  ? -2.124  10.548  4.924   1.00 0.00 ? 49  GLN A HA   2  
ATOM 2324  H HB2  . GLN A 1 49  ? -3.550  12.035  7.144   1.00 0.00 ? 49  GLN A HB2  2  
ATOM 2325  H HB3  . GLN A 1 49  ? -1.886  12.489  6.789   1.00 0.00 ? 49  GLN A HB3  2  
ATOM 2326  H HG2  . GLN A 1 49  ? -2.412  12.855  4.452   1.00 0.00 ? 49  GLN A HG2  2  
ATOM 2327  H HG3  . GLN A 1 49  ? -4.100  12.407  4.710   1.00 0.00 ? 49  GLN A HG3  2  
ATOM 2328  H HE21 . GLN A 1 49  ? -1.756  14.567  6.530   1.00 0.00 ? 49  GLN A HE21 2  
ATOM 2329  H HE22 . GLN A 1 49  ? -3.024  15.745  6.830   1.00 0.00 ? 49  GLN A HE22 2  
ATOM 2330  N N    . GLY A 1 50  ? -1.497  9.877   8.104   1.00 0.00 ? 50  GLY A N    2  
ATOM 2331  C CA   . GLY A 1 50  ? -0.467  9.470   9.036   1.00 0.00 ? 50  GLY A CA   2  
ATOM 2332  C C    . GLY A 1 50  ? 0.005   8.052   8.748   1.00 0.00 ? 50  GLY A C    2  
ATOM 2333  O O    . GLY A 1 50  ? 1.208   7.835   8.624   1.00 0.00 ? 50  GLY A O    2  
ATOM 2334  H H    . GLY A 1 50  ? -2.417  10.075  8.474   1.00 0.00 ? 50  GLY A H    2  
ATOM 2335  H HA2  . GLY A 1 50  ? 0.377   10.158  8.973   1.00 0.00 ? 50  GLY A HA2  2  
ATOM 2336  H HA3  . GLY A 1 50  ? -0.879  9.520   10.036  1.00 0.00 ? 50  GLY A HA3  2  
ATOM 2337  N N    . SER A 1 51  ? -0.924  7.104   8.586   1.00 0.00 ? 51  SER A N    2  
ATOM 2338  C CA   . SER A 1 51  ? -0.589  5.708   8.339   1.00 0.00 ? 51  SER A CA   2  
ATOM 2339  C C    . SER A 1 51  ? 0.274   5.572   7.084   1.00 0.00 ? 51  SER A C    2  
ATOM 2340  O O    . SER A 1 51  ? 1.318   4.929   7.147   1.00 0.00 ? 51  SER A O    2  
ATOM 2341  C CB   . SER A 1 51  ? -1.855  4.848   8.266   1.00 0.00 ? 51  SER A CB   2  
ATOM 2342  O OG   . SER A 1 51  ? -2.648  5.052   9.421   1.00 0.00 ? 51  SER A OG   2  
ATOM 2343  H H    . SER A 1 51  ? -1.900  7.329   8.695   1.00 0.00 ? 51  SER A H    2  
ATOM 2344  H HA   . SER A 1 51  ? 0.005   5.355   9.183   1.00 0.00 ? 51  SER A HA   2  
ATOM 2345  H HB2  . SER A 1 51  ? -2.434  5.118   7.381   1.00 0.00 ? 51  SER A HB2  2  
ATOM 2346  H HB3  . SER A 1 51  ? -1.572  3.796   8.199   1.00 0.00 ? 51  SER A HB3  2  
ATOM 2347  H HG   . SER A 1 51  ? -2.870  4.182   9.811   1.00 0.00 ? 51  SER A HG   2  
ATOM 2348  N N    . VAL A 1 52  ? -0.098  6.188   5.954   1.00 0.00 ? 52  VAL A N    2  
ATOM 2349  C CA   . VAL A 1 52  ? 0.711   6.148   4.750   1.00 0.00 ? 52  VAL A CA   2  
ATOM 2350  C C    . VAL A 1 52  ? 2.088   6.787   4.949   1.00 0.00 ? 52  VAL A C    2  
ATOM 2351  O O    . VAL A 1 52  ? 3.050   6.358   4.309   1.00 0.00 ? 52  VAL A O    2  
ATOM 2352  C CB   . VAL A 1 52  ? -0.079  6.771   3.581   1.00 0.00 ? 52  VAL A CB   2  
ATOM 2353  C CG1  . VAL A 1 52  ? 0.393   8.164   3.137   1.00 0.00 ? 52  VAL A CG1  2  
ATOM 2354  C CG2  . VAL A 1 52  ? 0.011   5.787   2.422   1.00 0.00 ? 52  VAL A CG2  2  
ATOM 2355  H H    . VAL A 1 52  ? -0.979  6.685   5.866   1.00 0.00 ? 52  VAL A H    2  
ATOM 2356  H HA   . VAL A 1 52  ? 0.873   5.094   4.537   1.00 0.00 ? 52  VAL A HA   2  
ATOM 2357  H HB   . VAL A 1 52  ? -1.134  6.843   3.843   1.00 0.00 ? 52  VAL A HB   2  
ATOM 2358  H HG11 . VAL A 1 52  ? 1.435   8.119   2.810   1.00 0.00 ? 52  VAL A HG11 2  
ATOM 2359  H HG12 . VAL A 1 52  ? -0.229  8.524   2.316   1.00 0.00 ? 52  VAL A HG12 2  
ATOM 2360  H HG13 . VAL A 1 52  ? 0.317   8.863   3.973   1.00 0.00 ? 52  VAL A HG13 2  
ATOM 2361  H HG21 . VAL A 1 52  ? 1.050   5.580   2.165   1.00 0.00 ? 52  VAL A HG21 2  
ATOM 2362  H HG22 . VAL A 1 52  ? -0.477  4.866   2.729   1.00 0.00 ? 52  VAL A HG22 2  
ATOM 2363  H HG23 . VAL A 1 52  ? -0.509  6.186   1.564   1.00 0.00 ? 52  VAL A HG23 2  
ATOM 2364  N N    . SER A 1 53  ? 2.177   7.811   5.797   1.00 0.00 ? 53  SER A N    2  
ATOM 2365  C CA   . SER A 1 53  ? 3.419   8.474   6.142   1.00 0.00 ? 53  SER A CA   2  
ATOM 2366  C C    . SER A 1 53  ? 4.318   7.451   6.808   1.00 0.00 ? 53  SER A C    2  
ATOM 2367  O O    . SER A 1 53  ? 5.429   7.218   6.346   1.00 0.00 ? 53  SER A O    2  
ATOM 2368  C CB   . SER A 1 53  ? 3.113   9.655   7.062   1.00 0.00 ? 53  SER A CB   2  
ATOM 2369  O OG   . SER A 1 53  ? 3.955   10.770  6.830   1.00 0.00 ? 53  SER A OG   2  
ATOM 2370  H H    . SER A 1 53  ? 1.344   8.106   6.292   1.00 0.00 ? 53  SER A H    2  
ATOM 2371  H HA   . SER A 1 53  ? 3.894   8.834   5.233   1.00 0.00 ? 53  SER A HA   2  
ATOM 2372  H HB2  . SER A 1 53  ? 2.091   9.953   6.875   1.00 0.00 ? 53  SER A HB2  2  
ATOM 2373  H HB3  . SER A 1 53  ? 3.186   9.345   8.104   1.00 0.00 ? 53  SER A HB3  2  
ATOM 2374  H HG   . SER A 1 53  ? 4.655   10.702  7.519   1.00 0.00 ? 53  SER A HG   2  
ATOM 2375  N N    . ASP A 1 54  ? 3.830   6.792   7.856   1.00 0.00 ? 54  ASP A N    2  
ATOM 2376  C CA   . ASP A 1 54  ? 4.588   5.782   8.573   1.00 0.00 ? 54  ASP A CA   2  
ATOM 2377  C C    . ASP A 1 54  ? 4.905   4.590   7.672   1.00 0.00 ? 54  ASP A C    2  
ATOM 2378  O O    . ASP A 1 54  ? 5.952   3.972   7.846   1.00 0.00 ? 54  ASP A O    2  
ATOM 2379  C CB   . ASP A 1 54  ? 3.838   5.356   9.840   1.00 0.00 ? 54  ASP A CB   2  
ATOM 2380  C CG   . ASP A 1 54  ? 4.129   6.315   10.988  1.00 0.00 ? 54  ASP A CG   2  
ATOM 2381  O OD1  . ASP A 1 54  ? 5.318   6.430   11.372  1.00 0.00 ? 54  ASP A OD1  2  
ATOM 2382  O OD2  . ASP A 1 54  ? 3.201   6.996   11.474  1.00 0.00 ? 54  ASP A OD2  2  
ATOM 2383  H H    . ASP A 1 54  ? 2.889   7.005   8.182   1.00 0.00 ? 54  ASP A H    2  
ATOM 2384  H HA   . ASP A 1 54  ? 5.542   6.218   8.874   1.00 0.00 ? 54  ASP A HA   2  
ATOM 2385  H HB2  . ASP A 1 54  ? 2.767   5.314   9.637   1.00 0.00 ? 54  ASP A HB2  2  
ATOM 2386  H HB3  . ASP A 1 54  ? 4.170   4.366   10.149  1.00 0.00 ? 54  ASP A HB3  2  
ATOM 2387  N N    . MET A 1 55  ? 4.061   4.260   6.694   1.00 0.00 ? 55  MET A N    2  
ATOM 2388  C CA   . MET A 1 55  ? 4.331   3.255   5.686   1.00 0.00 ? 55  MET A CA   2  
ATOM 2389  C C    . MET A 1 55  ? 5.542   3.642   4.839   1.00 0.00 ? 55  MET A C    2  
ATOM 2390  O O    . MET A 1 55  ? 6.524   2.909   4.791   1.00 0.00 ? 55  MET A O    2  
ATOM 2391  C CB   . MET A 1 55  ? 3.066   3.103   4.835   1.00 0.00 ? 55  MET A CB   2  
ATOM 2392  C CG   . MET A 1 55  ? 2.597   1.671   4.728   1.00 0.00 ? 55  MET A CG   2  
ATOM 2393  S SD   . MET A 1 55  ? 2.238   0.776   6.266   1.00 0.00 ? 55  MET A SD   2  
ATOM 2394  C CE   . MET A 1 55  ? 0.598   1.472   6.597   1.00 0.00 ? 55  MET A CE   2  
ATOM 2395  H H    . MET A 1 55  ? 3.141   4.690   6.631   1.00 0.00 ? 55  MET A H    2  
ATOM 2396  H HA   . MET A 1 55  ? 4.556   2.317   6.192   1.00 0.00 ? 55  MET A HA   2  
ATOM 2397  H HB2  . MET A 1 55  ? 2.248   3.662   5.270   1.00 0.00 ? 55  MET A HB2  2  
ATOM 2398  H HB3  . MET A 1 55  ? 3.221   3.490   3.827   1.00 0.00 ? 55  MET A HB3  2  
ATOM 2399  H HG2  . MET A 1 55  ? 1.666   1.758   4.187   1.00 0.00 ? 55  MET A HG2  2  
ATOM 2400  H HG3  . MET A 1 55  ? 3.328   1.119   4.140   1.00 0.00 ? 55  MET A HG3  2  
ATOM 2401  H HE1  . MET A 1 55  ? -0.055  1.261   5.747   1.00 0.00 ? 55  MET A HE1  2  
ATOM 2402  H HE2  . MET A 1 55  ? 0.178   1.027   7.499   1.00 0.00 ? 55  MET A HE2  2  
ATOM 2403  H HE3  . MET A 1 55  ? 0.673   2.548   6.735   1.00 0.00 ? 55  MET A HE3  2  
ATOM 2404  N N    . LEU A 1 56  ? 5.468   4.774   4.139   1.00 0.00 ? 56  LEU A N    2  
ATOM 2405  C CA   . LEU A 1 56  ? 6.523   5.253   3.258   1.00 0.00 ? 56  LEU A CA   2  
ATOM 2406  C C    . LEU A 1 56  ? 7.811   5.602   4.002   1.00 0.00 ? 56  LEU A C    2  
ATOM 2407  O O    . LEU A 1 56  ? 8.888   5.360   3.462   1.00 0.00 ? 56  LEU A O    2  
ATOM 2408  C CB   . LEU A 1 56  ? 6.008   6.460   2.450   1.00 0.00 ? 56  LEU A CB   2  
ATOM 2409  C CG   . LEU A 1 56  ? 4.978   6.094   1.354   1.00 0.00 ? 56  LEU A CG   2  
ATOM 2410  C CD1  . LEU A 1 56  ? 4.716   7.276   0.426   1.00 0.00 ? 56  LEU A CD1  2  
ATOM 2411  C CD2  . LEU A 1 56  ? 5.478   4.941   0.475   1.00 0.00 ? 56  LEU A CD2  2  
ATOM 2412  H H    . LEU A 1 56  ? 4.590   5.283   4.153   1.00 0.00 ? 56  LEU A H    2  
ATOM 2413  H HA   . LEU A 1 56  ? 6.794   4.444   2.584   1.00 0.00 ? 56  LEU A HA   2  
ATOM 2414  H HB2  . LEU A 1 56  ? 5.580   7.187   3.143   1.00 0.00 ? 56  LEU A HB2  2  
ATOM 2415  H HB3  . LEU A 1 56  ? 6.862   6.941   1.977   1.00 0.00 ? 56  LEU A HB3  2  
ATOM 2416  H HG   . LEU A 1 56  ? 4.025   5.821   1.816   1.00 0.00 ? 56  LEU A HG   2  
ATOM 2417  H HD11 . LEU A 1 56  ? 4.049   6.982   -0.386  1.00 0.00 ? 56  LEU A HD11 2  
ATOM 2418  H HD12 . LEU A 1 56  ? 4.229   8.072   0.977   1.00 0.00 ? 56  LEU A HD12 2  
ATOM 2419  H HD13 . LEU A 1 56  ? 5.646   7.643   0.001   1.00 0.00 ? 56  LEU A HD13 2  
ATOM 2420  H HD21 . LEU A 1 56  ? 5.398   4.009   1.032   1.00 0.00 ? 56  LEU A HD21 2  
ATOM 2421  H HD22 . LEU A 1 56  ? 4.866   4.846   -0.421  1.00 0.00 ? 56  LEU A HD22 2  
ATOM 2422  H HD23 . LEU A 1 56  ? 6.517   5.121   0.181   1.00 0.00 ? 56  LEU A HD23 2  
ATOM 2423  N N    . SER A 1 57  ? 7.728   6.170   5.203   1.00 0.00 ? 57  SER A N    2  
ATOM 2424  C CA   . SER A 1 57  ? 8.879   6.564   6.009   1.00 0.00 ? 57  SER A CA   2  
ATOM 2425  C C    . SER A 1 57  ? 9.502   5.368   6.737   1.00 0.00 ? 57  SER A C    2  
ATOM 2426  O O    . SER A 1 57  ? 10.725  5.310   6.882   1.00 0.00 ? 57  SER A O    2  
ATOM 2427  C CB   . SER A 1 57  ? 8.436   7.633   7.017   1.00 0.00 ? 57  SER A CB   2  
ATOM 2428  O OG   . SER A 1 57  ? 7.948   8.781   6.342   1.00 0.00 ? 57  SER A OG   2  
ATOM 2429  H H    . SER A 1 57  ? 6.810   6.400   5.573   1.00 0.00 ? 57  SER A H    2  
ATOM 2430  H HA   . SER A 1 57  ? 9.639   6.995   5.358   1.00 0.00 ? 57  SER A HA   2  
ATOM 2431  H HB2  . SER A 1 57  ? 7.647   7.226   7.650   1.00 0.00 ? 57  SER A HB2  2  
ATOM 2432  H HB3  . SER A 1 57  ? 9.284   7.916   7.641   1.00 0.00 ? 57  SER A HB3  2  
ATOM 2433  H HG   . SER A 1 57  ? 7.459   9.315   6.986   1.00 0.00 ? 57  SER A HG   2  
ATOM 2434  N N    . ARG A 1 58  ? 8.697   4.400   7.188   1.00 0.00 ? 58  ARG A N    2  
ATOM 2435  C CA   . ARG A 1 58  ? 9.159   3.214   7.908   1.00 0.00 ? 58  ARG A CA   2  
ATOM 2436  C C    . ARG A 1 58  ? 8.500   1.965   7.312   1.00 0.00 ? 58  ARG A C    2  
ATOM 2437  O O    . ARG A 1 58  ? 7.671   1.340   7.985   1.00 0.00 ? 58  ARG A O    2  
ATOM 2438  C CB   . ARG A 1 58  ? 8.902   3.374   9.422   1.00 0.00 ? 58  ARG A CB   2  
ATOM 2439  C CG   . ARG A 1 58  ? 9.594   4.601   10.035  1.00 0.00 ? 58  ARG A CG   2  
ATOM 2440  C CD   . ARG A 1 58  ? 9.515   4.583   11.566  1.00 0.00 ? 58  ARG A CD   2  
ATOM 2441  N NE   . ARG A 1 58  ? 9.823   5.912   12.113  1.00 0.00 ? 58  ARG A NE   2  
ATOM 2442  C CZ   . ARG A 1 58  ? 10.743  6.264   13.018  1.00 0.00 ? 58  ARG A CZ   2  
ATOM 2443  N NH1  . ARG A 1 58  ? 11.599  5.388   13.533  1.00 0.00 ? 58  ARG A NH1  2  
ATOM 2444  N NH2  . ARG A 1 58  ? 10.788  7.533   13.393  1.00 0.00 ? 58  ARG A NH2  2  
ATOM 2445  H H    . ARG A 1 58  ? 7.694   4.463   7.035   1.00 0.00 ? 58  ARG A H    2  
ATOM 2446  H HA   . ARG A 1 58  ? 10.230  3.097   7.773   1.00 0.00 ? 58  ARG A HA   2  
ATOM 2447  H HB2  . ARG A 1 58  ? 7.831   3.451   9.612   1.00 0.00 ? 58  ARG A HB2  2  
ATOM 2448  H HB3  . ARG A 1 58  ? 9.268   2.484   9.927   1.00 0.00 ? 58  ARG A HB3  2  
ATOM 2449  H HG2  . ARG A 1 58  ? 10.643  4.622   9.736   1.00 0.00 ? 58  ARG A HG2  2  
ATOM 2450  H HG3  . ARG A 1 58  ? 9.103   5.502   9.665   1.00 0.00 ? 58  ARG A HG3  2  
ATOM 2451  H HD2  . ARG A 1 58  ? 8.500   4.324   11.870  1.00 0.00 ? 58  ARG A HD2  2  
ATOM 2452  H HD3  . ARG A 1 58  ? 10.195  3.827   11.957  1.00 0.00 ? 58  ARG A HD3  2  
ATOM 2453  H HE   . ARG A 1 58  ? 9.190   6.652   11.815  1.00 0.00 ? 58  ARG A HE   2  
ATOM 2454  H HH11 . ARG A 1 58  ? 11.586  4.418   13.264  1.00 0.00 ? 58  ARG A HH11 2  
ATOM 2455  H HH12 . ARG A 1 58  ? 12.226  5.647   14.294  1.00 0.00 ? 58  ARG A HH12 2  
ATOM 2456  H HH21 . ARG A 1 58  ? 10.137  8.198   12.984  1.00 0.00 ? 58  ARG A HH21 2  
ATOM 2457  H HH22 . ARG A 1 58  ? 11.442  7.886   14.094  1.00 0.00 ? 58  ARG A HH22 2  
ATOM 2458  N N    . PRO A 1 59  ? 8.846   1.571   6.068   1.00 0.00 ? 59  PRO A N    2  
ATOM 2459  C CA   . PRO A 1 59  ? 8.286   0.372   5.470   1.00 0.00 ? 59  PRO A CA   2  
ATOM 2460  C C    . PRO A 1 59  ? 8.684   -0.848  6.288   1.00 0.00 ? 59  PRO A C    2  
ATOM 2461  O O    . PRO A 1 59  ? 9.859   -1.025  6.629   1.00 0.00 ? 59  PRO A O    2  
ATOM 2462  C CB   . PRO A 1 59  ? 8.818   0.256   4.045   1.00 0.00 ? 59  PRO A CB   2  
ATOM 2463  C CG   . PRO A 1 59  ? 9.689   1.492   3.818   1.00 0.00 ? 59  PRO A CG   2  
ATOM 2464  C CD   . PRO A 1 59  ? 9.747   2.246   5.144   1.00 0.00 ? 59  PRO A CD   2  
ATOM 2465  H HA   . PRO A 1 59  ? 7.202   0.470   5.435   1.00 0.00 ? 59  PRO A HA   2  
ATOM 2466  H HB2  . PRO A 1 59  ? 9.395   -0.665  3.949   1.00 0.00 ? 59  PRO A HB2  2  
ATOM 2467  H HB3  . PRO A 1 59  ? 7.992   0.243   3.337   1.00 0.00 ? 59  PRO A HB3  2  
ATOM 2468  H HG2  . PRO A 1 59  ? 10.683  1.210   3.489   1.00 0.00 ? 59  PRO A HG2  2  
ATOM 2469  H HG3  . PRO A 1 59  ? 9.245   2.132   3.060   1.00 0.00 ? 59  PRO A HG3  2  
ATOM 2470  H HD2  . PRO A 1 59  ? 10.765  2.245   5.534   1.00 0.00 ? 59  PRO A HD2  2  
ATOM 2471  H HD3  . PRO A 1 59  ? 9.411   3.266   4.964   1.00 0.00 ? 59  PRO A HD3  2  
ATOM 2472  N N    . LYS A 1 60  ? 7.707   -1.704  6.575   1.00 0.00 ? 60  LYS A N    2  
ATOM 2473  C CA   . LYS A 1 60  ? 7.945   -3.004  7.171   1.00 0.00 ? 60  LYS A CA   2  
ATOM 2474  C C    . LYS A 1 60  ? 8.447   -3.970  6.095   1.00 0.00 ? 60  LYS A C    2  
ATOM 2475  O O    . LYS A 1 60  ? 8.150   -3.778  4.911   1.00 0.00 ? 60  LYS A O    2  
ATOM 2476  C CB   . LYS A 1 60  ? 6.649   -3.504  7.827   1.00 0.00 ? 60  LYS A CB   2  
ATOM 2477  C CG   . LYS A 1 60  ? 6.339   -2.723  9.118   1.00 0.00 ? 60  LYS A CG   2  
ATOM 2478  C CD   . LYS A 1 60  ? 4.844   -2.502  9.371   1.00 0.00 ? 60  LYS A CD   2  
ATOM 2479  C CE   . LYS A 1 60  ? 4.134   -3.780  9.820   1.00 0.00 ? 60  LYS A CE   2  
ATOM 2480  N NZ   . LYS A 1 60  ? 2.705   -3.537  10.103  1.00 0.00 ? 60  LYS A NZ   2  
ATOM 2481  H H    . LYS A 1 60  ? 6.764   -1.484  6.290   1.00 0.00 ? 60  LYS A H    2  
ATOM 2482  H HA   . LYS A 1 60  ? 8.722   -2.870  7.914   1.00 0.00 ? 60  LYS A HA   2  
ATOM 2483  H HB2  . LYS A 1 60  ? 5.841   -3.390  7.107   1.00 0.00 ? 60  LYS A HB2  2  
ATOM 2484  H HB3  . LYS A 1 60  ? 6.743   -4.563  8.072   1.00 0.00 ? 60  LYS A HB3  2  
ATOM 2485  H HG2  . LYS A 1 60  ? 6.777   -3.254  9.962   1.00 0.00 ? 60  LYS A HG2  2  
ATOM 2486  H HG3  . LYS A 1 60  ? 6.799   -1.736  9.067   1.00 0.00 ? 60  LYS A HG3  2  
ATOM 2487  H HD2  . LYS A 1 60  ? 4.736   -1.746  10.150  1.00 0.00 ? 60  LYS A HD2  2  
ATOM 2488  H HD3  . LYS A 1 60  ? 4.391   -2.121  8.456   1.00 0.00 ? 60  LYS A HD3  2  
ATOM 2489  H HE2  . LYS A 1 60  ? 4.222   -4.533  9.035   1.00 0.00 ? 60  LYS A HE2  2  
ATOM 2490  H HE3  . LYS A 1 60  ? 4.620   -4.160  10.720  1.00 0.00 ? 60  LYS A HE3  2  
ATOM 2491  H HZ1  . LYS A 1 60  ? 2.241   -4.418  10.300  1.00 0.00 ? 60  LYS A HZ1  2  
ATOM 2492  H HZ2  . LYS A 1 60  ? 2.572   -2.941  10.916  1.00 0.00 ? 60  LYS A HZ2  2  
ATOM 2493  H HZ3  . LYS A 1 60  ? 2.243   -3.095  9.312   1.00 0.00 ? 60  LYS A HZ3  2  
ATOM 2494  N N    . PRO A 1 61  ? 9.175   -5.023  6.486   1.00 0.00 ? 61  PRO A N    2  
ATOM 2495  C CA   . PRO A 1 61  ? 9.636   -6.026  5.546   1.00 0.00 ? 61  PRO A CA   2  
ATOM 2496  C C    . PRO A 1 61  ? 8.459   -6.893  5.100   1.00 0.00 ? 61  PRO A C    2  
ATOM 2497  O O    . PRO A 1 61  ? 7.472   -7.076  5.820   1.00 0.00 ? 61  PRO A O    2  
ATOM 2498  C CB   . PRO A 1 61  ? 10.732  -6.801  6.284   1.00 0.00 ? 61  PRO A CB   2  
ATOM 2499  C CG   . PRO A 1 61  ? 10.395  -6.623  7.755   1.00 0.00 ? 61  PRO A CG   2  
ATOM 2500  C CD   . PRO A 1 61  ? 9.675   -5.278  7.826   1.00 0.00 ? 61  PRO A CD   2  
ATOM 2501  H HA   . PRO A 1 61  ? 10.063  -5.543  4.669   1.00 0.00 ? 61  PRO A HA   2  
ATOM 2502  H HB2  . PRO A 1 61  ? 10.745  -7.857  6.025   1.00 0.00 ? 61  PRO A HB2  2  
ATOM 2503  H HB3  . PRO A 1 61  ? 11.700  -6.347  6.083   1.00 0.00 ? 61  PRO A HB3  2  
ATOM 2504  H HG2  . PRO A 1 61  ? 9.719   -7.424  8.028   1.00 0.00 ? 61  PRO A HG2  2  
ATOM 2505  H HG3  . PRO A 1 61  ? 11.287  -6.638  8.382   1.00 0.00 ? 61  PRO A HG3  2  
ATOM 2506  H HD2  . PRO A 1 61  ? 8.857   -5.311  8.548   1.00 0.00 ? 61  PRO A HD2  2  
ATOM 2507  H HD3  . PRO A 1 61  ? 10.382  -4.496  8.097   1.00 0.00 ? 61  PRO A HD3  2  
ATOM 2508  N N    . TRP A 1 62  ? 8.575   -7.497  3.924   1.00 0.00 ? 62  TRP A N    2  
ATOM 2509  C CA   . TRP A 1 62  ? 7.578   -8.415  3.394   1.00 0.00 ? 62  TRP A CA   2  
ATOM 2510  C C    . TRP A 1 62  ? 7.466   -9.679  4.262   1.00 0.00 ? 62  TRP A C    2  
ATOM 2511  O O    . TRP A 1 62  ? 6.400   -10.293 4.350   1.00 0.00 ? 62  TRP A O    2  
ATOM 2512  C CB   . TRP A 1 62  ? 7.952   -8.741  1.951   1.00 0.00 ? 62  TRP A CB   2  
ATOM 2513  C CG   . TRP A 1 62  ? 6.854   -9.385  1.185   1.00 0.00 ? 62  TRP A CG   2  
ATOM 2514  C CD1  . TRP A 1 62  ? 6.662   -10.715 1.076   1.00 0.00 ? 62  TRP A CD1  2  
ATOM 2515  C CD2  . TRP A 1 62  ? 5.741   -8.753  0.487   1.00 0.00 ? 62  TRP A CD2  2  
ATOM 2516  N NE1  . TRP A 1 62  ? 5.579   -10.950 0.261   1.00 0.00 ? 62  TRP A NE1  2  
ATOM 2517  C CE2  . TRP A 1 62  ? 4.969   -9.780  -0.120  1.00 0.00 ? 62  TRP A CE2  2  
ATOM 2518  C CE3  . TRP A 1 62  ? 5.281   -7.427  0.330   1.00 0.00 ? 62  TRP A CE3  2  
ATOM 2519  C CZ2  . TRP A 1 62  ? 3.837   -9.506  -0.888  1.00 0.00 ? 62  TRP A CZ2  2  
ATOM 2520  C CZ3  . TRP A 1 62  ? 4.129   -7.143  -0.431  1.00 0.00 ? 62  TRP A CZ3  2  
ATOM 2521  C CH2  . TRP A 1 62  ? 3.426   -8.182  -1.063  1.00 0.00 ? 62  TRP A CH2  2  
ATOM 2522  H H    . TRP A 1 62  ? 9.464   -7.441  3.440   1.00 0.00 ? 62  TRP A H    2  
ATOM 2523  H HA   . TRP A 1 62  ? 6.611   -7.911  3.394   1.00 0.00 ? 62  TRP A HA   2  
ATOM 2524  H HB2  . TRP A 1 62  ? 8.215   -7.822  1.428   1.00 0.00 ? 62  TRP A HB2  2  
ATOM 2525  H HB3  . TRP A 1 62  ? 8.831   -9.385  1.937   1.00 0.00 ? 62  TRP A HB3  2  
ATOM 2526  H HD1  . TRP A 1 62  ? 7.275   -11.476 1.539   1.00 0.00 ? 62  TRP A HD1  2  
ATOM 2527  H HE1  . TRP A 1 62  ? 5.258   -11.876 -0.033  1.00 0.00 ? 62  TRP A HE1  2  
ATOM 2528  H HE3  . TRP A 1 62  ? 5.825   -6.619  0.795   1.00 0.00 ? 62  TRP A HE3  2  
ATOM 2529  H HZ2  . TRP A 1 62  ? 3.282   -10.313 -1.329  1.00 0.00 ? 62  TRP A HZ2  2  
ATOM 2530  H HZ3  . TRP A 1 62  ? 3.785   -6.124  -0.537  1.00 0.00 ? 62  TRP A HZ3  2  
ATOM 2531  H HH2  . TRP A 1 62  ? 2.559   -7.992  -1.672  1.00 0.00 ? 62  TRP A HH2  2  
ATOM 2532  N N    . SER A 1 63  ? 8.540   -10.026 4.972   1.00 0.00 ? 63  SER A N    2  
ATOM 2533  C CA   . SER A 1 63  ? 8.574   -11.068 5.991   1.00 0.00 ? 63  SER A CA   2  
ATOM 2534  C C    . SER A 1 63  ? 7.831   -10.712 7.294   1.00 0.00 ? 63  SER A C    2  
ATOM 2535  O O    . SER A 1 63  ? 7.649   -11.578 8.153   1.00 0.00 ? 63  SER A O    2  
ATOM 2536  C CB   . SER A 1 63  ? 10.040  -11.343 6.310   1.00 0.00 ? 63  SER A CB   2  
ATOM 2537  O OG   . SER A 1 63  ? 10.664  -12.025 5.239   1.00 0.00 ? 63  SER A OG   2  
ATOM 2538  H H    . SER A 1 63  ? 9.413   -9.551  4.768   1.00 0.00 ? 63  SER A H    2  
ATOM 2539  H HA   . SER A 1 63  ? 8.124   -11.973 5.581   1.00 0.00 ? 63  SER A HA   2  
ATOM 2540  H HB2  . SER A 1 63  ? 10.564  -10.406 6.494   1.00 0.00 ? 63  SER A HB2  2  
ATOM 2541  H HB3  . SER A 1 63  ? 10.078  -11.942 7.214   1.00 0.00 ? 63  SER A HB3  2  
ATOM 2542  H HG   . SER A 1 63  ? 11.328  -12.623 5.638   1.00 0.00 ? 63  SER A HG   2  
ATOM 2543  N N    . LYS A 1 64  ? 7.415   -9.459  7.487   1.00 0.00 ? 64  LYS A N    2  
ATOM 2544  C CA   . LYS A 1 64  ? 6.541   -9.014  8.587   1.00 0.00 ? 64  LYS A CA   2  
ATOM 2545  C C    . LYS A 1 64  ? 5.101   -8.886  8.128   1.00 0.00 ? 64  LYS A C    2  
ATOM 2546  O O    . LYS A 1 64  ? 4.183   -9.182  8.884   1.00 0.00 ? 64  LYS A O    2  
ATOM 2547  C CB   . LYS A 1 64  ? 6.990   -7.643  9.095   1.00 0.00 ? 64  LYS A CB   2  
ATOM 2548  C CG   . LYS A 1 64  ? 8.139   -7.801  10.083  1.00 0.00 ? 64  LYS A CG   2  
ATOM 2549  C CD   . LYS A 1 64  ? 7.653   -8.248  11.464  1.00 0.00 ? 64  LYS A CD   2  
ATOM 2550  C CE   . LYS A 1 64  ? 8.282   -7.340  12.512  1.00 0.00 ? 64  LYS A CE   2  
ATOM 2551  N NZ   . LYS A 1 64  ? 9.740   -7.537  12.618  1.00 0.00 ? 64  LYS A NZ   2  
ATOM 2552  H H    . LYS A 1 64  ? 7.649   -8.799  6.756   1.00 0.00 ? 64  LYS A H    2  
ATOM 2553  H HA   . LYS A 1 64  ? 6.569   -9.711  9.428   1.00 0.00 ? 64  LYS A HA   2  
ATOM 2554  H HB2  . LYS A 1 64  ? 7.309   -7.022  8.263   1.00 0.00 ? 64  LYS A HB2  2  
ATOM 2555  H HB3  . LYS A 1 64  ? 6.162   -7.125  9.584   1.00 0.00 ? 64  LYS A HB3  2  
ATOM 2556  H HG2  . LYS A 1 64  ? 8.851   -8.533  9.707   1.00 0.00 ? 64  LYS A HG2  2  
ATOM 2557  H HG3  . LYS A 1 64  ? 8.636   -6.836  10.159  1.00 0.00 ? 64  LYS A HG3  2  
ATOM 2558  H HD2  . LYS A 1 64  ? 6.573   -8.130  11.526  1.00 0.00 ? 64  LYS A HD2  2  
ATOM 2559  H HD3  . LYS A 1 64  ? 7.904   -9.296  11.646  1.00 0.00 ? 64  LYS A HD3  2  
ATOM 2560  H HE2  . LYS A 1 64  ? 8.068   -6.311  12.218  1.00 0.00 ? 64  LYS A HE2  2  
ATOM 2561  H HE3  . LYS A 1 64  ? 7.814   -7.548  13.470  1.00 0.00 ? 64  LYS A HE3  2  
ATOM 2562  H HZ1  . LYS A 1 64  ? 10.162  -7.719  11.711  1.00 0.00 ? 64  LYS A HZ1  2  
ATOM 2563  H HZ2  . LYS A 1 64  ? 10.198  -6.715  13.002  1.00 0.00 ? 64  LYS A HZ2  2  
ATOM 2564  H HZ3  . LYS A 1 64  ? 9.935   -8.324  13.226  1.00 0.00 ? 64  LYS A HZ3  2  
ATOM 2565  N N    . LEU A 1 65  ? 4.898   -8.373  6.917   1.00 0.00 ? 65  LEU A N    2  
ATOM 2566  C CA   . LEU A 1 65  ? 3.568   -8.050  6.439   1.00 0.00 ? 65  LEU A CA   2  
ATOM 2567  C C    . LEU A 1 65  ? 2.900   -9.376  6.100   1.00 0.00 ? 65  LEU A C    2  
ATOM 2568  O O    . LEU A 1 65  ? 3.436   -10.147 5.306   1.00 0.00 ? 65  LEU A O    2  
ATOM 2569  C CB   . LEU A 1 65  ? 3.679   -7.151  5.197   1.00 0.00 ? 65  LEU A CB   2  
ATOM 2570  C CG   . LEU A 1 65  ? 4.305   -5.769  5.469   1.00 0.00 ? 65  LEU A CG   2  
ATOM 2571  C CD1  . LEU A 1 65  ? 4.723   -5.153  4.135   1.00 0.00 ? 65  LEU A CD1  2  
ATOM 2572  C CD2  . LEU A 1 65  ? 3.331   -4.847  6.213   1.00 0.00 ? 65  LEU A CD2  2  
ATOM 2573  H H    . LEU A 1 65  ? 5.697   -8.140  6.343   1.00 0.00 ? 65  LEU A H    2  
ATOM 2574  H HA   . LEU A 1 65  ? 3.008   -7.542  7.225   1.00 0.00 ? 65  LEU A HA   2  
ATOM 2575  H HB2  . LEU A 1 65  ? 4.278   -7.677  4.450   1.00 0.00 ? 65  LEU A HB2  2  
ATOM 2576  H HB3  . LEU A 1 65  ? 2.683   -7.003  4.783   1.00 0.00 ? 65  LEU A HB3  2  
ATOM 2577  H HG   . LEU A 1 65  ? 5.197   -5.878  6.081   1.00 0.00 ? 65  LEU A HG   2  
ATOM 2578  H HD11 . LEU A 1 65  ? 5.167   -4.170  4.296   1.00 0.00 ? 65  LEU A HD11 2  
ATOM 2579  H HD12 . LEU A 1 65  ? 5.476   -5.781  3.661   1.00 0.00 ? 65  LEU A HD12 2  
ATOM 2580  H HD13 . LEU A 1 65  ? 3.866   -5.069  3.468   1.00 0.00 ? 65  LEU A HD13 2  
ATOM 2581  H HD21 . LEU A 1 65  ? 3.062   -5.276  7.177   1.00 0.00 ? 65  LEU A HD21 2  
ATOM 2582  H HD22 . LEU A 1 65  ? 3.791   -3.875  6.378   1.00 0.00 ? 65  LEU A HD22 2  
ATOM 2583  H HD23 . LEU A 1 65  ? 2.433   -4.697  5.621   1.00 0.00 ? 65  LEU A HD23 2  
ATOM 2584  N N    . THR A 1 66  ? 1.749   -9.660  6.699   1.00 0.00 ? 66  THR A N    2  
ATOM 2585  C CA   . THR A 1 66  ? 0.918   -10.825 6.396   1.00 0.00 ? 66  THR A CA   2  
ATOM 2586  C C    . THR A 1 66  ? 0.005   -10.501 5.213   1.00 0.00 ? 66  THR A C    2  
ATOM 2587  O O    . THR A 1 66  ? 0.135   -9.427  4.629   1.00 0.00 ? 66  THR A O    2  
ATOM 2588  C CB   . THR A 1 66  ? 0.125   -11.172 7.660   1.00 0.00 ? 66  THR A CB   2  
ATOM 2589  O OG1  . THR A 1 66  ? -0.623  -10.045 8.078   1.00 0.00 ? 66  THR A OG1  2  
ATOM 2590  C CG2  . THR A 1 66  ? 1.074   -11.596 8.779   1.00 0.00 ? 66  THR A CG2  2  
ATOM 2591  H H    . THR A 1 66  ? 1.359   -9.047  7.401   1.00 0.00 ? 66  THR A H    2  
ATOM 2592  H HA   . THR A 1 66  ? 1.546   -11.674 6.128   1.00 0.00 ? 66  THR A HA   2  
ATOM 2593  H HB   . THR A 1 66  ? -0.557  -11.993 7.448   1.00 0.00 ? 66  THR A HB   2  
ATOM 2594  H HG1  . THR A 1 66  ? -1.003  -10.270 8.946   1.00 0.00 ? 66  THR A HG1  2  
ATOM 2595  H HG21 . THR A 1 66  ? 1.708   -12.411 8.431   1.00 0.00 ? 66  THR A HG21 2  
ATOM 2596  H HG22 . THR A 1 66  ? 1.697   -10.761 9.094   1.00 0.00 ? 66  THR A HG22 2  
ATOM 2597  H HG23 . THR A 1 66  ? 0.502   -11.946 9.632   1.00 0.00 ? 66  THR A HG23 2  
ATOM 2598  N N    . GLN A 1 67  ? -0.957  -11.365 4.863   1.00 0.00 ? 67  GLN A N    2  
ATOM 2599  C CA   . GLN A 1 67  ? -1.940  -11.054 3.825   1.00 0.00 ? 67  GLN A CA   2  
ATOM 2600  C C    . GLN A 1 67  ? -2.577  -9.673  4.030   1.00 0.00 ? 67  GLN A C    2  
ATOM 2601  O O    . GLN A 1 67  ? -2.566  -8.848  3.111   1.00 0.00 ? 67  GLN A O    2  
ATOM 2602  C CB   . GLN A 1 67  ? -3.040  -12.121 3.770   1.00 0.00 ? 67  GLN A CB   2  
ATOM 2603  C CG   . GLN A 1 67  ? -2.576  -13.433 3.129   1.00 0.00 ? 67  GLN A CG   2  
ATOM 2604  C CD   . GLN A 1 67  ? -3.748  -14.159 2.476   1.00 0.00 ? 67  GLN A CD   2  
ATOM 2605  O OE1  . GLN A 1 67  ? -4.555  -14.802 3.146   1.00 0.00 ? 67  GLN A OE1  2  
ATOM 2606  N NE2  . GLN A 1 67  ? -3.892  -14.005 1.169   1.00 0.00 ? 67  GLN A NE2  2  
ATOM 2607  H H    . GLN A 1 67  ? -1.022  -12.262 5.326   1.00 0.00 ? 67  GLN A H    2  
ATOM 2608  H HA   . GLN A 1 67  ? -1.429  -11.032 2.860   1.00 0.00 ? 67  GLN A HA   2  
ATOM 2609  H HB2  . GLN A 1 67  ? -3.434  -12.320 4.768   1.00 0.00 ? 67  GLN A HB2  2  
ATOM 2610  H HB3  . GLN A 1 67  ? -3.851  -11.715 3.170   1.00 0.00 ? 67  GLN A HB3  2  
ATOM 2611  H HG2  . GLN A 1 67  ? -1.814  -13.235 2.375   1.00 0.00 ? 67  GLN A HG2  2  
ATOM 2612  H HG3  . GLN A 1 67  ? -2.135  -14.066 3.891   1.00 0.00 ? 67  GLN A HG3  2  
ATOM 2613  H HE21 . GLN A 1 67  ? -3.162  -13.524 0.645   1.00 0.00 ? 67  GLN A HE21 2  
ATOM 2614  H HE22 . GLN A 1 67  ? -4.599  -14.555 0.680   1.00 0.00 ? 67  GLN A HE22 2  
ATOM 2615  N N    . LYS A 1 68  ? -3.117  -9.395  5.225   1.00 0.00 ? 68  LYS A N    2  
ATOM 2616  C CA   . LYS A 1 68  ? -3.792  -8.115  5.455   1.00 0.00 ? 68  LYS A CA   2  
ATOM 2617  C C    . LYS A 1 68  ? -2.768  -6.977  5.490   1.00 0.00 ? 68  LYS A C    2  
ATOM 2618  O O    . LYS A 1 68  ? -3.083  -5.853  5.103   1.00 0.00 ? 68  LYS A O    2  
ATOM 2619  C CB   . LYS A 1 68  ? -4.620  -8.184  6.748   1.00 0.00 ? 68  LYS A CB   2  
ATOM 2620  C CG   . LYS A 1 68  ? -5.748  -7.131  6.821   1.00 0.00 ? 68  LYS A CG   2  
ATOM 2621  C CD   . LYS A 1 68  ? -7.163  -7.738  6.695   1.00 0.00 ? 68  LYS A CD   2  
ATOM 2622  C CE   . LYS A 1 68  ? -8.245  -6.836  7.317   1.00 0.00 ? 68  LYS A CE   2  
ATOM 2623  N NZ   . LYS A 1 68  ? -9.586  -7.464  7.306   1.00 0.00 ? 68  LYS A NZ   2  
ATOM 2624  H H    . LYS A 1 68  ? -3.008  -10.040 6.000   1.00 0.00 ? 68  LYS A H    2  
ATOM 2625  H HA   . LYS A 1 68  ? -4.472  -7.936  4.617   1.00 0.00 ? 68  LYS A HA   2  
ATOM 2626  H HB2  . LYS A 1 68  ? -5.052  -9.182  6.841   1.00 0.00 ? 68  LYS A HB2  2  
ATOM 2627  H HB3  . LYS A 1 68  ? -3.947  -8.043  7.596   1.00 0.00 ? 68  LYS A HB3  2  
ATOM 2628  H HG2  . LYS A 1 68  ? -5.665  -6.618  7.778   1.00 0.00 ? 68  LYS A HG2  2  
ATOM 2629  H HG3  . LYS A 1 68  ? -5.604  -6.380  6.048   1.00 0.00 ? 68  LYS A HG3  2  
ATOM 2630  H HD2  . LYS A 1 68  ? -7.385  -7.909  5.641   1.00 0.00 ? 68  LYS A HD2  2  
ATOM 2631  H HD3  . LYS A 1 68  ? -7.189  -8.697  7.206   1.00 0.00 ? 68  LYS A HD3  2  
ATOM 2632  H HE2  . LYS A 1 68  ? -7.972  -6.603  8.347   1.00 0.00 ? 68  LYS A HE2  2  
ATOM 2633  H HE3  . LYS A 1 68  ? -8.294  -5.904  6.755   1.00 0.00 ? 68  LYS A HE3  2  
ATOM 2634  H HZ1  . LYS A 1 68  ? -10.315 -6.820  7.589   1.00 0.00 ? 68  LYS A HZ1  2  
ATOM 2635  H HZ2  . LYS A 1 68  ? -9.835  -7.796  6.379   1.00 0.00 ? 68  LYS A HZ2  2  
ATOM 2636  H HZ3  . LYS A 1 68  ? -9.649  -8.280  7.909   1.00 0.00 ? 68  LYS A HZ3  2  
ATOM 2637  N N    . GLY A 1 69  ? -1.532  -7.257  5.912   1.00 0.00 ? 69  GLY A N    2  
ATOM 2638  C CA   . GLY A 1 69  ? -0.444  -6.292  5.932   1.00 0.00 ? 69  GLY A CA   2  
ATOM 2639  C C    . GLY A 1 69  ? 0.009   -5.896  4.531   1.00 0.00 ? 69  GLY A C    2  
ATOM 2640  O O    . GLY A 1 69  ? 0.327   -4.732  4.295   1.00 0.00 ? 69  GLY A O    2  
ATOM 2641  H H    . GLY A 1 69  ? -1.336  -8.185  6.261   1.00 0.00 ? 69  GLY A H    2  
ATOM 2642  H HA2  . GLY A 1 69  ? -0.759  -5.404  6.478   1.00 0.00 ? 69  GLY A HA2  2  
ATOM 2643  H HA3  . GLY A 1 69  ? 0.401   -6.732  6.458   1.00 0.00 ? 69  GLY A HA3  2  
ATOM 2644  N N    . ARG A 1 70  ? 0.080   -6.851  3.604   1.00 0.00 ? 70  ARG A N    2  
ATOM 2645  C CA   . ARG A 1 70  ? 0.613   -6.657  2.260   1.00 0.00 ? 70  ARG A CA   2  
ATOM 2646  C C    . ARG A 1 70  ? -0.338  -5.844  1.389   1.00 0.00 ? 70  ARG A C    2  
ATOM 2647  O O    . ARG A 1 70  ? 0.132   -5.189  0.467   1.00 0.00 ? 70  ARG A O    2  
ATOM 2648  C CB   . ARG A 1 70  ? 0.897   -8.029  1.618   1.00 0.00 ? 70  ARG A CB   2  
ATOM 2649  C CG   . ARG A 1 70  ? 2.095   -8.750  2.258   1.00 0.00 ? 70  ARG A CG   2  
ATOM 2650  C CD   . ARG A 1 70  ? 2.086   -10.259 1.994   1.00 0.00 ? 70  ARG A CD   2  
ATOM 2651  N NE   . ARG A 1 70  ? 3.246   -10.899 2.639   1.00 0.00 ? 70  ARG A NE   2  
ATOM 2652  C CZ   . ARG A 1 70  ? 3.678   -12.153 2.490   1.00 0.00 ? 70  ARG A CZ   2  
ATOM 2653  N NH1  . ARG A 1 70  ? 2.950   -13.053 1.846   1.00 0.00 ? 70  ARG A NH1  2  
ATOM 2654  N NH2  . ARG A 1 70  ? 4.835   -12.516 3.034   1.00 0.00 ? 70  ARG A NH2  2  
ATOM 2655  H H    . ARG A 1 70  ? -0.163  -7.799  3.873   1.00 0.00 ? 70  ARG A H    2  
ATOM 2656  H HA   . ARG A 1 70  ? 1.550   -6.103  2.321   1.00 0.00 ? 70  ARG A HA   2  
ATOM 2657  H HB2  . ARG A 1 70  ? 0.003   -8.648  1.698   1.00 0.00 ? 70  ARG A HB2  2  
ATOM 2658  H HB3  . ARG A 1 70  ? 1.124   -7.888  0.563   1.00 0.00 ? 70  ARG A HB3  2  
ATOM 2659  H HG2  . ARG A 1 70  ? 3.018   -8.313  1.881   1.00 0.00 ? 70  ARG A HG2  2  
ATOM 2660  H HG3  . ARG A 1 70  ? 2.082   -8.606  3.332   1.00 0.00 ? 70  ARG A HG3  2  
ATOM 2661  H HD2  . ARG A 1 70  ? 1.162   -10.675 2.398   1.00 0.00 ? 70  ARG A HD2  2  
ATOM 2662  H HD3  . ARG A 1 70  ? 2.116   -10.444 0.920   1.00 0.00 ? 70  ARG A HD3  2  
ATOM 2663  H HE   . ARG A 1 70  ? 3.757   -10.310 3.290   1.00 0.00 ? 70  ARG A HE   2  
ATOM 2664  H HH11 . ARG A 1 70  ? 2.064   -12.795 1.404   1.00 0.00 ? 70  ARG A HH11 2  
ATOM 2665  H HH12 . ARG A 1 70  ? 3.381   -13.929 1.529   1.00 0.00 ? 70  ARG A HH12 2  
ATOM 2666  H HH21 . ARG A 1 70  ? 5.403   -11.829 3.527   1.00 0.00 ? 70  ARG A HH21 2  
ATOM 2667  H HH22 . ARG A 1 70  ? 5.221   -13.453 2.907   1.00 0.00 ? 70  ARG A HH22 2  
ATOM 2668  N N    . GLU A 1 71  ? -1.641  -5.837  1.681   1.00 0.00 ? 71  GLU A N    2  
ATOM 2669  C CA   . GLU A 1 71  ? -2.683  -5.208  0.871   1.00 0.00 ? 71  GLU A CA   2  
ATOM 2670  C C    . GLU A 1 71  ? -2.324  -3.837  0.263   1.00 0.00 ? 71  GLU A C    2  
ATOM 2671  O O    . GLU A 1 71  ? -2.409  -3.708  -0.963  1.00 0.00 ? 71  GLU A O    2  
ATOM 2672  C CB   . GLU A 1 71  ? -3.980  -5.104  1.674   1.00 0.00 ? 71  GLU A CB   2  
ATOM 2673  C CG   . GLU A 1 71  ? -4.884  -6.320  1.496   1.00 0.00 ? 71  GLU A CG   2  
ATOM 2674  C CD   . GLU A 1 71  ? -6.193  -6.072  2.229   1.00 0.00 ? 71  GLU A CD   2  
ATOM 2675  O OE1  . GLU A 1 71  ? -6.974  -5.203  1.783   1.00 0.00 ? 71  GLU A OE1  2  
ATOM 2676  O OE2  . GLU A 1 71  ? -6.407  -6.696  3.294   1.00 0.00 ? 71  GLU A OE2  2  
ATOM 2677  H H    . GLU A 1 71  ? -1.971  -6.409  2.444   1.00 0.00 ? 71  GLU A H    2  
ATOM 2678  H HA   . GLU A 1 71  ? -2.872  -5.880  0.036   1.00 0.00 ? 71  GLU A HA   2  
ATOM 2679  H HB2  . GLU A 1 71  ? -3.760  -4.966  2.732   1.00 0.00 ? 71  GLU A HB2  2  
ATOM 2680  H HB3  . GLU A 1 71  ? -4.522  -4.227  1.335   1.00 0.00 ? 71  GLU A HB3  2  
ATOM 2681  H HG2  . GLU A 1 71  ? -5.089  -6.475  0.437   1.00 0.00 ? 71  GLU A HG2  2  
ATOM 2682  H HG3  . GLU A 1 71  ? -4.395  -7.207  1.900   1.00 0.00 ? 71  GLU A HG3  2  
ATOM 2683  N N    . PRO A 1 72  ? -1.947  -2.809  1.048   1.00 0.00 ? 72  PRO A N    2  
ATOM 2684  C CA   . PRO A 1 72  ? -1.643  -1.492  0.502   1.00 0.00 ? 72  PRO A CA   2  
ATOM 2685  C C    . PRO A 1 72  ? -0.348  -1.537  -0.310  1.00 0.00 ? 72  PRO A C    2  
ATOM 2686  O O    . PRO A 1 72  ? -0.305  -1.024  -1.425  1.00 0.00 ? 72  PRO A O    2  
ATOM 2687  C CB   . PRO A 1 72  ? -1.574  -0.552  1.709   1.00 0.00 ? 72  PRO A CB   2  
ATOM 2688  C CG   . PRO A 1 72  ? -1.209  -1.465  2.877   1.00 0.00 ? 72  PRO A CG   2  
ATOM 2689  C CD   . PRO A 1 72  ? -1.817  -2.810  2.496   1.00 0.00 ? 72  PRO A CD   2  
ATOM 2690  H HA   . PRO A 1 72  ? -2.453  -1.165  -0.152  1.00 0.00 ? 72  PRO A HA   2  
ATOM 2691  H HB2  . PRO A 1 72  ? -0.843  0.249   1.594   1.00 0.00 ? 72  PRO A HB2  2  
ATOM 2692  H HB3  . PRO A 1 72  ? -2.563  -0.125  1.879   1.00 0.00 ? 72  PRO A HB3  2  
ATOM 2693  H HG2  . PRO A 1 72  ? -0.126  -1.566  2.951   1.00 0.00 ? 72  PRO A HG2  2  
ATOM 2694  H HG3  . PRO A 1 72  ? -1.619  -1.094  3.814   1.00 0.00 ? 72  PRO A HG3  2  
ATOM 2695  H HD2  . PRO A 1 72  ? -1.162  -3.606  2.827   1.00 0.00 ? 72  PRO A HD2  2  
ATOM 2696  H HD3  . PRO A 1 72  ? -2.793  -2.926  2.958   1.00 0.00 ? 72  PRO A HD3  2  
ATOM 2697  N N    . PHE A 1 73  ? 0.687   -2.216  0.189   1.00 0.00 ? 73  PHE A N    2  
ATOM 2698  C CA   . PHE A 1 73  ? 1.952   -2.372  -0.516  1.00 0.00 ? 73  PHE A CA   2  
ATOM 2699  C C    . PHE A 1 73  ? 1.749   -3.023  -1.889  1.00 0.00 ? 73  PHE A C    2  
ATOM 2700  O O    . PHE A 1 73  ? 2.422   -2.661  -2.847  1.00 0.00 ? 73  PHE A O    2  
ATOM 2701  C CB   . PHE A 1 73  ? 2.921   -3.192  0.342   1.00 0.00 ? 73  PHE A CB   2  
ATOM 2702  C CG   . PHE A 1 73  ? 3.528   -2.428  1.506   1.00 0.00 ? 73  PHE A CG   2  
ATOM 2703  C CD1  . PHE A 1 73  ? 4.621   -1.571  1.272   1.00 0.00 ? 73  PHE A CD1  2  
ATOM 2704  C CD2  . PHE A 1 73  ? 3.017   -2.555  2.813   1.00 0.00 ? 73  PHE A CD2  2  
ATOM 2705  C CE1  . PHE A 1 73  ? 5.226   -0.880  2.333   1.00 0.00 ? 73  PHE A CE1  2  
ATOM 2706  C CE2  . PHE A 1 73  ? 3.616   -1.851  3.876   1.00 0.00 ? 73  PHE A CE2  2  
ATOM 2707  C CZ   . PHE A 1 73  ? 4.735   -1.032  3.640   1.00 0.00 ? 73  PHE A CZ   2  
ATOM 2708  H H    . PHE A 1 73  ? 0.571   -2.687  1.072   1.00 0.00 ? 73  PHE A H    2  
ATOM 2709  H HA   . PHE A 1 73  ? 2.381   -1.381  -0.679  1.00 0.00 ? 73  PHE A HA   2  
ATOM 2710  H HB2  . PHE A 1 73  ? 2.429   -4.102  0.695   1.00 0.00 ? 73  PHE A HB2  2  
ATOM 2711  H HB3  . PHE A 1 73  ? 3.739   -3.505  -0.300  1.00 0.00 ? 73  PHE A HB3  2  
ATOM 2712  H HD1  . PHE A 1 73  ? 5.007   -1.449  0.272   1.00 0.00 ? 73  PHE A HD1  2  
ATOM 2713  H HD2  . PHE A 1 73  ? 2.173   -3.200  3.010   1.00 0.00 ? 73  PHE A HD2  2  
ATOM 2714  H HE1  . PHE A 1 73  ? 6.076   -0.241  2.141   1.00 0.00 ? 73  PHE A HE1  2  
ATOM 2715  H HE2  . PHE A 1 73  ? 3.228   -1.951  4.882   1.00 0.00 ? 73  PHE A HE2  2  
ATOM 2716  H HZ   . PHE A 1 73  ? 5.221   -0.515  4.458   1.00 0.00 ? 73  PHE A HZ   2  
ATOM 2717  N N    . ILE A 1 74  ? 0.816   -3.962  -2.019  1.00 0.00 ? 74  ILE A N    2  
ATOM 2718  C CA   . ILE A 1 74  ? 0.442   -4.571  -3.290  1.00 0.00 ? 74  ILE A CA   2  
ATOM 2719  C C    . ILE A 1 74  ? -0.122  -3.516  -4.243  1.00 0.00 ? 74  ILE A C    2  
ATOM 2720  O O    . ILE A 1 74  ? 0.313   -3.451  -5.392  1.00 0.00 ? 74  ILE A O    2  
ATOM 2721  C CB   . ILE A 1 74  ? -0.545  -5.718  -3.004  1.00 0.00 ? 74  ILE A CB   2  
ATOM 2722  C CG1  . ILE A 1 74  ? 0.188   -6.916  -2.379  1.00 0.00 ? 74  ILE A CG1  2  
ATOM 2723  C CG2  . ILE A 1 74  ? -1.336  -6.148  -4.243  1.00 0.00 ? 74  ILE A CG2  2  
ATOM 2724  C CD1  . ILE A 1 74  ? -0.747  -7.829  -1.579  1.00 0.00 ? 74  ILE A CD1  2  
ATOM 2725  H H    . ILE A 1 74  ? 0.324   -4.258  -1.182  1.00 0.00 ? 74  ILE A H    2  
ATOM 2726  H HA   . ILE A 1 74  ? 1.333   -4.978  -3.771  1.00 0.00 ? 74  ILE A HA   2  
ATOM 2727  H HB   . ILE A 1 74  ? -1.259  -5.361  -2.273  1.00 0.00 ? 74  ILE A HB   2  
ATOM 2728  H HG12 . ILE A 1 74  ? 0.688   -7.490  -3.160  1.00 0.00 ? 74  ILE A HG12 2  
ATOM 2729  H HG13 . ILE A 1 74  ? 0.945   -6.550  -1.688  1.00 0.00 ? 74  ILE A HG13 2  
ATOM 2730  H HG21 . ILE A 1 74  ? -0.650  -6.403  -5.053  1.00 0.00 ? 74  ILE A HG21 2  
ATOM 2731  H HG22 . ILE A 1 74  ? -1.947  -7.017  -4.009  1.00 0.00 ? 74  ILE A HG22 2  
ATOM 2732  H HG23 . ILE A 1 74  ? -2.002  -5.346  -4.572  1.00 0.00 ? 74  ILE A HG23 2  
ATOM 2733  H HD11 . ILE A 1 74  ? -1.528  -8.244  -2.213  1.00 0.00 ? 74  ILE A HD11 2  
ATOM 2734  H HD12 . ILE A 1 74  ? -0.172  -8.652  -1.155  1.00 0.00 ? 74  ILE A HD12 2  
ATOM 2735  H HD13 . ILE A 1 74  ? -1.203  -7.265  -0.771  1.00 0.00 ? 74  ILE A HD13 2  
ATOM 2736  N N    . ARG A 1 75  ? -1.075  -2.686  -3.802  1.00 0.00 ? 75  ARG A N    2  
ATOM 2737  C CA   . ARG A 1 75  ? -1.617  -1.636  -4.641  1.00 0.00 ? 75  ARG A CA   2  
ATOM 2738  C C    . ARG A 1 75  ? -0.514  -0.662  -5.034  1.00 0.00 ? 75  ARG A C    2  
ATOM 2739  O O    . ARG A 1 75  ? -0.496  -0.232  -6.183  1.00 0.00 ? 75  ARG A O    2  
ATOM 2740  C CB   . ARG A 1 75  ? -2.761  -0.942  -3.903  1.00 0.00 ? 75  ARG A CB   2  
ATOM 2741  C CG   . ARG A 1 75  ? -4.030  -1.805  -3.866  1.00 0.00 ? 75  ARG A CG   2  
ATOM 2742  C CD   . ARG A 1 75  ? -5.192  -1.039  -3.207  1.00 0.00 ? 75  ARG A CD   2  
ATOM 2743  N NE   . ARG A 1 75  ? -6.162  -0.497  -4.175  1.00 0.00 ? 75  ARG A NE   2  
ATOM 2744  C CZ   . ARG A 1 75  ? -7.052  -1.211  -4.883  1.00 0.00 ? 75  ARG A CZ   2  
ATOM 2745  N NH1  . ARG A 1 75  ? -7.169  -2.525  -4.738  1.00 0.00 ? 75  ARG A NH1  2  
ATOM 2746  N NH2  . ARG A 1 75  ? -7.835  -0.607  -5.758  1.00 0.00 ? 75  ARG A NH2  2  
ATOM 2747  H H    . ARG A 1 75  ? -1.404  -2.671  -2.847  1.00 0.00 ? 75  ARG A H    2  
ATOM 2748  H HA   . ARG A 1 75  ? -2.001  -2.080  -5.561  1.00 0.00 ? 75  ARG A HA   2  
ATOM 2749  H HB2  . ARG A 1 75  ? -2.457  -0.698  -2.885  1.00 0.00 ? 75  ARG A HB2  2  
ATOM 2750  H HB3  . ARG A 1 75  ? -2.974  -0.020  -4.420  1.00 0.00 ? 75  ARG A HB3  2  
ATOM 2751  H HG2  . ARG A 1 75  ? -4.302  -2.104  -4.879  1.00 0.00 ? 75  ARG A HG2  2  
ATOM 2752  H HG3  . ARG A 1 75  ? -3.820  -2.713  -3.295  1.00 0.00 ? 75  ARG A HG3  2  
ATOM 2753  H HD2  . ARG A 1 75  ? -5.714  -1.706  -2.523  1.00 0.00 ? 75  ARG A HD2  2  
ATOM 2754  H HD3  . ARG A 1 75  ? -4.789  -0.199  -2.642  1.00 0.00 ? 75  ARG A HD3  2  
ATOM 2755  H HE   . ARG A 1 75  ? -6.171  0.519   -4.247  1.00 0.00 ? 75  ARG A HE   2  
ATOM 2756  H HH11 . ARG A 1 75  ? -6.591  -3.052  -4.084  1.00 0.00 ? 75  ARG A HH11 2  
ATOM 2757  H HH12 . ARG A 1 75  ? -7.867  -3.072  -5.231  1.00 0.00 ? 75  ARG A HH12 2  
ATOM 2758  H HH21 . ARG A 1 75  ? -7.830  0.408   -5.851  1.00 0.00 ? 75  ARG A HH21 2  
ATOM 2759  H HH22 . ARG A 1 75  ? -8.368  -1.127  -6.453  1.00 0.00 ? 75  ARG A HH22 2  
ATOM 2760  N N    . MET A 1 76  ? 0.432   -0.368  -4.136  1.00 0.00 ? 76  MET A N    2  
ATOM 2761  C CA   . MET A 1 76  ? 1.628   0.401   -4.441  1.00 0.00 ? 76  MET A CA   2  
ATOM 2762  C C    . MET A 1 76  ? 2.421   -0.209  -5.610  1.00 0.00 ? 76  MET A C    2  
ATOM 2763  O O    . MET A 1 76  ? 2.843   0.537   -6.491  1.00 0.00 ? 76  MET A O    2  
ATOM 2764  C CB   . MET A 1 76  ? 2.490   0.516   -3.168  1.00 0.00 ? 76  MET A CB   2  
ATOM 2765  C CG   . MET A 1 76  ? 2.771   1.962   -2.781  1.00 0.00 ? 76  MET A CG   2  
ATOM 2766  S SD   . MET A 1 76  ? 4.112   2.177   -1.575  1.00 0.00 ? 76  MET A SD   2  
ATOM 2767  C CE   . MET A 1 76  ? 3.189   1.981   -0.040  1.00 0.00 ? 76  MET A CE   2  
ATOM 2768  H H    . MET A 1 76  ? 0.335   -0.688  -3.175  1.00 0.00 ? 76  MET A H    2  
ATOM 2769  H HA   . MET A 1 76  ? 1.306   1.397   -4.750  1.00 0.00 ? 76  MET A HA   2  
ATOM 2770  H HB2  . MET A 1 76  ? 1.994   0.044   -2.325  1.00 0.00 ? 76  MET A HB2  2  
ATOM 2771  H HB3  . MET A 1 76  ? 3.441   0.015   -3.329  1.00 0.00 ? 76  MET A HB3  2  
ATOM 2772  H HG2  . MET A 1 76  ? 3.031   2.496   -3.689  1.00 0.00 ? 76  MET A HG2  2  
ATOM 2773  H HG3  . MET A 1 76  ? 1.863   2.401   -2.377  1.00 0.00 ? 76  MET A HG3  2  
ATOM 2774  H HE1  . MET A 1 76  ? 3.888   1.966   0.800   1.00 0.00 ? 76  MET A HE1  2  
ATOM 2775  H HE2  . MET A 1 76  ? 2.514   2.826   0.087   1.00 0.00 ? 76  MET A HE2  2  
ATOM 2776  H HE3  . MET A 1 76  ? 2.610   1.058   -0.104  1.00 0.00 ? 76  MET A HE3  2  
ATOM 2777  N N    . GLN A 1 77  ? 2.627   -1.536  -5.633  1.00 0.00 ? 77  GLN A N    2  
ATOM 2778  C CA   . GLN A 1 77  ? 3.395   -2.201  -6.692  1.00 0.00 ? 77  GLN A CA   2  
ATOM 2779  C C    . GLN A 1 77  ? 2.663   -2.065  -8.012  1.00 0.00 ? 77  GLN A C    2  
ATOM 2780  O O    . GLN A 1 77  ? 3.265   -1.734  -9.031  1.00 0.00 ? 77  GLN A O    2  
ATOM 2781  C CB   . GLN A 1 77  ? 3.579   -3.705  -6.432  1.00 0.00 ? 77  GLN A CB   2  
ATOM 2782  C CG   . GLN A 1 77  ? 4.435   -4.019  -5.209  1.00 0.00 ? 77  GLN A CG   2  
ATOM 2783  C CD   . GLN A 1 77  ? 4.281   -5.459  -4.741  1.00 0.00 ? 77  GLN A CD   2  
ATOM 2784  O OE1  . GLN A 1 77  ? 4.713   -6.395  -5.395  1.00 0.00 ? 77  GLN A OE1  2  
ATOM 2785  N NE2  . GLN A 1 77  ? 3.712   -5.666  -3.564  1.00 0.00 ? 77  GLN A NE2  2  
ATOM 2786  H H    . GLN A 1 77  ? 2.186   -2.128  -4.938  1.00 0.00 ? 77  GLN A H    2  
ATOM 2787  H HA   . GLN A 1 77  ? 4.373   -1.729  -6.790  1.00 0.00 ? 77  GLN A HA   2  
ATOM 2788  H HB2  . GLN A 1 77  ? 2.604   -4.174  -6.316  1.00 0.00 ? 77  GLN A HB2  2  
ATOM 2789  H HB3  . GLN A 1 77  ? 4.062   -4.137  -7.311  1.00 0.00 ? 77  GLN A HB3  2  
ATOM 2790  H HG2  . GLN A 1 77  ? 5.478   -3.850  -5.454  1.00 0.00 ? 77  GLN A HG2  2  
ATOM 2791  H HG3  . GLN A 1 77  ? 4.163   -3.348  -4.405  1.00 0.00 ? 77  GLN A HG3  2  
ATOM 2792  H HE21 . GLN A 1 77  ? 3.389   -4.885  -3.013  1.00 0.00 ? 77  GLN A HE21 2  
ATOM 2793  H HE22 . GLN A 1 77  ? 3.666   -6.623  -3.242  1.00 0.00 ? 77  GLN A HE22 2  
ATOM 2794  N N    . LEU A 1 78  ? 1.366   -2.366  -8.004  1.00 0.00 ? 78  LEU A N    2  
ATOM 2795  C CA   . LEU A 1 78  ? 0.582   -2.339  -9.218  1.00 0.00 ? 78  LEU A CA   2  
ATOM 2796  C C    . LEU A 1 78  ? 0.515   -0.934  -9.757  1.00 0.00 ? 78  LEU A C    2  
ATOM 2797  O O    . LEU A 1 78  ? 0.862   -0.753  -10.915 1.00 0.00 ? 78  LEU A O    2  
ATOM 2798  C CB   . LEU A 1 78  ? -0.808  -2.941  -8.982  1.00 0.00 ? 78  LEU A CB   2  
ATOM 2799  C CG   . LEU A 1 78  ? -0.823  -4.427  -9.365  1.00 0.00 ? 78  LEU A CG   2  
ATOM 2800  C CD1  . LEU A 1 78  ? -1.960  -5.146  -8.639  1.00 0.00 ? 78  LEU A CD1  2  
ATOM 2801  C CD2  . LEU A 1 78  ? -0.972  -4.583  -10.886 1.00 0.00 ? 78  LEU A CD2  2  
ATOM 2802  H H    . LEU A 1 78  ? 0.930   -2.639  -7.128  1.00 0.00 ? 78  LEU A H    2  
ATOM 2803  H HA   . LEU A 1 78  ? 1.128   -2.895  -9.976  1.00 0.00 ? 78  LEU A HA   2  
ATOM 2804  H HB2  . LEU A 1 78  ? -1.077  -2.818  -7.932  1.00 0.00 ? 78  LEU A HB2  2  
ATOM 2805  H HB3  . LEU A 1 78  ? -1.550  -2.411  -9.582  1.00 0.00 ? 78  LEU A HB3  2  
ATOM 2806  H HG   . LEU A 1 78  ? 0.114   -4.887  -9.047  1.00 0.00 ? 78  LEU A HG   2  
ATOM 2807  H HD11 . LEU A 1 78  ? -2.915  -4.686  -8.895  1.00 0.00 ? 78  LEU A HD11 2  
ATOM 2808  H HD12 . LEU A 1 78  ? -1.977  -6.193  -8.931  1.00 0.00 ? 78  LEU A HD12 2  
ATOM 2809  H HD13 . LEU A 1 78  ? -1.801  -5.073  -7.561  1.00 0.00 ? 78  LEU A HD13 2  
ATOM 2810  H HD21 . LEU A 1 78  ? -0.944  -5.632  -11.164 1.00 0.00 ? 78  LEU A HD21 2  
ATOM 2811  H HD22 . LEU A 1 78  ? -1.922  -4.160  -11.221 1.00 0.00 ? 78  LEU A HD22 2  
ATOM 2812  H HD23 . LEU A 1 78  ? -0.160  -4.074  -11.405 1.00 0.00 ? 78  LEU A HD23 2  
ATOM 2813  N N    . TRP A 1 79  ? 0.147   0.050   -8.937  1.00 0.00 ? 79  TRP A N    2  
ATOM 2814  C CA   . TRP A 1 79  ? -0.011  1.438   -9.346  1.00 0.00 ? 79  TRP A CA   2  
ATOM 2815  C C    . TRP A 1 79  ? 1.179   1.954   -10.157 1.00 0.00 ? 79  TRP A C    2  
ATOM 2816  O O    . TRP A 1 79  ? 0.974   2.672   -11.135 1.00 0.00 ? 79  TRP A O    2  
ATOM 2817  C CB   . TRP A 1 79  ? -0.228  2.305   -8.099  1.00 0.00 ? 79  TRP A CB   2  
ATOM 2818  C CG   . TRP A 1 79  ? -0.247  3.767   -8.390  1.00 0.00 ? 79  TRP A CG   2  
ATOM 2819  C CD1  . TRP A 1 79  ? -1.302  4.478   -8.847  1.00 0.00 ? 79  TRP A CD1  2  
ATOM 2820  C CD2  . TRP A 1 79  ? 0.885   4.686   -8.356  1.00 0.00 ? 79  TRP A CD2  2  
ATOM 2821  N NE1  . TRP A 1 79  ? -0.887  5.763   -9.135  1.00 0.00 ? 79  TRP A NE1  2  
ATOM 2822  C CE2  . TRP A 1 79  ? 0.448   5.952   -8.840  1.00 0.00 ? 79  TRP A CE2  2  
ATOM 2823  C CE3  . TRP A 1 79  ? 2.243   4.558   -7.988  1.00 0.00 ? 79  TRP A CE3  2  
ATOM 2824  C CZ2  . TRP A 1 79  ? 1.322   7.043   -8.960  1.00 0.00 ? 79  TRP A CZ2  2  
ATOM 2825  C CZ3  . TRP A 1 79  ? 3.120   5.654   -8.079  1.00 0.00 ? 79  TRP A CZ3  2  
ATOM 2826  C CH2  . TRP A 1 79  ? 2.664   6.890   -8.572  1.00 0.00 ? 79  TRP A CH2  2  
ATOM 2827  H H    . TRP A 1 79  ? -0.052  -0.171  -7.968  1.00 0.00 ? 79  TRP A H    2  
ATOM 2828  H HA   . TRP A 1 79  ? -0.886  1.504   -9.991  1.00 0.00 ? 79  TRP A HA   2  
ATOM 2829  H HB2  . TRP A 1 79  ? -1.155  2.025   -7.603  1.00 0.00 ? 79  TRP A HB2  2  
ATOM 2830  H HB3  . TRP A 1 79  ? 0.585   2.118   -7.397  1.00 0.00 ? 79  TRP A HB3  2  
ATOM 2831  H HD1  . TRP A 1 79  ? -2.302  4.098   -9.030  1.00 0.00 ? 79  TRP A HD1  2  
ATOM 2832  H HE1  . TRP A 1 79  ? -1.479  6.422   -9.641  1.00 0.00 ? 79  TRP A HE1  2  
ATOM 2833  H HE3  . TRP A 1 79  ? 2.613   3.601   -7.642  1.00 0.00 ? 79  TRP A HE3  2  
ATOM 2834  H HZ2  . TRP A 1 79  ? 0.955   7.981   -9.351  1.00 0.00 ? 79  TRP A HZ2  2  
ATOM 2835  H HZ3  . TRP A 1 79  ? 4.150   5.543   -7.779  1.00 0.00 ? 79  TRP A HZ3  2  
ATOM 2836  H HH2  . TRP A 1 79  ? 3.350   7.720   -8.651  1.00 0.00 ? 79  TRP A HH2  2  
ATOM 2837  N N    . LEU A 1 80  ? 2.401   1.550   -9.791  1.00 0.00 ? 80  LEU A N    2  
ATOM 2838  C CA   . LEU A 1 80  ? 3.629   1.988   -10.450 1.00 0.00 ? 80  LEU A CA   2  
ATOM 2839  C C    . LEU A 1 80  ? 3.565   1.726   -11.957 1.00 0.00 ? 80  LEU A C    2  
ATOM 2840  O O    . LEU A 1 80  ? 3.999   2.559   -12.754 1.00 0.00 ? 80  LEU A O    2  
ATOM 2841  C CB   . LEU A 1 80  ? 4.827   1.248   -9.834  1.00 0.00 ? 80  LEU A CB   2  
ATOM 2842  C CG   . LEU A 1 80  ? 5.540   2.009   -8.706  1.00 0.00 ? 80  LEU A CG   2  
ATOM 2843  C CD1  . LEU A 1 80  ? 6.353   0.995   -7.908  1.00 0.00 ? 80  LEU A CD1  2  
ATOM 2844  C CD2  . LEU A 1 80  ? 6.476   3.089   -9.254  1.00 0.00 ? 80  LEU A CD2  2  
ATOM 2845  H H    . LEU A 1 80  ? 2.457   0.844   -9.065  1.00 0.00 ? 80  LEU A H    2  
ATOM 2846  H HA   . LEU A 1 80  ? 3.741   3.061   -10.300 1.00 0.00 ? 80  LEU A HA   2  
ATOM 2847  H HB2  . LEU A 1 80  ? 4.482   0.293   -9.440  1.00 0.00 ? 80  LEU A HB2  2  
ATOM 2848  H HB3  . LEU A 1 80  ? 5.553   1.031   -10.619 1.00 0.00 ? 80  LEU A HB3  2  
ATOM 2849  H HG   . LEU A 1 80  ? 4.803   2.470   -8.049  1.00 0.00 ? 80  LEU A HG   2  
ATOM 2850  H HD11 . LEU A 1 80  ? 6.969   0.412   -8.586  1.00 0.00 ? 80  LEU A HD11 2  
ATOM 2851  H HD12 . LEU A 1 80  ? 7.000   1.493   -7.193  1.00 0.00 ? 80  LEU A HD12 2  
ATOM 2852  H HD13 . LEU A 1 80  ? 5.672   0.327   -7.381  1.00 0.00 ? 80  LEU A HD13 2  
ATOM 2853  H HD21 . LEU A 1 80  ? 7.264   2.640   -9.864  1.00 0.00 ? 80  LEU A HD21 2  
ATOM 2854  H HD22 . LEU A 1 80  ? 5.907   3.774   -9.866  1.00 0.00 ? 80  LEU A HD22 2  
ATOM 2855  H HD23 . LEU A 1 80  ? 6.936   3.652   -8.441  1.00 0.00 ? 80  LEU A HD23 2  
ATOM 2856  N N    . SER A 1 81  ? 3.013   0.583   -12.354 1.00 0.00 ? 81  SER A N    2  
ATOM 2857  C CA   . SER A 1 81  ? 2.814   0.214   -13.745 1.00 0.00 ? 81  SER A CA   2  
ATOM 2858  C C    . SER A 1 81  ? 1.387   0.603   -14.172 1.00 0.00 ? 81  SER A C    2  
ATOM 2859  O O    . SER A 1 81  ? 1.182   1.402   -15.084 1.00 0.00 ? 81  SER A O    2  
ATOM 2860  C CB   . SER A 1 81  ? 3.103   -1.291  -13.841 1.00 0.00 ? 81  SER A CB   2  
ATOM 2861  O OG   . SER A 1 81  ? 3.453   -1.700  -15.149 1.00 0.00 ? 81  SER A OG   2  
ATOM 2862  H H    . SER A 1 81  ? 2.614   -0.021  -11.639 1.00 0.00 ? 81  SER A H    2  
ATOM 2863  H HA   . SER A 1 81  ? 3.535   0.743   -14.370 1.00 0.00 ? 81  SER A HA   2  
ATOM 2864  H HB2  . SER A 1 81  ? 3.943   -1.534  -13.187 1.00 0.00 ? 81  SER A HB2  2  
ATOM 2865  H HB3  . SER A 1 81  ? 2.234   -1.854  -13.499 1.00 0.00 ? 81  SER A HB3  2  
ATOM 2866  H HG   . SER A 1 81  ? 4.436   -1.684  -15.207 1.00 0.00 ? 81  SER A HG   2  
ATOM 2867  N N    . ASP A 1 82  ? 0.402   0.052   -13.469 1.00 0.00 ? 82  ASP A N    2  
ATOM 2868  C CA   . ASP A 1 82  ? -1.001  -0.124  -13.821 1.00 0.00 ? 82  ASP A CA   2  
ATOM 2869  C C    . ASP A 1 82  ? -1.851  1.136   -13.651 1.00 0.00 ? 82  ASP A C    2  
ATOM 2870  O O    . ASP A 1 82  ? -2.933  1.219   -14.228 1.00 0.00 ? 82  ASP A O    2  
ATOM 2871  C CB   . ASP A 1 82  ? -1.539  -1.216  -12.885 1.00 0.00 ? 82  ASP A CB   2  
ATOM 2872  C CG   . ASP A 1 82  ? -2.919  -1.720  -13.290 1.00 0.00 ? 82  ASP A CG   2  
ATOM 2873  O OD1  . ASP A 1 82  ? -2.995  -2.489  -14.273 1.00 0.00 ? 82  ASP A OD1  2  
ATOM 2874  O OD2  . ASP A 1 82  ? -3.885  -1.426  -12.545 1.00 0.00 ? 82  ASP A OD2  2  
ATOM 2875  H H    . ASP A 1 82  ? 0.682   -0.464  -12.646 1.00 0.00 ? 82  ASP A H    2  
ATOM 2876  H HA   . ASP A 1 82  ? -1.074  -0.469  -14.854 1.00 0.00 ? 82  ASP A HA   2  
ATOM 2877  H HB2  . ASP A 1 82  ? -0.848  -2.063  -12.881 1.00 0.00 ? 82  ASP A HB2  2  
ATOM 2878  H HB3  . ASP A 1 82  ? -1.591  -0.822  -11.867 1.00 0.00 ? 82  ASP A HB3  2  
ATOM 2879  N N    . GLN A 1 83  ? -1.378  2.112   -12.868 1.00 0.00 ? 83  GLN A N    2  
ATOM 2880  C CA   . GLN A 1 83  ? -2.034  3.376   -12.517 1.00 0.00 ? 83  GLN A CA   2  
ATOM 2881  C C    . GLN A 1 83  ? -3.447  3.295   -11.897 1.00 0.00 ? 83  GLN A C    2  
ATOM 2882  O O    . GLN A 1 83  ? -3.929  4.334   -11.440 1.00 0.00 ? 83  GLN A O    2  
ATOM 2883  C CB   . GLN A 1 83  ? -2.004  4.347   -13.713 1.00 0.00 ? 83  GLN A CB   2  
ATOM 2884  C CG   . GLN A 1 83  ? -0.621  4.973   -13.972 1.00 0.00 ? 83  GLN A CG   2  
ATOM 2885  C CD   . GLN A 1 83  ? -0.762  6.404   -14.499 1.00 0.00 ? 83  GLN A CD   2  
ATOM 2886  O OE1  . GLN A 1 83  ? -1.293  7.268   -13.802 1.00 0.00 ? 83  GLN A OE1  2  
ATOM 2887  N NE2  . GLN A 1 83  ? -0.304  6.694   -15.707 1.00 0.00 ? 83  GLN A NE2  2  
ATOM 2888  H H    . GLN A 1 83  ? -0.449  1.987   -12.479 1.00 0.00 ? 83  GLN A H    2  
ATOM 2889  H HA   . GLN A 1 83  ? -1.422  3.827   -11.735 1.00 0.00 ? 83  GLN A HA   2  
ATOM 2890  H HB2  . GLN A 1 83  ? -2.351  3.845   -14.615 1.00 0.00 ? 83  GLN A HB2  2  
ATOM 2891  H HB3  . GLN A 1 83  ? -2.710  5.151   -13.510 1.00 0.00 ? 83  GLN A HB3  2  
ATOM 2892  H HG2  . GLN A 1 83  ? -0.056  5.022   -13.041 1.00 0.00 ? 83  GLN A HG2  2  
ATOM 2893  H HG3  . GLN A 1 83  ? -0.066  4.350   -14.674 1.00 0.00 ? 83  GLN A HG3  2  
ATOM 2894  H HE21 . GLN A 1 83  ? 0.155   5.992   -16.282 1.00 0.00 ? 83  GLN A HE21 2  
ATOM 2895  H HE22 . GLN A 1 83  ? -0.466  7.620   -16.084 1.00 0.00 ? 83  GLN A HE22 2  
ATOM 2896  N N    . LEU A 1 84  ? -4.065  2.112   -11.761 1.00 0.00 ? 84  LEU A N    2  
ATOM 2897  C CA   . LEU A 1 84  ? -5.449  1.874   -11.364 1.00 0.00 ? 84  LEU A CA   2  
ATOM 2898  C C    . LEU A 1 84  ? -6.457  2.619   -12.246 1.00 0.00 ? 84  LEU A C    2  
ATOM 2899  O O    . LEU A 1 84  ? -6.797  3.769   -11.968 1.00 0.00 ? 84  LEU A O    2  
ATOM 2900  C CB   . LEU A 1 84  ? -5.668  2.137   -9.880  1.00 0.00 ? 84  LEU A CB   2  
ATOM 2901  C CG   . LEU A 1 84  ? -4.990  1.090   -8.984  1.00 0.00 ? 84  LEU A CG   2  
ATOM 2902  C CD1  . LEU A 1 84  ? -3.643  1.552   -8.436  1.00 0.00 ? 84  LEU A CD1  2  
ATOM 2903  C CD2  . LEU A 1 84  ? -5.902  0.792   -7.815  1.00 0.00 ? 84  LEU A CD2  2  
ATOM 2904  H H    . LEU A 1 84  ? -3.604  1.286   -12.099 1.00 0.00 ? 84  LEU A H    2  
ATOM 2905  H HA   . LEU A 1 84  ? -5.642  0.810   -11.482 1.00 0.00 ? 84  LEU A HA   2  
ATOM 2906  H HB2  . LEU A 1 84  ? -5.313  3.131   -9.631  1.00 0.00 ? 84  LEU A HB2  2  
ATOM 2907  H HB3  . LEU A 1 84  ? -6.747  2.112   -9.721  1.00 0.00 ? 84  LEU A HB3  2  
ATOM 2908  H HG   . LEU A 1 84  ? -4.845  0.164   -9.533  1.00 0.00 ? 84  LEU A HG   2  
ATOM 2909  H HD11 . LEU A 1 84  ? -3.738  2.561   -8.043  1.00 0.00 ? 84  LEU A HD11 2  
ATOM 2910  H HD12 . LEU A 1 84  ? -3.315  0.898   -7.624  1.00 0.00 ? 84  LEU A HD12 2  
ATOM 2911  H HD13 . LEU A 1 84  ? -2.916  1.547   -9.241  1.00 0.00 ? 84  LEU A HD13 2  
ATOM 2912  H HD21 . LEU A 1 84  ? -6.052  1.703   -7.239  1.00 0.00 ? 84  LEU A HD21 2  
ATOM 2913  H HD22 . LEU A 1 84  ? -6.846  0.433   -8.221  1.00 0.00 ? 84  LEU A HD22 2  
ATOM 2914  H HD23 . LEU A 1 84  ? -5.456  0.020   -7.195  1.00 0.00 ? 84  LEU A HD23 2  
ATOM 2915  N N    . GLY A 1 85  ? -6.969  1.913   -13.260 1.00 0.00 ? 85  GLY A N    2  
ATOM 2916  C CA   . GLY A 1 85  ? -7.996  2.279   -14.237 1.00 0.00 ? 85  GLY A CA   2  
ATOM 2917  C C    . GLY A 1 85  ? -8.630  3.656   -14.055 1.00 0.00 ? 85  GLY A C    2  
ATOM 2918  O O    . GLY A 1 85  ? -8.298  4.591   -14.785 1.00 0.00 ? 85  GLY A O    2  
ATOM 2919  H H    . GLY A 1 85  ? -6.612  0.968   -13.364 1.00 0.00 ? 85  GLY A H    2  
ATOM 2920  H HA2  . GLY A 1 85  ? -7.547  2.239   -15.229 1.00 0.00 ? 85  GLY A HA2  2  
ATOM 2921  H HA3  . GLY A 1 85  ? -8.783  1.530   -14.188 1.00 0.00 ? 85  GLY A HA3  2  
ATOM 2922  N N    . GLN A 1 86  ? -9.580  3.790   -13.127 1.00 0.00 ? 86  GLN A N    2  
ATOM 2923  C CA   . GLN A 1 86  ? -10.011 5.072   -12.604 1.00 0.00 ? 86  GLN A CA   2  
ATOM 2924  C C    . GLN A 1 86  ? -10.445 4.927   -11.153 1.00 0.00 ? 86  GLN A C    2  
ATOM 2925  O O    . GLN A 1 86  ? -9.933  5.635   -10.284 1.00 0.00 ? 86  GLN A O    2  
ATOM 2926  C CB   . GLN A 1 86  ? -11.131 5.666   -13.477 1.00 0.00 ? 86  GLN A CB   2  
ATOM 2927  C CG   . GLN A 1 86  ? -10.725 7.089   -13.858 1.00 0.00 ? 86  GLN A CG   2  
ATOM 2928  C CD   . GLN A 1 86  ? -11.756 7.816   -14.718 1.00 0.00 ? 86  GLN A CD   2  
ATOM 2929  O OE1  . GLN A 1 86  ? -12.489 8.676   -14.231 1.00 0.00 ? 86  GLN A OE1  2  
ATOM 2930  N NE2  . GLN A 1 86  ? -11.806 7.545   -16.007 1.00 0.00 ? 86  GLN A NE2  2  
ATOM 2931  H H    . GLN A 1 86  ? -9.921  2.981   -12.632 1.00 0.00 ? 86  GLN A H    2  
ATOM 2932  H HA   . GLN A 1 86  ? -9.150  5.739   -12.601 1.00 0.00 ? 86  GLN A HA   2  
ATOM 2933  H HB2  . GLN A 1 86  ? -11.274 5.075   -14.381 1.00 0.00 ? 86  GLN A HB2  2  
ATOM 2934  H HB3  . GLN A 1 86  ? -12.069 5.675   -12.927 1.00 0.00 ? 86  GLN A HB3  2  
ATOM 2935  H HG2  . GLN A 1 86  ? -10.561 7.653   -12.941 1.00 0.00 ? 86  GLN A HG2  2  
ATOM 2936  H HG3  . GLN A 1 86  ? -9.778  7.032   -14.394 1.00 0.00 ? 86  GLN A HG3  2  
ATOM 2937  H HE21 . GLN A 1 86  ? -11.173 6.850   -16.404 1.00 0.00 ? 86  GLN A HE21 2  
ATOM 2938  H HE22 . GLN A 1 86  ? -12.423 8.084   -16.611 1.00 0.00 ? 86  GLN A HE22 2  
ATOM 2939  N N    . ALA A 1 87  ? -11.382 4.020   -10.890 1.00 0.00 ? 87  ALA A N    2  
ATOM 2940  C CA   . ALA A 1 87  ? -11.966 3.749   -9.592  1.00 0.00 ? 87  ALA A CA   2  
ATOM 2941  C C    . ALA A 1 87  ? -12.782 2.468   -9.737  1.00 0.00 ? 87  ALA A C    2  
ATOM 2942  O O    . ALA A 1 87  ? -13.373 2.235   -10.795 1.00 0.00 ? 87  ALA A O    2  
ATOM 2943  C CB   . ALA A 1 87  ? -12.883 4.912   -9.213  1.00 0.00 ? 87  ALA A CB   2  
ATOM 2944  H H    . ALA A 1 87  ? -11.729 3.425   -11.632 1.00 0.00 ? 87  ALA A H    2  
ATOM 2945  H HA   . ALA A 1 87  ? -11.179 3.627   -8.846  1.00 0.00 ? 87  ALA A HA   2  
ATOM 2946  H HB1  . ALA A 1 87  ? -13.655 5.029   -9.974  1.00 0.00 ? 87  ALA A HB1  2  
ATOM 2947  H HB2  . ALA A 1 87  ? -13.352 4.711   -8.252  1.00 0.00 ? 87  ALA A HB2  2  
ATOM 2948  H HB3  . ALA A 1 87  ? -12.302 5.833   -9.150  1.00 0.00 ? 87  ALA A HB3  2  
ATOM 2949  N N    . VAL A 1 88  ? -12.836 1.640   -8.703  1.00 0.00 ? 88  VAL A N    2  
ATOM 2950  C CA   . VAL A 1 88  ? -13.597 0.397   -8.719  1.00 0.00 ? 88  VAL A CA   2  
ATOM 2951  C C    . VAL A 1 88  ? -13.931 0.025   -7.274  1.00 0.00 ? 88  VAL A C    2  
ATOM 2952  O O    . VAL A 1 88  ? -13.306 0.534   -6.336  1.00 0.00 ? 88  VAL A O    2  
ATOM 2953  C CB   . VAL A 1 88  ? -12.793 -0.679  -9.497  1.00 0.00 ? 88  VAL A CB   2  
ATOM 2954  C CG1  . VAL A 1 88  ? -11.476 -1.067  -8.811  1.00 0.00 ? 88  VAL A CG1  2  
ATOM 2955  C CG2  . VAL A 1 88  ? -13.606 -1.943  -9.796  1.00 0.00 ? 88  VAL A CG2  2  
ATOM 2956  H H    . VAL A 1 88  ? -12.397 1.896   -7.830  1.00 0.00 ? 88  VAL A H    2  
ATOM 2957  H HA   . VAL A 1 88  ? -14.532 0.580   -9.250  1.00 0.00 ? 88  VAL A HA   2  
ATOM 2958  H HB   . VAL A 1 88  ? -12.533 -0.259  -10.468 1.00 0.00 ? 88  VAL A HB   2  
ATOM 2959  H HG11 . VAL A 1 88  ? -10.826 -0.196  -8.726  1.00 0.00 ? 88  VAL A HG11 2  
ATOM 2960  H HG12 . VAL A 1 88  ? -11.666 -1.482  -7.821  1.00 0.00 ? 88  VAL A HG12 2  
ATOM 2961  H HG13 . VAL A 1 88  ? -10.977 -1.821  -9.414  1.00 0.00 ? 88  VAL A HG13 2  
ATOM 2962  H HG21 . VAL A 1 88  ? -14.562 -1.675  -10.247 1.00 0.00 ? 88  VAL A HG21 2  
ATOM 2963  H HG22 . VAL A 1 88  ? -13.062 -2.569  -10.504 1.00 0.00 ? 88  VAL A HG22 2  
ATOM 2964  H HG23 . VAL A 1 88  ? -13.774 -2.522  -8.888  1.00 0.00 ? 88  VAL A HG23 2  
ATOM 2965  N N    . GLY A 1 89  ? -14.895 -0.871  -7.081  1.00 0.00 ? 89  GLY A N    2  
ATOM 2966  C CA   . GLY A 1 89  ? -15.361 -1.299  -5.777  1.00 0.00 ? 89  GLY A CA   2  
ATOM 2967  C C    . GLY A 1 89  ? -16.599 -0.492  -5.442  1.00 0.00 ? 89  GLY A C    2  
ATOM 2968  O O    . GLY A 1 89  ? -17.692 -0.866  -5.867  1.00 0.00 ? 89  GLY A O    2  
ATOM 2969  H H    . GLY A 1 89  ? -15.416 -1.204  -7.882  1.00 0.00 ? 89  GLY A H    2  
ATOM 2970  H HA2  . GLY A 1 89  ? -15.621 -2.357  -5.816  1.00 0.00 ? 89  GLY A HA2  2  
ATOM 2971  H HA3  . GLY A 1 89  ? -14.594 -1.150  -5.016  1.00 0.00 ? 89  GLY A HA3  2  
ATOM 2972  N N    . GLN A 1 90  ? -16.445 0.611   -4.714  1.00 0.00 ? 90  GLN A N    2  
ATOM 2973  C CA   . GLN A 1 90  ? -17.532 1.468   -4.268  1.00 0.00 ? 90  GLN A CA   2  
ATOM 2974  C C    . GLN A 1 90  ? -17.151 2.920   -4.564  1.00 0.00 ? 90  GLN A C    2  
ATOM 2975  O O    . GLN A 1 90  ? -16.102 3.394   -4.121  1.00 0.00 ? 90  GLN A O    2  
ATOM 2976  C CB   . GLN A 1 90  ? -17.784 1.233   -2.761  1.00 0.00 ? 90  GLN A CB   2  
ATOM 2977  C CG   . GLN A 1 90  ? -19.211 0.777   -2.419  1.00 0.00 ? 90  GLN A CG   2  
ATOM 2978  C CD   . GLN A 1 90  ? -19.401 -0.737  -2.496  1.00 0.00 ? 90  GLN A CD   2  
ATOM 2979  O OE1  . GLN A 1 90  ? -19.635 -1.397  -1.496  1.00 0.00 ? 90  GLN A OE1  2  
ATOM 2980  N NE2  . GLN A 1 90  ? -19.309 -1.341  -3.666  1.00 0.00 ? 90  GLN A NE2  2  
ATOM 2981  H H    . GLN A 1 90  ? -15.515 0.884   -4.403  1.00 0.00 ? 90  GLN A H    2  
ATOM 2982  H HA   . GLN A 1 90  ? -18.436 1.230   -4.830  1.00 0.00 ? 90  GLN A HA   2  
ATOM 2983  H HB2  . GLN A 1 90  ? -17.084 0.497   -2.365  1.00 0.00 ? 90  GLN A HB2  2  
ATOM 2984  H HB3  . GLN A 1 90  ? -17.590 2.161   -2.225  1.00 0.00 ? 90  GLN A HB3  2  
ATOM 2985  H HG2  . GLN A 1 90  ? -19.428 1.085   -1.395  1.00 0.00 ? 90  GLN A HG2  2  
ATOM 2986  H HG3  . GLN A 1 90  ? -19.932 1.269   -3.071  1.00 0.00 ? 90  GLN A HG3  2  
ATOM 2987  H HE21 . GLN A 1 90  ? -18.926 -0.872  -4.483  1.00 0.00 ? 90  GLN A HE21 2  
ATOM 2988  H HE22 . GLN A 1 90  ? -19.409 -2.361  -3.687  1.00 0.00 ? 90  GLN A HE22 2  
ATOM 2989  N N    . GLN A 1 91  ? -18.000 3.634   -5.299  1.00 0.00 ? 91  GLN A N    2  
ATOM 2990  C CA   . GLN A 1 91  ? -17.949 5.082   -5.468  1.00 0.00 ? 91  GLN A CA   2  
ATOM 2991  C C    . GLN A 1 91  ? -19.398 5.586   -5.411  1.00 0.00 ? 91  GLN A C    2  
ATOM 2992  O O    . GLN A 1 91  ? -20.292 4.855   -5.850  1.00 0.00 ? 91  GLN A O    2  
ATOM 2993  C CB   . GLN A 1 91  ? -17.281 5.402   -6.817  1.00 0.00 ? 91  GLN A CB   2  
ATOM 2994  C CG   . GLN A 1 91  ? -16.978 6.892   -6.997  1.00 0.00 ? 91  GLN A CG   2  
ATOM 2995  C CD   . GLN A 1 91  ? -16.298 7.168   -8.332  1.00 0.00 ? 91  GLN A CD   2  
ATOM 2996  O OE1  . GLN A 1 91  ? -16.958 7.387   -9.339  1.00 0.00 ? 91  GLN A OE1  2  
ATOM 2997  N NE2  . GLN A 1 91  ? -14.979 7.208   -8.380  1.00 0.00 ? 91  GLN A NE2  2  
ATOM 2998  H H    . GLN A 1 91  ? -18.812 3.180   -5.707  1.00 0.00 ? 91  GLN A H    2  
ATOM 2999  H HA   . GLN A 1 91  ? -17.363 5.515   -4.657  1.00 0.00 ? 91  GLN A HA   2  
ATOM 3000  H HB2  . GLN A 1 91  ? -16.341 4.852   -6.889  1.00 0.00 ? 91  GLN A HB2  2  
ATOM 3001  H HB3  . GLN A 1 91  ? -17.934 5.074   -7.626  1.00 0.00 ? 91  GLN A HB3  2  
ATOM 3002  H HG2  . GLN A 1 91  ? -17.907 7.459   -6.971  1.00 0.00 ? 91  GLN A HG2  2  
ATOM 3003  H HG3  . GLN A 1 91  ? -16.342 7.238   -6.182  1.00 0.00 ? 91  GLN A HG3  2  
ATOM 3004  H HE21 . GLN A 1 91  ? -14.438 7.038   -7.534  1.00 0.00 ? 91  GLN A HE21 2  
ATOM 3005  H HE22 . GLN A 1 91  ? -14.525 7.369   -9.276  1.00 0.00 ? 91  GLN A HE22 2  
ATOM 3006  N N    . PRO A 1 92  ? -19.689 6.782   -4.871  1.00 0.00 ? 92  PRO A N    2  
ATOM 3007  C CA   . PRO A 1 92  ? -21.057 7.283   -4.791  1.00 0.00 ? 92  PRO A CA   2  
ATOM 3008  C C    . PRO A 1 92  ? -21.522 8.039   -6.043  1.00 0.00 ? 92  PRO A C    2  
ATOM 3009  O O    . PRO A 1 92  ? -22.724 8.269   -6.172  1.00 0.00 ? 92  PRO A O    2  
ATOM 3010  C CB   . PRO A 1 92  ? -21.063 8.193   -3.563  1.00 0.00 ? 92  PRO A CB   2  
ATOM 3011  C CG   . PRO A 1 92  ? -19.655 8.776   -3.567  1.00 0.00 ? 92  PRO A CG   2  
ATOM 3012  C CD   . PRO A 1 92  ? -18.805 7.606   -4.061  1.00 0.00 ? 92  PRO A CD   2  
ATOM 3013  H HA   . PRO A 1 92  ? -21.747 6.459   -4.619  1.00 0.00 ? 92  PRO A HA   2  
ATOM 3014  H HB2  . PRO A 1 92  ? -21.829 8.966   -3.618  1.00 0.00 ? 92  PRO A HB2  2  
ATOM 3015  H HB3  . PRO A 1 92  ? -21.199 7.585   -2.667  1.00 0.00 ? 92  PRO A HB3  2  
ATOM 3016  H HG2  . PRO A 1 92  ? -19.595 9.605   -4.274  1.00 0.00 ? 92  PRO A HG2  2  
ATOM 3017  H HG3  . PRO A 1 92  ? -19.359 9.095   -2.568  1.00 0.00 ? 92  PRO A HG3  2  
ATOM 3018  H HD2  . PRO A 1 92  ? -17.953 7.975   -4.629  1.00 0.00 ? 92  PRO A HD2  2  
ATOM 3019  H HD3  . PRO A 1 92  ? -18.463 7.021   -3.208  1.00 0.00 ? 92  PRO A HD3  2  
ATOM 3020  N N    . GLY A 1 93  ? -20.615 8.447   -6.939  1.00 0.00 ? 93  GLY A N    2  
ATOM 3021  C CA   . GLY A 1 93  ? -20.951 9.203   -8.149  1.00 0.00 ? 93  GLY A CA   2  
ATOM 3022  C C    . GLY A 1 93  ? -21.660 10.526  -7.835  1.00 0.00 ? 93  GLY A C    2  
ATOM 3023  O O    . GLY A 1 93  ? -22.413 11.044  -8.666  1.00 0.00 ? 93  GLY A O    2  
ATOM 3024  H H    . GLY A 1 93  ? -19.644 8.244   -6.773  1.00 0.00 ? 93  GLY A H    2  
ATOM 3025  H HA2  . GLY A 1 93  ? -20.038 9.415   -8.705  1.00 0.00 ? 93  GLY A HA2  2  
ATOM 3026  H HA3  . GLY A 1 93  ? -21.602 8.593   -8.777  1.00 0.00 ? 93  GLY A HA3  2  
ATOM 3027  N N    . ALA A 1 94  ? -21.491 11.035  -6.613  1.00 0.00 ? 94  ALA A N    2  
ATOM 3028  C CA   . ALA A 1 94  ? -22.287 12.108  -6.049  1.00 0.00 ? 94  ALA A CA   2  
ATOM 3029  C C    . ALA A 1 94  ? -21.767 13.460  -6.526  1.00 0.00 ? 94  ALA A C    2  
ATOM 3030  O O    . ALA A 1 94  ? -20.562 13.626  -6.740  1.00 0.00 ? 94  ALA A O    2  
ATOM 3031  C CB   . ALA A 1 94  ? -22.217 12.009  -4.522  1.00 0.00 ? 94  ALA A CB   2  
ATOM 3032  H H    . ALA A 1 94  ? -20.753 10.639  -6.053  1.00 0.00 ? 94  ALA A H    2  
ATOM 3033  H HA   . ALA A 1 94  ? -23.320 11.987  -6.373  1.00 0.00 ? 94  ALA A HA   2  
ATOM 3034  H HB1  . ALA A 1 94  ? -22.688 11.084  -4.194  1.00 0.00 ? 94  ALA A HB1  2  
ATOM 3035  H HB2  . ALA A 1 94  ? -21.178 12.026  -4.192  1.00 0.00 ? 94  ALA A HB2  2  
ATOM 3036  H HB3  . ALA A 1 94  ? -22.750 12.843  -4.069  1.00 0.00 ? 94  ALA A HB3  2  
ATOM 3037  N N    . SER A 1 95  ? -22.646 14.455  -6.627  1.00 0.00 ? 95  SER A N    2  
ATOM 3038  C CA   . SER A 1 95  ? -22.252 15.838  -6.863  1.00 0.00 ? 95  SER A CA   2  
ATOM 3039  C C    . SER A 1 95  ? -21.319 16.315  -5.735  1.00 0.00 ? 95  SER A C    2  
ATOM 3040  O O    . SER A 1 95  ? -21.504 15.939  -4.569  1.00 0.00 ? 95  SER A O    2  
ATOM 3041  C CB   . SER A 1 95  ? -23.510 16.706  -7.013  1.00 0.00 ? 95  SER A CB   2  
ATOM 3042  O OG   . SER A 1 95  ? -24.489 16.400  -6.033  1.00 0.00 ? 95  SER A OG   2  
ATOM 3043  H H    . SER A 1 95  ? -23.625 14.292  -6.418  1.00 0.00 ? 95  SER A H    2  
ATOM 3044  H HA   . SER A 1 95  ? -21.708 15.887  -7.806  1.00 0.00 ? 95  SER A HA   2  
ATOM 3045  H HB2  . SER A 1 95  ? -23.238 17.758  -6.942  1.00 0.00 ? 95  SER A HB2  2  
ATOM 3046  H HB3  . SER A 1 95  ? -23.943 16.525  -7.999  1.00 0.00 ? 95  SER A HB3  2  
ATOM 3047  H HG   . SER A 1 95  ? -25.321 16.854  -6.297  1.00 0.00 ? 95  SER A HG   2  
ATOM 3048  N N    . SER A 1 96  ? -20.325 17.134  -6.075  1.00 0.00 ? 96  SER A N    2  
ATOM 3049  C CA   . SER A 1 96  ? -19.414 17.810  -5.164  1.00 0.00 ? 96  SER A CA   2  
ATOM 3050  C C    . SER A 1 96  ? -18.938 19.079  -5.866  1.00 0.00 ? 96  SER A C    2  
ATOM 3051  O O    . SER A 1 96  ? -18.504 19.005  -7.015  1.00 0.00 ? 96  SER A O    2  
ATOM 3052  C CB   . SER A 1 96  ? -18.210 16.907  -4.847  1.00 0.00 ? 96  SER A CB   2  
ATOM 3053  O OG   . SER A 1 96  ? -18.443 16.152  -3.671  1.00 0.00 ? 96  SER A OG   2  
ATOM 3054  H H    . SER A 1 96  ? -20.175 17.373  -7.048  1.00 0.00 ? 96  SER A H    2  
ATOM 3055  H HA   . SER A 1 96  ? -19.937 18.079  -4.245  1.00 0.00 ? 96  SER A HA   2  
ATOM 3056  H HB2  . SER A 1 96  ? -18.007 16.240  -5.687  1.00 0.00 ? 96  SER A HB2  2  
ATOM 3057  H HB3  . SER A 1 96  ? -17.328 17.527  -4.683  1.00 0.00 ? 96  SER A HB3  2  
ATOM 3058  H HG   . SER A 1 96  ? -18.455 16.795  -2.932  1.00 0.00 ? 96  SER A HG   2  
ATOM 3059  N N    . GLY A 1 97  ? -19.002 20.222  -5.178  1.00 0.00 ? 97  GLY A N    2  
ATOM 3060  C CA   . GLY A 1 97  ? -18.515 21.507  -5.665  1.00 0.00 ? 97  GLY A CA   2  
ATOM 3061  C C    . GLY A 1 97  ? -19.435 22.137  -6.718  1.00 0.00 ? 97  GLY A C    2  
ATOM 3062  O O    . GLY A 1 97  ? -20.350 21.477  -7.223  1.00 0.00 ? 97  GLY A O    2  
ATOM 3063  H H    . GLY A 1 97  ? -19.403 20.230  -4.249  1.00 0.00 ? 97  GLY A H    2  
ATOM 3064  H HA2  . GLY A 1 97  ? -18.413 22.180  -4.816  1.00 0.00 ? 97  GLY A HA2  2  
ATOM 3065  H HA3  . GLY A 1 97  ? -17.529 21.363  -6.110  1.00 0.00 ? 97  GLY A HA3  2  
ATOM 3066  N N    . PRO A 1 98  ? -19.225 23.425  -7.042  1.00 0.00 ? 98  PRO A N    2  
ATOM 3067  C CA   . PRO A 1 98  ? -19.687 24.024  -8.287  1.00 0.00 ? 98  PRO A CA   2  
ATOM 3068  C C    . PRO A 1 98  ? -18.637 23.907  -9.408  1.00 0.00 ? 98  PRO A C    2  
ATOM 3069  O O    . PRO A 1 98  ? -19.003 23.984  -10.581 1.00 0.00 ? 98  PRO A O    2  
ATOM 3070  C CB   . PRO A 1 98  ? -19.909 25.493  -7.922  1.00 0.00 ? 98  PRO A CB   2  
ATOM 3071  C CG   . PRO A 1 98  ? -18.791 25.772  -6.912  1.00 0.00 ? 98  PRO A CG   2  
ATOM 3072  C CD   . PRO A 1 98  ? -18.617 24.435  -6.183  1.00 0.00 ? 98  PRO A CD   2  
ATOM 3073  H HA   . PRO A 1 98  ? -20.624 23.574  -8.619  1.00 0.00 ? 98  PRO A HA   2  
ATOM 3074  H HB2  . PRO A 1 98  ? -19.845 26.149  -8.791  1.00 0.00 ? 98  PRO A HB2  2  
ATOM 3075  H HB3  . PRO A 1 98  ? -20.879 25.603  -7.434  1.00 0.00 ? 98  PRO A HB3  2  
ATOM 3076  H HG2  . PRO A 1 98  ? -17.873 26.028  -7.442  1.00 0.00 ? 98  PRO A HG2  2  
ATOM 3077  H HG3  . PRO A 1 98  ? -19.064 26.572  -6.223  1.00 0.00 ? 98  PRO A HG3  2  
ATOM 3078  H HD2  . PRO A 1 98  ? -17.559 24.227  -6.015  1.00 0.00 ? 98  PRO A HD2  2  
ATOM 3079  H HD3  . PRO A 1 98  ? -19.149 24.466  -5.231  1.00 0.00 ? 98  PRO A HD3  2  
ATOM 3080  N N    . SER A 1 99  ? -17.351 23.762  -9.054  1.00 0.00 ? 99  SER A N    2  
ATOM 3081  C CA   . SER A 1 99  ? -16.188 23.892  -9.921  1.00 0.00 ? 99  SER A CA   2  
ATOM 3082  C C    . SER A 1 99  ? -16.353 25.113  -10.837 1.00 0.00 ? 99  SER A C    2  
ATOM 3083  O O    . SER A 1 99  ? -16.638 25.016  -12.033 1.00 0.00 ? 99  SER A O    2  
ATOM 3084  C CB   . SER A 1 99  ? -15.910 22.542  -10.602 1.00 0.00 ? 99  SER A CB   2  
ATOM 3085  O OG   . SER A 1 99  ? -14.743 22.558  -11.408 1.00 0.00 ? 99  SER A OG   2  
ATOM 3086  H H    . SER A 1 99  ? -17.157 23.586  -8.082  1.00 0.00 ? 99  SER A H    2  
ATOM 3087  H HA   . SER A 1 99  ? -15.332 24.100  -9.281  1.00 0.00 ? 99  SER A HA   2  
ATOM 3088  H HB2  . SER A 1 99  ? -15.769 21.784  -9.832  1.00 0.00 ? 99  SER A HB2  2  
ATOM 3089  H HB3  . SER A 1 99  ? -16.772 22.257  -11.203 1.00 0.00 ? 99  SER A HB3  2  
ATOM 3090  H HG   . SER A 1 99  ? -14.025 22.196  -10.865 1.00 0.00 ? 99  SER A HG   2  
ATOM 3091  N N    . SER A 1 100 ? -16.222 26.298  -10.248 1.00 0.00 ? 100 SER A N    2  
ATOM 3092  C CA   . SER A 1 100 ? -16.066 27.561  -10.951 1.00 0.00 ? 100 SER A CA   2  
ATOM 3093  C C    . SER A 1 100 ? -15.203 28.470  -10.078 1.00 0.00 ? 100 SER A C    2  
ATOM 3094  O O    . SER A 1 100 ? -15.180 28.307  -8.850  1.00 0.00 ? 100 SER A O    2  
ATOM 3095  C CB   . SER A 1 100 ? -17.441 28.181  -11.222 1.00 0.00 ? 100 SER A CB   2  
ATOM 3096  O OG   . SER A 1 100 ? -18.212 27.348  -12.066 1.00 0.00 ? 100 SER A OG   2  
ATOM 3097  H H    . SER A 1 100 ? -15.961 26.344  -9.273  1.00 0.00 ? 100 SER A H    2  
ATOM 3098  H HA   . SER A 1 100 ? -15.547 27.390  -11.896 1.00 0.00 ? 100 SER A HA   2  
ATOM 3099  H HB2  . SER A 1 100 ? -17.967 28.324  -10.278 1.00 0.00 ? 100 SER A HB2  2  
ATOM 3100  H HB3  . SER A 1 100 ? -17.313 29.151  -11.703 1.00 0.00 ? 100 SER A HB3  2  
ATOM 3101  H HG   . SER A 1 100 ? -17.799 26.468  -12.097 1.00 0.00 ? 100 SER A HG   2  
ATOM 3102  N N    . GLY A 1 101 ? -14.521 29.423  -10.710 1.00 0.00 ? 101 GLY A N    2  
ATOM 3103  C CA   . GLY A 1 101 ? -13.327 30.046  -10.165 1.00 0.00 ? 101 GLY A CA   2  
ATOM 3104  C C    . GLY A 1 101 ? -12.115 29.299  -10.704 1.00 0.00 ? 101 GLY A C    2  
ATOM 3105  O O    . GLY A 1 101 ? -11.032 29.488  -10.124 1.00 0.00 ? 101 GLY A O    2  
ATOM 3106  H H    . GLY A 1 101 ? -14.497 29.381  -11.718 1.00 0.00 ? 101 GLY A H    2  
ATOM 3107  H HA2  . GLY A 1 101 ? -13.273 31.088  -10.479 1.00 0.00 ? 101 GLY A HA2  2  
ATOM 3108  H HA3  . GLY A 1 101 ? -13.326 29.995  -9.077  1.00 0.00 ? 101 GLY A HA3  2  
ATOM 3109  N N    . GLY A 1 1   ? 6.537   -15.926 -27.566 1.00 0.00 ? 1   GLY A N    3  
ATOM 3110  C CA   . GLY A 1 1   ? 6.723   -15.033 -26.420 1.00 0.00 ? 1   GLY A CA   3  
ATOM 3111  C C    . GLY A 1 1   ? 6.192   -13.656 -26.758 1.00 0.00 ? 1   GLY A C    3  
ATOM 3112  O O    . GLY A 1 1   ? 6.948   -12.760 -27.126 1.00 0.00 ? 1   GLY A O    3  
ATOM 3113  H H1   . GLY A 1 1   ? 5.588   -16.052 -27.854 1.00 0.00 ? 1   GLY A H1   3  
ATOM 3114  H HA2  . GLY A 1 1   ? 6.183   -15.429 -25.561 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3115  H HA3  . GLY A 1 1   ? 7.784   -14.960 -26.183 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3116  N N    . SER A 1 2   ? 4.878   -13.488 -26.680 1.00 0.00 ? 2   SER A N    3  
ATOM 3117  C CA   . SER A 1 2   ? 4.192   -12.216 -26.796 1.00 0.00 ? 2   SER A CA   3  
ATOM 3118  C C    . SER A 1 2   ? 4.217   -11.581 -25.406 1.00 0.00 ? 2   SER A C    3  
ATOM 3119  O O    . SER A 1 2   ? 3.940   -12.265 -24.417 1.00 0.00 ? 2   SER A O    3  
ATOM 3120  C CB   . SER A 1 2   ? 2.755   -12.468 -27.268 1.00 0.00 ? 2   SER A CB   3  
ATOM 3121  O OG   . SER A 1 2   ? 2.728   -13.389 -28.352 1.00 0.00 ? 2   SER A OG   3  
ATOM 3122  H H    . SER A 1 2   ? 4.297   -14.224 -26.295 1.00 0.00 ? 2   SER A H    3  
ATOM 3123  H HA   . SER A 1 2   ? 4.702   -11.576 -27.517 1.00 0.00 ? 2   SER A HA   3  
ATOM 3124  H HB2  . SER A 1 2   ? 2.183   -12.896 -26.445 1.00 0.00 ? 2   SER A HB2  3  
ATOM 3125  H HB3  . SER A 1 2   ? 2.301   -11.520 -27.563 1.00 0.00 ? 2   SER A HB3  3  
ATOM 3126  H HG   . SER A 1 2   ? 3.090   -12.938 -29.139 1.00 0.00 ? 2   SER A HG   3  
ATOM 3127  N N    . SER A 1 3   ? 4.572   -10.303 -25.337 1.00 0.00 ? 3   SER A N    3  
ATOM 3128  C CA   . SER A 1 3   ? 4.454   -9.488  -24.140 1.00 0.00 ? 3   SER A CA   3  
ATOM 3129  C C    . SER A 1 3   ? 2.980   -9.071  -24.004 1.00 0.00 ? 3   SER A C    3  
ATOM 3130  O O    . SER A 1 3   ? 2.217   -9.137  -24.972 1.00 0.00 ? 3   SER A O    3  
ATOM 3131  C CB   . SER A 1 3   ? 5.390   -8.288  -24.335 1.00 0.00 ? 3   SER A CB   3  
ATOM 3132  O OG   . SER A 1 3   ? 5.666   -7.567  -23.145 1.00 0.00 ? 3   SER A OG   3  
ATOM 3133  H H    . SER A 1 3   ? 4.642   -9.793  -26.212 1.00 0.00 ? 3   SER A H    3  
ATOM 3134  H HA   . SER A 1 3   ? 4.765   -10.074 -23.272 1.00 0.00 ? 3   SER A HA   3  
ATOM 3135  H HB2  . SER A 1 3   ? 6.341   -8.640  -24.740 1.00 0.00 ? 3   SER A HB2  3  
ATOM 3136  H HB3  . SER A 1 3   ? 4.935   -7.618  -25.064 1.00 0.00 ? 3   SER A HB3  3  
ATOM 3137  H HG   . SER A 1 3   ? 6.421   -8.012  -22.696 1.00 0.00 ? 3   SER A HG   3  
ATOM 3138  N N    . GLY A 1 4   ? 2.561   -8.620  -22.825 1.00 0.00 ? 4   GLY A N    3  
ATOM 3139  C CA   . GLY A 1 4   ? 1.201   -8.166  -22.565 1.00 0.00 ? 4   GLY A CA   3  
ATOM 3140  C C    . GLY A 1 4   ? 0.956   -7.942  -21.077 1.00 0.00 ? 4   GLY A C    3  
ATOM 3141  O O    . GLY A 1 4   ? 1.857   -8.140  -20.258 1.00 0.00 ? 4   GLY A O    3  
ATOM 3142  H H    . GLY A 1 4   ? 3.206   -8.580  -22.046 1.00 0.00 ? 4   GLY A H    3  
ATOM 3143  H HA2  . GLY A 1 4   ? 1.040   -7.225  -23.091 1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3144  H HA3  . GLY A 1 4   ? 0.491   -8.905  -22.937 1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3145  N N    . SER A 1 5   ? -0.249  -7.502  -20.728 1.00 0.00 ? 5   SER A N    3  
ATOM 3146  C CA   . SER A 1 5   ? -0.641  -7.218  -19.359 1.00 0.00 ? 5   SER A CA   3  
ATOM 3147  C C    . SER A 1 5   ? -0.738  -8.529  -18.577 1.00 0.00 ? 5   SER A C    3  
ATOM 3148  O O    . SER A 1 5   ? -1.639  -9.332  -18.829 1.00 0.00 ? 5   SER A O    3  
ATOM 3149  C CB   . SER A 1 5   ? -1.976  -6.468  -19.369 1.00 0.00 ? 5   SER A CB   3  
ATOM 3150  O OG   . SER A 1 5   ? -1.846  -5.255  -20.095 1.00 0.00 ? 5   SER A OG   3  
ATOM 3151  H H    . SER A 1 5   ? -0.985  -7.458  -21.422 1.00 0.00 ? 5   SER A H    3  
ATOM 3152  H HA   . SER A 1 5   ? 0.118   -6.579  -18.906 1.00 0.00 ? 5   SER A HA   3  
ATOM 3153  H HB2  . SER A 1 5   ? -2.739  -7.094  -19.834 1.00 0.00 ? 5   SER A HB2  3  
ATOM 3154  H HB3  . SER A 1 5   ? -2.280  -6.249  -18.345 1.00 0.00 ? 5   SER A HB3  3  
ATOM 3155  H HG   . SER A 1 5   ? -2.720  -4.831  -20.122 1.00 0.00 ? 5   SER A HG   3  
ATOM 3156  N N    . SER A 1 6   ? 0.197   -8.770  -17.658 1.00 0.00 ? 6   SER A N    3  
ATOM 3157  C CA   . SER A 1 6   ? 0.203   -9.930  -16.786 1.00 0.00 ? 6   SER A CA   3  
ATOM 3158  C C    . SER A 1 6   ? 0.996   -9.556  -15.533 1.00 0.00 ? 6   SER A C    3  
ATOM 3159  O O    . SER A 1 6   ? 2.231   -9.518  -15.573 1.00 0.00 ? 6   SER A O    3  
ATOM 3160  C CB   . SER A 1 6   ? 0.816   -11.109 -17.556 1.00 0.00 ? 6   SER A CB   3  
ATOM 3161  O OG   . SER A 1 6   ? 0.246   -12.349 -17.184 1.00 0.00 ? 6   SER A OG   3  
ATOM 3162  H H    . SER A 1 6   ? 0.933   -8.085  -17.513 1.00 0.00 ? 6   SER A H    3  
ATOM 3163  H HA   . SER A 1 6   ? -0.826  -10.170 -16.516 1.00 0.00 ? 6   SER A HA   3  
ATOM 3164  H HB2  . SER A 1 6   ? 0.632   -10.970 -18.621 1.00 0.00 ? 6   SER A HB2  3  
ATOM 3165  H HB3  . SER A 1 6   ? 1.893   -11.135 -17.421 1.00 0.00 ? 6   SER A HB3  3  
ATOM 3166  H HG   . SER A 1 6   ? -0.089  -12.720 -18.033 1.00 0.00 ? 6   SER A HG   3  
ATOM 3167  N N    . GLY A 1 7   ? 0.315   -9.246  -14.430 1.00 0.00 ? 7   GLY A N    3  
ATOM 3168  C CA   . GLY A 1 7   ? 0.971   -8.889  -13.180 1.00 0.00 ? 7   GLY A CA   3  
ATOM 3169  C C    . GLY A 1 7   ? -0.017  -8.330  -12.169 1.00 0.00 ? 7   GLY A C    3  
ATOM 3170  O O    . GLY A 1 7   ? 0.108   -7.174  -11.772 1.00 0.00 ? 7   GLY A O    3  
ATOM 3171  H H    . GLY A 1 7   ? -0.693  -9.315  -14.435 1.00 0.00 ? 7   GLY A H    3  
ATOM 3172  H HA2  . GLY A 1 7   ? 1.458   -9.770  -12.761 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3173  H HA3  . GLY A 1 7   ? 1.726   -8.129  -13.385 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3174  N N    . GLN A 1 8   ? -1.018  -9.116  -11.776 1.00 0.00 ? 8   GLN A N    3  
ATOM 3175  C CA   . GLN A 1 8   ? -2.040  -8.719  -10.812 1.00 0.00 ? 8   GLN A CA   3  
ATOM 3176  C C    . GLN A 1 8   ? -1.673  -9.206  -9.406  1.00 0.00 ? 8   GLN A C    3  
ATOM 3177  O O    . GLN A 1 8   ? -0.727  -9.973  -9.214  1.00 0.00 ? 8   GLN A O    3  
ATOM 3178  C CB   . GLN A 1 8   ? -3.404  -9.243  -11.290 1.00 0.00 ? 8   GLN A CB   3  
ATOM 3179  C CG   . GLN A 1 8   ? -3.886  -8.442  -12.515 1.00 0.00 ? 8   GLN A CG   3  
ATOM 3180  C CD   . GLN A 1 8   ? -4.662  -9.298  -13.507 1.00 0.00 ? 8   GLN A CD   3  
ATOM 3181  O OE1  . GLN A 1 8   ? -4.096  -9.757  -14.495 1.00 0.00 ? 8   GLN A OE1  3  
ATOM 3182  N NE2  . GLN A 1 8   ? -5.938  -9.555  -13.275 1.00 0.00 ? 8   GLN A NE2  3  
ATOM 3183  H H    . GLN A 1 8   ? -1.064  -10.065 -12.140 1.00 0.00 ? 8   GLN A H    3  
ATOM 3184  H HA   . GLN A 1 8   ? -2.095  -7.631  -10.777 1.00 0.00 ? 8   GLN A HA   3  
ATOM 3185  H HB2  . GLN A 1 8   ? -3.312  -10.301 -11.540 1.00 0.00 ? 8   GLN A HB2  3  
ATOM 3186  H HB3  . GLN A 1 8   ? -4.143  -9.146  -10.494 1.00 0.00 ? 8   GLN A HB3  3  
ATOM 3187  H HG2  . GLN A 1 8   ? -4.499  -7.603  -12.192 1.00 0.00 ? 8   GLN A HG2  3  
ATOM 3188  H HG3  . GLN A 1 8   ? -3.029  -8.020  -13.038 1.00 0.00 ? 8   GLN A HG3  3  
ATOM 3189  H HE21 . GLN A 1 8   ? -6.398  -9.117  -12.481 1.00 0.00 ? 8   GLN A HE21 3  
ATOM 3190  H HE22 . GLN A 1 8   ? -6.471  -10.111 -13.927 1.00 0.00 ? 8   GLN A HE22 3  
ATOM 3191  N N    . TYR A 1 9   ? -2.442  -8.757  -8.409  1.00 0.00 ? 9   TYR A N    3  
ATOM 3192  C CA   . TYR A 1 9   ? -2.176  -8.979  -6.990  1.00 0.00 ? 9   TYR A CA   3  
ATOM 3193  C C    . TYR A 1 9   ? -2.002  -10.451 -6.642  1.00 0.00 ? 9   TYR A C    3  
ATOM 3194  O O    . TYR A 1 9   ? -1.141  -10.782 -5.830  1.00 0.00 ? 9   TYR A O    3  
ATOM 3195  C CB   . TYR A 1 9   ? -3.286  -8.364  -6.125  1.00 0.00 ? 9   TYR A CB   3  
ATOM 3196  C CG   . TYR A 1 9   ? -4.715  -8.617  -6.566  1.00 0.00 ? 9   TYR A CG   3  
ATOM 3197  C CD1  . TYR A 1 9   ? -5.295  -7.732  -7.488  1.00 0.00 ? 9   TYR A CD1  3  
ATOM 3198  C CD2  . TYR A 1 9   ? -5.483  -9.675  -6.041  1.00 0.00 ? 9   TYR A CD2  3  
ATOM 3199  C CE1  . TYR A 1 9   ? -6.618  -7.908  -7.904  1.00 0.00 ? 9   TYR A CE1  3  
ATOM 3200  C CE2  . TYR A 1 9   ? -6.823  -9.846  -6.440  1.00 0.00 ? 9   TYR A CE2  3  
ATOM 3201  C CZ   . TYR A 1 9   ? -7.400  -8.956  -7.376  1.00 0.00 ? 9   TYR A CZ   3  
ATOM 3202  O OH   . TYR A 1 9   ? -8.701  -9.069  -7.771  1.00 0.00 ? 9   TYR A OH   3  
ATOM 3203  H H    . TYR A 1 9   ? -3.214  -8.152  -8.649  1.00 0.00 ? 9   TYR A H    3  
ATOM 3204  H HA   . TYR A 1 9   ? -1.237  -8.480  -6.753  1.00 0.00 ? 9   TYR A HA   3  
ATOM 3205  H HB2  . TYR A 1 9   ? -3.166  -8.705  -5.095  1.00 0.00 ? 9   TYR A HB2  3  
ATOM 3206  H HB3  . TYR A 1 9   ? -3.142  -7.288  -6.132  1.00 0.00 ? 9   TYR A HB3  3  
ATOM 3207  H HD1  . TYR A 1 9   ? -4.734  -6.892  -7.868  1.00 0.00 ? 9   TYR A HD1  3  
ATOM 3208  H HD2  . TYR A 1 9   ? -5.063  -10.343 -5.305  1.00 0.00 ? 9   TYR A HD2  3  
ATOM 3209  H HE1  . TYR A 1 9   ? -7.025  -7.208  -8.613  1.00 0.00 ? 9   TYR A HE1  3  
ATOM 3210  H HE2  . TYR A 1 9   ? -7.408  -10.643 -6.006  1.00 0.00 ? 9   TYR A HE2  3  
ATOM 3211  H HH   . TYR A 1 9   ? -9.205  -9.694  -7.212  1.00 0.00 ? 9   TYR A HH   3  
ATOM 3212  N N    . GLU A 1 10  ? -2.809  -11.315 -7.257  1.00 0.00 ? 10  GLU A N    3  
ATOM 3213  C CA   . GLU A 1 10  ? -2.784  -12.760 -7.081  1.00 0.00 ? 10  GLU A CA   3  
ATOM 3214  C C    . GLU A 1 10  ? -1.370  -13.318 -7.236  1.00 0.00 ? 10  GLU A C    3  
ATOM 3215  O O    . GLU A 1 10  ? -0.931  -14.086 -6.385  1.00 0.00 ? 10  GLU A O    3  
ATOM 3216  C CB   . GLU A 1 10  ? -3.717  -13.388 -8.127  1.00 0.00 ? 10  GLU A CB   3  
ATOM 3217  C CG   . GLU A 1 10  ? -5.162  -13.530 -7.639  1.00 0.00 ? 10  GLU A CG   3  
ATOM 3218  C CD   . GLU A 1 10  ? -5.386  -14.921 -7.052  1.00 0.00 ? 10  GLU A CD   3  
ATOM 3219  O OE1  . GLU A 1 10  ? -5.134  -15.130 -5.847  1.00 0.00 ? 10  GLU A OE1  3  
ATOM 3220  O OE2  . GLU A 1 10  ? -5.772  -15.843 -7.813  1.00 0.00 ? 10  GLU A OE2  3  
ATOM 3221  H H    . GLU A 1 10  ? -3.491  -10.930 -7.892  1.00 0.00 ? 10  GLU A H    3  
ATOM 3222  H HA   . GLU A 1 10  ? -3.133  -13.001 -6.075  1.00 0.00 ? 10  GLU A HA   3  
ATOM 3223  H HB2  . GLU A 1 10  ? -3.705  -12.774 -9.028  1.00 0.00 ? 10  GLU A HB2  3  
ATOM 3224  H HB3  . GLU A 1 10  ? -3.341  -14.371 -8.409  1.00 0.00 ? 10  GLU A HB3  3  
ATOM 3225  H HG2  . GLU A 1 10  ? -5.398  -12.761 -6.900  1.00 0.00 ? 10  GLU A HG2  3  
ATOM 3226  H HG3  . GLU A 1 10  ? -5.829  -13.395 -8.488  1.00 0.00 ? 10  GLU A HG3  3  
ATOM 3227  N N    . LEU A 1 11  ? -0.681  -12.930 -8.312  1.00 0.00 ? 11  LEU A N    3  
ATOM 3228  C CA   . LEU A 1 11  ? 0.628   -13.441 -8.708  1.00 0.00 ? 11  LEU A CA   3  
ATOM 3229  C C    . LEU A 1 11  ? 1.693   -13.022 -7.692  1.00 0.00 ? 11  LEU A C    3  
ATOM 3230  O O    . LEU A 1 11  ? 2.476   -13.851 -7.215  1.00 0.00 ? 11  LEU A O    3  
ATOM 3231  C CB   . LEU A 1 11  ? 0.875   -12.980 -10.163 1.00 0.00 ? 11  LEU A CB   3  
ATOM 3232  C CG   . LEU A 1 11  ? 2.229   -13.265 -10.847 1.00 0.00 ? 11  LEU A CG   3  
ATOM 3233  C CD1  . LEU A 1 11  ? 3.234   -12.145 -10.597 1.00 0.00 ? 11  LEU A CD1  3  
ATOM 3234  C CD2  . LEU A 1 11  ? 2.881   -14.593 -10.471 1.00 0.00 ? 11  LEU A CD2  3  
ATOM 3235  H H    . LEU A 1 11  ? -1.093  -12.222 -8.906  1.00 0.00 ? 11  LEU A H    3  
ATOM 3236  H HA   . LEU A 1 11  ? 0.586   -14.524 -8.702  1.00 0.00 ? 11  LEU A HA   3  
ATOM 3237  H HB2  . LEU A 1 11  ? 0.113   -13.466 -10.776 1.00 0.00 ? 11  LEU A HB2  3  
ATOM 3238  H HB3  . LEU A 1 11  ? 0.685   -11.909 -10.234 1.00 0.00 ? 11  LEU A HB3  3  
ATOM 3239  H HG   . LEU A 1 11  ? 2.045   -13.282 -11.921 1.00 0.00 ? 11  LEU A HG   3  
ATOM 3240  H HD11 . LEU A 1 11  ? 4.132   -12.320 -11.189 1.00 0.00 ? 11  LEU A HD11 3  
ATOM 3241  H HD12 . LEU A 1 11  ? 2.798   -11.200 -10.920 1.00 0.00 ? 11  LEU A HD12 3  
ATOM 3242  H HD13 . LEU A 1 11  ? 3.482   -12.088 -9.541  1.00 0.00 ? 11  LEU A HD13 3  
ATOM 3243  H HD21 . LEU A 1 11  ? 2.151   -15.395 -10.553 1.00 0.00 ? 11  LEU A HD21 3  
ATOM 3244  H HD22 . LEU A 1 11  ? 3.710   -14.788 -11.154 1.00 0.00 ? 11  LEU A HD22 3  
ATOM 3245  H HD23 . LEU A 1 11  ? 3.275   -14.548 -9.462  1.00 0.00 ? 11  LEU A HD23 3  
ATOM 3246  N N    . TYR A 1 12  ? 1.709   -11.745 -7.309  1.00 0.00 ? 12  TYR A N    3  
ATOM 3247  C CA   . TYR A 1 12  ? 2.676   -11.252 -6.327  1.00 0.00 ? 12  TYR A CA   3  
ATOM 3248  C C    . TYR A 1 12  ? 2.384   -11.781 -4.920  1.00 0.00 ? 12  TYR A C    3  
ATOM 3249  O O    . TYR A 1 12  ? 3.290   -11.833 -4.087  1.00 0.00 ? 12  TYR A O    3  
ATOM 3250  C CB   . TYR A 1 12  ? 2.746   -9.718  -6.347  1.00 0.00 ? 12  TYR A CB   3  
ATOM 3251  C CG   . TYR A 1 12  ? 3.057   -9.137  -7.716  1.00 0.00 ? 12  TYR A CG   3  
ATOM 3252  C CD1  . TYR A 1 12  ? 4.119   -9.658  -8.482  1.00 0.00 ? 12  TYR A CD1  3  
ATOM 3253  C CD2  . TYR A 1 12  ? 2.249   -8.117  -8.251  1.00 0.00 ? 12  TYR A CD2  3  
ATOM 3254  C CE1  . TYR A 1 12  ? 4.322   -9.231  -9.804  1.00 0.00 ? 12  TYR A CE1  3  
ATOM 3255  C CE2  . TYR A 1 12  ? 2.478   -7.646  -9.554  1.00 0.00 ? 12  TYR A CE2  3  
ATOM 3256  C CZ   . TYR A 1 12  ? 3.494   -8.224  -10.350 1.00 0.00 ? 12  TYR A CZ   3  
ATOM 3257  O OH   . TYR A 1 12  ? 3.656   -7.814  -11.637 1.00 0.00 ? 12  TYR A OH   3  
ATOM 3258  H H    . TYR A 1 12  ? 1.023   -11.124 -7.718  1.00 0.00 ? 12  TYR A H    3  
ATOM 3259  H HA   . TYR A 1 12  ? 3.659   -11.635 -6.604  1.00 0.00 ? 12  TYR A HA   3  
ATOM 3260  H HB2  . TYR A 1 12  ? 1.794   -9.322  -5.992  1.00 0.00 ? 12  TYR A HB2  3  
ATOM 3261  H HB3  . TYR A 1 12  ? 3.522   -9.394  -5.653  1.00 0.00 ? 12  TYR A HB3  3  
ATOM 3262  H HD1  . TYR A 1 12  ? 4.766   -10.425 -8.083  1.00 0.00 ? 12  TYR A HD1  3  
ATOM 3263  H HD2  . TYR A 1 12  ? 1.437   -7.695  -7.680  1.00 0.00 ? 12  TYR A HD2  3  
ATOM 3264  H HE1  . TYR A 1 12  ? 5.085   -9.716  -10.402 1.00 0.00 ? 12  TYR A HE1  3  
ATOM 3265  H HE2  . TYR A 1 12  ? 1.844   -6.863  -9.949  1.00 0.00 ? 12  TYR A HE2  3  
ATOM 3266  H HH   . TYR A 1 12  ? 4.033   -8.485  -12.239 1.00 0.00 ? 12  TYR A HH   3  
ATOM 3267  N N    . MET A 1 13  ? 1.155   -12.231 -4.644  1.00 0.00 ? 13  MET A N    3  
ATOM 3268  C CA   . MET A 1 13  ? 0.754   -12.751 -3.342  1.00 0.00 ? 13  MET A CA   3  
ATOM 3269  C C    . MET A 1 13  ? 1.616   -13.935 -2.903  1.00 0.00 ? 13  MET A C    3  
ATOM 3270  O O    . MET A 1 13  ? 1.761   -14.168 -1.699  1.00 0.00 ? 13  MET A O    3  
ATOM 3271  C CB   . MET A 1 13  ? -0.717  -13.195 -3.392  1.00 0.00 ? 13  MET A CB   3  
ATOM 3272  C CG   . MET A 1 13  ? -1.405  -13.077 -2.029  1.00 0.00 ? 13  MET A CG   3  
ATOM 3273  S SD   . MET A 1 13  ? -3.205  -12.857 -2.038  1.00 0.00 ? 13  MET A SD   3  
ATOM 3274  C CE   . MET A 1 13  ? -3.353  -11.211 -2.795  1.00 0.00 ? 13  MET A CE   3  
ATOM 3275  H H    . MET A 1 13  ? 0.435   -12.152 -5.355  1.00 0.00 ? 13  MET A H    3  
ATOM 3276  H HA   . MET A 1 13  ? 0.870   -11.944 -2.620  1.00 0.00 ? 13  MET A HA   3  
ATOM 3277  H HB2  . MET A 1 13  ? -1.266  -12.615 -4.122  1.00 0.00 ? 13  MET A HB2  3  
ATOM 3278  H HB3  . MET A 1 13  ? -0.756  -14.234 -3.713  1.00 0.00 ? 13  MET A HB3  3  
ATOM 3279  H HG2  . MET A 1 13  ? -1.191  -13.994 -1.485  1.00 0.00 ? 13  MET A HG2  3  
ATOM 3280  H HG3  . MET A 1 13  ? -0.977  -12.236 -1.488  1.00 0.00 ? 13  MET A HG3  3  
ATOM 3281  H HE1  . MET A 1 13  ? -2.837  -10.473 -2.182  1.00 0.00 ? 13  MET A HE1  3  
ATOM 3282  H HE2  . MET A 1 13  ? -2.926  -11.211 -3.798  1.00 0.00 ? 13  MET A HE2  3  
ATOM 3283  H HE3  . MET A 1 13  ? -4.407  -10.940 -2.865  1.00 0.00 ? 13  MET A HE3  3  
ATOM 3284  N N    . TYR A 1 14  ? 2.152   -14.701 -3.854  1.00 0.00 ? 14  TYR A N    3  
ATOM 3285  C CA   . TYR A 1 14  ? 2.932   -15.898 -3.573  1.00 0.00 ? 14  TYR A CA   3  
ATOM 3286  C C    . TYR A 1 14  ? 4.404   -15.602 -3.325  1.00 0.00 ? 14  TYR A C    3  
ATOM 3287  O O    . TYR A 1 14  ? 5.142   -16.509 -2.936  1.00 0.00 ? 14  TYR A O    3  
ATOM 3288  C CB   . TYR A 1 14  ? 2.859   -16.857 -4.763  1.00 0.00 ? 14  TYR A CB   3  
ATOM 3289  C CG   . TYR A 1 14  ? 1.495   -16.992 -5.395  1.00 0.00 ? 14  TYR A CG   3  
ATOM 3290  C CD1  . TYR A 1 14  ? 0.375   -17.279 -4.596  1.00 0.00 ? 14  TYR A CD1  3  
ATOM 3291  C CD2  . TYR A 1 14  ? 1.346   -16.786 -6.778  1.00 0.00 ? 14  TYR A CD2  3  
ATOM 3292  C CE1  . TYR A 1 14  ? -0.901  -17.331 -5.173  1.00 0.00 ? 14  TYR A CE1  3  
ATOM 3293  C CE2  . TYR A 1 14  ? 0.075   -16.895 -7.368  1.00 0.00 ? 14  TYR A CE2  3  
ATOM 3294  C CZ   . TYR A 1 14  ? -1.061  -17.154 -6.567  1.00 0.00 ? 14  TYR A CZ   3  
ATOM 3295  O OH   . TYR A 1 14  ? -2.304  -17.187 -7.128  1.00 0.00 ? 14  TYR A OH   3  
ATOM 3296  H H    . TYR A 1 14  ? 1.956   -14.480 -4.824  1.00 0.00 ? 14  TYR A H    3  
ATOM 3297  H HA   . TYR A 1 14  ? 2.519   -16.390 -2.693  1.00 0.00 ? 14  TYR A HA   3  
ATOM 3298  H HB2  . TYR A 1 14  ? 3.565   -16.523 -5.525  1.00 0.00 ? 14  TYR A HB2  3  
ATOM 3299  H HB3  . TYR A 1 14  ? 3.180   -17.839 -4.420  1.00 0.00 ? 14  TYR A HB3  3  
ATOM 3300  H HD1  . TYR A 1 14  ? 0.478   -17.406 -3.528  1.00 0.00 ? 14  TYR A HD1  3  
ATOM 3301  H HD2  . TYR A 1 14  ? 2.206   -16.504 -7.377  1.00 0.00 ? 14  TYR A HD2  3  
ATOM 3302  H HE1  . TYR A 1 14  ? -1.754  -17.458 -4.522  1.00 0.00 ? 14  TYR A HE1  3  
ATOM 3303  H HE2  . TYR A 1 14  ? -0.038  -16.735 -8.427  1.00 0.00 ? 14  TYR A HE2  3  
ATOM 3304  H HH   . TYR A 1 14  ? -2.981  -17.436 -6.472  1.00 0.00 ? 14  TYR A HH   3  
ATOM 3305  N N    . ARG A 1 15  ? 4.863   -14.391 -3.624  1.00 0.00 ? 15  ARG A N    3  
ATOM 3306  C CA   . ARG A 1 15  ? 6.265   -14.061 -3.757  1.00 0.00 ? 15  ARG A CA   3  
ATOM 3307  C C    . ARG A 1 15  ? 6.637   -13.111 -2.626  1.00 0.00 ? 15  ARG A C    3  
ATOM 3308  O O    . ARG A 1 15  ? 6.015   -13.145 -1.562  1.00 0.00 ? 15  ARG A O    3  
ATOM 3309  C CB   . ARG A 1 15  ? 6.490   -13.532 -5.192  1.00 0.00 ? 15  ARG A CB   3  
ATOM 3310  C CG   . ARG A 1 15  ? 7.695   -14.212 -5.854  1.00 0.00 ? 15  ARG A CG   3  
ATOM 3311  C CD   . ARG A 1 15  ? 9.041   -14.057 -5.129  1.00 0.00 ? 15  ARG A CD   3  
ATOM 3312  N NE   . ARG A 1 15  ? 9.713   -12.761 -5.339  1.00 0.00 ? 15  ARG A NE   3  
ATOM 3313  C CZ   . ARG A 1 15  ? 10.891  -12.431 -4.780  1.00 0.00 ? 15  ARG A CZ   3  
ATOM 3314  N NH1  . ARG A 1 15  ? 11.482  -13.274 -3.934  1.00 0.00 ? 15  ARG A NH1  3  
ATOM 3315  N NH2  . ARG A 1 15  ? 11.471  -11.265 -5.052  1.00 0.00 ? 15  ARG A NH2  3  
ATOM 3316  H H    . ARG A 1 15  ? 4.224   -13.652 -3.881  1.00 0.00 ? 15  ARG A H    3  
ATOM 3317  H HA   . ARG A 1 15  ? 6.843   -14.974 -3.610  1.00 0.00 ? 15  ARG A HA   3  
ATOM 3318  H HB2  . ARG A 1 15  ? 5.615   -13.771 -5.811  1.00 0.00 ? 15  ARG A HB2  3  
ATOM 3319  H HB3  . ARG A 1 15  ? 6.610   -12.451 -5.193  1.00 0.00 ? 15  ARG A HB3  3  
ATOM 3320  H HG2  . ARG A 1 15  ? 7.462   -15.276 -5.899  1.00 0.00 ? 15  ARG A HG2  3  
ATOM 3321  H HG3  . ARG A 1 15  ? 7.788   -13.862 -6.878  1.00 0.00 ? 15  ARG A HG3  3  
ATOM 3322  H HD2  . ARG A 1 15  ? 8.898   -14.235 -4.065  1.00 0.00 ? 15  ARG A HD2  3  
ATOM 3323  H HD3  . ARG A 1 15  ? 9.713   -14.828 -5.491  1.00 0.00 ? 15  ARG A HD3  3  
ATOM 3324  H HE   . ARG A 1 15  ? 9.289   -12.134 -6.015  1.00 0.00 ? 15  ARG A HE   3  
ATOM 3325  H HH11 . ARG A 1 15  ? 11.137  -14.224 -3.821  1.00 0.00 ? 15  ARG A HH11 3  
ATOM 3326  H HH12 . ARG A 1 15  ? 12.110  -12.940 -3.198  1.00 0.00 ? 15  ARG A HH12 3  
ATOM 3327  H HH21 . ARG A 1 15  ? 11.027  -10.539 -5.598  1.00 0.00 ? 15  ARG A HH21 3  
ATOM 3328  H HH22 . ARG A 1 15  ? 12.432  -11.072 -4.759  1.00 0.00 ? 15  ARG A HH22 3  
ATOM 3329  N N    . GLU A 1 16  ? 7.684   -12.321 -2.814  1.00 0.00 ? 16  GLU A N    3  
ATOM 3330  C CA   . GLU A 1 16  ? 8.001   -11.172 -1.995  1.00 0.00 ? 16  GLU A CA   3  
ATOM 3331  C C    . GLU A 1 16  ? 8.381   -10.036 -2.936  1.00 0.00 ? 16  GLU A C    3  
ATOM 3332  O O    . GLU A 1 16  ? 8.485   -10.229 -4.151  1.00 0.00 ? 16  GLU A O    3  
ATOM 3333  C CB   . GLU A 1 16  ? 9.030   -11.543 -0.906  1.00 0.00 ? 16  GLU A CB   3  
ATOM 3334  C CG   . GLU A 1 16  ? 10.492  -11.201 -1.210  1.00 0.00 ? 16  GLU A CG   3  
ATOM 3335  C CD   . GLU A 1 16  ? 11.458  -12.154 -0.499  1.00 0.00 ? 16  GLU A CD   3  
ATOM 3336  O OE1  . GLU A 1 16  ? 11.558  -12.106 0.754   1.00 0.00 ? 16  GLU A OE1  3  
ATOM 3337  O OE2  . GLU A 1 16  ? 12.098  -12.981 -1.186  1.00 0.00 ? 16  GLU A OE2  3  
ATOM 3338  H H    . GLU A 1 16  ? 8.129   -12.293 -3.722  1.00 0.00 ? 16  GLU A H    3  
ATOM 3339  H HA   . GLU A 1 16  ? 7.089   -10.847 -1.509  1.00 0.00 ? 16  GLU A HA   3  
ATOM 3340  H HB2  . GLU A 1 16  ? 8.769   -11.005 0.003   1.00 0.00 ? 16  GLU A HB2  3  
ATOM 3341  H HB3  . GLU A 1 16  ? 8.943   -12.611 -0.692  1.00 0.00 ? 16  GLU A HB3  3  
ATOM 3342  H HG2  . GLU A 1 16  ? 10.665  -11.254 -2.281  1.00 0.00 ? 16  GLU A HG2  3  
ATOM 3343  H HG3  . GLU A 1 16  ? 10.671  -10.178 -0.874  1.00 0.00 ? 16  GLU A HG3  3  
ATOM 3344  N N    . VAL A 1 17  ? 8.539   -8.844  -2.386  1.00 0.00 ? 17  VAL A N    3  
ATOM 3345  C CA   . VAL A 1 17  ? 8.850   -7.636  -3.120  1.00 0.00 ? 17  VAL A CA   3  
ATOM 3346  C C    . VAL A 1 17  ? 9.750   -6.810  -2.213  1.00 0.00 ? 17  VAL A C    3  
ATOM 3347  O O    . VAL A 1 17  ? 9.788   -7.016  -0.992  1.00 0.00 ? 17  VAL A O    3  
ATOM 3348  C CB   . VAL A 1 17  ? 7.545   -6.916  -3.529  1.00 0.00 ? 17  VAL A CB   3  
ATOM 3349  C CG1  . VAL A 1 17  ? 6.640   -6.659  -2.319  1.00 0.00 ? 17  VAL A CG1  3  
ATOM 3350  C CG2  . VAL A 1 17  ? 7.804   -5.592  -4.255  1.00 0.00 ? 17  VAL A CG2  3  
ATOM 3351  H H    . VAL A 1 17  ? 8.541   -8.734  -1.381  1.00 0.00 ? 17  VAL A H    3  
ATOM 3352  H HA   . VAL A 1 17  ? 9.404   -7.904  -4.020  1.00 0.00 ? 17  VAL A HA   3  
ATOM 3353  H HB   . VAL A 1 17  ? 7.006   -7.570  -4.216  1.00 0.00 ? 17  VAL A HB   3  
ATOM 3354  H HG11 . VAL A 1 17  ? 6.307   -7.617  -1.926  1.00 0.00 ? 17  VAL A HG11 3  
ATOM 3355  H HG12 . VAL A 1 17  ? 7.183   -6.115  -1.548  1.00 0.00 ? 17  VAL A HG12 3  
ATOM 3356  H HG13 . VAL A 1 17  ? 5.771   -6.080  -2.617  1.00 0.00 ? 17  VAL A HG13 3  
ATOM 3357  H HG21 . VAL A 1 17  ? 8.576   -5.741  -5.007  1.00 0.00 ? 17  VAL A HG21 3  
ATOM 3358  H HG22 . VAL A 1 17  ? 6.903   -5.252  -4.758  1.00 0.00 ? 17  VAL A HG22 3  
ATOM 3359  H HG23 . VAL A 1 17  ? 8.130   -4.819  -3.559  1.00 0.00 ? 17  VAL A HG23 3  
ATOM 3360  N N    . ASP A 1 18  ? 10.480  -5.873  -2.797  1.00 0.00 ? 18  ASP A N    3  
ATOM 3361  C CA   . ASP A 1 18  ? 11.432  -5.059  -2.080  1.00 0.00 ? 18  ASP A CA   3  
ATOM 3362  C C    . ASP A 1 18  ? 10.693  -3.869  -1.504  1.00 0.00 ? 18  ASP A C    3  
ATOM 3363  O O    . ASP A 1 18  ? 10.631  -2.820  -2.134  1.00 0.00 ? 18  ASP A O    3  
ATOM 3364  C CB   . ASP A 1 18  ? 12.557  -4.647  -3.027  1.00 0.00 ? 18  ASP A CB   3  
ATOM 3365  C CG   . ASP A 1 18  ? 13.389  -5.866  -3.365  1.00 0.00 ? 18  ASP A CG   3  
ATOM 3366  O OD1  . ASP A 1 18  ? 14.255  -6.188  -2.514  1.00 0.00 ? 18  ASP A OD1  3  
ATOM 3367  O OD2  . ASP A 1 18  ? 13.102  -6.521  -4.392  1.00 0.00 ? 18  ASP A OD2  3  
ATOM 3368  H H    . ASP A 1 18  ? 10.402  -5.710  -3.794  1.00 0.00 ? 18  ASP A H    3  
ATOM 3369  H HA   . ASP A 1 18  ? 11.874  -5.635  -1.274  1.00 0.00 ? 18  ASP A HA   3  
ATOM 3370  H HB2  . ASP A 1 18  ? 12.146  -4.209  -3.938  1.00 0.00 ? 18  ASP A HB2  3  
ATOM 3371  H HB3  . ASP A 1 18  ? 13.195  -3.922  -2.521  1.00 0.00 ? 18  ASP A HB3  3  
ATOM 3372  N N    . THR A 1 19  ? 10.132  -3.986  -0.301  1.00 0.00 ? 19  THR A N    3  
ATOM 3373  C CA   . THR A 1 19  ? 9.269   -2.943  0.252   1.00 0.00 ? 19  THR A CA   3  
ATOM 3374  C C    . THR A 1 19  ? 10.020  -1.633  0.550   1.00 0.00 ? 19  THR A C    3  
ATOM 3375  O O    . THR A 1 19  ? 9.379   -0.642  0.894   1.00 0.00 ? 19  THR A O    3  
ATOM 3376  C CB   . THR A 1 19  ? 8.520   -3.479  1.485   1.00 0.00 ? 19  THR A CB   3  
ATOM 3377  O OG1  . THR A 1 19  ? 9.409   -4.090  2.392   1.00 0.00 ? 19  THR A OG1  3  
ATOM 3378  C CG2  . THR A 1 19  ? 7.470   -4.526  1.095   1.00 0.00 ? 19  THR A CG2  3  
ATOM 3379  H H    . THR A 1 19  ? 10.194  -4.848  0.226   1.00 0.00 ? 19  THR A H    3  
ATOM 3380  H HA   . THR A 1 19  ? 8.522   -2.701  -0.505  1.00 0.00 ? 19  THR A HA   3  
ATOM 3381  H HB   . THR A 1 19  ? 8.014   -2.652  1.983   1.00 0.00 ? 19  THR A HB   3  
ATOM 3382  H HG1  . THR A 1 19  ? 8.976   -4.068  3.264   1.00 0.00 ? 19  THR A HG1  3  
ATOM 3383  H HG21 . THR A 1 19  ? 6.763   -4.097  0.384   1.00 0.00 ? 19  THR A HG21 3  
ATOM 3384  H HG22 . THR A 1 19  ? 7.953   -5.392  0.640   1.00 0.00 ? 19  THR A HG22 3  
ATOM 3385  H HG23 . THR A 1 19  ? 6.925   -4.847  1.984   1.00 0.00 ? 19  THR A HG23 3  
ATOM 3386  N N    . LEU A 1 20  ? 11.355  -1.613  0.438   1.00 0.00 ? 20  LEU A N    3  
ATOM 3387  C CA   . LEU A 1 20  ? 12.206  -0.437  0.540   1.00 0.00 ? 20  LEU A CA   3  
ATOM 3388  C C    . LEU A 1 20  ? 12.490  0.217   -0.818  1.00 0.00 ? 20  LEU A C    3  
ATOM 3389  O O    . LEU A 1 20  ? 12.836  1.396   -0.847  1.00 0.00 ? 20  LEU A O    3  
ATOM 3390  C CB   . LEU A 1 20  ? 13.537  -0.860  1.188   1.00 0.00 ? 20  LEU A CB   3  
ATOM 3391  C CG   . LEU A 1 20  ? 13.590  -0.763  2.724   1.00 0.00 ? 20  LEU A CG   3  
ATOM 3392  C CD1  . LEU A 1 20  ? 13.539  0.693   3.204   1.00 0.00 ? 20  LEU A CD1  3  
ATOM 3393  C CD2  . LEU A 1 20  ? 12.509  -1.599  3.421   1.00 0.00 ? 20  LEU A CD2  3  
ATOM 3394  H H    . LEU A 1 20  ? 11.824  -2.463  0.172   1.00 0.00 ? 20  LEU A H    3  
ATOM 3395  H HA   . LEU A 1 20  ? 11.708  0.310   1.157   1.00 0.00 ? 20  LEU A HA   3  
ATOM 3396  H HB2  . LEU A 1 20  ? 13.780  -1.879  0.885   1.00 0.00 ? 20  LEU A HB2  3  
ATOM 3397  H HB3  . LEU A 1 20  ? 14.328  -0.238  0.778   1.00 0.00 ? 20  LEU A HB3  3  
ATOM 3398  H HG   . LEU A 1 20  ? 14.550  -1.170  3.035   1.00 0.00 ? 20  LEU A HG   3  
ATOM 3399  H HD11 . LEU A 1 20  ? 14.366  1.240   2.751   1.00 0.00 ? 20  LEU A HD11 3  
ATOM 3400  H HD12 . LEU A 1 20  ? 12.602  1.166   2.921   1.00 0.00 ? 20  LEU A HD12 3  
ATOM 3401  H HD13 . LEU A 1 20  ? 13.651  0.724   4.287   1.00 0.00 ? 20  LEU A HD13 3  
ATOM 3402  H HD21 . LEU A 1 20  ? 11.514  -1.247  3.161   1.00 0.00 ? 20  LEU A HD21 3  
ATOM 3403  H HD22 . LEU A 1 20  ? 12.600  -2.642  3.113   1.00 0.00 ? 20  LEU A HD22 3  
ATOM 3404  H HD23 . LEU A 1 20  ? 12.636  -1.548  4.502   1.00 0.00 ? 20  LEU A HD23 3  
ATOM 3405  N N    . GLU A 1 21  ? 12.412  -0.521  -1.927  1.00 0.00 ? 21  GLU A N    3  
ATOM 3406  C CA   . GLU A 1 21  ? 12.616  -0.026  -3.278  1.00 0.00 ? 21  GLU A CA   3  
ATOM 3407  C C    . GLU A 1 21  ? 11.275  0.330   -3.901  1.00 0.00 ? 21  GLU A C    3  
ATOM 3408  O O    . GLU A 1 21  ? 11.154  1.349   -4.572  1.00 0.00 ? 21  GLU A O    3  
ATOM 3409  C CB   . GLU A 1 21  ? 13.267  -1.139  -4.108  1.00 0.00 ? 21  GLU A CB   3  
ATOM 3410  C CG   . GLU A 1 21  ? 14.795  -1.070  -4.157  1.00 0.00 ? 21  GLU A CG   3  
ATOM 3411  C CD   . GLU A 1 21  ? 15.258  0.187   -4.890  1.00 0.00 ? 21  GLU A CD   3  
ATOM 3412  O OE1  . GLU A 1 21  ? 15.344  0.163   -6.141  1.00 0.00 ? 21  GLU A OE1  3  
ATOM 3413  O OE2  . GLU A 1 21  ? 15.445  1.217   -4.201  1.00 0.00 ? 21  GLU A OE2  3  
ATOM 3414  H H    . GLU A 1 21  ? 12.103  -1.482  -1.917  1.00 0.00 ? 21  GLU A H    3  
ATOM 3415  H HA   . GLU A 1 21  ? 13.235  0.869   -3.260  1.00 0.00 ? 21  GLU A HA   3  
ATOM 3416  H HB2  . GLU A 1 21  ? 12.969  -2.100  -3.708  1.00 0.00 ? 21  GLU A HB2  3  
ATOM 3417  H HB3  . GLU A 1 21  ? 12.868  -1.101  -5.112  1.00 0.00 ? 21  GLU A HB3  3  
ATOM 3418  H HG2  . GLU A 1 21  ? 15.193  -1.079  -3.141  1.00 0.00 ? 21  GLU A HG2  3  
ATOM 3419  H HG3  . GLU A 1 21  ? 15.163  -1.950  -4.681  1.00 0.00 ? 21  GLU A HG3  3  
ATOM 3420  N N    . LEU A 1 22  ? 10.256  -0.485  -3.632  1.00 0.00 ? 22  LEU A N    3  
ATOM 3421  C CA   . LEU A 1 22  ? 8.874   -0.259  -3.997  1.00 0.00 ? 22  LEU A CA   3  
ATOM 3422  C C    . LEU A 1 22  ? 8.459   1.138   -3.566  1.00 0.00 ? 22  LEU A C    3  
ATOM 3423  O O    . LEU A 1 22  ? 8.045   1.939   -4.396  1.00 0.00 ? 22  LEU A O    3  
ATOM 3424  C CB   . LEU A 1 22  ? 8.019   -1.335  -3.314  1.00 0.00 ? 22  LEU A CB   3  
ATOM 3425  C CG   . LEU A 1 22  ? 6.509   -1.069  -3.376  1.00 0.00 ? 22  LEU A CG   3  
ATOM 3426  C CD1  . LEU A 1 22  ? 6.012   -0.955  -4.815  1.00 0.00 ? 22  LEU A CD1  3  
ATOM 3427  C CD2  . LEU A 1 22  ? 5.788   -2.203  -2.645  1.00 0.00 ? 22  LEU A CD2  3  
ATOM 3428  H H    . LEU A 1 22  ? 10.457  -1.349  -3.141  1.00 0.00 ? 22  LEU A H    3  
ATOM 3429  H HA   . LEU A 1 22  ? 8.770   -0.344  -5.081  1.00 0.00 ? 22  LEU A HA   3  
ATOM 3430  H HB2  . LEU A 1 22  ? 8.240   -2.300  -3.774  1.00 0.00 ? 22  LEU A HB2  3  
ATOM 3431  H HB3  . LEU A 1 22  ? 8.304   -1.383  -2.263  1.00 0.00 ? 22  LEU A HB3  3  
ATOM 3432  H HG   . LEU A 1 22  ? 6.271   -0.145  -2.850  1.00 0.00 ? 22  LEU A HG   3  
ATOM 3433  H HD11 . LEU A 1 22  ? 6.432   -0.069  -5.288  1.00 0.00 ? 22  LEU A HD11 3  
ATOM 3434  H HD12 . LEU A 1 22  ? 6.311   -1.831  -5.390  1.00 0.00 ? 22  LEU A HD12 3  
ATOM 3435  H HD13 . LEU A 1 22  ? 4.933   -0.848  -4.818  1.00 0.00 ? 22  LEU A HD13 3  
ATOM 3436  H HD21 . LEU A 1 22  ? 4.724   -1.979  -2.590  1.00 0.00 ? 22  LEU A HD21 3  
ATOM 3437  H HD22 . LEU A 1 22  ? 5.946   -3.145  -3.168  1.00 0.00 ? 22  LEU A HD22 3  
ATOM 3438  H HD23 . LEU A 1 22  ? 6.187   -2.300  -1.639  1.00 0.00 ? 22  LEU A HD23 3  
ATOM 3439  N N    . THR A 1 23  ? 8.576   1.444   -2.274  1.00 0.00 ? 23  THR A N    3  
ATOM 3440  C CA   . THR A 1 23  ? 8.244   2.752   -1.743  1.00 0.00 ? 23  THR A CA   3  
ATOM 3441  C C    . THR A 1 23  ? 9.079   3.794   -2.472  1.00 0.00 ? 23  THR A C    3  
ATOM 3442  O O    . THR A 1 23  ? 8.519   4.793   -2.891  1.00 0.00 ? 23  THR A O    3  
ATOM 3443  C CB   . THR A 1 23  ? 8.509   2.761   -0.240  1.00 0.00 ? 23  THR A CB   3  
ATOM 3444  O OG1  . THR A 1 23  ? 9.805   2.288   0.042   1.00 0.00 ? 23  THR A OG1  3  
ATOM 3445  C CG2  . THR A 1 23  ? 7.494   1.860   0.456   1.00 0.00 ? 23  THR A CG2  3  
ATOM 3446  H H    . THR A 1 23  ? 9.041   0.826   -1.621  1.00 0.00 ? 23  THR A H    3  
ATOM 3447  H HA   . THR A 1 23  ? 7.180   2.981   -1.899  1.00 0.00 ? 23  THR A HA   3  
ATOM 3448  H HB   . THR A 1 23  ? 8.403   3.777   0.140   1.00 0.00 ? 23  THR A HB   3  
ATOM 3449  H HG1  . THR A 1 23  ? 10.152  2.838   0.764   1.00 0.00 ? 23  THR A HG1  3  
ATOM 3450  H HG21 . THR A 1 23  ? 7.514   0.867   0.008   1.00 0.00 ? 23  THR A HG21 3  
ATOM 3451  H HG22 . THR A 1 23  ? 7.758   1.776   1.509   1.00 0.00 ? 23  THR A HG22 3  
ATOM 3452  H HG23 . THR A 1 23  ? 6.501   2.283   0.319   1.00 0.00 ? 23  THR A HG23 3  
ATOM 3453  N N    . ARG A 1 24  ? 10.386  3.572   -2.643  1.00 0.00 ? 24  ARG A N    3  
ATOM 3454  C CA   . ARG A 1 24  ? 11.284  4.481   -3.362  1.00 0.00 ? 24  ARG A CA   3  
ATOM 3455  C C    . ARG A 1 24  ? 10.728  4.850   -4.729  1.00 0.00 ? 24  ARG A C    3  
ATOM 3456  O O    . ARG A 1 24  ? 10.481  6.031   -4.954  1.00 0.00 ? 24  ARG A O    3  
ATOM 3457  C CB   . ARG A 1 24  ? 12.708  3.898   -3.474  1.00 0.00 ? 24  ARG A CB   3  
ATOM 3458  C CG   . ARG A 1 24  ? 13.715  4.720   -2.676  1.00 0.00 ? 24  ARG A CG   3  
ATOM 3459  C CD   . ARG A 1 24  ? 13.468  4.590   -1.169  1.00 0.00 ? 24  ARG A CD   3  
ATOM 3460  N NE   . ARG A 1 24  ? 14.119  5.683   -0.429  1.00 0.00 ? 24  ARG A NE   3  
ATOM 3461  C CZ   . ARG A 1 24  ? 15.380  5.661   0.023   1.00 0.00 ? 24  ARG A CZ   3  
ATOM 3462  N NH1  . ARG A 1 24  ? 16.180  4.636   -0.235  1.00 0.00 ? 24  ARG A NH1  3  
ATOM 3463  N NH2  . ARG A 1 24  ? 15.844  6.676   0.741   1.00 0.00 ? 24  ARG A NH2  3  
ATOM 3464  H H    . ARG A 1 24  ? 10.728  2.697   -2.265  1.00 0.00 ? 24  ARG A H    3  
ATOM 3465  H HA   . ARG A 1 24  ? 11.324  5.419   -2.810  1.00 0.00 ? 24  ARG A HA   3  
ATOM 3466  H HB2  . ARG A 1 24  ? 12.728  2.875   -3.114  1.00 0.00 ? 24  ARG A HB2  3  
ATOM 3467  H HB3  . ARG A 1 24  ? 13.030  3.897   -4.517  1.00 0.00 ? 24  ARG A HB3  3  
ATOM 3468  H HG2  . ARG A 1 24  ? 14.719  4.370   -2.898  1.00 0.00 ? 24  ARG A HG2  3  
ATOM 3469  H HG3  . ARG A 1 24  ? 13.638  5.758   -2.990  1.00 0.00 ? 24  ARG A HG3  3  
ATOM 3470  H HD2  . ARG A 1 24  ? 12.399  4.584   -0.975  1.00 0.00 ? 24  ARG A HD2  3  
ATOM 3471  H HD3  . ARG A 1 24  ? 13.846  3.634   -0.817  1.00 0.00 ? 24  ARG A HD3  3  
ATOM 3472  H HE   . ARG A 1 24  ? 13.621  6.566   -0.431  1.00 0.00 ? 24  ARG A HE   3  
ATOM 3473  H HH11 . ARG A 1 24  ? 15.877  3.861   -0.822  1.00 0.00 ? 24  ARG A HH11 3  
ATOM 3474  H HH12 . ARG A 1 24  ? 17.190  4.746   -0.131  1.00 0.00 ? 24  ARG A HH12 3  
ATOM 3475  H HH21 . ARG A 1 24  ? 15.322  7.533   0.859   1.00 0.00 ? 24  ARG A HH21 3  
ATOM 3476  H HH22 . ARG A 1 24  ? 16.809  6.711   1.072   1.00 0.00 ? 24  ARG A HH22 3  
ATOM 3477  N N    . GLN A 1 25  ? 10.499  3.876   -5.609  1.00 0.00 ? 25  GLN A N    3  
ATOM 3478  C CA   . GLN A 1 25  ? 9.942   4.124   -6.930  1.00 0.00 ? 25  GLN A CA   3  
ATOM 3479  C C    . GLN A 1 25  ? 8.606   4.845   -6.809  1.00 0.00 ? 25  GLN A C    3  
ATOM 3480  O O    . GLN A 1 25  ? 8.381   5.819   -7.517  1.00 0.00 ? 25  GLN A O    3  
ATOM 3481  C CB   . GLN A 1 25  ? 9.828   2.826   -7.740  1.00 0.00 ? 25  GLN A CB   3  
ATOM 3482  C CG   . GLN A 1 25  ? 11.204  2.214   -8.043  1.00 0.00 ? 25  GLN A CG   3  
ATOM 3483  C CD   . GLN A 1 25  ? 11.266  1.627   -9.449  1.00 0.00 ? 25  GLN A CD   3  
ATOM 3484  O OE1  . GLN A 1 25  ? 11.388  2.366   -10.423 1.00 0.00 ? 25  GLN A OE1  3  
ATOM 3485  N NE2  . GLN A 1 25  ? 11.174  0.319   -9.601  1.00 0.00 ? 25  GLN A NE2  3  
ATOM 3486  H H    . GLN A 1 25  ? 10.700  2.919   -5.336  1.00 0.00 ? 25  GLN A H    3  
ATOM 3487  H HA   . GLN A 1 25  ? 10.602  4.794   -7.476  1.00 0.00 ? 25  GLN A HA   3  
ATOM 3488  H HB2  . GLN A 1 25  ? 9.221   2.097   -7.204  1.00 0.00 ? 25  GLN A HB2  3  
ATOM 3489  H HB3  . GLN A 1 25  ? 9.337   3.066   -8.684  1.00 0.00 ? 25  GLN A HB3  3  
ATOM 3490  H HG2  . GLN A 1 25  ? 11.967  2.989   -7.982  1.00 0.00 ? 25  GLN A HG2  3  
ATOM 3491  H HG3  . GLN A 1 25  ? 11.429  1.449   -7.301  1.00 0.00 ? 25  GLN A HG3  3  
ATOM 3492  H HE21 . GLN A 1 25  ? 11.158  -0.315  -8.805  1.00 0.00 ? 25  GLN A HE21 3  
ATOM 3493  H HE22 . GLN A 1 25  ? 11.362  -0.070  -10.527 1.00 0.00 ? 25  GLN A HE22 3  
ATOM 3494  N N    . VAL A 1 26  ? 7.733   4.421   -5.895  1.00 0.00 ? 26  VAL A N    3  
ATOM 3495  C CA   . VAL A 1 26  ? 6.452   5.073   -5.682  1.00 0.00 ? 26  VAL A CA   3  
ATOM 3496  C C    . VAL A 1 26  ? 6.676   6.559   -5.333  1.00 0.00 ? 26  VAL A C    3  
ATOM 3497  O O    . VAL A 1 26  ? 6.177   7.436   -6.029  1.00 0.00 ? 26  VAL A O    3  
ATOM 3498  C CB   . VAL A 1 26  ? 5.633   4.293   -4.635  1.00 0.00 ? 26  VAL A CB   3  
ATOM 3499  C CG1  . VAL A 1 26  ? 4.333   5.018   -4.291  1.00 0.00 ? 26  VAL A CG1  3  
ATOM 3500  C CG2  . VAL A 1 26  ? 5.277   2.871   -5.094  1.00 0.00 ? 26  VAL A CG2  3  
ATOM 3501  H H    . VAL A 1 26  ? 7.965   3.610   -5.327  1.00 0.00 ? 26  VAL A H    3  
ATOM 3502  H HA   . VAL A 1 26  ? 5.923   5.013   -6.628  1.00 0.00 ? 26  VAL A HA   3  
ATOM 3503  H HB   . VAL A 1 26  ? 6.215   4.212   -3.720  1.00 0.00 ? 26  VAL A HB   3  
ATOM 3504  H HG11 . VAL A 1 26  ? 3.765   5.229   -5.199  1.00 0.00 ? 26  VAL A HG11 3  
ATOM 3505  H HG12 . VAL A 1 26  ? 3.737   4.399   -3.626  1.00 0.00 ? 26  VAL A HG12 3  
ATOM 3506  H HG13 . VAL A 1 26  ? 4.581   5.945   -3.780  1.00 0.00 ? 26  VAL A HG13 3  
ATOM 3507  H HG21 . VAL A 1 26  ? 4.329   2.847   -5.631  1.00 0.00 ? 26  VAL A HG21 3  
ATOM 3508  H HG22 . VAL A 1 26  ? 6.036   2.474   -5.754  1.00 0.00 ? 26  VAL A HG22 3  
ATOM 3509  H HG23 . VAL A 1 26  ? 5.243   2.216   -4.221  1.00 0.00 ? 26  VAL A HG23 3  
ATOM 3510  N N    . LYS A 1 27  ? 7.425   6.863   -4.272  1.00 0.00 ? 27  LYS A N    3  
ATOM 3511  C CA   . LYS A 1 27  ? 7.705   8.200   -3.743  1.00 0.00 ? 27  LYS A CA   3  
ATOM 3512  C C    . LYS A 1 27  ? 8.311   9.070   -4.836  1.00 0.00 ? 27  LYS A C    3  
ATOM 3513  O O    . LYS A 1 27  ? 7.794   10.153  -5.109  1.00 0.00 ? 27  LYS A O    3  
ATOM 3514  C CB   . LYS A 1 27  ? 8.655   8.095   -2.528  1.00 0.00 ? 27  LYS A CB   3  
ATOM 3515  C CG   . LYS A 1 27  ? 7.970   7.510   -1.276  1.00 0.00 ? 27  LYS A CG   3  
ATOM 3516  C CD   . LYS A 1 27  ? 8.895   6.664   -0.381  1.00 0.00 ? 27  LYS A CD   3  
ATOM 3517  C CE   . LYS A 1 27  ? 10.055  7.370   0.301   1.00 0.00 ? 27  LYS A CE   3  
ATOM 3518  N NZ   . LYS A 1 27  ? 9.663   8.160   1.478   1.00 0.00 ? 27  LYS A NZ   3  
ATOM 3519  H H    . LYS A 1 27  ? 7.885   6.083   -3.820  1.00 0.00 ? 27  LYS A H    3  
ATOM 3520  H HA   . LYS A 1 27  ? 6.770   8.665   -3.430  1.00 0.00 ? 27  LYS A HA   3  
ATOM 3521  H HB2  . LYS A 1 27  ? 9.510   7.476   -2.807  1.00 0.00 ? 27  LYS A HB2  3  
ATOM 3522  H HB3  . LYS A 1 27  ? 9.032   9.089   -2.281  1.00 0.00 ? 27  LYS A HB3  3  
ATOM 3523  H HG2  . LYS A 1 27  ? 7.531   8.321   -0.697  1.00 0.00 ? 27  LYS A HG2  3  
ATOM 3524  H HG3  . LYS A 1 27  ? 7.159   6.855   -1.595  1.00 0.00 ? 27  LYS A HG3  3  
ATOM 3525  H HD2  . LYS A 1 27  ? 8.303   6.141   0.366   1.00 0.00 ? 27  LYS A HD2  3  
ATOM 3526  H HD3  . LYS A 1 27  ? 9.367   5.906   -0.989  1.00 0.00 ? 27  LYS A HD3  3  
ATOM 3527  H HE2  . LYS A 1 27  ? 10.719  6.579   0.645   1.00 0.00 ? 27  LYS A HE2  3  
ATOM 3528  H HE3  . LYS A 1 27  ? 10.580  7.999   -0.420  1.00 0.00 ? 27  LYS A HE3  3  
ATOM 3529  H HZ1  . LYS A 1 27  ? 10.490  8.632   1.830   1.00 0.00 ? 27  LYS A HZ1  3  
ATOM 3530  H HZ2  . LYS A 1 27  ? 8.959   8.863   1.258   1.00 0.00 ? 27  LYS A HZ2  3  
ATOM 3531  H HZ3  . LYS A 1 27  ? 9.317   7.559   2.215   1.00 0.00 ? 27  LYS A HZ3  3  
ATOM 3532  N N    . GLU A 1 28  ? 9.385   8.600   -5.464  1.00 0.00 ? 28  GLU A N    3  
ATOM 3533  C CA   . GLU A 1 28  ? 10.133  9.339   -6.468  1.00 0.00 ? 28  GLU A CA   3  
ATOM 3534  C C    . GLU A 1 28  ? 9.267   9.593   -7.703  1.00 0.00 ? 28  GLU A C    3  
ATOM 3535  O O    . GLU A 1 28  ? 9.323   10.686  -8.266  1.00 0.00 ? 28  GLU A O    3  
ATOM 3536  C CB   . GLU A 1 28  ? 11.426  8.581   -6.821  1.00 0.00 ? 28  GLU A CB   3  
ATOM 3537  C CG   . GLU A 1 28  ? 12.426  8.637   -5.650  1.00 0.00 ? 28  GLU A CG   3  
ATOM 3538  C CD   . GLU A 1 28  ? 13.701  7.803   -5.839  1.00 0.00 ? 28  GLU A CD   3  
ATOM 3539  O OE1  . GLU A 1 28  ? 14.063  7.453   -6.992  1.00 0.00 ? 28  GLU A OE1  3  
ATOM 3540  O OE2  . GLU A 1 28  ? 14.358  7.544   -4.799  1.00 0.00 ? 28  GLU A OE2  3  
ATOM 3541  H H    . GLU A 1 28  ? 9.737   7.681   -5.213  1.00 0.00 ? 28  GLU A H    3  
ATOM 3542  H HA   . GLU A 1 28  ? 10.403  10.309  -6.048  1.00 0.00 ? 28  GLU A HA   3  
ATOM 3543  H HB2  . GLU A 1 28  ? 11.191  7.545   -7.067  1.00 0.00 ? 28  GLU A HB2  3  
ATOM 3544  H HB3  . GLU A 1 28  ? 11.882  9.052   -7.691  1.00 0.00 ? 28  GLU A HB3  3  
ATOM 3545  H HG2  . GLU A 1 28  ? 12.716  9.677   -5.493  1.00 0.00 ? 28  GLU A HG2  3  
ATOM 3546  H HG3  . GLU A 1 28  ? 11.930  8.294   -4.741  1.00 0.00 ? 28  GLU A HG3  3  
ATOM 3547  N N    . LYS A 1 29  ? 8.442   8.632   -8.131  1.00 0.00 ? 29  LYS A N    3  
ATOM 3548  C CA   . LYS A 1 29  ? 7.575   8.795   -9.298  1.00 0.00 ? 29  LYS A CA   3  
ATOM 3549  C C    . LYS A 1 29  ? 6.384   9.697   -8.984  1.00 0.00 ? 29  LYS A C    3  
ATOM 3550  O O    . LYS A 1 29  ? 6.005   10.530  -9.804  1.00 0.00 ? 29  LYS A O    3  
ATOM 3551  C CB   . LYS A 1 29  ? 7.149   7.408   -9.795  1.00 0.00 ? 29  LYS A CB   3  
ATOM 3552  C CG   . LYS A 1 29  ? 6.582   7.456   -11.216 1.00 0.00 ? 29  LYS A CG   3  
ATOM 3553  C CD   . LYS A 1 29  ? 6.509   6.044   -11.826 1.00 0.00 ? 29  LYS A CD   3  
ATOM 3554  C CE   . LYS A 1 29  ? 6.872   6.106   -13.315 1.00 0.00 ? 29  LYS A CE   3  
ATOM 3555  N NZ   . LYS A 1 29  ? 7.675   4.948   -13.747 1.00 0.00 ? 29  LYS A NZ   3  
ATOM 3556  H H    . LYS A 1 29  ? 8.444   7.727   -7.665  1.00 0.00 ? 29  LYS A H    3  
ATOM 3557  H HA   . LYS A 1 29  ? 8.163   9.267   -10.086 1.00 0.00 ? 29  LYS A HA   3  
ATOM 3558  H HB2  . LYS A 1 29  ? 8.045   6.786   -9.819  1.00 0.00 ? 29  LYS A HB2  3  
ATOM 3559  H HB3  . LYS A 1 29  ? 6.426   6.959   -9.116  1.00 0.00 ? 29  LYS A HB3  3  
ATOM 3560  H HG2  . LYS A 1 29  ? 5.594   7.919   -11.216 1.00 0.00 ? 29  LYS A HG2  3  
ATOM 3561  H HG3  . LYS A 1 29  ? 7.252   8.077   -11.812 1.00 0.00 ? 29  LYS A HG3  3  
ATOM 3562  H HD2  . LYS A 1 29  ? 7.211   5.384   -11.314 1.00 0.00 ? 29  LYS A HD2  3  
ATOM 3563  H HD3  . LYS A 1 29  ? 5.502   5.638   -11.705 1.00 0.00 ? 29  LYS A HD3  3  
ATOM 3564  H HE2  . LYS A 1 29  ? 5.960   6.176   -13.913 1.00 0.00 ? 29  LYS A HE2  3  
ATOM 3565  H HE3  . LYS A 1 29  ? 7.466   7.004   -13.492 1.00 0.00 ? 29  LYS A HE3  3  
ATOM 3566  H HZ1  . LYS A 1 29  ? 7.903   5.045   -14.732 1.00 0.00 ? 29  LYS A HZ1  3  
ATOM 3567  H HZ2  . LYS A 1 29  ? 8.545   4.876   -13.226 1.00 0.00 ? 29  LYS A HZ2  3  
ATOM 3568  H HZ3  . LYS A 1 29  ? 7.157   4.080   -13.650 1.00 0.00 ? 29  LYS A HZ3  3  
ATOM 3569  N N    . LEU A 1 30  ? 5.818   9.600   -7.780  1.00 0.00 ? 30  LEU A N    3  
ATOM 3570  C CA   . LEU A 1 30  ? 4.792   10.525  -7.311  1.00 0.00 ? 30  LEU A CA   3  
ATOM 3571  C C    . LEU A 1 30  ? 5.367   11.936  -7.310  1.00 0.00 ? 30  LEU A C    3  
ATOM 3572  O O    . LEU A 1 30  ? 4.692   12.859  -7.753  1.00 0.00 ? 30  LEU A O    3  
ATOM 3573  C CB   . LEU A 1 30  ? 4.291   10.149  -5.906  1.00 0.00 ? 30  LEU A CB   3  
ATOM 3574  C CG   . LEU A 1 30  ? 3.427   8.874   -5.872  1.00 0.00 ? 30  LEU A CG   3  
ATOM 3575  C CD1  . LEU A 1 30  ? 3.315   8.372   -4.435  1.00 0.00 ? 30  LEU A CD1  3  
ATOM 3576  C CD2  . LEU A 1 30  ? 2.008   9.111   -6.373  1.00 0.00 ? 30  LEU A CD2  3  
ATOM 3577  H H    . LEU A 1 30  ? 6.160   8.882   -7.148  1.00 0.00 ? 30  LEU A H    3  
ATOM 3578  H HA   . LEU A 1 30  ? 3.957   10.502  -8.012  1.00 0.00 ? 30  LEU A HA   3  
ATOM 3579  H HB2  . LEU A 1 30  ? 5.158   10.016  -5.258  1.00 0.00 ? 30  LEU A HB2  3  
ATOM 3580  H HB3  . LEU A 1 30  ? 3.705   10.977  -5.503  1.00 0.00 ? 30  LEU A HB3  3  
ATOM 3581  H HG   . LEU A 1 30  ? 3.875   8.098   -6.482  1.00 0.00 ? 30  LEU A HG   3  
ATOM 3582  H HD11 . LEU A 1 30  ? 2.740   7.447   -4.426  1.00 0.00 ? 30  LEU A HD11 3  
ATOM 3583  H HD12 . LEU A 1 30  ? 4.315   8.184   -4.044  1.00 0.00 ? 30  LEU A HD12 3  
ATOM 3584  H HD13 . LEU A 1 30  ? 2.822   9.123   -3.822  1.00 0.00 ? 30  LEU A HD13 3  
ATOM 3585  H HD21 . LEU A 1 30  ? 2.032   9.541   -7.371  1.00 0.00 ? 30  LEU A HD21 3  
ATOM 3586  H HD22 . LEU A 1 30  ? 1.488   8.156   -6.435  1.00 0.00 ? 30  LEU A HD22 3  
ATOM 3587  H HD23 . LEU A 1 30  ? 1.488   9.771   -5.684  1.00 0.00 ? 30  LEU A HD23 3  
ATOM 3588  N N    . ALA A 1 31  ? 6.597   12.127  -6.820  1.00 0.00 ? 31  ALA A N    3  
ATOM 3589  C CA   . ALA A 1 31  ? 7.284   13.413  -6.872  1.00 0.00 ? 31  ALA A CA   3  
ATOM 3590  C C    . ALA A 1 31  ? 7.474   13.883  -8.315  1.00 0.00 ? 31  ALA A C    3  
ATOM 3591  O O    . ALA A 1 31  ? 7.139   15.024  -8.627  1.00 0.00 ? 31  ALA A O    3  
ATOM 3592  C CB   . ALA A 1 31  ? 8.617   13.333  -6.122  1.00 0.00 ? 31  ALA A CB   3  
ATOM 3593  H H    . ALA A 1 31  ? 7.088   11.333  -6.416  1.00 0.00 ? 31  ALA A H    3  
ATOM 3594  H HA   . ALA A 1 31  ? 6.659   14.153  -6.376  1.00 0.00 ? 31  ALA A HA   3  
ATOM 3595  H HB1  . ALA A 1 31  ? 8.439   13.094  -5.074  1.00 0.00 ? 31  ALA A HB1  3  
ATOM 3596  H HB2  . ALA A 1 31  ? 9.263   12.574  -6.558  1.00 0.00 ? 31  ALA A HB2  3  
ATOM 3597  H HB3  . ALA A 1 31  ? 9.126   14.294  -6.187  1.00 0.00 ? 31  ALA A HB3  3  
ATOM 3598  N N    . LYS A 1 32  ? 7.953   13.000  -9.197  1.00 0.00 ? 32  LYS A N    3  
ATOM 3599  C CA   . LYS A 1 32  ? 8.146   13.260  -10.622 1.00 0.00 ? 32  LYS A CA   3  
ATOM 3600  C C    . LYS A 1 32  ? 6.868   13.797  -11.272 1.00 0.00 ? 32  LYS A C    3  
ATOM 3601  O O    . LYS A 1 32  ? 6.949   14.695  -12.107 1.00 0.00 ? 32  LYS A O    3  
ATOM 3602  C CB   . LYS A 1 32  ? 8.609   11.959  -11.304 1.00 0.00 ? 32  LYS A CB   3  
ATOM 3603  C CG   . LYS A 1 32  ? 9.184   12.190  -12.702 1.00 0.00 ? 32  LYS A CG   3  
ATOM 3604  C CD   . LYS A 1 32  ? 9.257   10.901  -13.528 1.00 0.00 ? 32  LYS A CD   3  
ATOM 3605  C CE   . LYS A 1 32  ? 10.578  10.147  -13.353 1.00 0.00 ? 32  LYS A CE   3  
ATOM 3606  N NZ   . LYS A 1 32  ? 10.562  8.876   -14.105 1.00 0.00 ? 32  LYS A NZ   3  
ATOM 3607  H H    . LYS A 1 32  ? 8.227   12.090  -8.844  1.00 0.00 ? 32  LYS A H    3  
ATOM 3608  H HA   . LYS A 1 32  ? 8.923   14.018  -10.730 1.00 0.00 ? 32  LYS A HA   3  
ATOM 3609  H HB2  . LYS A 1 32  ? 9.372   11.472  -10.707 1.00 0.00 ? 32  LYS A HB2  3  
ATOM 3610  H HB3  . LYS A 1 32  ? 7.758   11.288  -11.383 1.00 0.00 ? 32  LYS A HB3  3  
ATOM 3611  H HG2  . LYS A 1 32  ? 8.527   12.872  -13.224 1.00 0.00 ? 32  LYS A HG2  3  
ATOM 3612  H HG3  . LYS A 1 32  ? 10.167  12.651  -12.631 1.00 0.00 ? 32  LYS A HG3  3  
ATOM 3613  H HD2  . LYS A 1 32  ? 8.421   10.250  -13.265 1.00 0.00 ? 32  LYS A HD2  3  
ATOM 3614  H HD3  . LYS A 1 32  ? 9.150   11.167  -14.580 1.00 0.00 ? 32  LYS A HD3  3  
ATOM 3615  H HE2  . LYS A 1 32  ? 11.395  10.768  -13.723 1.00 0.00 ? 32  LYS A HE2  3  
ATOM 3616  H HE3  . LYS A 1 32  ? 10.749  9.941   -12.296 1.00 0.00 ? 32  LYS A HE3  3  
ATOM 3617  H HZ1  . LYS A 1 32  ? 10.040  8.179   -13.583 1.00 0.00 ? 32  LYS A HZ1  3  
ATOM 3618  H HZ2  . LYS A 1 32  ? 10.086  8.977   -14.999 1.00 0.00 ? 32  LYS A HZ2  3  
ATOM 3619  H HZ3  . LYS A 1 32  ? 11.503  8.525   -14.244 1.00 0.00 ? 32  LYS A HZ3  3  
ATOM 3620  N N    . ASN A 1 33  ? 5.706   13.248  -10.905 1.00 0.00 ? 33  ASN A N    3  
ATOM 3621  C CA   . ASN A 1 33  ? 4.421   13.626  -11.494 1.00 0.00 ? 33  ASN A CA   3  
ATOM 3622  C C    . ASN A 1 33  ? 3.780   14.812  -10.763 1.00 0.00 ? 33  ASN A C    3  
ATOM 3623  O O    . ASN A 1 33  ? 2.951   15.500  -11.354 1.00 0.00 ? 33  ASN A O    3  
ATOM 3624  C CB   . ASN A 1 33  ? 3.447   12.433  -11.498 1.00 0.00 ? 33  ASN A CB   3  
ATOM 3625  C CG   . ASN A 1 33  ? 3.899   11.252  -12.358 1.00 0.00 ? 33  ASN A CG   3  
ATOM 3626  O OD1  . ASN A 1 33  ? 4.924   11.296  -13.045 1.00 0.00 ? 33  ASN A OD1  3  
ATOM 3627  N ND2  . ASN A 1 33  ? 3.162   10.156  -12.320 1.00 0.00 ? 33  ASN A ND2  3  
ATOM 3628  H H    . ASN A 1 33  ? 5.734   12.451  -10.281 1.00 0.00 ? 33  ASN A H    3  
ATOM 3629  H HA   . ASN A 1 33  ? 4.586   13.924  -12.532 1.00 0.00 ? 33  ASN A HA   3  
ATOM 3630  H HB2  . ASN A 1 33  ? 3.303   12.090  -10.474 1.00 0.00 ? 33  ASN A HB2  3  
ATOM 3631  H HB3  . ASN A 1 33  ? 2.484   12.779  -11.880 1.00 0.00 ? 33  ASN A HB3  3  
ATOM 3632  H HD21 . ASN A 1 33  ? 2.263   10.112  -11.838 1.00 0.00 ? 33  ASN A HD21 3  
ATOM 3633  H HD22 . ASN A 1 33  ? 3.430   9.311   -12.811 1.00 0.00 ? 33  ASN A HD22 3  
ATOM 3634  N N    . GLY A 1 34  ? 4.148   15.078  -9.505  1.00 0.00 ? 34  GLY A N    3  
ATOM 3635  C CA   . GLY A 1 34  ? 3.626   16.185  -8.703  1.00 0.00 ? 34  GLY A CA   3  
ATOM 3636  C C    . GLY A 1 34  ? 2.529   15.768  -7.716  1.00 0.00 ? 34  GLY A C    3  
ATOM 3637  O O    . GLY A 1 34  ? 1.740   16.608  -7.282  1.00 0.00 ? 34  GLY A O    3  
ATOM 3638  H H    . GLY A 1 34  ? 4.832   14.475  -9.068  1.00 0.00 ? 34  GLY A H    3  
ATOM 3639  H HA2  . GLY A 1 34  ? 4.453   16.620  -8.146  1.00 0.00 ? 34  GLY A HA2  3  
ATOM 3640  H HA3  . GLY A 1 34  ? 3.225   16.960  -9.357  1.00 0.00 ? 34  GLY A HA3  3  
ATOM 3641  N N    . ILE A 1 35  ? 2.412   14.479  -7.384  1.00 0.00 ? 35  ILE A N    3  
ATOM 3642  C CA   . ILE A 1 35  ? 1.303   13.948  -6.596  1.00 0.00 ? 35  ILE A CA   3  
ATOM 3643  C C    . ILE A 1 35  ? 1.614   14.076  -5.103  1.00 0.00 ? 35  ILE A C    3  
ATOM 3644  O O    . ILE A 1 35  ? 2.715   13.747  -4.638  1.00 0.00 ? 35  ILE A O    3  
ATOM 3645  C CB   . ILE A 1 35  ? 0.966   12.508  -7.026  1.00 0.00 ? 35  ILE A CB   3  
ATOM 3646  C CG1  . ILE A 1 35  ? 0.449   12.551  -8.482  1.00 0.00 ? 35  ILE A CG1  3  
ATOM 3647  C CG2  . ILE A 1 35  ? -0.104  11.870  -6.106  1.00 0.00 ? 35  ILE A CG2  3  
ATOM 3648  C CD1  . ILE A 1 35  ? 0.477   11.194  -9.168  1.00 0.00 ? 35  ILE A CD1  3  
ATOM 3649  H H    . ILE A 1 35  ? 3.121   13.834  -7.715  1.00 0.00 ? 35  ILE A H    3  
ATOM 3650  H HA   . ILE A 1 35  ? 0.421   14.541  -6.824  1.00 0.00 ? 35  ILE A HA   3  
ATOM 3651  H HB   . ILE A 1 35  ? 1.879   11.915  -6.983  1.00 0.00 ? 35  ILE A HB   3  
ATOM 3652  H HG12 . ILE A 1 35  ? -0.570  12.931  -8.499  1.00 0.00 ? 35  ILE A HG12 3  
ATOM 3653  H HG13 . ILE A 1 35  ? 1.057   13.216  -9.094  1.00 0.00 ? 35  ILE A HG13 3  
ATOM 3654  H HG21 . ILE A 1 35  ? -0.997  12.495  -6.068  1.00 0.00 ? 35  ILE A HG21 3  
ATOM 3655  H HG22 . ILE A 1 35  ? -0.402  10.892  -6.482  1.00 0.00 ? 35  ILE A HG22 3  
ATOM 3656  H HG23 . ILE A 1 35  ? 0.277   11.719  -5.094  1.00 0.00 ? 35  ILE A HG23 3  
ATOM 3657  H HD11 . ILE A 1 35  ? 0.085   11.324  -10.171 1.00 0.00 ? 35  ILE A HD11 3  
ATOM 3658  H HD12 . ILE A 1 35  ? 1.503   10.836  -9.227  1.00 0.00 ? 35  ILE A HD12 3  
ATOM 3659  H HD13 . ILE A 1 35  ? -0.143  10.477  -8.637  1.00 0.00 ? 35  ILE A HD13 3  
ATOM 3660  N N    . CYS A 1 36  ? 0.603   14.530  -4.362  1.00 0.00 ? 36  CYS A N    3  
ATOM 3661  C CA   . CYS A 1 36  ? 0.534   14.622  -2.912  1.00 0.00 ? 36  CYS A CA   3  
ATOM 3662  C C    . CYS A 1 36  ? 0.472   13.203  -2.334  1.00 0.00 ? 36  CYS A C    3  
ATOM 3663  O O    . CYS A 1 36  ? -0.514  12.491  -2.546  1.00 0.00 ? 36  CYS A O    3  
ATOM 3664  C CB   . CYS A 1 36  ? -0.732  15.406  -2.527  1.00 0.00 ? 36  CYS A CB   3  
ATOM 3665  S SG   . CYS A 1 36  ? -1.013  16.829  -3.622  1.00 0.00 ? 36  CYS A SG   3  
ATOM 3666  H H    . CYS A 1 36  ? -0.246  14.793  -4.840  1.00 0.00 ? 36  CYS A H    3  
ATOM 3667  H HA   . CYS A 1 36  ? 1.415   15.147  -2.543  1.00 0.00 ? 36  CYS A HA   3  
ATOM 3668  H HB2  . CYS A 1 36  ? -1.594  14.745  -2.619  1.00 0.00 ? 36  CYS A HB2  3  
ATOM 3669  H HB3  . CYS A 1 36  ? -0.659  15.745  -1.493  1.00 0.00 ? 36  CYS A HB3  3  
ATOM 3670  H HG   . CYS A 1 36  ? -0.163  17.683  -3.020  1.00 0.00 ? 36  CYS A HG   3  
ATOM 3671  N N    . GLN A 1 37  ? 1.509   12.773  -1.619  1.00 0.00 ? 37  GLN A N    3  
ATOM 3672  C CA   . GLN A 1 37  ? 1.634   11.395  -1.154  1.00 0.00 ? 37  GLN A CA   3  
ATOM 3673  C C    . GLN A 1 37  ? 0.510   10.996  -0.183  1.00 0.00 ? 37  GLN A C    3  
ATOM 3674  O O    . GLN A 1 37  ? 0.075   9.843   -0.220  1.00 0.00 ? 37  GLN A O    3  
ATOM 3675  C CB   . GLN A 1 37  ? 3.029   11.183  -0.534  1.00 0.00 ? 37  GLN A CB   3  
ATOM 3676  C CG   . GLN A 1 37  ? 4.105   10.969  -1.617  1.00 0.00 ? 37  GLN A CG   3  
ATOM 3677  C CD   . GLN A 1 37  ? 5.536   11.122  -1.097  1.00 0.00 ? 37  GLN A CD   3  
ATOM 3678  O OE1  . GLN A 1 37  ? 5.802   11.042  0.100   1.00 0.00 ? 37  GLN A OE1  3  
ATOM 3679  N NE2  . GLN A 1 37  ? 6.499   11.382  -1.960  1.00 0.00 ? 37  GLN A NE2  3  
ATOM 3680  H H    . GLN A 1 37  ? 2.262   13.420  -1.397  1.00 0.00 ? 37  GLN A H    3  
ATOM 3681  H HA   . GLN A 1 37  ? 1.531   10.750  -2.031  1.00 0.00 ? 37  GLN A HA   3  
ATOM 3682  H HB2  . GLN A 1 37  ? 3.283   12.042  0.086   1.00 0.00 ? 37  GLN A HB2  3  
ATOM 3683  H HB3  . GLN A 1 37  ? 3.017   10.307  0.116   1.00 0.00 ? 37  GLN A HB3  3  
ATOM 3684  H HG2  . GLN A 1 37  ? 4.005   9.965   -2.019  1.00 0.00 ? 37  GLN A HG2  3  
ATOM 3685  H HG3  . GLN A 1 37  ? 3.935   11.669  -2.433  1.00 0.00 ? 37  GLN A HG3  3  
ATOM 3686  H HE21 . GLN A 1 37  ? 6.259   11.635  -2.915  1.00 0.00 ? 37  GLN A HE21 3  
ATOM 3687  H HE22 . GLN A 1 37  ? 7.421   11.609  -1.595  1.00 0.00 ? 37  GLN A HE22 3  
ATOM 3688  N N    . ARG A 1 38  ? -0.010  11.925  0.628   1.00 0.00 ? 38  ARG A N    3  
ATOM 3689  C CA   . ARG A 1 38  ? -1.187  11.688  1.470   1.00 0.00 ? 38  ARG A CA   3  
ATOM 3690  C C    . ARG A 1 38  ? -2.395  11.222  0.655   1.00 0.00 ? 38  ARG A C    3  
ATOM 3691  O O    . ARG A 1 38  ? -3.033  10.229  0.996   1.00 0.00 ? 38  ARG A O    3  
ATOM 3692  C CB   . ARG A 1 38  ? -1.531  12.948  2.285   1.00 0.00 ? 38  ARG A CB   3  
ATOM 3693  C CG   . ARG A 1 38  ? -1.881  14.174  1.441   1.00 0.00 ? 38  ARG A CG   3  
ATOM 3694  C CD   . ARG A 1 38  ? -1.949  15.492  2.194   1.00 0.00 ? 38  ARG A CD   3  
ATOM 3695  N NE   . ARG A 1 38  ? -2.642  16.459  1.333   1.00 0.00 ? 38  ARG A NE   3  
ATOM 3696  C CZ   . ARG A 1 38  ? -2.387  17.766  1.218   1.00 0.00 ? 38  ARG A CZ   3  
ATOM 3697  N NH1  . ARG A 1 38  ? -1.345  18.327  1.825   1.00 0.00 ? 38  ARG A NH1  3  
ATOM 3698  N NH2  . ARG A 1 38  ? -3.187  18.508  0.462   1.00 0.00 ? 38  ARG A NH2  3  
ATOM 3699  H H    . ARG A 1 38  ? 0.443   12.828  0.671   1.00 0.00 ? 38  ARG A H    3  
ATOM 3700  H HA   . ARG A 1 38  ? -0.949  10.886  2.174   1.00 0.00 ? 38  ARG A HA   3  
ATOM 3701  H HB2  . ARG A 1 38  ? -2.429  12.728  2.857   1.00 0.00 ? 38  ARG A HB2  3  
ATOM 3702  H HB3  . ARG A 1 38  ? -0.703  13.178  2.955   1.00 0.00 ? 38  ARG A HB3  3  
ATOM 3703  H HG2  . ARG A 1 38  ? -1.177  14.288  0.617   1.00 0.00 ? 38  ARG A HG2  3  
ATOM 3704  H HG3  . ARG A 1 38  ? -2.880  13.999  1.051   1.00 0.00 ? 38  ARG A HG3  3  
ATOM 3705  H HD2  . ARG A 1 38  ? -2.520  15.366  3.113   1.00 0.00 ? 38  ARG A HD2  3  
ATOM 3706  H HD3  . ARG A 1 38  ? -0.941  15.825  2.443   1.00 0.00 ? 38  ARG A HD3  3  
ATOM 3707  H HE   . ARG A 1 38  ? -3.441  16.073  0.827   1.00 0.00 ? 38  ARG A HE   3  
ATOM 3708  H HH11 . ARG A 1 38  ? -0.743  17.828  2.476   1.00 0.00 ? 38  ARG A HH11 3  
ATOM 3709  H HH12 . ARG A 1 38  ? -1.091  19.287  1.605   1.00 0.00 ? 38  ARG A HH12 3  
ATOM 3710  H HH21 . ARG A 1 38  ? -4.010  18.120  0.017   1.00 0.00 ? 38  ARG A HH21 3  
ATOM 3711  H HH22 . ARG A 1 38  ? -3.083  19.518  0.400   1.00 0.00 ? 38  ARG A HH22 3  
ATOM 3712  N N    . ILE A 1 39  ? -2.710  11.940  -0.421  1.00 0.00 ? 39  ILE A N    3  
ATOM 3713  C CA   . ILE A 1 39  ? -3.927  11.743  -1.194  1.00 0.00 ? 39  ILE A CA   3  
ATOM 3714  C C    . ILE A 1 39  ? -3.818  10.386  -1.879  1.00 0.00 ? 39  ILE A C    3  
ATOM 3715  O O    . ILE A 1 39  ? -4.764  9.602   -1.852  1.00 0.00 ? 39  ILE A O    3  
ATOM 3716  C CB   . ILE A 1 39  ? -4.107  12.910  -2.191  1.00 0.00 ? 39  ILE A CB   3  
ATOM 3717  C CG1  . ILE A 1 39  ? -4.196  14.258  -1.446  1.00 0.00 ? 39  ILE A CG1  3  
ATOM 3718  C CG2  . ILE A 1 39  ? -5.298  12.623  -3.127  1.00 0.00 ? 39  ILE A CG2  3  
ATOM 3719  C CD1  . ILE A 1 39  ? -4.516  15.443  -2.358  1.00 0.00 ? 39  ILE A CD1  3  
ATOM 3720  H H    . ILE A 1 39  ? -2.084  12.672  -0.713  1.00 0.00 ? 39  ILE A H    3  
ATOM 3721  H HA   . ILE A 1 39  ? -4.783  11.711  -0.513  1.00 0.00 ? 39  ILE A HA   3  
ATOM 3722  H HB   . ILE A 1 39  ? -3.207  12.993  -2.792  1.00 0.00 ? 39  ILE A HB   3  
ATOM 3723  H HG12 . ILE A 1 39  ? -4.900  14.198  -0.616  1.00 0.00 ? 39  ILE A HG12 3  
ATOM 3724  H HG13 . ILE A 1 39  ? -3.218  14.471  -1.025  1.00 0.00 ? 39  ILE A HG13 3  
ATOM 3725  H HG21 . ILE A 1 39  ? -5.389  13.395  -3.890  1.00 0.00 ? 39  ILE A HG21 3  
ATOM 3726  H HG22 . ILE A 1 39  ? -5.151  11.674  -3.654  1.00 0.00 ? 39  ILE A HG22 3  
ATOM 3727  H HG23 . ILE A 1 39  ? -6.224  12.568  -2.553  1.00 0.00 ? 39  ILE A HG23 3  
ATOM 3728  H HD11 . ILE A 1 39  ? -5.539  15.378  -2.724  1.00 0.00 ? 39  ILE A HD11 3  
ATOM 3729  H HD12 . ILE A 1 39  ? -4.395  16.369  -1.798  1.00 0.00 ? 39  ILE A HD12 3  
ATOM 3730  H HD13 . ILE A 1 39  ? -3.828  15.436  -3.205  1.00 0.00 ? 39  ILE A HD13 3  
ATOM 3731  N N    . PHE A 1 40  ? -2.638  10.085  -2.428  1.00 0.00 ? 40  PHE A N    3  
ATOM 3732  C CA   . PHE A 1 40  ? -2.338  8.765   -2.962  1.00 0.00 ? 40  PHE A CA   3  
ATOM 3733  C C    . PHE A 1 40  ? -2.679  7.665   -1.942  1.00 0.00 ? 40  PHE A C    3  
ATOM 3734  O O    . PHE A 1 40  ? -3.298  6.667   -2.299  1.00 0.00 ? 40  PHE A O    3  
ATOM 3735  C CB   . PHE A 1 40  ? -0.860  8.699   -3.380  1.00 0.00 ? 40  PHE A CB   3  
ATOM 3736  C CG   . PHE A 1 40  ? -0.357  7.291   -3.662  1.00 0.00 ? 40  PHE A CG   3  
ATOM 3737  C CD1  . PHE A 1 40  ? 0.123   6.441   -2.636  1.00 0.00 ? 40  PHE A CD1  3  
ATOM 3738  C CD2  . PHE A 1 40  ? -0.407  6.804   -4.977  1.00 0.00 ? 40  PHE A CD2  3  
ATOM 3739  C CE1  . PHE A 1 40  ? 0.568   5.149   -2.944  1.00 0.00 ? 40  PHE A CE1  3  
ATOM 3740  C CE2  . PHE A 1 40  ? 0.037   5.506   -5.267  1.00 0.00 ? 40  PHE A CE2  3  
ATOM 3741  C CZ   . PHE A 1 40  ? 0.540   4.676   -4.257  1.00 0.00 ? 40  PHE A CZ   3  
ATOM 3742  H H    . PHE A 1 40  ? -1.950  10.825  -2.485  1.00 0.00 ? 40  PHE A H    3  
ATOM 3743  H HA   . PHE A 1 40  ? -2.974  8.631   -3.842  1.00 0.00 ? 40  PHE A HA   3  
ATOM 3744  H HB2  . PHE A 1 40  ? -0.708  9.326   -4.258  1.00 0.00 ? 40  PHE A HB2  3  
ATOM 3745  H HB3  . PHE A 1 40  ? -0.240  9.149   -2.615  1.00 0.00 ? 40  PHE A HB3  3  
ATOM 3746  H HD1  . PHE A 1 40  ? 0.191   6.719   -1.592  1.00 0.00 ? 40  PHE A HD1  3  
ATOM 3747  H HD2  . PHE A 1 40  ? -0.798  7.418   -5.776  1.00 0.00 ? 40  PHE A HD2  3  
ATOM 3748  H HE1  . PHE A 1 40  ? 0.958   4.523   -2.160  1.00 0.00 ? 40  PHE A HE1  3  
ATOM 3749  H HE2  . PHE A 1 40  ? -0.025  5.145   -6.272  1.00 0.00 ? 40  PHE A HE2  3  
ATOM 3750  H HZ   . PHE A 1 40  ? 0.893   3.679   -4.473  1.00 0.00 ? 40  PHE A HZ   3  
ATOM 3751  N N    . GLY A 1 41  ? -2.292  7.833   -0.673  1.00 0.00 ? 41  GLY A N    3  
ATOM 3752  C CA   . GLY A 1 41  ? -2.646  6.886   0.375   1.00 0.00 ? 41  GLY A CA   3  
ATOM 3753  C C    . GLY A 1 41  ? -4.157  6.754   0.510   1.00 0.00 ? 41  GLY A C    3  
ATOM 3754  O O    . GLY A 1 41  ? -4.694  5.650   0.459   1.00 0.00 ? 41  GLY A O    3  
ATOM 3755  H H    . GLY A 1 41  ? -1.796  8.675   -0.412  1.00 0.00 ? 41  GLY A H    3  
ATOM 3756  H HA2  . GLY A 1 41  ? -2.227  5.910   0.138   1.00 0.00 ? 41  GLY A HA2  3  
ATOM 3757  H HA3  . GLY A 1 41  ? -2.243  7.231   1.326   1.00 0.00 ? 41  GLY A HA3  3  
ATOM 3758  N N    . GLU A 1 42  ? -4.833  7.886   0.659   1.00 0.00 ? 42  GLU A N    3  
ATOM 3759  C CA   . GLU A 1 42  ? -6.256  7.974   0.944   1.00 0.00 ? 42  GLU A CA   3  
ATOM 3760  C C    . GLU A 1 42  ? -7.140  7.511   -0.226  1.00 0.00 ? 42  GLU A C    3  
ATOM 3761  O O    . GLU A 1 42  ? -8.302  7.173   0.016   1.00 0.00 ? 42  GLU A O    3  
ATOM 3762  C CB   . GLU A 1 42  ? -6.556  9.425   1.359   1.00 0.00 ? 42  GLU A CB   3  
ATOM 3763  C CG   . GLU A 1 42  ? -6.353  9.637   2.869   1.00 0.00 ? 42  GLU A CG   3  
ATOM 3764  C CD   . GLU A 1 42  ? -7.655  9.456   3.656   1.00 0.00 ? 42  GLU A CD   3  
ATOM 3765  O OE1  . GLU A 1 42  ? -8.431  10.442  3.712   1.00 0.00 ? 42  GLU A OE1  3  
ATOM 3766  O OE2  . GLU A 1 42  ? -7.910  8.379   4.245   1.00 0.00 ? 42  GLU A OE2  3  
ATOM 3767  H H    . GLU A 1 42  ? -4.313  8.756   0.633   1.00 0.00 ? 42  GLU A H    3  
ATOM 3768  H HA   . GLU A 1 42  ? -6.480  7.316   1.786   1.00 0.00 ? 42  GLU A HA   3  
ATOM 3769  H HB2  . GLU A 1 42  ? -5.896  10.101  0.814   1.00 0.00 ? 42  GLU A HB2  3  
ATOM 3770  H HB3  . GLU A 1 42  ? -7.572  9.700   1.091   1.00 0.00 ? 42  GLU A HB3  3  
ATOM 3771  H HG2  . GLU A 1 42  ? -5.583  8.967   3.250   1.00 0.00 ? 42  GLU A HG2  3  
ATOM 3772  H HG3  . GLU A 1 42  ? -6.002  10.658  3.026   1.00 0.00 ? 42  GLU A HG3  3  
ATOM 3773  N N    . LYS A 1 43  ? -6.651  7.466   -1.474  1.00 0.00 ? 43  LYS A N    3  
ATOM 3774  C CA   . LYS A 1 43  ? -7.451  7.069   -2.633  1.00 0.00 ? 43  LYS A CA   3  
ATOM 3775  C C    . LYS A 1 43  ? -6.929  5.832   -3.363  1.00 0.00 ? 43  LYS A C    3  
ATOM 3776  O O    . LYS A 1 43  ? -7.757  5.028   -3.792  1.00 0.00 ? 43  LYS A O    3  
ATOM 3777  C CB   . LYS A 1 43  ? -7.618  8.268   -3.568  1.00 0.00 ? 43  LYS A CB   3  
ATOM 3778  C CG   . LYS A 1 43  ? -8.560  9.311   -2.936  1.00 0.00 ? 43  LYS A CG   3  
ATOM 3779  C CD   . LYS A 1 43  ? -9.197  10.151  -4.038  1.00 0.00 ? 43  LYS A CD   3  
ATOM 3780  C CE   . LYS A 1 43  ? -10.101 11.317  -3.592  1.00 0.00 ? 43  LYS A CE   3  
ATOM 3781  N NZ   . LYS A 1 43  ? -11.133 10.933  -2.602  1.00 0.00 ? 43  LYS A NZ   3  
ATOM 3782  H H    . LYS A 1 43  ? -5.778  7.944   -1.667  1.00 0.00 ? 43  LYS A H    3  
ATOM 3783  H HA   . LYS A 1 43  ? -8.457  6.805   -2.307  1.00 0.00 ? 43  LYS A HA   3  
ATOM 3784  H HB2  . LYS A 1 43  ? -6.651  8.720   -3.795  1.00 0.00 ? 43  LYS A HB2  3  
ATOM 3785  H HB3  . LYS A 1 43  ? -8.053  7.903   -4.497  1.00 0.00 ? 43  LYS A HB3  3  
ATOM 3786  H HG2  . LYS A 1 43  ? -9.357  8.797   -2.404  1.00 0.00 ? 43  LYS A HG2  3  
ATOM 3787  H HG3  . LYS A 1 43  ? -8.004  9.947   -2.245  1.00 0.00 ? 43  LYS A HG3  3  
ATOM 3788  H HD2  . LYS A 1 43  ? -8.374  10.552  -4.620  1.00 0.00 ? 43  LYS A HD2  3  
ATOM 3789  H HD3  . LYS A 1 43  ? -9.778  9.478   -4.669  1.00 0.00 ? 43  LYS A HD3  3  
ATOM 3790  H HE2  . LYS A 1 43  ? -9.481  12.103  -3.155  1.00 0.00 ? 43  LYS A HE2  3  
ATOM 3791  H HE3  . LYS A 1 43  ? -10.594 11.722  -4.477  1.00 0.00 ? 43  LYS A HE3  3  
ATOM 3792  H HZ1  . LYS A 1 43  ? -11.892 11.600  -2.587  1.00 0.00 ? 43  LYS A HZ1  3  
ATOM 3793  H HZ2  . LYS A 1 43  ? -11.516 10.010  -2.792  1.00 0.00 ? 43  LYS A HZ2  3  
ATOM 3794  H HZ3  . LYS A 1 43  ? -10.716 10.909  -1.675  1.00 0.00 ? 43  LYS A HZ3  3  
ATOM 3795  N N    . VAL A 1 44  ? -5.617  5.627   -3.494  1.00 0.00 ? 44  VAL A N    3  
ATOM 3796  C CA   . VAL A 1 44  ? -5.098  4.377   -4.050  1.00 0.00 ? 44  VAL A CA   3  
ATOM 3797  C C    . VAL A 1 44  ? -5.111  3.321   -2.949  1.00 0.00 ? 44  VAL A C    3  
ATOM 3798  O O    . VAL A 1 44  ? -5.698  2.254   -3.137  1.00 0.00 ? 44  VAL A O    3  
ATOM 3799  C CB   . VAL A 1 44  ? -3.684  4.526   -4.662  1.00 0.00 ? 44  VAL A CB   3  
ATOM 3800  C CG1  . VAL A 1 44  ? -3.305  3.280   -5.474  1.00 0.00 ? 44  VAL A CG1  3  
ATOM 3801  C CG2  . VAL A 1 44  ? -3.586  5.723   -5.609  1.00 0.00 ? 44  VAL A CG2  3  
ATOM 3802  H H    . VAL A 1 44  ? -4.947  6.280   -3.106  1.00 0.00 ? 44  VAL A H    3  
ATOM 3803  H HA   . VAL A 1 44  ? -5.772  4.052   -4.845  1.00 0.00 ? 44  VAL A HA   3  
ATOM 3804  H HB   . VAL A 1 44  ? -2.946  4.653   -3.871  1.00 0.00 ? 44  VAL A HB   3  
ATOM 3805  H HG11 . VAL A 1 44  ? -2.275  3.365   -5.820  1.00 0.00 ? 44  VAL A HG11 3  
ATOM 3806  H HG12 . VAL A 1 44  ? -3.389  2.382   -4.865  1.00 0.00 ? 44  VAL A HG12 3  
ATOM 3807  H HG13 . VAL A 1 44  ? -3.969  3.185   -6.334  1.00 0.00 ? 44  VAL A HG13 3  
ATOM 3808  H HG21 . VAL A 1 44  ? -4.408  5.700   -6.324  1.00 0.00 ? 44  VAL A HG21 3  
ATOM 3809  H HG22 . VAL A 1 44  ? -3.610  6.642   -5.027  1.00 0.00 ? 44  VAL A HG22 3  
ATOM 3810  H HG23 . VAL A 1 44  ? -2.647  5.692   -6.160  1.00 0.00 ? 44  VAL A HG23 3  
ATOM 3811  N N    . LEU A 1 45  ? -4.413  3.570   -1.832  1.00 0.00 ? 45  LEU A N    3  
ATOM 3812  C CA   . LEU A 1 45  ? -4.067  2.491   -0.908  1.00 0.00 ? 45  LEU A CA   3  
ATOM 3813  C C    . LEU A 1 45  ? -5.198  2.169   0.061   1.00 0.00 ? 45  LEU A C    3  
ATOM 3814  O O    . LEU A 1 45  ? -5.282  1.020   0.486   1.00 0.00 ? 45  LEU A O    3  
ATOM 3815  C CB   . LEU A 1 45  ? -2.796  2.779   -0.092  1.00 0.00 ? 45  LEU A CB   3  
ATOM 3816  C CG   . LEU A 1 45  ? -1.518  3.124   -0.877  1.00 0.00 ? 45  LEU A CG   3  
ATOM 3817  C CD1  . LEU A 1 45  ? -0.296  2.832   -0.007  1.00 0.00 ? 45  LEU A CD1  3  
ATOM 3818  C CD2  . LEU A 1 45  ? -1.314  2.320   -2.150  1.00 0.00 ? 45  LEU A CD2  3  
ATOM 3819  H H    . LEU A 1 45  ? -4.014  4.492   -1.704  1.00 0.00 ? 45  LEU A H    3  
ATOM 3820  H HA   . LEU A 1 45  ? -3.882  1.592   -1.497  1.00 0.00 ? 45  LEU A HA   3  
ATOM 3821  H HB2  . LEU A 1 45  ? -2.996  3.585   0.613   1.00 0.00 ? 45  LEU A HB2  3  
ATOM 3822  H HB3  . LEU A 1 45  ? -2.603  1.881   0.497   1.00 0.00 ? 45  LEU A HB3  3  
ATOM 3823  H HG   . LEU A 1 45  ? -1.535  4.183   -1.134  1.00 0.00 ? 45  LEU A HG   3  
ATOM 3824  H HD11 . LEU A 1 45  ? -0.214  1.763   0.192   1.00 0.00 ? 45  LEU A HD11 3  
ATOM 3825  H HD12 . LEU A 1 45  ? 0.605   3.174   -0.508  1.00 0.00 ? 45  LEU A HD12 3  
ATOM 3826  H HD13 . LEU A 1 45  ? -0.391  3.360   0.927   1.00 0.00 ? 45  LEU A HD13 3  
ATOM 3827  H HD21 . LEU A 1 45  ? -1.362  1.264   -1.917  1.00 0.00 ? 45  LEU A HD21 3  
ATOM 3828  H HD22 . LEU A 1 45  ? -2.070  2.581   -2.883  1.00 0.00 ? 45  LEU A HD22 3  
ATOM 3829  H HD23 . LEU A 1 45  ? -0.339  2.553   -2.566  1.00 0.00 ? 45  LEU A HD23 3  
ATOM 3830  N N    . GLY A 1 46  ? -6.034  3.144   0.424   1.00 0.00 ? 46  GLY A N    3  
ATOM 3831  C CA   . GLY A 1 46  ? -6.957  3.023   1.548   1.00 0.00 ? 46  GLY A CA   3  
ATOM 3832  C C    . GLY A 1 46  ? -6.282  3.336   2.884   1.00 0.00 ? 46  GLY A C    3  
ATOM 3833  O O    . GLY A 1 46  ? -6.759  2.895   3.930   1.00 0.00 ? 46  GLY A O    3  
ATOM 3834  H H    . GLY A 1 46  ? -5.872  4.076   0.059   1.00 0.00 ? 46  GLY A H    3  
ATOM 3835  H HA2  . GLY A 1 46  ? -7.784  3.718   1.413   1.00 0.00 ? 46  GLY A HA2  3  
ATOM 3836  H HA3  . GLY A 1 46  ? -7.361  2.011   1.587   1.00 0.00 ? 46  GLY A HA3  3  
ATOM 3837  N N    . LEU A 1 47  ? -5.157  4.062   2.882   1.00 0.00 ? 47  LEU A N    3  
ATOM 3838  C CA   . LEU A 1 47  ? -4.395  4.369   4.083   1.00 0.00 ? 47  LEU A CA   3  
ATOM 3839  C C    . LEU A 1 47  ? -4.493  5.851   4.414   1.00 0.00 ? 47  LEU A C    3  
ATOM 3840  O O    . LEU A 1 47  ? -4.104  6.698   3.607   1.00 0.00 ? 47  LEU A O    3  
ATOM 3841  C CB   . LEU A 1 47  ? -2.932  3.945   3.912   1.00 0.00 ? 47  LEU A CB   3  
ATOM 3842  C CG   . LEU A 1 47  ? -2.704  2.422   3.870   1.00 0.00 ? 47  LEU A CG   3  
ATOM 3843  C CD1  . LEU A 1 47  ? -1.195  2.176   3.853   1.00 0.00 ? 47  LEU A CD1  3  
ATOM 3844  C CD2  . LEU A 1 47  ? -3.308  1.667   5.061   1.00 0.00 ? 47  LEU A CD2  3  
ATOM 3845  H H    . LEU A 1 47  ? -4.834  4.475   2.014   1.00 0.00 ? 47  LEU A H    3  
ATOM 3846  H HA   . LEU A 1 47  ? -4.807  3.822   4.927   1.00 0.00 ? 47  LEU A HA   3  
ATOM 3847  H HB2  . LEU A 1 47  ? -2.546  4.394   2.997   1.00 0.00 ? 47  LEU A HB2  3  
ATOM 3848  H HB3  . LEU A 1 47  ? -2.365  4.361   4.743   1.00 0.00 ? 47  LEU A HB3  3  
ATOM 3849  H HG   . LEU A 1 47  ? -3.134  2.016   2.955   1.00 0.00 ? 47  LEU A HG   3  
ATOM 3850  H HD11 . LEU A 1 47  ? -0.709  2.722   4.660   1.00 0.00 ? 47  LEU A HD11 3  
ATOM 3851  H HD12 . LEU A 1 47  ? -0.982  1.113   3.956   1.00 0.00 ? 47  LEU A HD12 3  
ATOM 3852  H HD13 . LEU A 1 47  ? -0.793  2.510   2.903   1.00 0.00 ? 47  LEU A HD13 3  
ATOM 3853  H HD21 . LEU A 1 47  ? -3.012  0.618   5.029   1.00 0.00 ? 47  LEU A HD21 3  
ATOM 3854  H HD22 . LEU A 1 47  ? -2.988  2.106   6.003   1.00 0.00 ? 47  LEU A HD22 3  
ATOM 3855  H HD23 . LEU A 1 47  ? -4.397  1.686   5.001   1.00 0.00 ? 47  LEU A HD23 3  
ATOM 3856  N N    . SER A 1 48  ? -4.936  6.127   5.641   1.00 0.00 ? 48  SER A N    3  
ATOM 3857  C CA   . SER A 1 48  ? -4.946  7.417   6.307   1.00 0.00 ? 48  SER A CA   3  
ATOM 3858  C C    . SER A 1 48  ? -3.583  8.099   6.255   1.00 0.00 ? 48  SER A C    3  
ATOM 3859  O O    . SER A 1 48  ? -2.557  7.444   6.058   1.00 0.00 ? 48  SER A O    3  
ATOM 3860  C CB   . SER A 1 48  ? -5.289  7.174   7.780   1.00 0.00 ? 48  SER A CB   3  
ATOM 3861  O OG   . SER A 1 48  ? -6.306  6.203   7.943   1.00 0.00 ? 48  SER A OG   3  
ATOM 3862  H H    . SER A 1 48  ? -5.273  5.386   6.233   1.00 0.00 ? 48  SER A H    3  
ATOM 3863  H HA   . SER A 1 48  ? -5.701  8.054   5.843   1.00 0.00 ? 48  SER A HA   3  
ATOM 3864  H HB2  . SER A 1 48  ? -4.397  6.813   8.296   1.00 0.00 ? 48  SER A HB2  3  
ATOM 3865  H HB3  . SER A 1 48  ? -5.594  8.109   8.245   1.00 0.00 ? 48  SER A HB3  3  
ATOM 3866  H HG   . SER A 1 48  ? -6.306  6.004   8.900   1.00 0.00 ? 48  SER A HG   3  
ATOM 3867  N N    . GLN A 1 49  ? -3.572  9.394   6.556   1.00 0.00 ? 49  GLN A N    3  
ATOM 3868  C CA   . GLN A 1 49  ? -2.373  10.220  6.516   1.00 0.00 ? 49  GLN A CA   3  
ATOM 3869  C C    . GLN A 1 49  ? -1.284  9.687   7.438   1.00 0.00 ? 49  GLN A C    3  
ATOM 3870  O O    . GLN A 1 49  ? -0.144  9.525   6.995   1.00 0.00 ? 49  GLN A O    3  
ATOM 3871  C CB   . GLN A 1 49  ? -2.738  11.682  6.819   1.00 0.00 ? 49  GLN A CB   3  
ATOM 3872  C CG   . GLN A 1 49  ? -2.858  12.417  5.485   1.00 0.00 ? 49  GLN A CG   3  
ATOM 3873  C CD   . GLN A 1 49  ? -3.348  13.853  5.588   1.00 0.00 ? 49  GLN A CD   3  
ATOM 3874  O OE1  . GLN A 1 49  ? -4.112  14.290  4.730   1.00 0.00 ? 49  GLN A OE1  3  
ATOM 3875  N NE2  . GLN A 1 49  ? -2.895  14.628  6.563   1.00 0.00 ? 49  GLN A NE2  3  
ATOM 3876  H H    . GLN A 1 49  ? -4.464  9.825   6.776   1.00 0.00 ? 49  GLN A H    3  
ATOM 3877  H HA   . GLN A 1 49  ? -1.963  10.157  5.507   1.00 0.00 ? 49  GLN A HA   3  
ATOM 3878  H HB2  . GLN A 1 49  ? -3.679  11.748  7.365   1.00 0.00 ? 49  GLN A HB2  3  
ATOM 3879  H HB3  . GLN A 1 49  ? -1.954  12.148  7.415   1.00 0.00 ? 49  GLN A HB3  3  
ATOM 3880  H HG2  . GLN A 1 49  ? -1.877  12.425  5.013   1.00 0.00 ? 49  GLN A HG2  3  
ATOM 3881  H HG3  . GLN A 1 49  ? -3.551  11.869  4.843   1.00 0.00 ? 49  GLN A HG3  3  
ATOM 3882  H HE21 . GLN A 1 49  ? -2.282  14.258  7.277   1.00 0.00 ? 49  GLN A HE21 3  
ATOM 3883  H HE22 . GLN A 1 49  ? -3.274  15.556  6.675   1.00 0.00 ? 49  GLN A HE22 3  
ATOM 3884  N N    . GLY A 1 50  ? -1.631  9.376   8.689   1.00 0.00 ? 50  GLY A N    3  
ATOM 3885  C CA   . GLY A 1 50  ? -0.685  8.813   9.637   1.00 0.00 ? 50  GLY A CA   3  
ATOM 3886  C C    . GLY A 1 50  ? -0.274  7.393   9.264   1.00 0.00 ? 50  GLY A C    3  
ATOM 3887  O O    . GLY A 1 50  ? 0.808   6.962   9.655   1.00 0.00 ? 50  GLY A O    3  
ATOM 3888  H H    . GLY A 1 50  ? -2.571  9.575   9.002   1.00 0.00 ? 50  GLY A H    3  
ATOM 3889  H HA2  . GLY A 1 50  ? 0.209   9.434   9.657   1.00 0.00 ? 50  GLY A HA2  3  
ATOM 3890  H HA3  . GLY A 1 50  ? -1.128  8.804   10.633  1.00 0.00 ? 50  GLY A HA3  3  
ATOM 3891  N N    . SER A 1 51  ? -1.099  6.662   8.511   1.00 0.00 ? 51  SER A N    3  
ATOM 3892  C CA   . SER A 1 51  ? -0.744  5.353   7.996   1.00 0.00 ? 51  SER A CA   3  
ATOM 3893  C C    . SER A 1 51  ? 0.295   5.521   6.891   1.00 0.00 ? 51  SER A C    3  
ATOM 3894  O O    . SER A 1 51  ? 1.442   5.135   7.103   1.00 0.00 ? 51  SER A O    3  
ATOM 3895  C CB   . SER A 1 51  ? -1.995  4.589   7.560   1.00 0.00 ? 51  SER A CB   3  
ATOM 3896  O OG   . SER A 1 51  ? -2.833  4.364   8.680   1.00 0.00 ? 51  SER A OG   3  
ATOM 3897  H H    . SER A 1 51  ? -1.930  7.093   8.132   1.00 0.00 ? 51  SER A H    3  
ATOM 3898  H HA   . SER A 1 51  ? -0.278  4.772   8.787   1.00 0.00 ? 51  SER A HA   3  
ATOM 3899  H HB2  . SER A 1 51  ? -2.542  5.157   6.813   1.00 0.00 ? 51  SER A HB2  3  
ATOM 3900  H HB3  . SER A 1 51  ? -1.699  3.631   7.133   1.00 0.00 ? 51  SER A HB3  3  
ATOM 3901  H HG   . SER A 1 51  ? -2.619  3.465   9.025   1.00 0.00 ? 51  SER A HG   3  
ATOM 3902  N N    . VAL A 1 52  ? -0.067  6.096   5.738   1.00 0.00 ? 52  VAL A N    3  
ATOM 3903  C CA   . VAL A 1 52  ? 0.798   6.119   4.570   1.00 0.00 ? 52  VAL A CA   3  
ATOM 3904  C C    . VAL A 1 52  ? 2.123   6.830   4.858   1.00 0.00 ? 52  VAL A C    3  
ATOM 3905  O O    . VAL A 1 52  ? 3.162   6.354   4.408   1.00 0.00 ? 52  VAL A O    3  
ATOM 3906  C CB   . VAL A 1 52  ? 0.022   6.648   3.337   1.00 0.00 ? 52  VAL A CB   3  
ATOM 3907  C CG1  . VAL A 1 52  ? 0.374   8.069   2.876   1.00 0.00 ? 52  VAL A CG1  3  
ATOM 3908  C CG2  . VAL A 1 52  ? 0.215   5.639   2.202   1.00 0.00 ? 52  VAL A CG2  3  
ATOM 3909  H H    . VAL A 1 52  ? -1.003  6.467   5.601   1.00 0.00 ? 52  VAL A H    3  
ATOM 3910  H HA   . VAL A 1 52  ? 1.050   5.076   4.383   1.00 0.00 ? 52  VAL A HA   3  
ATOM 3911  H HB   . VAL A 1 52  ? -1.044  6.644   3.568   1.00 0.00 ? 52  VAL A HB   3  
ATOM 3912  H HG11 . VAL A 1 52  ? -0.267  8.351   2.041   1.00 0.00 ? 52  VAL A HG11 3  
ATOM 3913  H HG12 . VAL A 1 52  ? 0.196   8.774   3.690   1.00 0.00 ? 52  VAL A HG12 3  
ATOM 3914  H HG13 . VAL A 1 52  ? 1.414   8.129   2.555   1.00 0.00 ? 52  VAL A HG13 3  
ATOM 3915  H HG21 . VAL A 1 52  ? 1.272   5.510   1.967   1.00 0.00 ? 52  VAL A HG21 3  
ATOM 3916  H HG22 . VAL A 1 52  ? -0.198  4.695   2.543   1.00 0.00 ? 52  VAL A HG22 3  
ATOM 3917  H HG23 . VAL A 1 52  ? -0.310  5.934   1.296   1.00 0.00 ? 52  VAL A HG23 3  
ATOM 3918  N N    . SER A 1 53  ? 2.115   7.914   5.638   1.00 0.00 ? 53  SER A N    3  
ATOM 3919  C CA   . SER A 1 53  ? 3.324   8.664   5.936   1.00 0.00 ? 53  SER A CA   3  
ATOM 3920  C C    . SER A 1 53  ? 4.317   7.804   6.718   1.00 0.00 ? 53  SER A C    3  
ATOM 3921  O O    . SER A 1 53  ? 5.505   7.790   6.391   1.00 0.00 ? 53  SER A O    3  
ATOM 3922  C CB   . SER A 1 53  ? 2.935   9.899   6.738   1.00 0.00 ? 53  SER A CB   3  
ATOM 3923  O OG   . SER A 1 53  ? 4.003   10.820  6.842   1.00 0.00 ? 53  SER A OG   3  
ATOM 3924  H H    . SER A 1 53  ? 1.231   8.258   5.997   1.00 0.00 ? 53  SER A H    3  
ATOM 3925  H HA   . SER A 1 53  ? 3.780   8.973   4.995   1.00 0.00 ? 53  SER A HA   3  
ATOM 3926  H HB2  . SER A 1 53  ? 2.110   10.390  6.228   1.00 0.00 ? 53  SER A HB2  3  
ATOM 3927  H HB3  . SER A 1 53  ? 2.612   9.573   7.729   1.00 0.00 ? 53  SER A HB3  3  
ATOM 3928  H HG   . SER A 1 53  ? 4.388   10.729  7.743   1.00 0.00 ? 53  SER A HG   3  
ATOM 3929  N N    . ASP A 1 54  ? 3.844   7.102   7.752   1.00 0.00 ? 54  ASP A N    3  
ATOM 3930  C CA   . ASP A 1 54  ? 4.690   6.256   8.586   1.00 0.00 ? 54  ASP A CA   3  
ATOM 3931  C C    . ASP A 1 54  ? 5.221   5.094   7.753   1.00 0.00 ? 54  ASP A C    3  
ATOM 3932  O O    . ASP A 1 54  ? 6.390   4.733   7.883   1.00 0.00 ? 54  ASP A O    3  
ATOM 3933  C CB   . ASP A 1 54  ? 3.897   5.740   9.796   1.00 0.00 ? 54  ASP A CB   3  
ATOM 3934  C CG   . ASP A 1 54  ? 4.774   5.463   11.009  1.00 0.00 ? 54  ASP A CG   3  
ATOM 3935  O OD1  . ASP A 1 54  ? 5.133   6.440   11.705  1.00 0.00 ? 54  ASP A OD1  3  
ATOM 3936  O OD2  . ASP A 1 54  ? 4.973   4.291   11.409  1.00 0.00 ? 54  ASP A OD2  3  
ATOM 3937  H H    . ASP A 1 54  ? 2.846   7.086   7.924   1.00 0.00 ? 54  ASP A H    3  
ATOM 3938  H HA   . ASP A 1 54  ? 5.529   6.851   8.946   1.00 0.00 ? 54  ASP A HA   3  
ATOM 3939  H HB2  . ASP A 1 54  ? 3.194   6.517   10.101  1.00 0.00 ? 54  ASP A HB2  3  
ATOM 3940  H HB3  . ASP A 1 54  ? 3.330   4.854   9.524   1.00 0.00 ? 54  ASP A HB3  3  
ATOM 3941  N N    . MET A 1 55  ? 4.385   4.575   6.845   1.00 0.00 ? 55  MET A N    3  
ATOM 3942  C CA   . MET A 1 55  ? 4.708   3.539   5.883   1.00 0.00 ? 55  MET A CA   3  
ATOM 3943  C C    . MET A 1 55  ? 5.868   3.964   4.989   1.00 0.00 ? 55  MET A C    3  
ATOM 3944  O O    . MET A 1 55  ? 6.891   3.286   4.943   1.00 0.00 ? 55  MET A O    3  
ATOM 3945  C CB   . MET A 1 55  ? 3.447   3.249   5.054   1.00 0.00 ? 55  MET A CB   3  
ATOM 3946  C CG   . MET A 1 55  ? 3.006   1.804   5.147   1.00 0.00 ? 55  MET A CG   3  
ATOM 3947  S SD   . MET A 1 55  ? 2.615   1.174   6.799   1.00 0.00 ? 55  MET A SD   3  
ATOM 3948  C CE   . MET A 1 55  ? 0.830   1.476   6.781   1.00 0.00 ? 55  MET A CE   3  
ATOM 3949  H H    . MET A 1 55  ? 3.437   4.942   6.775   1.00 0.00 ? 55  MET A H    3  
ATOM 3950  H HA   . MET A 1 55  ? 5.009   2.647   6.431   1.00 0.00 ? 55  MET A HA   3  
ATOM 3951  H HB2  . MET A 1 55  ? 2.616   3.859   5.389   1.00 0.00 ? 55  MET A HB2  3  
ATOM 3952  H HB3  . MET A 1 55  ? 3.607   3.486   4.001   1.00 0.00 ? 55  MET A HB3  3  
ATOM 3953  H HG2  . MET A 1 55  ? 2.098   1.775   4.562   1.00 0.00 ? 55  MET A HG2  3  
ATOM 3954  H HG3  . MET A 1 55  ? 3.763   1.172   4.683   1.00 0.00 ? 55  MET A HG3  3  
ATOM 3955  H HE1  . MET A 1 55  ? 0.370   0.993   7.642   1.00 0.00 ? 55  MET A HE1  3  
ATOM 3956  H HE2  . MET A 1 55  ? 0.641   2.548   6.814   1.00 0.00 ? 55  MET A HE2  3  
ATOM 3957  H HE3  . MET A 1 55  ? 0.402   1.060   5.866   1.00 0.00 ? 55  MET A HE3  3  
ATOM 3958  N N    . LEU A 1 56  ? 5.706   5.042   4.222   1.00 0.00 ? 56  LEU A N    3  
ATOM 3959  C CA   . LEU A 1 56  ? 6.741   5.560   3.335   1.00 0.00 ? 56  LEU A CA   3  
ATOM 3960  C C    . LEU A 1 56  ? 7.982   6.054   4.075   1.00 0.00 ? 56  LEU A C    3  
ATOM 3961  O O    . LEU A 1 56  ? 9.047   6.116   3.447   1.00 0.00 ? 56  LEU A O    3  
ATOM 3962  C CB   . LEU A 1 56  ? 6.177   6.707   2.488   1.00 0.00 ? 56  LEU A CB   3  
ATOM 3963  C CG   . LEU A 1 56  ? 5.006   6.326   1.569   1.00 0.00 ? 56  LEU A CG   3  
ATOM 3964  C CD1  . LEU A 1 56  ? 4.698   7.499   0.643   1.00 0.00 ? 56  LEU A CD1  3  
ATOM 3965  C CD2  . LEU A 1 56  ? 5.261   5.064   0.740   1.00 0.00 ? 56  LEU A CD2  3  
ATOM 3966  H H    . LEU A 1 56  ? 4.764   5.414   4.135   1.00 0.00 ? 56  LEU A H    3  
ATOM 3967  H HA   . LEU A 1 56  ? 7.067   4.755   2.677   1.00 0.00 ? 56  LEU A HA   3  
ATOM 3968  H HB2  . LEU A 1 56  ? 5.855   7.509   3.155   1.00 0.00 ? 56  LEU A HB2  3  
ATOM 3969  H HB3  . LEU A 1 56  ? 6.980   7.100   1.871   1.00 0.00 ? 56  LEU A HB3  3  
ATOM 3970  H HG   . LEU A 1 56  ? 4.127   6.144   2.178   1.00 0.00 ? 56  LEU A HG   3  
ATOM 3971  H HD11 . LEU A 1 56  ? 4.814   8.449   1.162   1.00 0.00 ? 56  LEU A HD11 3  
ATOM 3972  H HD12 . LEU A 1 56  ? 5.348   7.469   -0.230  1.00 0.00 ? 56  LEU A HD12 3  
ATOM 3973  H HD13 . LEU A 1 56  ? 3.667   7.418   0.319   1.00 0.00 ? 56  LEU A HD13 3  
ATOM 3974  H HD21 . LEU A 1 56  ? 6.167   5.178   0.142   1.00 0.00 ? 56  LEU A HD21 3  
ATOM 3975  H HD22 . LEU A 1 56  ? 5.346   4.198   1.392   1.00 0.00 ? 56  LEU A HD22 3  
ATOM 3976  H HD23 . LEU A 1 56  ? 4.400   4.892   0.092   1.00 0.00 ? 56  LEU A HD23 3  
ATOM 3977  N N    . SER A 1 57  ? 7.883   6.426   5.351   1.00 0.00 ? 57  SER A N    3  
ATOM 3978  C CA   . SER A 1 57  ? 9.043   6.824   6.138   1.00 0.00 ? 57  SER A CA   3  
ATOM 3979  C C    . SER A 1 57  ? 9.828   5.574   6.551   1.00 0.00 ? 57  SER A C    3  
ATOM 3980  O O    . SER A 1 57  ? 11.014  5.465   6.238   1.00 0.00 ? 57  SER A O    3  
ATOM 3981  C CB   . SER A 1 57  ? 8.593   7.671   7.341   1.00 0.00 ? 57  SER A CB   3  
ATOM 3982  O OG   . SER A 1 57  ? 9.670   8.387   7.927   1.00 0.00 ? 57  SER A OG   3  
ATOM 3983  H H    . SER A 1 57  ? 6.969   6.436   5.797   1.00 0.00 ? 57  SER A H    3  
ATOM 3984  H HA   . SER A 1 57  ? 9.680   7.442   5.503   1.00 0.00 ? 57  SER A HA   3  
ATOM 3985  H HB2  . SER A 1 57  ? 7.860   8.404   7.004   1.00 0.00 ? 57  SER A HB2  3  
ATOM 3986  H HB3  . SER A 1 57  ? 8.124   7.032   8.091   1.00 0.00 ? 57  SER A HB3  3  
ATOM 3987  H HG   . SER A 1 57  ? 9.479   9.342   7.801   1.00 0.00 ? 57  SER A HG   3  
ATOM 3988  N N    . ARG A 1 58  ? 9.167   4.597   7.189   1.00 0.00 ? 58  ARG A N    3  
ATOM 3989  C CA   . ARG A 1 58  ? 9.791   3.411   7.770   1.00 0.00 ? 58  ARG A CA   3  
ATOM 3990  C C    . ARG A 1 58  ? 8.987   2.158   7.385   1.00 0.00 ? 58  ARG A C    3  
ATOM 3991  O O    . ARG A 1 58  ? 8.288   1.593   8.236   1.00 0.00 ? 58  ARG A O    3  
ATOM 3992  C CB   . ARG A 1 58  ? 9.989   3.600   9.294   1.00 0.00 ? 58  ARG A CB   3  
ATOM 3993  C CG   . ARG A 1 58  ? 8.743   4.052   10.078  1.00 0.00 ? 58  ARG A CG   3  
ATOM 3994  C CD   . ARG A 1 58  ? 8.987   4.051   11.591  1.00 0.00 ? 58  ARG A CD   3  
ATOM 3995  N NE   . ARG A 1 58  ? 7.736   4.354   12.296  1.00 0.00 ? 58  ARG A NE   3  
ATOM 3996  C CZ   . ARG A 1 58  ? 7.499   4.299   13.608  1.00 0.00 ? 58  ARG A CZ   3  
ATOM 3997  N NH1  . ARG A 1 58  ? 8.455   4.036   14.495  1.00 0.00 ? 58  ARG A NH1  3  
ATOM 3998  N NH2  . ARG A 1 58  ? 6.261   4.510   14.021  1.00 0.00 ? 58  ARG A NH2  3  
ATOM 3999  H H    . ARG A 1 58  ? 8.164   4.689   7.329   1.00 0.00 ? 58  ARG A H    3  
ATOM 4000  H HA   . ARG A 1 58  ? 10.787  3.294   7.346   1.00 0.00 ? 58  ARG A HA   3  
ATOM 4001  H HB2  . ARG A 1 58  ? 10.355  2.662   9.714   1.00 0.00 ? 58  ARG A HB2  3  
ATOM 4002  H HB3  . ARG A 1 58  ? 10.765  4.350   9.448   1.00 0.00 ? 58  ARG A HB3  3  
ATOM 4003  H HG2  . ARG A 1 58  ? 8.465   5.061   9.770   1.00 0.00 ? 58  ARG A HG2  3  
ATOM 4004  H HG3  . ARG A 1 58  ? 7.906   3.388   9.869   1.00 0.00 ? 58  ARG A HG3  3  
ATOM 4005  H HD2  . ARG A 1 58  ? 9.339   3.065   11.897  1.00 0.00 ? 58  ARG A HD2  3  
ATOM 4006  H HD3  . ARG A 1 58  ? 9.740   4.798   11.843  1.00 0.00 ? 58  ARG A HD3  3  
ATOM 4007  H HE   . ARG A 1 58  ? 6.921   4.508   11.703  1.00 0.00 ? 58  ARG A HE   3  
ATOM 4008  H HH11 . ARG A 1 58  ? 9.422   3.897   14.213  1.00 0.00 ? 58  ARG A HH11 3  
ATOM 4009  H HH12 . ARG A 1 58  ? 8.225   3.838   15.466  1.00 0.00 ? 58  ARG A HH12 3  
ATOM 4010  H HH21 . ARG A 1 58  ? 5.525   4.671   13.334  1.00 0.00 ? 58  ARG A HH21 3  
ATOM 4011  H HH22 . ARG A 1 58  ? 6.033   4.443   15.011  1.00 0.00 ? 58  ARG A HH22 3  
ATOM 4012  N N    . PRO A 1 59  ? 9.070   1.694   6.127   1.00 0.00 ? 59  PRO A N    3  
ATOM 4013  C CA   . PRO A 1 59  ? 8.378   0.480   5.721   1.00 0.00 ? 59  PRO A CA   3  
ATOM 4014  C C    . PRO A 1 59  ? 8.982   -0.724  6.441   1.00 0.00 ? 59  PRO A C    3  
ATOM 4015  O O    . PRO A 1 59  ? 10.099  -0.663  6.967   1.00 0.00 ? 59  PRO A O    3  
ATOM 4016  C CB   . PRO A 1 59  ? 8.507   0.385   4.200   1.00 0.00 ? 59  PRO A CB   3  
ATOM 4017  C CG   . PRO A 1 59  ? 9.658   1.318   3.835   1.00 0.00 ? 59  PRO A CG   3  
ATOM 4018  C CD   . PRO A 1 59  ? 9.849   2.251   5.030   1.00 0.00 ? 59  PRO A CD   3  
ATOM 4019  H HA   . PRO A 1 59  ? 7.321   0.562   5.983   1.00 0.00 ? 59  PRO A HA   3  
ATOM 4020  H HB2  . PRO A 1 59  ? 8.705   -0.636  3.867   1.00 0.00 ? 59  PRO A HB2  3  
ATOM 4021  H HB3  . PRO A 1 59  ? 7.593   0.749   3.741   1.00 0.00 ? 59  PRO A HB3  3  
ATOM 4022  H HG2  . PRO A 1 59  ? 10.550  0.728   3.673   1.00 0.00 ? 59  PRO A HG2  3  
ATOM 4023  H HG3  . PRO A 1 59  ? 9.441   1.883   2.933   1.00 0.00 ? 59  PRO A HG3  3  
ATOM 4024  H HD2  . PRO A 1 59  ? 10.905  2.303   5.295   1.00 0.00 ? 59  PRO A HD2  3  
ATOM 4025  H HD3  . PRO A 1 59  ? 9.480   3.246   4.782   1.00 0.00 ? 59  PRO A HD3  3  
ATOM 4026  N N    . LYS A 1 60  ? 8.237   -1.827  6.468   1.00 0.00 ? 60  LYS A N    3  
ATOM 4027  C CA   . LYS A 1 60  ? 8.658   -3.100  7.044   1.00 0.00 ? 60  LYS A CA   3  
ATOM 4028  C C    . LYS A 1 60  ? 8.815   -4.131  5.927   1.00 0.00 ? 60  LYS A C    3  
ATOM 4029  O O    . LYS A 1 60  ? 8.234   -3.931  4.853   1.00 0.00 ? 60  LYS A O    3  
ATOM 4030  C CB   . LYS A 1 60  ? 7.669   -3.482  8.162   1.00 0.00 ? 60  LYS A CB   3  
ATOM 4031  C CG   . LYS A 1 60  ? 7.955   -2.612  9.405   1.00 0.00 ? 60  LYS A CG   3  
ATOM 4032  C CD   . LYS A 1 60  ? 8.207   -3.417  10.683  1.00 0.00 ? 60  LYS A CD   3  
ATOM 4033  C CE   . LYS A 1 60  ? 6.963   -4.074  11.296  1.00 0.00 ? 60  LYS A CE   3  
ATOM 4034  N NZ   . LYS A 1 60  ? 5.976   -3.078  11.753  1.00 0.00 ? 60  LYS A NZ   3  
ATOM 4035  H H    . LYS A 1 60  ? 7.388   -1.864  5.923   1.00 0.00 ? 60  LYS A H    3  
ATOM 4036  H HA   . LYS A 1 60  ? 9.649   -2.985  7.484   1.00 0.00 ? 60  LYS A HA   3  
ATOM 4037  H HB2  . LYS A 1 60  ? 6.642   -3.323  7.826   1.00 0.00 ? 60  LYS A HB2  3  
ATOM 4038  H HB3  . LYS A 1 60  ? 7.768   -4.538  8.409   1.00 0.00 ? 60  LYS A HB3  3  
ATOM 4039  H HG2  . LYS A 1 60  ? 8.853   -2.019  9.238   1.00 0.00 ? 60  LYS A HG2  3  
ATOM 4040  H HG3  . LYS A 1 60  ? 7.146   -1.903  9.559   1.00 0.00 ? 60  LYS A HG3  3  
ATOM 4041  H HD2  . LYS A 1 60  ? 8.944   -4.187  10.451  1.00 0.00 ? 60  LYS A HD2  3  
ATOM 4042  H HD3  . LYS A 1 60  ? 8.654   -2.758  11.429  1.00 0.00 ? 60  LYS A HD3  3  
ATOM 4043  H HE2  . LYS A 1 60  ? 6.500   -4.747  10.572  1.00 0.00 ? 60  LYS A HE2  3  
ATOM 4044  H HE3  . LYS A 1 60  ? 7.283   -4.667  12.156  1.00 0.00 ? 60  LYS A HE3  3  
ATOM 4045  H HZ1  . LYS A 1 60  ? 5.495   -2.680  10.952  1.00 0.00 ? 60  LYS A HZ1  3  
ATOM 4046  H HZ2  . LYS A 1 60  ? 5.283   -3.518  12.355  1.00 0.00 ? 60  LYS A HZ2  3  
ATOM 4047  H HZ3  . LYS A 1 60  ? 6.428   -2.318  12.254  1.00 0.00 ? 60  LYS A HZ3  3  
ATOM 4048  N N    . PRO A 1 61  ? 9.588   -5.208  6.139   1.00 0.00 ? 61  PRO A N    3  
ATOM 4049  C CA   . PRO A 1 61  ? 9.826   -6.200  5.102   1.00 0.00 ? 61  PRO A CA   3  
ATOM 4050  C C    . PRO A 1 61  ? 8.526   -6.959  4.839   1.00 0.00 ? 61  PRO A C    3  
ATOM 4051  O O    . PRO A 1 61  ? 7.745   -7.196  5.764   1.00 0.00 ? 61  PRO A O    3  
ATOM 4052  C CB   . PRO A 1 61  ? 10.940  -7.102  5.642   1.00 0.00 ? 61  PRO A CB   3  
ATOM 4053  C CG   . PRO A 1 61  ? 10.724  -7.025  7.146   1.00 0.00 ? 61  PRO A CG   3  
ATOM 4054  C CD   . PRO A 1 61  ? 10.279  -5.581  7.365   1.00 0.00 ? 61  PRO A CD   3  
ATOM 4055  H HA   . PRO A 1 61  ? 10.169  -5.721  4.186   1.00 0.00 ? 61  PRO A HA   3  
ATOM 4056  H HB2  . PRO A 1 61  ? 10.860  -8.127  5.280   1.00 0.00 ? 61  PRO A HB2  3  
ATOM 4057  H HB3  . PRO A 1 61  ? 11.912  -6.681  5.383   1.00 0.00 ? 61  PRO A HB3  3  
ATOM 4058  H HG2  . PRO A 1 61  ? 9.918   -7.706  7.396   1.00 0.00 ? 61  PRO A HG2  3  
ATOM 4059  H HG3  . PRO A 1 61  ? 11.609  -7.270  7.726   1.00 0.00 ? 61  PRO A HG3  3  
ATOM 4060  H HD2  . PRO A 1 61  ? 9.633   -5.526  8.237   1.00 0.00 ? 61  PRO A HD2  3  
ATOM 4061  H HD3  . PRO A 1 61  ? 11.147  -4.940  7.507   1.00 0.00 ? 61  PRO A HD3  3  
ATOM 4062  N N    . TRP A 1 62  ? 8.321   -7.393  3.598   1.00 0.00 ? 62  TRP A N    3  
ATOM 4063  C CA   . TRP A 1 62  ? 7.181   -8.184  3.155   1.00 0.00 ? 62  TRP A CA   3  
ATOM 4064  C C    . TRP A 1 62  ? 6.990   -9.413  4.045   1.00 0.00 ? 62  TRP A C    3  
ATOM 4065  O O    . TRP A 1 62  ? 5.858   -9.765  4.386   1.00 0.00 ? 62  TRP A O    3  
ATOM 4066  C CB   . TRP A 1 62  ? 7.425   -8.597  1.702   1.00 0.00 ? 62  TRP A CB   3  
ATOM 4067  C CG   . TRP A 1 62  ? 6.326   -9.370  1.052   1.00 0.00 ? 62  TRP A CG   3  
ATOM 4068  C CD1  . TRP A 1 62  ? 6.280   -10.716 0.962   1.00 0.00 ? 62  TRP A CD1  3  
ATOM 4069  C CD2  . TRP A 1 62  ? 5.172   -8.876  0.309   1.00 0.00 ? 62  TRP A CD2  3  
ATOM 4070  N NE1  . TRP A 1 62  ? 5.223   -11.085 0.161   1.00 0.00 ? 62  TRP A NE1  3  
ATOM 4071  C CE2  . TRP A 1 62  ? 4.538   -9.989  -0.315  1.00 0.00 ? 62  TRP A CE2  3  
ATOM 4072  C CE3  . TRP A 1 62  ? 4.629   -7.598  0.052   1.00 0.00 ? 62  TRP A CE3  3  
ATOM 4073  C CZ2  . TRP A 1 62  ? 3.467   -9.838  -1.206  1.00 0.00 ? 62  TRP A CZ2  3  
ATOM 4074  C CZ3  . TRP A 1 62  ? 3.533   -7.436  -0.817  1.00 0.00 ? 62  TRP A CZ3  3  
ATOM 4075  C CH2  . TRP A 1 62  ? 2.967   -8.553  -1.461  1.00 0.00 ? 62  TRP A CH2  3  
ATOM 4076  H H    . TRP A 1 62  ? 9.107   -7.323  2.955   1.00 0.00 ? 62  TRP A H    3  
ATOM 4077  H HA   . TRP A 1 62  ? 6.288   -7.567  3.206   1.00 0.00 ? 62  TRP A HA   3  
ATOM 4078  H HB2  . TRP A 1 62  ? 7.615   -7.709  1.100   1.00 0.00 ? 62  TRP A HB2  3  
ATOM 4079  H HB3  . TRP A 1 62  ? 8.331   -9.204  1.662   1.00 0.00 ? 62  TRP A HB3  3  
ATOM 4080  H HD1  . TRP A 1 62  ? 7.026   -11.403 1.350   1.00 0.00 ? 62  TRP A HD1  3  
ATOM 4081  H HE1  . TRP A 1 62  ? 5.142   -12.039 -0.194  1.00 0.00 ? 62  TRP A HE1  3  
ATOM 4082  H HE3  . TRP A 1 62  ? 5.096   -6.730  0.495   1.00 0.00 ? 62  TRP A HE3  3  
ATOM 4083  H HZ2  . TRP A 1 62  ? 3.044   -10.703 -1.698  1.00 0.00 ? 62  TRP A HZ2  3  
ATOM 4084  H HZ3  . TRP A 1 62  ? 3.147   -6.445  -1.011  1.00 0.00 ? 62  TRP A HZ3  3  
ATOM 4085  H HH2  . TRP A 1 62  ? 2.152   -8.441  -2.158  1.00 0.00 ? 62  TRP A HH2  3  
ATOM 4086  N N    . SER A 1 63  ? 8.087   -10.033 4.476   1.00 0.00 ? 63  SER A N    3  
ATOM 4087  C CA   . SER A 1 63  ? 8.110   -11.190 5.355   1.00 0.00 ? 63  SER A CA   3  
ATOM 4088  C C    . SER A 1 63  ? 7.418   -10.913 6.698   1.00 0.00 ? 63  SER A C    3  
ATOM 4089  O O    . SER A 1 63  ? 6.694   -11.767 7.207   1.00 0.00 ? 63  SER A O    3  
ATOM 4090  C CB   . SER A 1 63  ? 9.574   -11.600 5.557   1.00 0.00 ? 63  SER A CB   3  
ATOM 4091  O OG   . SER A 1 63  ? 10.287  -11.481 4.335   1.00 0.00 ? 63  SER A OG   3  
ATOM 4092  H H    . SER A 1 63  ? 8.992   -9.765  4.097   1.00 0.00 ? 63  SER A H    3  
ATOM 4093  H HA   . SER A 1 63  ? 7.587   -12.006 4.855   1.00 0.00 ? 63  SER A HA   3  
ATOM 4094  H HB2  . SER A 1 63  ? 10.033  -10.936 6.289   1.00 0.00 ? 63  SER A HB2  3  
ATOM 4095  H HB3  . SER A 1 63  ? 9.614   -12.620 5.933   1.00 0.00 ? 63  SER A HB3  3  
ATOM 4096  H HG   . SER A 1 63  ? 10.758  -12.303 4.142   1.00 0.00 ? 63  SER A HG   3  
ATOM 4097  N N    . LYS A 1 64  ? 7.587   -9.713  7.267   1.00 0.00 ? 64  LYS A N    3  
ATOM 4098  C CA   . LYS A 1 64  ? 6.929   -9.285  8.510   1.00 0.00 ? 64  LYS A CA   3  
ATOM 4099  C C    . LYS A 1 64  ? 5.456   -8.932  8.302   1.00 0.00 ? 64  LYS A C    3  
ATOM 4100  O O    . LYS A 1 64  ? 4.759   -8.718  9.296   1.00 0.00 ? 64  LYS A O    3  
ATOM 4101  C CB   . LYS A 1 64  ? 7.645   -8.051  9.086   1.00 0.00 ? 64  LYS A CB   3  
ATOM 4102  C CG   . LYS A 1 64  ? 8.979   -8.362  9.784   1.00 0.00 ? 64  LYS A CG   3  
ATOM 4103  C CD   . LYS A 1 64  ? 8.810   -8.801  11.240  1.00 0.00 ? 64  LYS A CD   3  
ATOM 4104  C CE   . LYS A 1 64  ? 8.822   -10.310 11.451  1.00 0.00 ? 64  LYS A CE   3  
ATOM 4105  N NZ   . LYS A 1 64  ? 8.437   -10.622 12.838  1.00 0.00 ? 64  LYS A NZ   3  
ATOM 4106  H H    . LYS A 1 64  ? 8.097   -9.021  6.730   1.00 0.00 ? 64  LYS A H    3  
ATOM 4107  H HA   . LYS A 1 64  ? 6.973   -10.091 9.244   1.00 0.00 ? 64  LYS A HA   3  
ATOM 4108  H HB2  . LYS A 1 64  ? 7.821   -7.338  8.284   1.00 0.00 ? 64  LYS A HB2  3  
ATOM 4109  H HB3  . LYS A 1 64  ? 6.994   -7.541  9.799   1.00 0.00 ? 64  LYS A HB3  3  
ATOM 4110  H HG2  . LYS A 1 64  ? 9.553   -9.105  9.227   1.00 0.00 ? 64  LYS A HG2  3  
ATOM 4111  H HG3  . LYS A 1 64  ? 9.551   -7.436  9.799   1.00 0.00 ? 64  LYS A HG3  3  
ATOM 4112  H HD2  . LYS A 1 64  ? 9.648   -8.397  11.802  1.00 0.00 ? 64  LYS A HD2  3  
ATOM 4113  H HD3  . LYS A 1 64  ? 7.892   -8.379  11.647  1.00 0.00 ? 64  LYS A HD3  3  
ATOM 4114  H HE2  . LYS A 1 64  ? 8.122   -10.795 10.769  1.00 0.00 ? 64  LYS A HE2  3  
ATOM 4115  H HE3  . LYS A 1 64  ? 9.830   -10.683 11.255  1.00 0.00 ? 64  LYS A HE3  3  
ATOM 4116  H HZ1  . LYS A 1 64  ? 8.972   -10.064 13.496  1.00 0.00 ? 64  LYS A HZ1  3  
ATOM 4117  H HZ2  . LYS A 1 64  ? 7.447   -10.424 12.958  1.00 0.00 ? 64  LYS A HZ2  3  
ATOM 4118  H HZ3  . LYS A 1 64  ? 8.590   -11.603 13.036  1.00 0.00 ? 64  LYS A HZ3  3  
ATOM 4119  N N    . LEU A 1 65  ? 4.975   -8.785  7.067   1.00 0.00 ? 65  LEU A N    3  
ATOM 4120  C CA   . LEU A 1 65  ? 3.587   -8.427  6.792   1.00 0.00 ? 65  LEU A CA   3  
ATOM 4121  C C    . LEU A 1 65  ? 2.769   -9.710  6.655   1.00 0.00 ? 65  LEU A C    3  
ATOM 4122  O O    . LEU A 1 65  ? 3.282   -10.720 6.178   1.00 0.00 ? 65  LEU A O    3  
ATOM 4123  C CB   . LEU A 1 65  ? 3.489   -7.613  5.493   1.00 0.00 ? 65  LEU A CB   3  
ATOM 4124  C CG   . LEU A 1 65  ? 4.336   -6.332  5.419   1.00 0.00 ? 65  LEU A CG   3  
ATOM 4125  C CD1  . LEU A 1 65  ? 4.148   -5.683  4.046   1.00 0.00 ? 65  LEU A CD1  3  
ATOM 4126  C CD2  . LEU A 1 65  ? 3.981   -5.330  6.520   1.00 0.00 ? 65  LEU A CD2  3  
ATOM 4127  H H    . LEU A 1 65  ? 5.555   -9.021  6.272   1.00 0.00 ? 65  LEU A H    3  
ATOM 4128  H HA   . LEU A 1 65  ? 3.187   -7.830  7.612   1.00 0.00 ? 65  LEU A HA   3  
ATOM 4129  H HB2  . LEU A 1 65  ? 3.799   -8.261  4.676   1.00 0.00 ? 65  LEU A HB2  3  
ATOM 4130  H HB3  . LEU A 1 65  ? 2.444   -7.349  5.341   1.00 0.00 ? 65  LEU A HB3  3  
ATOM 4131  H HG   . LEU A 1 65  ? 5.382   -6.595  5.519   1.00 0.00 ? 65  LEU A HG   3  
ATOM 4132  H HD11 . LEU A 1 65  ? 3.122   -5.335  3.937   1.00 0.00 ? 65  LEU A HD11 3  
ATOM 4133  H HD12 . LEU A 1 65  ? 4.829   -4.836  3.947   1.00 0.00 ? 65  LEU A HD12 3  
ATOM 4134  H HD13 . LEU A 1 65  ? 4.369   -6.396  3.253   1.00 0.00 ? 65  LEU A HD13 3  
ATOM 4135  H HD21 . LEU A 1 65  ? 2.918   -5.101  6.480   1.00 0.00 ? 65  LEU A HD21 3  
ATOM 4136  H HD22 . LEU A 1 65  ? 4.228   -5.738  7.499   1.00 0.00 ? 65  LEU A HD22 3  
ATOM 4137  H HD23 . LEU A 1 65  ? 4.551   -4.411  6.377   1.00 0.00 ? 65  LEU A HD23 3  
ATOM 4138  N N    . THR A 1 66  ? 1.491   -9.664  7.020   1.00 0.00 ? 66  THR A N    3  
ATOM 4139  C CA   . THR A 1 66  ? 0.502   -10.687 6.670   1.00 0.00 ? 66  THR A CA   3  
ATOM 4140  C C    . THR A 1 66  ? -0.105  -10.336 5.304   1.00 0.00 ? 66  THR A C    3  
ATOM 4141  O O    . THR A 1 66  ? 0.179   -9.256  4.790   1.00 0.00 ? 66  THR A O    3  
ATOM 4142  C CB   . THR A 1 66  ? -0.566  -10.754 7.775   1.00 0.00 ? 66  THR A CB   3  
ATOM 4143  O OG1  . THR A 1 66  ? -1.210  -9.502  7.967   1.00 0.00 ? 66  THR A OG1  3  
ATOM 4144  C CG2  . THR A 1 66  ? 0.031   -11.194 9.113   1.00 0.00 ? 66  THR A CG2  3  
ATOM 4145  H H    . THR A 1 66  ? 1.120   -8.797  7.393   1.00 0.00 ? 66  THR A H    3  
ATOM 4146  H HA   . THR A 1 66  ? 0.993   -11.658 6.586   1.00 0.00 ? 66  THR A HA   3  
ATOM 4147  H HB   . THR A 1 66  ? -1.312  -11.490 7.483   1.00 0.00 ? 66  THR A HB   3  
ATOM 4148  H HG1  . THR A 1 66  ? -0.562  -8.880  8.361   1.00 0.00 ? 66  THR A HG1  3  
ATOM 4149  H HG21 . THR A 1 66  ? -0.746  -11.211 9.875   1.00 0.00 ? 66  THR A HG21 3  
ATOM 4150  H HG22 . THR A 1 66  ? 0.442   -12.199 9.009   1.00 0.00 ? 66  THR A HG22 3  
ATOM 4151  H HG23 . THR A 1 66  ? 0.806   -10.500 9.435   1.00 0.00 ? 66  THR A HG23 3  
ATOM 4152  N N    . GLN A 1 67  ? -0.983  -11.160 4.720   1.00 0.00 ? 67  GLN A N    3  
ATOM 4153  C CA   . GLN A 1 67  ? -1.733  -10.757 3.523   1.00 0.00 ? 67  GLN A CA   3  
ATOM 4154  C C    . GLN A 1 67  ? -2.487  -9.441  3.784   1.00 0.00 ? 67  GLN A C    3  
ATOM 4155  O O    . GLN A 1 67  ? -2.422  -8.524  2.963   1.00 0.00 ? 67  GLN A O    3  
ATOM 4156  C CB   . GLN A 1 67  ? -2.694  -11.866 3.076   1.00 0.00 ? 67  GLN A CB   3  
ATOM 4157  C CG   . GLN A 1 67  ? -1.997  -13.103 2.494   1.00 0.00 ? 67  GLN A CG   3  
ATOM 4158  C CD   . GLN A 1 67  ? -2.915  -14.315 2.600   1.00 0.00 ? 67  GLN A CD   3  
ATOM 4159  O OE1  . GLN A 1 67  ? -3.022  -14.891 3.679   1.00 0.00 ? 67  GLN A OE1  3  
ATOM 4160  N NE2  . GLN A 1 67  ? -3.591  -14.707 1.536   1.00 0.00 ? 67  GLN A NE2  3  
ATOM 4161  H H    . GLN A 1 67  ? -1.232  -12.037 5.165   1.00 0.00 ? 67  GLN A H    3  
ATOM 4162  H HA   . GLN A 1 67  ? -1.027  -10.578 2.713   1.00 0.00 ? 67  GLN A HA   3  
ATOM 4163  H HB2  . GLN A 1 67  ? -3.308  -12.161 3.923   1.00 0.00 ? 67  GLN A HB2  3  
ATOM 4164  H HB3  . GLN A 1 67  ? -3.354  -11.475 2.306   1.00 0.00 ? 67  GLN A HB3  3  
ATOM 4165  H HG2  . GLN A 1 67  ? -1.731  -12.917 1.454   1.00 0.00 ? 67  GLN A HG2  3  
ATOM 4166  H HG3  . GLN A 1 67  ? -1.085  -13.318 3.053   1.00 0.00 ? 67  GLN A HG3  3  
ATOM 4167  H HE21 . GLN A 1 67  ? -3.562  -14.230 0.647   1.00 0.00 ? 67  GLN A HE21 3  
ATOM 4168  H HE22 . GLN A 1 67  ? -4.215  -15.503 1.657   1.00 0.00 ? 67  GLN A HE22 3  
ATOM 4169  N N    . LYS A 1 68  ? -3.114  -9.298  4.959   1.00 0.00 ? 68  LYS A N    3  
ATOM 4170  C CA   . LYS A 1 68  ? -3.781  -8.069  5.404   1.00 0.00 ? 68  LYS A CA   3  
ATOM 4171  C C    . LYS A 1 68  ? -2.817  -6.881  5.416   1.00 0.00 ? 68  LYS A C    3  
ATOM 4172  O O    . LYS A 1 68  ? -3.227  -5.767  5.098   1.00 0.00 ? 68  LYS A O    3  
ATOM 4173  C CB   . LYS A 1 68  ? -4.385  -8.288  6.811   1.00 0.00 ? 68  LYS A CB   3  
ATOM 4174  C CG   . LYS A 1 68  ? -5.914  -8.223  6.938   1.00 0.00 ? 68  LYS A CG   3  
ATOM 4175  C CD   . LYS A 1 68  ? -6.598  -6.912  6.525   1.00 0.00 ? 68  LYS A CD   3  
ATOM 4176  C CE   . LYS A 1 68  ? -6.358  -5.710  7.450   1.00 0.00 ? 68  LYS A CE   3  
ATOM 4177  N NZ   . LYS A 1 68  ? -5.070  -5.030  7.207   1.00 0.00 ? 68  LYS A NZ   3  
ATOM 4178  H H    . LYS A 1 68  ? -3.181  -10.120 5.551   1.00 0.00 ? 68  LYS A H    3  
ATOM 4179  H HA   . LYS A 1 68  ? -4.576  -7.844  4.691   1.00 0.00 ? 68  LYS A HA   3  
ATOM 4180  H HB2  . LYS A 1 68  ? -4.087  -9.268  7.171   1.00 0.00 ? 68  LYS A HB2  3  
ATOM 4181  H HB3  . LYS A 1 68  ? -3.959  -7.576  7.507   1.00 0.00 ? 68  LYS A HB3  3  
ATOM 4182  H HG2  . LYS A 1 68  ? -6.342  -9.024  6.341   1.00 0.00 ? 68  LYS A HG2  3  
ATOM 4183  H HG3  . LYS A 1 68  ? -6.173  -8.431  7.975   1.00 0.00 ? 68  LYS A HG3  3  
ATOM 4184  H HD2  . LYS A 1 68  ? -6.339  -6.663  5.499   1.00 0.00 ? 68  LYS A HD2  3  
ATOM 4185  H HD3  . LYS A 1 68  ? -7.670  -7.105  6.535   1.00 0.00 ? 68  LYS A HD3  3  
ATOM 4186  H HE2  . LYS A 1 68  ? -7.155  -4.990  7.255   1.00 0.00 ? 68  LYS A HE2  3  
ATOM 4187  H HE3  . LYS A 1 68  ? -6.439  -6.024  8.493   1.00 0.00 ? 68  LYS A HE3  3  
ATOM 4188  H HZ1  . LYS A 1 68  ? -4.931  -4.905  6.205   1.00 0.00 ? 68  LYS A HZ1  3  
ATOM 4189  H HZ2  . LYS A 1 68  ? -5.082  -4.102  7.619   1.00 0.00 ? 68  LYS A HZ2  3  
ATOM 4190  H HZ3  . LYS A 1 68  ? -4.286  -5.544  7.594   1.00 0.00 ? 68  LYS A HZ3  3  
ATOM 4191  N N    . GLY A 1 69  ? -1.558  -7.096  5.801   1.00 0.00 ? 69  GLY A N    3  
ATOM 4192  C CA   . GLY A 1 69  ? -0.543  -6.050  5.853   1.00 0.00 ? 69  GLY A CA   3  
ATOM 4193  C C    . GLY A 1 69  ? 0.070   -5.752  4.483   1.00 0.00 ? 69  GLY A C    3  
ATOM 4194  O O    . GLY A 1 69  ? 0.546   -4.643  4.254   1.00 0.00 ? 69  GLY A O    3  
ATOM 4195  H H    . GLY A 1 69  ? -1.298  -8.036  6.065   1.00 0.00 ? 69  GLY A H    3  
ATOM 4196  H HA2  . GLY A 1 69  ? -0.982  -5.138  6.255   1.00 0.00 ? 69  GLY A HA2  3  
ATOM 4197  H HA3  . GLY A 1 69  ? 0.253   -6.362  6.528   1.00 0.00 ? 69  GLY A HA3  3  
ATOM 4198  N N    . ARG A 1 70  ? 0.088   -6.731  3.572   1.00 0.00 ? 70  ARG A N    3  
ATOM 4199  C CA   . ARG A 1 70  ? 0.622   -6.615  2.212   1.00 0.00 ? 70  ARG A CA   3  
ATOM 4200  C C    . ARG A 1 70  ? -0.352  -5.880  1.304   1.00 0.00 ? 70  ARG A C    3  
ATOM 4201  O O    . ARG A 1 70  ? 0.079   -5.228  0.361   1.00 0.00 ? 70  ARG A O    3  
ATOM 4202  C CB   . ARG A 1 70  ? 0.895   -8.020  1.645   1.00 0.00 ? 70  ARG A CB   3  
ATOM 4203  C CG   . ARG A 1 70  ? 2.096   -8.670  2.342   1.00 0.00 ? 70  ARG A CG   3  
ATOM 4204  C CD   . ARG A 1 70  ? 2.190   -10.181 2.136   1.00 0.00 ? 70  ARG A CD   3  
ATOM 4205  N NE   . ARG A 1 70  ? 3.341   -10.722 2.875   1.00 0.00 ? 70  ARG A NE   3  
ATOM 4206  C CZ   . ARG A 1 70  ? 3.559   -12.005 3.175   1.00 0.00 ? 70  ARG A CZ   3  
ATOM 4207  N NH1  . ARG A 1 70  ? 2.760   -12.956 2.706   1.00 0.00 ? 70  ARG A NH1  3  
ATOM 4208  N NH2  . ARG A 1 70  ? 4.581   -12.300 3.965   1.00 0.00 ? 70  ARG A NH2  3  
ATOM 4209  H H    . ARG A 1 70  ? -0.271  -7.639  3.853   1.00 0.00 ? 70  ARG A H    3  
ATOM 4210  H HA   . ARG A 1 70  ? 1.553   -6.047  2.232   1.00 0.00 ? 70  ARG A HA   3  
ATOM 4211  H HB2  . ARG A 1 70  ? 0.009   -8.642  1.773   1.00 0.00 ? 70  ARG A HB2  3  
ATOM 4212  H HB3  . ARG A 1 70  ? 1.106   -7.949  0.578   1.00 0.00 ? 70  ARG A HB3  3  
ATOM 4213  H HG2  . ARG A 1 70  ? 3.010   -8.191  2.004   1.00 0.00 ? 70  ARG A HG2  3  
ATOM 4214  H HG3  . ARG A 1 70  ? 2.017   -8.496  3.405   1.00 0.00 ? 70  ARG A HG3  3  
ATOM 4215  H HD2  . ARG A 1 70  ? 1.279   -10.647 2.509   1.00 0.00 ? 70  ARG A HD2  3  
ATOM 4216  H HD3  . ARG A 1 70  ? 2.288   -10.410 1.076   1.00 0.00 ? 70  ARG A HD3  3  
ATOM 4217  H HE   . ARG A 1 70  ? 4.026   -10.056 3.212   1.00 0.00 ? 70  ARG A HE   3  
ATOM 4218  H HH11 . ARG A 1 70  ? 2.058   -12.753 1.992   1.00 0.00 ? 70  ARG A HH11 3  
ATOM 4219  H HH12 . ARG A 1 70  ? 2.769   -13.911 3.055   1.00 0.00 ? 70  ARG A HH12 3  
ATOM 4220  H HH21 . ARG A 1 70  ? 5.095   -11.533 4.389   1.00 0.00 ? 70  ARG A HH21 3  
ATOM 4221  H HH22 . ARG A 1 70  ? 4.876   -13.248 4.187   1.00 0.00 ? 70  ARG A HH22 3  
ATOM 4222  N N    . GLU A 1 71  ? -1.644  -5.950  1.601   1.00 0.00 ? 71  GLU A N    3  
ATOM 4223  C CA   . GLU A 1 71  ? -2.750  -5.397  0.837   1.00 0.00 ? 71  GLU A CA   3  
ATOM 4224  C C    . GLU A 1 71  ? -2.505  -3.961  0.309   1.00 0.00 ? 71  GLU A C    3  
ATOM 4225  O O    . GLU A 1 71  ? -2.659  -3.744  -0.899  1.00 0.00 ? 71  GLU A O    3  
ATOM 4226  C CB   . GLU A 1 71  ? -3.994  -5.545  1.711   1.00 0.00 ? 71  GLU A CB   3  
ATOM 4227  C CG   . GLU A 1 71  ? -5.240  -5.909  0.915   1.00 0.00 ? 71  GLU A CG   3  
ATOM 4228  C CD   . GLU A 1 71  ? -6.449  -5.581  1.790   1.00 0.00 ? 71  GLU A CD   3  
ATOM 4229  O OE1  . GLU A 1 71  ? -6.607  -6.233  2.850   1.00 0.00 ? 71  GLU A OE1  3  
ATOM 4230  O OE2  . GLU A 1 71  ? -7.122  -4.556  1.542   1.00 0.00 ? 71  GLU A OE2  3  
ATOM 4231  H H    . GLU A 1 71  ? -1.925  -6.518  2.388   1.00 0.00 ? 71  GLU A H    3  
ATOM 4232  H HA   . GLU A 1 71  ? -2.903  -6.036  -0.029  1.00 0.00 ? 71  GLU A HA   3  
ATOM 4233  H HB2  . GLU A 1 71  ? -3.845  -6.329  2.455   1.00 0.00 ? 71  GLU A HB2  3  
ATOM 4234  H HB3  . GLU A 1 71  ? -4.165  -4.628  2.261   1.00 0.00 ? 71  GLU A HB3  3  
ATOM 4235  H HG2  . GLU A 1 71  ? -5.239  -5.357  -0.027  1.00 0.00 ? 71  GLU A HG2  3  
ATOM 4236  H HG3  . GLU A 1 71  ? -5.224  -6.975  0.692   1.00 0.00 ? 71  GLU A HG3  3  
ATOM 4237  N N    . PRO A 1 72  ? -2.067  -2.983  1.131   1.00 0.00 ? 72  PRO A N    3  
ATOM 4238  C CA   . PRO A 1 72  ? -1.753  -1.634  0.651   1.00 0.00 ? 72  PRO A CA   3  
ATOM 4239  C C    . PRO A 1 72  ? -0.457  -1.596  -0.172  1.00 0.00 ? 72  PRO A C    3  
ATOM 4240  O O    . PRO A 1 72  ? -0.415  -0.941  -1.211  1.00 0.00 ? 72  PRO A O    3  
ATOM 4241  C CB   . PRO A 1 72  ? -1.682  -0.752  1.903   1.00 0.00 ? 72  PRO A CB   3  
ATOM 4242  C CG   . PRO A 1 72  ? -1.319  -1.736  3.006   1.00 0.00 ? 72  PRO A CG   3  
ATOM 4243  C CD   . PRO A 1 72  ? -1.984  -3.034  2.584   1.00 0.00 ? 72  PRO A CD   3  
ATOM 4244  H HA   . PRO A 1 72  ? -2.572  -1.276  0.025   1.00 0.00 ? 72  PRO A HA   3  
ATOM 4245  H HB2  . PRO A 1 72  ? -0.936  0.044   1.841   1.00 0.00 ? 72  PRO A HB2  3  
ATOM 4246  H HB3  . PRO A 1 72  ? -2.672  -0.335  2.102   1.00 0.00 ? 72  PRO A HB3  3  
ATOM 4247  H HG2  . PRO A 1 72  ? -0.241  -1.889  3.015   1.00 0.00 ? 72  PRO A HG2  3  
ATOM 4248  H HG3  . PRO A 1 72  ? -1.686  -1.393  3.971   1.00 0.00 ? 72  PRO A HG3  3  
ATOM 4249  H HD2  . PRO A 1 72  ? -1.382  -3.866  2.932   1.00 0.00 ? 72  PRO A HD2  3  
ATOM 4250  H HD3  . PRO A 1 72  ? -2.981  -3.103  3.014   1.00 0.00 ? 72  PRO A HD3  3  
ATOM 4251  N N    . PHE A 1 73  ? 0.602   -2.304  0.235   1.00 0.00 ? 73  PHE A N    3  
ATOM 4252  C CA   . PHE A 1 73  ? 1.825   -2.446  -0.558  1.00 0.00 ? 73  PHE A CA   3  
ATOM 4253  C C    . PHE A 1 73  ? 1.547   -3.030  -1.945  1.00 0.00 ? 73  PHE A C    3  
ATOM 4254  O O    . PHE A 1 73  ? 2.229   -2.675  -2.896  1.00 0.00 ? 73  PHE A O    3  
ATOM 4255  C CB   . PHE A 1 73  ? 2.852   -3.328  0.167   1.00 0.00 ? 73  PHE A CB   3  
ATOM 4256  C CG   . PHE A 1 73  ? 3.524   -2.651  1.344   1.00 0.00 ? 73  PHE A CG   3  
ATOM 4257  C CD1  . PHE A 1 73  ? 4.659   -1.848  1.133   1.00 0.00 ? 73  PHE A CD1  3  
ATOM 4258  C CD2  . PHE A 1 73  ? 3.023   -2.813  2.647   1.00 0.00 ? 73  PHE A CD2  3  
ATOM 4259  C CE1  . PHE A 1 73  ? 5.309   -1.237  2.218   1.00 0.00 ? 73  PHE A CE1  3  
ATOM 4260  C CE2  . PHE A 1 73  ? 3.660   -2.184  3.732   1.00 0.00 ? 73  PHE A CE2  3  
ATOM 4261  C CZ   . PHE A 1 73  ? 4.807   -1.399  3.520   1.00 0.00 ? 73  PHE A CZ   3  
ATOM 4262  H H    . PHE A 1 73  ? 0.527   -2.825  1.091   1.00 0.00 ? 73  PHE A H    3  
ATOM 4263  H HA   . PHE A 1 73  ? 2.261   -1.456  -0.697  1.00 0.00 ? 73  PHE A HA   3  
ATOM 4264  H HB2  . PHE A 1 73  ? 2.381   -4.264  0.481   1.00 0.00 ? 73  PHE A HB2  3  
ATOM 4265  H HB3  . PHE A 1 73  ? 3.633   -3.598  -0.547  1.00 0.00 ? 73  PHE A HB3  3  
ATOM 4266  H HD1  . PHE A 1 73  ? 5.043   -1.697  0.136   1.00 0.00 ? 73  PHE A HD1  3  
ATOM 4267  H HD2  . PHE A 1 73  ? 2.145   -3.419  2.820   1.00 0.00 ? 73  PHE A HD2  3  
ATOM 4268  H HE1  . PHE A 1 73  ? 6.194   -0.642  2.042   1.00 0.00 ? 73  PHE A HE1  3  
ATOM 4269  H HE2  . PHE A 1 73  ? 3.256   -2.302  4.728   1.00 0.00 ? 73  PHE A HE2  3  
ATOM 4270  H HZ   . PHE A 1 73  ? 5.302   -0.914  4.348   1.00 0.00 ? 73  PHE A HZ   3  
ATOM 4271  N N    . ILE A 1 74  ? 0.578   -3.929  -2.090  1.00 0.00 ? 74  ILE A N    3  
ATOM 4272  C CA   . ILE A 1 74  ? 0.170   -4.481  -3.378  1.00 0.00 ? 74  ILE A CA   3  
ATOM 4273  C C    . ILE A 1 74  ? -0.397  -3.361  -4.251  1.00 0.00 ? 74  ILE A C    3  
ATOM 4274  O O    . ILE A 1 74  ? -0.004  -3.244  -5.408  1.00 0.00 ? 74  ILE A O    3  
ATOM 4275  C CB   . ILE A 1 74  ? -0.827  -5.629  -3.120  1.00 0.00 ? 74  ILE A CB   3  
ATOM 4276  C CG1  . ILE A 1 74  ? -0.097  -6.860  -2.544  1.00 0.00 ? 74  ILE A CG1  3  
ATOM 4277  C CG2  . ILE A 1 74  ? -1.620  -6.032  -4.365  1.00 0.00 ? 74  ILE A CG2  3  
ATOM 4278  C CD1  . ILE A 1 74  ? -1.031  -7.781  -1.754  1.00 0.00 ? 74  ILE A CD1  3  
ATOM 4279  H H    . ILE A 1 74  ? 0.091   -4.247  -1.257  1.00 0.00 ? 74  ILE A H    3  
ATOM 4280  H HA   . ILE A 1 74  ? 1.045   -4.874  -3.900  1.00 0.00 ? 74  ILE A HA   3  
ATOM 4281  H HB   . ILE A 1 74  ? -1.547  -5.288  -2.384  1.00 0.00 ? 74  ILE A HB   3  
ATOM 4282  H HG12 . ILE A 1 74  ? 0.373   -7.425  -3.350  1.00 0.00 ? 74  ILE A HG12 3  
ATOM 4283  H HG13 . ILE A 1 74  ? 0.689   -6.541  -1.860  1.00 0.00 ? 74  ILE A HG13 3  
ATOM 4284  H HG21 . ILE A 1 74  ? -2.183  -5.185  -4.760  1.00 0.00 ? 74  ILE A HG21 3  
ATOM 4285  H HG22 . ILE A 1 74  ? -0.947  -6.410  -5.138  1.00 0.00 ? 74  ILE A HG22 3  
ATOM 4286  H HG23 . ILE A 1 74  ? -2.337  -6.801  -4.084  1.00 0.00 ? 74  ILE A HG23 3  
ATOM 4287  H HD11 . ILE A 1 74  ? -1.793  -8.210  -2.400  1.00 0.00 ? 74  ILE A HD11 3  
ATOM 4288  H HD12 . ILE A 1 74  ? -0.453  -8.581  -1.297  1.00 0.00 ? 74  ILE A HD12 3  
ATOM 4289  H HD13 . ILE A 1 74  ? -1.523  -7.213  -0.970  1.00 0.00 ? 74  ILE A HD13 3  
ATOM 4290  N N    . ARG A 1 75  ? -1.285  -2.518  -3.714  1.00 0.00 ? 75  ARG A N    3  
ATOM 4291  C CA   . ARG A 1 75  ? -1.832  -1.385  -4.440  1.00 0.00 ? 75  ARG A CA   3  
ATOM 4292  C C    . ARG A 1 75  ? -0.712  -0.419  -4.840  1.00 0.00 ? 75  ARG A C    3  
ATOM 4293  O O    . ARG A 1 75  ? -0.714  0.094   -5.956  1.00 0.00 ? 75  ARG A O    3  
ATOM 4294  C CB   . ARG A 1 75  ? -2.919  -0.746  -3.566  1.00 0.00 ? 75  ARG A CB   3  
ATOM 4295  C CG   . ARG A 1 75  ? -4.156  -1.646  -3.407  1.00 0.00 ? 75  ARG A CG   3  
ATOM 4296  C CD   . ARG A 1 75  ? -5.120  -1.091  -2.356  1.00 0.00 ? 75  ARG A CD   3  
ATOM 4297  N NE   . ARG A 1 75  ? -6.260  -1.995  -2.134  1.00 0.00 ? 75  ARG A NE   3  
ATOM 4298  C CZ   . ARG A 1 75  ? -7.191  -1.856  -1.183  1.00 0.00 ? 75  ARG A CZ   3  
ATOM 4299  N NH1  . ARG A 1 75  ? -7.198  -0.805  -0.371  1.00 0.00 ? 75  ARG A NH1  3  
ATOM 4300  N NH2  . ARG A 1 75  ? -8.128  -2.777  -1.037  1.00 0.00 ? 75  ARG A NH2  3  
ATOM 4301  H H    . ARG A 1 75  ? -1.585  -2.586  -2.752  1.00 0.00 ? 75  ARG A H    3  
ATOM 4302  H HA   . ARG A 1 75  ? -2.282  -1.744  -5.366  1.00 0.00 ? 75  ARG A HA   3  
ATOM 4303  H HB2  . ARG A 1 75  ? -2.514  -0.529  -2.582  1.00 0.00 ? 75  ARG A HB2  3  
ATOM 4304  H HB3  . ARG A 1 75  ? -3.217  0.184   -4.021  1.00 0.00 ? 75  ARG A HB3  3  
ATOM 4305  H HG2  . ARG A 1 75  ? -4.678  -1.720  -4.359  1.00 0.00 ? 75  ARG A HG2  3  
ATOM 4306  H HG3  . ARG A 1 75  ? -3.838  -2.641  -3.103  1.00 0.00 ? 75  ARG A HG3  3  
ATOM 4307  H HD2  . ARG A 1 75  ? -4.585  -0.958  -1.415  1.00 0.00 ? 75  ARG A HD2  3  
ATOM 4308  H HD3  . ARG A 1 75  ? -5.491  -0.128  -2.702  1.00 0.00 ? 75  ARG A HD3  3  
ATOM 4309  H HE   . ARG A 1 75  ? -6.364  -2.756  -2.799  1.00 0.00 ? 75  ARG A HE   3  
ATOM 4310  H HH11 . ARG A 1 75  ? -6.425  -0.145  -0.338  1.00 0.00 ? 75  ARG A HH11 3  
ATOM 4311  H HH12 . ARG A 1 75  ? -7.953  -0.636  0.291   1.00 0.00 ? 75  ARG A HH12 3  
ATOM 4312  H HH21 . ARG A 1 75  ? -8.094  -3.647  -1.571  1.00 0.00 ? 75  ARG A HH21 3  
ATOM 4313  H HH22 . ARG A 1 75  ? -8.804  -2.746  -0.283  1.00 0.00 ? 75  ARG A HH22 3  
ATOM 4314  N N    . MET A 1 76  ? 0.287   -0.233  -3.971  1.00 0.00 ? 76  MET A N    3  
ATOM 4315  C CA   . MET A 1 76  ? 1.525   0.466   -4.284  1.00 0.00 ? 76  MET A CA   3  
ATOM 4316  C C    . MET A 1 76  ? 2.248   -0.138  -5.496  1.00 0.00 ? 76  MET A C    3  
ATOM 4317  O O    . MET A 1 76  ? 2.656   0.617   -6.376  1.00 0.00 ? 76  MET A O    3  
ATOM 4318  C CB   . MET A 1 76  ? 2.420   0.450   -3.031  1.00 0.00 ? 76  MET A CB   3  
ATOM 4319  C CG   . MET A 1 76  ? 2.882   1.842   -2.641  1.00 0.00 ? 76  MET A CG   3  
ATOM 4320  S SD   . MET A 1 76  ? 4.193   1.867   -1.389  1.00 0.00 ? 76  MET A SD   3  
ATOM 4321  C CE   . MET A 1 76  ? 3.158   1.992   0.085   1.00 0.00 ? 76  MET A CE   3  
ATOM 4322  H H    . MET A 1 76  ? 0.200   -0.590  -3.025  1.00 0.00 ? 76  MET A H    3  
ATOM 4323  H HA   . MET A 1 76  ? 1.275   1.494   -4.552  1.00 0.00 ? 76  MET A HA   3  
ATOM 4324  H HB2  . MET A 1 76  ? 1.879   0.047   -2.180  1.00 0.00 ? 76  MET A HB2  3  
ATOM 4325  H HB3  . MET A 1 76  ? 3.297   -0.171  -3.205  1.00 0.00 ? 76  MET A HB3  3  
ATOM 4326  H HG2  . MET A 1 76  ? 3.241   2.324   -3.539  1.00 0.00 ? 76  MET A HG2  3  
ATOM 4327  H HG3  . MET A 1 76  ? 2.027   2.403   -2.274  1.00 0.00 ? 76  MET A HG3  3  
ATOM 4328  H HE1  . MET A 1 76  ? 3.783   1.961   0.979   1.00 0.00 ? 76  MET A HE1  3  
ATOM 4329  H HE2  . MET A 1 76  ? 2.665   2.964   0.068   1.00 0.00 ? 76  MET A HE2  3  
ATOM 4330  H HE3  . MET A 1 76  ? 2.416   1.182   0.068   1.00 0.00 ? 76  MET A HE3  3  
ATOM 4331  N N    . GLN A 1 77  ? 2.429   -1.466  -5.542  1.00 0.00 ? 77  GLN A N    3  
ATOM 4332  C CA   . GLN A 1 77  ? 3.119   -2.137  -6.647  1.00 0.00 ? 77  GLN A CA   3  
ATOM 4333  C C    . GLN A 1 77  ? 2.362   -1.917  -7.941  1.00 0.00 ? 77  GLN A C    3  
ATOM 4334  O O    . GLN A 1 77  ? 2.983   -1.599  -8.953  1.00 0.00 ? 77  GLN A O    3  
ATOM 4335  C CB   . GLN A 1 77  ? 3.248   -3.654  -6.442  1.00 0.00 ? 77  GLN A CB   3  
ATOM 4336  C CG   . GLN A 1 77  ? 4.187   -4.038  -5.301  1.00 0.00 ? 77  GLN A CG   3  
ATOM 4337  C CD   . GLN A 1 77  ? 4.070   -5.506  -4.906  1.00 0.00 ? 77  GLN A CD   3  
ATOM 4338  O OE1  . GLN A 1 77  ? 4.621   -6.395  -5.541  1.00 0.00 ? 77  GLN A OE1  3  
ATOM 4339  N NE2  . GLN A 1 77  ? 3.391   -5.795  -3.808  1.00 0.00 ? 77  GLN A NE2  3  
ATOM 4340  H H    . GLN A 1 77  ? 2.060   -2.039  -4.792  1.00 0.00 ? 77  GLN A H    3  
ATOM 4341  H HA   . GLN A 1 77  ? 4.114   -1.707  -6.767  1.00 0.00 ? 77  GLN A HA   3  
ATOM 4342  H HB2  . GLN A 1 77  ? 2.264   -4.086  -6.266  1.00 0.00 ? 77  GLN A HB2  3  
ATOM 4343  H HB3  . GLN A 1 77  ? 3.647   -4.072  -7.370  1.00 0.00 ? 77  GLN A HB3  3  
ATOM 4344  H HG2  . GLN A 1 77  ? 5.205   -3.847  -5.615  1.00 0.00 ? 77  GLN A HG2  3  
ATOM 4345  H HG3  . GLN A 1 77  ? 3.983   -3.417  -4.437  1.00 0.00 ? 77  GLN A HG3  3  
ATOM 4346  H HE21 . GLN A 1 77  ? 2.949   -5.053  -3.291  1.00 0.00 ? 77  GLN A HE21 3  
ATOM 4347  H HE22 . GLN A 1 77  ? 3.377   -6.761  -3.516  1.00 0.00 ? 77  GLN A HE22 3  
ATOM 4348  N N    . LEU A 1 78  ? 1.045   -2.118  -7.911  1.00 0.00 ? 78  LEU A N    3  
ATOM 4349  C CA   . LEU A 1 78  ? 0.227   -2.015  -9.102  1.00 0.00 ? 78  LEU A CA   3  
ATOM 4350  C C    . LEU A 1 78  ? 0.321   -0.612  -9.655  1.00 0.00 ? 78  LEU A C    3  
ATOM 4351  O O    . LEU A 1 78  ? 0.692   -0.480  -10.812 1.00 0.00 ? 78  LEU A O    3  
ATOM 4352  C CB   . LEU A 1 78  ? -1.212  -2.485  -8.835  1.00 0.00 ? 78  LEU A CB   3  
ATOM 4353  C CG   . LEU A 1 78  ? -1.282  -4.018  -9.008  1.00 0.00 ? 78  LEU A CG   3  
ATOM 4354  C CD1  . LEU A 1 78  ? -2.422  -4.658  -8.217  1.00 0.00 ? 78  LEU A CD1  3  
ATOM 4355  C CD2  . LEU A 1 78  ? -1.453  -4.384  -10.483 1.00 0.00 ? 78  LEU A CD2  3  
ATOM 4356  H H    . LEU A 1 78  ? 0.613   -2.410  -7.041  1.00 0.00 ? 78  LEU A H    3  
ATOM 4357  H HA   . LEU A 1 78  ? 0.674   -2.648  -9.864  1.00 0.00 ? 78  LEU A HA   3  
ATOM 4358  H HB2  . LEU A 1 78  ? -1.506  -2.192  -7.826  1.00 0.00 ? 78  LEU A HB2  3  
ATOM 4359  H HB3  . LEU A 1 78  ? -1.892  -2.000  -9.541  1.00 0.00 ? 78  LEU A HB3  3  
ATOM 4360  H HG   . LEU A 1 78  ? -0.359  -4.464  -8.635  1.00 0.00 ? 78  LEU A HG   3  
ATOM 4361  H HD11 . LEU A 1 78  ? -2.350  -5.740  -8.312  1.00 0.00 ? 78  LEU A HD11 3  
ATOM 4362  H HD12 . LEU A 1 78  ? -2.333  -4.400  -7.162  1.00 0.00 ? 78  LEU A HD12 3  
ATOM 4363  H HD13 . LEU A 1 78  ? -3.385  -4.331  -8.602  1.00 0.00 ? 78  LEU A HD13 3  
ATOM 4364  H HD21 . LEU A 1 78  ? -2.372  -3.957  -10.883 1.00 0.00 ? 78  LEU A HD21 3  
ATOM 4365  H HD22 . LEU A 1 78  ? -0.613  -3.999  -11.057 1.00 0.00 ? 78  LEU A HD22 3  
ATOM 4366  H HD23 . LEU A 1 78  ? -1.476  -5.467  -10.598 1.00 0.00 ? 78  LEU A HD23 3  
ATOM 4367  N N    . TRP A 1 79  ? 0.086   0.429   -8.854  1.00 0.00 ? 79  TRP A N    3  
ATOM 4368  C CA   . TRP A 1 79  ? 0.030   1.800   -9.360  1.00 0.00 ? 79  TRP A CA   3  
ATOM 4369  C C    . TRP A 1 79  ? 1.244   2.218   -10.192 1.00 0.00 ? 79  TRP A C    3  
ATOM 4370  O O    . TRP A 1 79  ? 1.105   3.037   -11.102 1.00 0.00 ? 79  TRP A O    3  
ATOM 4371  C CB   . TRP A 1 79  ? -0.144  2.761   -8.182  1.00 0.00 ? 79  TRP A CB   3  
ATOM 4372  C CG   . TRP A 1 79  ? 0.030   4.209   -8.532  1.00 0.00 ? 79  TRP A CG   3  
ATOM 4373  C CD1  . TRP A 1 79  ? -0.927  5.063   -8.956  1.00 0.00 ? 79  TRP A CD1  3  
ATOM 4374  C CD2  . TRP A 1 79  ? 1.279   4.964   -8.560  1.00 0.00 ? 79  TRP A CD2  3  
ATOM 4375  N NE1  . TRP A 1 79  ? -0.351  6.272   -9.298  1.00 0.00 ? 79  TRP A NE1  3  
ATOM 4376  C CE2  . TRP A 1 79  ? 1.005   6.272   -9.056  1.00 0.00 ? 79  TRP A CE2  3  
ATOM 4377  C CE3  . TRP A 1 79  ? 2.618   4.658   -8.236  1.00 0.00 ? 79  TRP A CE3  3  
ATOM 4378  C CZ2  . TRP A 1 79  ? 2.009   7.233   -9.227  1.00 0.00 ? 79  TRP A CZ2  3  
ATOM 4379  C CZ3  . TRP A 1 79  ? 3.635   5.613   -8.420  1.00 0.00 ? 79  TRP A CZ3  3  
ATOM 4380  C CH2  . TRP A 1 79  ? 3.332   6.899   -8.900  1.00 0.00 ? 79  TRP A CH2  3  
ATOM 4381  H H    . TRP A 1 79  ? -0.167  0.256   -7.886  1.00 0.00 ? 79  TRP A H    3  
ATOM 4382  H HA   . TRP A 1 79  ? -0.829  1.859   -10.024 1.00 0.00 ? 79  TRP A HA   3  
ATOM 4383  H HB2  . TRP A 1 79  ? -1.119  2.589   -7.744  1.00 0.00 ? 79  TRP A HB2  3  
ATOM 4384  H HB3  . TRP A 1 79  ? 0.600   2.517   -7.421  1.00 0.00 ? 79  TRP A HB3  3  
ATOM 4385  H HD1  . TRP A 1 79  ? -1.967  4.817   -9.081  1.00 0.00 ? 79  TRP A HD1  3  
ATOM 4386  H HE1  . TRP A 1 79  ? -0.833  7.001   -9.807  1.00 0.00 ? 79  TRP A HE1  3  
ATOM 4387  H HE3  . TRP A 1 79  ? 2.853   3.670   -7.858  1.00 0.00 ? 79  TRP A HE3  3  
ATOM 4388  H HZ2  . TRP A 1 79  ? 1.770   8.213   -9.613  1.00 0.00 ? 79  TRP A HZ2  3  
ATOM 4389  H HZ3  . TRP A 1 79  ? 4.662   5.359   -8.213  1.00 0.00 ? 79  TRP A HZ3  3  
ATOM 4390  H HH2  . TRP A 1 79  ? 4.114   7.634   -9.014  1.00 0.00 ? 79  TRP A HH2  3  
ATOM 4391  N N    . LEU A 1 80  ? 2.420   1.672   -9.885  1.00 0.00 ? 80  LEU A N    3  
ATOM 4392  C CA   . LEU A 1 80  ? 3.632   1.911   -10.666 1.00 0.00 ? 80  LEU A CA   3  
ATOM 4393  C C    . LEU A 1 80  ? 3.373   1.556   -12.139 1.00 0.00 ? 80  LEU A C    3  
ATOM 4394  O O    . LEU A 1 80  ? 3.477   2.435   -12.998 1.00 0.00 ? 80  LEU A O    3  
ATOM 4395  C CB   . LEU A 1 80  ? 4.822   1.134   -10.068 1.00 0.00 ? 80  LEU A CB   3  
ATOM 4396  C CG   . LEU A 1 80  ? 5.583   1.919   -8.978  1.00 0.00 ? 80  LEU A CG   3  
ATOM 4397  C CD1  . LEU A 1 80  ? 6.469   0.964   -8.179  1.00 0.00 ? 80  LEU A CD1  3  
ATOM 4398  C CD2  . LEU A 1 80  ? 6.478   3.035   -9.537  1.00 0.00 ? 80  LEU A CD2  3  
ATOM 4399  H H    . LEU A 1 80  ? 2.385   0.968   -9.156  1.00 0.00 ? 80  LEU A H    3  
ATOM 4400  H HA   . LEU A 1 80  ? 3.861   2.977   -10.630 1.00 0.00 ? 80  LEU A HA   3  
ATOM 4401  H HB2  . LEU A 1 80  ? 4.451   0.207   -9.628  1.00 0.00 ? 80  LEU A HB2  3  
ATOM 4402  H HB3  . LEU A 1 80  ? 5.515   0.861   -10.868 1.00 0.00 ? 80  LEU A HB3  3  
ATOM 4403  H HG   . LEU A 1 80  ? 4.864   2.363   -8.291  1.00 0.00 ? 80  LEU A HG   3  
ATOM 4404  H HD11 . LEU A 1 80  ? 5.848   0.218   -7.683  1.00 0.00 ? 80  LEU A HD11 3  
ATOM 4405  H HD12 . LEU A 1 80  ? 7.171   0.465   -8.843  1.00 0.00 ? 80  LEU A HD12 3  
ATOM 4406  H HD13 . LEU A 1 80  ? 7.021   1.521   -7.425  1.00 0.00 ? 80  LEU A HD13 3  
ATOM 4407  H HD21 . LEU A 1 80  ? 7.023   3.532   -8.730  1.00 0.00 ? 80  LEU A HD21 3  
ATOM 4408  H HD22 . LEU A 1 80  ? 7.213   2.621   -10.229 1.00 0.00 ? 80  LEU A HD22 3  
ATOM 4409  H HD23 . LEU A 1 80  ? 5.872   3.776   -10.051 1.00 0.00 ? 80  LEU A HD23 3  
ATOM 4410  N N    . SER A 1 81  ? 3.001   0.303   -12.424 1.00 0.00 ? 81  SER A N    3  
ATOM 4411  C CA   . SER A 1 81  ? 2.858   -0.216  -13.781 1.00 0.00 ? 81  SER A CA   3  
ATOM 4412  C C    . SER A 1 81  ? 1.429   -0.132  -14.327 1.00 0.00 ? 81  SER A C    3  
ATOM 4413  O O    . SER A 1 81  ? 1.252   0.227   -15.492 1.00 0.00 ? 81  SER A O    3  
ATOM 4414  C CB   . SER A 1 81  ? 3.355   -1.666  -13.818 1.00 0.00 ? 81  SER A CB   3  
ATOM 4415  O OG   . SER A 1 81  ? 4.538   -1.731  -14.584 1.00 0.00 ? 81  SER A OG   3  
ATOM 4416  H H    . SER A 1 81  ? 2.820   -0.331  -11.655 1.00 0.00 ? 81  SER A H    3  
ATOM 4417  H HA   . SER A 1 81  ? 3.491   0.382   -14.436 1.00 0.00 ? 81  SER A HA   3  
ATOM 4418  H HB2  . SER A 1 81  ? 3.561   -2.020  -12.807 1.00 0.00 ? 81  SER A HB2  3  
ATOM 4419  H HB3  . SER A 1 81  ? 2.603   -2.318  -14.262 1.00 0.00 ? 81  SER A HB3  3  
ATOM 4420  H HG   . SER A 1 81  ? 4.719   -2.681  -14.740 1.00 0.00 ? 81  SER A HG   3  
ATOM 4421  N N    . ASP A 1 82  ? 0.421   -0.478  -13.523 1.00 0.00 ? 82  ASP A N    3  
ATOM 4422  C CA   . ASP A 1 82  ? -1.012  -0.409  -13.837 1.00 0.00 ? 82  ASP A CA   3  
ATOM 4423  C C    . ASP A 1 82  ? -1.347  1.001   -14.309 1.00 0.00 ? 82  ASP A C    3  
ATOM 4424  O O    . ASP A 1 82  ? -1.985  1.169   -15.348 1.00 0.00 ? 82  ASP A O    3  
ATOM 4425  C CB   . ASP A 1 82  ? -1.837  -0.758  -12.579 1.00 0.00 ? 82  ASP A CB   3  
ATOM 4426  C CG   . ASP A 1 82  ? -3.348  -0.619  -12.769 1.00 0.00 ? 82  ASP A CG   3  
ATOM 4427  O OD1  . ASP A 1 82  ? -3.814  0.532   -12.908 1.00 0.00 ? 82  ASP A OD1  3  
ATOM 4428  O OD2  . ASP A 1 82  ? -4.083  -1.632  -12.717 1.00 0.00 ? 82  ASP A OD2  3  
ATOM 4429  H H    . ASP A 1 82  ? 0.652   -0.749  -12.573 1.00 0.00 ? 82  ASP A H    3  
ATOM 4430  H HA   . ASP A 1 82  ? -1.254  -1.120  -14.624 1.00 0.00 ? 82  ASP A HA   3  
ATOM 4431  H HB2  . ASP A 1 82  ? -1.592  -1.765  -12.246 1.00 0.00 ? 82  ASP A HB2  3  
ATOM 4432  H HB3  . ASP A 1 82  ? -1.568  -0.072  -11.777 1.00 0.00 ? 82  ASP A HB3  3  
ATOM 4433  N N    . GLN A 1 83  ? -0.853  1.974   -13.536 1.00 0.00 ? 83  GLN A N    3  
ATOM 4434  C CA   . GLN A 1 83  ? -0.918  3.417   -13.536 1.00 0.00 ? 83  GLN A CA   3  
ATOM 4435  C C    . GLN A 1 83  ? -1.947  3.937   -12.529 1.00 0.00 ? 83  GLN A C    3  
ATOM 4436  O O    . GLN A 1 83  ? -1.696  5.007   -11.975 1.00 0.00 ? 83  GLN A O    3  
ATOM 4437  C CB   . GLN A 1 83  ? -1.087  4.035   -14.919 1.00 0.00 ? 83  GLN A CB   3  
ATOM 4438  C CG   . GLN A 1 83  ? 0.181   3.909   -15.782 1.00 0.00 ? 83  GLN A CG   3  
ATOM 4439  C CD   . GLN A 1 83  ? 0.169   4.868   -16.973 1.00 0.00 ? 83  GLN A CD   3  
ATOM 4440  O OE1  . GLN A 1 83  ? -0.122  6.058   -16.821 1.00 0.00 ? 83  GLN A OE1  3  
ATOM 4441  N NE2  . GLN A 1 83  ? 0.562   4.423   -18.154 1.00 0.00 ? 83  GLN A NE2  3  
ATOM 4442  H H    . GLN A 1 83  ? -0.280  1.671   -12.786 1.00 0.00 ? 83  GLN A H    3  
ATOM 4443  H HA   . GLN A 1 83  ? 0.048   3.763   -13.180 1.00 0.00 ? 83  GLN A HA   3  
ATOM 4444  H HB2  . GLN A 1 83  ? -1.936  3.586   -15.408 1.00 0.00 ? 83  GLN A HB2  3  
ATOM 4445  H HB3  . GLN A 1 83  ? -1.293  5.081   -14.748 1.00 0.00 ? 83  GLN A HB3  3  
ATOM 4446  H HG2  . GLN A 1 83  ? 1.057   4.149   -15.180 1.00 0.00 ? 83  GLN A HG2  3  
ATOM 4447  H HG3  . GLN A 1 83  ? 0.280   2.883   -16.128 1.00 0.00 ? 83  GLN A HG3  3  
ATOM 4448  H HE21 . GLN A 1 83  ? 0.877   3.459   -18.259 1.00 0.00 ? 83  GLN A HE21 3  
ATOM 4449  H HE22 . GLN A 1 83  ? 0.509   5.007   -18.980 1.00 0.00 ? 83  GLN A HE22 3  
ATOM 4450  N N    . LEU A 1 84  ? -3.007  3.171   -12.220 1.00 0.00 ? 84  LEU A N    3  
ATOM 4451  C CA   . LEU A 1 84  ? -4.121  3.395   -11.279 1.00 0.00 ? 84  LEU A CA   3  
ATOM 4452  C C    . LEU A 1 84  ? -4.764  4.784   -11.306 1.00 0.00 ? 84  LEU A C    3  
ATOM 4453  O O    . LEU A 1 84  ? -5.921  4.928   -11.700 1.00 0.00 ? 84  LEU A O    3  
ATOM 4454  C CB   . LEU A 1 84  ? -3.750  2.907   -9.858  1.00 0.00 ? 84  LEU A CB   3  
ATOM 4455  C CG   . LEU A 1 84  ? -4.464  1.597   -9.462  1.00 0.00 ? 84  LEU A CG   3  
ATOM 4456  C CD1  . LEU A 1 84  ? -3.632  0.767   -8.478  1.00 0.00 ? 84  LEU A CD1  3  
ATOM 4457  C CD2  . LEU A 1 84  ? -5.816  1.915   -8.820  1.00 0.00 ? 84  LEU A CD2  3  
ATOM 4458  H H    . LEU A 1 84  ? -3.087  2.278   -12.712 1.00 0.00 ? 84  LEU A H    3  
ATOM 4459  H HA   . LEU A 1 84  ? -4.905  2.750   -11.638 1.00 0.00 ? 84  LEU A HA   3  
ATOM 4460  H HB2  . LEU A 1 84  ? -2.678  2.752   -9.819  1.00 0.00 ? 84  LEU A HB2  3  
ATOM 4461  H HB3  . LEU A 1 84  ? -3.991  3.675   -9.121  1.00 0.00 ? 84  LEU A HB3  3  
ATOM 4462  H HG   . LEU A 1 84  ? -4.628  0.981   -10.345 1.00 0.00 ? 84  LEU A HG   3  
ATOM 4463  H HD11 . LEU A 1 84  ? -4.196  -0.112  -8.171  1.00 0.00 ? 84  LEU A HD11 3  
ATOM 4464  H HD12 . LEU A 1 84  ? -2.718  0.428   -8.961  1.00 0.00 ? 84  LEU A HD12 3  
ATOM 4465  H HD13 . LEU A 1 84  ? -3.380  1.340   -7.589  1.00 0.00 ? 84  LEU A HD13 3  
ATOM 4466  H HD21 . LEU A 1 84  ? -6.348  0.983   -8.623  1.00 0.00 ? 84  LEU A HD21 3  
ATOM 4467  H HD22 . LEU A 1 84  ? -5.679  2.453   -7.882  1.00 0.00 ? 84  LEU A HD22 3  
ATOM 4468  H HD23 . LEU A 1 84  ? -6.411  2.525   -9.499  1.00 0.00 ? 84  LEU A HD23 3  
ATOM 4469  N N    . GLY A 1 85  ? -4.004  5.774   -10.864 1.00 0.00 ? 85  GLY A N    3  
ATOM 4470  C CA   . GLY A 1 85  ? -4.161  7.211   -11.044 1.00 0.00 ? 85  GLY A CA   3  
ATOM 4471  C C    . GLY A 1 85  ? -5.605  7.687   -11.046 1.00 0.00 ? 85  GLY A C    3  
ATOM 4472  O O    . GLY A 1 85  ? -6.186  7.877   -12.112 1.00 0.00 ? 85  GLY A O    3  
ATOM 4473  H H    . GLY A 1 85  ? -3.067  5.414   -10.773 1.00 0.00 ? 85  GLY A H    3  
ATOM 4474  H HA2  . GLY A 1 85  ? -3.617  7.729   -10.255 1.00 0.00 ? 85  GLY A HA2  3  
ATOM 4475  H HA3  . GLY A 1 85  ? -3.708  7.487   -11.999 1.00 0.00 ? 85  GLY A HA3  3  
ATOM 4476  N N    . GLN A 1 86  ? -6.184  7.931   -9.866  1.00 0.00 ? 86  GLN A N    3  
ATOM 4477  C CA   . GLN A 1 86  ? -7.472  8.595   -9.774  1.00 0.00 ? 86  GLN A CA   3  
ATOM 4478  C C    . GLN A 1 86  ? -7.444  9.931   -10.519 1.00 0.00 ? 86  GLN A C    3  
ATOM 4479  O O    . GLN A 1 86  ? -8.403  10.242  -11.226 1.00 0.00 ? 86  GLN A O    3  
ATOM 4480  C CB   . GLN A 1 86  ? -7.834  8.877   -8.309  1.00 0.00 ? 86  GLN A CB   3  
ATOM 4481  C CG   . GLN A 1 86  ? -8.706  7.831   -7.609  1.00 0.00 ? 86  GLN A CG   3  
ATOM 4482  C CD   . GLN A 1 86  ? -7.991  6.549   -7.196  1.00 0.00 ? 86  GLN A CD   3  
ATOM 4483  O OE1  . GLN A 1 86  ? -6.764  6.467   -7.176  1.00 0.00 ? 86  GLN A OE1  3  
ATOM 4484  N NE2  . GLN A 1 86  ? -8.764  5.548   -6.808  1.00 0.00 ? 86  GLN A NE2  3  
ATOM 4485  H H    . GLN A 1 86  ? -5.721  7.724   -8.994  1.00 0.00 ? 86  GLN A H    3  
ATOM 4486  H HA   . GLN A 1 86  ? -8.226  7.955   -10.231 1.00 0.00 ? 86  GLN A HA   3  
ATOM 4487  H HB2  . GLN A 1 86  ? -6.941  9.092   -7.729  1.00 0.00 ? 86  GLN A HB2  3  
ATOM 4488  H HB3  . GLN A 1 86  ? -8.410  9.792   -8.303  1.00 0.00 ? 86  GLN A HB3  3  
ATOM 4489  H HG2  . GLN A 1 86  ? -9.098  8.291   -6.704  1.00 0.00 ? 86  GLN A HG2  3  
ATOM 4490  H HG3  . GLN A 1 86  ? -9.551  7.593   -8.258  1.00 0.00 ? 86  GLN A HG3  3  
ATOM 4491  H HE21 . GLN A 1 86  ? -9.763  5.711   -6.680  1.00 0.00 ? 86  GLN A HE21 3  
ATOM 4492  H HE22 . GLN A 1 86  ? -8.366  4.675   -6.473  1.00 0.00 ? 86  GLN A HE22 3  
ATOM 4493  N N    . ALA A 1 87  ? -6.414  10.744  -10.265 1.00 0.00 ? 87  ALA A N    3  
ATOM 4494  C CA   . ALA A 1 87  ? -6.315  12.145  -10.630 1.00 0.00 ? 87  ALA A CA   3  
ATOM 4495  C C    . ALA A 1 87  ? -4.907  12.641  -10.248 1.00 0.00 ? 87  ALA A C    3  
ATOM 4496  O O    . ALA A 1 87  ? -4.031  11.832  -9.933  1.00 0.00 ? 87  ALA A O    3  
ATOM 4497  C CB   . ALA A 1 87  ? -7.390  12.919  -9.859  1.00 0.00 ? 87  ALA A CB   3  
ATOM 4498  H H    . ALA A 1 87  ? -5.636  10.429  -9.701  1.00 0.00 ? 87  ALA A H    3  
ATOM 4499  H HA   . ALA A 1 87  ? -6.481  12.252  -11.701 1.00 0.00 ? 87  ALA A HA   3  
ATOM 4500  H HB1  . ALA A 1 87  ? -7.166  12.857  -8.802  1.00 0.00 ? 87  ALA A HB1  3  
ATOM 4501  H HB2  . ALA A 1 87  ? -7.399  13.959  -10.161 1.00 0.00 ? 87  ALA A HB2  3  
ATOM 4502  H HB3  . ALA A 1 87  ? -8.377  12.499  -10.040 1.00 0.00 ? 87  ALA A HB3  3  
ATOM 4503  N N    . VAL A 1 88  ? -4.736  13.967  -10.207 1.00 0.00 ? 88  VAL A N    3  
ATOM 4504  C CA   . VAL A 1 88  ? -3.592  14.730  -9.702  1.00 0.00 ? 88  VAL A CA   3  
ATOM 4505  C C    . VAL A 1 88  ? -2.413  14.699  -10.695 1.00 0.00 ? 88  VAL A C    3  
ATOM 4506  O O    . VAL A 1 88  ? -2.179  13.718  -11.409 1.00 0.00 ? 88  VAL A O    3  
ATOM 4507  C CB   . VAL A 1 88  ? -3.232  14.315  -8.247  1.00 0.00 ? 88  VAL A CB   3  
ATOM 4508  C CG1  . VAL A 1 88  ? -2.232  15.273  -7.579  1.00 0.00 ? 88  VAL A CG1  3  
ATOM 4509  C CG2  . VAL A 1 88  ? -4.463  14.287  -7.325  1.00 0.00 ? 88  VAL A CG2  3  
ATOM 4510  H H    . VAL A 1 88  ? -5.539  14.510  -10.476 1.00 0.00 ? 88  VAL A H    3  
ATOM 4511  H HA   . VAL A 1 88  ? -3.936  15.763  -9.652  1.00 0.00 ? 88  VAL A HA   3  
ATOM 4512  H HB   . VAL A 1 88  ? -2.788  13.325  -8.257  1.00 0.00 ? 88  VAL A HB   3  
ATOM 4513  H HG11 . VAL A 1 88  ? -1.307  15.318  -8.151  1.00 0.00 ? 88  VAL A HG11 3  
ATOM 4514  H HG12 . VAL A 1 88  ? -2.665  16.271  -7.506  1.00 0.00 ? 88  VAL A HG12 3  
ATOM 4515  H HG13 . VAL A 1 88  ? -1.998  14.918  -6.576  1.00 0.00 ? 88  VAL A HG13 3  
ATOM 4516  H HG21 . VAL A 1 88  ? -4.170  14.036  -6.305  1.00 0.00 ? 88  VAL A HG21 3  
ATOM 4517  H HG22 . VAL A 1 88  ? -4.954  15.258  -7.330  1.00 0.00 ? 88  VAL A HG22 3  
ATOM 4518  H HG23 . VAL A 1 88  ? -5.172  13.529  -7.647  1.00 0.00 ? 88  VAL A HG23 3  
ATOM 4519  N N    . GLY A 1 89  ? -1.674  15.811  -10.746 1.00 0.00 ? 89  GLY A N    3  
ATOM 4520  C CA   . GLY A 1 89  ? -0.576  16.057  -11.665 1.00 0.00 ? 89  GLY A CA   3  
ATOM 4521  C C    . GLY A 1 89  ? -0.214  17.540  -11.625 1.00 0.00 ? 89  GLY A C    3  
ATOM 4522  O O    . GLY A 1 89  ? 0.579   17.964  -10.781 1.00 0.00 ? 89  GLY A O    3  
ATOM 4523  H H    . GLY A 1 89  ? -1.890  16.571  -10.110 1.00 0.00 ? 89  GLY A H    3  
ATOM 4524  H HA2  . GLY A 1 89  ? 0.290   15.465  -11.369 1.00 0.00 ? 89  GLY A HA2  3  
ATOM 4525  H HA3  . GLY A 1 89  ? -0.870  15.774  -12.677 1.00 0.00 ? 89  GLY A HA3  3  
ATOM 4526  N N    . GLN A 1 90  ? -0.835  18.352  -12.481 1.00 0.00 ? 90  GLN A N    3  
ATOM 4527  C CA   . GLN A 1 90  ? -0.549  19.777  -12.614 1.00 0.00 ? 90  GLN A CA   3  
ATOM 4528  C C    . GLN A 1 90  ? -1.091  20.578  -11.419 1.00 0.00 ? 90  GLN A C    3  
ATOM 4529  O O    . GLN A 1 90  ? -2.227  21.052  -11.437 1.00 0.00 ? 90  GLN A O    3  
ATOM 4530  C CB   . GLN A 1 90  ? -1.076  20.305  -13.962 1.00 0.00 ? 90  GLN A CB   3  
ATOM 4531  C CG   . GLN A 1 90  ? -0.017  20.229  -15.069 1.00 0.00 ? 90  GLN A CG   3  
ATOM 4532  C CD   . GLN A 1 90  ? -0.584  20.721  -16.399 1.00 0.00 ? 90  GLN A CD   3  
ATOM 4533  O OE1  . GLN A 1 90  ? -1.062  19.941  -17.225 1.00 0.00 ? 90  GLN A OE1  3  
ATOM 4534  N NE2  . GLN A 1 90  ? -0.552  22.020  -16.628 1.00 0.00 ? 90  GLN A NE2  3  
ATOM 4535  H H    . GLN A 1 90  ? -1.550  17.946  -13.076 1.00 0.00 ? 90  GLN A H    3  
ATOM 4536  H HA   . GLN A 1 90  ? 0.531   19.900  -12.620 1.00 0.00 ? 90  GLN A HA   3  
ATOM 4537  H HB2  . GLN A 1 90  ? -1.973  19.759  -14.260 1.00 0.00 ? 90  GLN A HB2  3  
ATOM 4538  H HB3  . GLN A 1 90  ? -1.340  21.352  -13.858 1.00 0.00 ? 90  GLN A HB3  3  
ATOM 4539  H HG2  . GLN A 1 90  ? 0.837   20.849  -14.794 1.00 0.00 ? 90  GLN A HG2  3  
ATOM 4540  H HG3  . GLN A 1 90  ? 0.342   19.210  -15.178 1.00 0.00 ? 90  GLN A HG3  3  
ATOM 4541  H HE21 . GLN A 1 90  ? -0.151  22.656  -15.955 1.00 0.00 ? 90  GLN A HE21 3  
ATOM 4542  H HE22 . GLN A 1 90  ? -0.952  22.404  -17.484 1.00 0.00 ? 90  GLN A HE22 3  
ATOM 4543  N N    . GLN A 1 91  ? -0.283  20.758  -10.380 1.00 0.00 ? 91  GLN A N    3  
ATOM 4544  C CA   . GLN A 1 91  ? -0.345  21.881  -9.447  1.00 0.00 ? 91  GLN A CA   3  
ATOM 4545  C C    . GLN A 1 91  ? 1.111   22.222  -9.085  1.00 0.00 ? 91  GLN A C    3  
ATOM 4546  O O    . GLN A 1 91  ? 1.961   21.323  -9.126  1.00 0.00 ? 91  GLN A O    3  
ATOM 4547  C CB   . GLN A 1 91  ? -1.138  21.527  -8.178  1.00 0.00 ? 91  GLN A CB   3  
ATOM 4548  C CG   . GLN A 1 91  ? -2.664  21.456  -8.327  1.00 0.00 ? 91  GLN A CG   3  
ATOM 4549  C CD   . GLN A 1 91  ? -3.316  21.102  -6.992  1.00 0.00 ? 91  GLN A CD   3  
ATOM 4550  O OE1  . GLN A 1 91  ? -3.291  19.955  -6.549  1.00 0.00 ? 91  GLN A OE1  3  
ATOM 4551  N NE2  . GLN A 1 91  ? -3.844  22.068  -6.261  1.00 0.00 ? 91  GLN A NE2  3  
ATOM 4552  H H    . GLN A 1 91  ? 0.605   20.271  -10.382 1.00 0.00 ? 91  GLN A H    3  
ATOM 4553  H HA   . GLN A 1 91  ? -0.811  22.735  -9.939  1.00 0.00 ? 91  GLN A HA   3  
ATOM 4554  H HB2  . GLN A 1 91  ? -0.777  20.573  -7.803  1.00 0.00 ? 91  GLN A HB2  3  
ATOM 4555  H HB3  . GLN A 1 91  ? -0.927  22.285  -7.424  1.00 0.00 ? 91  GLN A HB3  3  
ATOM 4556  H HG2  . GLN A 1 91  ? -3.039  22.417  -8.680  1.00 0.00 ? 91  GLN A HG2  3  
ATOM 4557  H HG3  . GLN A 1 91  ? -2.928  20.689  -9.049  1.00 0.00 ? 91  GLN A HG3  3  
ATOM 4558  H HE21 . GLN A 1 91  ? -4.035  22.982  -6.673  1.00 0.00 ? 91  GLN A HE21 3  
ATOM 4559  H HE22 . GLN A 1 91  ? -4.360  21.803  -5.420  1.00 0.00 ? 91  GLN A HE22 3  
ATOM 4560  N N    . PRO A 1 92  ? 1.434   23.479  -8.736  1.00 0.00 ? 92  PRO A N    3  
ATOM 4561  C CA   . PRO A 1 92  ? 2.806   23.890  -8.466  1.00 0.00 ? 92  PRO A CA   3  
ATOM 4562  C C    . PRO A 1 92  ? 3.262   23.385  -7.091  1.00 0.00 ? 92  PRO A C    3  
ATOM 4563  O O    . PRO A 1 92  ? 2.679   23.745  -6.058  1.00 0.00 ? 92  PRO A O    3  
ATOM 4564  C CB   . PRO A 1 92  ? 2.797   25.416  -8.576  1.00 0.00 ? 92  PRO A CB   3  
ATOM 4565  C CG   . PRO A 1 92  ? 1.368   25.809  -8.209  1.00 0.00 ? 92  PRO A CG   3  
ATOM 4566  C CD   . PRO A 1 92  ? 0.534   24.626  -8.700  1.00 0.00 ? 92  PRO A CD   3  
ATOM 4567  H HA   . PRO A 1 92  ? 3.467   23.490  -9.237  1.00 0.00 ? 92  PRO A HA   3  
ATOM 4568  H HB2  . PRO A 1 92  ? 3.532   25.885  -7.920  1.00 0.00 ? 92  PRO A HB2  3  
ATOM 4569  H HB3  . PRO A 1 92  ? 2.979   25.693  -9.615  1.00 0.00 ? 92  PRO A HB3  3  
ATOM 4570  H HG2  . PRO A 1 92  ? 1.282   25.905  -7.129  1.00 0.00 ? 92  PRO A HG2  3  
ATOM 4571  H HG3  . PRO A 1 92  ? 1.070   26.736  -8.696  1.00 0.00 ? 92  PRO A HG3  3  
ATOM 4572  H HD2  . PRO A 1 92  ? -0.305  24.456  -8.025  1.00 0.00 ? 92  PRO A HD2  3  
ATOM 4573  H HD3  . PRO A 1 92  ? 0.169   24.831  -9.707  1.00 0.00 ? 92  PRO A HD3  3  
ATOM 4574  N N    . GLY A 1 93  ? 4.301   22.548  -7.065  1.00 0.00 ? 93  GLY A N    3  
ATOM 4575  C CA   . GLY A 1 93  ? 4.831   21.943  -5.853  1.00 0.00 ? 93  GLY A CA   3  
ATOM 4576  C C    . GLY A 1 93  ? 6.225   21.396  -6.095  1.00 0.00 ? 93  GLY A C    3  
ATOM 4577  O O    . GLY A 1 93  ? 6.389   20.179  -6.193  1.00 0.00 ? 93  GLY A O    3  
ATOM 4578  H H    . GLY A 1 93  ? 4.715   22.243  -7.941  1.00 0.00 ? 93  GLY A H    3  
ATOM 4579  H HA2  . GLY A 1 93  ? 4.857   22.669  -5.042  1.00 0.00 ? 93  GLY A HA2  3  
ATOM 4580  H HA3  . GLY A 1 93  ? 4.186   21.116  -5.566  1.00 0.00 ? 93  GLY A HA3  3  
ATOM 4581  N N    . ALA A 1 94  ? 7.214   22.279  -6.242  1.00 0.00 ? 94  ALA A N    3  
ATOM 4582  C CA   . ALA A 1 94  ? 8.596   21.886  -6.474  1.00 0.00 ? 94  ALA A CA   3  
ATOM 4583  C C    . ALA A 1 94  ? 9.093   21.016  -5.312  1.00 0.00 ? 94  ALA A C    3  
ATOM 4584  O O    . ALA A 1 94  ? 8.886   21.358  -4.146  1.00 0.00 ? 94  ALA A O    3  
ATOM 4585  C CB   . ALA A 1 94  ? 9.461   23.133  -6.664  1.00 0.00 ? 94  ALA A CB   3  
ATOM 4586  H H    . ALA A 1 94  ? 7.007   23.260  -6.097  1.00 0.00 ? 94  ALA A H    3  
ATOM 4587  H HA   . ALA A 1 94  ? 8.620   21.305  -7.394  1.00 0.00 ? 94  ALA A HA   3  
ATOM 4588  H HB1  . ALA A 1 94  ? 10.508  22.846  -6.771  1.00 0.00 ? 94  ALA A HB1  3  
ATOM 4589  H HB2  . ALA A 1 94  ? 9.146   23.674  -7.556  1.00 0.00 ? 94  ALA A HB2  3  
ATOM 4590  H HB3  . ALA A 1 94  ? 9.352   23.784  -5.799  1.00 0.00 ? 94  ALA A HB3  3  
ATOM 4591  N N    . SER A 1 95  ? 9.724   19.887  -5.636  1.00 0.00 ? 95  SER A N    3  
ATOM 4592  C CA   . SER A 1 95  ? 10.063  18.827  -4.691  1.00 0.00 ? 95  SER A CA   3  
ATOM 4593  C C    . SER A 1 95  ? 11.367  19.101  -3.921  1.00 0.00 ? 95  SER A C    3  
ATOM 4594  O O    . SER A 1 95  ? 11.616  18.417  -2.928  1.00 0.00 ? 95  SER A O    3  
ATOM 4595  C CB   . SER A 1 95  ? 10.122  17.495  -5.457  1.00 0.00 ? 95  SER A CB   3  
ATOM 4596  O OG   . SER A 1 95  ? 9.571   16.434  -4.698  1.00 0.00 ? 95  SER A OG   3  
ATOM 4597  H H    . SER A 1 95  ? 9.898   19.717  -6.620  1.00 0.00 ? 95  SER A H    3  
ATOM 4598  H HA   . SER A 1 95  ? 9.253   18.770  -3.963  1.00 0.00 ? 95  SER A HA   3  
ATOM 4599  H HB2  . SER A 1 95  ? 9.537   17.575  -6.375  1.00 0.00 ? 95  SER A HB2  3  
ATOM 4600  H HB3  . SER A 1 95  ? 11.153  17.262  -5.726  1.00 0.00 ? 95  SER A HB3  3  
ATOM 4601  H HG   . SER A 1 95  ? 10.286  16.085  -4.130  1.00 0.00 ? 95  SER A HG   3  
ATOM 4602  N N    . SER A 1 96  ? 12.161  20.087  -4.365  1.00 0.00 ? 96  SER A N    3  
ATOM 4603  C CA   . SER A 1 96  ? 13.324  20.690  -3.717  1.00 0.00 ? 96  SER A CA   3  
ATOM 4604  C C    . SER A 1 96  ? 14.204  19.753  -2.880  1.00 0.00 ? 96  SER A C    3  
ATOM 4605  O O    . SER A 1 96  ? 13.935  19.508  -1.703  1.00 0.00 ? 96  SER A O    3  
ATOM 4606  C CB   . SER A 1 96  ? 12.841  21.879  -2.882  1.00 0.00 ? 96  SER A CB   3  
ATOM 4607  O OG   . SER A 1 96  ? 12.382  22.893  -3.755  1.00 0.00 ? 96  SER A OG   3  
ATOM 4608  H H    . SER A 1 96  ? 11.819  20.606  -5.159  1.00 0.00 ? 96  SER A H    3  
ATOM 4609  H HA   . SER A 1 96  ? 13.956  21.086  -4.511  1.00 0.00 ? 96  SER A HA   3  
ATOM 4610  H HB2  . SER A 1 96  ? 12.036  21.565  -2.215  1.00 0.00 ? 96  SER A HB2  3  
ATOM 4611  H HB3  . SER A 1 96  ? 13.666  22.267  -2.285  1.00 0.00 ? 96  SER A HB3  3  
ATOM 4612  H HG   . SER A 1 96  ? 13.175  23.229  -4.213  1.00 0.00 ? 96  SER A HG   3  
ATOM 4613  N N    . GLY A 1 97  ? 15.335  19.310  -3.433  1.00 0.00 ? 97  GLY A N    3  
ATOM 4614  C CA   . GLY A 1 97  ? 16.376  18.665  -2.646  1.00 0.00 ? 97  GLY A CA   3  
ATOM 4615  C C    . GLY A 1 97  ? 17.715  18.560  -3.378  1.00 0.00 ? 97  GLY A C    3  
ATOM 4616  O O    . GLY A 1 97  ? 17.810  19.005  -4.527  1.00 0.00 ? 97  GLY A O    3  
ATOM 4617  H H    . GLY A 1 97  ? 15.566  19.512  -4.396  1.00 0.00 ? 97  GLY A H    3  
ATOM 4618  H HA2  . GLY A 1 97  ? 16.519  19.224  -1.721  1.00 0.00 ? 97  GLY A HA2  3  
ATOM 4619  H HA3  . GLY A 1 97  ? 16.043  17.663  -2.402  1.00 0.00 ? 97  GLY A HA3  3  
ATOM 4620  N N    . PRO A 1 98  ? 18.738  17.996  -2.708  1.00 0.00 ? 98  PRO A N    3  
ATOM 4621  C CA   . PRO A 1 98  ? 20.006  17.579  -3.305  1.00 0.00 ? 98  PRO A CA   3  
ATOM 4622  C C    . PRO A 1 98  ? 19.847  16.270  -4.088  1.00 0.00 ? 98  PRO A C    3  
ATOM 4623  O O    . PRO A 1 98  ? 18.807  15.608  -4.000  1.00 0.00 ? 98  PRO A O    3  
ATOM 4624  C CB   . PRO A 1 98  ? 20.960  17.393  -2.119  1.00 0.00 ? 98  PRO A CB   3  
ATOM 4625  C CG   . PRO A 1 98  ? 20.038  16.983  -0.974  1.00 0.00 ? 98  PRO A CG   3  
ATOM 4626  C CD   . PRO A 1 98  ? 18.729  17.704  -1.281  1.00 0.00 ? 98  PRO A CD   3  
ATOM 4627  H HA   . PRO A 1 98  ? 20.388  18.350  -3.972  1.00 0.00 ? 98  PRO A HA   3  
ATOM 4628  H HB2  . PRO A 1 98  ? 21.719  16.636  -2.305  1.00 0.00 ? 98  PRO A HB2  3  
ATOM 4629  H HB3  . PRO A 1 98  ? 21.440  18.341  -1.882  1.00 0.00 ? 98  PRO A HB3  3  
ATOM 4630  H HG2  . PRO A 1 98  ? 19.878  15.905  -0.997  1.00 0.00 ? 98  PRO A HG2  3  
ATOM 4631  H HG3  . PRO A 1 98  ? 20.437  17.295  -0.010  1.00 0.00 ? 98  PRO A HG3  3  
ATOM 4632  H HD2  . PRO A 1 98  ? 17.884  17.071  -1.009  1.00 0.00 ? 98  PRO A HD2  3  
ATOM 4633  H HD3  . PRO A 1 98  ? 18.690  18.640  -0.724  1.00 0.00 ? 98  PRO A HD3  3  
ATOM 4634  N N    . SER A 1 99  ? 20.896  15.866  -4.810  1.00 0.00 ? 99  SER A N    3  
ATOM 4635  C CA   . SER A 1 99  ? 20.908  14.713  -5.697  1.00 0.00 ? 99  SER A CA   3  
ATOM 4636  C C    . SER A 1 99  ? 22.321  14.122  -5.694  1.00 0.00 ? 99  SER A C    3  
ATOM 4637  O O    . SER A 1 99  ? 23.223  14.675  -6.327  1.00 0.00 ? 99  SER A O    3  
ATOM 4638  C CB   . SER A 1 99  ? 20.454  15.204  -7.074  1.00 0.00 ? 99  SER A CB   3  
ATOM 4639  O OG   . SER A 1 99  ? 20.073  14.165  -7.956  1.00 0.00 ? 99  SER A OG   3  
ATOM 4640  H H    . SER A 1 99  ? 21.751  16.415  -4.782  1.00 0.00 ? 99  SER A H    3  
ATOM 4641  H HA   . SER A 1 99  ? 20.195  13.970  -5.338  1.00 0.00 ? 99  SER A HA   3  
ATOM 4642  H HB2  . SER A 1 99  ? 19.581  15.845  -6.934  1.00 0.00 ? 99  SER A HB2  3  
ATOM 4643  H HB3  . SER A 1 99  ? 21.246  15.799  -7.529  1.00 0.00 ? 99  SER A HB3  3  
ATOM 4644  H HG   . SER A 1 99  ? 20.886  13.734  -8.295  1.00 0.00 ? 99  SER A HG   3  
ATOM 4645  N N    . SER A 1 100 ? 22.525  13.042  -4.944  1.00 0.00 ? 100 SER A N    3  
ATOM 4646  C CA   . SER A 1 100 ? 23.816  12.384  -4.786  1.00 0.00 ? 100 SER A CA   3  
ATOM 4647  C C    . SER A 1 100 ? 24.216  11.555  -6.015  1.00 0.00 ? 100 SER A C    3  
ATOM 4648  O O    . SER A 1 100 ? 23.461  11.449  -6.984  1.00 0.00 ? 100 SER A O    3  
ATOM 4649  C CB   . SER A 1 100 ? 23.735  11.516  -3.530  1.00 0.00 ? 100 SER A CB   3  
ATOM 4650  O OG   . SER A 1 100 ? 23.629  12.346  -2.388  1.00 0.00 ? 100 SER A OG   3  
ATOM 4651  H H    . SER A 1 100 ? 21.743  12.611  -4.475  1.00 0.00 ? 100 SER A H    3  
ATOM 4652  H HA   . SER A 1 100 ? 24.583  13.146  -4.646  1.00 0.00 ? 100 SER A HA   3  
ATOM 4653  H HB2  . SER A 1 100 ? 22.872  10.852  -3.594  1.00 0.00 ? 100 SER A HB2  3  
ATOM 4654  H HB3  . SER A 1 100 ? 24.642  10.925  -3.440  1.00 0.00 ? 100 SER A HB3  3  
ATOM 4655  H HG   . SER A 1 100 ? 24.516  12.763  -2.301  1.00 0.00 ? 100 SER A HG   3  
ATOM 4656  N N    . GLY A 1 101 ? 25.411  10.963  -5.974  1.00 0.00 ? 101 GLY A N    3  
ATOM 4657  C CA   . GLY A 1 101 ? 25.939  10.036  -6.961  1.00 0.00 ? 101 GLY A CA   3  
ATOM 4658  C C    . GLY A 1 101 ? 26.302  8.752   -6.257  1.00 0.00 ? 101 GLY A C    3  
ATOM 4659  O O    . GLY A 1 101 ? 25.920  7.673   -6.755  1.00 0.00 ? 101 GLY A O    3  
ATOM 4660  H H    . GLY A 1 101 ? 25.983  11.045  -5.146  1.00 0.00 ? 101 GLY A H    3  
ATOM 4661  H HA2  . GLY A 1 101 ? 25.201  9.834   -7.733  1.00 0.00 ? 101 GLY A HA2  3  
ATOM 4662  H HA3  . GLY A 1 101 ? 26.827  10.461  -7.428  1.00 0.00 ? 101 GLY A HA3  3  
ATOM 4663  N N    . GLY A 1 1   ? 0.977   -24.229 -16.614 1.00 0.00 ? 1   GLY A N    4  
ATOM 4664  C CA   . GLY A 1 1   ? -0.369  -24.262 -16.025 1.00 0.00 ? 1   GLY A CA   4  
ATOM 4665  C C    . GLY A 1 1   ? -1.418  -23.890 -17.054 1.00 0.00 ? 1   GLY A C    4  
ATOM 4666  O O    . GLY A 1 1   ? -1.105  -23.694 -18.225 1.00 0.00 ? 1   GLY A O    4  
ATOM 4667  H H1   . GLY A 1 1   ? 1.262   -23.338 -16.968 1.00 0.00 ? 1   GLY A H1   4  
ATOM 4668  H HA2  . GLY A 1 1   ? -0.588  -25.250 -15.631 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 4669  H HA3  . GLY A 1 1   ? -0.405  -23.543 -15.209 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 4670  N N    . SER A 1 2   ? -2.670  -23.734 -16.627 1.00 0.00 ? 2   SER A N    4  
ATOM 4671  C CA   . SER A 1 2   ? -3.473  -22.662 -17.199 1.00 0.00 ? 2   SER A CA   4  
ATOM 4672  C C    . SER A 1 2   ? -2.919  -21.345 -16.641 1.00 0.00 ? 2   SER A C    4  
ATOM 4673  O O    . SER A 1 2   ? -2.360  -21.344 -15.542 1.00 0.00 ? 2   SER A O    4  
ATOM 4674  C CB   . SER A 1 2   ? -4.941  -22.848 -16.806 1.00 0.00 ? 2   SER A CB   4  
ATOM 4675  O OG   . SER A 1 2   ? -5.441  -24.063 -17.348 1.00 0.00 ? 2   SER A OG   4  
ATOM 4676  H H    . SER A 1 2   ? -2.851  -23.898 -15.641 1.00 0.00 ? 2   SER A H    4  
ATOM 4677  H HA   . SER A 1 2   ? -3.389  -22.659 -18.286 1.00 0.00 ? 2   SER A HA   4  
ATOM 4678  H HB2  . SER A 1 2   ? -5.034  -22.868 -15.720 1.00 0.00 ? 2   SER A HB2  4  
ATOM 4679  H HB3  . SER A 1 2   ? -5.529  -22.011 -17.189 1.00 0.00 ? 2   SER A HB3  4  
ATOM 4680  H HG   . SER A 1 2   ? -6.282  -23.820 -17.807 1.00 0.00 ? 2   SER A HG   4  
ATOM 4681  N N    . SER A 1 3   ? -3.128  -20.240 -17.354 1.00 0.00 ? 3   SER A N    4  
ATOM 4682  C CA   . SER A 1 3   ? -2.904  -18.888 -16.859 1.00 0.00 ? 3   SER A CA   4  
ATOM 4683  C C    . SER A 1 3   ? -1.464  -18.638 -16.410 1.00 0.00 ? 3   SER A C    4  
ATOM 4684  O O    . SER A 1 3   ? -1.144  -18.544 -15.222 1.00 0.00 ? 3   SER A O    4  
ATOM 4685  C CB   . SER A 1 3   ? -3.948  -18.563 -15.791 1.00 0.00 ? 3   SER A CB   4  
ATOM 4686  O OG   . SER A 1 3   ? -5.242  -18.853 -16.275 1.00 0.00 ? 3   SER A OG   4  
ATOM 4687  H H    . SER A 1 3   ? -3.582  -20.290 -18.256 1.00 0.00 ? 3   SER A H    4  
ATOM 4688  H HA   . SER A 1 3   ? -3.080  -18.208 -17.689 1.00 0.00 ? 3   SER A HA   4  
ATOM 4689  H HB2  . SER A 1 3   ? -3.755  -19.168 -14.906 1.00 0.00 ? 3   SER A HB2  4  
ATOM 4690  H HB3  . SER A 1 3   ? -3.899  -17.509 -15.527 1.00 0.00 ? 3   SER A HB3  4  
ATOM 4691  H HG   . SER A 1 3   ? -5.812  -18.872 -15.474 1.00 0.00 ? 3   SER A HG   4  
ATOM 4692  N N    . GLY A 1 4   ? -0.605  -18.451 -17.405 1.00 0.00 ? 4   GLY A N    4  
ATOM 4693  C CA   . GLY A 1 4   ? 0.743   -17.939 -17.247 1.00 0.00 ? 4   GLY A CA   4  
ATOM 4694  C C    . GLY A 1 4   ? 0.831   -16.445 -17.547 1.00 0.00 ? 4   GLY A C    4  
ATOM 4695  O O    . GLY A 1 4   ? 1.901   -15.978 -17.939 1.00 0.00 ? 4   GLY A O    4  
ATOM 4696  H H    . GLY A 1 4   ? -0.932  -18.624 -18.350 1.00 0.00 ? 4   GLY A H    4  
ATOM 4697  H HA2  . GLY A 1 4   ? 1.053   -18.093 -16.217 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 4698  H HA3  . GLY A 1 4   ? 1.420   -18.485 -17.904 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 4699  N N    . SER A 1 5   ? -0.263  -15.685 -17.411 1.00 0.00 ? 5   SER A N    4  
ATOM 4700  C CA   . SER A 1 5   ? -0.194  -14.232 -17.428 1.00 0.00 ? 5   SER A CA   4  
ATOM 4701  C C    . SER A 1 5   ? 0.390   -13.821 -16.075 1.00 0.00 ? 5   SER A C    4  
ATOM 4702  O O    . SER A 1 5   ? -0.348  -13.670 -15.101 1.00 0.00 ? 5   SER A O    4  
ATOM 4703  C CB   . SER A 1 5   ? -1.581  -13.616 -17.711 1.00 0.00 ? 5   SER A CB   4  
ATOM 4704  O OG   . SER A 1 5   ? -1.479  -12.564 -18.660 1.00 0.00 ? 5   SER A OG   4  
ATOM 4705  H H    . SER A 1 5   ? -1.082  -16.091 -16.977 1.00 0.00 ? 5   SER A H    4  
ATOM 4706  H HA   . SER A 1 5   ? 0.497   -13.930 -18.217 1.00 0.00 ? 5   SER A HA   4  
ATOM 4707  H HB2  . SER A 1 5   ? -2.245  -14.379 -18.117 1.00 0.00 ? 5   SER A HB2  4  
ATOM 4708  H HB3  . SER A 1 5   ? -2.031  -13.228 -16.795 1.00 0.00 ? 5   SER A HB3  4  
ATOM 4709  H HG   . SER A 1 5   ? -2.381  -12.177 -18.768 1.00 0.00 ? 5   SER A HG   4  
ATOM 4710  N N    . SER A 1 6   ? 1.715   -13.705 -16.007 1.00 0.00 ? 6   SER A N    4  
ATOM 4711  C CA   . SER A 1 6   ? 2.432   -13.233 -14.838 1.00 0.00 ? 6   SER A CA   4  
ATOM 4712  C C    . SER A 1 6   ? 2.043   -11.775 -14.591 1.00 0.00 ? 6   SER A C    4  
ATOM 4713  O O    . SER A 1 6   ? 2.553   -10.874 -15.266 1.00 0.00 ? 6   SER A O    4  
ATOM 4714  C CB   . SER A 1 6   ? 3.937   -13.413 -15.073 1.00 0.00 ? 6   SER A CB   4  
ATOM 4715  O OG   . SER A 1 6   ? 4.226   -14.757 -15.406 1.00 0.00 ? 6   SER A OG   4  
ATOM 4716  H H    . SER A 1 6   ? 2.280   -13.973 -16.804 1.00 0.00 ? 6   SER A H    4  
ATOM 4717  H HA   . SER A 1 6   ? 2.130   -13.833 -13.981 1.00 0.00 ? 6   SER A HA   4  
ATOM 4718  H HB2  . SER A 1 6   ? 4.253   -12.775 -15.896 1.00 0.00 ? 6   SER A HB2  4  
ATOM 4719  H HB3  . SER A 1 6   ? 4.485   -13.130 -14.176 1.00 0.00 ? 6   SER A HB3  4  
ATOM 4720  H HG   . SER A 1 6   ? 3.700   -15.327 -14.798 1.00 0.00 ? 6   SER A HG   4  
ATOM 4721  N N    . GLY A 1 7   ? 1.095   -11.536 -13.689 1.00 0.00 ? 7   GLY A N    4  
ATOM 4722  C CA   . GLY A 1 7   ? 0.451   -10.242 -13.549 1.00 0.00 ? 7   GLY A CA   4  
ATOM 4723  C C    . GLY A 1 7   ? -0.641  -10.256 -12.482 1.00 0.00 ? 7   GLY A C    4  
ATOM 4724  O O    . GLY A 1 7   ? -0.815  -11.246 -11.758 1.00 0.00 ? 7   GLY A O    4  
ATOM 4725  H H    . GLY A 1 7   ? 0.643   -12.319 -13.226 1.00 0.00 ? 7   GLY A H    4  
ATOM 4726  H HA2  . GLY A 1 7   ? 1.199   -9.497  -13.274 1.00 0.00 ? 7   GLY A HA2  4  
ATOM 4727  H HA3  . GLY A 1 7   ? 0.016   -9.962  -14.509 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 4728  N N    . GLN A 1 8   ? -1.337  -9.121  -12.381 1.00 0.00 ? 8   GLN A N    4  
ATOM 4729  C CA   . GLN A 1 8   ? -2.136  -8.670  -11.250 1.00 0.00 ? 8   GLN A CA   4  
ATOM 4730  C C    . GLN A 1 8   ? -1.418  -8.893  -9.909  1.00 0.00 ? 8   GLN A C    4  
ATOM 4731  O O    . GLN A 1 8   ? -0.235  -9.235  -9.826  1.00 0.00 ? 8   GLN A O    4  
ATOM 4732  C CB   . GLN A 1 8   ? -3.579  -9.241  -11.322 1.00 0.00 ? 8   GLN A CB   4  
ATOM 4733  C CG   . GLN A 1 8   ? -4.473  -8.381  -12.230 1.00 0.00 ? 8   GLN A CG   4  
ATOM 4734  C CD   . GLN A 1 8   ? -5.966  -8.615  -11.995 1.00 0.00 ? 8   GLN A CD   4  
ATOM 4735  O OE1  . GLN A 1 8   ? -6.561  -7.968  -11.134 1.00 0.00 ? 8   GLN A OE1  4  
ATOM 4736  N NE2  . GLN A 1 8   ? -6.601  -9.504  -12.738 1.00 0.00 ? 8   GLN A NE2  4  
ATOM 4737  H H    . GLN A 1 8   ? -1.211  -8.459  -13.136 1.00 0.00 ? 8   GLN A H    4  
ATOM 4738  H HA   . GLN A 1 8   ? -2.214  -7.588  -11.349 1.00 0.00 ? 8   GLN A HA   4  
ATOM 4739  H HB2  . GLN A 1 8   ? -3.571  -10.273 -11.675 1.00 0.00 ? 8   GLN A HB2  4  
ATOM 4740  H HB3  . GLN A 1 8   ? -4.041  -9.238  -10.336 1.00 0.00 ? 8   GLN A HB3  4  
ATOM 4741  H HG2  . GLN A 1 8   ? -4.282  -7.329  -12.017 1.00 0.00 ? 8   GLN A HG2  4  
ATOM 4742  H HG3  . GLN A 1 8   ? -4.230  -8.565  -13.272 1.00 0.00 ? 8   GLN A HG3  4  
ATOM 4743  H HE21 . GLN A 1 8   ? -6.098  -9.977  -13.488 1.00 0.00 ? 8   GLN A HE21 4  
ATOM 4744  H HE22 . GLN A 1 8   ? -7.600  -9.637  -12.635 1.00 0.00 ? 8   GLN A HE22 4  
ATOM 4745  N N    . TYR A 1 9   ? -2.141  -8.632  -8.823  1.00 0.00 ? 9   TYR A N    4  
ATOM 4746  C CA   . TYR A 1 9   ? -1.704  -8.917  -7.467  1.00 0.00 ? 9   TYR A CA   4  
ATOM 4747  C C    . TYR A 1 9   ? -1.348  -10.387 -7.278  1.00 0.00 ? 9   TYR A C    4  
ATOM 4748  O O    . TYR A 1 9   ? -0.566  -10.702 -6.386  1.00 0.00 ? 9   TYR A O    4  
ATOM 4749  C CB   . TYR A 1 9   ? -2.818  -8.516  -6.497  1.00 0.00 ? 9   TYR A CB   4  
ATOM 4750  C CG   . TYR A 1 9   ? -4.236  -8.765  -6.975  1.00 0.00 ? 9   TYR A CG   4  
ATOM 4751  C CD1  . TYR A 1 9   ? -4.796  -10.056 -6.980  1.00 0.00 ? 9   TYR A CD1  4  
ATOM 4752  C CD2  . TYR A 1 9   ? -4.987  -7.676  -7.451  1.00 0.00 ? 9   TYR A CD2  4  
ATOM 4753  C CE1  . TYR A 1 9   ? -6.100  -10.256 -7.467  1.00 0.00 ? 9   TYR A CE1  4  
ATOM 4754  C CE2  . TYR A 1 9   ? -6.285  -7.870  -7.932  1.00 0.00 ? 9   TYR A CE2  4  
ATOM 4755  C CZ   . TYR A 1 9   ? -6.851  -9.162  -7.950  1.00 0.00 ? 9   TYR A CZ   4  
ATOM 4756  O OH   . TYR A 1 9   ? -8.127  -9.349  -8.375  1.00 0.00 ? 9   TYR A OH   4  
ATOM 4757  H H    . TYR A 1 9   ? -3.099  -8.321  -8.935  1.00 0.00 ? 9   TYR A H    4  
ATOM 4758  H HA   . TYR A 1 9   ? -0.814  -8.326  -7.249  1.00 0.00 ? 9   TYR A HA   4  
ATOM 4759  H HB2  . TYR A 1 9   ? -2.658  -9.005  -5.535  1.00 0.00 ? 9   TYR A HB2  4  
ATOM 4760  H HB3  . TYR A 1 9   ? -2.729  -7.448  -6.349  1.00 0.00 ? 9   TYR A HB3  4  
ATOM 4761  H HD1  . TYR A 1 9   ? -4.229  -10.897 -6.614  1.00 0.00 ? 9   TYR A HD1  4  
ATOM 4762  H HD2  . TYR A 1 9   ? -4.591  -6.671  -7.454  1.00 0.00 ? 9   TYR A HD2  4  
ATOM 4763  H HE1  . TYR A 1 9   ? -6.531  -11.247 -7.484  1.00 0.00 ? 9   TYR A HE1  4  
ATOM 4764  H HE2  . TYR A 1 9   ? -6.824  -7.002  -8.278  1.00 0.00 ? 9   TYR A HE2  4  
ATOM 4765  H HH   . TYR A 1 9   ? -8.459  -8.552  -8.824  1.00 0.00 ? 9   TYR A HH   4  
ATOM 4766  N N    . GLU A 1 10  ? -1.897  -11.285 -8.100  1.00 0.00 ? 10  GLU A N    4  
ATOM 4767  C CA   . GLU A 1 10  ? -1.701  -12.718 -7.976  1.00 0.00 ? 10  GLU A CA   4  
ATOM 4768  C C    . GLU A 1 10  ? -0.224  -13.089 -8.114  1.00 0.00 ? 10  GLU A C    4  
ATOM 4769  O O    . GLU A 1 10  ? 0.225   -14.002 -7.431  1.00 0.00 ? 10  GLU A O    4  
ATOM 4770  C CB   . GLU A 1 10  ? -2.586  -13.468 -8.979  1.00 0.00 ? 10  GLU A CB   4  
ATOM 4771  C CG   . GLU A 1 10  ? -4.069  -13.183 -8.692  1.00 0.00 ? 10  GLU A CG   4  
ATOM 4772  C CD   . GLU A 1 10  ? -4.997  -14.232 -9.297  1.00 0.00 ? 10  GLU A CD   4  
ATOM 4773  O OE1  . GLU A 1 10  ? -4.979  -15.384 -8.814  1.00 0.00 ? 10  GLU A OE1  4  
ATOM 4774  O OE2  . GLU A 1 10  ? -5.818  -13.894 -10.183 1.00 0.00 ? 10  GLU A OE2  4  
ATOM 4775  H H    . GLU A 1 10  ? -2.517  -10.959 -8.822  1.00 0.00 ? 10  GLU A H    4  
ATOM 4776  H HA   . GLU A 1 10  ? -2.012  -13.017 -6.977  1.00 0.00 ? 10  GLU A HA   4  
ATOM 4777  H HB2  . GLU A 1 10  ? -2.339  -13.169 -10.000 1.00 0.00 ? 10  GLU A HB2  4  
ATOM 4778  H HB3  . GLU A 1 10  ? -2.393  -14.533 -8.862  1.00 0.00 ? 10  GLU A HB3  4  
ATOM 4779  H HG2  . GLU A 1 10  ? -4.234  -13.174 -7.614  1.00 0.00 ? 10  GLU A HG2  4  
ATOM 4780  H HG3  . GLU A 1 10  ? -4.328  -12.199 -9.082  1.00 0.00 ? 10  GLU A HG3  4  
ATOM 4781  N N    . LEU A 1 11  ? 0.562   -12.366 -8.921  1.00 0.00 ? 11  LEU A N    4  
ATOM 4782  C CA   . LEU A 1 11  ? 2.007   -12.592 -9.029  1.00 0.00 ? 11  LEU A CA   4  
ATOM 4783  C C    . LEU A 1 11  ? 2.643   -12.402 -7.647  1.00 0.00 ? 11  LEU A C    4  
ATOM 4784  O O    . LEU A 1 11  ? 3.304   -13.298 -7.112  1.00 0.00 ? 11  LEU A O    4  
ATOM 4785  C CB   . LEU A 1 11  ? 2.597   -11.633 -10.087 1.00 0.00 ? 11  LEU A CB   4  
ATOM 4786  C CG   . LEU A 1 11  ? 3.996   -11.965 -10.650 1.00 0.00 ? 11  LEU A CG   4  
ATOM 4787  C CD1  . LEU A 1 11  ? 5.158   -11.888 -9.658  1.00 0.00 ? 11  LEU A CD1  4  
ATOM 4788  C CD2  . LEU A 1 11  ? 4.017   -13.337 -11.317 1.00 0.00 ? 11  LEU A CD2  4  
ATOM 4789  H H    . LEU A 1 11  ? 0.161   -11.581 -9.421  1.00 0.00 ? 11  LEU A H    4  
ATOM 4790  H HA   . LEU A 1 11  ? 2.163   -13.624 -9.343  1.00 0.00 ? 11  LEU A HA   4  
ATOM 4791  H HB2  . LEU A 1 11  ? 1.911   -11.620 -10.936 1.00 0.00 ? 11  LEU A HB2  4  
ATOM 4792  H HB3  . LEU A 1 11  ? 2.605   -10.617 -9.691  1.00 0.00 ? 11  LEU A HB3  4  
ATOM 4793  H HG   . LEU A 1 11  ? 4.193   -11.228 -11.429 1.00 0.00 ? 11  LEU A HG   4  
ATOM 4794  H HD11 . LEU A 1 11  ? 5.189   -10.910 -9.190  1.00 0.00 ? 11  LEU A HD11 4  
ATOM 4795  H HD12 . LEU A 1 11  ? 5.076   -12.659 -8.897  1.00 0.00 ? 11  LEU A HD12 4  
ATOM 4796  H HD13 . LEU A 1 11  ? 6.100   -12.034 -10.188 1.00 0.00 ? 11  LEU A HD13 4  
ATOM 4797  H HD21 . LEU A 1 11  ? 3.172   -13.434 -11.993 1.00 0.00 ? 11  LEU A HD21 4  
ATOM 4798  H HD22 . LEU A 1 11  ? 4.943   -13.439 -11.880 1.00 0.00 ? 11  LEU A HD22 4  
ATOM 4799  H HD23 . LEU A 1 11  ? 3.972   -14.127 -10.571 1.00 0.00 ? 11  LEU A HD23 4  
ATOM 4800  N N    . TYR A 1 12  ? 2.377   -11.244 -7.044  1.00 0.00 ? 12  TYR A N    4  
ATOM 4801  C CA   . TYR A 1 12  ? 2.908   -10.794 -5.760  1.00 0.00 ? 12  TYR A CA   4  
ATOM 4802  C C    . TYR A 1 12  ? 2.234   -11.522 -4.592  1.00 0.00 ? 12  TYR A C    4  
ATOM 4803  O O    . TYR A 1 12  ? 2.617   -11.340 -3.435  1.00 0.00 ? 12  TYR A O    4  
ATOM 4804  C CB   . TYR A 1 12  ? 2.726   -9.266  -5.636  1.00 0.00 ? 12  TYR A CB   4  
ATOM 4805  C CG   . TYR A 1 12  ? 2.920   -8.477  -6.928  1.00 0.00 ? 12  TYR A CG   4  
ATOM 4806  C CD1  . TYR A 1 12  ? 3.960   -8.820  -7.813  1.00 0.00 ? 12  TYR A CD1  4  
ATOM 4807  C CD2  . TYR A 1 12  ? 2.014   -7.461  -7.288  1.00 0.00 ? 12  TYR A CD2  4  
ATOM 4808  C CE1  . TYR A 1 12  ? 4.034   -8.249  -9.093  1.00 0.00 ? 12  TYR A CE1  4  
ATOM 4809  C CE2  . TYR A 1 12  ? 2.118   -6.835  -8.543  1.00 0.00 ? 12  TYR A CE2  4  
ATOM 4810  C CZ   . TYR A 1 12  ? 3.102   -7.255  -9.463  1.00 0.00 ? 12  TYR A CZ   4  
ATOM 4811  O OH   . TYR A 1 12  ? 3.179   -6.676  -10.691 1.00 0.00 ? 12  TYR A OH   4  
ATOM 4812  H H    . TYR A 1 12  ? 1.745   -10.612 -7.514  1.00 0.00 ? 12  TYR A H    4  
ATOM 4813  H HA   . TYR A 1 12  ? 3.974   -11.019 -5.733  1.00 0.00 ? 12  TYR A HA   4  
ATOM 4814  H HB2  . TYR A 1 12  ? 1.717   -9.073  -5.271  1.00 0.00 ? 12  TYR A HB2  4  
ATOM 4815  H HB3  . TYR A 1 12  ? 3.424   -8.895  -4.886  1.00 0.00 ? 12  TYR A HB3  4  
ATOM 4816  H HD1  . TYR A 1 12  ? 4.686   -9.566  -7.524  1.00 0.00 ? 12  TYR A HD1  4  
ATOM 4817  H HD2  . TYR A 1 12  ? 1.222   -7.168  -6.615  1.00 0.00 ? 12  TYR A HD2  4  
ATOM 4818  H HE1  . TYR A 1 12  ? 4.797   -8.594  -9.782  1.00 0.00 ? 12  TYR A HE1  4  
ATOM 4819  H HE2  . TYR A 1 12  ? 1.420   -6.065  -8.829  1.00 0.00 ? 12  TYR A HE2  4  
ATOM 4820  H HH   . TYR A 1 12  ? 3.458   -7.344  -11.351 1.00 0.00 ? 12  TYR A HH   4  
ATOM 4821  N N    . MET A 1 13  ? 1.226   -12.358 -4.855  1.00 0.00 ? 13  MET A N    4  
ATOM 4822  C CA   . MET A 1 13  ? 0.560   -13.147 -3.841  1.00 0.00 ? 13  MET A CA   4  
ATOM 4823  C C    . MET A 1 13  ? 1.445   -14.298 -3.356  1.00 0.00 ? 13  MET A C    4  
ATOM 4824  O O    . MET A 1 13  ? 1.128   -14.899 -2.325  1.00 0.00 ? 13  MET A O    4  
ATOM 4825  C CB   . MET A 1 13  ? -0.809  -13.603 -4.355  1.00 0.00 ? 13  MET A CB   4  
ATOM 4826  C CG   . MET A 1 13  ? -1.789  -13.751 -3.190  1.00 0.00 ? 13  MET A CG   4  
ATOM 4827  S SD   . MET A 1 13  ? -3.543  -13.603 -3.620  1.00 0.00 ? 13  MET A SD   4  
ATOM 4828  C CE   . MET A 1 13  ? -3.644  -11.810 -3.902  1.00 0.00 ? 13  MET A CE   4  
ATOM 4829  H H    . MET A 1 13  ? 0.872   -12.445 -5.799  1.00 0.00 ? 13  MET A H    4  
ATOM 4830  H HA   . MET A 1 13  ? 0.379   -12.480 -3.007  1.00 0.00 ? 13  MET A HA   4  
ATOM 4831  H HB2  . MET A 1 13  ? -1.199  -12.835 -5.014  1.00 0.00 ? 13  MET A HB2  4  
ATOM 4832  H HB3  . MET A 1 13  ? -0.727  -14.539 -4.909  1.00 0.00 ? 13  MET A HB3  4  
ATOM 4833  H HG2  . MET A 1 13  ? -1.617  -14.717 -2.725  1.00 0.00 ? 13  MET A HG2  4  
ATOM 4834  H HG3  . MET A 1 13  ? -1.571  -12.978 -2.455  1.00 0.00 ? 13  MET A HG3  4  
ATOM 4835  H HE1  . MET A 1 13  ? -2.962  -11.512 -4.699  1.00 0.00 ? 13  MET A HE1  4  
ATOM 4836  H HE2  . MET A 1 13  ? -4.662  -11.540 -4.183  1.00 0.00 ? 13  MET A HE2  4  
ATOM 4837  H HE3  . MET A 1 13  ? -3.379  -11.274 -2.990  1.00 0.00 ? 13  MET A HE3  4  
ATOM 4838  N N    . TYR A 1 14  ? 2.567   -14.563 -4.034  1.00 0.00 ? 14  TYR A N    4  
ATOM 4839  C CA   . TYR A 1 14  ? 3.558   -15.556 -3.635  1.00 0.00 ? 14  TYR A CA   4  
ATOM 4840  C C    . TYR A 1 14  ? 4.921   -14.894 -3.518  1.00 0.00 ? 14  TYR A C    4  
ATOM 4841  O O    . TYR A 1 14  ? 5.483   -14.859 -2.420  1.00 0.00 ? 14  TYR A O    4  
ATOM 4842  C CB   . TYR A 1 14  ? 3.579   -16.749 -4.602  1.00 0.00 ? 14  TYR A CB   4  
ATOM 4843  C CG   . TYR A 1 14  ? 2.219   -17.084 -5.161  1.00 0.00 ? 14  TYR A CG   4  
ATOM 4844  C CD1  . TYR A 1 14  ? 1.221   -17.560 -4.299  1.00 0.00 ? 14  TYR A CD1  4  
ATOM 4845  C CD2  . TYR A 1 14  ? 1.920   -16.781 -6.500  1.00 0.00 ? 14  TYR A CD2  4  
ATOM 4846  C CE1  . TYR A 1 14  ? -0.089  -17.720 -4.764  1.00 0.00 ? 14  TYR A CE1  4  
ATOM 4847  C CE2  . TYR A 1 14  ? 0.613   -16.955 -6.977  1.00 0.00 ? 14  TYR A CE2  4  
ATOM 4848  C CZ   . TYR A 1 14  ? -0.403  -17.397 -6.103  1.00 0.00 ? 14  TYR A CZ   4  
ATOM 4849  O OH   . TYR A 1 14  ? -1.676  -17.512 -6.561  1.00 0.00 ? 14  TYR A OH   4  
ATOM 4850  H H    . TYR A 1 14  ? 2.722   -14.051 -4.892  1.00 0.00 ? 14  TYR A H    4  
ATOM 4851  H HA   . TYR A 1 14  ? 3.284   -15.935 -2.653  1.00 0.00 ? 14  TYR A HA   4  
ATOM 4852  H HB2  . TYR A 1 14  ? 4.259   -16.551 -5.431  1.00 0.00 ? 14  TYR A HB2  4  
ATOM 4853  H HB3  . TYR A 1 14  ? 3.965   -17.612 -4.061  1.00 0.00 ? 14  TYR A HB3  4  
ATOM 4854  H HD1  . TYR A 1 14  ? 1.458   -17.763 -3.265  1.00 0.00 ? 14  TYR A HD1  4  
ATOM 4855  H HD2  . TYR A 1 14  ? 2.677   -16.356 -7.143  1.00 0.00 ? 14  TYR A HD2  4  
ATOM 4856  H HE1  . TYR A 1 14  ? -0.844  -18.072 -4.080  1.00 0.00 ? 14  TYR A HE1  4  
ATOM 4857  H HE2  . TYR A 1 14  ? 0.374   -16.669 -7.990  1.00 0.00 ? 14  TYR A HE2  4  
ATOM 4858  H HH   . TYR A 1 14  ? -2.316  -17.275 -5.864  1.00 0.00 ? 14  TYR A HH   4  
ATOM 4859  N N    . ARG A 1 15  ? 5.409   -14.325 -4.626  1.00 0.00 ? 15  ARG A N    4  
ATOM 4860  C CA   . ARG A 1 15  ? 6.690   -13.633 -4.714  1.00 0.00 ? 15  ARG A CA   4  
ATOM 4861  C C    . ARG A 1 15  ? 6.801   -12.549 -3.647  1.00 0.00 ? 15  ARG A C    4  
ATOM 4862  O O    . ARG A 1 15  ? 5.797   -11.949 -3.253  1.00 0.00 ? 15  ARG A O    4  
ATOM 4863  C CB   . ARG A 1 15  ? 6.852   -13.050 -6.134  1.00 0.00 ? 15  ARG A CB   4  
ATOM 4864  C CG   . ARG A 1 15  ? 7.908   -13.778 -6.979  1.00 0.00 ? 15  ARG A CG   4  
ATOM 4865  C CD   . ARG A 1 15  ? 9.338   -13.409 -6.567  1.00 0.00 ? 15  ARG A CD   4  
ATOM 4866  N NE   . ARG A 1 15  ? 10.334  -14.117 -7.384  1.00 0.00 ? 15  ARG A NE   4  
ATOM 4867  C CZ   . ARG A 1 15  ? 11.632  -14.268 -7.089  1.00 0.00 ? 15  ARG A CZ   4  
ATOM 4868  N NH1  . ARG A 1 15  ? 12.172  -13.687 -6.022  1.00 0.00 ? 15  ARG A NH1  4  
ATOM 4869  N NH2  . ARG A 1 15  ? 12.398  -15.016 -7.874  1.00 0.00 ? 15  ARG A NH2  4  
ATOM 4870  H H    . ARG A 1 15  ? 4.865   -14.380 -5.477  1.00 0.00 ? 15  ARG A H    4  
ATOM 4871  H HA   . ARG A 1 15  ? 7.468   -14.373 -4.529  1.00 0.00 ? 15  ARG A HA   4  
ATOM 4872  H HB2  . ARG A 1 15  ? 5.898   -13.116 -6.660  1.00 0.00 ? 15  ARG A HB2  4  
ATOM 4873  H HB3  . ARG A 1 15  ? 7.119   -11.994 -6.082  1.00 0.00 ? 15  ARG A HB3  4  
ATOM 4874  H HG2  . ARG A 1 15  ? 7.759   -14.855 -6.902  1.00 0.00 ? 15  ARG A HG2  4  
ATOM 4875  H HG3  . ARG A 1 15  ? 7.761   -13.493 -8.020  1.00 0.00 ? 15  ARG A HG3  4  
ATOM 4876  H HD2  . ARG A 1 15  ? 9.475   -12.334 -6.698  1.00 0.00 ? 15  ARG A HD2  4  
ATOM 4877  H HD3  . ARG A 1 15  ? 9.484   -13.665 -5.518  1.00 0.00 ? 15  ARG A HD3  4  
ATOM 4878  H HE   . ARG A 1 15  ? 9.980   -14.508 -8.251  1.00 0.00 ? 15  ARG A HE   4  
ATOM 4879  H HH11 . ARG A 1 15  ? 11.630  -13.035 -5.448  1.00 0.00 ? 15  ARG A HH11 4  
ATOM 4880  H HH12 . ARG A 1 15  ? 13.144  -13.802 -5.739  1.00 0.00 ? 15  ARG A HH12 4  
ATOM 4881  H HH21 . ARG A 1 15  ? 12.031  -15.448 -8.719  1.00 0.00 ? 15  ARG A HH21 4  
ATOM 4882  H HH22 . ARG A 1 15  ? 13.352  -15.265 -7.621  1.00 0.00 ? 15  ARG A HH22 4  
ATOM 4883  N N    . GLU A 1 16  ? 8.026   -12.320 -3.188  1.00 0.00 ? 16  GLU A N    4  
ATOM 4884  C CA   . GLU A 1 16  ? 8.377   -11.230 -2.297  1.00 0.00 ? 16  GLU A CA   4  
ATOM 4885  C C    . GLU A 1 16  ? 8.533   -9.943  -3.105  1.00 0.00 ? 16  GLU A C    4  
ATOM 4886  O O    . GLU A 1 16  ? 8.311   -9.901  -4.318  1.00 0.00 ? 16  GLU A O    4  
ATOM 4887  C CB   . GLU A 1 16  ? 9.644   -11.623 -1.505  1.00 0.00 ? 16  GLU A CB   4  
ATOM 4888  C CG   . GLU A 1 16  ? 9.333   -12.655 -0.406  1.00 0.00 ? 16  GLU A CG   4  
ATOM 4889  C CD   . GLU A 1 16  ? 10.557  -13.427 0.094   1.00 0.00 ? 16  GLU A CD   4  
ATOM 4890  O OE1  . GLU A 1 16  ? 10.908  -14.459 -0.522  1.00 0.00 ? 16  GLU A OE1  4  
ATOM 4891  O OE2  . GLU A 1 16  ? 11.105  -13.052 1.161   1.00 0.00 ? 16  GLU A OE2  4  
ATOM 4892  H H    . GLU A 1 16  ? 8.805   -12.782 -3.629  1.00 0.00 ? 16  GLU A H    4  
ATOM 4893  H HA   . GLU A 1 16  ? 7.564   -11.037 -1.609  1.00 0.00 ? 16  GLU A HA   4  
ATOM 4894  H HB2  . GLU A 1 16  ? 10.381  -12.040 -2.191  1.00 0.00 ? 16  GLU A HB2  4  
ATOM 4895  H HB3  . GLU A 1 16  ? 10.062  -10.734 -1.026  1.00 0.00 ? 16  GLU A HB3  4  
ATOM 4896  H HG2  . GLU A 1 16  ? 8.910   -12.118 0.439   1.00 0.00 ? 16  GLU A HG2  4  
ATOM 4897  H HG3  . GLU A 1 16  ? 8.591   -13.375 -0.759  1.00 0.00 ? 16  GLU A HG3  4  
ATOM 4898  N N    . VAL A 1 17  ? 8.886   -8.865  -2.414  1.00 0.00 ? 17  VAL A N    4  
ATOM 4899  C CA   . VAL A 1 17  ? 9.346   -7.635  -3.021  1.00 0.00 ? 17  VAL A CA   4  
ATOM 4900  C C    . VAL A 1 17  ? 10.302  -6.979  -2.022  1.00 0.00 ? 17  VAL A C    4  
ATOM 4901  O O    . VAL A 1 17  ? 10.210  -7.205  -0.808  1.00 0.00 ? 17  VAL A O    4  
ATOM 4902  C CB   . VAL A 1 17  ? 8.141   -6.756  -3.441  1.00 0.00 ? 17  VAL A CB   4  
ATOM 4903  C CG1  . VAL A 1 17  ? 7.130   -6.576  -2.304  1.00 0.00 ? 17  VAL A CG1  4  
ATOM 4904  C CG2  . VAL A 1 17  ? 8.539   -5.380  -3.989  1.00 0.00 ? 17  VAL A CG2  4  
ATOM 4905  H H    . VAL A 1 17  ? 9.046   -8.923  -1.418  1.00 0.00 ? 17  VAL A H    4  
ATOM 4906  H HA   . VAL A 1 17  ? 9.894   -7.924  -3.914  1.00 0.00 ? 17  VAL A HA   4  
ATOM 4907  H HB   . VAL A 1 17  ? 7.621   -7.271  -4.246  1.00 0.00 ? 17  VAL A HB   4  
ATOM 4908  H HG11 . VAL A 1 17  ? 6.694   -7.547  -2.071  1.00 0.00 ? 17  VAL A HG11 4  
ATOM 4909  H HG12 . VAL A 1 17  ? 7.625   -6.177  -1.420  1.00 0.00 ? 17  VAL A HG12 4  
ATOM 4910  H HG13 . VAL A 1 17  ? 6.329   -5.906  -2.615  1.00 0.00 ? 17  VAL A HG13 4  
ATOM 4911  H HG21 . VAL A 1 17  ? 8.955   -4.750  -3.203  1.00 0.00 ? 17  VAL A HG21 4  
ATOM 4912  H HG22 . VAL A 1 17  ? 9.269   -5.494  -4.790  1.00 0.00 ? 17  VAL A HG22 4  
ATOM 4913  H HG23 . VAL A 1 17  ? 7.660   -4.884  -4.406  1.00 0.00 ? 17  VAL A HG23 4  
ATOM 4914  N N    . ASP A 1 18  ? 11.235  -6.174  -2.520  1.00 0.00 ? 18  ASP A N    4  
ATOM 4915  C CA   . ASP A 1 18  ? 12.107  -5.341  -1.708  1.00 0.00 ? 18  ASP A CA   4  
ATOM 4916  C C    . ASP A 1 18  ? 11.313  -4.105  -1.328  1.00 0.00 ? 18  ASP A C    4  
ATOM 4917  O O    . ASP A 1 18  ? 11.224  -3.149  -2.099  1.00 0.00 ? 18  ASP A O    4  
ATOM 4918  C CB   . ASP A 1 18  ? 13.391  -4.995  -2.468  1.00 0.00 ? 18  ASP A CB   4  
ATOM 4919  C CG   . ASP A 1 18  ? 14.354  -6.168  -2.374  1.00 0.00 ? 18  ASP A CG   4  
ATOM 4920  O OD1  . ASP A 1 18  ? 14.967  -6.344  -1.298  1.00 0.00 ? 18  ASP A OD1  4  
ATOM 4921  O OD2  . ASP A 1 18  ? 14.444  -6.951  -3.347  1.00 0.00 ? 18  ASP A OD2  4  
ATOM 4922  H H    . ASP A 1 18  ? 11.276  -6.049  -3.524  1.00 0.00 ? 18  ASP A H    4  
ATOM 4923  H HA   . ASP A 1 18  ? 12.382  -5.878  -0.798  1.00 0.00 ? 18  ASP A HA   4  
ATOM 4924  H HB2  . ASP A 1 18  ? 13.172  -4.760  -3.512  1.00 0.00 ? 18  ASP A HB2  4  
ATOM 4925  H HB3  . ASP A 1 18  ? 13.856  -4.120  -2.010  1.00 0.00 ? 18  ASP A HB3  4  
ATOM 4926  N N    . THR A 1 19  ? 10.666  -4.134  -0.164  1.00 0.00 ? 19  THR A N    4  
ATOM 4927  C CA   . THR A 1 19  ? 9.728   -3.095  0.220   1.00 0.00 ? 19  THR A CA   4  
ATOM 4928  C C    . THR A 1 19  ? 10.402  -1.718  0.319   1.00 0.00 ? 19  THR A C    4  
ATOM 4929  O O    . THR A 1 19  ? 9.748   -0.725  -0.011  1.00 0.00 ? 19  THR A O    4  
ATOM 4930  C CB   . THR A 1 19  ? 9.003   -3.495  1.515   1.00 0.00 ? 19  THR A CB   4  
ATOM 4931  O OG1  . THR A 1 19  ? 9.892   -4.090  2.432   1.00 0.00 ? 19  THR A OG1  4  
ATOM 4932  C CG2  . THR A 1 19  ? 7.892   -4.513  1.240   1.00 0.00 ? 19  THR A CG2  4  
ATOM 4933  H H    . THR A 1 19  ? 10.759  -4.913  0.475   1.00 0.00 ? 19  THR A H    4  
ATOM 4934  H HA   . THR A 1 19  ? 8.980   -3.028  -0.578  1.00 0.00 ? 19  THR A HA   4  
ATOM 4935  H HB   . THR A 1 19  ? 8.553   -2.612  1.969   1.00 0.00 ? 19  THR A HB   4  
ATOM 4936  H HG1  . THR A 1 19  ? 9.532   -3.918  3.321   1.00 0.00 ? 19  THR A HG1  4  
ATOM 4937  H HG21 . THR A 1 19  ? 7.389   -4.782  2.168   1.00 0.00 ? 19  THR A HG21 4  
ATOM 4938  H HG22 . THR A 1 19  ? 7.155   -4.084  0.561   1.00 0.00 ? 19  THR A HG22 4  
ATOM 4939  H HG23 . THR A 1 19  ? 8.306   -5.413  0.789   1.00 0.00 ? 19  THR A HG23 4  
ATOM 4940  N N    . LEU A 1 20  ? 11.684  -1.617  0.699   1.00 0.00 ? 20  LEU A N    4  
ATOM 4941  C CA   . LEU A 1 20  ? 12.405  -0.357  0.613   1.00 0.00 ? 20  LEU A CA   4  
ATOM 4942  C C    . LEU A 1 20  ? 12.299  0.227   -0.791  1.00 0.00 ? 20  LEU A C    4  
ATOM 4943  O O    . LEU A 1 20  ? 11.796  1.340   -0.948  1.00 0.00 ? 20  LEU A O    4  
ATOM 4944  C CB   . LEU A 1 20  ? 13.877  -0.540  1.015   1.00 0.00 ? 20  LEU A CB   4  
ATOM 4945  C CG   . LEU A 1 20  ? 14.271  0.214   2.286   1.00 0.00 ? 20  LEU A CG   4  
ATOM 4946  C CD1  . LEU A 1 20  ? 14.064  1.730   2.154   1.00 0.00 ? 20  LEU A CD1  4  
ATOM 4947  C CD2  . LEU A 1 20  ? 13.580  -0.317  3.543   1.00 0.00 ? 20  LEU A CD2  4  
ATOM 4948  H H    . LEU A 1 20  ? 12.188  -2.416  1.072   1.00 0.00 ? 20  LEU A H    4  
ATOM 4949  H HA   . LEU A 1 20  ? 11.915  0.331   1.295   1.00 0.00 ? 20  LEU A HA   4  
ATOM 4950  H HB2  . LEU A 1 20  ? 14.113  -1.595  1.133   1.00 0.00 ? 20  LEU A HB2  4  
ATOM 4951  H HB3  . LEU A 1 20  ? 14.523  -0.181  0.213   1.00 0.00 ? 20  LEU A HB3  4  
ATOM 4952  H HG   . LEU A 1 20  ? 15.326  0.016   2.410   1.00 0.00 ? 20  LEU A HG   4  
ATOM 4953  H HD11 . LEU A 1 20  ? 14.474  2.227   3.030   1.00 0.00 ? 20  LEU A HD11 4  
ATOM 4954  H HD12 . LEU A 1 20  ? 14.590  2.093   1.270   1.00 0.00 ? 20  LEU A HD12 4  
ATOM 4955  H HD13 . LEU A 1 20  ? 13.009  1.985   2.081   1.00 0.00 ? 20  LEU A HD13 4  
ATOM 4956  H HD21 . LEU A 1 20  ? 12.508  -0.380  3.398   1.00 0.00 ? 20  LEU A HD21 4  
ATOM 4957  H HD22 . LEU A 1 20  ? 13.947  -1.317  3.755   1.00 0.00 ? 20  LEU A HD22 4  
ATOM 4958  H HD23 . LEU A 1 20  ? 13.800  0.319   4.398   1.00 0.00 ? 20  LEU A HD23 4  
ATOM 4959  N N    . GLU A 1 21  ? 12.752  -0.531  -1.787  1.00 0.00 ? 21  GLU A N    4  
ATOM 4960  C CA   . GLU A 1 21  ? 12.838  -0.111  -3.177  1.00 0.00 ? 21  GLU A CA   4  
ATOM 4961  C C    . GLU A 1 21  ? 11.451  0.104   -3.787  1.00 0.00 ? 21  GLU A C    4  
ATOM 4962  O O    . GLU A 1 21  ? 11.267  1.035   -4.570  1.00 0.00 ? 21  GLU A O    4  
ATOM 4963  C CB   . GLU A 1 21  ? 13.676  -1.129  -3.951  1.00 0.00 ? 21  GLU A CB   4  
ATOM 4964  C CG   . GLU A 1 21  ? 13.875  -0.690  -5.407  1.00 0.00 ? 21  GLU A CG   4  
ATOM 4965  C CD   . GLU A 1 21  ? 15.142  -1.273  -6.030  1.00 0.00 ? 21  GLU A CD   4  
ATOM 4966  O OE1  . GLU A 1 21  ? 15.514  -2.432  -5.722  1.00 0.00 ? 21  GLU A OE1  4  
ATOM 4967  O OE2  . GLU A 1 21  ? 15.774  -0.557  -6.839  1.00 0.00 ? 21  GLU A OE2  4  
ATOM 4968  H H    . GLU A 1 21  ? 13.066  -1.470  -1.582  1.00 0.00 ? 21  GLU A H    4  
ATOM 4969  H HA   . GLU A 1 21  ? 13.381  0.830   -3.211  1.00 0.00 ? 21  GLU A HA   4  
ATOM 4970  H HB2  . GLU A 1 21  ? 14.649  -1.181  -3.461  1.00 0.00 ? 21  GLU A HB2  4  
ATOM 4971  H HB3  . GLU A 1 21  ? 13.208  -2.114  -3.924  1.00 0.00 ? 21  GLU A HB3  4  
ATOM 4972  H HG2  . GLU A 1 21  ? 13.006  -0.988  -5.998  1.00 0.00 ? 21  GLU A HG2  4  
ATOM 4973  H HG3  . GLU A 1 21  ? 13.953  0.400   -5.440  1.00 0.00 ? 21  GLU A HG3  4  
ATOM 4974  N N    . LEU A 1 22  ? 10.450  -0.674  -3.363  1.00 0.00 ? 22  LEU A N    4  
ATOM 4975  C CA   . LEU A 1 22  ? 9.053   -0.425  -3.700  1.00 0.00 ? 22  LEU A CA   4  
ATOM 4976  C C    . LEU A 1 22  ? 8.661   0.982   -3.255  1.00 0.00 ? 22  LEU A C    4  
ATOM 4977  O O    . LEU A 1 22  ? 8.268   1.785   -4.096  1.00 0.00 ? 22  LEU A O    4  
ATOM 4978  C CB   . LEU A 1 22  ? 8.141   -1.509  -3.107  1.00 0.00 ? 22  LEU A CB   4  
ATOM 4979  C CG   . LEU A 1 22  ? 6.637   -1.163  -3.137  1.00 0.00 ? 22  LEU A CG   4  
ATOM 4980  C CD1  . LEU A 1 22  ? 6.121   -0.908  -4.548  1.00 0.00 ? 22  LEU A CD1  4  
ATOM 4981  C CD2  . LEU A 1 22  ? 5.810   -2.306  -2.545  1.00 0.00 ? 22  LEU A CD2  4  
ATOM 4982  H H    . LEU A 1 22  ? 10.689  -1.473  -2.782  1.00 0.00 ? 22  LEU A H    4  
ATOM 4983  H HA   . LEU A 1 22  ? 8.955   -0.464  -4.785  1.00 0.00 ? 22  LEU A HA   4  
ATOM 4984  H HB2  . LEU A 1 22  ? 8.311   -2.435  -3.656  1.00 0.00 ? 22  LEU A HB2  4  
ATOM 4985  H HB3  . LEU A 1 22  ? 8.432   -1.672  -2.077  1.00 0.00 ? 22  LEU A HB3  4  
ATOM 4986  H HG   . LEU A 1 22  ? 6.458   -0.276  -2.527  1.00 0.00 ? 22  LEU A HG   4  
ATOM 4987  H HD11 . LEU A 1 22  ? 5.066   -0.652  -4.523  1.00 0.00 ? 22  LEU A HD11 4  
ATOM 4988  H HD12 . LEU A 1 22  ? 6.664   -0.090  -5.015  1.00 0.00 ? 22  LEU A HD12 4  
ATOM 4989  H HD13 . LEU A 1 22  ? 6.255   -1.805  -5.146  1.00 0.00 ? 22  LEU A HD13 4  
ATOM 4990  H HD21 . LEU A 1 22  ? 4.759   -2.006  -2.524  1.00 0.00 ? 22  LEU A HD21 4  
ATOM 4991  H HD22 . LEU A 1 22  ? 5.936   -3.197  -3.160  1.00 0.00 ? 22  LEU A HD22 4  
ATOM 4992  H HD23 . LEU A 1 22  ? 6.144   -2.558  -1.543  1.00 0.00 ? 22  LEU A HD23 4  
ATOM 4993  N N    . THR A 1 23  ? 8.783   1.317   -1.962  1.00 0.00 ? 23  THR A N    4  
ATOM 4994  C CA   . THR A 1 23  ? 8.417   2.669   -1.529  1.00 0.00 ? 23  THR A CA   4  
ATOM 4995  C C    . THR A 1 23  ? 9.256   3.693   -2.301  1.00 0.00 ? 23  THR A C    4  
ATOM 4996  O O    . THR A 1 23  ? 8.765   4.776   -2.593  1.00 0.00 ? 23  THR A O    4  
ATOM 4997  C CB   . THR A 1 23  ? 8.561   2.898   -0.017  1.00 0.00 ? 23  THR A CB   4  
ATOM 4998  O OG1  . THR A 1 23  ? 9.900   2.880   0.450   1.00 0.00 ? 23  THR A OG1  4  
ATOM 4999  C CG2  . THR A 1 23  ? 7.733   1.902   0.769   1.00 0.00 ? 23  THR A CG2  4  
ATOM 5000  H H    . THR A 1 23  ? 9.216   0.663   -1.318  1.00 0.00 ? 23  THR A H    4  
ATOM 5001  H HA   . THR A 1 23  ? 7.348   2.820   -1.755  1.00 0.00 ? 23  THR A HA   4  
ATOM 5002  H HB   . THR A 1 23  ? 8.145   3.883   0.196   1.00 0.00 ? 23  THR A HB   4  
ATOM 5003  H HG1  . THR A 1 23  ? 10.319  2.045   0.177   1.00 0.00 ? 23  THR A HG1  4  
ATOM 5004  H HG21 . THR A 1 23  ? 6.812   1.683   0.224   1.00 0.00 ? 23  THR A HG21 4  
ATOM 5005  H HG22 . THR A 1 23  ? 8.315   1.001   0.908   1.00 0.00 ? 23  THR A HG22 4  
ATOM 5006  H HG23 . THR A 1 23  ? 7.494   2.310   1.749   1.00 0.00 ? 23  THR A HG23 4  
ATOM 5007  N N    . ARG A 1 24  ? 10.521  3.377   -2.602  1.00 0.00 ? 24  ARG A N    4  
ATOM 5008  C CA   . ARG A 1 24  ? 11.436  4.263   -3.322  1.00 0.00 ? 24  ARG A CA   4  
ATOM 5009  C C    . ARG A 1 24  ? 10.867  4.676   -4.668  1.00 0.00 ? 24  ARG A C    4  
ATOM 5010  O O    . ARG A 1 24  ? 10.667  5.875   -4.864  1.00 0.00 ? 24  ARG A O    4  
ATOM 5011  C CB   . ARG A 1 24  ? 12.839  3.638   -3.469  1.00 0.00 ? 24  ARG A CB   4  
ATOM 5012  C CG   . ARG A 1 24  ? 13.919  4.691   -3.192  1.00 0.00 ? 24  ARG A CG   4  
ATOM 5013  C CD   . ARG A 1 24  ? 13.971  4.971   -1.682  1.00 0.00 ? 24  ARG A CD   4  
ATOM 5014  N NE   . ARG A 1 24  ? 14.229  6.385   -1.377  1.00 0.00 ? 24  ARG A NE   4  
ATOM 5015  C CZ   . ARG A 1 24  ? 15.279  6.865   -0.705  1.00 0.00 ? 24  ARG A CZ   4  
ATOM 5016  N NH1  . ARG A 1 24  ? 16.381  6.154   -0.509  1.00 0.00 ? 24  ARG A NH1  4  
ATOM 5017  N NH2  . ARG A 1 24  ? 15.211  8.080   -0.182  1.00 0.00 ? 24  ARG A NH2  4  
ATOM 5018  H H    . ARG A 1 24  ? 10.833  2.465   -2.275  1.00 0.00 ? 24  ARG A H    4  
ATOM 5019  H HA   . ARG A 1 24  ? 11.515  5.178   -2.743  1.00 0.00 ? 24  ARG A HA   4  
ATOM 5020  H HB2  . ARG A 1 24  ? 12.968  2.832   -2.753  1.00 0.00 ? 24  ARG A HB2  4  
ATOM 5021  H HB3  . ARG A 1 24  ? 12.972  3.227   -4.475  1.00 0.00 ? 24  ARG A HB3  4  
ATOM 5022  H HG2  . ARG A 1 24  ? 14.891  4.323   -3.522  1.00 0.00 ? 24  ARG A HG2  4  
ATOM 5023  H HG3  . ARG A 1 24  ? 13.683  5.598   -3.748  1.00 0.00 ? 24  ARG A HG3  4  
ATOM 5024  H HD2  . ARG A 1 24  ? 13.017  4.715   -1.224  1.00 0.00 ? 24  ARG A HD2  4  
ATOM 5025  H HD3  . ARG A 1 24  ? 14.712  4.321   -1.221  1.00 0.00 ? 24  ARG A HD3  4  
ATOM 5026  H HE   . ARG A 1 24  ? 13.521  7.037   -1.710  1.00 0.00 ? 24  ARG A HE   4  
ATOM 5027  H HH11 . ARG A 1 24  ? 16.501  5.208   -0.886  1.00 0.00 ? 24  ARG A HH11 4  
ATOM 5028  H HH12 . ARG A 1 24  ? 17.244  6.602   -0.202  1.00 0.00 ? 24  ARG A HH12 4  
ATOM 5029  H HH21 . ARG A 1 24  ? 14.327  8.580   -0.122  1.00 0.00 ? 24  ARG A HH21 4  
ATOM 5030  H HH22 . ARG A 1 24  ? 15.915  8.333   0.516   1.00 0.00 ? 24  ARG A HH22 4  
ATOM 5031  N N    . GLN A 1 25  ? 10.582  3.711   -5.541  1.00 0.00 ? 25  GLN A N    4  
ATOM 5032  C CA   . GLN A 1 25  ? 9.983   3.935   -6.849  1.00 0.00 ? 25  GLN A CA   4  
ATOM 5033  C C    . GLN A 1 25  ? 8.666   4.685   -6.717  1.00 0.00 ? 25  GLN A C    4  
ATOM 5034  O O    . GLN A 1 25  ? 8.419   5.624   -7.473  1.00 0.00 ? 25  GLN A O    4  
ATOM 5035  C CB   . GLN A 1 25  ? 9.794   2.580   -7.547  1.00 0.00 ? 25  GLN A CB   4  
ATOM 5036  C CG   . GLN A 1 25  ? 11.069  2.136   -8.267  1.00 0.00 ? 25  GLN A CG   4  
ATOM 5037  C CD   . GLN A 1 25  ? 11.172  2.791   -9.644  1.00 0.00 ? 25  GLN A CD   4  
ATOM 5038  O OE1  . GLN A 1 25  ? 10.568  2.353   -10.624 1.00 0.00 ? 25  GLN A OE1  4  
ATOM 5039  N NE2  . GLN A 1 25  ? 11.874  3.904   -9.736  1.00 0.00 ? 25  GLN A NE2  4  
ATOM 5040  H H    . GLN A 1 25  ? 10.776  2.747   -5.284  1.00 0.00 ? 25  GLN A H    4  
ATOM 5041  H HA   . GLN A 1 25  ? 10.641  4.564   -7.445  1.00 0.00 ? 25  GLN A HA   4  
ATOM 5042  H HB2  . GLN A 1 25  ? 9.505   1.827   -6.813  1.00 0.00 ? 25  GLN A HB2  4  
ATOM 5043  H HB3  . GLN A 1 25  ? 9.002   2.652   -8.286  1.00 0.00 ? 25  GLN A HB3  4  
ATOM 5044  H HG2  . GLN A 1 25  ? 11.931  2.396   -7.662  1.00 0.00 ? 25  GLN A HG2  4  
ATOM 5045  H HG3  . GLN A 1 25  ? 11.065  1.056   -8.369  1.00 0.00 ? 25  GLN A HG3  4  
ATOM 5046  H HE21 . GLN A 1 25  ? 12.319  4.288   -8.911  1.00 0.00 ? 25  GLN A HE21 4  
ATOM 5047  H HE22 . GLN A 1 25  ? 11.930  4.410   -10.612 1.00 0.00 ? 25  GLN A HE22 4  
ATOM 5048  N N    . VAL A 1 26  ? 7.839   4.292   -5.747  1.00 0.00 ? 26  VAL A N    4  
ATOM 5049  C CA   . VAL A 1 26  ? 6.566   4.937   -5.478  1.00 0.00 ? 26  VAL A CA   4  
ATOM 5050  C C    . VAL A 1 26  ? 6.807   6.427   -5.202  1.00 0.00 ? 26  VAL A C    4  
ATOM 5051  O O    . VAL A 1 26  ? 6.274   7.277   -5.914  1.00 0.00 ? 26  VAL A O    4  
ATOM 5052  C CB   . VAL A 1 26  ? 5.872   4.172   -4.336  1.00 0.00 ? 26  VAL A CB   4  
ATOM 5053  C CG1  . VAL A 1 26  ? 4.675   4.933   -3.759  1.00 0.00 ? 26  VAL A CG1  4  
ATOM 5054  C CG2  . VAL A 1 26  ? 5.467   2.771   -4.815  1.00 0.00 ? 26  VAL A CG2  4  
ATOM 5055  H H    . VAL A 1 26  ? 8.095   3.498   -5.162  1.00 0.00 ? 26  VAL A H    4  
ATOM 5056  H HA   . VAL A 1 26  ? 5.951   4.853   -6.375  1.00 0.00 ? 26  VAL A HA   4  
ATOM 5057  H HB   . VAL A 1 26  ? 6.579   4.041   -3.522  1.00 0.00 ? 26  VAL A HB   4  
ATOM 5058  H HG11 . VAL A 1 26  ? 4.087   4.282   -3.118  1.00 0.00 ? 26  VAL A HG11 4  
ATOM 5059  H HG12 . VAL A 1 26  ? 5.025   5.773   -3.162  1.00 0.00 ? 26  VAL A HG12 4  
ATOM 5060  H HG13 . VAL A 1 26  ? 4.054   5.302   -4.572  1.00 0.00 ? 26  VAL A HG13 4  
ATOM 5061  H HG21 . VAL A 1 26  ? 5.328   2.120   -3.956  1.00 0.00 ? 26  VAL A HG21 4  
ATOM 5062  H HG22 . VAL A 1 26  ? 4.567   2.803   -5.424  1.00 0.00 ? 26  VAL A HG22 4  
ATOM 5063  H HG23 . VAL A 1 26  ? 6.245   2.322   -5.419  1.00 0.00 ? 26  VAL A HG23 4  
ATOM 5064  N N    . LYS A 1 27  ? 7.622   6.758   -4.195  1.00 0.00 ? 27  LYS A N    4  
ATOM 5065  C CA   . LYS A 1 27  ? 7.989   8.116   -3.826  1.00 0.00 ? 27  LYS A CA   4  
ATOM 5066  C C    . LYS A 1 27  ? 8.506   8.884   -5.037  1.00 0.00 ? 27  LYS A C    4  
ATOM 5067  O O    . LYS A 1 27  ? 8.005   9.974   -5.300  1.00 0.00 ? 27  LYS A O    4  
ATOM 5068  C CB   . LYS A 1 27  ? 9.021   8.049   -2.690  1.00 0.00 ? 27  LYS A CB   4  
ATOM 5069  C CG   . LYS A 1 27  ? 8.358   7.755   -1.336  1.00 0.00 ? 27  LYS A CG   4  
ATOM 5070  C CD   . LYS A 1 27  ? 9.387   7.519   -0.219  1.00 0.00 ? 27  LYS A CD   4  
ATOM 5071  C CE   . LYS A 1 27  ? 9.969   6.106   -0.304  1.00 0.00 ? 27  LYS A CE   4  
ATOM 5072  N NZ   . LYS A 1 27  ? 10.634  5.625   0.926   1.00 0.00 ? 27  LYS A NZ   4  
ATOM 5073  H H    . LYS A 1 27  ? 8.065   6.025   -3.650  1.00 0.00 ? 27  LYS A H    4  
ATOM 5074  H HA   . LYS A 1 27  ? 7.101   8.640   -3.474  1.00 0.00 ? 27  LYS A HA   4  
ATOM 5075  H HB2  . LYS A 1 27  ? 9.759   7.282   -2.914  1.00 0.00 ? 27  LYS A HB2  4  
ATOM 5076  H HB3  . LYS A 1 27  ? 9.546   8.997   -2.625  1.00 0.00 ? 27  LYS A HB3  4  
ATOM 5077  H HG2  . LYS A 1 27  ? 7.736   8.609   -1.069  1.00 0.00 ? 27  LYS A HG2  4  
ATOM 5078  H HG3  . LYS A 1 27  ? 7.703   6.887   -1.412  1.00 0.00 ? 27  LYS A HG3  4  
ATOM 5079  H HD2  . LYS A 1 27  ? 10.187  8.251   -0.308  1.00 0.00 ? 27  LYS A HD2  4  
ATOM 5080  H HD3  . LYS A 1 27  ? 8.870   7.638   0.731   1.00 0.00 ? 27  LYS A HD3  4  
ATOM 5081  H HE2  . LYS A 1 27  ? 9.130   5.442   -0.491  1.00 0.00 ? 27  LYS A HE2  4  
ATOM 5082  H HE3  . LYS A 1 27  ? 10.649  6.039   -1.153  1.00 0.00 ? 27  LYS A HE3  4  
ATOM 5083  H HZ1  . LYS A 1 27  ? 10.042  5.794   1.735   1.00 0.00 ? 27  LYS A HZ1  4  
ATOM 5084  H HZ2  . LYS A 1 27  ? 10.749  4.616   0.876   1.00 0.00 ? 27  LYS A HZ2  4  
ATOM 5085  H HZ3  . LYS A 1 27  ? 11.547  6.046   1.078   1.00 0.00 ? 27  LYS A HZ3  4  
ATOM 5086  N N    . GLU A 1 28  ? 9.461   8.333   -5.789  1.00 0.00 ? 28  GLU A N    4  
ATOM 5087  C CA   . GLU A 1 28  ? 10.043  8.951   -6.950  1.00 0.00 ? 28  GLU A CA   4  
ATOM 5088  C C    . GLU A 1 28  ? 8.980   9.359   -7.966  1.00 0.00 ? 28  GLU A C    4  
ATOM 5089  O O    . GLU A 1 28  ? 8.914   10.528  -8.341  1.00 0.00 ? 28  GLU A O    4  
ATOM 5090  C CB   . GLU A 1 28  ? 11.061  7.974   -7.571  1.00 0.00 ? 28  GLU A CB   4  
ATOM 5091  C CG   . GLU A 1 28  ? 12.338  8.731   -7.899  1.00 0.00 ? 28  GLU A CG   4  
ATOM 5092  C CD   . GLU A 1 28  ? 13.039  8.145   -9.124  1.00 0.00 ? 28  GLU A CD   4  
ATOM 5093  O OE1  . GLU A 1 28  ? 13.644  7.056   -8.987  1.00 0.00 ? 28  GLU A OE1  4  
ATOM 5094  O OE2  . GLU A 1 28  ? 12.996  8.783   -10.203 1.00 0.00 ? 28  GLU A OE2  4  
ATOM 5095  H H    . GLU A 1 28  ? 9.905   7.452   -5.585  1.00 0.00 ? 28  GLU A H    4  
ATOM 5096  H HA   . GLU A 1 28  ? 10.546  9.856   -6.603  1.00 0.00 ? 28  GLU A HA   4  
ATOM 5097  H HB2  . GLU A 1 28  ? 11.318  7.169   -6.886  1.00 0.00 ? 28  GLU A HB2  4  
ATOM 5098  H HB3  . GLU A 1 28  ? 10.652  7.524   -8.478  1.00 0.00 ? 28  GLU A HB3  4  
ATOM 5099  H HG2  . GLU A 1 28  ? 12.051  9.759   -8.075  1.00 0.00 ? 28  GLU A HG2  4  
ATOM 5100  H HG3  . GLU A 1 28  ? 13.008  8.708   -7.035  1.00 0.00 ? 28  GLU A HG3  4  
ATOM 5101  N N    . LYS A 1 29  ? 8.149   8.409   -8.407  1.00 0.00 ? 29  LYS A N    4  
ATOM 5102  C CA   . LYS A 1 29  ? 7.137   8.629   -9.436  1.00 0.00 ? 29  LYS A CA   4  
ATOM 5103  C C    . LYS A 1 29  ? 6.055   9.588   -8.944  1.00 0.00 ? 29  LYS A C    4  
ATOM 5104  O O    . LYS A 1 29  ? 5.581   10.436  -9.696  1.00 0.00 ? 29  LYS A O    4  
ATOM 5105  C CB   . LYS A 1 29  ? 6.564   7.267   -9.847  1.00 0.00 ? 29  LYS A CB   4  
ATOM 5106  C CG   . LYS A 1 29  ? 5.634   7.355   -11.063 1.00 0.00 ? 29  LYS A CG   4  
ATOM 5107  C CD   . LYS A 1 29  ? 5.270   5.942   -11.527 1.00 0.00 ? 29  LYS A CD   4  
ATOM 5108  C CE   . LYS A 1 29  ? 4.442   6.007   -12.810 1.00 0.00 ? 29  LYS A CE   4  
ATOM 5109  N NZ   . LYS A 1 29  ? 4.763   4.899   -13.728 1.00 0.00 ? 29  LYS A NZ   4  
ATOM 5110  H H    . LYS A 1 29  ? 8.253   7.467   -8.037  1.00 0.00 ? 29  LYS A H    4  
ATOM 5111  H HA   . LYS A 1 29  ? 7.622   9.074   -10.305 1.00 0.00 ? 29  LYS A HA   4  
ATOM 5112  H HB2  . LYS A 1 29  ? 7.400   6.609   -10.096 1.00 0.00 ? 29  LYS A HB2  4  
ATOM 5113  H HB3  . LYS A 1 29  ? 6.019   6.828   -9.012  1.00 0.00 ? 29  LYS A HB3  4  
ATOM 5114  H HG2  . LYS A 1 29  ? 4.727   7.905   -10.810 1.00 0.00 ? 29  LYS A HG2  4  
ATOM 5115  H HG3  . LYS A 1 29  ? 6.153   7.872   -11.872 1.00 0.00 ? 29  LYS A HG3  4  
ATOM 5116  H HD2  . LYS A 1 29  ? 6.196   5.396   -11.703 1.00 0.00 ? 29  LYS A HD2  4  
ATOM 5117  H HD3  . LYS A 1 29  ? 4.697   5.425   -10.758 1.00 0.00 ? 29  LYS A HD3  4  
ATOM 5118  H HE2  . LYS A 1 29  ? 3.379   5.997   -12.563 1.00 0.00 ? 29  LYS A HE2  4  
ATOM 5119  H HE3  . LYS A 1 29  ? 4.661   6.952   -13.306 1.00 0.00 ? 29  LYS A HE3  4  
ATOM 5120  H HZ1  . LYS A 1 29  ? 4.192   4.951   -14.569 1.00 0.00 ? 29  LYS A HZ1  4  
ATOM 5121  H HZ2  . LYS A 1 29  ? 5.738   4.930   -14.007 1.00 0.00 ? 29  LYS A HZ2  4  
ATOM 5122  H HZ3  . LYS A 1 29  ? 4.558   3.990   -13.323 1.00 0.00 ? 29  LYS A HZ3  4  
ATOM 5123  N N    . LEU A 1 30  ? 5.670   9.489   -7.671  1.00 0.00 ? 30  LEU A N    4  
ATOM 5124  C CA   . LEU A 1 30  ? 4.714   10.408  -7.074  1.00 0.00 ? 30  LEU A CA   4  
ATOM 5125  C C    . LEU A 1 30  ? 5.268   11.831  -7.121  1.00 0.00 ? 30  LEU A C    4  
ATOM 5126  O O    . LEU A 1 30  ? 4.570   12.730  -7.587  1.00 0.00 ? 30  LEU A O    4  
ATOM 5127  C CB   . LEU A 1 30  ? 4.395   9.995   -5.630  1.00 0.00 ? 30  LEU A CB   4  
ATOM 5128  C CG   . LEU A 1 30  ? 3.515   8.731   -5.513  1.00 0.00 ? 30  LEU A CG   4  
ATOM 5129  C CD1  . LEU A 1 30  ? 3.529   8.215   -4.069  1.00 0.00 ? 30  LEU A CD1  4  
ATOM 5130  C CD2  . LEU A 1 30  ? 2.065   8.948   -5.957  1.00 0.00 ? 30  LEU A CD2  4  
ATOM 5131  H H    . LEU A 1 30  ? 6.103   8.778   -7.089  1.00 0.00 ? 30  LEU A H    4  
ATOM 5132  H HA   . LEU A 1 30  ? 3.801   10.395  -7.671  1.00 0.00 ? 30  LEU A HA   4  
ATOM 5133  H HB2  . LEU A 1 30  ? 5.336   9.825   -5.104  1.00 0.00 ? 30  LEU A HB2  4  
ATOM 5134  H HB3  . LEU A 1 30  ? 3.906   10.836  -5.149  1.00 0.00 ? 30  LEU A HB3  4  
ATOM 5135  H HG   . LEU A 1 30  ? 3.924   7.952   -6.149  1.00 0.00 ? 30  LEU A HG   4  
ATOM 5136  H HD11 . LEU A 1 30  ? 2.959   7.289   -4.014  1.00 0.00 ? 30  LEU A HD11 4  
ATOM 5137  H HD12 . LEU A 1 30  ? 4.557   8.013   -3.768  1.00 0.00 ? 30  LEU A HD12 4  
ATOM 5138  H HD13 . LEU A 1 30  ? 3.090   8.931   -3.379  1.00 0.00 ? 30  LEU A HD13 4  
ATOM 5139  H HD21 . LEU A 1 30  ? 1.541   9.619   -5.288  1.00 0.00 ? 30  LEU A HD21 4  
ATOM 5140  H HD22 . LEU A 1 30  ? 2.032   9.352   -6.966  1.00 0.00 ? 30  LEU A HD22 4  
ATOM 5141  H HD23 . LEU A 1 30  ? 1.543   7.992   -5.952  1.00 0.00 ? 30  LEU A HD23 4  
ATOM 5142  N N    . ALA A 1 31  ? 6.503   12.037  -6.657  1.00 0.00 ? 31  ALA A N    4  
ATOM 5143  C CA   . ALA A 1 31  ? 7.157   13.340  -6.642  1.00 0.00 ? 31  ALA A CA   4  
ATOM 5144  C C    . ALA A 1 31  ? 7.453   13.849  -8.059  1.00 0.00 ? 31  ALA A C    4  
ATOM 5145  O O    . ALA A 1 31  ? 7.417   15.056  -8.279  1.00 0.00 ? 31  ALA A O    4  
ATOM 5146  C CB   . ALA A 1 31  ? 8.442   13.256  -5.811  1.00 0.00 ? 31  ALA A CB   4  
ATOM 5147  H H    . ALA A 1 31  ? 7.026   11.252  -6.279  1.00 0.00 ? 31  ALA A H    4  
ATOM 5148  H HA   . ALA A 1 31  ? 6.488   14.056  -6.160  1.00 0.00 ? 31  ALA A HA   4  
ATOM 5149  H HB1  . ALA A 1 31  ? 8.946   14.223  -5.818  1.00 0.00 ? 31  ALA A HB1  4  
ATOM 5150  H HB2  . ALA A 1 31  ? 8.198   12.989  -4.783  1.00 0.00 ? 31  ALA A HB2  4  
ATOM 5151  H HB3  . ALA A 1 31  ? 9.108   12.501  -6.227  1.00 0.00 ? 31  ALA A HB3  4  
ATOM 5152  N N    . LYS A 1 32  ? 7.712   12.955  -9.022  1.00 0.00 ? 32  LYS A N    4  
ATOM 5153  C CA   . LYS A 1 32  ? 7.869   13.273  -10.442 1.00 0.00 ? 32  LYS A CA   4  
ATOM 5154  C C    . LYS A 1 32  ? 6.618   13.979  -10.938 1.00 0.00 ? 32  LYS A C    4  
ATOM 5155  O O    . LYS A 1 32  ? 6.702   15.058  -11.523 1.00 0.00 ? 32  LYS A O    4  
ATOM 5156  C CB   . LYS A 1 32  ? 8.128   11.971  -11.219 1.00 0.00 ? 32  LYS A CB   4  
ATOM 5157  C CG   . LYS A 1 32  ? 8.545   12.170  -12.678 1.00 0.00 ? 32  LYS A CG   4  
ATOM 5158  C CD   . LYS A 1 32  ? 8.733   10.784  -13.315 1.00 0.00 ? 32  LYS A CD   4  
ATOM 5159  C CE   . LYS A 1 32  ? 9.528   10.872  -14.619 1.00 0.00 ? 32  LYS A CE   4  
ATOM 5160  N NZ   . LYS A 1 32  ? 10.150  9.583   -14.983 1.00 0.00 ? 32  LYS A NZ   4  
ATOM 5161  H H    . LYS A 1 32  ? 7.782   11.977  -8.760  1.00 0.00 ? 32  LYS A H    4  
ATOM 5162  H HA   . LYS A 1 32  ? 8.712   13.953  -10.557 1.00 0.00 ? 32  LYS A HA   4  
ATOM 5163  H HB2  . LYS A 1 32  ? 8.929   11.427  -10.719 1.00 0.00 ? 32  LYS A HB2  4  
ATOM 5164  H HB3  . LYS A 1 32  ? 7.225   11.360  -11.218 1.00 0.00 ? 32  LYS A HB3  4  
ATOM 5165  H HG2  . LYS A 1 32  ? 7.778   12.726  -13.214 1.00 0.00 ? 32  LYS A HG2  4  
ATOM 5166  H HG3  . LYS A 1 32  ? 9.486   12.724  -12.703 1.00 0.00 ? 32  LYS A HG3  4  
ATOM 5167  H HD2  . LYS A 1 32  ? 9.270   10.150  -12.611 1.00 0.00 ? 32  LYS A HD2  4  
ATOM 5168  H HD3  . LYS A 1 32  ? 7.757   10.332  -13.508 1.00 0.00 ? 32  LYS A HD3  4  
ATOM 5169  H HE2  . LYS A 1 32  ? 8.862   11.192  -15.421 1.00 0.00 ? 32  LYS A HE2  4  
ATOM 5170  H HE3  . LYS A 1 32  ? 10.318  11.617  -14.511 1.00 0.00 ? 32  LYS A HE3  4  
ATOM 5171  H HZ1  . LYS A 1 32  ? 9.470   8.829   -15.016 1.00 0.00 ? 32  LYS A HZ1  4  
ATOM 5172  H HZ2  . LYS A 1 32  ? 10.602  9.668   -15.887 1.00 0.00 ? 32  LYS A HZ2  4  
ATOM 5173  H HZ3  . LYS A 1 32  ? 10.854  9.323   -14.303 1.00 0.00 ? 32  LYS A HZ3  4  
ATOM 5174  N N    . ASN A 1 33  ? 5.457   13.374  -10.688 1.00 0.00 ? 33  ASN A N    4  
ATOM 5175  C CA   . ASN A 1 33  ? 4.192   13.932  -11.144 1.00 0.00 ? 33  ASN A CA   4  
ATOM 5176  C C    . ASN A 1 33  ? 3.811   15.133  -10.268 1.00 0.00 ? 33  ASN A C    4  
ATOM 5177  O O    . ASN A 1 33  ? 3.229   16.093  -10.768 1.00 0.00 ? 33  ASN A O    4  
ATOM 5178  C CB   . ASN A 1 33  ? 3.099   12.854  -11.085 1.00 0.00 ? 33  ASN A CB   4  
ATOM 5179  C CG   . ASN A 1 33  ? 3.356   11.621  -11.954 1.00 0.00 ? 33  ASN A CG   4  
ATOM 5180  O OD1  . ASN A 1 33  ? 4.402   11.455  -12.580 1.00 0.00 ? 33  ASN A OD1  4  
ATOM 5181  N ND2  . ASN A 1 33  ? 2.412   10.698  -12.000 1.00 0.00 ? 33  ASN A ND2  4  
ATOM 5182  H H    . ASN A 1 33  ? 5.465   12.449  -10.269 1.00 0.00 ? 33  ASN A H    4  
ATOM 5183  H HA   . ASN A 1 33  ? 4.294   14.260  -12.180 1.00 0.00 ? 33  ASN A HA   4  
ATOM 5184  H HB2  . ASN A 1 33  ? 2.980   12.526  -10.055 1.00 0.00 ? 33  ASN A HB2  4  
ATOM 5185  H HB3  . ASN A 1 33  ? 2.170   13.317  -11.410 1.00 0.00 ? 33  ASN A HB3  4  
ATOM 5186  H HD21 . ASN A 1 33  ? 1.504   10.873  -11.596 1.00 0.00 ? 33  ASN A HD21 4  
ATOM 5187  H HD22 . ASN A 1 33  ? 2.584   9.853   -12.537 1.00 0.00 ? 33  ASN A HD22 4  
ATOM 5188  N N    . GLY A 1 34  ? 4.265   15.163  -9.011  1.00 0.00 ? 34  GLY A N    4  
ATOM 5189  C CA   . GLY A 1 34  ? 4.022   16.228  -8.043  1.00 0.00 ? 34  GLY A CA   4  
ATOM 5190  C C    . GLY A 1 34  ? 2.890   15.901  -7.063  1.00 0.00 ? 34  GLY A C    4  
ATOM 5191  O O    . GLY A 1 34  ? 2.436   16.795  -6.345  1.00 0.00 ? 34  GLY A O    4  
ATOM 5192  H H    . GLY A 1 34  ? 4.752   14.345  -8.672  1.00 0.00 ? 34  GLY A H    4  
ATOM 5193  H HA2  . GLY A 1 34  ? 4.939   16.394  -7.474  1.00 0.00 ? 34  GLY A HA2  4  
ATOM 5194  H HA3  . GLY A 1 34  ? 3.783   17.156  -8.564  1.00 0.00 ? 34  GLY A HA3  4  
ATOM 5195  N N    . ILE A 1 35  ? 2.423   14.649  -7.024  1.00 0.00 ? 35  ILE A N    4  
ATOM 5196  C CA   . ILE A 1 35  ? 1.274   14.183  -6.251  1.00 0.00 ? 35  ILE A CA   4  
ATOM 5197  C C    . ILE A 1 35  ? 1.622   14.201  -4.757  1.00 0.00 ? 35  ILE A C    4  
ATOM 5198  O O    . ILE A 1 35  ? 2.635   13.615  -4.364  1.00 0.00 ? 35  ILE A O    4  
ATOM 5199  C CB   . ILE A 1 35  ? 0.885   12.773  -6.740  1.00 0.00 ? 35  ILE A CB   4  
ATOM 5200  C CG1  . ILE A 1 35  ? 0.442   12.853  -8.220  1.00 0.00 ? 35  ILE A CG1  4  
ATOM 5201  C CG2  . ILE A 1 35  ? -0.248  12.150  -5.903  1.00 0.00 ? 35  ILE A CG2  4  
ATOM 5202  C CD1  . ILE A 1 35  ? 0.160   11.485  -8.837  1.00 0.00 ? 35  ILE A CD1  4  
ATOM 5203  H H    . ILE A 1 35  ? 2.951   13.954  -7.535  1.00 0.00 ? 35  ILE A H    4  
ATOM 5204  H HA   . ILE A 1 35  ? 0.425   14.832  -6.453  1.00 0.00 ? 35  ILE A HA   4  
ATOM 5205  H HB   . ILE A 1 35  ? 1.763   12.129  -6.659  1.00 0.00 ? 35  ILE A HB   4  
ATOM 5206  H HG12 . ILE A 1 35  ? -0.456  13.468  -8.302  1.00 0.00 ? 35  ILE A HG12 4  
ATOM 5207  H HG13 . ILE A 1 35  ? 1.220   13.322  -8.819  1.00 0.00 ? 35  ILE A HG13 4  
ATOM 5208  H HG21 . ILE A 1 35  ? -0.046  12.213  -4.835  1.00 0.00 ? 35  ILE A HG21 4  
ATOM 5209  H HG22 . ILE A 1 35  ? -1.192  12.656  -6.103  1.00 0.00 ? 35  ILE A HG22 4  
ATOM 5210  H HG23 . ILE A 1 35  ? -0.331  11.094  -6.142  1.00 0.00 ? 35  ILE A HG23 4  
ATOM 5211  H HD11 . ILE A 1 35  ? -0.009  11.603  -9.905  1.00 0.00 ? 35  ILE A HD11 4  
ATOM 5212  H HD12 . ILE A 1 35  ? 1.012   10.829  -8.677  1.00 0.00 ? 35  ILE A HD12 4  
ATOM 5213  H HD13 . ILE A 1 35  ? -0.735  11.059  -8.390  1.00 0.00 ? 35  ILE A HD13 4  
ATOM 5214  N N    . CYS A 1 36  ? 0.764   14.791  -3.919  1.00 0.00 ? 36  CYS A N    4  
ATOM 5215  C CA   . CYS A 1 36  ? 0.870   14.813  -2.457  1.00 0.00 ? 36  CYS A CA   4  
ATOM 5216  C C    . CYS A 1 36  ? 0.605   13.418  -1.838  1.00 0.00 ? 36  CYS A C    4  
ATOM 5217  O O    . CYS A 1 36  ? -0.483  12.865  -2.023  1.00 0.00 ? 36  CYS A O    4  
ATOM 5218  C CB   . CYS A 1 36  ? -0.161  15.816  -1.916  1.00 0.00 ? 36  CYS A CB   4  
ATOM 5219  S SG   . CYS A 1 36  ? 0.022   17.447  -2.704  1.00 0.00 ? 36  CYS A SG   4  
ATOM 5220  H H    . CYS A 1 36  ? -0.012  15.297  -4.324  1.00 0.00 ? 36  CYS A H    4  
ATOM 5221  H HA   . CYS A 1 36  ? 1.873   15.154  -2.188  1.00 0.00 ? 36  CYS A HA   4  
ATOM 5222  H HB2  . CYS A 1 36  ? -1.161  15.437  -2.124  1.00 0.00 ? 36  CYS A HB2  4  
ATOM 5223  H HB3  . CYS A 1 36  ? -0.044  15.914  -0.837  1.00 0.00 ? 36  CYS A HB3  4  
ATOM 5224  H HG   . CYS A 1 36  ? -1.073  18.002  -2.161  1.00 0.00 ? 36  CYS A HG   4  
ATOM 5225  N N    . GLN A 1 37  ? 1.558   12.864  -1.073  1.00 0.00 ? 37  GLN A N    4  
ATOM 5226  C CA   . GLN A 1 37  ? 1.548   11.476  -0.570  1.00 0.00 ? 37  GLN A CA   4  
ATOM 5227  C C    . GLN A 1 37  ? 0.322   11.138  0.274   1.00 0.00 ? 37  GLN A C    4  
ATOM 5228  O O    . GLN A 1 37  ? -0.208  10.032  0.158   1.00 0.00 ? 37  GLN A O    4  
ATOM 5229  C CB   . GLN A 1 37  ? 2.843   11.113  0.185   1.00 0.00 ? 37  GLN A CB   4  
ATOM 5230  C CG   . GLN A 1 37  ? 4.133   11.207  -0.655  1.00 0.00 ? 37  GLN A CG   4  
ATOM 5231  C CD   . GLN A 1 37  ? 4.822   12.569  -0.521  1.00 0.00 ? 37  GLN A CD   4  
ATOM 5232  O OE1  . GLN A 1 37  ? 4.177   13.609  -0.468  1.00 0.00 ? 37  GLN A OE1  4  
ATOM 5233  N NE2  . GLN A 1 37  ? 6.138   12.618  -0.392  1.00 0.00 ? 37  GLN A NE2  4  
ATOM 5234  H H    . GLN A 1 37  ? 2.421   13.383  -0.955  1.00 0.00 ? 37  GLN A H    4  
ATOM 5235  H HA   . GLN A 1 37  ? 1.482   10.804  -1.416  1.00 0.00 ? 37  GLN A HA   4  
ATOM 5236  H HB2  . GLN A 1 37  ? 2.942   11.728  1.079   1.00 0.00 ? 37  GLN A HB2  4  
ATOM 5237  H HB3  . GLN A 1 37  ? 2.741   10.078  0.513   1.00 0.00 ? 37  GLN A HB3  4  
ATOM 5238  H HG2  . GLN A 1 37  ? 4.819   10.436  -0.298  1.00 0.00 ? 37  GLN A HG2  4  
ATOM 5239  H HG3  . GLN A 1 37  ? 3.910   10.998  -1.707  1.00 0.00 ? 37  GLN A HG3  4  
ATOM 5240  H HE21 . GLN A 1 37  ? 6.719   11.781  -0.420  1.00 0.00 ? 37  GLN A HE21 4  
ATOM 5241  H HE22 . GLN A 1 37  ? 6.559   13.530  -0.517  1.00 0.00 ? 37  GLN A HE22 4  
ATOM 5242  N N    . ARG A 1 38  ? -0.148  12.079  1.091   1.00 0.00 ? 38  ARG A N    4  
ATOM 5243  C CA   . ARG A 1 38  ? -1.377  11.928  1.863   1.00 0.00 ? 38  ARG A CA   4  
ATOM 5244  C C    . ARG A 1 38  ? -2.544  11.527  0.973   1.00 0.00 ? 38  ARG A C    4  
ATOM 5245  O O    . ARG A 1 38  ? -3.247  10.567  1.269   1.00 0.00 ? 38  ARG A O    4  
ATOM 5246  C CB   . ARG A 1 38  ? -1.669  13.207  2.665   1.00 0.00 ? 38  ARG A CB   4  
ATOM 5247  C CG   . ARG A 1 38  ? -1.533  14.543  1.937   1.00 0.00 ? 38  ARG A CG   4  
ATOM 5248  C CD   . ARG A 1 38  ? -2.675  15.516  2.252   1.00 0.00 ? 38  ARG A CD   4  
ATOM 5249  N NE   . ARG A 1 38  ? -2.559  16.715  1.413   1.00 0.00 ? 38  ARG A NE   4  
ATOM 5250  C CZ   . ARG A 1 38  ? -1.720  17.737  1.636   1.00 0.00 ? 38  ARG A CZ   4  
ATOM 5251  N NH1  . ARG A 1 38  ? -1.113  17.895  2.810   1.00 0.00 ? 38  ARG A NH1  4  
ATOM 5252  N NH2  . ARG A 1 38  ? -1.486  18.607  0.668   1.00 0.00 ? 38  ARG A NH2  4  
ATOM 5253  H H    . ARG A 1 38  ? 0.424   12.901  1.241   1.00 0.00 ? 38  ARG A H    4  
ATOM 5254  H HA   . ARG A 1 38  ? -1.239  11.109  2.567   1.00 0.00 ? 38  ARG A HA   4  
ATOM 5255  H HB2  . ARG A 1 38  ? -2.674  13.124  3.083   1.00 0.00 ? 38  ARG A HB2  4  
ATOM 5256  H HB3  . ARG A 1 38  ? -0.931  13.260  3.452   1.00 0.00 ? 38  ARG A HB3  4  
ATOM 5257  H HG2  . ARG A 1 38  ? -0.580  15.002  2.203   1.00 0.00 ? 38  ARG A HG2  4  
ATOM 5258  H HG3  . ARG A 1 38  ? -1.510  14.351  0.879   1.00 0.00 ? 38  ARG A HG3  4  
ATOM 5259  H HD2  . ARG A 1 38  ? -3.631  15.037  2.040   1.00 0.00 ? 38  ARG A HD2  4  
ATOM 5260  H HD3  . ARG A 1 38  ? -2.653  15.782  3.309   1.00 0.00 ? 38  ARG A HD3  4  
ATOM 5261  H HE   . ARG A 1 38  ? -3.142  16.711  0.576   1.00 0.00 ? 38  ARG A HE   4  
ATOM 5262  H HH11 . ARG A 1 38  ? -1.400  17.381  3.638   1.00 0.00 ? 38  ARG A HH11 4  
ATOM 5263  H HH12 . ARG A 1 38  ? -0.480  18.670  3.001   1.00 0.00 ? 38  ARG A HH12 4  
ATOM 5264  H HH21 . ARG A 1 38  ? -1.993  18.604  -0.215  1.00 0.00 ? 38  ARG A HH21 4  
ATOM 5265  H HH22 . ARG A 1 38  ? -0.801  19.352  0.800   1.00 0.00 ? 38  ARG A HH22 4  
ATOM 5266  N N    . ILE A 1 39  ? -2.730  12.260  -0.121  1.00 0.00 ? 39  ILE A N    4  
ATOM 5267  C CA   . ILE A 1 39  ? -3.854  12.082  -1.016  1.00 0.00 ? 39  ILE A CA   4  
ATOM 5268  C C    . ILE A 1 39  ? -3.706  10.751  -1.738  1.00 0.00 ? 39  ILE A C    4  
ATOM 5269  O O    . ILE A 1 39  ? -4.692  10.037  -1.879  1.00 0.00 ? 39  ILE A O    4  
ATOM 5270  C CB   . ILE A 1 39  ? -3.938  13.242  -2.023  1.00 0.00 ? 39  ILE A CB   4  
ATOM 5271  C CG1  . ILE A 1 39  ? -3.904  14.608  -1.325  1.00 0.00 ? 39  ILE A CG1  4  
ATOM 5272  C CG2  . ILE A 1 39  ? -5.188  13.033  -2.903  1.00 0.00 ? 39  ILE A CG2  4  
ATOM 5273  C CD1  . ILE A 1 39  ? -3.928  15.736  -2.352  1.00 0.00 ? 39  ILE A CD1  4  
ATOM 5274  H H    . ILE A 1 39  ? -2.022  12.927  -0.390  1.00 0.00 ? 39  ILE A H    4  
ATOM 5275  H HA   . ILE A 1 39  ? -4.769  12.056  -0.420  1.00 0.00 ? 39  ILE A HA   4  
ATOM 5276  H HB   . ILE A 1 39  ? -3.047  13.222  -2.647  1.00 0.00 ? 39  ILE A HB   4  
ATOM 5277  H HG12 . ILE A 1 39  ? -4.722  14.697  -0.608  1.00 0.00 ? 39  ILE A HG12 4  
ATOM 5278  H HG13 . ILE A 1 39  ? -2.970  14.707  -0.780  1.00 0.00 ? 39  ILE A HG13 4  
ATOM 5279  H HG21 . ILE A 1 39  ? -6.078  12.987  -2.272  1.00 0.00 ? 39  ILE A HG21 4  
ATOM 5280  H HG22 . ILE A 1 39  ? -5.311  13.833  -3.630  1.00 0.00 ? 39  ILE A HG22 4  
ATOM 5281  H HG23 . ILE A 1 39  ? -5.100  12.089  -3.449  1.00 0.00 ? 39  ILE A HG23 4  
ATOM 5282  H HD11 . ILE A 1 39  ? -3.299  15.494  -3.209  1.00 0.00 ? 39  ILE A HD11 4  
ATOM 5283  H HD12 . ILE A 1 39  ? -4.953  15.901  -2.678  1.00 0.00 ? 39  ILE A HD12 4  
ATOM 5284  H HD13 . ILE A 1 39  ? -3.533  16.635  -1.892  1.00 0.00 ? 39  ILE A HD13 4  
ATOM 5285  N N    . PHE A 1 40  ? -2.498  10.423  -2.204  1.00 0.00 ? 40  PHE A N    4  
ATOM 5286  C CA   . PHE A 1 40  ? -2.254  9.155   -2.871  1.00 0.00 ? 40  PHE A CA   4  
ATOM 5287  C C    . PHE A 1 40  ? -2.752  8.004   -1.998  1.00 0.00 ? 40  PHE A C    4  
ATOM 5288  O O    . PHE A 1 40  ? -3.501  7.147   -2.463  1.00 0.00 ? 40  PHE A O    4  
ATOM 5289  C CB   . PHE A 1 40  ? -0.757  9.017   -3.162  1.00 0.00 ? 40  PHE A CB   4  
ATOM 5290  C CG   . PHE A 1 40  ? -0.327  7.604   -3.493  1.00 0.00 ? 40  PHE A CG   4  
ATOM 5291  C CD1  . PHE A 1 40  ? -0.872  6.937   -4.606  1.00 0.00 ? 40  PHE A CD1  4  
ATOM 5292  C CD2  . PHE A 1 40  ? 0.541   6.920   -2.621  1.00 0.00 ? 40  PHE A CD2  4  
ATOM 5293  C CE1  . PHE A 1 40  ? -0.593  5.576   -4.812  1.00 0.00 ? 40  PHE A CE1  4  
ATOM 5294  C CE2  . PHE A 1 40  ? 0.835   5.566   -2.842  1.00 0.00 ? 40  PHE A CE2  4  
ATOM 5295  C CZ   . PHE A 1 40  ? 0.226   4.882   -3.907  1.00 0.00 ? 40  PHE A CZ   4  
ATOM 5296  H H    . PHE A 1 40  ? -1.731  11.072  -2.079  1.00 0.00 ? 40  PHE A H    4  
ATOM 5297  H HA   . PHE A 1 40  ? -2.819  9.153   -3.806  1.00 0.00 ? 40  PHE A HA   4  
ATOM 5298  H HB2  . PHE A 1 40  ? -0.505  9.683   -3.975  1.00 0.00 ? 40  PHE A HB2  4  
ATOM 5299  H HB3  . PHE A 1 40  ? -0.189  9.355   -2.299  1.00 0.00 ? 40  PHE A HB3  4  
ATOM 5300  H HD1  . PHE A 1 40  ? -1.543  7.451   -5.280  1.00 0.00 ? 40  PHE A HD1  4  
ATOM 5301  H HD2  . PHE A 1 40  ? 0.965   7.423   -1.765  1.00 0.00 ? 40  PHE A HD2  4  
ATOM 5302  H HE1  . PHE A 1 40  ? -1.031  5.054   -5.650  1.00 0.00 ? 40  PHE A HE1  4  
ATOM 5303  H HE2  . PHE A 1 40  ? 1.507   5.043   -2.177  1.00 0.00 ? 40  PHE A HE2  4  
ATOM 5304  H HZ   . PHE A 1 40  ? 0.411   3.824   -4.055  1.00 0.00 ? 40  PHE A HZ   4  
ATOM 5305  N N    . GLY A 1 41  ? -2.362  8.017   -0.726  1.00 0.00 ? 41  GLY A N    4  
ATOM 5306  C CA   . GLY A 1 41  ? -2.861  7.070   0.261   1.00 0.00 ? 41  GLY A CA   4  
ATOM 5307  C C    . GLY A 1 41  ? -4.388  7.063   0.317   1.00 0.00 ? 41  GLY A C    4  
ATOM 5308  O O    . GLY A 1 41  ? -5.008  6.025   0.097   1.00 0.00 ? 41  GLY A O    4  
ATOM 5309  H H    . GLY A 1 41  ? -1.705  8.747   -0.471  1.00 0.00 ? 41  GLY A H    4  
ATOM 5310  H HA2  . GLY A 1 41  ? -2.510  6.079   -0.020  1.00 0.00 ? 41  GLY A HA2  4  
ATOM 5311  H HA3  . GLY A 1 41  ? -2.483  7.325   1.249   1.00 0.00 ? 41  GLY A HA3  4  
ATOM 5312  N N    . GLU A 1 42  ? -4.984  8.224   0.571   1.00 0.00 ? 42  GLU A N    4  
ATOM 5313  C CA   . GLU A 1 42  ? -6.416  8.412   0.782   1.00 0.00 ? 42  GLU A CA   4  
ATOM 5314  C C    . GLU A 1 42  ? -7.275  8.097   -0.457  1.00 0.00 ? 42  GLU A C    4  
ATOM 5315  O O    . GLU A 1 42  ? -8.479  7.855   -0.328  1.00 0.00 ? 42  GLU A O    4  
ATOM 5316  C CB   . GLU A 1 42  ? -6.623  9.875   1.193   1.00 0.00 ? 42  GLU A CB   4  
ATOM 5317  C CG   . GLU A 1 42  ? -6.154  10.186  2.624   1.00 0.00 ? 42  GLU A CG   4  
ATOM 5318  C CD   . GLU A 1 42  ? -7.309  10.233  3.623   1.00 0.00 ? 42  GLU A CD   4  
ATOM 5319  O OE1  . GLU A 1 42  ? -8.120  11.181  3.529   1.00 0.00 ? 42  GLU A OE1  4  
ATOM 5320  O OE2  . GLU A 1 42  ? -7.373  9.404   4.561   1.00 0.00 ? 42  GLU A OE2  4  
ATOM 5321  H H    . GLU A 1 42  ? -4.393  9.031   0.754   1.00 0.00 ? 42  GLU A H    4  
ATOM 5322  H HA   . GLU A 1 42  ? -6.744  7.766   1.598   1.00 0.00 ? 42  GLU A HA   4  
ATOM 5323  H HB2  . GLU A 1 42  ? -6.075  10.514  0.504   1.00 0.00 ? 42  GLU A HB2  4  
ATOM 5324  H HB3  . GLU A 1 42  ? -7.671  10.138  1.090   1.00 0.00 ? 42  GLU A HB3  4  
ATOM 5325  H HG2  . GLU A 1 42  ? -5.409  9.467   2.953   1.00 0.00 ? 42  GLU A HG2  4  
ATOM 5326  H HG3  . GLU A 1 42  ? -5.669  11.164  2.629   1.00 0.00 ? 42  GLU A HG3  4  
ATOM 5327  N N    . LYS A 1 43  ? -6.707  8.113   -1.666  1.00 0.00 ? 43  LYS A N    4  
ATOM 5328  C CA   . LYS A 1 43  ? -7.424  7.898   -2.928  1.00 0.00 ? 43  LYS A CA   4  
ATOM 5329  C C    . LYS A 1 43  ? -7.151  6.521   -3.524  1.00 0.00 ? 43  LYS A C    4  
ATOM 5330  O O    . LYS A 1 43  ? -8.059  5.951   -4.127  1.00 0.00 ? 43  LYS A O    4  
ATOM 5331  C CB   . LYS A 1 43  ? -7.044  8.987   -3.950  1.00 0.00 ? 43  LYS A CB   4  
ATOM 5332  C CG   . LYS A 1 43  ? -7.686  10.360  -3.662  1.00 0.00 ? 43  LYS A CG   4  
ATOM 5333  C CD   . LYS A 1 43  ? -9.186  10.424  -3.998  1.00 0.00 ? 43  LYS A CD   4  
ATOM 5334  C CE   . LYS A 1 43  ? -9.423  10.400  -5.516  1.00 0.00 ? 43  LYS A CE   4  
ATOM 5335  N NZ   . LYS A 1 43  ? -10.806 10.016  -5.861  1.00 0.00 ? 43  LYS A NZ   4  
ATOM 5336  H H    . LYS A 1 43  ? -5.745  8.431   -1.702  1.00 0.00 ? 43  LYS A H    4  
ATOM 5337  H HA   . LYS A 1 43  ? -8.498  7.939   -2.742  1.00 0.00 ? 43  LYS A HA   4  
ATOM 5338  H HB2  . LYS A 1 43  ? -5.958  9.099   -3.960  1.00 0.00 ? 43  LYS A HB2  4  
ATOM 5339  H HB3  . LYS A 1 43  ? -7.338  8.653   -4.947  1.00 0.00 ? 43  LYS A HB3  4  
ATOM 5340  H HG2  . LYS A 1 43  ? -7.549  10.609  -2.608  1.00 0.00 ? 43  LYS A HG2  4  
ATOM 5341  H HG3  . LYS A 1 43  ? -7.174  11.115  -4.259  1.00 0.00 ? 43  LYS A HG3  4  
ATOM 5342  H HD2  . LYS A 1 43  ? -9.700  9.586   -3.527  1.00 0.00 ? 43  LYS A HD2  4  
ATOM 5343  H HD3  . LYS A 1 43  ? -9.605  11.347  -3.591  1.00 0.00 ? 43  LYS A HD3  4  
ATOM 5344  H HE2  . LYS A 1 43  ? -9.199  11.385  -5.930  1.00 0.00 ? 43  LYS A HE2  4  
ATOM 5345  H HE3  . LYS A 1 43  ? -8.752  9.672   -5.972  1.00 0.00 ? 43  LYS A HE3  4  
ATOM 5346  H HZ1  . LYS A 1 43  ? -10.928 10.018  -6.868  1.00 0.00 ? 43  LYS A HZ1  4  
ATOM 5347  H HZ2  . LYS A 1 43  ? -10.983 9.077   -5.504  1.00 0.00 ? 43  LYS A HZ2  4  
ATOM 5348  H HZ3  . LYS A 1 43  ? -11.471 10.679  -5.475  1.00 0.00 ? 43  LYS A HZ3  4  
ATOM 5349  N N    . VAL A 1 44  ? -5.930  6.001   -3.394  1.00 0.00 ? 44  VAL A N    4  
ATOM 5350  C CA   . VAL A 1 44  ? -5.503  4.790   -4.103  1.00 0.00 ? 44  VAL A CA   4  
ATOM 5351  C C    . VAL A 1 44  ? -5.277  3.639   -3.125  1.00 0.00 ? 44  VAL A C    4  
ATOM 5352  O O    . VAL A 1 44  ? -5.688  2.509   -3.397  1.00 0.00 ? 44  VAL A O    4  
ATOM 5353  C CB   . VAL A 1 44  ? -4.236  5.074   -4.942  1.00 0.00 ? 44  VAL A CB   4  
ATOM 5354  C CG1  . VAL A 1 44  ? -3.824  3.837   -5.753  1.00 0.00 ? 44  VAL A CG1  4  
ATOM 5355  C CG2  . VAL A 1 44  ? -4.438  6.254   -5.910  1.00 0.00 ? 44  VAL A CG2  4  
ATOM 5356  H H    . VAL A 1 44  ? -5.216  6.563   -2.938  1.00 0.00 ? 44  VAL A H    4  
ATOM 5357  H HA   . VAL A 1 44  ? -6.291  4.477   -4.791  1.00 0.00 ? 44  VAL A HA   4  
ATOM 5358  H HB   . VAL A 1 44  ? -3.414  5.318   -4.268  1.00 0.00 ? 44  VAL A HB   4  
ATOM 5359  H HG11 . VAL A 1 44  ? -4.656  3.509   -6.379  1.00 0.00 ? 44  VAL A HG11 4  
ATOM 5360  H HG12 . VAL A 1 44  ? -2.966  4.063   -6.375  1.00 0.00 ? 44  VAL A HG12 4  
ATOM 5361  H HG13 . VAL A 1 44  ? -3.536  3.022   -5.089  1.00 0.00 ? 44  VAL A HG13 4  
ATOM 5362  H HG21 . VAL A 1 44  ? -4.578  7.179   -5.351  1.00 0.00 ? 44  VAL A HG21 4  
ATOM 5363  H HG22 . VAL A 1 44  ? -3.559  6.373   -6.543  1.00 0.00 ? 44  VAL A HG22 4  
ATOM 5364  H HG23 . VAL A 1 44  ? -5.314  6.077   -6.535  1.00 0.00 ? 44  VAL A HG23 4  
ATOM 5365  N N    . LEU A 1 45  ? -4.583  3.888   -2.010  1.00 0.00 ? 45  LEU A N    4  
ATOM 5366  C CA   . LEU A 1 45  ? -4.261  2.829   -1.056  1.00 0.00 ? 45  LEU A CA   4  
ATOM 5367  C C    . LEU A 1 45  ? -5.416  2.592   -0.079  1.00 0.00 ? 45  LEU A C    4  
ATOM 5368  O O    . LEU A 1 45  ? -5.454  1.538   0.555   1.00 0.00 ? 45  LEU A O    4  
ATOM 5369  C CB   . LEU A 1 45  ? -2.951  3.128   -0.304  1.00 0.00 ? 45  LEU A CB   4  
ATOM 5370  C CG   . LEU A 1 45  ? -1.705  3.280   -1.207  1.00 0.00 ? 45  LEU A CG   4  
ATOM 5371  C CD1  . LEU A 1 45  ? -0.464  3.658   -0.392  1.00 0.00 ? 45  LEU A CD1  4  
ATOM 5372  C CD2  . LEU A 1 45  ? -1.376  1.969   -1.912  1.00 0.00 ? 45  LEU A CD2  4  
ATOM 5373  H H    . LEU A 1 45  ? -4.319  4.843   -1.800  1.00 0.00 ? 45  LEU A H    4  
ATOM 5374  H HA   . LEU A 1 45  ? -4.128  1.896   -1.601  1.00 0.00 ? 45  LEU A HA   4  
ATOM 5375  H HB2  . LEU A 1 45  ? -3.089  4.025   0.295   1.00 0.00 ? 45  LEU A HB2  4  
ATOM 5376  H HB3  . LEU A 1 45  ? -2.785  2.297   0.381   1.00 0.00 ? 45  LEU A HB3  4  
ATOM 5377  H HG   . LEU A 1 45  ? -1.879  4.053   -1.956  1.00 0.00 ? 45  LEU A HG   4  
ATOM 5378  H HD11 . LEU A 1 45  ? -0.408  3.062   0.518   1.00 0.00 ? 45  LEU A HD11 4  
ATOM 5379  H HD12 . LEU A 1 45  ? 0.442   3.484   -0.976  1.00 0.00 ? 45  LEU A HD12 4  
ATOM 5380  H HD13 . LEU A 1 45  ? -0.512  4.717   -0.151  1.00 0.00 ? 45  LEU A HD13 4  
ATOM 5381  H HD21 . LEU A 1 45  ? -0.464  2.076   -2.497  1.00 0.00 ? 45  LEU A HD21 4  
ATOM 5382  H HD22 . LEU A 1 45  ? -1.232  1.205   -1.153  1.00 0.00 ? 45  LEU A HD22 4  
ATOM 5383  H HD23 . LEU A 1 45  ? -2.182  1.689   -2.588  1.00 0.00 ? 45  LEU A HD23 4  
ATOM 5384  N N    . GLY A 1 46  ? -6.350  3.540   0.045   1.00 0.00 ? 46  GLY A N    4  
ATOM 5385  C CA   . GLY A 1 46  ? -7.421  3.508   1.028   1.00 0.00 ? 46  GLY A CA   4  
ATOM 5386  C C    . GLY A 1 46  ? -6.855  3.491   2.446   1.00 0.00 ? 46  GLY A C    4  
ATOM 5387  O O    . GLY A 1 46  ? -7.326  2.718   3.280   1.00 0.00 ? 46  GLY A O    4  
ATOM 5388  H H    . GLY A 1 46  ? -6.191  4.412   -0.442  1.00 0.00 ? 46  GLY A H    4  
ATOM 5389  H HA2  . GLY A 1 46  ? -8.052  4.388   0.908   1.00 0.00 ? 46  GLY A HA2  4  
ATOM 5390  H HA3  . GLY A 1 46  ? -8.031  2.620   0.870   1.00 0.00 ? 46  GLY A HA3  4  
ATOM 5391  N N    . LEU A 1 47  ? -5.824  4.300   2.719   1.00 0.00 ? 47  LEU A N    4  
ATOM 5392  C CA   . LEU A 1 47  ? -5.182  4.398   4.027   1.00 0.00 ? 47  LEU A CA   4  
ATOM 5393  C C    . LEU A 1 47  ? -5.204  5.846   4.498   1.00 0.00 ? 47  LEU A C    4  
ATOM 5394  O O    . LEU A 1 47  ? -5.114  6.761   3.678   1.00 0.00 ? 47  LEU A O    4  
ATOM 5395  C CB   . LEU A 1 47  ? -3.718  3.938   3.939   1.00 0.00 ? 47  LEU A CB   4  
ATOM 5396  C CG   . LEU A 1 47  ? -3.505  2.439   3.666   1.00 0.00 ? 47  LEU A CG   4  
ATOM 5397  C CD1  . LEU A 1 47  ? -2.000  2.204   3.531   1.00 0.00 ? 47  LEU A CD1  4  
ATOM 5398  C CD2  . LEU A 1 47  ? -4.053  1.547   4.780   1.00 0.00 ? 47  LEU A CD2  4  
ATOM 5399  H H    . LEU A 1 47  ? -5.497  4.951   2.015   1.00 0.00 ? 47  LEU A H    4  
ATOM 5400  H HA   . LEU A 1 47  ? -5.717  3.790   4.757   1.00 0.00 ? 47  LEU A HA   4  
ATOM 5401  H HB2  . LEU A 1 47  ? -3.228  4.514   3.151   1.00 0.00 ? 47  LEU A HB2  4  
ATOM 5402  H HB3  . LEU A 1 47  ? -3.227  4.189   4.881   1.00 0.00 ? 47  LEU A HB3  4  
ATOM 5403  H HG   . LEU A 1 47  ? -3.983  2.160   2.728   1.00 0.00 ? 47  LEU A HG   4  
ATOM 5404  H HD11 . LEU A 1 47  ? -1.664  2.573   2.565   1.00 0.00 ? 47  LEU A HD11 4  
ATOM 5405  H HD12 . LEU A 1 47  ? -1.468  2.722   4.327   1.00 0.00 ? 47  LEU A HD12 4  
ATOM 5406  H HD13 . LEU A 1 47  ? -1.772  1.145   3.603   1.00 0.00 ? 47  LEU A HD13 4  
ATOM 5407  H HD21 . LEU A 1 47  ? -3.632  1.832   5.745   1.00 0.00 ? 47  LEU A HD21 4  
ATOM 5408  H HD22 . LEU A 1 47  ? -5.137  1.631   4.814   1.00 0.00 ? 47  LEU A HD22 4  
ATOM 5409  H HD23 . LEU A 1 47  ? -3.816  0.503   4.576   1.00 0.00 ? 47  LEU A HD23 4  
ATOM 5410  N N    . SER A 1 48  ? -5.243  6.034   5.818   1.00 0.00 ? 48  SER A N    4  
ATOM 5411  C CA   . SER A 1 48  ? -5.144  7.320   6.474   1.00 0.00 ? 48  SER A CA   4  
ATOM 5412  C C    . SER A 1 48  ? -3.804  7.985   6.157   1.00 0.00 ? 48  SER A C    4  
ATOM 5413  O O    . SER A 1 48  ? -2.779  7.317   5.997   1.00 0.00 ? 48  SER A O    4  
ATOM 5414  C CB   . SER A 1 48  ? -5.304  7.113   7.984   1.00 0.00 ? 48  SER A CB   4  
ATOM 5415  O OG   . SER A 1 48  ? -6.464  6.360   8.296   1.00 0.00 ? 48  SER A OG   4  
ATOM 5416  H H    . SER A 1 48  ? -5.318  5.252   6.444   1.00 0.00 ? 48  SER A H    4  
ATOM 5417  H HA   . SER A 1 48  ? -5.949  7.951   6.105   1.00 0.00 ? 48  SER A HA   4  
ATOM 5418  H HB2  . SER A 1 48  ? -4.428  6.599   8.370   1.00 0.00 ? 48  SER A HB2  4  
ATOM 5419  H HB3  . SER A 1 48  ? -5.380  8.083   8.469   1.00 0.00 ? 48  SER A HB3  4  
ATOM 5420  H HG   . SER A 1 48  ? -7.205  6.986   8.239   1.00 0.00 ? 48  SER A HG   4  
ATOM 5421  N N    . GLN A 1 49  ? -3.812  9.315   6.138   1.00 0.00 ? 49  GLN A N    4  
ATOM 5422  C CA   . GLN A 1 49  ? -2.671  10.160  5.827   1.00 0.00 ? 49  GLN A CA   4  
ATOM 5423  C C    . GLN A 1 49  ? -1.462  9.799   6.685   1.00 0.00 ? 49  GLN A C    4  
ATOM 5424  O O    . GLN A 1 49  ? -0.377  9.589   6.141   1.00 0.00 ? 49  GLN A O    4  
ATOM 5425  C CB   . GLN A 1 49  ? -3.061  11.638  6.009   1.00 0.00 ? 49  GLN A CB   4  
ATOM 5426  C CG   . GLN A 1 49  ? -1.828  12.557  6.026   1.00 0.00 ? 49  GLN A CG   4  
ATOM 5427  C CD   . GLN A 1 49  ? -2.175  14.035  5.941   1.00 0.00 ? 49  GLN A CD   4  
ATOM 5428  O OE1  . GLN A 1 49  ? -3.305  14.452  6.169   1.00 0.00 ? 49  GLN A OE1  4  
ATOM 5429  N NE2  . GLN A 1 49  ? -1.208  14.872  5.629   1.00 0.00 ? 49  GLN A NE2  4  
ATOM 5430  H H    . GLN A 1 49  ? -4.710  9.756   6.304   1.00 0.00 ? 49  GLN A H    4  
ATOM 5431  H HA   . GLN A 1 49  ? -2.405  9.998   4.783   1.00 0.00 ? 49  GLN A HA   4  
ATOM 5432  H HB2  . GLN A 1 49  ? -3.721  11.926  5.189   1.00 0.00 ? 49  GLN A HB2  4  
ATOM 5433  H HB3  . GLN A 1 49  ? -3.595  11.768  6.953   1.00 0.00 ? 49  GLN A HB3  4  
ATOM 5434  H HG2  . GLN A 1 49  ? -1.266  12.411  6.948   1.00 0.00 ? 49  GLN A HG2  4  
ATOM 5435  H HG3  . GLN A 1 49  ? -1.185  12.289  5.190   1.00 0.00 ? 49  GLN A HG3  4  
ATOM 5436  H HE21 . GLN A 1 49  ? -0.251  14.532  5.531   1.00 0.00 ? 49  GLN A HE21 4  
ATOM 5437  H HE22 . GLN A 1 49  ? -1.352  15.880  5.657   1.00 0.00 ? 49  GLN A HE22 4  
ATOM 5438  N N    . GLY A 1 50  ? -1.625  9.802   8.009   1.00 0.00 ? 50  GLY A N    4  
ATOM 5439  C CA   . GLY A 1 50  ? -0.554  9.608   8.975   1.00 0.00 ? 50  GLY A CA   4  
ATOM 5440  C C    . GLY A 1 50  ? 0.011   8.198   8.877   1.00 0.00 ? 50  GLY A C    4  
ATOM 5441  O O    . GLY A 1 50  ? 1.232   8.031   8.911   1.00 0.00 ? 50  GLY A O    4  
ATOM 5442  H H    . GLY A 1 50  ? -2.565  9.920   8.381   1.00 0.00 ? 50  GLY A H    4  
ATOM 5443  H HA2  . GLY A 1 50  ? 0.241   10.334  8.796   1.00 0.00 ? 50  GLY A HA2  4  
ATOM 5444  H HA3  . GLY A 1 50  ? -0.949  9.757   9.980   1.00 0.00 ? 50  GLY A HA3  4  
ATOM 5445  N N    . SER A 1 51  ? -0.873  7.215   8.684   1.00 0.00 ? 51  SER A N    4  
ATOM 5446  C CA   . SER A 1 51  ? -0.509  5.833   8.447   1.00 0.00 ? 51  SER A CA   4  
ATOM 5447  C C    . SER A 1 51  ? 0.398   5.745   7.221   1.00 0.00 ? 51  SER A C    4  
ATOM 5448  O O    . SER A 1 51  ? 1.554   5.351   7.353   1.00 0.00 ? 51  SER A O    4  
ATOM 5449  C CB   . SER A 1 51  ? -1.772  4.979   8.306   1.00 0.00 ? 51  SER A CB   4  
ATOM 5450  O OG   . SER A 1 51  ? -2.623  5.157   9.425   1.00 0.00 ? 51  SER A OG   4  
ATOM 5451  H H    . SER A 1 51  ? -1.861  7.427   8.690   1.00 0.00 ? 51  SER A H    4  
ATOM 5452  H HA   . SER A 1 51  ? 0.058   5.481   9.308   1.00 0.00 ? 51  SER A HA   4  
ATOM 5453  H HB2  . SER A 1 51  ? -2.314  5.252   7.402   1.00 0.00 ? 51  SER A HB2  4  
ATOM 5454  H HB3  . SER A 1 51  ? -1.483  3.933   8.229   1.00 0.00 ? 51  SER A HB3  4  
ATOM 5455  H HG   . SER A 1 51  ? -3.084  4.297   9.554   1.00 0.00 ? 51  SER A HG   4  
ATOM 5456  N N    . VAL A 1 52  ? -0.082  6.146   6.039   1.00 0.00 ? 52  VAL A N    4  
ATOM 5457  C CA   . VAL A 1 52  ? 0.686   6.072   4.803   1.00 0.00 ? 52  VAL A CA   4  
ATOM 5458  C C    . VAL A 1 52  ? 1.979   6.907   4.882   1.00 0.00 ? 52  VAL A C    4  
ATOM 5459  O O    . VAL A 1 52  ? 2.968   6.560   4.236   1.00 0.00 ? 52  VAL A O    4  
ATOM 5460  C CB   . VAL A 1 52  ? -0.257  6.439   3.628   1.00 0.00 ? 52  VAL A CB   4  
ATOM 5461  C CG1  . VAL A 1 52  ? 0.017   7.817   3.010   1.00 0.00 ? 52  VAL A CG1  4  
ATOM 5462  C CG2  . VAL A 1 52  ? -0.233  5.349   2.555   1.00 0.00 ? 52  VAL A CG2  4  
ATOM 5463  H H    . VAL A 1 52  ? -1.043  6.471   5.957   1.00 0.00 ? 52  VAL A H    4  
ATOM 5464  H HA   . VAL A 1 52  ? 0.981   5.028   4.688   1.00 0.00 ? 52  VAL A HA   4  
ATOM 5465  H HB   . VAL A 1 52  ? -1.284  6.457   3.994   1.00 0.00 ? 52  VAL A HB   4  
ATOM 5466  H HG11 . VAL A 1 52  ? 1.019   7.847   2.573   1.00 0.00 ? 52  VAL A HG11 4  
ATOM 5467  H HG12 . VAL A 1 52  ? -0.712  8.035   2.232   1.00 0.00 ? 52  VAL A HG12 4  
ATOM 5468  H HG13 . VAL A 1 52  ? -0.085  8.561   3.798   1.00 0.00 ? 52  VAL A HG13 4  
ATOM 5469  H HG21 . VAL A 1 52  ? -1.084  5.478   1.884   1.00 0.00 ? 52  VAL A HG21 4  
ATOM 5470  H HG22 . VAL A 1 52  ? 0.701   5.365   1.992   1.00 0.00 ? 52  VAL A HG22 4  
ATOM 5471  H HG23 . VAL A 1 52  ? -0.345  4.379   3.032   1.00 0.00 ? 52  VAL A HG23 4  
ATOM 5472  N N    . SER A 1 53  ? 1.983   7.987   5.672   1.00 0.00 ? 53  SER A N    4  
ATOM 5473  C CA   . SER A 1 53  ? 3.123   8.863   5.902   1.00 0.00 ? 53  SER A CA   4  
ATOM 5474  C C    . SER A 1 53  ? 4.235   8.088   6.613   1.00 0.00 ? 53  SER A C    4  
ATOM 5475  O O    . SER A 1 53  ? 5.370   8.079   6.127   1.00 0.00 ? 53  SER A O    4  
ATOM 5476  C CB   . SER A 1 53  ? 2.647   10.084  6.704   1.00 0.00 ? 53  SER A CB   4  
ATOM 5477  O OG   . SER A 1 53  ? 3.610   11.110  6.813   1.00 0.00 ? 53  SER A OG   4  
ATOM 5478  H H    . SER A 1 53  ? 1.121   8.200   6.161   1.00 0.00 ? 53  SER A H    4  
ATOM 5479  H HA   . SER A 1 53  ? 3.490   9.197   4.934   1.00 0.00 ? 53  SER A HA   4  
ATOM 5480  H HB2  . SER A 1 53  ? 1.782   10.503  6.200   1.00 0.00 ? 53  SER A HB2  4  
ATOM 5481  H HB3  . SER A 1 53  ? 2.358   9.763   7.701   1.00 0.00 ? 53  SER A HB3  4  
ATOM 5482  H HG   . SER A 1 53  ? 3.227   11.845  7.331   1.00 0.00 ? 53  SER A HG   4  
ATOM 5483  N N    . ASP A 1 54  ? 3.901   7.433   7.736   1.00 0.00 ? 54  ASP A N    4  
ATOM 5484  C CA   . ASP A 1 54  ? 4.807   6.532   8.454   1.00 0.00 ? 54  ASP A CA   4  
ATOM 5485  C C    . ASP A 1 54  ? 5.285   5.429   7.523   1.00 0.00 ? 54  ASP A C    4  
ATOM 5486  O O    . ASP A 1 54  ? 6.478   5.166   7.464   1.00 0.00 ? 54  ASP A O    4  
ATOM 5487  C CB   . ASP A 1 54  ? 4.106   5.897   9.666   1.00 0.00 ? 54  ASP A CB   4  
ATOM 5488  C CG   . ASP A 1 54  ? 5.039   4.934   10.407  1.00 0.00 ? 54  ASP A CG   4  
ATOM 5489  O OD1  . ASP A 1 54  ? 5.994   5.427   11.059  1.00 0.00 ? 54  ASP A OD1  4  
ATOM 5490  O OD2  . ASP A 1 54  ? 4.808   3.701   10.380  1.00 0.00 ? 54  ASP A OD2  4  
ATOM 5491  H H    . ASP A 1 54  ? 2.920   7.422   8.018   1.00 0.00 ? 54  ASP A H    4  
ATOM 5492  H HA   . ASP A 1 54  ? 5.686   7.081   8.799   1.00 0.00 ? 54  ASP A HA   4  
ATOM 5493  H HB2  . ASP A 1 54  ? 3.776   6.680   10.351  1.00 0.00 ? 54  ASP A HB2  4  
ATOM 5494  H HB3  . ASP A 1 54  ? 3.223   5.347   9.331   1.00 0.00 ? 54  ASP A HB3  4  
ATOM 5495  N N    . MET A 1 55  ? 4.350   4.839   6.774   1.00 0.00 ? 55  MET A N    4  
ATOM 5496  C CA   . MET A 1 55  ? 4.573   3.702   5.895   1.00 0.00 ? 55  MET A CA   4  
ATOM 5497  C C    . MET A 1 55  ? 5.652   4.019   4.868   1.00 0.00 ? 55  MET A C    4  
ATOM 5498  O O    . MET A 1 55  ? 6.745   3.459   4.930   1.00 0.00 ? 55  MET A O    4  
ATOM 5499  C CB   . MET A 1 55  ? 3.243   3.305   5.232   1.00 0.00 ? 55  MET A CB   4  
ATOM 5500  C CG   . MET A 1 55  ? 3.067   1.794   5.240   1.00 0.00 ? 55  MET A CG   4  
ATOM 5501  S SD   . MET A 1 55  ? 1.480   1.222   4.587   1.00 0.00 ? 55  MET A SD   4  
ATOM 5502  C CE   . MET A 1 55  ? 0.434   1.547   6.034   1.00 0.00 ? 55  MET A CE   4  
ATOM 5503  H H    . MET A 1 55  ? 3.398   5.168   6.908   1.00 0.00 ? 55  MET A H    4  
ATOM 5504  H HA   . MET A 1 55  ? 4.921   2.879   6.519   1.00 0.00 ? 55  MET A HA   4  
ATOM 5505  H HB2  . MET A 1 55  ? 2.420   3.758   5.761   1.00 0.00 ? 55  MET A HB2  4  
ATOM 5506  H HB3  . MET A 1 55  ? 3.178   3.661   4.205   1.00 0.00 ? 55  MET A HB3  4  
ATOM 5507  H HG2  . MET A 1 55  ? 3.859   1.392   4.622   1.00 0.00 ? 55  MET A HG2  4  
ATOM 5508  H HG3  . MET A 1 55  ? 3.188   1.414   6.256   1.00 0.00 ? 55  MET A HG3  4  
ATOM 5509  H HE1  . MET A 1 55  ? 0.419   2.615   6.256   1.00 0.00 ? 55  MET A HE1  4  
ATOM 5510  H HE2  . MET A 1 55  ? -0.577  1.200   5.822   1.00 0.00 ? 55  MET A HE2  4  
ATOM 5511  H HE3  . MET A 1 55  ? 0.823   1.010   6.899   1.00 0.00 ? 55  MET A HE3  4  
ATOM 5512  N N    . LEU A 1 56  ? 5.362   4.952   3.955   1.00 0.00 ? 56  LEU A N    4  
ATOM 5513  C CA   . LEU A 1 56  ? 6.306   5.368   2.919   1.00 0.00 ? 56  LEU A CA   4  
ATOM 5514  C C    . LEU A 1 56  ? 7.612   5.919   3.495   1.00 0.00 ? 56  LEU A C    4  
ATOM 5515  O O    . LEU A 1 56  ? 8.621   5.908   2.785   1.00 0.00 ? 56  LEU A O    4  
ATOM 5516  C CB   . LEU A 1 56  ? 5.688   6.428   1.984   1.00 0.00 ? 56  LEU A CB   4  
ATOM 5517  C CG   . LEU A 1 56  ? 4.571   5.936   1.044   1.00 0.00 ? 56  LEU A CG   4  
ATOM 5518  C CD1  . LEU A 1 56  ? 4.165   7.072   0.098   1.00 0.00 ? 56  LEU A CD1  4  
ATOM 5519  C CD2  . LEU A 1 56  ? 5.016   4.753   0.175   1.00 0.00 ? 56  LEU A CD2  4  
ATOM 5520  H H    . LEU A 1 56  ? 4.398   5.274   3.946   1.00 0.00 ? 56  LEU A H    4  
ATOM 5521  H HA   . LEU A 1 56  ? 6.574   4.485   2.339   1.00 0.00 ? 56  LEU A HA   4  
ATOM 5522  H HB2  . LEU A 1 56  ? 5.304   7.248   2.593   1.00 0.00 ? 56  LEU A HB2  4  
ATOM 5523  H HB3  . LEU A 1 56  ? 6.489   6.834   1.363   1.00 0.00 ? 56  LEU A HB3  4  
ATOM 5524  H HG   . LEU A 1 56  ? 3.695   5.650   1.631   1.00 0.00 ? 56  LEU A HG   4  
ATOM 5525  H HD11 . LEU A 1 56  ? 5.008   7.351   -0.537  1.00 0.00 ? 56  LEU A HD11 4  
ATOM 5526  H HD12 . LEU A 1 56  ? 3.339   6.749   -0.536  1.00 0.00 ? 56  LEU A HD12 4  
ATOM 5527  H HD13 . LEU A 1 56  ? 3.844   7.935   0.680   1.00 0.00 ? 56  LEU A HD13 4  
ATOM 5528  H HD21 . LEU A 1 56  ? 4.238   4.514   -0.550  1.00 0.00 ? 56  LEU A HD21 4  
ATOM 5529  H HD22 . LEU A 1 56  ? 5.937   4.991   -0.358  1.00 0.00 ? 56  LEU A HD22 4  
ATOM 5530  H HD23 . LEU A 1 56  ? 5.175   3.874   0.799   1.00 0.00 ? 56  LEU A HD23 4  
ATOM 5531  N N    . SER A 1 57  ? 7.627   6.423   4.732   1.00 0.00 ? 57  SER A N    4  
ATOM 5532  C CA   . SER A 1 57  ? 8.853   6.895   5.352   1.00 0.00 ? 57  SER A CA   4  
ATOM 5533  C C    . SER A 1 57  ? 9.695   5.712   5.834   1.00 0.00 ? 57  SER A C    4  
ATOM 5534  O O    . SER A 1 57  ? 10.885  5.644   5.519   1.00 0.00 ? 57  SER A O    4  
ATOM 5535  C CB   . SER A 1 57  ? 8.523   7.869   6.488   1.00 0.00 ? 57  SER A CB   4  
ATOM 5536  O OG   . SER A 1 57  ? 9.678   8.579   6.891   1.00 0.00 ? 57  SER A OG   4  
ATOM 5537  H H    . SER A 1 57  ? 6.781   6.393   5.290   1.00 0.00 ? 57  SER A H    4  
ATOM 5538  H HA   . SER A 1 57  ? 9.423   7.435   4.597   1.00 0.00 ? 57  SER A HA   4  
ATOM 5539  H HB2  . SER A 1 57  ? 7.795   8.597   6.135   1.00 0.00 ? 57  SER A HB2  4  
ATOM 5540  H HB3  . SER A 1 57  ? 8.100   7.332   7.338   1.00 0.00 ? 57  SER A HB3  4  
ATOM 5541  H HG   . SER A 1 57  ? 10.063  8.982   6.084   1.00 0.00 ? 57  SER A HG   4  
ATOM 5542  N N    . ARG A 1 58  ? 9.105   4.799   6.605   1.00 0.00 ? 58  ARG A N    4  
ATOM 5543  C CA   . ARG A 1 58  ? 9.785   3.750   7.354   1.00 0.00 ? 58  ARG A CA   4  
ATOM 5544  C C    . ARG A 1 58  ? 9.037   2.431   7.137   1.00 0.00 ? 58  ARG A C    4  
ATOM 5545  O O    . ARG A 1 58  ? 8.394   1.941   8.074   1.00 0.00 ? 58  ARG A O    4  
ATOM 5546  C CB   . ARG A 1 58  ? 9.870   4.152   8.842   1.00 0.00 ? 58  ARG A CB   4  
ATOM 5547  C CG   . ARG A 1 58  ? 10.744  5.398   9.045   1.00 0.00 ? 58  ARG A CG   4  
ATOM 5548  C CD   . ARG A 1 58  ? 11.273  5.515   10.480  1.00 0.00 ? 58  ARG A CD   4  
ATOM 5549  N NE   . ARG A 1 58  ? 10.376  6.281   11.353  1.00 0.00 ? 58  ARG A NE   4  
ATOM 5550  C CZ   . ARG A 1 58  ? 10.733  6.829   12.516  1.00 0.00 ? 58  ARG A CZ   4  
ATOM 5551  N NH1  . ARG A 1 58  ? 11.871  6.488   13.116  1.00 0.00 ? 58  ARG A NH1  4  
ATOM 5552  N NH2  . ARG A 1 58  ? 9.915   7.700   13.086  1.00 0.00 ? 58  ARG A NH2  4  
ATOM 5553  H H    . ARG A 1 58  ? 8.098   4.859   6.749   1.00 0.00 ? 58  ARG A H    4  
ATOM 5554  H HA   . ARG A 1 58  ? 10.802  3.619   6.980   1.00 0.00 ? 58  ARG A HA   4  
ATOM 5555  H HB2  . ARG A 1 58  ? 8.870   4.338   9.242   1.00 0.00 ? 58  ARG A HB2  4  
ATOM 5556  H HB3  . ARG A 1 58  ? 10.310  3.321   9.393   1.00 0.00 ? 58  ARG A HB3  4  
ATOM 5557  H HG2  . ARG A 1 58  ? 11.609  5.327   8.384   1.00 0.00 ? 58  ARG A HG2  4  
ATOM 5558  H HG3  . ARG A 1 58  ? 10.171  6.290   8.778   1.00 0.00 ? 58  ARG A HG3  4  
ATOM 5559  H HD2  . ARG A 1 58  ? 11.442  4.525   10.905  1.00 0.00 ? 58  ARG A HD2  4  
ATOM 5560  H HD3  . ARG A 1 58  ? 12.234  6.031   10.439  1.00 0.00 ? 58  ARG A HD3  4  
ATOM 5561  H HE   . ARG A 1 58  ? 9.450   6.502   10.994  1.00 0.00 ? 58  ARG A HE   4  
ATOM 5562  H HH11 . ARG A 1 58  ? 12.531  5.848   12.683  1.00 0.00 ? 58  ARG A HH11 4  
ATOM 5563  H HH12 . ARG A 1 58  ? 12.150  6.880   14.020  1.00 0.00 ? 58  ARG A HH12 4  
ATOM 5564  H HH21 . ARG A 1 58  ? 9.032   7.923   12.630  1.00 0.00 ? 58  ARG A HH21 4  
ATOM 5565  H HH22 . ARG A 1 58  ? 10.249  8.305   13.840  1.00 0.00 ? 58  ARG A HH22 4  
ATOM 5566  N N    . PRO A 1 59  ? 9.101   1.833   5.934   1.00 0.00 ? 59  PRO A N    4  
ATOM 5567  C CA   . PRO A 1 59  ? 8.396   0.590   5.651   1.00 0.00 ? 59  PRO A CA   4  
ATOM 5568  C C    . PRO A 1 59  ? 9.007   -0.572  6.448   1.00 0.00 ? 59  PRO A C    4  
ATOM 5569  O O    . PRO A 1 59  ? 10.104  -0.468  7.002   1.00 0.00 ? 59  PRO A O    4  
ATOM 5570  C CB   . PRO A 1 59  ? 8.496   0.398   4.132   1.00 0.00 ? 59  PRO A CB   4  
ATOM 5571  C CG   . PRO A 1 59  ? 9.780   1.134   3.770   1.00 0.00 ? 59  PRO A CG   4  
ATOM 5572  C CD   . PRO A 1 59  ? 9.832   2.292   4.763   1.00 0.00 ? 59  PRO A CD   4  
ATOM 5573  H HA   . PRO A 1 59  ? 7.346   0.698   5.929   1.00 0.00 ? 59  PRO A HA   4  
ATOM 5574  H HB2  . PRO A 1 59  ? 8.540   -0.653  3.843   1.00 0.00 ? 59  PRO A HB2  4  
ATOM 5575  H HB3  . PRO A 1 59  ? 7.663   0.896   3.638   1.00 0.00 ? 59  PRO A HB3  4  
ATOM 5576  H HG2  . PRO A 1 59  ? 10.619  0.472   3.932   1.00 0.00 ? 59  PRO A HG2  4  
ATOM 5577  H HG3  . PRO A 1 59  ? 9.782   1.487   2.742   1.00 0.00 ? 59  PRO A HG3  4  
ATOM 5578  H HD2  . PRO A 1 59  ? 10.868  2.536   5.006   1.00 0.00 ? 59  PRO A HD2  4  
ATOM 5579  H HD3  . PRO A 1 59  ? 9.323   3.159   4.338   1.00 0.00 ? 59  PRO A HD3  4  
ATOM 5580  N N    . LYS A 1 60  ? 8.291   -1.695  6.497   1.00 0.00 ? 60  LYS A N    4  
ATOM 5581  C CA   . LYS A 1 60  ? 8.709   -2.976  7.068   1.00 0.00 ? 60  LYS A CA   4  
ATOM 5582  C C    . LYS A 1 60  ? 9.112   -3.926  5.929   1.00 0.00 ? 60  LYS A C    4  
ATOM 5583  O O    . LYS A 1 60  ? 8.690   -3.699  4.786   1.00 0.00 ? 60  LYS A O    4  
ATOM 5584  C CB   . LYS A 1 60  ? 7.514   -3.552  7.860   1.00 0.00 ? 60  LYS A CB   4  
ATOM 5585  C CG   . LYS A 1 60  ? 7.164   -2.732  9.112   1.00 0.00 ? 60  LYS A CG   4  
ATOM 5586  C CD   . LYS A 1 60  ? 8.165   -2.965  10.250  1.00 0.00 ? 60  LYS A CD   4  
ATOM 5587  C CE   . LYS A 1 60  ? 7.988   -1.918  11.353  1.00 0.00 ? 60  LYS A CE   4  
ATOM 5588  N NZ   . LYS A 1 60  ? 9.001   -2.100  12.413  1.00 0.00 ? 60  LYS A NZ   4  
ATOM 5589  H H    . LYS A 1 60  ? 7.421   -1.735  5.976   1.00 0.00 ? 60  LYS A H    4  
ATOM 5590  H HA   . LYS A 1 60  ? 9.575   -2.822  7.713   1.00 0.00 ? 60  LYS A HA   4  
ATOM 5591  H HB2  . LYS A 1 60  ? 6.640   -3.575  7.206   1.00 0.00 ? 60  LYS A HB2  4  
ATOM 5592  H HB3  . LYS A 1 60  ? 7.713   -4.578  8.162   1.00 0.00 ? 60  LYS A HB3  4  
ATOM 5593  H HG2  . LYS A 1 60  ? 7.134   -1.674  8.859   1.00 0.00 ? 60  LYS A HG2  4  
ATOM 5594  H HG3  . LYS A 1 60  ? 6.173   -3.026  9.453   1.00 0.00 ? 60  LYS A HG3  4  
ATOM 5595  H HD2  . LYS A 1 60  ? 8.023   -3.967  10.657  1.00 0.00 ? 60  LYS A HD2  4  
ATOM 5596  H HD3  . LYS A 1 60  ? 9.179   -2.891  9.862   1.00 0.00 ? 60  LYS A HD3  4  
ATOM 5597  H HE2  . LYS A 1 60  ? 8.100   -0.928  10.906  1.00 0.00 ? 60  LYS A HE2  4  
ATOM 5598  H HE3  . LYS A 1 60  ? 6.987   -1.997  11.776  1.00 0.00 ? 60  LYS A HE3  4  
ATOM 5599  H HZ1  . LYS A 1 60  ? 9.928   -2.145  11.993  1.00 0.00 ? 60  LYS A HZ1  4  
ATOM 5600  H HZ2  . LYS A 1 60  ? 8.984   -1.341  13.082  1.00 0.00 ? 60  LYS A HZ2  4  
ATOM 5601  H HZ3  . LYS A 1 60  ? 8.819   -2.962  12.921  1.00 0.00 ? 60  LYS A HZ3  4  
ATOM 5602  N N    . PRO A 1 61  ? 9.861   -5.008  6.201   1.00 0.00 ? 61  PRO A N    4  
ATOM 5603  C CA   . PRO A 1 61  ? 10.170  -6.004  5.180   1.00 0.00 ? 61  PRO A CA   4  
ATOM 5604  C C    . PRO A 1 61  ? 8.889   -6.717  4.746   1.00 0.00 ? 61  PRO A C    4  
ATOM 5605  O O    . PRO A 1 61  ? 7.951   -6.831  5.541   1.00 0.00 ? 61  PRO A O    4  
ATOM 5606  C CB   . PRO A 1 61  ? 11.160  -6.969  5.831   1.00 0.00 ? 61  PRO A CB   4  
ATOM 5607  C CG   . PRO A 1 61  ? 10.928  -6.813  7.327   1.00 0.00 ? 61  PRO A CG   4  
ATOM 5608  C CD   . PRO A 1 61  ? 10.427  -5.383  7.489   1.00 0.00 ? 61  PRO A CD   4  
ATOM 5609  H HA   . PRO A 1 61  ? 10.647  -5.536  4.320   1.00 0.00 ? 61  PRO A HA   4  
ATOM 5610  H HB2  . PRO A 1 61  ? 10.974  -8.000  5.543   1.00 0.00 ? 61  PRO A HB2  4  
ATOM 5611  H HB3  . PRO A 1 61  ? 12.179  -6.669  5.584   1.00 0.00 ? 61  PRO A HB3  4  
ATOM 5612  H HG2  . PRO A 1 61  ? 10.152  -7.511  7.639   1.00 0.00 ? 61  PRO A HG2  4  
ATOM 5613  H HG3  . PRO A 1 61  ? 11.846  -6.977  7.886   1.00 0.00 ? 61  PRO A HG3  4  
ATOM 5614  H HD2  . PRO A 1 61  ? 9.696   -5.337  8.294   1.00 0.00 ? 61  PRO A HD2  4  
ATOM 5615  H HD3  . PRO A 1 61  ? 11.262  -4.728  7.715   1.00 0.00 ? 61  PRO A HD3  4  
ATOM 5616  N N    . TRP A 1 62  ? 8.866   -7.285  3.538   1.00 0.00 ? 62  TRP A N    4  
ATOM 5617  C CA   . TRP A 1 62  ? 7.750   -8.120  3.090   1.00 0.00 ? 62  TRP A CA   4  
ATOM 5618  C C    . TRP A 1 62  ? 7.537   -9.304  4.040   1.00 0.00 ? 62  TRP A C    4  
ATOM 5619  O O    . TRP A 1 62  ? 6.406   -9.728  4.289   1.00 0.00 ? 62  TRP A O    4  
ATOM 5620  C CB   . TRP A 1 62  ? 8.026   -8.619  1.673   1.00 0.00 ? 62  TRP A CB   4  
ATOM 5621  C CG   . TRP A 1 62  ? 6.853   -9.210  0.970   1.00 0.00 ? 62  TRP A CG   4  
ATOM 5622  C CD1  . TRP A 1 62  ? 6.608   -10.530 0.817   1.00 0.00 ? 62  TRP A CD1  4  
ATOM 5623  C CD2  . TRP A 1 62  ? 5.737   -8.521  0.336   1.00 0.00 ? 62  TRP A CD2  4  
ATOM 5624  N NE1  . TRP A 1 62  ? 5.518   -10.697 -0.011  1.00 0.00 ? 62  TRP A NE1  4  
ATOM 5625  C CE2  . TRP A 1 62  ? 4.941   -9.492  -0.334  1.00 0.00 ? 62  TRP A CE2  4  
ATOM 5626  C CE3  . TRP A 1 62  ? 5.316   -7.177  0.247   1.00 0.00 ? 62  TRP A CE3  4  
ATOM 5627  C CZ2  . TRP A 1 62  ? 3.830   -9.144  -1.108  1.00 0.00 ? 62  TRP A CZ2  4  
ATOM 5628  C CZ3  . TRP A 1 62  ? 4.179   -6.820  -0.502  1.00 0.00 ? 62  TRP A CZ3  4  
ATOM 5629  C CH2  . TRP A 1 62  ? 3.447   -7.802  -1.189  1.00 0.00 ? 62  TRP A CH2  4  
ATOM 5630  H H    . TRP A 1 62  ? 9.669   -7.193  2.919   1.00 0.00 ? 62  TRP A H    4  
ATOM 5631  H HA   . TRP A 1 62  ? 6.847   -7.510  3.078   1.00 0.00 ? 62  TRP A HA   4  
ATOM 5632  H HB2  . TRP A 1 62  ? 8.371   -7.792  1.058   1.00 0.00 ? 62  TRP A HB2  4  
ATOM 5633  H HB3  . TRP A 1 62  ? 8.828   -9.356  1.696   1.00 0.00 ? 62  TRP A HB3  4  
ATOM 5634  H HD1  . TRP A 1 62  ? 7.203   -11.334 1.230   1.00 0.00 ? 62  TRP A HD1  4  
ATOM 5635  H HE1  . TRP A 1 62  ? 5.184   -11.603 -0.346  1.00 0.00 ? 62  TRP A HE1  4  
ATOM 5636  H HE3  . TRP A 1 62  ? 5.900   -6.411  0.728   1.00 0.00 ? 62  TRP A HE3  4  
ATOM 5637  H HZ2  . TRP A 1 62  ? 3.283   -9.906  -1.632  1.00 0.00 ? 62  TRP A HZ2  4  
ATOM 5638  H HZ3  . TRP A 1 62  ? 3.884   -5.787  -0.584  1.00 0.00 ? 62  TRP A HZ3  4  
ATOM 5639  H HH2  . TRP A 1 62  ? 2.593   -7.537  -1.784  1.00 0.00 ? 62  TRP A HH2  4  
ATOM 5640  N N    . SER A 1 63  ? 8.626   -9.772  4.650   1.00 0.00 ? 63  SER A N    4  
ATOM 5641  C CA   . SER A 1 63  ? 8.665   -10.806 5.668   1.00 0.00 ? 63  SER A CA   4  
ATOM 5642  C C    . SER A 1 63  ? 7.694   -10.498 6.814   1.00 0.00 ? 63  SER A C    4  
ATOM 5643  O O    . SER A 1 63  ? 7.028   -11.393 7.335   1.00 0.00 ? 63  SER A O    4  
ATOM 5644  C CB   . SER A 1 63  ? 10.096  -10.899 6.227   1.00 0.00 ? 63  SER A CB   4  
ATOM 5645  O OG   . SER A 1 63  ? 11.107  -10.595 5.274   1.00 0.00 ? 63  SER A OG   4  
ATOM 5646  H H    . SER A 1 63  ? 9.523   -9.437  4.327   1.00 0.00 ? 63  SER A H    4  
ATOM 5647  H HA   . SER A 1 63  ? 8.392   -11.751 5.195   1.00 0.00 ? 63  SER A HA   4  
ATOM 5648  H HB2  . SER A 1 63  ? 10.200  -10.189 7.051   1.00 0.00 ? 63  SER A HB2  4  
ATOM 5649  H HB3  . SER A 1 63  ? 10.257  -11.895 6.623   1.00 0.00 ? 63  SER A HB3  4  
ATOM 5650  H HG   . SER A 1 63  ? 10.851  -10.963 4.394   1.00 0.00 ? 63  SER A HG   4  
ATOM 5651  N N    . LYS A 1 64  ? 7.609   -9.226  7.217   1.00 0.00 ? 64  LYS A N    4  
ATOM 5652  C CA   . LYS A 1 64  ? 6.797   -8.794  8.349   1.00 0.00 ? 64  LYS A CA   4  
ATOM 5653  C C    . LYS A 1 64  ? 5.329   -8.651  7.999   1.00 0.00 ? 64  LYS A C    4  
ATOM 5654  O O    . LYS A 1 64  ? 4.487   -8.752  8.893   1.00 0.00 ? 64  LYS A O    4  
ATOM 5655  C CB   . LYS A 1 64  ? 7.334   -7.456  8.898   1.00 0.00 ? 64  LYS A CB   4  
ATOM 5656  C CG   . LYS A 1 64  ? 8.421   -7.693  9.949   1.00 0.00 ? 64  LYS A CG   4  
ATOM 5657  C CD   . LYS A 1 64  ? 7.774   -8.203  11.248  1.00 0.00 ? 64  LYS A CD   4  
ATOM 5658  C CE   . LYS A 1 64  ? 8.732   -9.067  12.058  1.00 0.00 ? 64  LYS A CE   4  
ATOM 5659  N NZ   . LYS A 1 64  ? 7.989   -9.981  12.944  1.00 0.00 ? 64  LYS A NZ   4  
ATOM 5660  H H    . LYS A 1 64  ? 8.122   -8.526  6.695   1.00 0.00 ? 64  LYS A H    4  
ATOM 5661  H HA   . LYS A 1 64  ? 6.856   -9.575  9.106   1.00 0.00 ? 64  LYS A HA   4  
ATOM 5662  H HB2  . LYS A 1 64  ? 7.749   -6.863  8.085   1.00 0.00 ? 64  LYS A HB2  4  
ATOM 5663  H HB3  . LYS A 1 64  ? 6.523   -6.883  9.356   1.00 0.00 ? 64  LYS A HB3  4  
ATOM 5664  H HG2  . LYS A 1 64  ? 9.148   -8.405  9.546   1.00 0.00 ? 64  LYS A HG2  4  
ATOM 5665  H HG3  . LYS A 1 64  ? 8.939   -6.757  10.159  1.00 0.00 ? 64  LYS A HG3  4  
ATOM 5666  H HD2  . LYS A 1 64  ? 7.451   -7.351  11.847  1.00 0.00 ? 64  LYS A HD2  4  
ATOM 5667  H HD3  . LYS A 1 64  ? 6.888   -8.795  11.027  1.00 0.00 ? 64  LYS A HD3  4  
ATOM 5668  H HE2  . LYS A 1 64  ? 9.350   -9.662  11.383  1.00 0.00 ? 64  LYS A HE2  4  
ATOM 5669  H HE3  . LYS A 1 64  ? 9.379   -8.422  12.651  1.00 0.00 ? 64  LYS A HE3  4  
ATOM 5670  H HZ1  . LYS A 1 64  ? 8.591   -10.272 13.708  1.00 0.00 ? 64  LYS A HZ1  4  
ATOM 5671  H HZ2  . LYS A 1 64  ? 7.159   -9.540  13.328  1.00 0.00 ? 64  LYS A HZ2  4  
ATOM 5672  H HZ3  . LYS A 1 64  ? 7.713   -10.827 12.451  1.00 0.00 ? 64  LYS A HZ3  4  
ATOM 5673  N N    . LEU A 1 65  ? 5.018   -8.388  6.735   1.00 0.00 ? 65  LEU A N    4  
ATOM 5674  C CA   . LEU A 1 65  ? 3.660   -8.122  6.306   1.00 0.00 ? 65  LEU A CA   4  
ATOM 5675  C C    . LEU A 1 65  ? 2.932   -9.461  6.180   1.00 0.00 ? 65  LEU A C    4  
ATOM 5676  O O    . LEU A 1 65  ? 3.424   -10.374 5.512   1.00 0.00 ? 65  LEU A O    4  
ATOM 5677  C CB   . LEU A 1 65  ? 3.679   -7.366  4.971   1.00 0.00 ? 65  LEU A CB   4  
ATOM 5678  C CG   . LEU A 1 65  ? 4.422   -6.018  4.958   1.00 0.00 ? 65  LEU A CG   4  
ATOM 5679  C CD1  . LEU A 1 65  ? 4.380   -5.452  3.534   1.00 0.00 ? 65  LEU A CD1  4  
ATOM 5680  C CD2  . LEU A 1 65  ? 3.825   -5.002  5.936   1.00 0.00 ? 65  LEU A CD2  4  
ATOM 5681  H H    . LEU A 1 65  ? 5.752   -8.400  6.038   1.00 0.00 ? 65  LEU A H    4  
ATOM 5682  H HA   . LEU A 1 65  ? 3.162   -7.507  7.058   1.00 0.00 ? 65  LEU A HA   4  
ATOM 5683  H HB2  . LEU A 1 65  ? 4.137   -8.013  4.220   1.00 0.00 ? 65  LEU A HB2  4  
ATOM 5684  H HB3  . LEU A 1 65  ? 2.646   -7.177  4.692   1.00 0.00 ? 65  LEU A HB3  4  
ATOM 5685  H HG   . LEU A 1 65  ? 5.463   -6.183  5.225   1.00 0.00 ? 65  LEU A HG   4  
ATOM 5686  H HD11 . LEU A 1 65  ? 3.352   -5.232  3.247   1.00 0.00 ? 65  LEU A HD11 4  
ATOM 5687  H HD12 . LEU A 1 65  ? 4.965   -4.536  3.481   1.00 0.00 ? 65  LEU A HD12 4  
ATOM 5688  H HD13 . LEU A 1 65  ? 4.801   -6.174  2.837   1.00 0.00 ? 65  LEU A HD13 4  
ATOM 5689  H HD21 . LEU A 1 65  ? 2.773   -4.831  5.714   1.00 0.00 ? 65  LEU A HD21 4  
ATOM 5690  H HD22 . LEU A 1 65  ? 3.930   -5.358  6.961   1.00 0.00 ? 65  LEU A HD22 4  
ATOM 5691  H HD23 . LEU A 1 65  ? 4.359   -4.055  5.854   1.00 0.00 ? 65  LEU A HD23 4  
ATOM 5692  N N    . THR A 1 66  ? 1.760   -9.580  6.799   1.00 0.00 ? 66  THR A N    4  
ATOM 5693  C CA   . THR A 1 66  ? 0.773   -10.635 6.535   1.00 0.00 ? 66  THR A CA   4  
ATOM 5694  C C    . THR A 1 66  ? 0.094   -10.353 5.183   1.00 0.00 ? 66  THR A C    4  
ATOM 5695  O O    . THR A 1 66  ? 0.394   -9.321  4.589   1.00 0.00 ? 66  THR A O    4  
ATOM 5696  C CB   . THR A 1 66  ? -0.253  -10.604 7.679   1.00 0.00 ? 66  THR A CB   4  
ATOM 5697  O OG1  . THR A 1 66  ? -0.885  -9.334  7.712   1.00 0.00 ? 66  THR A OG1  4  
ATOM 5698  C CG2  . THR A 1 66  ? 0.396   -10.906 9.031   1.00 0.00 ? 66  THR A CG2  4  
ATOM 5699  H H    . THR A 1 66  ? 1.404   -8.799  7.329   1.00 0.00 ? 66  THR A H    4  
ATOM 5700  H HA   . THR A 1 66  ? 1.265   -11.609 6.497   1.00 0.00 ? 66  THR A HA   4  
ATOM 5701  H HB   . THR A 1 66  ? -1.007  -11.365 7.487   1.00 0.00 ? 66  THR A HB   4  
ATOM 5702  H HG1  . THR A 1 66  ? -0.558  -8.815  8.475   1.00 0.00 ? 66  THR A HG1  4  
ATOM 5703  H HG21 . THR A 1 66  ? -0.372  -10.940 9.799   1.00 0.00 ? 66  THR A HG21 4  
ATOM 5704  H HG22 . THR A 1 66  ? 0.891   -11.876 8.988   1.00 0.00 ? 66  THR A HG22 4  
ATOM 5705  H HG23 . THR A 1 66  ? 1.128   -10.146 9.305   1.00 0.00 ? 66  THR A HG23 4  
ATOM 5706  N N    . GLN A 1 67  ? -0.872  -11.149 4.695   1.00 0.00 ? 67  GLN A N    4  
ATOM 5707  C CA   . GLN A 1 67  ? -1.675  -10.695 3.549   1.00 0.00 ? 67  GLN A CA   4  
ATOM 5708  C C    . GLN A 1 67  ? -2.344  -9.351  3.854   1.00 0.00 ? 67  GLN A C    4  
ATOM 5709  O O    . GLN A 1 67  ? -2.278  -8.441  3.033   1.00 0.00 ? 67  GLN A O    4  
ATOM 5710  C CB   . GLN A 1 67  ? -2.764  -11.684 3.125   1.00 0.00 ? 67  GLN A CB   4  
ATOM 5711  C CG   . GLN A 1 67  ? -2.263  -12.880 2.299   1.00 0.00 ? 67  GLN A CG   4  
ATOM 5712  C CD   . GLN A 1 67  ? -3.236  -13.263 1.176   1.00 0.00 ? 67  GLN A CD   4  
ATOM 5713  O OE1  . GLN A 1 67  ? -4.449  -13.093 1.297   1.00 0.00 ? 67  GLN A OE1  4  
ATOM 5714  N NE2  . GLN A 1 67  ? -2.737  -13.750 0.056   1.00 0.00 ? 67  GLN A NE2  4  
ATOM 5715  H H    . GLN A 1 67  ? -1.084  -12.042 5.125   1.00 0.00 ? 67  GLN A H    4  
ATOM 5716  H HA   . GLN A 1 67  ? -1.007  -10.539 2.702   1.00 0.00 ? 67  GLN A HA   4  
ATOM 5717  H HB2  . GLN A 1 67  ? -3.299  -12.028 4.008   1.00 0.00 ? 67  GLN A HB2  4  
ATOM 5718  H HB3  . GLN A 1 67  ? -3.469  -11.120 2.512   1.00 0.00 ? 67  GLN A HB3  4  
ATOM 5719  H HG2  . GLN A 1 67  ? -1.302  -12.625 1.855   1.00 0.00 ? 67  GLN A HG2  4  
ATOM 5720  H HG3  . GLN A 1 67  ? -2.124  -13.734 2.961   1.00 0.00 ? 67  GLN A HG3  4  
ATOM 5721  H HE21 . GLN A 1 67  ? -1.734  -13.890 -0.049  1.00 0.00 ? 67  GLN A HE21 4  
ATOM 5722  H HE22 . GLN A 1 67  ? -3.363  -14.053 -0.672  1.00 0.00 ? 67  GLN A HE22 4  
ATOM 5723  N N    . LYS A 1 68  ? -2.959  -9.197  5.033   1.00 0.00 ? 68  LYS A N    4  
ATOM 5724  C CA   . LYS A 1 68  ? -3.595  -7.943  5.432   1.00 0.00 ? 68  LYS A CA   4  
ATOM 5725  C C    . LYS A 1 68  ? -2.596  -6.788  5.406   1.00 0.00 ? 68  LYS A C    4  
ATOM 5726  O O    . LYS A 1 68  ? -2.967  -5.676  5.022   1.00 0.00 ? 68  LYS A O    4  
ATOM 5727  C CB   . LYS A 1 68  ? -4.197  -8.098  6.834   1.00 0.00 ? 68  LYS A CB   4  
ATOM 5728  C CG   . LYS A 1 68  ? -5.654  -8.571  6.840   1.00 0.00 ? 68  LYS A CG   4  
ATOM 5729  C CD   . LYS A 1 68  ? -5.921  -9.980  6.288   1.00 0.00 ? 68  LYS A CD   4  
ATOM 5730  C CE   . LYS A 1 68  ? -6.436  -9.938  4.844   1.00 0.00 ? 68  LYS A CE   4  
ATOM 5731  N NZ   . LYS A 1 68  ? -7.173  -11.169 4.505   1.00 0.00 ? 68  LYS A NZ   4  
ATOM 5732  H H    . LYS A 1 68  ? -2.940  -9.946  5.711   1.00 0.00 ? 68  LYS A H    4  
ATOM 5733  H HA   . LYS A 1 68  ? -4.385  -7.702  4.718   1.00 0.00 ? 68  LYS A HA   4  
ATOM 5734  H HB2  . LYS A 1 68  ? -3.586  -8.771  7.439   1.00 0.00 ? 68  LYS A HB2  4  
ATOM 5735  H HB3  . LYS A 1 68  ? -4.178  -7.126  7.323   1.00 0.00 ? 68  LYS A HB3  4  
ATOM 5736  H HG2  . LYS A 1 68  ? -5.982  -8.565  7.879   1.00 0.00 ? 68  LYS A HG2  4  
ATOM 5737  H HG3  . LYS A 1 68  ? -6.265  -7.842  6.305   1.00 0.00 ? 68  LYS A HG3  4  
ATOM 5738  H HD2  . LYS A 1 68  ? -5.032  -10.607 6.362   1.00 0.00 ? 68  LYS A HD2  4  
ATOM 5739  H HD3  . LYS A 1 68  ? -6.699  -10.425 6.912   1.00 0.00 ? 68  LYS A HD3  4  
ATOM 5740  H HE2  . LYS A 1 68  ? -7.127  -9.098  4.741   1.00 0.00 ? 68  LYS A HE2  4  
ATOM 5741  H HE3  . LYS A 1 68  ? -5.615  -9.786  4.142   1.00 0.00 ? 68  LYS A HE3  4  
ATOM 5742  H HZ1  . LYS A 1 68  ? -6.555  -11.965 4.397   1.00 0.00 ? 68  LYS A HZ1  4  
ATOM 5743  H HZ2  . LYS A 1 68  ? -7.853  -11.410 5.223   1.00 0.00 ? 68  LYS A HZ2  4  
ATOM 5744  H HZ3  . LYS A 1 68  ? -7.673  -11.054 3.629   1.00 0.00 ? 68  LYS A HZ3  4  
ATOM 5745  N N    . GLY A 1 69  ? -1.343  -7.050  5.785   1.00 0.00 ? 69  GLY A N    4  
ATOM 5746  C CA   . GLY A 1 69  ? -0.269  -6.075  5.742   1.00 0.00 ? 69  GLY A CA   4  
ATOM 5747  C C    . GLY A 1 69  ? 0.261   -5.837  4.329   1.00 0.00 ? 69  GLY A C    4  
ATOM 5748  O O    . GLY A 1 69  ? 0.701   -4.733  4.041   1.00 0.00 ? 69  GLY A O    4  
ATOM 5749  H H    . GLY A 1 69  ? -1.135  -7.973  6.148   1.00 0.00 ? 69  GLY A H    4  
ATOM 5750  H HA2  . GLY A 1 69  ? -0.630  -5.129  6.147   1.00 0.00 ? 69  GLY A HA2  4  
ATOM 5751  H HA3  . GLY A 1 69  ? 0.551   -6.425  6.368   1.00 0.00 ? 69  GLY A HA3  4  
ATOM 5752  N N    . ARG A 1 70  ? 0.257   -6.841  3.445   1.00 0.00 ? 70  ARG A N    4  
ATOM 5753  C CA   . ARG A 1 70  ? 0.707   -6.740  2.054   1.00 0.00 ? 70  ARG A CA   4  
ATOM 5754  C C    . ARG A 1 70  ? -0.326  -5.994  1.215   1.00 0.00 ? 70  ARG A C    4  
ATOM 5755  O O    . ARG A 1 70  ? 0.049   -5.355  0.241   1.00 0.00 ? 70  ARG A O    4  
ATOM 5756  C CB   . ARG A 1 70  ? 0.974   -8.150  1.476   1.00 0.00 ? 70  ARG A CB   4  
ATOM 5757  C CG   . ARG A 1 70  ? 2.217   -8.808  2.099   1.00 0.00 ? 70  ARG A CG   4  
ATOM 5758  C CD   . ARG A 1 70  ? 2.334   -10.323 1.890   1.00 0.00 ? 70  ARG A CD   4  
ATOM 5759  N NE   . ARG A 1 70  ? 3.443   -10.864 2.696   1.00 0.00 ? 70  ARG A NE   4  
ATOM 5760  C CZ   . ARG A 1 70  ? 4.140   -11.992 2.508   1.00 0.00 ? 70  ARG A CZ   4  
ATOM 5761  N NH1  . ARG A 1 70  ? 3.800   -12.897 1.596   1.00 0.00 ? 70  ARG A NH1  4  
ATOM 5762  N NH2  . ARG A 1 70  ? 5.219   -12.201 3.248   1.00 0.00 ? 70  ARG A NH2  4  
ATOM 5763  H H    . ARG A 1 70  ? -0.061  -7.756  3.750   1.00 0.00 ? 70  ARG A H    4  
ATOM 5764  H HA   . ARG A 1 70  ? 1.633   -6.166  2.018   1.00 0.00 ? 70  ARG A HA   4  
ATOM 5765  H HB2  . ARG A 1 70  ? 0.099   -8.777  1.643   1.00 0.00 ? 70  ARG A HB2  4  
ATOM 5766  H HB3  . ARG A 1 70  ? 1.131   -8.077  0.401   1.00 0.00 ? 70  ARG A HB3  4  
ATOM 5767  H HG2  . ARG A 1 70  ? 3.110   -8.319  1.717   1.00 0.00 ? 70  ARG A HG2  4  
ATOM 5768  H HG3  . ARG A 1 70  ? 2.195   -8.644  3.165   1.00 0.00 ? 70  ARG A HG3  4  
ATOM 5769  H HD2  . ARG A 1 70  ? 1.401   -10.801 2.192   1.00 0.00 ? 70  ARG A HD2  4  
ATOM 5770  H HD3  . ARG A 1 70  ? 2.521   -10.519 0.839   1.00 0.00 ? 70  ARG A HD3  4  
ATOM 5771  H HE   . ARG A 1 70  ? 3.686   -10.325 3.522   1.00 0.00 ? 70  ARG A HE   4  
ATOM 5772  H HH11 . ARG A 1 70  ? 3.129   -12.707 0.859   1.00 0.00 ? 70  ARG A HH11 4  
ATOM 5773  H HH12 . ARG A 1 70  ? 4.308   -13.778 1.536   1.00 0.00 ? 70  ARG A HH12 4  
ATOM 5774  H HH21 . ARG A 1 70  ? 5.565   -11.475 3.869   1.00 0.00 ? 70  ARG A HH21 4  
ATOM 5775  H HH22 . ARG A 1 70  ? 5.852   -12.964 3.006   1.00 0.00 ? 70  ARG A HH22 4  
ATOM 5776  N N    . GLU A 1 71  ? -1.597  -6.022  1.606   1.00 0.00 ? 71  GLU A N    4  
ATOM 5777  C CA   . GLU A 1 71  ? -2.742  -5.478  0.890   1.00 0.00 ? 71  GLU A CA   4  
ATOM 5778  C C    . GLU A 1 71  ? -2.529  -4.059  0.313   1.00 0.00 ? 71  GLU A C    4  
ATOM 5779  O O    . GLU A 1 71  ? -2.750  -3.872  -0.885  1.00 0.00 ? 71  GLU A O    4  
ATOM 5780  C CB   . GLU A 1 71  ? -3.962  -5.560  1.818   1.00 0.00 ? 71  GLU A CB   4  
ATOM 5781  C CG   . GLU A 1 71  ? -5.235  -5.940  1.073   1.00 0.00 ? 71  GLU A CG   4  
ATOM 5782  C CD   . GLU A 1 71  ? -6.433  -5.324  1.791   1.00 0.00 ? 71  GLU A CD   4  
ATOM 5783  O OE1  . GLU A 1 71  ? -6.836  -5.850  2.857   1.00 0.00 ? 71  GLU A OE1  4  
ATOM 5784  O OE2  . GLU A 1 71  ? -6.874  -4.239  1.349   1.00 0.00 ? 71  GLU A OE2  4  
ATOM 5785  H H    . GLU A 1 71  ? -1.837  -6.626  2.382   1.00 0.00 ? 71  GLU A H    4  
ATOM 5786  H HA   . GLU A 1 71  ? -2.928  -6.145  0.047   1.00 0.00 ? 71  GLU A HA   4  
ATOM 5787  H HB2  . GLU A 1 71  ? -3.809  -6.311  2.593   1.00 0.00 ? 71  GLU A HB2  4  
ATOM 5788  H HB3  . GLU A 1 71  ? -4.111  -4.604  2.313   1.00 0.00 ? 71  GLU A HB3  4  
ATOM 5789  H HG2  . GLU A 1 71  ? -5.173  -5.582  0.043   1.00 0.00 ? 71  GLU A HG2  4  
ATOM 5790  H HG3  . GLU A 1 71  ? -5.321  -7.026  1.066   1.00 0.00 ? 71  GLU A HG3  4  
ATOM 5791  N N    . PRO A 1 72  ? -2.095  -3.040  1.085   1.00 0.00 ? 72  PRO A N    4  
ATOM 5792  C CA   . PRO A 1 72  ? -1.853  -1.714  0.524   1.00 0.00 ? 72  PRO A CA   4  
ATOM 5793  C C    . PRO A 1 72  ? -0.602  -1.721  -0.360  1.00 0.00 ? 72  PRO A C    4  
ATOM 5794  O O    . PRO A 1 72  ? -0.599  -1.145  -1.445  1.00 0.00 ? 72  PRO A O    4  
ATOM 5795  C CB   . PRO A 1 72  ? -1.731  -0.778  1.729   1.00 0.00 ? 72  PRO A CB   4  
ATOM 5796  C CG   . PRO A 1 72  ? -1.243  -1.680  2.860   1.00 0.00 ? 72  PRO A CG   4  
ATOM 5797  C CD   . PRO A 1 72  ? -1.842  -3.043  2.520   1.00 0.00 ? 72  PRO A CD   4  
ATOM 5798  H HA   . PRO A 1 72  ? -2.706  -1.402  -0.082  1.00 0.00 ? 72  PRO A HA   4  
ATOM 5799  H HB2  . PRO A 1 72  ? -1.041  0.052   1.566   1.00 0.00 ? 72  PRO A HB2  4  
ATOM 5800  H HB3  . PRO A 1 72  ? -2.723  -0.398  1.977   1.00 0.00 ? 72  PRO A HB3  4  
ATOM 5801  H HG2  . PRO A 1 72  ? -0.156  -1.739  2.835   1.00 0.00 ? 72  PRO A HG2  4  
ATOM 5802  H HG3  . PRO A 1 72  ? -1.576  -1.324  3.834   1.00 0.00 ? 72  PRO A HG3  4  
ATOM 5803  H HD2  . PRO A 1 72  ? -1.144  -3.824  2.797   1.00 0.00 ? 72  PRO A HD2  4  
ATOM 5804  H HD3  . PRO A 1 72  ? -2.774  -3.183  3.061   1.00 0.00 ? 72  PRO A HD3  4  
ATOM 5805  N N    . PHE A 1 73  ? 0.459   -2.411  0.058   1.00 0.00 ? 73  PHE A N    4  
ATOM 5806  C CA   . PHE A 1 73  ? 1.704   -2.505  -0.692  1.00 0.00 ? 73  PHE A CA   4  
ATOM 5807  C C    . PHE A 1 73  ? 1.505   -3.136  -2.066  1.00 0.00 ? 73  PHE A C    4  
ATOM 5808  O O    . PHE A 1 73  ? 2.203   -2.778  -3.002  1.00 0.00 ? 73  PHE A O    4  
ATOM 5809  C CB   . PHE A 1 73  ? 2.730   -3.295  0.113   1.00 0.00 ? 73  PHE A CB   4  
ATOM 5810  C CG   . PHE A 1 73  ? 3.242   -2.510  1.298   1.00 0.00 ? 73  PHE A CG   4  
ATOM 5811  C CD1  . PHE A 1 73  ? 4.355   -1.677  1.134   1.00 0.00 ? 73  PHE A CD1  4  
ATOM 5812  C CD2  . PHE A 1 73  ? 2.593   -2.560  2.540   1.00 0.00 ? 73  PHE A CD2  4  
ATOM 5813  C CE1  . PHE A 1 73  ? 4.863   -0.947  2.218   1.00 0.00 ? 73  PHE A CE1  4  
ATOM 5814  C CE2  . PHE A 1 73  ? 3.079   -1.813  3.625   1.00 0.00 ? 73  PHE A CE2  4  
ATOM 5815  C CZ   . PHE A 1 73  ? 4.220   -1.009  3.461   1.00 0.00 ? 73  PHE A CZ   4  
ATOM 5816  H H    . PHE A 1 73  ? 0.374   -2.958  0.901   1.00 0.00 ? 73  PHE A H    4  
ATOM 5817  H HA   . PHE A 1 73  ? 2.095   -1.499  -0.842  1.00 0.00 ? 73  PHE A HA   4  
ATOM 5818  H HB2  . PHE A 1 73  ? 2.296   -4.246  0.433   1.00 0.00 ? 73  PHE A HB2  4  
ATOM 5819  H HB3  . PHE A 1 73  ? 3.577   -3.518  -0.537  1.00 0.00 ? 73  PHE A HB3  4  
ATOM 5820  H HD1  . PHE A 1 73  ? 4.820   -1.611  0.164   1.00 0.00 ? 73  PHE A HD1  4  
ATOM 5821  H HD2  . PHE A 1 73  ? 1.717   -3.171  2.653   1.00 0.00 ? 73  PHE A HD2  4  
ATOM 5822  H HE1  . PHE A 1 73  ? 5.761   -0.357  2.095   1.00 0.00 ? 73  PHE A HE1  4  
ATOM 5823  H HE2  . PHE A 1 73  ? 2.581   -1.872  4.583   1.00 0.00 ? 73  PHE A HE2  4  
ATOM 5824  H HZ   . PHE A 1 73  ? 4.646   -0.471  4.295   1.00 0.00 ? 73  PHE A HZ   4  
ATOM 5825  N N    . ILE A 1 74  ? 0.564   -4.058  -2.213  1.00 0.00 ? 74  ILE A N    4  
ATOM 5826  C CA   . ILE A 1 74  ? 0.184   -4.644  -3.488  1.00 0.00 ? 74  ILE A CA   4  
ATOM 5827  C C    . ILE A 1 74  ? -0.374  -3.562  -4.404  1.00 0.00 ? 74  ILE A C    4  
ATOM 5828  O O    . ILE A 1 74  ? 0.054   -3.476  -5.552  1.00 0.00 ? 74  ILE A O    4  
ATOM 5829  C CB   . ILE A 1 74  ? -0.855  -5.751  -3.194  1.00 0.00 ? 74  ILE A CB   4  
ATOM 5830  C CG1  . ILE A 1 74  ? -0.123  -7.008  -2.690  1.00 0.00 ? 74  ILE A CG1  4  
ATOM 5831  C CG2  . ILE A 1 74  ? -1.773  -6.052  -4.382  1.00 0.00 ? 74  ILE A CG2  4  
ATOM 5832  C CD1  . ILE A 1 74  ? -1.011  -7.915  -1.836  1.00 0.00 ? 74  ILE A CD1  4  
ATOM 5833  H H    . ILE A 1 74  ? 0.056   -4.354  -1.384  1.00 0.00 ? 74  ILE A H    4  
ATOM 5834  H HA   . ILE A 1 74  ? 1.087   -5.041  -3.981  1.00 0.00 ? 74  ILE A HA   4  
ATOM 5835  H HB   . ILE A 1 74  ? -1.504  -5.399  -2.396  1.00 0.00 ? 74  ILE A HB   4  
ATOM 5836  H HG12 . ILE A 1 74  ? 0.290   -7.567  -3.532  1.00 0.00 ? 74  ILE A HG12 4  
ATOM 5837  H HG13 . ILE A 1 74  ? 0.697   -6.692  -2.052  1.00 0.00 ? 74  ILE A HG13 4  
ATOM 5838  H HG21 . ILE A 1 74  ? -2.415  -6.897  -4.140  1.00 0.00 ? 74  ILE A HG21 4  
ATOM 5839  H HG22 . ILE A 1 74  ? -2.431  -5.200  -4.593  1.00 0.00 ? 74  ILE A HG22 4  
ATOM 5840  H HG23 . ILE A 1 74  ? -1.172  -6.279  -5.263  1.00 0.00 ? 74  ILE A HG23 4  
ATOM 5841  H HD11 . ILE A 1 74  ? -1.426  -7.338  -1.010  1.00 0.00 ? 74  ILE A HD11 4  
ATOM 5842  H HD12 . ILE A 1 74  ? -1.823  -8.330  -2.430  1.00 0.00 ? 74  ILE A HD12 4  
ATOM 5843  H HD13 . ILE A 1 74  ? -0.403  -8.721  -1.429  1.00 0.00 ? 74  ILE A HD13 4  
ATOM 5844  N N    . ARG A 1 75  ? -1.312  -2.735  -3.931  1.00 0.00 ? 75  ARG A N    4  
ATOM 5845  C CA   . ARG A 1 75  ? -1.826  -1.645  -4.729  1.00 0.00 ? 75  ARG A CA   4  
ATOM 5846  C C    . ARG A 1 75  ? -0.700  -0.685  -5.096  1.00 0.00 ? 75  ARG A C    4  
ATOM 5847  O O    . ARG A 1 75  ? -0.671  -0.212  -6.224  1.00 0.00 ? 75  ARG A O    4  
ATOM 5848  C CB   . ARG A 1 75  ? -2.942  -0.944  -3.956  1.00 0.00 ? 75  ARG A CB   4  
ATOM 5849  C CG   . ARG A 1 75  ? -4.261  -1.739  -3.913  1.00 0.00 ? 75  ARG A CG   4  
ATOM 5850  C CD   . ARG A 1 75  ? -5.406  -0.717  -3.799  1.00 0.00 ? 75  ARG A CD   4  
ATOM 5851  N NE   . ARG A 1 75  ? -6.753  -1.289  -3.972  1.00 0.00 ? 75  ARG A NE   4  
ATOM 5852  C CZ   . ARG A 1 75  ? -7.851  -0.543  -4.178  1.00 0.00 ? 75  ARG A CZ   4  
ATOM 5853  N NH1  . ARG A 1 75  ? -7.776  0.782   -4.211  1.00 0.00 ? 75  ARG A NH1  4  
ATOM 5854  N NH2  . ARG A 1 75  ? -9.041  -1.105  -4.336  1.00 0.00 ? 75  ARG A NH2  4  
ATOM 5855  H H    . ARG A 1 75  ? -1.650  -2.770  -2.980  1.00 0.00 ? 75  ARG A H    4  
ATOM 5856  H HA   . ARG A 1 75  ? -2.227  -2.042  -5.664  1.00 0.00 ? 75  ARG A HA   4  
ATOM 5857  H HB2  . ARG A 1 75  ? -2.627  -0.709  -2.940  1.00 0.00 ? 75  ARG A HB2  4  
ATOM 5858  H HB3  . ARG A 1 75  ? -3.101  -0.004  -4.463  1.00 0.00 ? 75  ARG A HB3  4  
ATOM 5859  H HG2  . ARG A 1 75  ? -4.360  -2.351  -4.816  1.00 0.00 ? 75  ARG A HG2  4  
ATOM 5860  H HG3  . ARG A 1 75  ? -4.262  -2.404  -3.049  1.00 0.00 ? 75  ARG A HG3  4  
ATOM 5861  H HD2  . ARG A 1 75  ? -5.343  -0.221  -2.826  1.00 0.00 ? 75  ARG A HD2  4  
ATOM 5862  H HD3  . ARG A 1 75  ? -5.270  0.038   -4.577  1.00 0.00 ? 75  ARG A HD3  4  
ATOM 5863  H HE   . ARG A 1 75  ? -6.841  -2.299  -3.959  1.00 0.00 ? 75  ARG A HE   4  
ATOM 5864  H HH11 . ARG A 1 75  ? -6.906  1.300   -4.091  1.00 0.00 ? 75  ARG A HH11 4  
ATOM 5865  H HH12 . ARG A 1 75  ? -8.626  1.343   -4.216  1.00 0.00 ? 75  ARG A HH12 4  
ATOM 5866  H HH21 . ARG A 1 75  ? -9.175  -2.113  -4.235  1.00 0.00 ? 75  ARG A HH21 4  
ATOM 5867  H HH22 . ARG A 1 75  ? -9.848  -0.531  -4.571  1.00 0.00 ? 75  ARG A HH22 4  
ATOM 5868  N N    . MET A 1 76  ? 0.247   -0.448  -4.186  1.00 0.00 ? 76  MET A N    4  
ATOM 5869  C CA   . MET A 1 76  ? 1.461   0.311   -4.448  1.00 0.00 ? 76  MET A CA   4  
ATOM 5870  C C    . MET A 1 76  ? 2.262   -0.293  -5.621  1.00 0.00 ? 76  MET A C    4  
ATOM 5871  O O    . MET A 1 76  ? 2.647   0.441   -6.530  1.00 0.00 ? 76  MET A O    4  
ATOM 5872  C CB   . MET A 1 76  ? 2.284   0.350   -3.147  1.00 0.00 ? 76  MET A CB   4  
ATOM 5873  C CG   . MET A 1 76  ? 2.799   1.735   -2.794  1.00 0.00 ? 76  MET A CG   4  
ATOM 5874  S SD   . MET A 1 76  ? 4.144   1.713   -1.576  1.00 0.00 ? 76  MET A SD   4  
ATOM 5875  C CE   . MET A 1 76  ? 3.182   1.630   -0.063  1.00 0.00 ? 76  MET A CE   4  
ATOM 5876  H H    . MET A 1 76  ? 0.125   -0.815  -3.248  1.00 0.00 ? 76  MET A H    4  
ATOM 5877  H HA   . MET A 1 76  ? 1.160   1.324   -4.728  1.00 0.00 ? 76  MET A HA   4  
ATOM 5878  H HB2  . MET A 1 76  ? 1.677   0.024   -2.307  1.00 0.00 ? 76  MET A HB2  4  
ATOM 5879  H HB3  . MET A 1 76  ? 3.134   -0.324  -3.234  1.00 0.00 ? 76  MET A HB3  4  
ATOM 5880  H HG2  . MET A 1 76  ? 3.166   2.184   -3.703  1.00 0.00 ? 76  MET A HG2  4  
ATOM 5881  H HG3  . MET A 1 76  ? 1.976   2.347   -2.429  1.00 0.00 ? 76  MET A HG3  4  
ATOM 5882  H HE1  . MET A 1 76  ? 2.223   1.143   -0.255  1.00 0.00 ? 76  MET A HE1  4  
ATOM 5883  H HE2  . MET A 1 76  ? 3.761   1.052   0.647   1.00 0.00 ? 76  MET A HE2  4  
ATOM 5884  H HE3  . MET A 1 76  ? 3.044   2.641   0.328   1.00 0.00 ? 76  MET A HE3  4  
ATOM 5885  N N    . GLN A 1 77  ? 2.502   -1.616  -5.615  1.00 0.00 ? 77  GLN A N    4  
ATOM 5886  C CA   . GLN A 1 77  ? 3.222   -2.325  -6.677  1.00 0.00 ? 77  GLN A CA   4  
ATOM 5887  C C    . GLN A 1 77  ? 2.494   -2.165  -8.002  1.00 0.00 ? 77  GLN A C    4  
ATOM 5888  O O    . GLN A 1 77  ? 3.113   -1.827  -9.003  1.00 0.00 ? 77  GLN A O    4  
ATOM 5889  C CB   . GLN A 1 77  ? 3.365   -3.834  -6.394  1.00 0.00 ? 77  GLN A CB   4  
ATOM 5890  C CG   . GLN A 1 77  ? 4.303   -4.140  -5.228  1.00 0.00 ? 77  GLN A CG   4  
ATOM 5891  C CD   . GLN A 1 77  ? 4.364   -5.611  -4.832  1.00 0.00 ? 77  GLN A CD   4  
ATOM 5892  O OE1  . GLN A 1 77  ? 5.128   -6.407  -5.365  1.00 0.00 ? 77  GLN A OE1  4  
ATOM 5893  N NE2  . GLN A 1 77  ? 3.600   -5.981  -3.820  1.00 0.00 ? 77  GLN A NE2  4  
ATOM 5894  H H    . GLN A 1 77  ? 2.145   -2.165  -4.843  1.00 0.00 ? 77  GLN A H    4  
ATOM 5895  H HA   . GLN A 1 77  ? 4.215   -1.887  -6.786  1.00 0.00 ? 77  GLN A HA   4  
ATOM 5896  H HB2  . GLN A 1 77  ? 2.388   -4.274  -6.198  1.00 0.00 ? 77  GLN A HB2  4  
ATOM 5897  H HB3  . GLN A 1 77  ? 3.778   -4.299  -7.290  1.00 0.00 ? 77  GLN A HB3  4  
ATOM 5898  H HG2  . GLN A 1 77  ? 5.294   -3.838  -5.503  1.00 0.00 ? 77  GLN A HG2  4  
ATOM 5899  H HG3  . GLN A 1 77  ? 4.015   -3.549  -4.368  1.00 0.00 ? 77  GLN A HG3  4  
ATOM 5900  H HE21 . GLN A 1 77  ? 3.028   -5.291  -3.362  1.00 0.00 ? 77  GLN A HE21 4  
ATOM 5901  H HE22 . GLN A 1 77  ? 3.720   -6.924  -3.482  1.00 0.00 ? 77  GLN A HE22 4  
ATOM 5902  N N    . LEU A 1 78  ? 1.187   -2.431  -8.012  1.00 0.00 ? 78  LEU A N    4  
ATOM 5903  C CA   . LEU A 1 78  ? 0.394   -2.357  -9.226  1.00 0.00 ? 78  LEU A CA   4  
ATOM 5904  C C    . LEU A 1 78  ? 0.427   -0.947  -9.762  1.00 0.00 ? 78  LEU A C    4  
ATOM 5905  O O    . LEU A 1 78  ? 0.807   -0.771  -10.910 1.00 0.00 ? 78  LEU A O    4  
ATOM 5906  C CB   . LEU A 1 78  ? -1.049  -2.827  -8.973  1.00 0.00 ? 78  LEU A CB   4  
ATOM 5907  C CG   . LEU A 1 78  ? -1.142  -4.349  -8.779  1.00 0.00 ? 78  LEU A CG   4  
ATOM 5908  C CD1  . LEU A 1 78  ? -2.474  -4.722  -8.129  1.00 0.00 ? 78  LEU A CD1  4  
ATOM 5909  C CD2  . LEU A 1 78  ? -0.992  -5.100  -10.108 1.00 0.00 ? 78  LEU A CD2  4  
ATOM 5910  H H    . LEU A 1 78  ? 0.739   -2.710  -7.146  1.00 0.00 ? 78  LEU A H    4  
ATOM 5911  H HA   . LEU A 1 78  ? 0.879   -2.960  -9.996  1.00 0.00 ? 78  LEU A HA   4  
ATOM 5912  H HB2  . LEU A 1 78  ? -1.429  -2.319  -8.086  1.00 0.00 ? 78  LEU A HB2  4  
ATOM 5913  H HB3  . LEU A 1 78  ? -1.679  -2.539  -9.817  1.00 0.00 ? 78  LEU A HB3  4  
ATOM 5914  H HG   . LEU A 1 78  ? -0.351  -4.676  -8.105  1.00 0.00 ? 78  LEU A HG   4  
ATOM 5915  H HD11 . LEU A 1 78  ? -2.551  -4.252  -7.149  1.00 0.00 ? 78  LEU A HD11 4  
ATOM 5916  H HD12 . LEU A 1 78  ? -3.307  -4.395  -8.754  1.00 0.00 ? 78  LEU A HD12 4  
ATOM 5917  H HD13 . LEU A 1 78  ? -2.523  -5.801  -8.007  1.00 0.00 ? 78  LEU A HD13 4  
ATOM 5918  H HD21 . LEU A 1 78  ? -1.818  -4.857  -10.779 1.00 0.00 ? 78  LEU A HD21 4  
ATOM 5919  H HD22 . LEU A 1 78  ? -0.054  -4.841  -10.597 1.00 0.00 ? 78  LEU A HD22 4  
ATOM 5920  H HD23 . LEU A 1 78  ? -0.984  -6.171  -9.920  1.00 0.00 ? 78  LEU A HD23 4  
ATOM 5921  N N    . TRP A 1 79  ? 0.105   0.055   -8.945  1.00 0.00 ? 79  TRP A N    4  
ATOM 5922  C CA   . TRP A 1 79  ? 0.026   1.449   -9.351  1.00 0.00 ? 79  TRP A CA   4  
ATOM 5923  C C    . TRP A 1 79  ? 1.253   1.914   -10.131 1.00 0.00 ? 79  TRP A C    4  
ATOM 5924  O O    . TRP A 1 79  ? 1.106   2.734   -11.037 1.00 0.00 ? 79  TRP A O    4  
ATOM 5925  C CB   . TRP A 1 79  ? -0.180  2.303   -8.092  1.00 0.00 ? 79  TRP A CB   4  
ATOM 5926  C CG   . TRP A 1 79  ? -0.144  3.786   -8.282  1.00 0.00 ? 79  TRP A CG   4  
ATOM 5927  C CD1  . TRP A 1 79  ? -1.209  4.599   -8.459  1.00 0.00 ? 79  TRP A CD1  4  
ATOM 5928  C CD2  . TRP A 1 79  ? 1.030   4.649   -8.332  1.00 0.00 ? 79  TRP A CD2  4  
ATOM 5929  N NE1  . TRP A 1 79  ? -0.775  5.905   -8.548  1.00 0.00 ? 79  TRP A NE1  4  
ATOM 5930  C CE2  . TRP A 1 79  ? 0.601   5.990   -8.532  1.00 0.00 ? 79  TRP A CE2  4  
ATOM 5931  C CE3  . TRP A 1 79  ? 2.419   4.424   -8.227  1.00 0.00 ? 79  TRP A CE3  4  
ATOM 5932  C CZ2  . TRP A 1 79  ? 1.507   7.053   -8.658  1.00 0.00 ? 79  TRP A CZ2  4  
ATOM 5933  C CZ3  . TRP A 1 79  ? 3.338   5.485   -8.315  1.00 0.00 ? 79  TRP A CZ3  4  
ATOM 5934  C CH2  . TRP A 1 79  ? 2.884   6.796   -8.543  1.00 0.00 ? 79  TRP A CH2  4  
ATOM 5935  H H    . TRP A 1 79  ? -0.131  -0.164  -7.983  1.00 0.00 ? 79  TRP A H    4  
ATOM 5936  H HA   . TRP A 1 79  ? -0.828  1.548   -10.016 1.00 0.00 ? 79  TRP A HA   4  
ATOM 5937  H HB2  . TRP A 1 79  ? -1.125  2.028   -7.632  1.00 0.00 ? 79  TRP A HB2  4  
ATOM 5938  H HB3  . TRP A 1 79  ? 0.605   2.054   -7.376  1.00 0.00 ? 79  TRP A HB3  4  
ATOM 5939  H HD1  . TRP A 1 79  ? -2.244  4.285   -8.502  1.00 0.00 ? 79  TRP A HD1  4  
ATOM 5940  H HE1  . TRP A 1 79  ? -1.413  6.699   -8.601  1.00 0.00 ? 79  TRP A HE1  4  
ATOM 5941  H HE3  . TRP A 1 79  ? 2.760   3.413   -8.050  1.00 0.00 ? 79  TRP A HE3  4  
ATOM 5942  H HZ2  . TRP A 1 79  ? 1.147   8.058   -8.825  1.00 0.00 ? 79  TRP A HZ2  4  
ATOM 5943  H HZ3  . TRP A 1 79  ? 4.397   5.288   -8.215  1.00 0.00 ? 79  TRP A HZ3  4  
ATOM 5944  H HH2  . TRP A 1 79  ? 3.592   7.608   -8.615  1.00 0.00 ? 79  TRP A HH2  4  
ATOM 5945  N N    . LEU A 1 80  ? 2.438   1.391   -9.799  1.00 0.00 ? 80  LEU A N    4  
ATOM 5946  C CA   . LEU A 1 80  ? 3.674   1.742   -10.483 1.00 0.00 ? 80  LEU A CA   4  
ATOM 5947  C C    . LEU A 1 80  ? 3.561   1.499   -11.988 1.00 0.00 ? 80  LEU A C    4  
ATOM 5948  O O    . LEU A 1 80  ? 4.037   2.349   -12.747 1.00 0.00 ? 80  LEU A O    4  
ATOM 5949  C CB   . LEU A 1 80  ? 4.878   0.977   -9.894  1.00 0.00 ? 80  LEU A CB   4  
ATOM 5950  C CG   . LEU A 1 80  ? 5.621   1.769   -8.804  1.00 0.00 ? 80  LEU A CG   4  
ATOM 5951  C CD1  . LEU A 1 80  ? 6.478   0.824   -7.961  1.00 0.00 ? 80  LEU A CD1  4  
ATOM 5952  C CD2  . LEU A 1 80  ? 6.525   2.851   -9.410  1.00 0.00 ? 80  LEU A CD2  4  
ATOM 5953  H H    . LEU A 1 80  ? 2.444   0.664   -9.093  1.00 0.00 ? 80  LEU A H    4  
ATOM 5954  H HA   . LEU A 1 80  ? 3.832   2.809   -10.338 1.00 0.00 ? 80  LEU A HA   4  
ATOM 5955  H HB2  . LEU A 1 80  ? 4.548   0.021   -9.490  1.00 0.00 ? 80  LEU A HB2  4  
ATOM 5956  H HB3  . LEU A 1 80  ? 5.581   0.755   -10.696 1.00 0.00 ? 80  LEU A HB3  4  
ATOM 5957  H HG   . LEU A 1 80  ? 4.894   2.247   -8.146  1.00 0.00 ? 80  LEU A HG   4  
ATOM 5958  H HD11 . LEU A 1 80  ? 7.162   0.264   -8.600  1.00 0.00 ? 80  LEU A HD11 4  
ATOM 5959  H HD12 . LEU A 1 80  ? 7.052   1.389   -7.231  1.00 0.00 ? 80  LEU A HD12 4  
ATOM 5960  H HD13 . LEU A 1 80  ? 5.828   0.124   -7.436  1.00 0.00 ? 80  LEU A HD13 4  
ATOM 5961  H HD21 . LEU A 1 80  ? 6.943   3.479   -8.624  1.00 0.00 ? 80  LEU A HD21 4  
ATOM 5962  H HD22 . LEU A 1 80  ? 7.350   2.391   -9.959  1.00 0.00 ? 80  LEU A HD22 4  
ATOM 5963  H HD23 . LEU A 1 80  ? 5.961   3.477   -10.095 1.00 0.00 ? 80  LEU A HD23 4  
ATOM 5964  N N    . SER A 1 81  ? 3.058   0.345   -12.433 1.00 0.00 ? 81  SER A N    4  
ATOM 5965  C CA   . SER A 1 81  ? 2.788   0.067   -13.848 1.00 0.00 ? 81  SER A CA   4  
ATOM 5966  C C    . SER A 1 81  ? 1.324   0.302   -14.250 1.00 0.00 ? 81  SER A C    4  
ATOM 5967  O O    . SER A 1 81  ? 1.036   0.988   -15.226 1.00 0.00 ? 81  SER A O    4  
ATOM 5968  C CB   . SER A 1 81  ? 3.275   -1.341  -14.192 1.00 0.00 ? 81  SER A CB   4  
ATOM 5969  O OG   . SER A 1 81  ? 3.702   -1.388  -15.538 1.00 0.00 ? 81  SER A OG   4  
ATOM 5970  H H    . SER A 1 81  ? 2.660   -0.299  -11.746 1.00 0.00 ? 81  SER A H    4  
ATOM 5971  H HA   . SER A 1 81  ? 3.384   0.764   -14.440 1.00 0.00 ? 81  SER A HA   4  
ATOM 5972  H HB2  . SER A 1 81  ? 4.120   -1.595  -13.551 1.00 0.00 ? 81  SER A HB2  4  
ATOM 5973  H HB3  . SER A 1 81  ? 2.479   -2.064  -14.021 1.00 0.00 ? 81  SER A HB3  4  
ATOM 5974  H HG   . SER A 1 81  ? 4.516   -1.914  -15.551 1.00 0.00 ? 81  SER A HG   4  
ATOM 5975  N N    . ASP A 1 82  ? 0.403   -0.337  -13.528 1.00 0.00 ? 82  ASP A N    4  
ATOM 5976  C CA   . ASP A 1 82  ? -1.025  -0.498  -13.817 1.00 0.00 ? 82  ASP A CA   4  
ATOM 5977  C C    . ASP A 1 82  ? -1.772  0.830   -13.821 1.00 0.00 ? 82  ASP A C    4  
ATOM 5978  O O    . ASP A 1 82  ? -2.829  0.945   -14.445 1.00 0.00 ? 82  ASP A O    4  
ATOM 5979  C CB   . ASP A 1 82  ? -1.650  -1.379  -12.720 1.00 0.00 ? 82  ASP A CB   4  
ATOM 5980  C CG   . ASP A 1 82  ? -3.083  -1.808  -13.039 1.00 0.00 ? 82  ASP A CG   4  
ATOM 5981  O OD1  . ASP A 1 82  ? -3.281  -2.531  -14.041 1.00 0.00 ? 82  ASP A OD1  4  
ATOM 5982  O OD2  . ASP A 1 82  ? -4.010  -1.501  -12.252 1.00 0.00 ? 82  ASP A OD2  4  
ATOM 5983  H H    . ASP A 1 82  ? 0.727   -0.828  -12.703 1.00 0.00 ? 82  ASP A H    4  
ATOM 5984  H HA   . ASP A 1 82  ? -1.141  -0.987  -14.786 1.00 0.00 ? 82  ASP A HA   4  
ATOM 5985  H HB2  . ASP A 1 82  ? -1.041  -2.269  -12.570 1.00 0.00 ? 82  ASP A HB2  4  
ATOM 5986  H HB3  . ASP A 1 82  ? -1.652  -0.826  -11.781 1.00 0.00 ? 82  ASP A HB3  4  
ATOM 5987  N N    . GLN A 1 83  ? -1.237  1.821   -13.101 1.00 0.00 ? 83  GLN A N    4  
ATOM 5988  C CA   . GLN A 1 83  ? -1.728  3.185   -12.974 1.00 0.00 ? 83  GLN A CA   4  
ATOM 5989  C C    . GLN A 1 83  ? -3.212  3.313   -12.580 1.00 0.00 ? 83  GLN A C    4  
ATOM 5990  O O    . GLN A 1 83  ? -3.748  4.423   -12.640 1.00 0.00 ? 83  GLN A O    4  
ATOM 5991  C CB   . GLN A 1 83  ? -1.365  3.969   -14.249 1.00 0.00 ? 83  GLN A CB   4  
ATOM 5992  C CG   . GLN A 1 83  ? -0.741  5.325   -13.909 1.00 0.00 ? 83  GLN A CG   4  
ATOM 5993  C CD   . GLN A 1 83  ? -0.737  6.258   -15.116 1.00 0.00 ? 83  GLN A CD   4  
ATOM 5994  O OE1  . GLN A 1 83  ? -1.658  7.055   -15.295 1.00 0.00 ? 83  GLN A OE1  4  
ATOM 5995  N NE2  . GLN A 1 83  ? 0.270   6.189   -15.966 1.00 0.00 ? 83  GLN A NE2  4  
ATOM 5996  H H    . GLN A 1 83  ? -0.326  1.655   -12.696 1.00 0.00 ? 83  GLN A H    4  
ATOM 5997  H HA   . GLN A 1 83  ? -1.158  3.614   -12.150 1.00 0.00 ? 83  GLN A HA   4  
ATOM 5998  H HB2  . GLN A 1 83  ? -0.642  3.416   -14.850 1.00 0.00 ? 83  GLN A HB2  4  
ATOM 5999  H HB3  . GLN A 1 83  ? -2.262  4.115   -14.850 1.00 0.00 ? 83  GLN A HB3  4  
ATOM 6000  H HG2  . GLN A 1 83  ? -1.321  5.783   -13.113 1.00 0.00 ? 83  GLN A HG2  4  
ATOM 6001  H HG3  . GLN A 1 83  ? 0.278   5.180   -13.544 1.00 0.00 ? 83  GLN A HG3  4  
ATOM 6002  H HE21 . GLN A 1 83  ? 0.960   5.445   -15.906 1.00 0.00 ? 83  GLN A HE21 4  
ATOM 6003  H HE22 . GLN A 1 83  ? 0.201   6.709   -16.838 1.00 0.00 ? 83  GLN A HE22 4  
ATOM 6004  N N    . LEU A 1 84  ? -3.863  2.217   -12.163 1.00 0.00 ? 84  LEU A N    4  
ATOM 6005  C CA   . LEU A 1 84  ? -5.279  2.070   -11.825 1.00 0.00 ? 84  LEU A CA   4  
ATOM 6006  C C    . LEU A 1 84  ? -6.159  2.924   -12.737 1.00 0.00 ? 84  LEU A C    4  
ATOM 6007  O O    . LEU A 1 84  ? -6.711  3.957   -12.350 1.00 0.00 ? 84  LEU A O    4  
ATOM 6008  C CB   . LEU A 1 84  ? -5.543  2.268   -10.327 1.00 0.00 ? 84  LEU A CB   4  
ATOM 6009  C CG   . LEU A 1 84  ? -4.895  1.126   -9.509  1.00 0.00 ? 84  LEU A CG   4  
ATOM 6010  C CD1  . LEU A 1 84  ? -3.547  1.546   -8.923  1.00 0.00 ? 84  LEU A CD1  4  
ATOM 6011  C CD2  . LEU A 1 84  ? -5.806  0.667   -8.379  1.00 0.00 ? 84  LEU A CD2  4  
ATOM 6012  H H    . LEU A 1 84  ? -3.348  1.349   -12.225 1.00 0.00 ? 84  LEU A H    4  
ATOM 6013  H HA   . LEU A 1 84  ? -5.552  1.029   -12.017 1.00 0.00 ? 84  LEU A HA   4  
ATOM 6014  H HB2  . LEU A 1 84  ? -5.191  3.245   -9.994  1.00 0.00 ? 84  LEU A HB2  4  
ATOM 6015  H HB3  . LEU A 1 84  ? -6.626  2.241   -10.205 1.00 0.00 ? 84  LEU A HB3  4  
ATOM 6016  H HG   . LEU A 1 84  ? -4.732  0.262   -10.153 1.00 0.00 ? 84  LEU A HG   4  
ATOM 6017  H HD11 . LEU A 1 84  ? -2.910  1.931   -9.713  1.00 0.00 ? 84  LEU A HD11 4  
ATOM 6018  H HD12 . LEU A 1 84  ? -3.690  2.321   -8.172  1.00 0.00 ? 84  LEU A HD12 4  
ATOM 6019  H HD13 . LEU A 1 84  ? -3.065  0.683   -8.462  1.00 0.00 ? 84  LEU A HD13 4  
ATOM 6020  H HD21 . LEU A 1 84  ? -6.772  0.396   -8.798  1.00 0.00 ? 84  LEU A HD21 4  
ATOM 6021  H HD22 . LEU A 1 84  ? -5.380  -0.213  -7.898  1.00 0.00 ? 84  LEU A HD22 4  
ATOM 6022  H HD23 . LEU A 1 84  ? -5.923  1.458   -7.644  1.00 0.00 ? 84  LEU A HD23 4  
ATOM 6023  N N    . GLY A 1 85  ? -6.242  2.481   -13.989 1.00 0.00 ? 85  GLY A N    4  
ATOM 6024  C CA   . GLY A 1 85  ? -7.083  3.034   -15.030 1.00 0.00 ? 85  GLY A CA   4  
ATOM 6025  C C    . GLY A 1 85  ? -8.090  1.958   -15.383 1.00 0.00 ? 85  GLY A C    4  
ATOM 6026  O O    . GLY A 1 85  ? -7.740  0.989   -16.060 1.00 0.00 ? 85  GLY A O    4  
ATOM 6027  H H    . GLY A 1 85  ? -5.753  1.629   -14.215 1.00 0.00 ? 85  GLY A H    4  
ATOM 6028  H HA2  . GLY A 1 85  ? -7.591  3.926   -14.669 1.00 0.00 ? 85  GLY A HA2  4  
ATOM 6029  H HA3  . GLY A 1 85  ? -6.477  3.279   -15.903 1.00 0.00 ? 85  GLY A HA3  4  
ATOM 6030  N N    . GLN A 1 86  ? -9.296  2.057   -14.837 1.00 0.00 ? 86  GLN A N    4  
ATOM 6031  C CA   . GLN A 1 86  ? -10.314 1.026   -14.906 1.00 0.00 ? 86  GLN A CA   4  
ATOM 6032  C C    . GLN A 1 86  ? -11.677 1.670   -15.139 1.00 0.00 ? 86  GLN A C    4  
ATOM 6033  O O    . GLN A 1 86  ? -12.218 1.621   -16.244 1.00 0.00 ? 86  GLN A O    4  
ATOM 6034  C CB   . GLN A 1 86  ? -10.255 0.167   -13.622 1.00 0.00 ? 86  GLN A CB   4  
ATOM 6035  C CG   . GLN A 1 86  ? -9.803  -1.262  -13.914 1.00 0.00 ? 86  GLN A CG   4  
ATOM 6036  C CD   . GLN A 1 86  ? -9.716  -2.075  -12.625 1.00 0.00 ? 86  GLN A CD   4  
ATOM 6037  O OE1  . GLN A 1 86  ? -8.667  -2.140  -11.983 1.00 0.00 ? 86  GLN A OE1  4  
ATOM 6038  N NE2  . GLN A 1 86  ? -10.819 -2.673  -12.219 1.00 0.00 ? 86  GLN A NE2  4  
ATOM 6039  H H    . GLN A 1 86  ? -9.511  2.872   -14.281 1.00 0.00 ? 86  GLN A H    4  
ATOM 6040  H HA   . GLN A 1 86  ? -10.113 0.401   -15.770 1.00 0.00 ? 86  GLN A HA   4  
ATOM 6041  H HB2  . GLN A 1 86  ? -9.564  0.605   -12.901 1.00 0.00 ? 86  GLN A HB2  4  
ATOM 6042  H HB3  . GLN A 1 86  ? -11.234 0.121   -13.149 1.00 0.00 ? 86  GLN A HB3  4  
ATOM 6043  H HG2  . GLN A 1 86  ? -10.524 -1.721  -14.593 1.00 0.00 ? 86  GLN A HG2  4  
ATOM 6044  H HG3  . GLN A 1 86  ? -8.825  -1.241  -14.395 1.00 0.00 ? 86  GLN A HG3  4  
ATOM 6045  H HE21 . GLN A 1 86  ? -11.679 -2.522  -12.748 1.00 0.00 ? 86  GLN A HE21 4  
ATOM 6046  H HE22 . GLN A 1 86  ? -10.830 -3.326  -11.437 1.00 0.00 ? 86  GLN A HE22 4  
ATOM 6047  N N    . ALA A 1 87  ? -12.239 2.273   -14.097 1.00 0.00 ? 87  ALA A N    4  
ATOM 6048  C CA   . ALA A 1 87  ? -13.523 2.924   -14.058 1.00 0.00 ? 87  ALA A CA   4  
ATOM 6049  C C    . ALA A 1 87  ? -13.496 3.824   -12.819 1.00 0.00 ? 87  ALA A C    4  
ATOM 6050  O O    . ALA A 1 87  ? -12.518 3.860   -12.069 1.00 0.00 ? 87  ALA A O    4  
ATOM 6051  C CB   . ALA A 1 87  ? -14.629 1.859   -14.013 1.00 0.00 ? 87  ALA A CB   4  
ATOM 6052  H H    . ALA A 1 87  ? -11.732 2.396   -13.231 1.00 0.00 ? 87  ALA A H    4  
ATOM 6053  H HA   . ALA A 1 87  ? -13.644 3.542   -14.948 1.00 0.00 ? 87  ALA A HA   4  
ATOM 6054  H HB1  . ALA A 1 87  ? -14.610 1.277   -14.935 1.00 0.00 ? 87  ALA A HB1  4  
ATOM 6055  H HB2  . ALA A 1 87  ? -14.457 1.174   -13.187 1.00 0.00 ? 87  ALA A HB2  4  
ATOM 6056  H HB3  . ALA A 1 87  ? -15.607 2.326   -13.911 1.00 0.00 ? 87  ALA A HB3  4  
ATOM 6057  N N    . VAL A 1 88  ? -14.569 4.564   -12.613 1.00 0.00 ? 88  VAL A N    4  
ATOM 6058  C CA   . VAL A 1 88  ? -14.665 5.696   -11.711 1.00 0.00 ? 88  VAL A CA   4  
ATOM 6059  C C    . VAL A 1 88  ? -15.994 5.559   -10.963 1.00 0.00 ? 88  VAL A C    4  
ATOM 6060  O O    . VAL A 1 88  ? -16.916 4.885   -11.425 1.00 0.00 ? 88  VAL A O    4  
ATOM 6061  C CB   . VAL A 1 88  ? -14.475 6.988   -12.553 1.00 0.00 ? 88  VAL A CB   4  
ATOM 6062  C CG1  . VAL A 1 88  ? -15.375 7.071   -13.796 1.00 0.00 ? 88  VAL A CG1  4  
ATOM 6063  C CG2  . VAL A 1 88  ? -14.657 8.288   -11.767 1.00 0.00 ? 88  VAL A CG2  4  
ATOM 6064  H H    . VAL A 1 88  ? -15.397 4.381   -13.148 1.00 0.00 ? 88  VAL A H    4  
ATOM 6065  H HA   . VAL A 1 88  ? -13.856 5.643   -10.979 1.00 0.00 ? 88  VAL A HA   4  
ATOM 6066  H HB   . VAL A 1 88  ? -13.445 6.982   -12.912 1.00 0.00 ? 88  VAL A HB   4  
ATOM 6067  H HG11 . VAL A 1 88  ? -16.419 7.057   -13.489 1.00 0.00 ? 88  VAL A HG11 4  
ATOM 6068  H HG12 . VAL A 1 88  ? -15.182 7.999   -14.336 1.00 0.00 ? 88  VAL A HG12 4  
ATOM 6069  H HG13 . VAL A 1 88  ? -15.182 6.241   -14.474 1.00 0.00 ? 88  VAL A HG13 4  
ATOM 6070  H HG21 . VAL A 1 88  ? -15.690 8.401   -11.435 1.00 0.00 ? 88  VAL A HG21 4  
ATOM 6071  H HG22 . VAL A 1 88  ? -14.002 8.303   -10.908 1.00 0.00 ? 88  VAL A HG22 4  
ATOM 6072  H HG23 . VAL A 1 88  ? -14.395 9.136   -12.399 1.00 0.00 ? 88  VAL A HG23 4  
ATOM 6073  N N    . GLY A 1 89  ? -16.089 6.166   -9.786  1.00 0.00 ? 89  GLY A N    4  
ATOM 6074  C CA   . GLY A 1 89  ? -17.263 6.148   -8.928  1.00 0.00 ? 89  GLY A CA   4  
ATOM 6075  C C    . GLY A 1 89  ? -17.086 5.141   -7.797  1.00 0.00 ? 89  GLY A C    4  
ATOM 6076  O O    . GLY A 1 89  ? -16.568 5.506   -6.737  1.00 0.00 ? 89  GLY A O    4  
ATOM 6077  H H    . GLY A 1 89  ? -15.278 6.670   -9.456  1.00 0.00 ? 89  GLY A H    4  
ATOM 6078  H HA2  . GLY A 1 89  ? -17.387 7.139   -8.492  1.00 0.00 ? 89  GLY A HA2  4  
ATOM 6079  H HA3  . GLY A 1 89  ? -18.162 5.915   -9.501  1.00 0.00 ? 89  GLY A HA3  4  
ATOM 6080  N N    . GLN A 1 90  ? -17.527 3.893   -7.989  1.00 0.00 ? 90  GLN A N    4  
ATOM 6081  C CA   . GLN A 1 90  ? -17.626 2.909   -6.912  1.00 0.00 ? 90  GLN A CA   4  
ATOM 6082  C C    . GLN A 1 90  ? -17.521 1.470   -7.428  1.00 0.00 ? 90  GLN A C    4  
ATOM 6083  O O    . GLN A 1 90  ? -17.363 1.235   -8.630  1.00 0.00 ? 90  GLN A O    4  
ATOM 6084  C CB   . GLN A 1 90  ? -18.946 3.151   -6.145  1.00 0.00 ? 90  GLN A CB   4  
ATOM 6085  C CG   . GLN A 1 90  ? -18.664 3.566   -4.698  1.00 0.00 ? 90  GLN A CG   4  
ATOM 6086  C CD   . GLN A 1 90  ? -19.895 4.138   -4.010  1.00 0.00 ? 90  GLN A CD   4  
ATOM 6087  O OE1  . GLN A 1 90  ? -20.659 3.426   -3.367  1.00 0.00 ? 90  GLN A OE1  4  
ATOM 6088  N NE2  . GLN A 1 90  ? -20.133 5.428   -4.153  1.00 0.00 ? 90  GLN A NE2  4  
ATOM 6089  H H    . GLN A 1 90  ? -17.918 3.629   -8.889  1.00 0.00 ? 90  GLN A H    4  
ATOM 6090  H HA   . GLN A 1 90  ? -16.781 3.063   -6.240  1.00 0.00 ? 90  GLN A HA   4  
ATOM 6091  H HB2  . GLN A 1 90  ? -19.511 3.949   -6.622  1.00 0.00 ? 90  GLN A HB2  4  
ATOM 6092  H HB3  . GLN A 1 90  ? -19.577 2.262   -6.147  1.00 0.00 ? 90  GLN A HB3  4  
ATOM 6093  H HG2  . GLN A 1 90  ? -18.324 2.701   -4.135  1.00 0.00 ? 90  GLN A HG2  4  
ATOM 6094  H HG3  . GLN A 1 90  ? -17.877 4.320   -4.679  1.00 0.00 ? 90  GLN A HG3  4  
ATOM 6095  H HE21 . GLN A 1 90  ? -19.635 5.949   -4.873  1.00 0.00 ? 90  GLN A HE21 4  
ATOM 6096  H HE22 . GLN A 1 90  ? -20.883 5.885   -3.641  1.00 0.00 ? 90  GLN A HE22 4  
ATOM 6097  N N    . GLN A 1 91  ? -17.558 0.505   -6.502  1.00 0.00 ? 91  GLN A N    4  
ATOM 6098  C CA   . GLN A 1 91  ? -17.595 -0.931  -6.763  1.00 0.00 ? 91  GLN A CA   4  
ATOM 6099  C C    . GLN A 1 91  ? -18.725 -1.523  -5.904  1.00 0.00 ? 91  GLN A C    4  
ATOM 6100  O O    . GLN A 1 91  ? -18.490 -1.810  -4.727  1.00 0.00 ? 91  GLN A O    4  
ATOM 6101  C CB   . GLN A 1 91  ? -16.249 -1.617  -6.442  1.00 0.00 ? 91  GLN A CB   4  
ATOM 6102  C CG   . GLN A 1 91  ? -15.103 -1.355  -7.433  1.00 0.00 ? 91  GLN A CG   4  
ATOM 6103  C CD   . GLN A 1 91  ? -14.274 -0.118  -7.099  1.00 0.00 ? 91  GLN A CD   4  
ATOM 6104  O OE1  . GLN A 1 91  ? -13.337 -0.170  -6.299  1.00 0.00 ? 91  GLN A OE1  4  
ATOM 6105  N NE2  . GLN A 1 91  ? -14.583 1.011   -7.705  1.00 0.00 ? 91  GLN A NE2  4  
ATOM 6106  H H    . GLN A 1 91  ? -17.672 0.772   -5.534  1.00 0.00 ? 91  GLN A H    4  
ATOM 6107  H HA   . GLN A 1 91  ? -17.817 -1.107  -7.813  1.00 0.00 ? 91  GLN A HA   4  
ATOM 6108  H HB2  . GLN A 1 91  ? -15.926 -1.350  -5.435  1.00 0.00 ? 91  GLN A HB2  4  
ATOM 6109  H HB3  . GLN A 1 91  ? -16.427 -2.694  -6.449  1.00 0.00 ? 91  GLN A HB3  4  
ATOM 6110  H HG2  . GLN A 1 91  ? -14.432 -2.215  -7.408  1.00 0.00 ? 91  GLN A HG2  4  
ATOM 6111  H HG3  . GLN A 1 91  ? -15.499 -1.282  -8.445  1.00 0.00 ? 91  GLN A HG3  4  
ATOM 6112  H HE21 . GLN A 1 91  ? -15.319 1.014   -8.401  1.00 0.00 ? 91  GLN A HE21 4  
ATOM 6113  H HE22 . GLN A 1 91  ? -14.014 1.841   -7.566  1.00 0.00 ? 91  GLN A HE22 4  
ATOM 6114  N N    . PRO A 1 92  ? -19.968 -1.624  -6.405  1.00 0.00 ? 92  PRO A N    4  
ATOM 6115  C CA   . PRO A 1 92  ? -21.080 -2.182  -5.644  1.00 0.00 ? 92  PRO A CA   4  
ATOM 6116  C C    . PRO A 1 92  ? -20.949 -3.711  -5.538  1.00 0.00 ? 92  PRO A C    4  
ATOM 6117  O O    . PRO A 1 92  ? -21.527 -4.459  -6.331  1.00 0.00 ? 92  PRO A O    4  
ATOM 6118  C CB   . PRO A 1 92  ? -22.342 -1.714  -6.376  1.00 0.00 ? 92  PRO A CB   4  
ATOM 6119  C CG   . PRO A 1 92  ? -21.883 -1.580  -7.824  1.00 0.00 ? 92  PRO A CG   4  
ATOM 6120  C CD   . PRO A 1 92  ? -20.424 -1.143  -7.702  1.00 0.00 ? 92  PRO A CD   4  
ATOM 6121  H HA   . PRO A 1 92  ? -21.088 -1.760  -4.638  1.00 0.00 ? 92  PRO A HA   4  
ATOM 6122  H HB2  . PRO A 1 92  ? -23.173 -2.412  -6.270  1.00 0.00 ? 92  PRO A HB2  4  
ATOM 6123  H HB3  . PRO A 1 92  ? -22.628 -0.730  -6.006  1.00 0.00 ? 92  PRO A HB3  4  
ATOM 6124  H HG2  . PRO A 1 92  ? -21.936 -2.552  -8.315  1.00 0.00 ? 92  PRO A HG2  4  
ATOM 6125  H HG3  . PRO A 1 92  ? -22.476 -0.839  -8.358  1.00 0.00 ? 92  PRO A HG3  4  
ATOM 6126  H HD2  . PRO A 1 92  ? -19.842 -1.577  -8.515  1.00 0.00 ? 92  PRO A HD2  4  
ATOM 6127  H HD3  . PRO A 1 92  ? -20.361 -0.054  -7.732  1.00 0.00 ? 92  PRO A HD3  4  
ATOM 6128  N N    . GLY A 1 93  ? -20.203 -4.183  -4.535  1.00 0.00 ? 93  GLY A N    4  
ATOM 6129  C CA   . GLY A 1 93  ? -19.980 -5.605  -4.305  1.00 0.00 ? 93  GLY A CA   4  
ATOM 6130  C C    . GLY A 1 93  ? -19.210 -6.223  -5.470  1.00 0.00 ? 93  GLY A C    4  
ATOM 6131  O O    . GLY A 1 93  ? -18.347 -5.565  -6.061  1.00 0.00 ? 93  GLY A O    4  
ATOM 6132  H H    . GLY A 1 93  ? -19.667 -3.516  -3.993  1.00 0.00 ? 93  GLY A H    4  
ATOM 6133  H HA2  . GLY A 1 93  ? -19.404 -5.734  -3.388  1.00 0.00 ? 93  GLY A HA2  4  
ATOM 6134  H HA3  . GLY A 1 93  ? -20.941 -6.106  -4.193  1.00 0.00 ? 93  GLY A HA3  4  
ATOM 6135  N N    . ALA A 1 94  ? -19.475 -7.499  -5.764  1.00 0.00 ? 94  ALA A N    4  
ATOM 6136  C CA   . ALA A 1 94  ? -18.934 -8.213  -6.915  1.00 0.00 ? 94  ALA A CA   4  
ATOM 6137  C C    . ALA A 1 94  ? -20.088 -8.987  -7.548  1.00 0.00 ? 94  ALA A C    4  
ATOM 6138  O O    . ALA A 1 94  ? -20.451 -10.068 -7.074  1.00 0.00 ? 94  ALA A O    4  
ATOM 6139  C CB   . ALA A 1 94  ? -17.777 -9.133  -6.501  1.00 0.00 ? 94  ALA A CB   4  
ATOM 6140  H H    . ALA A 1 94  ? -20.190 -7.983  -5.242  1.00 0.00 ? 94  ALA A H    4  
ATOM 6141  H HA   . ALA A 1 94  ? -18.548 -7.493  -7.639  1.00 0.00 ? 94  ALA A HA   4  
ATOM 6142  H HB1  . ALA A 1 94  ? -17.325 -9.564  -7.394  1.00 0.00 ? 94  ALA A HB1  4  
ATOM 6143  H HB2  . ALA A 1 94  ? -17.019 -8.564  -5.962  1.00 0.00 ? 94  ALA A HB2  4  
ATOM 6144  H HB3  . ALA A 1 94  ? -18.134 -9.948  -5.876  1.00 0.00 ? 94  ALA A HB3  4  
ATOM 6145  N N    . SER A 1 95  ? -20.754 -8.399  -8.535  1.00 0.00 ? 95  SER A N    4  
ATOM 6146  C CA   . SER A 1 95  ? -21.865 -8.966  -9.290  1.00 0.00 ? 95  SER A CA   4  
ATOM 6147  C C    . SER A 1 95  ? -22.059 -8.080  -10.519 1.00 0.00 ? 95  SER A C    4  
ATOM 6148  O O    . SER A 1 95  ? -22.402 -6.908  -10.338 1.00 0.00 ? 95  SER A O    4  
ATOM 6149  C CB   . SER A 1 95  ? -23.144 -8.957  -8.437  1.00 0.00 ? 95  SER A CB   4  
ATOM 6150  O OG   . SER A 1 95  ? -23.090 -9.958  -7.429  1.00 0.00 ? 95  SER A OG   4  
ATOM 6151  H H    . SER A 1 95  ? -20.429 -7.493  -8.865  1.00 0.00 ? 95  SER A H    4  
ATOM 6152  H HA   . SER A 1 95  ? -21.626 -9.984  -9.605  1.00 0.00 ? 95  SER A HA   4  
ATOM 6153  H HB2  . SER A 1 95  ? -23.264 -7.977  -7.971  1.00 0.00 ? 95  SER A HB2  4  
ATOM 6154  H HB3  . SER A 1 95  ? -24.007 -9.137  -9.078  1.00 0.00 ? 95  SER A HB3  4  
ATOM 6155  H HG   . SER A 1 95  ? -22.149 -10.023 -7.172  1.00 0.00 ? 95  SER A HG   4  
ATOM 6156  N N    . SER A 1 96  ? -21.818 -8.614  -11.725 1.00 0.00 ? 96  SER A N    4  
ATOM 6157  C CA   . SER A 1 96  ? -21.874 -7.893  -12.996 1.00 0.00 ? 96  SER A CA   4  
ATOM 6158  C C    . SER A 1 96  ? -21.260 -6.491  -12.883 1.00 0.00 ? 96  SER A C    4  
ATOM 6159  O O    . SER A 1 96  ? -21.961 -5.474  -12.802 1.00 0.00 ? 96  SER A O    4  
ATOM 6160  C CB   . SER A 1 96  ? -23.313 -7.895  -13.530 1.00 0.00 ? 96  SER A CB   4  
ATOM 6161  O OG   . SER A 1 96  ? -23.540 -9.056  -14.312 1.00 0.00 ? 96  SER A OG   4  
ATOM 6162  H H    . SER A 1 96  ? -21.532 -9.586  -11.787 1.00 0.00 ? 96  SER A H    4  
ATOM 6163  H HA   . SER A 1 96  ? -21.253 -8.438  -13.709 1.00 0.00 ? 96  SER A HA   4  
ATOM 6164  H HB2  . SER A 1 96  ? -24.023 -7.851  -12.703 1.00 0.00 ? 96  SER A HB2  4  
ATOM 6165  H HB3  . SER A 1 96  ? -23.470 -7.021  -14.162 1.00 0.00 ? 96  SER A HB3  4  
ATOM 6166  H HG   . SER A 1 96  ? -23.317 -8.778  -15.222 1.00 0.00 ? 96  SER A HG   4  
ATOM 6167  N N    . GLY A 1 97  ? -19.932 -6.449  -12.845 1.00 0.00 ? 97  GLY A N    4  
ATOM 6168  C CA   . GLY A 1 97  ? -19.153 -5.226  -12.845 1.00 0.00 ? 97  GLY A CA   4  
ATOM 6169  C C    . GLY A 1 97  ? -19.359 -4.432  -14.139 1.00 0.00 ? 97  GLY A C    4  
ATOM 6170  O O    . GLY A 1 97  ? -19.945 -4.933  -15.107 1.00 0.00 ? 97  GLY A O    4  
ATOM 6171  H H    . GLY A 1 97  ? -19.422 -7.316  -12.992 1.00 0.00 ? 97  GLY A H    4  
ATOM 6172  H HA2  . GLY A 1 97  ? -19.454 -4.617  -11.992 1.00 0.00 ? 97  GLY A HA2  4  
ATOM 6173  H HA3  . GLY A 1 97  ? -18.097 -5.481  -12.749 1.00 0.00 ? 97  GLY A HA3  4  
ATOM 6174  N N    . PRO A 1 98  ? -18.876 -3.183  -14.178 1.00 0.00 ? 98  PRO A N    4  
ATOM 6175  C CA   . PRO A 1 98  ? -19.025 -2.312  -15.327 1.00 0.00 ? 98  PRO A CA   4  
ATOM 6176  C C    . PRO A 1 98  ? -18.272 -2.896  -16.518 1.00 0.00 ? 98  PRO A C    4  
ATOM 6177  O O    . PRO A 1 98  ? -17.050 -3.048  -16.466 1.00 0.00 ? 98  PRO A O    4  
ATOM 6178  C CB   . PRO A 1 98  ? -18.492 -0.945  -14.893 1.00 0.00 ? 98  PRO A CB   4  
ATOM 6179  C CG   . PRO A 1 98  ? -17.530 -1.276  -13.755 1.00 0.00 ? 98  PRO A CG   4  
ATOM 6180  C CD   . PRO A 1 98  ? -18.174 -2.497  -13.110 1.00 0.00 ? 98  PRO A CD   4  
ATOM 6181  H HA   . PRO A 1 98  ? -20.079 -2.216  -15.572 1.00 0.00 ? 98  PRO A HA   4  
ATOM 6182  H HB2  . PRO A 1 98  ? -17.990 -0.422  -15.707 1.00 0.00 ? 98  PRO A HB2  4  
ATOM 6183  H HB3  . PRO A 1 98  ? -19.318 -0.346  -14.507 1.00 0.00 ? 98  PRO A HB3  4  
ATOM 6184  H HG2  . PRO A 1 98  ? -16.554 -1.545  -14.158 1.00 0.00 ? 98  PRO A HG2  4  
ATOM 6185  H HG3  . PRO A 1 98  ? -17.438 -0.454  -13.049 1.00 0.00 ? 98  PRO A HG3  4  
ATOM 6186  H HD2  . PRO A 1 98  ? -17.411 -3.130  -12.655 1.00 0.00 ? 98  PRO A HD2  4  
ATOM 6187  H HD3  . PRO A 1 98  ? -18.901 -2.176  -12.364 1.00 0.00 ? 98  PRO A HD3  4  
ATOM 6188  N N    . SER A 1 99  ? -19.002 -3.208  -17.590 1.00 0.00 ? 99  SER A N    4  
ATOM 6189  C CA   . SER A 1 99  ? -18.494 -3.536  -18.920 1.00 0.00 ? 99  SER A CA   4  
ATOM 6190  C C    . SER A 1 99  ? -17.850 -4.924  -19.030 1.00 0.00 ? 99  SER A C    4  
ATOM 6191  O O    . SER A 1 99  ? -17.869 -5.510  -20.119 1.00 0.00 ? 99  SER A O    4  
ATOM 6192  C CB   . SER A 1 99  ? -17.547 -2.411  -19.370 1.00 0.00 ? 99  SER A CB   4  
ATOM 6193  O OG   . SER A 1 99  ? -17.384 -2.378  -20.772 1.00 0.00 ? 99  SER A OG   4  
ATOM 6194  H H    . SER A 1 99  ? -20.005 -3.119  -17.515 1.00 0.00 ? 99  SER A H    4  
ATOM 6195  H HA   . SER A 1 99  ? -19.353 -3.534  -19.588 1.00 0.00 ? 99  SER A HA   4  
ATOM 6196  H HB2  . SER A 1 99  ? -17.960 -1.453  -19.055 1.00 0.00 ? 99  SER A HB2  4  
ATOM 6197  H HB3  . SER A 1 99  ? -16.571 -2.535  -18.899 1.00 0.00 ? 99  SER A HB3  4  
ATOM 6198  H HG   . SER A 1 99  ? -17.469 -1.432  -21.025 1.00 0.00 ? 99  SER A HG   4  
ATOM 6199  N N    . SER A 1 100 ? -17.294 -5.478  -17.955 1.00 0.00 ? 100 SER A N    4  
ATOM 6200  C CA   . SER A 1 100 ? -16.584 -6.744  -17.946 1.00 0.00 ? 100 SER A CA   4  
ATOM 6201  C C    . SER A 1 100 ? -17.256 -7.693  -16.963 1.00 0.00 ? 100 SER A C    4  
ATOM 6202  O O    . SER A 1 100 ? -17.238 -7.458  -15.750 1.00 0.00 ? 100 SER A O    4  
ATOM 6203  C CB   . SER A 1 100 ? -15.095 -6.525  -17.658 1.00 0.00 ? 100 SER A CB   4  
ATOM 6204  O OG   . SER A 1 100 ? -14.852 -5.591  -16.623 1.00 0.00 ? 100 SER A OG   4  
ATOM 6205  H H    . SER A 1 100 ? -17.257 -4.952  -17.092 1.00 0.00 ? 100 SER A H    4  
ATOM 6206  H HA   . SER A 1 100 ? -16.630 -7.207  -18.930 1.00 0.00 ? 100 SER A HA   4  
ATOM 6207  H HB2  . SER A 1 100 ? -14.653 -7.482  -17.386 1.00 0.00 ? 100 SER A HB2  4  
ATOM 6208  H HB3  . SER A 1 100 ? -14.614 -6.168  -18.568 1.00 0.00 ? 100 SER A HB3  4  
ATOM 6209  H HG   . SER A 1 100 ? -14.669 -6.123  -15.821 1.00 0.00 ? 100 SER A HG   4  
ATOM 6210  N N    . GLY A 1 101 ? -17.864 -8.754  -17.494 1.00 0.00 ? 101 GLY A N    4  
ATOM 6211  C CA   . GLY A 1 101 ? -18.092 -9.972  -16.737 1.00 0.00 ? 101 GLY A CA   4  
ATOM 6212  C C    . GLY A 1 101 ? -16.760 -10.519 -16.267 1.00 0.00 ? 101 GLY A C    4  
ATOM 6213  O O    . GLY A 1 101 ? -16.742 -11.216 -15.236 1.00 0.00 ? 101 GLY A O    4  
ATOM 6214  H H    . GLY A 1 101 ? -17.860 -8.860  -18.501 1.00 0.00 ? 101 GLY A H    4  
ATOM 6215  H HA2  . GLY A 1 101 ? -18.728 -9.773  -15.878 1.00 0.00 ? 101 GLY A HA2  4  
ATOM 6216  H HA3  . GLY A 1 101 ? -18.565 -10.713 -17.376 1.00 0.00 ? 101 GLY A HA3  4  
ATOM 6217  N N    . GLY A 1 1   ? -0.403  -19.746 -27.030 1.00 0.00 ? 1   GLY A N    5  
ATOM 6218  C CA   . GLY A 1 1   ? -0.101  -20.392 -25.752 1.00 0.00 ? 1   GLY A CA   5  
ATOM 6219  C C    . GLY A 1 1   ? 1.342   -20.098 -25.412 1.00 0.00 ? 1   GLY A C    5  
ATOM 6220  O O    . GLY A 1 1   ? 2.237   -20.850 -25.799 1.00 0.00 ? 1   GLY A O    5  
ATOM 6221  H H1   . GLY A 1 1   ? 0.220   -19.976 -27.778 1.00 0.00 ? 1   GLY A H1   5  
ATOM 6222  H HA2  . GLY A 1 1   ? -0.762  -20.011 -24.973 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 6223  H HA3  . GLY A 1 1   ? -0.240  -21.468 -25.852 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6224  N N    . SER A 1 2   ? 1.589   -18.966 -24.759 1.00 0.00 ? 2   SER A N    5  
ATOM 6225  C CA   . SER A 1 2   ? 2.934   -18.487 -24.496 1.00 0.00 ? 2   SER A CA   5  
ATOM 6226  C C    . SER A 1 2   ? 3.542   -19.129 -23.249 1.00 0.00 ? 2   SER A C    5  
ATOM 6227  O O    . SER A 1 2   ? 2.938   -19.989 -22.597 1.00 0.00 ? 2   SER A O    5  
ATOM 6228  C CB   . SER A 1 2   ? 2.895   -16.959 -24.390 1.00 0.00 ? 2   SER A CB   5  
ATOM 6229  O OG   . SER A 1 2   ? 2.657   -16.378 -25.668 1.00 0.00 ? 2   SER A OG   5  
ATOM 6230  H H    . SER A 1 2   ? 0.823   -18.414 -24.383 1.00 0.00 ? 2   SER A H    5  
ATOM 6231  H HA   . SER A 1 2   ? 3.571   -18.768 -25.333 1.00 0.00 ? 2   SER A HA   5  
ATOM 6232  H HB2  . SER A 1 2   ? 2.136   -16.666 -23.670 1.00 0.00 ? 2   SER A HB2  5  
ATOM 6233  H HB3  . SER A 1 2   ? 3.852   -16.594 -24.023 1.00 0.00 ? 2   SER A HB3  5  
ATOM 6234  H HG   . SER A 1 2   ? 1.695   -16.327 -25.845 1.00 0.00 ? 2   SER A HG   5  
ATOM 6235  N N    . SER A 1 3   ? 4.764   -18.696 -22.931 1.00 0.00 ? 3   SER A N    5  
ATOM 6236  C CA   . SER A 1 3   ? 5.509   -18.981 -21.717 1.00 0.00 ? 3   SER A CA   5  
ATOM 6237  C C    . SER A 1 3   ? 4.856   -18.260 -20.524 1.00 0.00 ? 3   SER A C    5  
ATOM 6238  O O    . SER A 1 3   ? 5.448   -17.381 -19.887 1.00 0.00 ? 3   SER A O    5  
ATOM 6239  C CB   . SER A 1 3   ? 6.974   -18.594 -21.971 1.00 0.00 ? 3   SER A CB   5  
ATOM 6240  O OG   . SER A 1 3   ? 7.847   -19.389 -21.202 1.00 0.00 ? 3   SER A OG   5  
ATOM 6241  H H    . SER A 1 3   ? 5.202   -18.038 -23.564 1.00 0.00 ? 3   SER A H    5  
ATOM 6242  H HA   . SER A 1 3   ? 5.468   -20.053 -21.530 1.00 0.00 ? 3   SER A HA   5  
ATOM 6243  H HB2  . SER A 1 3   ? 7.217   -18.770 -23.020 1.00 0.00 ? 3   SER A HB2  5  
ATOM 6244  H HB3  . SER A 1 3   ? 7.135   -17.538 -21.759 1.00 0.00 ? 3   SER A HB3  5  
ATOM 6245  H HG   . SER A 1 3   ? 8.715   -19.355 -21.647 1.00 0.00 ? 3   SER A HG   5  
ATOM 6246  N N    . GLY A 1 4   ? 3.607   -18.629 -20.240 1.00 0.00 ? 4   GLY A N    5  
ATOM 6247  C CA   . GLY A 1 4   ? 2.749   -18.057 -19.222 1.00 0.00 ? 4   GLY A CA   5  
ATOM 6248  C C    . GLY A 1 4   ? 2.081   -16.768 -19.696 1.00 0.00 ? 4   GLY A C    5  
ATOM 6249  O O    . GLY A 1 4   ? 2.639   -16.008 -20.495 1.00 0.00 ? 4   GLY A O    5  
ATOM 6250  H H    . GLY A 1 4   ? 3.167   -19.293 -20.866 1.00 0.00 ? 4   GLY A H    5  
ATOM 6251  H HA2  . GLY A 1 4   ? 1.988   -18.791 -18.955 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 6252  H HA3  . GLY A 1 4   ? 3.343   -17.835 -18.335 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 6253  N N    . SER A 1 5   ? 0.913   -16.505 -19.116 1.00 0.00 ? 5   SER A N    5  
ATOM 6254  C CA   . SER A 1 5   ? 0.306   -15.200 -18.949 1.00 0.00 ? 5   SER A CA   5  
ATOM 6255  C C    . SER A 1 5   ? -0.614  -15.306 -17.739 1.00 0.00 ? 5   SER A C    5  
ATOM 6256  O O    . SER A 1 5   ? -1.757  -15.772 -17.834 1.00 0.00 ? 5   SER A O    5  
ATOM 6257  C CB   . SER A 1 5   ? -0.452  -14.741 -20.201 1.00 0.00 ? 5   SER A CB   5  
ATOM 6258  O OG   . SER A 1 5   ? 0.432   -14.029 -21.041 1.00 0.00 ? 5   SER A OG   5  
ATOM 6259  H H    . SER A 1 5   ? 0.536   -17.223 -18.504 1.00 0.00 ? 5   SER A H    5  
ATOM 6260  H HA   . SER A 1 5   ? 1.091   -14.475 -18.724 1.00 0.00 ? 5   SER A HA   5  
ATOM 6261  H HB2  . SER A 1 5   ? -0.860  -15.598 -20.738 1.00 0.00 ? 5   SER A HB2  5  
ATOM 6262  H HB3  . SER A 1 5   ? -1.265  -14.070 -19.912 1.00 0.00 ? 5   SER A HB3  5  
ATOM 6263  H HG   . SER A 1 5   ? 0.429   -14.489 -21.902 1.00 0.00 ? 5   SER A HG   5  
ATOM 6264  N N    . SER A 1 6   ? -0.094  -14.920 -16.582 1.00 0.00 ? 6   SER A N    5  
ATOM 6265  C CA   . SER A 1 6   ? -0.892  -14.412 -15.486 1.00 0.00 ? 6   SER A CA   5  
ATOM 6266  C C    . SER A 1 6   ? -0.042  -13.349 -14.791 1.00 0.00 ? 6   SER A C    5  
ATOM 6267  O O    . SER A 1 6   ? 1.197   -13.351 -14.884 1.00 0.00 ? 6   SER A O    5  
ATOM 6268  C CB   . SER A 1 6   ? -1.324  -15.542 -14.539 1.00 0.00 ? 6   SER A CB   5  
ATOM 6269  O OG   . SER A 1 6   ? -2.641  -15.319 -14.070 1.00 0.00 ? 6   SER A OG   5  
ATOM 6270  H H    . SER A 1 6   ? 0.874   -14.622 -16.557 1.00 0.00 ? 6   SER A H    5  
ATOM 6271  H HA   . SER A 1 6   ? -1.782  -13.929 -15.898 1.00 0.00 ? 6   SER A HA   5  
ATOM 6272  H HB2  . SER A 1 6   ? -1.306  -16.495 -15.065 1.00 0.00 ? 6   SER A HB2  5  
ATOM 6273  H HB3  . SER A 1 6   ? -0.639  -15.590 -13.694 1.00 0.00 ? 6   SER A HB3  5  
ATOM 6274  H HG   . SER A 1 6   ? -2.788  -15.919 -13.323 1.00 0.00 ? 6   SER A HG   5  
ATOM 6275  N N    . GLY A 1 7   ? -0.721  -12.433 -14.116 1.00 0.00 ? 7   GLY A N    5  
ATOM 6276  C CA   . GLY A 1 7   ? -0.175  -11.229 -13.525 1.00 0.00 ? 7   GLY A CA   5  
ATOM 6277  C C    . GLY A 1 7   ? -1.081  -10.866 -12.361 1.00 0.00 ? 7   GLY A C    5  
ATOM 6278  O O    . GLY A 1 7   ? -1.418  -11.745 -11.565 1.00 0.00 ? 7   GLY A O    5  
ATOM 6279  H H    . GLY A 1 7   ? -1.716  -12.563 -13.987 1.00 0.00 ? 7   GLY A H    5  
ATOM 6280  H HA2  . GLY A 1 7   ? 0.838   -11.400 -13.173 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 6281  H HA3  . GLY A 1 7   ? -0.164  -10.433 -14.268 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 6282  N N    . GLN A 1 8   ? -1.525  -9.605  -12.312 1.00 0.00 ? 8   GLN A N    5  
ATOM 6283  C CA   . GLN A 1 8   ? -2.318  -9.060  -11.214 1.00 0.00 ? 8   GLN A CA   5  
ATOM 6284  C C    . GLN A 1 8   ? -1.574  -9.315  -9.895  1.00 0.00 ? 8   GLN A C    5  
ATOM 6285  O O    . GLN A 1 8   ? -0.370  -9.583  -9.887  1.00 0.00 ? 8   GLN A O    5  
ATOM 6286  C CB   . GLN A 1 8   ? -3.778  -9.590  -11.254 1.00 0.00 ? 8   GLN A CB   5  
ATOM 6287  C CG   . GLN A 1 8   ? -4.681  -8.855  -12.262 1.00 0.00 ? 8   GLN A CG   5  
ATOM 6288  C CD   . GLN A 1 8   ? -4.872  -9.579  -13.594 1.00 0.00 ? 8   GLN A CD   5  
ATOM 6289  O OE1  . GLN A 1 8   ? -5.994  -9.855  -14.011 1.00 0.00 ? 8   GLN A OE1  5  
ATOM 6290  N NE2  . GLN A 1 8   ? -3.803  -9.854  -14.318 1.00 0.00 ? 8   GLN A NE2  5  
ATOM 6291  H H    . GLN A 1 8   ? -1.036  -8.922  -12.883 1.00 0.00 ? 8   GLN A H    5  
ATOM 6292  H HA   . GLN A 1 8   ? -2.332  -7.975  -11.340 1.00 0.00 ? 8   GLN A HA   5  
ATOM 6293  H HB2  . GLN A 1 8   ? -3.785  -10.666 -11.472 1.00 0.00 ? 8   GLN A HB2  5  
ATOM 6294  H HB3  . GLN A 1 8   ? -4.234  -9.415  -10.274 1.00 0.00 ? 8   GLN A HB3  5  
ATOM 6295  H HG2  . GLN A 1 8   ? -5.662  -8.733  -11.796 1.00 0.00 ? 8   GLN A HG2  5  
ATOM 6296  H HG3  . GLN A 1 8   ? -4.295  -7.855  -12.460 1.00 0.00 ? 8   GLN A HG3  5  
ATOM 6297  H HE21 . GLN A 1 8   ? -2.908  -9.573  -13.967 1.00 0.00 ? 8   GLN A HE21 5  
ATOM 6298  H HE22 . GLN A 1 8   ? -3.885  -10.222 -15.262 1.00 0.00 ? 8   GLN A HE22 5  
ATOM 6299  N N    . TYR A 1 9   ? -2.262  -9.169  -8.766  1.00 0.00 ? 9   TYR A N    5  
ATOM 6300  C CA   . TYR A 1 9   ? -1.685  -9.428  -7.464  1.00 0.00 ? 9   TYR A CA   5  
ATOM 6301  C C    . TYR A 1 9   ? -1.244  -10.879 -7.304  1.00 0.00 ? 9   TYR A C    5  
ATOM 6302  O O    . TYR A 1 9   ? -0.314  -11.128 -6.543  1.00 0.00 ? 9   TYR A O    5  
ATOM 6303  C CB   . TYR A 1 9   ? -2.663  -9.001  -6.369  1.00 0.00 ? 9   TYR A CB   5  
ATOM 6304  C CG   . TYR A 1 9   ? -4.096  -9.457  -6.555  1.00 0.00 ? 9   TYR A CG   5  
ATOM 6305  C CD1  . TYR A 1 9   ? -4.471  -10.785 -6.271  1.00 0.00 ? 9   TYR A CD1  5  
ATOM 6306  C CD2  . TYR A 1 9   ? -5.058  -8.537  -7.016  1.00 0.00 ? 9   TYR A CD2  5  
ATOM 6307  C CE1  . TYR A 1 9   ? -5.801  -11.198 -6.463  1.00 0.00 ? 9   TYR A CE1  5  
ATOM 6308  C CE2  . TYR A 1 9   ? -6.391  -8.940  -7.187  1.00 0.00 ? 9   TYR A CE2  5  
ATOM 6309  C CZ   . TYR A 1 9   ? -6.765  -10.276 -6.922  1.00 0.00 ? 9   TYR A CZ   5  
ATOM 6310  O OH   . TYR A 1 9   ? -8.057  -10.669 -7.060  1.00 0.00 ? 9   TYR A OH   5  
ATOM 6311  H H    . TYR A 1 9   ? -3.246  -8.957  -8.812  1.00 0.00 ? 9   TYR A H    5  
ATOM 6312  H HA   . TYR A 1 9   ? -0.796  -8.816  -7.377  1.00 0.00 ? 9   TYR A HA   5  
ATOM 6313  H HB2  . TYR A 1 9   ? -2.293  -9.346  -5.406  1.00 0.00 ? 9   TYR A HB2  5  
ATOM 6314  H HB3  . TYR A 1 9   ? -2.659  -7.916  -6.343  1.00 0.00 ? 9   TYR A HB3  5  
ATOM 6315  H HD1  . TYR A 1 9   ? -3.748  -11.505 -5.916  1.00 0.00 ? 9   TYR A HD1  5  
ATOM 6316  H HD2  . TYR A 1 9   ? -4.792  -7.512  -7.243  1.00 0.00 ? 9   TYR A HD2  5  
ATOM 6317  H HE1  . TYR A 1 9   ? -6.095  -12.217 -6.255  1.00 0.00 ? 9   TYR A HE1  5  
ATOM 6318  H HE2  . TYR A 1 9   ? -7.121  -8.226  -7.542  1.00 0.00 ? 9   TYR A HE2  5  
ATOM 6319  H HH   . TYR A 1 9   ? -8.661  -9.922  -6.899  1.00 0.00 ? 9   TYR A HH   5  
ATOM 6320  N N    . GLU A 1 10  ? -1.868  -11.828 -8.010  1.00 0.00 ? 10  GLU A N    5  
ATOM 6321  C CA   . GLU A 1 10  ? -1.559  -13.249 -7.874  1.00 0.00 ? 10  GLU A CA   5  
ATOM 6322  C C    . GLU A 1 10  ? -0.112  -13.572 -8.235  1.00 0.00 ? 10  GLU A C    5  
ATOM 6323  O O    . GLU A 1 10  ? 0.473   -14.433 -7.585  1.00 0.00 ? 10  GLU A O    5  
ATOM 6324  C CB   . GLU A 1 10  ? -2.543  -14.121 -8.664  1.00 0.00 ? 10  GLU A CB   5  
ATOM 6325  C CG   . GLU A 1 10  ? -3.822  -14.369 -7.850  1.00 0.00 ? 10  GLU A CG   5  
ATOM 6326  C CD   . GLU A 1 10  ? -4.753  -15.384 -8.519  1.00 0.00 ? 10  GLU A CD   5  
ATOM 6327  O OE1  . GLU A 1 10  ? -5.622  -14.997 -9.334  1.00 0.00 ? 10  GLU A OE1  5  
ATOM 6328  O OE2  . GLU A 1 10  ? -4.650  -16.589 -8.188  1.00 0.00 ? 10  GLU A OE2  5  
ATOM 6329  H H    . GLU A 1 10  ? -2.612  -11.562 -8.641  1.00 0.00 ? 10  GLU A H    5  
ATOM 6330  H HA   . GLU A 1 10  ? -1.665  -13.516 -6.828  1.00 0.00 ? 10  GLU A HA   5  
ATOM 6331  H HB2  . GLU A 1 10  ? -2.769  -13.664 -9.625  1.00 0.00 ? 10  GLU A HB2  5  
ATOM 6332  H HB3  . GLU A 1 10  ? -2.077  -15.084 -8.856  1.00 0.00 ? 10  GLU A HB3  5  
ATOM 6333  H HG2  . GLU A 1 10  ? -3.536  -14.753 -6.869  1.00 0.00 ? 10  GLU A HG2  5  
ATOM 6334  H HG3  . GLU A 1 10  ? -4.350  -13.429 -7.691  1.00 0.00 ? 10  GLU A HG3  5  
ATOM 6335  N N    . LEU A 1 11  ? 0.502   -12.848 -9.176  1.00 0.00 ? 11  LEU A N    5  
ATOM 6336  C CA   . LEU A 1 11  ? 1.937   -12.944 -9.449  1.00 0.00 ? 11  LEU A CA   5  
ATOM 6337  C C    . LEU A 1 11  ? 2.709   -12.823 -8.133  1.00 0.00 ? 11  LEU A C    5  
ATOM 6338  O O    . LEU A 1 11  ? 3.528   -13.676 -7.775  1.00 0.00 ? 11  LEU A O    5  
ATOM 6339  C CB   . LEU A 1 11  ? 2.330   -11.821 -10.430 1.00 0.00 ? 11  LEU A CB   5  
ATOM 6340  C CG   . LEU A 1 11  ? 3.708   -11.906 -11.120 1.00 0.00 ? 11  LEU A CG   5  
ATOM 6341  C CD1  . LEU A 1 11  ? 4.907   -12.223 -10.219 1.00 0.00 ? 11  LEU A CD1  5  
ATOM 6342  C CD2  . LEU A 1 11  ? 3.691   -12.921 -12.264 1.00 0.00 ? 11  LEU A CD2  5  
ATOM 6343  H H    . LEU A 1 11  ? -0.049  -12.165 -9.681  1.00 0.00 ? 11  LEU A H    5  
ATOM 6344  H HA   . LEU A 1 11  ? 2.146   -13.913 -9.899  1.00 0.00 ? 11  LEU A HA   5  
ATOM 6345  H HB2  . LEU A 1 11  ? 1.573   -11.772 -11.208 1.00 0.00 ? 11  LEU A HB2  5  
ATOM 6346  H HB3  . LEU A 1 11  ? 2.277   -10.866 -9.908  1.00 0.00 ? 11  LEU A HB3  5  
ATOM 6347  H HG   . LEU A 1 11  ? 3.885   -10.928 -11.561 1.00 0.00 ? 11  LEU A HG   5  
ATOM 6348  H HD11 . LEU A 1 11  ? 5.831   -12.072 -10.778 1.00 0.00 ? 11  LEU A HD11 5  
ATOM 6349  H HD12 . LEU A 1 11  ? 4.915   -11.561 -9.356  1.00 0.00 ? 11  LEU A HD12 5  
ATOM 6350  H HD13 . LEU A 1 11  ? 4.872   -13.258 -9.880  1.00 0.00 ? 11  LEU A HD13 5  
ATOM 6351  H HD21 . LEU A 1 11  ? 3.596   -13.928 -11.861 1.00 0.00 ? 11  LEU A HD21 5  
ATOM 6352  H HD22 . LEU A 1 11  ? 2.861   -12.702 -12.932 1.00 0.00 ? 11  LEU A HD22 5  
ATOM 6353  H HD23 . LEU A 1 11  ? 4.624   -12.845 -12.823 1.00 0.00 ? 11  LEU A HD23 5  
ATOM 6354  N N    . TYR A 1 12  ? 2.439   -11.737 -7.417  1.00 0.00 ? 12  TYR A N    5  
ATOM 6355  C CA   . TYR A 1 12  ? 3.184   -11.334 -6.245  1.00 0.00 ? 12  TYR A CA   5  
ATOM 6356  C C    . TYR A 1 12  ? 2.692   -12.044 -4.984  1.00 0.00 ? 12  TYR A C    5  
ATOM 6357  O O    . TYR A 1 12  ? 3.392   -11.974 -3.975  1.00 0.00 ? 12  TYR A O    5  
ATOM 6358  C CB   . TYR A 1 12  ? 3.081   -9.818  -6.037  1.00 0.00 ? 12  TYR A CB   5  
ATOM 6359  C CG   . TYR A 1 12  ? 2.840   -8.948  -7.252  1.00 0.00 ? 12  TYR A CG   5  
ATOM 6360  C CD1  . TYR A 1 12  ? 3.716   -8.956  -8.352  1.00 0.00 ? 12  TYR A CD1  5  
ATOM 6361  C CD2  . TYR A 1 12  ? 1.703   -8.124  -7.273  1.00 0.00 ? 12  TYR A CD2  5  
ATOM 6362  C CE1  . TYR A 1 12  ? 3.429   -8.171  -9.485  1.00 0.00 ? 12  TYR A CE1  5  
ATOM 6363  C CE2  . TYR A 1 12  ? 1.415   -7.345  -8.401  1.00 0.00 ? 12  TYR A CE2  5  
ATOM 6364  C CZ   . TYR A 1 12  ? 2.277   -7.354  -9.514  1.00 0.00 ? 12  TYR A CZ   5  
ATOM 6365  O OH   . TYR A 1 12  ? 1.989   -6.574  -10.595 1.00 0.00 ? 12  TYR A OH   5  
ATOM 6366  H H    . TYR A 1 12  ? 1.706   -11.122 -7.748  1.00 0.00 ? 12  TYR A H    5  
ATOM 6367  H HA   . TYR A 1 12  ? 4.236   -11.578 -6.399  1.00 0.00 ? 12  TYR A HA   5  
ATOM 6368  H HB2  . TYR A 1 12  ? 2.244   -9.648  -5.363  1.00 0.00 ? 12  TYR A HB2  5  
ATOM 6369  H HB3  . TYR A 1 12  ? 3.992   -9.478  -5.545  1.00 0.00 ? 12  TYR A HB3  5  
ATOM 6370  H HD1  . TYR A 1 12  ? 4.605   -9.567  -8.333  1.00 0.00 ? 12  TYR A HD1  5  
ATOM 6371  H HD2  . TYR A 1 12  ? 1.049   -8.075  -6.416  1.00 0.00 ? 12  TYR A HD2  5  
ATOM 6372  H HE1  . TYR A 1 12  ? 4.092   -8.197  -10.332 1.00 0.00 ? 12  TYR A HE1  5  
ATOM 6373  H HE2  . TYR A 1 12  ? 0.525   -6.749  -8.419  1.00 0.00 ? 12  TYR A HE2  5  
ATOM 6374  H HH   . TYR A 1 12  ? 2.739   -6.488  -11.205 1.00 0.00 ? 12  TYR A HH   5  
ATOM 6375  N N    . MET A 1 13  ? 1.520   -12.701 -4.988  1.00 0.00 ? 13  MET A N    5  
ATOM 6376  C CA   . MET A 1 13  ? 0.938   -13.350 -3.805  1.00 0.00 ? 13  MET A CA   5  
ATOM 6377  C C    . MET A 1 13  ? 1.967   -14.268 -3.158  1.00 0.00 ? 13  MET A C    5  
ATOM 6378  O O    . MET A 1 13  ? 2.156   -14.238 -1.943  1.00 0.00 ? 13  MET A O    5  
ATOM 6379  C CB   . MET A 1 13  ? -0.326  -14.155 -4.159  1.00 0.00 ? 13  MET A CB   5  
ATOM 6380  C CG   . MET A 1 13  ? -1.583  -13.284 -4.177  1.00 0.00 ? 13  MET A CG   5  
ATOM 6381  S SD   . MET A 1 13  ? -2.147  -12.730 -2.543  1.00 0.00 ? 13  MET A SD   5  
ATOM 6382  C CE   . MET A 1 13  ? -2.558  -11.011 -2.927  1.00 0.00 ? 13  MET A CE   5  
ATOM 6383  H H    . MET A 1 13  ? 0.964   -12.667 -5.836  1.00 0.00 ? 13  MET A H    5  
ATOM 6384  H HA   . MET A 1 13  ? 0.660   -12.591 -3.075  1.00 0.00 ? 13  MET A HA   5  
ATOM 6385  H HB2  . MET A 1 13  ? -0.199  -14.650 -5.121  1.00 0.00 ? 13  MET A HB2  5  
ATOM 6386  H HB3  . MET A 1 13  ? -0.486  -14.927 -3.408  1.00 0.00 ? 13  MET A HB3  5  
ATOM 6387  H HG2  . MET A 1 13  ? -1.394  -12.419 -4.801  1.00 0.00 ? 13  MET A HG2  5  
ATOM 6388  H HG3  . MET A 1 13  ? -2.390  -13.845 -4.644  1.00 0.00 ? 13  MET A HG3  5  
ATOM 6389  H HE1  . MET A 1 13  ? -2.914  -10.520 -2.023  1.00 0.00 ? 13  MET A HE1  5  
ATOM 6390  H HE2  . MET A 1 13  ? -1.667  -10.496 -3.291  1.00 0.00 ? 13  MET A HE2  5  
ATOM 6391  H HE3  . MET A 1 13  ? -3.340  -10.974 -3.683  1.00 0.00 ? 13  MET A HE3  5  
ATOM 6392  N N    . TYR A 1 14  ? 2.654   -15.049 -3.988  1.00 0.00 ? 14  TYR A N    5  
ATOM 6393  C CA   . TYR A 1 14  ? 3.576   -16.079 -3.544  1.00 0.00 ? 14  TYR A CA   5  
ATOM 6394  C C    . TYR A 1 14  ? 5.009   -15.543 -3.405  1.00 0.00 ? 14  TYR A C    5  
ATOM 6395  O O    . TYR A 1 14  ? 5.865   -16.254 -2.879  1.00 0.00 ? 14  TYR A O    5  
ATOM 6396  C CB   . TYR A 1 14  ? 3.531   -17.241 -4.559  1.00 0.00 ? 14  TYR A CB   5  
ATOM 6397  C CG   . TYR A 1 14  ? 2.190   -17.456 -5.248  1.00 0.00 ? 14  TYR A CG   5  
ATOM 6398  C CD1  . TYR A 1 14  ? 1.035   -17.726 -4.491  1.00 0.00 ? 14  TYR A CD1  5  
ATOM 6399  C CD2  . TYR A 1 14  ? 2.078   -17.286 -6.641  1.00 0.00 ? 14  TYR A CD2  5  
ATOM 6400  C CE1  . TYR A 1 14  ? -0.221  -17.794 -5.116  1.00 0.00 ? 14  TYR A CE1  5  
ATOM 6401  C CE2  . TYR A 1 14  ? 0.826   -17.381 -7.274  1.00 0.00 ? 14  TYR A CE2  5  
ATOM 6402  C CZ   . TYR A 1 14  ? -0.340  -17.599 -6.509  1.00 0.00 ? 14  TYR A CZ   5  
ATOM 6403  O OH   . TYR A 1 14  ? -1.569  -17.635 -7.098  1.00 0.00 ? 14  TYR A OH   5  
ATOM 6404  H H    . TYR A 1 14  ? 2.387   -15.032 -4.964  1.00 0.00 ? 14  TYR A H    5  
ATOM 6405  H HA   . TYR A 1 14  ? 3.241   -16.456 -2.574  1.00 0.00 ? 14  TYR A HA   5  
ATOM 6406  H HB2  . TYR A 1 14  ? 4.282   -17.067 -5.329  1.00 0.00 ? 14  TYR A HB2  5  
ATOM 6407  H HB3  . TYR A 1 14  ? 3.817   -18.159 -4.051  1.00 0.00 ? 14  TYR A HB3  5  
ATOM 6408  H HD1  . TYR A 1 14  ? 1.097   -17.835 -3.418  1.00 0.00 ? 14  TYR A HD1  5  
ATOM 6409  H HD2  . TYR A 1 14  ? 2.943   -17.032 -7.235  1.00 0.00 ? 14  TYR A HD2  5  
ATOM 6410  H HE1  . TYR A 1 14  ? -1.103  -17.971 -4.522  1.00 0.00 ? 14  TYR A HE1  5  
ATOM 6411  H HE2  . TYR A 1 14  ? 0.759   -17.216 -8.339  1.00 0.00 ? 14  TYR A HE2  5  
ATOM 6412  H HH   . TYR A 1 14  ? -1.512  -17.525 -8.054  1.00 0.00 ? 14  TYR A HH   5  
ATOM 6413  N N    . ARG A 1 15  ? 5.316   -14.351 -3.930  1.00 0.00 ? 15  ARG A N    5  
ATOM 6414  C CA   . ARG A 1 15  ? 6.663   -13.848 -4.210  1.00 0.00 ? 15  ARG A CA   5  
ATOM 6415  C C    . ARG A 1 15  ? 7.079   -12.855 -3.109  1.00 0.00 ? 15  ARG A C    5  
ATOM 6416  O O    . ARG A 1 15  ? 6.311   -12.576 -2.185  1.00 0.00 ? 15  ARG A O    5  
ATOM 6417  C CB   . ARG A 1 15  ? 6.632   -13.210 -5.626  1.00 0.00 ? 15  ARG A CB   5  
ATOM 6418  C CG   . ARG A 1 15  ? 7.758   -13.604 -6.603  1.00 0.00 ? 15  ARG A CG   5  
ATOM 6419  C CD   . ARG A 1 15  ? 9.148   -13.111 -6.188  1.00 0.00 ? 15  ARG A CD   5  
ATOM 6420  N NE   . ARG A 1 15  ? 10.077  -12.892 -7.319  1.00 0.00 ? 15  ARG A NE   5  
ATOM 6421  C CZ   . ARG A 1 15  ? 11.133  -13.646 -7.656  1.00 0.00 ? 15  ARG A CZ   5  
ATOM 6422  N NH1  . ARG A 1 15  ? 11.259  -14.871 -7.154  1.00 0.00 ? 15  ARG A NH1  5  
ATOM 6423  N NH2  . ARG A 1 15  ? 12.065  -13.197 -8.493  1.00 0.00 ? 15  ARG A NH2  5  
ATOM 6424  H H    . ARG A 1 15  ? 4.563   -13.726 -4.179  1.00 0.00 ? 15  ARG A H    5  
ATOM 6425  H HA   . ARG A 1 15  ? 7.358   -14.690 -4.194  1.00 0.00 ? 15  ARG A HA   5  
ATOM 6426  H HB2  . ARG A 1 15  ? 5.704   -13.509 -6.120  1.00 0.00 ? 15  ARG A HB2  5  
ATOM 6427  H HB3  . ARG A 1 15  ? 6.601   -12.122 -5.533  1.00 0.00 ? 15  ARG A HB3  5  
ATOM 6428  H HG2  . ARG A 1 15  ? 7.772   -14.685 -6.719  1.00 0.00 ? 15  ARG A HG2  5  
ATOM 6429  H HG3  . ARG A 1 15  ? 7.509   -13.164 -7.568  1.00 0.00 ? 15  ARG A HG3  5  
ATOM 6430  H HD2  . ARG A 1 15  ? 9.022   -12.147 -5.706  1.00 0.00 ? 15  ARG A HD2  5  
ATOM 6431  H HD3  . ARG A 1 15  ? 9.577   -13.791 -5.452  1.00 0.00 ? 15  ARG A HD3  5  
ATOM 6432  H HE   . ARG A 1 15  ? 10.076  -11.929 -7.650  1.00 0.00 ? 15  ARG A HE   5  
ATOM 6433  H HH11 . ARG A 1 15  ? 10.531  -15.270 -6.565  1.00 0.00 ? 15  ARG A HH11 5  
ATOM 6434  H HH12 . ARG A 1 15  ? 12.074  -15.454 -7.312  1.00 0.00 ? 15  ARG A HH12 5  
ATOM 6435  H HH21 . ARG A 1 15  ? 12.057  -12.290 -8.981  1.00 0.00 ? 15  ARG A HH21 5  
ATOM 6436  H HH22 . ARG A 1 15  ? 12.926  -13.718 -8.649  1.00 0.00 ? 15  ARG A HH22 5  
ATOM 6437  N N    . GLU A 1 16  ? 8.292   -12.310 -3.197  1.00 0.00 ? 16  GLU A N    5  
ATOM 6438  C CA   . GLU A 1 16  ? 8.753   -11.186 -2.388  1.00 0.00 ? 16  GLU A CA   5  
ATOM 6439  C C    . GLU A 1 16  ? 8.922   -9.938  -3.246  1.00 0.00 ? 16  GLU A C    5  
ATOM 6440  O O    . GLU A 1 16  ? 8.862   -9.997  -4.476  1.00 0.00 ? 16  GLU A O    5  
ATOM 6441  C CB   . GLU A 1 16  ? 10.036  -11.550 -1.622  1.00 0.00 ? 16  GLU A CB   5  
ATOM 6442  C CG   . GLU A 1 16  ? 9.783   -12.627 -0.550  1.00 0.00 ? 16  GLU A CG   5  
ATOM 6443  C CD   . GLU A 1 16  ? 10.584  -13.922 -0.762  1.00 0.00 ? 16  GLU A CD   5  
ATOM 6444  O OE1  . GLU A 1 16  ? 10.630  -14.463 -1.890  1.00 0.00 ? 16  GLU A OE1  5  
ATOM 6445  O OE2  . GLU A 1 16  ? 11.170  -14.446 0.217   1.00 0.00 ? 16  GLU A OE2  5  
ATOM 6446  H H    . GLU A 1 16  ? 8.903   -12.531 -3.967  1.00 0.00 ? 16  GLU A H    5  
ATOM 6447  H HA   . GLU A 1 16  ? 7.993   -10.921 -1.665  1.00 0.00 ? 16  GLU A HA   5  
ATOM 6448  H HB2  . GLU A 1 16  ? 10.805  -11.879 -2.321  1.00 0.00 ? 16  GLU A HB2  5  
ATOM 6449  H HB3  . GLU A 1 16  ? 10.401  -10.651 -1.119  1.00 0.00 ? 16  GLU A HB3  5  
ATOM 6450  H HG2  . GLU A 1 16  ? 10.047  -12.191 0.418   1.00 0.00 ? 16  GLU A HG2  5  
ATOM 6451  H HG3  . GLU A 1 16  ? 8.721   -12.876 -0.503  1.00 0.00 ? 16  GLU A HG3  5  
ATOM 6452  N N    . VAL A 1 17  ? 9.087   -8.795  -2.583  1.00 0.00 ? 17  VAL A N    5  
ATOM 6453  C CA   . VAL A 1 17  ? 9.231   -7.491  -3.195  1.00 0.00 ? 17  VAL A CA   5  
ATOM 6454  C C    . VAL A 1 17  ? 9.923   -6.606  -2.163  1.00 0.00 ? 17  VAL A C    5  
ATOM 6455  O O    . VAL A 1 17  ? 9.619   -6.682  -0.966  1.00 0.00 ? 17  VAL A O    5  
ATOM 6456  C CB   . VAL A 1 17  ? 7.856   -6.957  -3.656  1.00 0.00 ? 17  VAL A CB   5  
ATOM 6457  C CG1  . VAL A 1 17  ? 6.754   -7.117  -2.600  1.00 0.00 ? 17  VAL A CG1  5  
ATOM 6458  C CG2  . VAL A 1 17  ? 7.919   -5.496  -4.122  1.00 0.00 ? 17  VAL A CG2  5  
ATOM 6459  H H    . VAL A 1 17  ? 9.151   -8.777  -1.573  1.00 0.00 ? 17  VAL A H    5  
ATOM 6460  H HA   . VAL A 1 17  ? 9.875   -7.609  -4.066  1.00 0.00 ? 17  VAL A HA   5  
ATOM 6461  H HB   . VAL A 1 17  ? 7.558   -7.551  -4.515  1.00 0.00 ? 17  VAL A HB   5  
ATOM 6462  H HG11 . VAL A 1 17  ? 5.812   -6.774  -3.009  1.00 0.00 ? 17  VAL A HG11 5  
ATOM 6463  H HG12 . VAL A 1 17  ? 6.633   -8.166  -2.333  1.00 0.00 ? 17  VAL A HG12 5  
ATOM 6464  H HG13 . VAL A 1 17  ? 7.002   -6.537  -1.712  1.00 0.00 ? 17  VAL A HG13 5  
ATOM 6465  H HG21 . VAL A 1 17  ? 8.733   -5.364  -4.837  1.00 0.00 ? 17  VAL A HG21 5  
ATOM 6466  H HG22 . VAL A 1 17  ? 6.989   -5.234  -4.620  1.00 0.00 ? 17  VAL A HG22 5  
ATOM 6467  H HG23 . VAL A 1 17  ? 8.073   -4.828  -3.274  1.00 0.00 ? 17  VAL A HG23 5  
ATOM 6468  N N    . ASP A 1 18  ? 10.869  -5.782  -2.607  1.00 0.00 ? 18  ASP A N    5  
ATOM 6469  C CA   . ASP A 1 18  ? 11.713  -5.018  -1.704  1.00 0.00 ? 18  ASP A CA   5  
ATOM 6470  C C    . ASP A 1 18  ? 10.984  -3.771  -1.261  1.00 0.00 ? 18  ASP A C    5  
ATOM 6471  O O    . ASP A 1 18  ? 10.963  -2.769  -1.968  1.00 0.00 ? 18  ASP A O    5  
ATOM 6472  C CB   . ASP A 1 18  ? 13.061  -4.690  -2.346  1.00 0.00 ? 18  ASP A CB   5  
ATOM 6473  C CG   . ASP A 1 18  ? 13.952  -5.907  -2.165  1.00 0.00 ? 18  ASP A CG   5  
ATOM 6474  O OD1  . ASP A 1 18  ? 14.401  -6.128  -1.008  1.00 0.00 ? 18  ASP A OD1  5  
ATOM 6475  O OD2  . ASP A 1 18  ? 14.154  -6.685  -3.116  1.00 0.00 ? 18  ASP A OD2  5  
ATOM 6476  H H    . ASP A 1 18  ? 11.071  -5.719  -3.599  1.00 0.00 ? 18  ASP A H    5  
ATOM 6477  H HA   . ASP A 1 18  ? 11.909  -5.623  -0.817  1.00 0.00 ? 18  ASP A HA   5  
ATOM 6478  H HB2  . ASP A 1 18  ? 12.944  -4.412  -3.400  1.00 0.00 ? 18  ASP A HB2  5  
ATOM 6479  H HB3  . ASP A 1 18  ? 13.519  -3.851  -1.816  1.00 0.00 ? 18  ASP A HB3  5  
ATOM 6480  N N    . THR A 1 19  ? 10.373  -3.818  -0.081  1.00 0.00 ? 19  THR A N    5  
ATOM 6481  C CA   . THR A 1 19  ? 9.531   -2.743  0.412   1.00 0.00 ? 19  THR A CA   5  
ATOM 6482  C C    . THR A 1 19  ? 10.266  -1.392  0.474   1.00 0.00 ? 19  THR A C    5  
ATOM 6483  O O    . THR A 1 19  ? 9.638   -0.345  0.286   1.00 0.00 ? 19  THR A O    5  
ATOM 6484  C CB   . THR A 1 19  ? 8.911   -3.141  1.758   1.00 0.00 ? 19  THR A CB   5  
ATOM 6485  O OG1  . THR A 1 19  ? 9.919   -3.476  2.694   1.00 0.00 ? 19  THR A OG1  5  
ATOM 6486  C CG2  . THR A 1 19  ? 7.970   -4.342  1.625   1.00 0.00 ? 19  THR A CG2  5  
ATOM 6487  H H    . THR A 1 19  ? 10.392  -4.685  0.439   1.00 0.00 ? 19  THR A H    5  
ATOM 6488  H HA   . THR A 1 19  ? 8.712   -2.644  -0.295  1.00 0.00 ? 19  THR A HA   5  
ATOM 6489  H HB   . THR A 1 19  ? 8.332   -2.298  2.133   1.00 0.00 ? 19  THR A HB   5  
ATOM 6490  H HG1  . THR A 1 19  ? 9.456   -3.551  3.554   1.00 0.00 ? 19  THR A HG1  5  
ATOM 6491  H HG21 . THR A 1 19  ? 8.513   -5.228  1.297   1.00 0.00 ? 19  THR A HG21 5  
ATOM 6492  H HG22 . THR A 1 19  ? 7.490   -4.543  2.583   1.00 0.00 ? 19  THR A HG22 5  
ATOM 6493  H HG23 . THR A 1 19  ? 7.203   -4.115  0.886   1.00 0.00 ? 19  THR A HG23 5  
ATOM 6494  N N    . LEU A 1 20  ? 11.585  -1.386  0.711   1.00 0.00 ? 20  LEU A N    5  
ATOM 6495  C CA   . LEU A 1 20  ? 12.383  -0.170  0.710   1.00 0.00 ? 20  LEU A CA   5  
ATOM 6496  C C    . LEU A 1 20  ? 12.353  0.460   -0.679  1.00 0.00 ? 20  LEU A C    5  
ATOM 6497  O O    . LEU A 1 20  ? 11.960  1.622   -0.807  1.00 0.00 ? 20  LEU A O    5  
ATOM 6498  C CB   . LEU A 1 20  ? 13.832  -0.472  1.145   1.00 0.00 ? 20  LEU A CB   5  
ATOM 6499  C CG   . LEU A 1 20  ? 14.160  -0.080  2.594   1.00 0.00 ? 20  LEU A CG   5  
ATOM 6500  C CD1  . LEU A 1 20  ? 13.969  1.425   2.857   1.00 0.00 ? 20  LEU A CD1  5  
ATOM 6501  C CD2  . LEU A 1 20  ? 13.356  -0.887  3.622   1.00 0.00 ? 20  LEU A CD2  5  
ATOM 6502  H H    . LEU A 1 20  ? 12.066  -2.271  0.805   1.00 0.00 ? 20  LEU A H    5  
ATOM 6503  H HA   . LEU A 1 20  ? 11.914  0.536   1.394   1.00 0.00 ? 20  LEU A HA   5  
ATOM 6504  H HB2  . LEU A 1 20  ? 14.057  -1.533  1.001   1.00 0.00 ? 20  LEU A HB2  5  
ATOM 6505  H HB3  . LEU A 1 20  ? 14.515  0.078   0.498   1.00 0.00 ? 20  LEU A HB3  5  
ATOM 6506  H HG   . LEU A 1 20  ? 15.210  -0.327  2.731   1.00 0.00 ? 20  LEU A HG   5  
ATOM 6507  H HD11 . LEU A 1 20  ? 14.504  1.993   2.096   1.00 0.00 ? 20  LEU A HD11 5  
ATOM 6508  H HD12 . LEU A 1 20  ? 12.919  1.716   2.837   1.00 0.00 ? 20  LEU A HD12 5  
ATOM 6509  H HD13 . LEU A 1 20  ? 14.381  1.678   3.834   1.00 0.00 ? 20  LEU A HD13 5  
ATOM 6510  H HD21 . LEU A 1 20  ? 12.293  -0.665  3.548   1.00 0.00 ? 20  LEU A HD21 5  
ATOM 6511  H HD22 . LEU A 1 20  ? 13.515  -1.947  3.439   1.00 0.00 ? 20  LEU A HD22 5  
ATOM 6512  H HD23 . LEU A 1 20  ? 13.722  -0.648  4.619   1.00 0.00 ? 20  LEU A HD23 5  
ATOM 6513  N N    . GLU A 1 21  ? 12.744  -0.306  -1.698  1.00 0.00 ? 21  GLU A N    5  
ATOM 6514  C CA   . GLU A 1 21  ? 12.754  0.119   -3.091  1.00 0.00 ? 21  GLU A CA   5  
ATOM 6515  C C    . GLU A 1 21  ? 11.337  0.475   -3.549  1.00 0.00 ? 21  GLU A C    5  
ATOM 6516  O O    . GLU A 1 21  ? 11.135  1.487   -4.214  1.00 0.00 ? 21  GLU A O    5  
ATOM 6517  C CB   . GLU A 1 21  ? 13.368  -0.986  -3.967  1.00 0.00 ? 21  GLU A CB   5  
ATOM 6518  C CG   . GLU A 1 21  ? 13.269  -0.581  -5.440  1.00 0.00 ? 21  GLU A CG   5  
ATOM 6519  C CD   . GLU A 1 21  ? 13.956  -1.532  -6.407  1.00 0.00 ? 21  GLU A CD   5  
ATOM 6520  O OE1  . GLU A 1 21  ? 15.208  -1.459  -6.494  1.00 0.00 ? 21  GLU A OE1  5  
ATOM 6521  O OE2  . GLU A 1 21  ? 13.239  -2.189  -7.189  1.00 0.00 ? 21  GLU A OE2  5  
ATOM 6522  H H    . GLU A 1 21  ? 12.977  -1.277  -1.533  1.00 0.00 ? 21  GLU A H    5  
ATOM 6523  H HA   . GLU A 1 21  ? 13.379  1.008   -3.179  1.00 0.00 ? 21  GLU A HA   5  
ATOM 6524  H HB2  . GLU A 1 21  ? 14.414  -1.119  -3.689  1.00 0.00 ? 21  GLU A HB2  5  
ATOM 6525  H HB3  . GLU A 1 21  ? 12.831  -1.923  -3.816  1.00 0.00 ? 21  GLU A HB3  5  
ATOM 6526  H HG2  . GLU A 1 21  ? 12.217  -0.556  -5.706  1.00 0.00 ? 21  GLU A HG2  5  
ATOM 6527  H HG3  . GLU A 1 21  ? 13.679  0.421   -5.579  1.00 0.00 ? 21  GLU A HG3  5  
ATOM 6528  N N    . LEU A 1 22  ? 10.340  -0.316  -3.160  1.00 0.00 ? 22  LEU A N    5  
ATOM 6529  C CA   . LEU A 1 22  ? 8.953   -0.085  -3.519  1.00 0.00 ? 22  LEU A CA   5  
ATOM 6530  C C    . LEU A 1 22  ? 8.516   1.305   -3.058  1.00 0.00 ? 22  LEU A C    5  
ATOM 6531  O O    . LEU A 1 22  ? 8.081   2.098   -3.884  1.00 0.00 ? 22  LEU A O    5  
ATOM 6532  C CB   . LEU A 1 22  ? 8.094   -1.230  -2.966  1.00 0.00 ? 22  LEU A CB   5  
ATOM 6533  C CG   . LEU A 1 22  ? 6.576   -1.005  -3.051  1.00 0.00 ? 22  LEU A CG   5  
ATOM 6534  C CD1  . LEU A 1 22  ? 6.111   -0.803  -4.491  1.00 0.00 ? 22  LEU A CD1  5  
ATOM 6535  C CD2  . LEU A 1 22  ? 5.835   -2.200  -2.444  1.00 0.00 ? 22  LEU A CD2  5  
ATOM 6536  H H    . LEU A 1 22  ? 10.590  -1.179  -2.688  1.00 0.00 ? 22  LEU A H    5  
ATOM 6537  H HA   . LEU A 1 22  ? 8.886   -0.107  -4.608  1.00 0.00 ? 22  LEU A HA   5  
ATOM 6538  H HB2  . LEU A 1 22  ? 8.353   -2.144  -3.502  1.00 0.00 ? 22  LEU A HB2  5  
ATOM 6539  H HB3  . LEU A 1 22  ? 8.361   -1.373  -1.927  1.00 0.00 ? 22  LEU A HB3  5  
ATOM 6540  H HG   . LEU A 1 22  ? 6.311   -0.122  -2.467  1.00 0.00 ? 22  LEU A HG   5  
ATOM 6541  H HD11 . LEU A 1 22  ? 6.568   0.096   -4.898  1.00 0.00 ? 22  LEU A HD11 5  
ATOM 6542  H HD12 . LEU A 1 22  ? 6.399   -1.653  -5.114  1.00 0.00 ? 22  LEU A HD12 5  
ATOM 6543  H HD13 . LEU A 1 22  ? 5.032   -0.671  -4.525  1.00 0.00 ? 22  LEU A HD13 5  
ATOM 6544  H HD21 . LEU A 1 22  ? 6.172   -2.402  -1.433  1.00 0.00 ? 22  LEU A HD21 5  
ATOM 6545  H HD22 . LEU A 1 22  ? 4.765   -1.989  -2.427  1.00 0.00 ? 22  LEU A HD22 5  
ATOM 6546  H HD23 . LEU A 1 22  ? 6.044   -3.097  -3.025  1.00 0.00 ? 22  LEU A HD23 5  
ATOM 6547  N N    . THR A 1 23  ? 8.653   1.642   -1.768  1.00 0.00 ? 23  THR A N    5  
ATOM 6548  C CA   . THR A 1 23  ? 8.296   2.993   -1.309  1.00 0.00 ? 23  THR A CA   5  
ATOM 6549  C C    . THR A 1 23  ? 9.103   4.047   -2.068  1.00 0.00 ? 23  THR A C    5  
ATOM 6550  O O    . THR A 1 23  ? 8.574   5.105   -2.400  1.00 0.00 ? 23  THR A O    5  
ATOM 6551  C CB   . THR A 1 23  ? 8.498   3.171   0.202   1.00 0.00 ? 23  THR A CB   5  
ATOM 6552  O OG1  . THR A 1 23  ? 9.811   2.857   0.628   1.00 0.00 ? 23  THR A OG1  5  
ATOM 6553  C CG2  . THR A 1 23  ? 7.539   2.271   0.959   1.00 0.00 ? 23  THR A CG2  5  
ATOM 6554  H H    . THR A 1 23  ? 9.101   0.983   -1.144  1.00 0.00 ? 23  THR A H    5  
ATOM 6555  H HA   . THR A 1 23  ? 7.231   3.162   -1.519  1.00 0.00 ? 23  THR A HA   5  
ATOM 6556  H HB   . THR A 1 23  ? 8.268   4.208   0.459   1.00 0.00 ? 23  THR A HB   5  
ATOM 6557  H HG1  . THR A 1 23  ? 10.032  1.948   0.380   1.00 0.00 ? 23  THR A HG1  5  
ATOM 6558  H HG21 . THR A 1 23  ? 7.954   1.279   0.967   1.00 0.00 ? 23  THR A HG21 5  
ATOM 6559  H HG22 . THR A 1 23  ? 7.458   2.581   1.996   1.00 0.00 ? 23  THR A HG22 5  
ATOM 6560  H HG23 . THR A 1 23  ? 6.559   2.274   0.478   1.00 0.00 ? 23  THR A HG23 5  
ATOM 6561  N N    . ARG A 1 24  ? 10.380  3.756   -2.331  1.00 0.00 ? 24  ARG A N    5  
ATOM 6562  C CA   . ARG A 1 24  ? 11.292  4.633   -3.067  1.00 0.00 ? 24  ARG A CA   5  
ATOM 6563  C C    . ARG A 1 24  ? 10.704  4.996   -4.430  1.00 0.00 ? 24  ARG A C    5  
ATOM 6564  O O    . ARG A 1 24  ? 10.369  6.155   -4.649  1.00 0.00 ? 24  ARG A O    5  
ATOM 6565  C CB   . ARG A 1 24  ? 12.693  4.008   -3.173  1.00 0.00 ? 24  ARG A CB   5  
ATOM 6566  C CG   . ARG A 1 24  ? 13.728  5.069   -3.534  1.00 0.00 ? 24  ARG A CG   5  
ATOM 6567  C CD   . ARG A 1 24  ? 15.118  4.437   -3.538  1.00 0.00 ? 24  ARG A CD   5  
ATOM 6568  N NE   . ARG A 1 24  ? 16.133  5.427   -3.912  1.00 0.00 ? 24  ARG A NE   5  
ATOM 6569  C CZ   . ARG A 1 24  ? 17.443  5.183   -4.019  1.00 0.00 ? 24  ARG A CZ   5  
ATOM 6570  N NH1  . ARG A 1 24  ? 17.965  4.015   -3.656  1.00 0.00 ? 24  ARG A NH1  5  
ATOM 6571  N NH2  . ARG A 1 24  ? 18.245  6.138   -4.464  1.00 0.00 ? 24  ARG A NH2  5  
ATOM 6572  H H    . ARG A 1 24  ? 10.691  2.850   -1.987  1.00 0.00 ? 24  ARG A H    5  
ATOM 6573  H HA   . ARG A 1 24  ? 11.405  5.558   -2.506  1.00 0.00 ? 24  ARG A HA   5  
ATOM 6574  H HB2  . ARG A 1 24  ? 12.971  3.555   -2.222  1.00 0.00 ? 24  ARG A HB2  5  
ATOM 6575  H HB3  . ARG A 1 24  ? 12.733  3.244   -3.944  1.00 0.00 ? 24  ARG A HB3  5  
ATOM 6576  H HG2  . ARG A 1 24  ? 13.500  5.476   -4.520  1.00 0.00 ? 24  ARG A HG2  5  
ATOM 6577  H HG3  . ARG A 1 24  ? 13.704  5.873   -2.800  1.00 0.00 ? 24  ARG A HG3  5  
ATOM 6578  H HD2  . ARG A 1 24  ? 15.329  4.019   -2.550  1.00 0.00 ? 24  ARG A HD2  5  
ATOM 6579  H HD3  . ARG A 1 24  ? 15.137  3.635   -4.274  1.00 0.00 ? 24  ARG A HD3  5  
ATOM 6580  H HE   . ARG A 1 24  ? 15.763  6.329   -4.213  1.00 0.00 ? 24  ARG A HE   5  
ATOM 6581  H HH11 . ARG A 1 24  ? 17.392  3.233   -3.339  1.00 0.00 ? 24  ARG A HH11 5  
ATOM 6582  H HH12 . ARG A 1 24  ? 18.951  3.805   -3.791  1.00 0.00 ? 24  ARG A HH12 5  
ATOM 6583  H HH21 . ARG A 1 24  ? 17.895  7.012   -4.846  1.00 0.00 ? 24  ARG A HH21 5  
ATOM 6584  H HH22 . ARG A 1 24  ? 19.223  5.921   -4.609  1.00 0.00 ? 24  ARG A HH22 5  
ATOM 6585  N N    . GLN A 1 25  ? 10.541  4.027   -5.329  1.00 0.00 ? 25  GLN A N    5  
ATOM 6586  C CA   . GLN A 1 25  ? 10.042  4.284   -6.674  1.00 0.00 ? 25  GLN A CA   5  
ATOM 6587  C C    . GLN A 1 25  ? 8.613   4.814   -6.651  1.00 0.00 ? 25  GLN A C    5  
ATOM 6588  O O    . GLN A 1 25  ? 8.262   5.599   -7.528  1.00 0.00 ? 25  GLN A O    5  
ATOM 6589  C CB   . GLN A 1 25  ? 10.165  3.033   -7.548  1.00 0.00 ? 25  GLN A CB   5  
ATOM 6590  C CG   . GLN A 1 25  ? 11.639  2.648   -7.756  1.00 0.00 ? 25  GLN A CG   5  
ATOM 6591  C CD   . GLN A 1 25  ? 11.828  1.617   -8.867  1.00 0.00 ? 25  GLN A CD   5  
ATOM 6592  O OE1  . GLN A 1 25  ? 11.196  1.683   -9.921  1.00 0.00 ? 25  GLN A OE1  5  
ATOM 6593  N NE2  . GLN A 1 25  ? 12.656  0.613   -8.641  1.00 0.00 ? 25  GLN A NE2  5  
ATOM 6594  H H    . GLN A 1 25  ? 10.768  3.074   -5.061  1.00 0.00 ? 25  GLN A H    5  
ATOM 6595  H HA   . GLN A 1 25  ? 10.647  5.061   -7.137  1.00 0.00 ? 25  GLN A HA   5  
ATOM 6596  H HB2  . GLN A 1 25  ? 9.624   2.202   -7.094  1.00 0.00 ? 25  GLN A HB2  5  
ATOM 6597  H HB3  . GLN A 1 25  ? 9.719   3.259   -8.515  1.00 0.00 ? 25  GLN A HB3  5  
ATOM 6598  H HG2  . GLN A 1 25  ? 12.211  3.533   -8.030  1.00 0.00 ? 25  GLN A HG2  5  
ATOM 6599  H HG3  . GLN A 1 25  ? 12.019  2.249   -6.815  1.00 0.00 ? 25  GLN A HG3  5  
ATOM 6600  H HE21 . GLN A 1 25  ? 13.156  0.552   -7.768  1.00 0.00 ? 25  GLN A HE21 5  
ATOM 6601  H HE22 . GLN A 1 25  ? 12.733  -0.145  -9.311  1.00 0.00 ? 25  GLN A HE22 5  
ATOM 6602  N N    . VAL A 1 26  ? 7.796   4.447   -5.656  1.00 0.00 ? 26  VAL A N    5  
ATOM 6603  C CA   . VAL A 1 26  ? 6.477   5.047   -5.492  1.00 0.00 ? 26  VAL A CA   5  
ATOM 6604  C C    . VAL A 1 26  ? 6.638   6.562   -5.317  1.00 0.00 ? 26  VAL A C    5  
ATOM 6605  O O    . VAL A 1 26  ? 6.056   7.334   -6.083  1.00 0.00 ? 26  VAL A O    5  
ATOM 6606  C CB   . VAL A 1 26  ? 5.716   4.357   -4.341  1.00 0.00 ? 26  VAL A CB   5  
ATOM 6607  C CG1  . VAL A 1 26  ? 4.425   5.083   -3.928  1.00 0.00 ? 26  VAL A CG1  5  
ATOM 6608  C CG2  . VAL A 1 26  ? 5.358   2.915   -4.734  1.00 0.00 ? 26  VAL A CG2  5  
ATOM 6609  H H    . VAL A 1 26  ? 8.097   3.758   -4.969  1.00 0.00 ? 26  VAL A H    5  
ATOM 6610  H HA   . VAL A 1 26  ? 5.932   4.868   -6.413  1.00 0.00 ? 26  VAL A HA   5  
ATOM 6611  H HB   . VAL A 1 26  ? 6.364   4.324   -3.467  1.00 0.00 ? 26  VAL A HB   5  
ATOM 6612  H HG11 . VAL A 1 26  ? 3.760   5.197   -4.785  1.00 0.00 ? 26  VAL A HG11 5  
ATOM 6613  H HG12 . VAL A 1 26  ? 3.916   4.518   -3.149  1.00 0.00 ? 26  VAL A HG12 5  
ATOM 6614  H HG13 . VAL A 1 26  ? 4.659   6.070   -3.531  1.00 0.00 ? 26  VAL A HG13 5  
ATOM 6615  H HG21 . VAL A 1 26  ? 6.128   2.482   -5.364  1.00 0.00 ? 26  VAL A HG21 5  
ATOM 6616  H HG22 . VAL A 1 26  ? 5.313   2.305   -3.830  1.00 0.00 ? 26  VAL A HG22 5  
ATOM 6617  H HG23 . VAL A 1 26  ? 4.414   2.873   -5.281  1.00 0.00 ? 26  VAL A HG23 5  
ATOM 6618  N N    . LYS A 1 27  ? 7.441   6.999   -4.337  1.00 0.00 ? 27  LYS A N    5  
ATOM 6619  C CA   . LYS A 1 27  ? 7.692   8.418   -4.102  1.00 0.00 ? 27  LYS A CA   5  
ATOM 6620  C C    . LYS A 1 27  ? 8.255   9.085   -5.351  1.00 0.00 ? 27  LYS A C    5  
ATOM 6621  O O    . LYS A 1 27  ? 7.747   10.142  -5.705  1.00 0.00 ? 27  LYS A O    5  
ATOM 6622  C CB   . LYS A 1 27  ? 8.629   8.613   -2.908  1.00 0.00 ? 27  LYS A CB   5  
ATOM 6623  C CG   . LYS A 1 27  ? 7.970   8.216   -1.578  1.00 0.00 ? 27  LYS A CG   5  
ATOM 6624  C CD   . LYS A 1 27  ? 8.990   8.177   -0.439  1.00 0.00 ? 27  LYS A CD   5  
ATOM 6625  C CE   . LYS A 1 27  ? 9.974   7.006   -0.555  1.00 0.00 ? 27  LYS A CE   5  
ATOM 6626  N NZ   . LYS A 1 27  ? 11.212  7.247   0.213   1.00 0.00 ? 27  LYS A NZ   5  
ATOM 6627  H H    . LYS A 1 27  ? 7.948   6.330   -3.760  1.00 0.00 ? 27  LYS A H    5  
ATOM 6628  H HA   . LYS A 1 27  ? 6.744   8.908   -3.882  1.00 0.00 ? 27  LYS A HA   5  
ATOM 6629  H HB2  . LYS A 1 27  ? 9.528   8.029   -3.074  1.00 0.00 ? 27  LYS A HB2  5  
ATOM 6630  H HB3  . LYS A 1 27  ? 8.921   9.663   -2.854  1.00 0.00 ? 27  LYS A HB3  5  
ATOM 6631  H HG2  . LYS A 1 27  ? 7.205   8.953   -1.343  1.00 0.00 ? 27  LYS A HG2  5  
ATOM 6632  H HG3  . LYS A 1 27  ? 7.475   7.252   -1.650  1.00 0.00 ? 27  LYS A HG3  5  
ATOM 6633  H HD2  . LYS A 1 27  ? 9.534   9.114   -0.448  1.00 0.00 ? 27  LYS A HD2  5  
ATOM 6634  H HD3  . LYS A 1 27  ? 8.449   8.099   0.501   1.00 0.00 ? 27  LYS A HD3  5  
ATOM 6635  H HE2  . LYS A 1 27  ? 9.485   6.100   -0.190  1.00 0.00 ? 27  LYS A HE2  5  
ATOM 6636  H HE3  . LYS A 1 27  ? 10.230  6.854   -1.606  1.00 0.00 ? 27  LYS A HE3  5  
ATOM 6637  H HZ1  . LYS A 1 27  ? 11.756  6.392   0.276   1.00 0.00 ? 27  LYS A HZ1  5  
ATOM 6638  H HZ2  . LYS A 1 27  ? 11.779  7.963   -0.232  1.00 0.00 ? 27  LYS A HZ2  5  
ATOM 6639  H HZ3  . LYS A 1 27  ? 10.997  7.543   1.165   1.00 0.00 ? 27  LYS A HZ3  5  
ATOM 6640  N N    . GLU A 1 28  ? 9.238   8.489   -6.027  1.00 0.00 ? 28  GLU A N    5  
ATOM 6641  C CA   . GLU A 1 28  ? 9.811   9.043   -7.245  1.00 0.00 ? 28  GLU A CA   5  
ATOM 6642  C C    . GLU A 1 28  ? 8.737   9.239   -8.324  1.00 0.00 ? 28  GLU A C    5  
ATOM 6643  O O    . GLU A 1 28  ? 8.586   10.347  -8.829  1.00 0.00 ? 28  GLU A O    5  
ATOM 6644  C CB   . GLU A 1 28  ? 10.958  8.134   -7.719  1.00 0.00 ? 28  GLU A CB   5  
ATOM 6645  C CG   . GLU A 1 28  ? 12.266  8.911   -7.889  1.00 0.00 ? 28  GLU A CG   5  
ATOM 6646  C CD   . GLU A 1 28  ? 12.208  9.962   -9.008  1.00 0.00 ? 28  GLU A CD   5  
ATOM 6647  O OE1  . GLU A 1 28  ? 11.665  9.676   -10.097 1.00 0.00 ? 28  GLU A OE1  5  
ATOM 6648  O OE2  . GLU A 1 28  ? 12.768  11.064  -8.799  1.00 0.00 ? 28  GLU A OE2  5  
ATOM 6649  H H    . GLU A 1 28  ? 9.673   7.650   -5.657  1.00 0.00 ? 28  GLU A H    5  
ATOM 6650  H HA   . GLU A 1 28  ? 10.201  10.032  -6.990  1.00 0.00 ? 28  GLU A HA   5  
ATOM 6651  H HB2  . GLU A 1 28  ? 11.143  7.359   -6.976  1.00 0.00 ? 28  GLU A HB2  5  
ATOM 6652  H HB3  . GLU A 1 28  ? 10.694  7.626   -8.649  1.00 0.00 ? 28  GLU A HB3  5  
ATOM 6653  H HG2  . GLU A 1 28  ? 12.540  9.389   -6.943  1.00 0.00 ? 28  GLU A HG2  5  
ATOM 6654  H HG3  . GLU A 1 28  ? 13.041  8.182   -8.114  1.00 0.00 ? 28  GLU A HG3  5  
ATOM 6655  N N    . LYS A 1 29  ? 7.937   8.214   -8.650  1.00 0.00 ? 29  LYS A N    5  
ATOM 6656  C CA   . LYS A 1 29  ? 6.858   8.332   -9.641  1.00 0.00 ? 29  LYS A CA   5  
ATOM 6657  C C    . LYS A 1 29  ? 5.884   9.451   -9.274  1.00 0.00 ? 29  LYS A C    5  
ATOM 6658  O O    . LYS A 1 29  ? 5.548   10.273  -10.129 1.00 0.00 ? 29  LYS A O    5  
ATOM 6659  C CB   . LYS A 1 29  ? 6.167   6.988   -9.855  1.00 0.00 ? 29  LYS A CB   5  
ATOM 6660  C CG   . LYS A 1 29  ? 5.067   7.049   -10.938 1.00 0.00 ? 29  LYS A CG   5  
ATOM 6661  C CD   . LYS A 1 29  ? 4.905   5.689   -11.617 1.00 0.00 ? 29  LYS A CD   5  
ATOM 6662  C CE   . LYS A 1 29  ? 5.914   5.581   -12.765 1.00 0.00 ? 29  LYS A CE   5  
ATOM 6663  N NZ   . LYS A 1 29  ? 6.128   4.201   -13.242 1.00 0.00 ? 29  LYS A NZ   5  
ATOM 6664  H H    . LYS A 1 29  ? 8.076   7.313   -8.199  1.00 0.00 ? 29  LYS A H    5  
ATOM 6665  H HA   . LYS A 1 29  ? 7.304   8.561   -10.601 1.00 0.00 ? 29  LYS A HA   5  
ATOM 6666  H HB2  . LYS A 1 29  ? 6.929   6.276   -10.166 1.00 0.00 ? 29  LYS A HB2  5  
ATOM 6667  H HB3  . LYS A 1 29  ? 5.744   6.638   -8.917  1.00 0.00 ? 29  LYS A HB3  5  
ATOM 6668  H HG2  . LYS A 1 29  ? 4.130   7.341   -10.483 1.00 0.00 ? 29  LYS A HG2  5  
ATOM 6669  H HG3  . LYS A 1 29  ? 5.285   7.811   -11.680 1.00 0.00 ? 29  LYS A HG3  5  
ATOM 6670  H HD2  . LYS A 1 29  ? 5.129   4.953   -10.856 1.00 0.00 ? 29  LYS A HD2  5  
ATOM 6671  H HD3  . LYS A 1 29  ? 3.882   5.573   -11.991 1.00 0.00 ? 29  LYS A HD3  5  
ATOM 6672  H HE2  . LYS A 1 29  ? 5.565   6.200   -13.591 1.00 0.00 ? 29  LYS A HE2  5  
ATOM 6673  H HE3  . LYS A 1 29  ? 6.865   5.983   -12.413 1.00 0.00 ? 29  LYS A HE3  5  
ATOM 6674  H HZ1  . LYS A 1 29  ? 6.588   3.634   -12.539 1.00 0.00 ? 29  LYS A HZ1  5  
ATOM 6675  H HZ2  . LYS A 1 29  ? 5.243   3.738   -13.445 1.00 0.00 ? 29  LYS A HZ2  5  
ATOM 6676  H HZ3  . LYS A 1 29  ? 6.737   4.160   -14.052 1.00 0.00 ? 29  LYS A HZ3  5  
ATOM 6677  N N    . LEU A 1 30  ? 5.473   9.519   -8.003  1.00 0.00 ? 30  LEU A N    5  
ATOM 6678  C CA   . LEU A 1 30  ? 4.596   10.566  -7.493  1.00 0.00 ? 30  LEU A CA   5  
ATOM 6679  C C    . LEU A 1 30  ? 5.258   11.924  -7.705  1.00 0.00 ? 30  LEU A C    5  
ATOM 6680  O O    . LEU A 1 30  ? 4.632   12.833  -8.235  1.00 0.00 ? 30  LEU A O    5  
ATOM 6681  C CB   . LEU A 1 30  ? 4.286   10.365  -5.995  1.00 0.00 ? 30  LEU A CB   5  
ATOM 6682  C CG   . LEU A 1 30  ? 3.411   9.154   -5.639  1.00 0.00 ? 30  LEU A CG   5  
ATOM 6683  C CD1  . LEU A 1 30  ? 3.470   8.891   -4.132  1.00 0.00 ? 30  LEU A CD1  5  
ATOM 6684  C CD2  . LEU A 1 30  ? 1.954   9.384   -6.036  1.00 0.00 ? 30  LEU A CD2  5  
ATOM 6685  H H    . LEU A 1 30  ? 5.813   8.809   -7.362  1.00 0.00 ? 30  LEU A H    5  
ATOM 6686  H HA   . LEU A 1 30  ? 3.666   10.554  -8.062  1.00 0.00 ? 30  LEU A HA   5  
ATOM 6687  H HB2  . LEU A 1 30  ? 5.228   10.281  -5.459  1.00 0.00 ? 30  LEU A HB2  5  
ATOM 6688  H HB3  . LEU A 1 30  ? 3.784   11.259  -5.626  1.00 0.00 ? 30  LEU A HB3  5  
ATOM 6689  H HG   . LEU A 1 30  ? 3.781   8.269   -6.142  1.00 0.00 ? 30  LEU A HG   5  
ATOM 6690  H HD11 . LEU A 1 30  ? 4.490   8.655   -3.842  1.00 0.00 ? 30  LEU A HD11 5  
ATOM 6691  H HD12 . LEU A 1 30  ? 3.133   9.767   -3.586  1.00 0.00 ? 30  LEU A HD12 5  
ATOM 6692  H HD13 . LEU A 1 30  ? 2.842   8.037   -3.888  1.00 0.00 ? 30  LEU A HD13 5  
ATOM 6693  H HD21 . LEU A 1 30  ? 1.883   9.636   -7.092  1.00 0.00 ? 30  LEU A HD21 5  
ATOM 6694  H HD22 . LEU A 1 30  ? 1.398   8.462   -5.887  1.00 0.00 ? 30  LEU A HD22 5  
ATOM 6695  H HD23 . LEU A 1 30  ? 1.519   10.180  -5.434  1.00 0.00 ? 30  LEU A HD23 5  
ATOM 6696  N N    . ALA A 1 31  ? 6.505   12.089  -7.266  1.00 0.00 ? 31  ALA A N    5  
ATOM 6697  C CA   . ALA A 1 31  ? 7.276   13.323  -7.328  1.00 0.00 ? 31  ALA A CA   5  
ATOM 6698  C C    . ALA A 1 31  ? 7.503   13.785  -8.766  1.00 0.00 ? 31  ALA A C    5  
ATOM 6699  O O    . ALA A 1 31  ? 7.438   14.985  -9.036  1.00 0.00 ? 31  ALA A O    5  
ATOM 6700  C CB   . ALA A 1 31  ? 8.617   13.102  -6.626  1.00 0.00 ? 31  ALA A CB   5  
ATOM 6701  H H    . ALA A 1 31  ? 6.977   11.280  -6.880  1.00 0.00 ? 31  ALA A H    5  
ATOM 6702  H HA   . ALA A 1 31  ? 6.733   14.108  -6.801  1.00 0.00 ? 31  ALA A HA   5  
ATOM 6703  H HB1  . ALA A 1 31  ? 9.164   12.285  -7.096  1.00 0.00 ? 31  ALA A HB1  5  
ATOM 6704  H HB2  . ALA A 1 31  ? 9.210   14.006  -6.710  1.00 0.00 ? 31  ALA A HB2  5  
ATOM 6705  H HB3  . ALA A 1 31  ? 8.457   12.877  -5.573  1.00 0.00 ? 31  ALA A HB3  5  
ATOM 6706  N N    . LYS A 1 32  ? 7.751   12.859  -9.694  1.00 0.00 ? 32  LYS A N    5  
ATOM 6707  C CA   . LYS A 1 32  ? 7.889   13.128  -11.117 1.00 0.00 ? 32  LYS A CA   5  
ATOM 6708  C C    . LYS A 1 32  ? 6.596   13.726  -11.665 1.00 0.00 ? 32  LYS A C    5  
ATOM 6709  O O    . LYS A 1 32  ? 6.647   14.612  -12.515 1.00 0.00 ? 32  LYS A O    5  
ATOM 6710  C CB   . LYS A 1 32  ? 8.251   11.821  -11.842 1.00 0.00 ? 32  LYS A CB   5  
ATOM 6711  C CG   . LYS A 1 32  ? 8.854   12.086  -13.225 1.00 0.00 ? 32  LYS A CG   5  
ATOM 6712  C CD   . LYS A 1 32  ? 9.096   10.783  -14.000 1.00 0.00 ? 32  LYS A CD   5  
ATOM 6713  C CE   . LYS A 1 32  ? 10.257  10.911  -14.993 1.00 0.00 ? 32  LYS A CE   5  
ATOM 6714  N NZ   . LYS A 1 32  ? 10.195  9.897   -16.066 1.00 0.00 ? 32  LYS A NZ   5  
ATOM 6715  H H    . LYS A 1 32  ? 7.867   11.898  -9.387  1.00 0.00 ? 32  LYS A H    5  
ATOM 6716  H HA   . LYS A 1 32  ? 8.701   13.841  -11.255 1.00 0.00 ? 32  LYS A HA   5  
ATOM 6717  H HB2  . LYS A 1 32  ? 8.989   11.269  -11.257 1.00 0.00 ? 32  LYS A HB2  5  
ATOM 6718  H HB3  . LYS A 1 32  ? 7.364   11.198  -11.941 1.00 0.00 ? 32  LYS A HB3  5  
ATOM 6719  H HG2  . LYS A 1 32  ? 8.186   12.721  -13.807 1.00 0.00 ? 32  LYS A HG2  5  
ATOM 6720  H HG3  . LYS A 1 32  ? 9.801   12.600  -13.074 1.00 0.00 ? 32  LYS A HG3  5  
ATOM 6721  H HD2  . LYS A 1 32  ? 9.353   9.985   -13.304 1.00 0.00 ? 32  LYS A HD2  5  
ATOM 6722  H HD3  . LYS A 1 32  ? 8.177   10.518  -14.523 1.00 0.00 ? 32  LYS A HD3  5  
ATOM 6723  H HE2  . LYS A 1 32  ? 10.229  11.901  -15.448 1.00 0.00 ? 32  LYS A HE2  5  
ATOM 6724  H HE3  . LYS A 1 32  ? 11.194  10.805  -14.441 1.00 0.00 ? 32  LYS A HE3  5  
ATOM 6725  H HZ1  . LYS A 1 32  ? 9.899   8.990   -15.729 1.00 0.00 ? 32  LYS A HZ1  5  
ATOM 6726  H HZ2  . LYS A 1 32  ? 9.548   10.210  -16.786 1.00 0.00 ? 32  LYS A HZ2  5  
ATOM 6727  H HZ3  . LYS A 1 32  ? 11.097  9.793   -16.524 1.00 0.00 ? 32  LYS A HZ3  5  
ATOM 6728  N N    . ASN A 1 33  ? 5.447   13.231  -11.201 1.00 0.00 ? 33  ASN A N    5  
ATOM 6729  C CA   . ASN A 1 33  ? 4.139   13.683  -11.653 1.00 0.00 ? 33  ASN A CA   5  
ATOM 6730  C C    . ASN A 1 33  ? 3.590   14.862  -10.852 1.00 0.00 ? 33  ASN A C    5  
ATOM 6731  O O    . ASN A 1 33  ? 2.632   15.479  -11.314 1.00 0.00 ? 33  ASN A O    5  
ATOM 6732  C CB   . ASN A 1 33  ? 3.152   12.504  -11.672 1.00 0.00 ? 33  ASN A CB   5  
ATOM 6733  C CG   . ASN A 1 33  ? 3.126   11.912  -13.070 1.00 0.00 ? 33  ASN A CG   5  
ATOM 6734  O OD1  . ASN A 1 33  ? 2.740   12.603  -14.008 1.00 0.00 ? 33  ASN A OD1  5  
ATOM 6735  N ND2  . ASN A 1 33  ? 3.577   10.684  -13.248 1.00 0.00 ? 33  ASN A ND2  5  
ATOM 6736  H H    . ASN A 1 33  ? 5.475   12.485  -10.519 1.00 0.00 ? 33  ASN A H    5  
ATOM 6737  H HA   . ASN A 1 33  ? 4.248   14.046  -12.677 1.00 0.00 ? 33  ASN A HA   5  
ATOM 6738  H HB2  . ASN A 1 33  ? 3.406   11.756  -10.920 1.00 0.00 ? 33  ASN A HB2  5  
ATOM 6739  H HB3  . ASN A 1 33  ? 2.147   12.853  -11.446 1.00 0.00 ? 33  ASN A HB3  5  
ATOM 6740  H HD21 . ASN A 1 33  ? 3.667   10.069  -12.446 1.00 0.00 ? 33  ASN A HD21 5  
ATOM 6741  H HD22 . ASN A 1 33  ? 3.508   10.297  -14.181 1.00 0.00 ? 33  ASN A HD22 5  
ATOM 6742  N N    . GLY A 1 34  ? 4.196   15.209  -9.713  1.00 0.00 ? 34  GLY A N    5  
ATOM 6743  C CA   . GLY A 1 34  ? 3.773   16.295  -8.836  1.00 0.00 ? 34  GLY A CA   5  
ATOM 6744  C C    . GLY A 1 34  ? 2.692   15.883  -7.830  1.00 0.00 ? 34  GLY A C    5  
ATOM 6745  O O    . GLY A 1 34  ? 2.110   16.742  -7.170  1.00 0.00 ? 34  GLY A O    5  
ATOM 6746  H H    . GLY A 1 34  ? 4.960   14.627  -9.397  1.00 0.00 ? 34  GLY A H    5  
ATOM 6747  H HA2  . GLY A 1 34  ? 4.641   16.662  -8.291  1.00 0.00 ? 34  GLY A HA2  5  
ATOM 6748  H HA3  . GLY A 1 34  ? 3.386   17.113  -9.442  1.00 0.00 ? 34  GLY A HA3  5  
ATOM 6749  N N    . ILE A 1 35  ? 2.389   14.590  -7.713  1.00 0.00 ? 35  ILE A N    5  
ATOM 6750  C CA   . ILE A 1 35  ? 1.278   14.069  -6.922  1.00 0.00 ? 35  ILE A CA   5  
ATOM 6751  C C    . ILE A 1 35  ? 1.670   14.082  -5.440  1.00 0.00 ? 35  ILE A C    5  
ATOM 6752  O O    . ILE A 1 35  ? 2.770   13.653  -5.078  1.00 0.00 ? 35  ILE A O    5  
ATOM 6753  C CB   . ILE A 1 35  ? 0.890   12.664  -7.417  1.00 0.00 ? 35  ILE A CB   5  
ATOM 6754  C CG1  . ILE A 1 35  ? 0.438   12.762  -8.891  1.00 0.00 ? 35  ILE A CG1  5  
ATOM 6755  C CG2  . ILE A 1 35  ? -0.246  12.042  -6.574  1.00 0.00 ? 35  ILE A CG2  5  
ATOM 6756  C CD1  . ILE A 1 35  ? 0.346   11.398  -9.559  1.00 0.00 ? 35  ILE A CD1  5  
ATOM 6757  H H    . ILE A 1 35  ? 2.989   13.919  -8.175  1.00 0.00 ? 35  ILE A H    5  
ATOM 6758  H HA   . ILE A 1 35  ? 0.406   14.691  -7.097  1.00 0.00 ? 35  ILE A HA   5  
ATOM 6759  H HB   . ILE A 1 35  ? 1.765   12.019  -7.352  1.00 0.00 ? 35  ILE A HB   5  
ATOM 6760  H HG12 . ILE A 1 35  ? -0.538  13.242  -8.948  1.00 0.00 ? 35  ILE A HG12 5  
ATOM 6761  H HG13 . ILE A 1 35  ? 1.141   13.355  -9.474  1.00 0.00 ? 35  ILE A HG13 5  
ATOM 6762  H HG21 . ILE A 1 35  ? -1.147  12.646  -6.655  1.00 0.00 ? 35  ILE A HG21 5  
ATOM 6763  H HG22 . ILE A 1 35  ? -0.477  11.032  -6.913  1.00 0.00 ? 35  ILE A HG22 5  
ATOM 6764  H HG23 . ILE A 1 35  ? 0.030   11.969  -5.524  1.00 0.00 ? 35  ILE A HG23 5  
ATOM 6765  H HD11 . ILE A 1 35  ? 0.151   11.540  -10.618 1.00 0.00 ? 35  ILE A HD11 5  
ATOM 6766  H HD12 . ILE A 1 35  ? 1.289   10.871  -9.438  1.00 0.00 ? 35  ILE A HD12 5  
ATOM 6767  H HD13 . ILE A 1 35  ? -0.462  10.824  -9.117  1.00 0.00 ? 35  ILE A HD13 5  
ATOM 6768  N N    . CYS A 1 36  ? 0.752   14.516  -4.576  1.00 0.00 ? 36  CYS A N    5  
ATOM 6769  C CA   . CYS A 1 36  ? 0.913   14.475  -3.131  1.00 0.00 ? 36  CYS A CA   5  
ATOM 6770  C C    . CYS A 1 36  ? 0.868   13.024  -2.655  1.00 0.00 ? 36  CYS A C    5  
ATOM 6771  O O    . CYS A 1 36  ? -0.150  12.356  -2.866  1.00 0.00 ? 36  CYS A O    5  
ATOM 6772  C CB   . CYS A 1 36  ? -0.238  15.246  -2.477  1.00 0.00 ? 36  CYS A CB   5  
ATOM 6773  S SG   . CYS A 1 36  ? -0.296  16.959  -3.050  1.00 0.00 ? 36  CYS A SG   5  
ATOM 6774  H H    . CYS A 1 36  ? -0.132  14.866  -4.919  1.00 0.00 ? 36  CYS A H    5  
ATOM 6775  H HA   . CYS A 1 36  ? 1.860   14.940  -2.858  1.00 0.00 ? 36  CYS A HA   5  
ATOM 6776  H HB2  . CYS A 1 36  ? -1.171  14.755  -2.733  1.00 0.00 ? 36  CYS A HB2  5  
ATOM 6777  H HB3  . CYS A 1 36  ? -0.131  15.234  -1.394  1.00 0.00 ? 36  CYS A HB3  5  
ATOM 6778  H HG   . CYS A 1 36  ? 0.882   17.336  -2.528  1.00 0.00 ? 36  CYS A HG   5  
ATOM 6779  N N    . GLN A 1 37  ? 1.902   12.551  -1.948  1.00 0.00 ? 37  GLN A N    5  
ATOM 6780  C CA   . GLN A 1 37  ? 1.868   11.239  -1.306  1.00 0.00 ? 37  GLN A CA   5  
ATOM 6781  C C    . GLN A 1 37  ? 0.709   11.146  -0.309  1.00 0.00 ? 37  GLN A C    5  
ATOM 6782  O O    . GLN A 1 37  ? 0.147   10.067  -0.140  1.00 0.00 ? 37  GLN A O    5  
ATOM 6783  C CB   . GLN A 1 37  ? 3.175   10.888  -0.564  1.00 0.00 ? 37  GLN A CB   5  
ATOM 6784  C CG   . GLN A 1 37  ? 4.501   11.210  -1.294  1.00 0.00 ? 37  GLN A CG   5  
ATOM 6785  C CD   . GLN A 1 37  ? 5.422   12.173  -0.527  1.00 0.00 ? 37  GLN A CD   5  
ATOM 6786  O OE1  . GLN A 1 37  ? 5.014   12.872  0.397   1.00 0.00 ? 37  GLN A OE1  5  
ATOM 6787  N NE2  . GLN A 1 37  ? 6.685   12.258  -0.907  1.00 0.00 ? 37  GLN A NE2  5  
ATOM 6788  H H    . GLN A 1 37  ? 2.641   13.196  -1.690  1.00 0.00 ? 37  GLN A H    5  
ATOM 6789  H HA   . GLN A 1 37  ? 1.692   10.503  -2.086  1.00 0.00 ? 37  GLN A HA   5  
ATOM 6790  H HB2  . GLN A 1 37  ? 3.153   11.350  0.427   1.00 0.00 ? 37  GLN A HB2  5  
ATOM 6791  H HB3  . GLN A 1 37  ? 3.154   9.813   -0.390  1.00 0.00 ? 37  GLN A HB3  5  
ATOM 6792  H HG2  . GLN A 1 37  ? 5.044   10.275  -1.432  1.00 0.00 ? 37  GLN A HG2  5  
ATOM 6793  H HG3  . GLN A 1 37  ? 4.307   11.612  -2.291  1.00 0.00 ? 37  GLN A HG3  5  
ATOM 6794  H HE21 . GLN A 1 37  ? 7.052   11.776  -1.717  1.00 0.00 ? 37  GLN A HE21 5  
ATOM 6795  H HE22 . GLN A 1 37  ? 7.286   12.920  -0.432  1.00 0.00 ? 37  GLN A HE22 5  
ATOM 6796  N N    . ARG A 1 38  ? 0.339   12.259  0.340   1.00 0.00 ? 38  ARG A N    5  
ATOM 6797  C CA   . ARG A 1 38  ? -0.755  12.300  1.312   1.00 0.00 ? 38  ARG A CA   5  
ATOM 6798  C C    . ARG A 1 38  ? -2.061  11.851  0.651   1.00 0.00 ? 38  ARG A C    5  
ATOM 6799  O O    . ARG A 1 38  ? -2.694  10.887  1.078   1.00 0.00 ? 38  ARG A O    5  
ATOM 6800  C CB   . ARG A 1 38  ? -0.871  13.731  1.880   1.00 0.00 ? 38  ARG A CB   5  
ATOM 6801  C CG   . ARG A 1 38  ? -1.659  13.798  3.194   1.00 0.00 ? 38  ARG A CG   5  
ATOM 6802  C CD   . ARG A 1 38  ? -2.596  15.008  3.219   1.00 0.00 ? 38  ARG A CD   5  
ATOM 6803  N NE   . ARG A 1 38  ? -3.873  14.680  2.568   1.00 0.00 ? 38  ARG A NE   5  
ATOM 6804  C CZ   . ARG A 1 38  ? -4.846  13.930  3.101   1.00 0.00 ? 38  ARG A CZ   5  
ATOM 6805  N NH1  . ARG A 1 38  ? -4.824  13.549  4.372   1.00 0.00 ? 38  ARG A NH1  5  
ATOM 6806  N NH2  . ARG A 1 38  ? -5.869  13.529  2.368   1.00 0.00 ? 38  ARG A NH2  5  
ATOM 6807  H H    . ARG A 1 38  ? 0.887   13.103  0.175   1.00 0.00 ? 38  ARG A H    5  
ATOM 6808  H HA   . ARG A 1 38  ? -0.522  11.599  2.119   1.00 0.00 ? 38  ARG A HA   5  
ATOM 6809  H HB2  . ARG A 1 38  ? 0.121   14.120  2.104   1.00 0.00 ? 38  ARG A HB2  5  
ATOM 6810  H HB3  . ARG A 1 38  ? -1.323  14.385  1.130   1.00 0.00 ? 38  ARG A HB3  5  
ATOM 6811  H HG2  . ARG A 1 38  ? -2.220  12.878  3.368   1.00 0.00 ? 38  ARG A HG2  5  
ATOM 6812  H HG3  . ARG A 1 38  ? -0.950  13.896  4.010   1.00 0.00 ? 38  ARG A HG3  5  
ATOM 6813  H HD2  . ARG A 1 38  ? -2.773  15.300  4.250   1.00 0.00 ? 38  ARG A HD2  5  
ATOM 6814  H HD3  . ARG A 1 38  ? -2.124  15.849  2.711   1.00 0.00 ? 38  ARG A HD3  5  
ATOM 6815  H HE   . ARG A 1 38  ? -4.001  15.051  1.637   1.00 0.00 ? 38  ARG A HE   5  
ATOM 6816  H HH11 . ARG A 1 38  ? -4.086  13.816  5.017   1.00 0.00 ? 38  ARG A HH11 5  
ATOM 6817  H HH12 . ARG A 1 38  ? -5.568  12.933  4.703   1.00 0.00 ? 38  ARG A HH12 5  
ATOM 6818  H HH21 . ARG A 1 38  ? -6.023  13.682  1.377   1.00 0.00 ? 38  ARG A HH21 5  
ATOM 6819  H HH22 . ARG A 1 38  ? -6.590  12.968  2.834   1.00 0.00 ? 38  ARG A HH22 5  
ATOM 6820  N N    . ILE A 1 39  ? -2.466  12.550  -0.408  1.00 0.00 ? 39  ILE A N    5  
ATOM 6821  C CA   . ILE A 1 39  ? -3.709  12.294  -1.134  1.00 0.00 ? 39  ILE A CA   5  
ATOM 6822  C C    . ILE A 1 39  ? -3.587  10.944  -1.837  1.00 0.00 ? 39  ILE A C    5  
ATOM 6823  O O    . ILE A 1 39  ? -4.564  10.204  -1.876  1.00 0.00 ? 39  ILE A O    5  
ATOM 6824  C CB   . ILE A 1 39  ? -3.943  13.443  -2.147  1.00 0.00 ? 39  ILE A CB   5  
ATOM 6825  C CG1  . ILE A 1 39  ? -4.201  14.774  -1.402  1.00 0.00 ? 39  ILE A CG1  5  
ATOM 6826  C CG2  . ILE A 1 39  ? -5.096  13.154  -3.123  1.00 0.00 ? 39  ILE A CG2  5  
ATOM 6827  C CD1  . ILE A 1 39  ? -4.114  15.989  -2.328  1.00 0.00 ? 39  ILE A CD1  5  
ATOM 6828  H H    . ILE A 1 39  ? -1.852  13.271  -0.750  1.00 0.00 ? 39  ILE A H    5  
ATOM 6829  H HA   . ILE A 1 39  ? -4.551  12.222  -0.422  1.00 0.00 ? 39  ILE A HA   5  
ATOM 6830  H HB   . ILE A 1 39  ? -3.041  13.545  -2.750  1.00 0.00 ? 39  ILE A HB   5  
ATOM 6831  H HG12 . ILE A 1 39  ? -5.186  14.750  -0.934  1.00 0.00 ? 39  ILE A HG12 5  
ATOM 6832  H HG13 . ILE A 1 39  ? -3.458  14.916  -0.618  1.00 0.00 ? 39  ILE A HG13 5  
ATOM 6833  H HG21 . ILE A 1 39  ? -6.037  13.106  -2.576  1.00 0.00 ? 39  ILE A HG21 5  
ATOM 6834  H HG22 . ILE A 1 39  ? -5.165  13.936  -3.878  1.00 0.00 ? 39  ILE A HG22 5  
ATOM 6835  H HG23 . ILE A 1 39  ? -4.925  12.215  -3.649  1.00 0.00 ? 39  ILE A HG23 5  
ATOM 6836  H HD11 . ILE A 1 39  ? -4.253  16.900  -1.751  1.00 0.00 ? 39  ILE A HD11 5  
ATOM 6837  H HD12 . ILE A 1 39  ? -3.141  16.014  -2.812  1.00 0.00 ? 39  ILE A HD12 5  
ATOM 6838  H HD13 . ILE A 1 39  ? -4.890  15.949  -3.085  1.00 0.00 ? 39  ILE A HD13 5  
ATOM 6839  N N    . PHE A 1 40  ? -2.420  10.597  -2.385  1.00 0.00 ? 40  PHE A N    5  
ATOM 6840  C CA   . PHE A 1 40  ? -2.189  9.272   -2.946  1.00 0.00 ? 40  PHE A CA   5  
ATOM 6841  C C    . PHE A 1 40  ? -2.527  8.201   -1.903  1.00 0.00 ? 40  PHE A C    5  
ATOM 6842  O O    . PHE A 1 40  ? -3.281  7.284   -2.201  1.00 0.00 ? 40  PHE A O    5  
ATOM 6843  C CB   . PHE A 1 40  ? -0.745  9.161   -3.453  1.00 0.00 ? 40  PHE A CB   5  
ATOM 6844  C CG   . PHE A 1 40  ? -0.200  7.747   -3.549  1.00 0.00 ? 40  PHE A CG   5  
ATOM 6845  C CD1  . PHE A 1 40  ? -0.432  6.978   -4.705  1.00 0.00 ? 40  PHE A CD1  5  
ATOM 6846  C CD2  . PHE A 1 40  ? 0.558   7.204   -2.488  1.00 0.00 ? 40  PHE A CD2  5  
ATOM 6847  C CE1  . PHE A 1 40  ? 0.075   5.672   -4.802  1.00 0.00 ? 40  PHE A CE1  5  
ATOM 6848  C CE2  . PHE A 1 40  ? 1.093   5.907   -2.600  1.00 0.00 ? 40  PHE A CE2  5  
ATOM 6849  C CZ   . PHE A 1 40  ? 0.837   5.138   -3.752  1.00 0.00 ? 40  PHE A CZ   5  
ATOM 6850  H H    . PHE A 1 40  ? -1.659  11.268  -2.416  1.00 0.00 ? 40  PHE A H    5  
ATOM 6851  H HA   . PHE A 1 40  ? -2.863  9.137   -3.793  1.00 0.00 ? 40  PHE A HA   5  
ATOM 6852  H HB2  . PHE A 1 40  ? -0.665  9.651   -4.424  1.00 0.00 ? 40  PHE A HB2  5  
ATOM 6853  H HB3  . PHE A 1 40  ? -0.106  9.717   -2.785  1.00 0.00 ? 40  PHE A HB3  5  
ATOM 6854  H HD1  . PHE A 1 40  ? -0.978  7.394   -5.540  1.00 0.00 ? 40  PHE A HD1  5  
ATOM 6855  H HD2  . PHE A 1 40  ? 0.744   7.779   -1.589  1.00 0.00 ? 40  PHE A HD2  5  
ATOM 6856  H HE1  . PHE A 1 40  ? -0.106  5.085   -5.695  1.00 0.00 ? 40  PHE A HE1  5  
ATOM 6857  H HE2  . PHE A 1 40  ? 1.698   5.506   -1.800  1.00 0.00 ? 40  PHE A HE2  5  
ATOM 6858  H HZ   . PHE A 1 40  ? 1.216   4.134   -3.851  1.00 0.00 ? 40  PHE A HZ   5  
ATOM 6859  N N    . GLY A 1 41  ? -2.024  8.308   -0.674  1.00 0.00 ? 41  GLY A N    5  
ATOM 6860  C CA   . GLY A 1 41  ? -2.298  7.323   0.354   1.00 0.00 ? 41  GLY A CA   5  
ATOM 6861  C C    . GLY A 1 41  ? -3.788  7.205   0.649   1.00 0.00 ? 41  GLY A C    5  
ATOM 6862  O O    . GLY A 1 41  ? -4.340  6.108   0.692   1.00 0.00 ? 41  GLY A O    5  
ATOM 6863  H H    . GLY A 1 41  ? -1.387  9.066   -0.452  1.00 0.00 ? 41  GLY A H    5  
ATOM 6864  H HA2  . GLY A 1 41  ? -1.921  6.359   0.016   1.00 0.00 ? 41  GLY A HA2  5  
ATOM 6865  H HA3  . GLY A 1 41  ? -1.798  7.639   1.265   1.00 0.00 ? 41  GLY A HA3  5  
ATOM 6866  N N    . GLU A 1 42  ? -4.430  8.350   0.830   1.00 0.00 ? 42  GLU A N    5  
ATOM 6867  C CA   . GLU A 1 42  ? -5.822  8.463   1.227   1.00 0.00 ? 42  GLU A CA   5  
ATOM 6868  C C    . GLU A 1 42  ? -6.743  7.962   0.103   1.00 0.00 ? 42  GLU A C    5  
ATOM 6869  O O    . GLU A 1 42  ? -7.646  7.167   0.355   1.00 0.00 ? 42  GLU A O    5  
ATOM 6870  C CB   . GLU A 1 42  ? -6.034  9.933   1.639   1.00 0.00 ? 42  GLU A CB   5  
ATOM 6871  C CG   . GLU A 1 42  ? -5.393  10.204  3.024   1.00 0.00 ? 42  GLU A CG   5  
ATOM 6872  C CD   . GLU A 1 42  ? -6.384  10.535  4.145   1.00 0.00 ? 42  GLU A CD   5  
ATOM 6873  O OE1  . GLU A 1 42  ? -6.954  11.656  4.088   1.00 0.00 ? 42  GLU A OE1  5  
ATOM 6874  O OE2  . GLU A 1 42  ? -6.531  9.755   5.108   1.00 0.00 ? 42  GLU A OE2  5  
ATOM 6875  H H    . GLU A 1 42  ? -3.898  9.207   0.757   1.00 0.00 ? 42  GLU A H    5  
ATOM 6876  H HA   . GLU A 1 42  ? -5.999  7.820   2.093   1.00 0.00 ? 42  GLU A HA   5  
ATOM 6877  H HB2  . GLU A 1 42  ? -5.545  10.570  0.901   1.00 0.00 ? 42  GLU A HB2  5  
ATOM 6878  H HB3  . GLU A 1 42  ? -7.083  10.216  1.611   1.00 0.00 ? 42  GLU A HB3  5  
ATOM 6879  H HG2  . GLU A 1 42  ? -4.790  9.350   3.337   1.00 0.00 ? 42  GLU A HG2  5  
ATOM 6880  H HG3  . GLU A 1 42  ? -4.722  11.058  2.917   1.00 0.00 ? 42  GLU A HG3  5  
ATOM 6881  N N    . LYS A 1 43  ? -6.541  8.388   -1.148  1.00 0.00 ? 43  LYS A N    5  
ATOM 6882  C CA   . LYS A 1 43  ? -7.385  8.039   -2.289  1.00 0.00 ? 43  LYS A CA   5  
ATOM 6883  C C    . LYS A 1 43  ? -6.975  6.736   -2.961  1.00 0.00 ? 43  LYS A C    5  
ATOM 6884  O O    . LYS A 1 43  ? -7.835  5.917   -3.278  1.00 0.00 ? 43  LYS A O    5  
ATOM 6885  C CB   . LYS A 1 43  ? -7.341  9.156   -3.331  1.00 0.00 ? 43  LYS A CB   5  
ATOM 6886  C CG   . LYS A 1 43  ? -7.908  10.478  -2.789  1.00 0.00 ? 43  LYS A CG   5  
ATOM 6887  C CD   . LYS A 1 43  ? -8.500  11.283  -3.943  1.00 0.00 ? 43  LYS A CD   5  
ATOM 6888  C CE   . LYS A 1 43  ? -7.436  11.728  -4.954  1.00 0.00 ? 43  LYS A CE   5  
ATOM 6889  N NZ   . LYS A 1 43  ? -7.986  11.925  -6.306  1.00 0.00 ? 43  LYS A NZ   5  
ATOM 6890  H H    . LYS A 1 43  ? -5.812  9.070   -1.317  1.00 0.00 ? 43  LYS A H    5  
ATOM 6891  H HA   . LYS A 1 43  ? -8.421  7.931   -1.957  1.00 0.00 ? 43  LYS A HA   5  
ATOM 6892  H HB2  . LYS A 1 43  ? -6.319  9.312   -3.681  1.00 0.00 ? 43  LYS A HB2  5  
ATOM 6893  H HB3  . LYS A 1 43  ? -7.946  8.822   -4.176  1.00 0.00 ? 43  LYS A HB3  5  
ATOM 6894  H HG2  . LYS A 1 43  ? -8.710  10.272  -2.079  1.00 0.00 ? 43  LYS A HG2  5  
ATOM 6895  H HG3  . LYS A 1 43  ? -7.128  11.047  -2.284  1.00 0.00 ? 43  LYS A HG3  5  
ATOM 6896  H HD2  . LYS A 1 43  ? -9.235  10.641  -4.425  1.00 0.00 ? 43  LYS A HD2  5  
ATOM 6897  H HD3  . LYS A 1 43  ? -9.005  12.156  -3.540  1.00 0.00 ? 43  LYS A HD3  5  
ATOM 6898  H HE2  . LYS A 1 43  ? -6.977  12.655  -4.609  1.00 0.00 ? 43  LYS A HE2  5  
ATOM 6899  H HE3  . LYS A 1 43  ? -6.664  10.962  -5.016  1.00 0.00 ? 43  LYS A HE3  5  
ATOM 6900  H HZ1  . LYS A 1 43  ? -8.576  11.149  -6.594  1.00 0.00 ? 43  LYS A HZ1  5  
ATOM 6901  H HZ2  . LYS A 1 43  ? -8.529  12.777  -6.381  1.00 0.00 ? 43  LYS A HZ2  5  
ATOM 6902  H HZ3  . LYS A 1 43  ? -7.236  11.976  -6.994  1.00 0.00 ? 43  LYS A HZ3  5  
ATOM 6903  N N    . VAL A 1 44  ? -5.698  6.581   -3.312  1.00 0.00 ? 44  VAL A N    5  
ATOM 6904  C CA   . VAL A 1 44  ? -5.195  5.394   -4.001  1.00 0.00 ? 44  VAL A CA   5  
ATOM 6905  C C    . VAL A 1 44  ? -5.125  4.272   -2.969  1.00 0.00 ? 44  VAL A C    5  
ATOM 6906  O O    . VAL A 1 44  ? -5.898  3.319   -3.062  1.00 0.00 ? 44  VAL A O    5  
ATOM 6907  C CB   . VAL A 1 44  ? -3.851  5.646   -4.743  1.00 0.00 ? 44  VAL A CB   5  
ATOM 6908  C CG1  . VAL A 1 44  ? -3.397  4.436   -5.568  1.00 0.00 ? 44  VAL A CG1  5  
ATOM 6909  C CG2  . VAL A 1 44  ? -3.950  6.864   -5.678  1.00 0.00 ? 44  VAL A CG2  5  
ATOM 6910  H H    . VAL A 1 44  ? -5.019  7.259   -2.990  1.00 0.00 ? 44  VAL A H    5  
ATOM 6911  H HA   . VAL A 1 44  ? -5.923  5.098   -4.756  1.00 0.00 ? 44  VAL A HA   5  
ATOM 6912  H HB   . VAL A 1 44  ? -3.048  5.824   -4.036  1.00 0.00 ? 44  VAL A HB   5  
ATOM 6913  H HG11 . VAL A 1 44  ? -3.154  3.605   -4.906  1.00 0.00 ? 44  VAL A HG11 5  
ATOM 6914  H HG12 . VAL A 1 44  ? -4.174  4.127   -6.265  1.00 0.00 ? 44  VAL A HG12 5  
ATOM 6915  H HG13 . VAL A 1 44  ? -2.487  4.671   -6.118  1.00 0.00 ? 44  VAL A HG13 5  
ATOM 6916  H HG21 . VAL A 1 44  ? -3.021  6.986   -6.234  1.00 0.00 ? 44  VAL A HG21 5  
ATOM 6917  H HG22 . VAL A 1 44  ? -4.761  6.720   -6.391  1.00 0.00 ? 44  VAL A HG22 5  
ATOM 6918  H HG23 . VAL A 1 44  ? -4.118  7.772   -5.099  1.00 0.00 ? 44  VAL A HG23 5  
ATOM 6919  N N    . LEU A 1 45  ? -4.195  4.340   -2.011  1.00 0.00 ? 45  LEU A N    5  
ATOM 6920  C CA   . LEU A 1 45  ? -3.923  3.188   -1.145  1.00 0.00 ? 45  LEU A CA   5  
ATOM 6921  C C    . LEU A 1 45  ? -5.103  2.868   -0.228  1.00 0.00 ? 45  LEU A C    5  
ATOM 6922  O O    . LEU A 1 45  ? -5.190  1.730   0.236   1.00 0.00 ? 45  LEU A O    5  
ATOM 6923  C CB   . LEU A 1 45  ? -2.639  3.376   -0.313  1.00 0.00 ? 45  LEU A CB   5  
ATOM 6924  C CG   . LEU A 1 45  ? -1.348  3.451   -1.147  1.00 0.00 ? 45  LEU A CG   5  
ATOM 6925  C CD1  . LEU A 1 45  ? -0.161  3.818   -0.250  1.00 0.00 ? 45  LEU A CD1  5  
ATOM 6926  C CD2  . LEU A 1 45  ? -1.034  2.112   -1.807  1.00 0.00 ? 45  LEU A CD2  5  
ATOM 6927  H H    . LEU A 1 45  ? -3.639  5.185   -1.933  1.00 0.00 ? 45  LEU A H    5  
ATOM 6928  H HA   . LEU A 1 45  ? -3.798  2.311   -1.781  1.00 0.00 ? 45  LEU A HA   5  
ATOM 6929  H HB2  . LEU A 1 45  ? -2.728  4.276   0.288   1.00 0.00 ? 45  LEU A HB2  5  
ATOM 6930  H HB3  . LEU A 1 45  ? -2.553  2.537   0.381   1.00 0.00 ? 45  LEU A HB3  5  
ATOM 6931  H HG   . LEU A 1 45  ? -1.449  4.211   -1.922  1.00 0.00 ? 45  LEU A HG   5  
ATOM 6932  H HD11 . LEU A 1 45  ? 0.770   3.703   -0.801  1.00 0.00 ? 45  LEU A HD11 5  
ATOM 6933  H HD12 . LEU A 1 45  ? -0.253  4.858   0.053   1.00 0.00 ? 45  LEU A HD12 5  
ATOM 6934  H HD13 . LEU A 1 45  ? -0.137  3.173   0.630   1.00 0.00 ? 45  LEU A HD13 5  
ATOM 6935  H HD21 . LEU A 1 45  ? -1.849  1.796   -2.455  1.00 0.00 ? 45  LEU A HD21 5  
ATOM 6936  H HD22 . LEU A 1 45  ? -0.146  2.209   -2.422  1.00 0.00 ? 45  LEU A HD22 5  
ATOM 6937  H HD23 . LEU A 1 45  ? -0.868  1.370   -1.029  1.00 0.00 ? 45  LEU A HD23 5  
ATOM 6938  N N    . GLY A 1 46  ? -6.002  3.825   0.019   1.00 0.00 ? 46  GLY A N    5  
ATOM 6939  C CA   . GLY A 1 46  ? -7.133  3.630   0.910   1.00 0.00 ? 46  GLY A CA   5  
ATOM 6940  C C    . GLY A 1 46  ? -6.668  3.487   2.357   1.00 0.00 ? 46  GLY A C    5  
ATOM 6941  O O    . GLY A 1 46  ? -7.283  2.754   3.132   1.00 0.00 ? 46  GLY A O    5  
ATOM 6942  H H    . GLY A 1 46  ? -5.816  4.763   -0.306  1.00 0.00 ? 46  GLY A H    5  
ATOM 6943  H HA2  . GLY A 1 46  ? -7.812  4.481   0.829   1.00 0.00 ? 46  GLY A HA2  5  
ATOM 6944  H HA3  . GLY A 1 46  ? -7.655  2.722   0.610   1.00 0.00 ? 46  GLY A HA3  5  
ATOM 6945  N N    . LEU A 1 47  ? -5.550  4.124   2.716   1.00 0.00 ? 47  LEU A N    5  
ATOM 6946  C CA   . LEU A 1 47  ? -4.986  4.110   4.054   1.00 0.00 ? 47  LEU A CA   5  
ATOM 6947  C C    . LEU A 1 47  ? -5.148  5.498   4.651   1.00 0.00 ? 47  LEU A C    5  
ATOM 6948  O O    . LEU A 1 47  ? -4.882  6.496   3.977   1.00 0.00 ? 47  LEU A O    5  
ATOM 6949  C CB   . LEU A 1 47  ? -3.500  3.724   3.996   1.00 0.00 ? 47  LEU A CB   5  
ATOM 6950  C CG   . LEU A 1 47  ? -3.237  2.208   3.908   1.00 0.00 ? 47  LEU A CG   5  
ATOM 6951  C CD1  . LEU A 1 47  ? -1.723  1.997   3.801   1.00 0.00 ? 47  LEU A CD1  5  
ATOM 6952  C CD2  . LEU A 1 47  ? -3.748  1.431   5.130   1.00 0.00 ? 47  LEU A CD2  5  
ATOM 6953  H H    . LEU A 1 47  ? -5.139  4.771   2.052   1.00 0.00 ? 47  LEU A H    5  
ATOM 6954  H HA   . LEU A 1 47  ? -5.529  3.399   4.672   1.00 0.00 ? 47  LEU A HA   5  
ATOM 6955  H HB2  . LEU A 1 47  ? -3.039  4.221   3.139   1.00 0.00 ? 47  LEU A HB2  5  
ATOM 6956  H HB3  . LEU A 1 47  ? -3.013  4.106   4.891   1.00 0.00 ? 47  LEU A HB3  5  
ATOM 6957  H HG   . LEU A 1 47  ? -3.709  1.802   3.013   1.00 0.00 ? 47  LEU A HG   5  
ATOM 6958  H HD11 . LEU A 1 47  ? -1.383  2.358   2.832   1.00 0.00 ? 47  LEU A HD11 5  
ATOM 6959  H HD12 . LEU A 1 47  ? -1.206  2.535   4.595   1.00 0.00 ? 47  LEU A HD12 5  
ATOM 6960  H HD13 . LEU A 1 47  ? -1.478  0.940   3.878   1.00 0.00 ? 47  LEU A HD13 5  
ATOM 6961  H HD21 . LEU A 1 47  ? -4.837  1.430   5.146   1.00 0.00 ? 47  LEU A HD21 5  
ATOM 6962  H HD22 . LEU A 1 47  ? -3.425  0.391   5.081   1.00 0.00 ? 47  LEU A HD22 5  
ATOM 6963  H HD23 . LEU A 1 47  ? -3.379  1.880   6.050   1.00 0.00 ? 47  LEU A HD23 5  
ATOM 6964  N N    . SER A 1 48  ? -5.523  5.545   5.931   1.00 0.00 ? 48  SER A N    5  
ATOM 6965  C CA   . SER A 1 48  ? -5.524  6.772   6.695   1.00 0.00 ? 48  SER A CA   5  
ATOM 6966  C C    . SER A 1 48  ? -4.116  7.355   6.752   1.00 0.00 ? 48  SER A C    5  
ATOM 6967  O O    . SER A 1 48  ? -3.106  6.663   6.576   1.00 0.00 ? 48  SER A O    5  
ATOM 6968  C CB   . SER A 1 48  ? -6.087  6.523   8.099   1.00 0.00 ? 48  SER A CB   5  
ATOM 6969  O OG   . SER A 1 48  ? -7.506  6.580   8.076   1.00 0.00 ? 48  SER A OG   5  
ATOM 6970  H H    . SER A 1 48  ? -5.643  4.687   6.448   1.00 0.00 ? 48  SER A H    5  
ATOM 6971  H HA   . SER A 1 48  ? -6.161  7.484   6.175   1.00 0.00 ? 48  SER A HA   5  
ATOM 6972  H HB2  . SER A 1 48  ? -5.744  5.560   8.479   1.00 0.00 ? 48  SER A HB2  5  
ATOM 6973  H HB3  . SER A 1 48  ? -5.730  7.302   8.774   1.00 0.00 ? 48  SER A HB3  5  
ATOM 6974  H HG   . SER A 1 48  ? -7.862  5.797   7.593   1.00 0.00 ? 48  SER A HG   5  
ATOM 6975  N N    . GLN A 1 49  ? -4.072  8.658   7.013   1.00 0.00 ? 49  GLN A N    5  
ATOM 6976  C CA   . GLN A 1 49  ? -2.865  9.454   6.912   1.00 0.00 ? 49  GLN A CA   5  
ATOM 6977  C C    . GLN A 1 49  ? -1.738  8.919   7.794   1.00 0.00 ? 49  GLN A C    5  
ATOM 6978  O O    . GLN A 1 49  ? -0.630  8.719   7.297   1.00 0.00 ? 49  GLN A O    5  
ATOM 6979  C CB   . GLN A 1 49  ? -3.196  10.917  7.216   1.00 0.00 ? 49  GLN A CB   5  
ATOM 6980  C CG   . GLN A 1 49  ? -2.035  11.815  6.792   1.00 0.00 ? 49  GLN A CG   5  
ATOM 6981  C CD   . GLN A 1 49  ? -2.294  13.266  7.157   1.00 0.00 ? 49  GLN A CD   5  
ATOM 6982  O OE1  . GLN A 1 49  ? -2.779  14.056  6.349   1.00 0.00 ? 49  GLN A OE1  5  
ATOM 6983  N NE2  . GLN A 1 49  ? -1.948  13.665  8.361   1.00 0.00 ? 49  GLN A NE2  5  
ATOM 6984  H H    . GLN A 1 49  ? -4.966  9.133   7.045   1.00 0.00 ? 49  GLN A H    5  
ATOM 6985  H HA   . GLN A 1 49  ? -2.522  9.381   5.884   1.00 0.00 ? 49  GLN A HA   5  
ATOM 6986  H HB2  . GLN A 1 49  ? -4.089  11.215  6.663   1.00 0.00 ? 49  GLN A HB2  5  
ATOM 6987  H HB3  . GLN A 1 49  ? -3.379  11.039  8.283   1.00 0.00 ? 49  GLN A HB3  5  
ATOM 6988  H HG2  . GLN A 1 49  ? -1.112  11.491  7.277   1.00 0.00 ? 49  GLN A HG2  5  
ATOM 6989  H HG3  . GLN A 1 49  ? -1.895  11.741  5.715   1.00 0.00 ? 49  GLN A HG3  5  
ATOM 6990  H HE21 . GLN A 1 49  ? -1.585  12.977  9.018   1.00 0.00 ? 49  GLN A HE21 5  
ATOM 6991  H HE22 . GLN A 1 49  ? -1.918  14.643  8.636   1.00 0.00 ? 49  GLN A HE22 5  
ATOM 6992  N N    . GLY A 1 50  ? -2.002  8.677   9.082   1.00 0.00 ? 50  GLY A N    5  
ATOM 6993  C CA   . GLY A 1 50  ? -0.989  8.166   9.999   1.00 0.00 ? 50  GLY A CA   5  
ATOM 6994  C C    . GLY A 1 50  ? -0.467  6.800   9.565   1.00 0.00 ? 50  GLY A C    5  
ATOM 6995  O O    . GLY A 1 50  ? 0.711   6.504   9.772   1.00 0.00 ? 50  GLY A O    5  
ATOM 6996  H H    . GLY A 1 50  ? -2.931  8.842   9.440   1.00 0.00 ? 50  GLY A H    5  
ATOM 6997  H HA2  . GLY A 1 50  ? -0.146  8.858   10.012  1.00 0.00 ? 50  GLY A HA2  5  
ATOM 6998  H HA3  . GLY A 1 50  ? -1.411  8.080   11.002  1.00 0.00 ? 50  GLY A HA3  5  
ATOM 6999  N N    . SER A 1 51  ? -1.315  5.985   8.940   1.00 0.00 ? 51  SER A N    5  
ATOM 7000  C CA   . SER A 1 51  ? -0.958  4.675   8.440   1.00 0.00 ? 51  SER A CA   5  
ATOM 7001  C C    . SER A 1 51  ? 0.045   4.852   7.301   1.00 0.00 ? 51  SER A C    5  
ATOM 7002  O O    . SER A 1 51  ? 1.157   4.333   7.384   1.00 0.00 ? 51  SER A O    5  
ATOM 7003  C CB   . SER A 1 51  ? -2.219  3.912   8.003   1.00 0.00 ? 51  SER A CB   5  
ATOM 7004  O OG   . SER A 1 51  ? -3.372  4.254   8.755   1.00 0.00 ? 51  SER A OG   5  
ATOM 7005  H H    . SER A 1 51  ? -2.270  6.268   8.768   1.00 0.00 ? 51  SER A H    5  
ATOM 7006  H HA   . SER A 1 51  ? -0.484  4.116   9.246   1.00 0.00 ? 51  SER A HA   5  
ATOM 7007  H HB2  . SER A 1 51  ? -2.439  4.149   6.966   1.00 0.00 ? 51  SER A HB2  5  
ATOM 7008  H HB3  . SER A 1 51  ? -2.037  2.840   8.077   1.00 0.00 ? 51  SER A HB3  5  
ATOM 7009  H HG   . SER A 1 51  ? -3.126  4.451   9.686   1.00 0.00 ? 51  SER A HG   5  
ATOM 7010  N N    . VAL A 1 52  ? -0.327  5.607   6.257   1.00 0.00 ? 52  VAL A N    5  
ATOM 7011  C CA   . VAL A 1 52  ? 0.497   5.786   5.067   1.00 0.00 ? 52  VAL A CA   5  
ATOM 7012  C C    . VAL A 1 52  ? 1.815   6.496   5.381   1.00 0.00 ? 52  VAL A C    5  
ATOM 7013  O O    . VAL A 1 52  ? 2.822   6.237   4.712   1.00 0.00 ? 52  VAL A O    5  
ATOM 7014  C CB   . VAL A 1 52  ? -0.318  6.458   3.933   1.00 0.00 ? 52  VAL A CB   5  
ATOM 7015  C CG1  . VAL A 1 52  ? 0.218   7.829   3.471   1.00 0.00 ? 52  VAL A CG1  5  
ATOM 7016  C CG2  . VAL A 1 52  ? -0.356  5.477   2.753   1.00 0.00 ? 52  VAL A CG2  5  
ATOM 7017  H H    . VAL A 1 52  ? -1.249  6.037   6.278   1.00 0.00 ? 52  VAL A H    5  
ATOM 7018  H HA   . VAL A 1 52  ? 0.753   4.784   4.737   1.00 0.00 ? 52  VAL A HA   5  
ATOM 7019  H HB   . VAL A 1 52  ? -1.346  6.609   4.263   1.00 0.00 ? 52  VAL A HB   5  
ATOM 7020  H HG11 . VAL A 1 52  ? -0.427  8.263   2.714   1.00 0.00 ? 52  VAL A HG11 5  
ATOM 7021  H HG12 . VAL A 1 52  ? 0.261   8.515   4.324   1.00 0.00 ? 52  VAL A HG12 5  
ATOM 7022  H HG13 . VAL A 1 52  ? 1.205   7.729   3.024   1.00 0.00 ? 52  VAL A HG13 5  
ATOM 7023  H HG21 . VAL A 1 52  ? -1.128  5.757   2.051   1.00 0.00 ? 52  VAL A HG21 5  
ATOM 7024  H HG22 . VAL A 1 52  ? 0.610   5.432   2.249   1.00 0.00 ? 52  VAL A HG22 5  
ATOM 7025  H HG23 . VAL A 1 52  ? -0.614  4.480   3.099   1.00 0.00 ? 52  VAL A HG23 5  
ATOM 7026  N N    . SER A 1 53  ? 1.809   7.393   6.368   1.00 0.00 ? 53  SER A N    5  
ATOM 7027  C CA   . SER A 1 53  ? 2.959   8.210   6.682   1.00 0.00 ? 53  SER A CA   5  
ATOM 7028  C C    . SER A 1 53  ? 4.103   7.308   7.133   1.00 0.00 ? 53  SER A C    5  
ATOM 7029  O O    . SER A 1 53  ? 5.153   7.345   6.487   1.00 0.00 ? 53  SER A O    5  
ATOM 7030  C CB   . SER A 1 53  ? 2.554   9.271   7.706   1.00 0.00 ? 53  SER A CB   5  
ATOM 7031  O OG   . SER A 1 53  ? 3.563   10.254  7.878   1.00 0.00 ? 53  SER A OG   5  
ATOM 7032  H H    . SER A 1 53  ? 0.935   7.597   6.846   1.00 0.00 ? 53  SER A H    5  
ATOM 7033  H HA   . SER A 1 53  ? 3.267   8.712   5.765   1.00 0.00 ? 53  SER A HA   5  
ATOM 7034  H HB2  . SER A 1 53  ? 1.671   9.788   7.325   1.00 0.00 ? 53  SER A HB2  5  
ATOM 7035  H HB3  . SER A 1 53  ? 2.330   8.773   8.653   1.00 0.00 ? 53  SER A HB3  5  
ATOM 7036  H HG   . SER A 1 53  ? 3.245   10.905  8.533   1.00 0.00 ? 53  SER A HG   5  
ATOM 7037  N N    . ASP A 1 54  ? 3.899   6.490   8.173   1.00 0.00 ? 54  ASP A N    5  
ATOM 7038  C CA   . ASP A 1 54  ? 4.877   5.509   8.649   1.00 0.00 ? 54  ASP A CA   5  
ATOM 7039  C C    . ASP A 1 54  ? 5.191   4.480   7.564   1.00 0.00 ? 54  ASP A C    5  
ATOM 7040  O O    . ASP A 1 54  ? 6.355   4.110   7.423   1.00 0.00 ? 54  ASP A O    5  
ATOM 7041  C CB   . ASP A 1 54  ? 4.348   4.819   9.907   1.00 0.00 ? 54  ASP A CB   5  
ATOM 7042  C CG   . ASP A 1 54  ? 5.266   3.674   10.341  1.00 0.00 ? 54  ASP A CG   5  
ATOM 7043  O OD1  . ASP A 1 54  ? 6.265   3.938   11.064  1.00 0.00 ? 54  ASP A OD1  5  
ATOM 7044  O OD2  . ASP A 1 54  ? 4.909   2.512   10.063  1.00 0.00 ? 54  ASP A OD2  5  
ATOM 7045  H H    . ASP A 1 54  ? 2.984   6.498   8.611   1.00 0.00 ? 54  ASP A H    5  
ATOM 7046  H HA   . ASP A 1 54  ? 5.814   6.021   8.898   1.00 0.00 ? 54  ASP A HA   5  
ATOM 7047  H HB2  . ASP A 1 54  ? 4.256   5.565   10.704  1.00 0.00 ? 54  ASP A HB2  5  
ATOM 7048  H HB3  . ASP A 1 54  ? 3.350   4.418   9.698   1.00 0.00 ? 54  ASP A HB3  5  
ATOM 7049  N N    . MET A 1 55  ? 4.211   4.099   6.737   1.00 0.00 ? 55  MET A N    5  
ATOM 7050  C CA   . MET A 1 55  ? 4.391   3.188   5.606   1.00 0.00 ? 55  MET A CA   5  
ATOM 7051  C C    . MET A 1 55  ? 5.499   3.672   4.660   1.00 0.00 ? 55  MET A C    5  
ATOM 7052  O O    . MET A 1 55  ? 6.518   3.003   4.521   1.00 0.00 ? 55  MET A O    5  
ATOM 7053  C CB   . MET A 1 55  ? 3.045   3.046   4.870   1.00 0.00 ? 55  MET A CB   5  
ATOM 7054  C CG   . MET A 1 55  ? 2.494   1.634   4.802   1.00 0.00 ? 55  MET A CG   5  
ATOM 7055  S SD   . MET A 1 55  ? 2.378   0.729   6.369   1.00 0.00 ? 55  MET A SD   5  
ATOM 7056  C CE   . MET A 1 55  ? 0.585   0.843   6.668   1.00 0.00 ? 55  MET A CE   5  
ATOM 7057  H H    . MET A 1 55  ? 3.262   4.434   6.895   1.00 0.00 ? 55  MET A H    5  
ATOM 7058  H HA   . MET A 1 55  ? 4.691   2.212   5.999   1.00 0.00 ? 55  MET A HA   5  
ATOM 7059  H HB2  . MET A 1 55  ? 2.298   3.636   5.376   1.00 0.00 ? 55  MET A HB2  5  
ATOM 7060  H HB3  . MET A 1 55  ? 3.111   3.421   3.847   1.00 0.00 ? 55  MET A HB3  5  
ATOM 7061  H HG2  . MET A 1 55  ? 1.493   1.732   4.392   1.00 0.00 ? 55  MET A HG2  5  
ATOM 7062  H HG3  . MET A 1 55  ? 3.114   1.072   4.108   1.00 0.00 ? 55  MET A HG3  5  
ATOM 7063  H HE1  . MET A 1 55  ? 0.295   1.894   6.758   1.00 0.00 ? 55  MET A HE1  5  
ATOM 7064  H HE2  . MET A 1 55  ? 0.036   0.377   5.843   1.00 0.00 ? 55  MET A HE2  5  
ATOM 7065  H HE3  . MET A 1 55  ? 0.336   0.318   7.593   1.00 0.00 ? 55  MET A HE3  5  
ATOM 7066  N N    . LEU A 1 56  ? 5.304   4.809   3.985   1.00 0.00 ? 56  LEU A N    5  
ATOM 7067  C CA   . LEU A 1 56  ? 6.297   5.346   3.061   1.00 0.00 ? 56  LEU A CA   5  
ATOM 7068  C C    . LEU A 1 56  ? 7.556   5.833   3.778   1.00 0.00 ? 56  LEU A C    5  
ATOM 7069  O O    . LEU A 1 56  ? 8.620   5.869   3.161   1.00 0.00 ? 56  LEU A O    5  
ATOM 7070  C CB   . LEU A 1 56  ? 5.705   6.487   2.221   1.00 0.00 ? 56  LEU A CB   5  
ATOM 7071  C CG   . LEU A 1 56  ? 4.512   6.098   1.328   1.00 0.00 ? 56  LEU A CG   5  
ATOM 7072  C CD1  . LEU A 1 56  ? 4.084   7.329   0.527   1.00 0.00 ? 56  LEU A CD1  5  
ATOM 7073  C CD2  . LEU A 1 56  ? 4.838   4.956   0.359   1.00 0.00 ? 56  LEU A CD2  5  
ATOM 7074  H H    . LEU A 1 56  ? 4.405   5.267   4.093   1.00 0.00 ? 56  LEU A H    5  
ATOM 7075  H HA   . LEU A 1 56  ? 6.596   4.543   2.395   1.00 0.00 ? 56  LEU A HA   5  
ATOM 7076  H HB2  . LEU A 1 56  ? 5.387   7.282   2.895   1.00 0.00 ? 56  LEU A HB2  5  
ATOM 7077  H HB3  . LEU A 1 56  ? 6.499   6.878   1.584   1.00 0.00 ? 56  LEU A HB3  5  
ATOM 7078  H HG   . LEU A 1 56  ? 3.672   5.790   1.952   1.00 0.00 ? 56  LEU A HG   5  
ATOM 7079  H HD11 . LEU A 1 56  ? 3.844   8.141   1.218   1.00 0.00 ? 56  LEU A HD11 5  
ATOM 7080  H HD12 . LEU A 1 56  ? 4.892   7.638   -0.141  1.00 0.00 ? 56  LEU A HD12 5  
ATOM 7081  H HD13 . LEU A 1 56  ? 3.201   7.098   -0.068  1.00 0.00 ? 56  LEU A HD13 5  
ATOM 7082  H HD21 . LEU A 1 56  ? 4.007   4.797   -0.329  1.00 0.00 ? 56  LEU A HD21 5  
ATOM 7083  H HD22 . LEU A 1 56  ? 5.733   5.188   -0.218  1.00 0.00 ? 56  LEU A HD22 5  
ATOM 7084  H HD23 . LEU A 1 56  ? 4.991   4.031   0.915   1.00 0.00 ? 56  LEU A HD23 5  
ATOM 7085  N N    . SER A 1 57  ? 7.465   6.259   5.038   1.00 0.00 ? 57  SER A N    5  
ATOM 7086  C CA   . SER A 1 57  ? 8.604   6.766   5.784   1.00 0.00 ? 57  SER A CA   5  
ATOM 7087  C C    . SER A 1 57  ? 9.553   5.625   6.157   1.00 0.00 ? 57  SER A C    5  
ATOM 7088  O O    . SER A 1 57  ? 10.752  5.726   5.888   1.00 0.00 ? 57  SER A O    5  
ATOM 7089  C CB   . SER A 1 57  ? 8.109   7.550   7.002   1.00 0.00 ? 57  SER A CB   5  
ATOM 7090  O OG   . SER A 1 57  ? 9.139   8.304   7.594   1.00 0.00 ? 57  SER A OG   5  
ATOM 7091  H H    . SER A 1 57  ? 6.570   6.220   5.508   1.00 0.00 ? 57  SER A H    5  
ATOM 7092  H HA   . SER A 1 57  ? 9.141   7.465   5.146   1.00 0.00 ? 57  SER A HA   5  
ATOM 7093  H HB2  . SER A 1 57  ? 7.352   8.258   6.682   1.00 0.00 ? 57  SER A HB2  5  
ATOM 7094  H HB3  . SER A 1 57  ? 7.678   6.875   7.736   1.00 0.00 ? 57  SER A HB3  5  
ATOM 7095  H HG   . SER A 1 57  ? 8.757   8.795   8.340   1.00 0.00 ? 57  SER A HG   5  
ATOM 7096  N N    . ARG A 1 58  ? 9.046   4.554   6.774   1.00 0.00 ? 58  ARG A N    5  
ATOM 7097  C CA   . ARG A 1 58  ? 9.814   3.431   7.301   1.00 0.00 ? 58  ARG A CA   5  
ATOM 7098  C C    . ARG A 1 58  ? 9.007   2.137   7.108   1.00 0.00 ? 58  ARG A C    5  
ATOM 7099  O O    . ARG A 1 58  ? 8.484   1.606   8.096   1.00 0.00 ? 58  ARG A O    5  
ATOM 7100  C CB   . ARG A 1 58  ? 10.113  3.660   8.797   1.00 0.00 ? 58  ARG A CB   5  
ATOM 7101  C CG   . ARG A 1 58  ? 10.975  4.889   9.117   1.00 0.00 ? 58  ARG A CG   5  
ATOM 7102  C CD   . ARG A 1 58  ? 11.449  4.773   10.572  1.00 0.00 ? 58  ARG A CD   5  
ATOM 7103  N NE   . ARG A 1 58  ? 12.397  5.823   10.984  1.00 0.00 ? 58  ARG A NE   5  
ATOM 7104  C CZ   . ARG A 1 58  ? 13.071  5.815   12.149  1.00 0.00 ? 58  ARG A CZ   5  
ATOM 7105  N NH1  . ARG A 1 58  ? 12.862  4.859   13.052  1.00 0.00 ? 58  ARG A NH1  5  
ATOM 7106  N NH2  . ARG A 1 58  ? 13.968  6.751   12.423  1.00 0.00 ? 58  ARG A NH2  5  
ATOM 7107  H H    . ARG A 1 58  ? 8.040   4.511   6.911   1.00 0.00 ? 58  ARG A H    5  
ATOM 7108  H HA   . ARG A 1 58  ? 10.758  3.355   6.760   1.00 0.00 ? 58  ARG A HA   5  
ATOM 7109  H HB2  . ARG A 1 58  ? 9.168   3.768   9.337   1.00 0.00 ? 58  ARG A HB2  5  
ATOM 7110  H HB3  . ARG A 1 58  ? 10.632  2.773   9.167   1.00 0.00 ? 58  ARG A HB3  5  
ATOM 7111  H HG2  . ARG A 1 58  ? 11.837  4.914   8.455   1.00 0.00 ? 58  ARG A HG2  5  
ATOM 7112  H HG3  . ARG A 1 58  ? 10.374  5.791   8.984   1.00 0.00 ? 58  ARG A HG3  5  
ATOM 7113  H HD2  . ARG A 1 58  ? 10.578  4.808   11.220  1.00 0.00 ? 58  ARG A HD2  5  
ATOM 7114  H HD3  . ARG A 1 58  ? 11.932  3.806   10.705  1.00 0.00 ? 58  ARG A HD3  5  
ATOM 7115  H HE   . ARG A 1 58  ? 12.553  6.576   10.326  1.00 0.00 ? 58  ARG A HE   5  
ATOM 7116  H HH11 . ARG A 1 58  ? 12.091  4.203   12.939  1.00 0.00 ? 58  ARG A HH11 5  
ATOM 7117  H HH12 . ARG A 1 58  ? 13.418  4.799   13.901  1.00 0.00 ? 58  ARG A HH12 5  
ATOM 7118  H HH21 . ARG A 1 58  ? 14.154  7.562   11.840  1.00 0.00 ? 58  ARG A HH21 5  
ATOM 7119  H HH22 . ARG A 1 58  ? 14.503  6.678   13.290  1.00 0.00 ? 58  ARG A HH22 5  
ATOM 7120  N N    . PRO A 1 59  ? 8.904   1.589   5.886   1.00 0.00 ? 59  PRO A N    5  
ATOM 7121  C CA   . PRO A 1 59  ? 8.094   0.399   5.653   1.00 0.00 ? 59  PRO A CA   5  
ATOM 7122  C C    . PRO A 1 59  ? 8.668   -0.791  6.414   1.00 0.00 ? 59  PRO A C    5  
ATOM 7123  O O    . PRO A 1 59  ? 9.881   -0.852  6.644   1.00 0.00 ? 59  PRO A O    5  
ATOM 7124  C CB   . PRO A 1 59  ? 8.144   0.140   4.150   1.00 0.00 ? 59  PRO A CB   5  
ATOM 7125  C CG   . PRO A 1 59  ? 9.433   0.834   3.712   1.00 0.00 ? 59  PRO A CG   5  
ATOM 7126  C CD   . PRO A 1 59  ? 9.561   2.022   4.664   1.00 0.00 ? 59  PRO A CD   5  
ATOM 7127  H HA   . PRO A 1 59  ? 7.067   0.580   5.968   1.00 0.00 ? 59  PRO A HA   5  
ATOM 7128  H HB2  . PRO A 1 59  ? 8.179   -0.933  3.959   1.00 0.00 ? 59  PRO A HB2  5  
ATOM 7129  H HB3  . PRO A 1 59  ? 7.284   0.597   3.663   1.00 0.00 ? 59  PRO A HB3  5  
ATOM 7130  H HG2  . PRO A 1 59  ? 10.266  0.153   3.856   1.00 0.00 ? 59  PRO A HG2  5  
ATOM 7131  H HG3  . PRO A 1 59  ? 9.404   1.149   2.676   1.00 0.00 ? 59  PRO A HG3  5  
ATOM 7132  H HD2  . PRO A 1 59  ? 10.613  2.251   4.836   1.00 0.00 ? 59  PRO A HD2  5  
ATOM 7133  H HD3  . PRO A 1 59  ? 9.051   2.894   4.250   1.00 0.00 ? 59  PRO A HD3  5  
ATOM 7134  N N    . LYS A 1 60  ? 7.820   -1.760  6.761   1.00 0.00 ? 60  LYS A N    5  
ATOM 7135  C CA   . LYS A 1 60  ? 8.281   -3.044  7.283   1.00 0.00 ? 60  LYS A CA   5  
ATOM 7136  C C    . LYS A 1 60  ? 8.941   -3.872  6.174   1.00 0.00 ? 60  LYS A C    5  
ATOM 7137  O O    . LYS A 1 60  ? 8.639   -3.642  5.002   1.00 0.00 ? 60  LYS A O    5  
ATOM 7138  C CB   . LYS A 1 60  ? 7.077   -3.807  7.852   1.00 0.00 ? 60  LYS A CB   5  
ATOM 7139  C CG   . LYS A 1 60  ? 6.586   -3.248  9.196   1.00 0.00 ? 60  LYS A CG   5  
ATOM 7140  C CD   . LYS A 1 60  ? 7.281   -3.956  10.360  1.00 0.00 ? 60  LYS A CD   5  
ATOM 7141  C CE   . LYS A 1 60  ? 6.820   -3.388  11.701  1.00 0.00 ? 60  LYS A CE   5  
ATOM 7142  N NZ   . LYS A 1 60  ? 7.218   -4.284  12.802  1.00 0.00 ? 60  LYS A NZ   5  
ATOM 7143  H H    . LYS A 1 60  ? 6.837   -1.668  6.530   1.00 0.00 ? 60  LYS A H    5  
ATOM 7144  H HA   . LYS A 1 60  ? 9.023   -2.840  8.047   1.00 0.00 ? 60  LYS A HA   5  
ATOM 7145  H HB2  . LYS A 1 60  ? 6.265   -3.751  7.129   1.00 0.00 ? 60  LYS A HB2  5  
ATOM 7146  H HB3  . LYS A 1 60  ? 7.338   -4.860  7.968   1.00 0.00 ? 60  LYS A HB3  5  
ATOM 7147  H HG2  . LYS A 1 60  ? 6.765   -2.172  9.257   1.00 0.00 ? 60  LYS A HG2  5  
ATOM 7148  H HG3  . LYS A 1 60  ? 5.513   -3.432  9.279   1.00 0.00 ? 60  LYS A HG3  5  
ATOM 7149  H HD2  . LYS A 1 60  ? 7.027   -5.014  10.315  1.00 0.00 ? 60  LYS A HD2  5  
ATOM 7150  H HD3  . LYS A 1 60  ? 8.362   -3.852  10.277  1.00 0.00 ? 60  LYS A HD3  5  
ATOM 7151  H HE2  . LYS A 1 60  ? 7.274   -2.406  11.850  1.00 0.00 ? 60  LYS A HE2  5  
ATOM 7152  H HE3  . LYS A 1 60  ? 5.732   -3.279  11.690  1.00 0.00 ? 60  LYS A HE3  5  
ATOM 7153  H HZ1  . LYS A 1 60  ? 6.695   -5.152  12.734  1.00 0.00 ? 60  LYS A HZ1  5  
ATOM 7154  H HZ2  . LYS A 1 60  ? 8.213   -4.490  12.757  1.00 0.00 ? 60  LYS A HZ2  5  
ATOM 7155  H HZ3  . LYS A 1 60  ? 7.017   -3.856  13.701  1.00 0.00 ? 60  LYS A HZ3  5  
ATOM 7156  N N    . PRO A 1 61  ? 9.778   -4.869  6.510   1.00 0.00 ? 61  PRO A N    5  
ATOM 7157  C CA   . PRO A 1 61  ? 10.260  -5.833  5.531   1.00 0.00 ? 61  PRO A CA   5  
ATOM 7158  C C    . PRO A 1 61  ? 9.087   -6.709  5.089   1.00 0.00 ? 61  PRO A C    5  
ATOM 7159  O O    . PRO A 1 61  ? 8.142   -6.926  5.855   1.00 0.00 ? 61  PRO A O    5  
ATOM 7160  C CB   . PRO A 1 61  ? 11.358  -6.631  6.237   1.00 0.00 ? 61  PRO A CB   5  
ATOM 7161  C CG   . PRO A 1 61  ? 10.993  -6.527  7.712   1.00 0.00 ? 61  PRO A CG   5  
ATOM 7162  C CD   . PRO A 1 61  ? 10.265  -5.189  7.841   1.00 0.00 ? 61  PRO A CD   5  
ATOM 7163  H HA   . PRO A 1 61  ? 10.681  -5.319  4.665   1.00 0.00 ? 61  PRO A HA   5  
ATOM 7164  H HB2  . PRO A 1 61  ? 11.373  -7.676  5.926   1.00 0.00 ? 61  PRO A HB2  5  
ATOM 7165  H HB3  . PRO A 1 61  ? 12.320  -6.153  6.059   1.00 0.00 ? 61  PRO A HB3  5  
ATOM 7166  H HG2  . PRO A 1 61  ? 10.325  -7.346  7.964   1.00 0.00 ? 61  PRO A HG2  5  
ATOM 7167  H HG3  . PRO A 1 61  ? 11.871  -6.573  8.350   1.00 0.00 ? 61  PRO A HG3  5  
ATOM 7168  H HD2  . PRO A 1 61  ? 9.448   -5.278  8.555   1.00 0.00 ? 61  PRO A HD2  5  
ATOM 7169  H HD3  . PRO A 1 61  ? 10.950  -4.410  8.167   1.00 0.00 ? 61  PRO A HD3  5  
ATOM 7170  N N    . TRP A 1 62  ? 9.163   -7.255  3.874   1.00 0.00 ? 62  TRP A N    5  
ATOM 7171  C CA   . TRP A 1 62  ? 8.088   -8.041  3.276   1.00 0.00 ? 62  TRP A CA   5  
ATOM 7172  C C    . TRP A 1 62  ? 7.631   -9.167  4.199   1.00 0.00 ? 62  TRP A C    5  
ATOM 7173  O O    . TRP A 1 62  ? 6.438   -9.347  4.451   1.00 0.00 ? 62  TRP A O    5  
ATOM 7174  C CB   . TRP A 1 62  ? 8.553   -8.637  1.944   1.00 0.00 ? 62  TRP A CB   5  
ATOM 7175  C CG   . TRP A 1 62  ? 7.441   -9.233  1.153   1.00 0.00 ? 62  TRP A CG   5  
ATOM 7176  C CD1  . TRP A 1 62  ? 7.335   -10.537 0.822   1.00 0.00 ? 62  TRP A CD1  5  
ATOM 7177  C CD2  . TRP A 1 62  ? 6.247   -8.586  0.624   1.00 0.00 ? 62  TRP A CD2  5  
ATOM 7178  N NE1  . TRP A 1 62  ? 6.205   -10.732 0.061   1.00 0.00 ? 62  TRP A NE1  5  
ATOM 7179  C CE2  . TRP A 1 62  ? 5.485   -9.570  -0.062  1.00 0.00 ? 62  TRP A CE2  5  
ATOM 7180  C CE3  . TRP A 1 62  ? 5.718   -7.276  0.658   1.00 0.00 ? 62  TRP A CE3  5  
ATOM 7181  C CZ2  . TRP A 1 62  ? 4.272   -9.270  -0.677  1.00 0.00 ? 62  TRP A CZ2  5  
ATOM 7182  C CZ3  . TRP A 1 62  ? 4.485   -6.963  0.058   1.00 0.00 ? 62  TRP A CZ3  5  
ATOM 7183  C CH2  . TRP A 1 62  ? 3.759   -7.968  -0.592  1.00 0.00 ? 62  TRP A CH2  5  
ATOM 7184  H H    . TRP A 1 62  ? 9.993   -7.125  3.309   1.00 0.00 ? 62  TRP A H    5  
ATOM 7185  H HA   . TRP A 1 62  ? 7.240   -7.380  3.098   1.00 0.00 ? 62  TRP A HA   5  
ATOM 7186  H HB2  . TRP A 1 62  ? 9.023   -7.878  1.327   1.00 0.00 ? 62  TRP A HB2  5  
ATOM 7187  H HB3  . TRP A 1 62  ? 9.305   -9.406  2.125   1.00 0.00 ? 62  TRP A HB3  5  
ATOM 7188  H HD1  . TRP A 1 62  ? 8.047   -11.309 1.068   1.00 0.00 ? 62  TRP A HD1  5  
ATOM 7189  H HE1  . TRP A 1 62  ? 5.997   -11.602 -0.435  1.00 0.00 ? 62  TRP A HE1  5  
ATOM 7190  H HE3  . TRP A 1 62  ? 6.281   -6.500  1.142   1.00 0.00 ? 62  TRP A HE3  5  
ATOM 7191  H HZ2  . TRP A 1 62  ? 3.732   -10.061 -1.167  1.00 0.00 ? 62  TRP A HZ2  5  
ATOM 7192  H HZ3  . TRP A 1 62  ? 4.074   -5.964  0.096   1.00 0.00 ? 62  TRP A HZ3  5  
ATOM 7193  H HH2  . TRP A 1 62  ? 2.798   -7.742  -1.025  1.00 0.00 ? 62  TRP A HH2  5  
ATOM 7194  N N    . SER A 1 63  ? 8.588   -9.900  4.759   1.00 0.00 ? 63  SER A N    5  
ATOM 7195  C CA   . SER A 1 63  ? 8.340   -11.050 5.612   1.00 0.00 ? 63  SER A CA   5  
ATOM 7196  C C    . SER A 1 63  ? 7.640   -10.681 6.921   1.00 0.00 ? 63  SER A C    5  
ATOM 7197  O O    . SER A 1 63  ? 6.928   -11.511 7.489   1.00 0.00 ? 63  SER A O    5  
ATOM 7198  C CB   . SER A 1 63  ? 9.680   -11.703 5.908   1.00 0.00 ? 63  SER A CB   5  
ATOM 7199  O OG   . SER A 1 63  ? 10.281  -12.066 4.682   1.00 0.00 ? 63  SER A OG   5  
ATOM 7200  H H    . SER A 1 63  ? 9.554   -9.710  4.497   1.00 0.00 ? 63  SER A H    5  
ATOM 7201  H HA   . SER A 1 63  ? 7.719   -11.767 5.073   1.00 0.00 ? 63  SER A HA   5  
ATOM 7202  H HB2  . SER A 1 63  ? 10.317  -10.994 6.437   1.00 0.00 ? 63  SER A HB2  5  
ATOM 7203  H HB3  . SER A 1 63  ? 9.519   -12.581 6.531   1.00 0.00 ? 63  SER A HB3  5  
ATOM 7204  H HG   . SER A 1 63  ? 10.807  -11.301 4.376   1.00 0.00 ? 63  SER A HG   5  
ATOM 7205  N N    . LYS A 1 64  ? 7.801   -9.450  7.413   1.00 0.00 ? 64  LYS A N    5  
ATOM 7206  C CA   . LYS A 1 64  ? 7.064   -9.011  8.593   1.00 0.00 ? 64  LYS A CA   5  
ATOM 7207  C C    . LYS A 1 64  ? 5.609   -8.723  8.266   1.00 0.00 ? 64  LYS A C    5  
ATOM 7208  O O    . LYS A 1 64  ? 4.764   -8.946  9.134   1.00 0.00 ? 64  LYS A O    5  
ATOM 7209  C CB   . LYS A 1 64  ? 7.719   -7.792  9.256   1.00 0.00 ? 64  LYS A CB   5  
ATOM 7210  C CG   . LYS A 1 64  ? 8.858   -8.208  10.197  1.00 0.00 ? 64  LYS A CG   5  
ATOM 7211  C CD   . LYS A 1 64  ? 8.295   -8.767  11.514  1.00 0.00 ? 64  LYS A CD   5  
ATOM 7212  C CE   . LYS A 1 64  ? 9.290   -9.661  12.263  1.00 0.00 ? 64  LYS A CE   5  
ATOM 7213  N NZ   . LYS A 1 64  ? 8.594   -10.411 13.331  1.00 0.00 ? 64  LYS A NZ   5  
ATOM 7214  H H    . LYS A 1 64  ? 8.339   -8.790  6.867   1.00 0.00 ? 64  LYS A H    5  
ATOM 7215  H HA   . LYS A 1 64  ? 7.069   -9.841  9.292   1.00 0.00 ? 64  LYS A HA   5  
ATOM 7216  H HB2  . LYS A 1 64  ? 8.090   -7.122  8.485   1.00 0.00 ? 64  LYS A HB2  5  
ATOM 7217  H HB3  . LYS A 1 64  ? 6.971   -7.256  9.840   1.00 0.00 ? 64  LYS A HB3  5  
ATOM 7218  H HG2  . LYS A 1 64  ? 9.474   -8.950  9.693   1.00 0.00 ? 64  LYS A HG2  5  
ATOM 7219  H HG3  . LYS A 1 64  ? 9.486   -7.344  10.419  1.00 0.00 ? 64  LYS A HG3  5  
ATOM 7220  H HD2  . LYS A 1 64  ? 8.015   -7.921  12.143  1.00 0.00 ? 64  LYS A HD2  5  
ATOM 7221  H HD3  . LYS A 1 64  ? 7.397   -9.357  11.320  1.00 0.00 ? 64  LYS A HD3  5  
ATOM 7222  H HE2  . LYS A 1 64  ? 9.734   -10.371 11.559  1.00 0.00 ? 64  LYS A HE2  5  
ATOM 7223  H HE3  . LYS A 1 64  ? 10.083  -9.048  12.695  1.00 0.00 ? 64  LYS A HE3  5  
ATOM 7224  H HZ1  . LYS A 1 64  ? 8.041   -11.168 12.935  1.00 0.00 ? 64  LYS A HZ1  5  
ATOM 7225  H HZ2  . LYS A 1 64  ? 9.217   -10.859 13.991  1.00 0.00 ? 64  LYS A HZ2  5  
ATOM 7226  H HZ3  . LYS A 1 64  ? 7.967   -9.816  13.870  1.00 0.00 ? 64  LYS A HZ3  5  
ATOM 7227  N N    . LEU A 1 65  ? 5.297   -8.285  7.049   1.00 0.00 ? 65  LEU A N    5  
ATOM 7228  C CA   . LEU A 1 65  ? 3.923   -8.030  6.656   1.00 0.00 ? 65  LEU A CA   5  
ATOM 7229  C C    . LEU A 1 65  ? 3.241   -9.379  6.433   1.00 0.00 ? 65  LEU A C    5  
ATOM 7230  O O    . LEU A 1 65  ? 3.862   -10.348 5.981   1.00 0.00 ? 65  LEU A O    5  
ATOM 7231  C CB   . LEU A 1 65  ? 3.866   -7.195  5.365   1.00 0.00 ? 65  LEU A CB   5  
ATOM 7232  C CG   . LEU A 1 65  ? 4.522   -5.804  5.445   1.00 0.00 ? 65  LEU A CG   5  
ATOM 7233  C CD1  . LEU A 1 65  ? 4.690   -5.249  4.029   1.00 0.00 ? 65  LEU A CD1  5  
ATOM 7234  C CD2  . LEU A 1 65  ? 3.679   -4.843  6.292   1.00 0.00 ? 65  LEU A CD2  5  
ATOM 7235  H H    . LEU A 1 65  ? 6.016   -8.223  6.340   1.00 0.00 ? 65  LEU A H    5  
ATOM 7236  H HA   . LEU A 1 65  ? 3.417   -7.495  7.460   1.00 0.00 ? 65  LEU A HA   5  
ATOM 7237  H HB2  . LEU A 1 65  ? 4.346   -7.767  4.570   1.00 0.00 ? 65  LEU A HB2  5  
ATOM 7238  H HB3  . LEU A 1 65  ? 2.817   -7.055  5.098   1.00 0.00 ? 65  LEU A HB3  5  
ATOM 7239  H HG   . LEU A 1 65  ? 5.511   -5.883  5.892   1.00 0.00 ? 65  LEU A HG   5  
ATOM 7240  H HD11 . LEU A 1 65  ? 3.719   -5.190  3.538   1.00 0.00 ? 65  LEU A HD11 5  
ATOM 7241  H HD12 . LEU A 1 65  ? 5.143   -4.256  4.068   1.00 0.00 ? 65  LEU A HD12 5  
ATOM 7242  H HD13 . LEU A 1 65  ? 5.343   -5.903  3.450   1.00 0.00 ? 65  LEU A HD13 5  
ATOM 7243  H HD21 . LEU A 1 65  ? 4.131   -3.852  6.291   1.00 0.00 ? 65  LEU A HD21 5  
ATOM 7244  H HD22 . LEU A 1 65  ? 2.674   -4.763  5.876   1.00 0.00 ? 65  LEU A HD22 5  
ATOM 7245  H HD23 . LEU A 1 65  ? 3.617   -5.193  7.322   1.00 0.00 ? 65  LEU A HD23 5  
ATOM 7246  N N    . THR A 1 66  ? 1.952   -9.446  6.742   1.00 0.00 ? 66  THR A N    5  
ATOM 7247  C CA   . THR A 1 66  ? 1.104   -10.599 6.451   1.00 0.00 ? 66  THR A CA   5  
ATOM 7248  C C    . THR A 1 66  ? 0.332   -10.327 5.167   1.00 0.00 ? 66  THR A C    5  
ATOM 7249  O O    . THR A 1 66  ? 0.361   -9.191  4.711   1.00 0.00 ? 66  THR A O    5  
ATOM 7250  C CB   . THR A 1 66  ? 0.159   -10.817 7.631   1.00 0.00 ? 66  THR A CB   5  
ATOM 7251  O OG1  . THR A 1 66  ? -0.600  -9.655  7.903   1.00 0.00 ? 66  THR A OG1  5  
ATOM 7252  C CG2  . THR A 1 66  ? 0.937   -11.212 8.888   1.00 0.00 ? 66  THR A CG2  5  
ATOM 7253  H H    . THR A 1 66  ? 1.452   -8.633  7.080   1.00 0.00 ? 66  THR A H    5  
ATOM 7254  H HA   . THR A 1 66  ? 1.698   -11.494 6.295   1.00 0.00 ? 66  THR A HA   5  
ATOM 7255  H HB   . THR A 1 66  ? -0.525  -11.613 7.355   1.00 0.00 ? 66  THR A HB   5  
ATOM 7256  H HG1  . THR A 1 66  ? -1.372  -9.958  8.408   1.00 0.00 ? 66  THR A HG1  5  
ATOM 7257  H HG21 . THR A 1 66  ? 1.433   -12.162 8.697   1.00 0.00 ? 66  THR A HG21 5  
ATOM 7258  H HG22 . THR A 1 66  ? 1.681   -10.453 9.141   1.00 0.00 ? 66  THR A HG22 5  
ATOM 7259  H HG23 . THR A 1 66  ? 0.245   -11.328 9.716   1.00 0.00 ? 66  THR A HG23 5  
ATOM 7260  N N    . GLN A 1 67  ? -0.401  -11.287 4.594   1.00 0.00 ? 67  GLN A N    5  
ATOM 7261  C CA   . GLN A 1 67  ? -1.257  -10.994 3.440   1.00 0.00 ? 67  GLN A CA   5  
ATOM 7262  C C    . GLN A 1 67  ? -2.148  -9.775  3.707   1.00 0.00 ? 67  GLN A C    5  
ATOM 7263  O O    . GLN A 1 67  ? -2.135  -8.823  2.927   1.00 0.00 ? 67  GLN A O    5  
ATOM 7264  C CB   . GLN A 1 67  ? -2.087  -12.212 3.026   1.00 0.00 ? 67  GLN A CB   5  
ATOM 7265  C CG   . GLN A 1 67  ? -1.295  -13.165 2.120   1.00 0.00 ? 67  GLN A CG   5  
ATOM 7266  C CD   . GLN A 1 67  ? -2.225  -14.103 1.368   1.00 0.00 ? 67  GLN A CD   5  
ATOM 7267  O OE1  . GLN A 1 67  ? -2.208  -15.313 1.571   1.00 0.00 ? 67  GLN A OE1  5  
ATOM 7268  N NE2  . GLN A 1 67  ? -3.051  -13.571 0.483   1.00 0.00 ? 67  GLN A NE2  5  
ATOM 7269  H H    . GLN A 1 67  ? -0.393  -12.230 4.962   1.00 0.00 ? 67  GLN A H    5  
ATOM 7270  H HA   . GLN A 1 67  ? -0.618  -10.727 2.600   1.00 0.00 ? 67  GLN A HA   5  
ATOM 7271  H HB2  . GLN A 1 67  ? -2.463  -12.744 3.900   1.00 0.00 ? 67  GLN A HB2  5  
ATOM 7272  H HB3  . GLN A 1 67  ? -2.951  -11.858 2.468   1.00 0.00 ? 67  GLN A HB3  5  
ATOM 7273  H HG2  . GLN A 1 67  ? -0.726  -12.598 1.383   1.00 0.00 ? 67  GLN A HG2  5  
ATOM 7274  H HG3  . GLN A 1 67  ? -0.594  -13.747 2.717   1.00 0.00 ? 67  GLN A HG3  5  
ATOM 7275  H HE21 . GLN A 1 67  ? -3.000  -12.584 0.268   1.00 0.00 ? 67  GLN A HE21 5  
ATOM 7276  H HE22 . GLN A 1 67  ? -3.737  -14.125 -0.009  1.00 0.00 ? 67  GLN A HE22 5  
ATOM 7277  N N    . LYS A 1 68  ? -2.832  -9.738  4.853   1.00 0.00 ? 68  LYS A N    5  
ATOM 7278  C CA   . LYS A 1 68  ? -3.638  -8.592  5.268   1.00 0.00 ? 68  LYS A CA   5  
ATOM 7279  C C    . LYS A 1 68  ? -2.820  -7.299  5.309   1.00 0.00 ? 68  LYS A C    5  
ATOM 7280  O O    . LYS A 1 68  ? -3.290  -6.270  4.836   1.00 0.00 ? 68  LYS A O    5  
ATOM 7281  C CB   . LYS A 1 68  ? -4.284  -8.945  6.611   1.00 0.00 ? 68  LYS A CB   5  
ATOM 7282  C CG   . LYS A 1 68  ? -5.288  -7.909  7.124   1.00 0.00 ? 68  LYS A CG   5  
ATOM 7283  C CD   . LYS A 1 68  ? -6.090  -8.546  8.265   1.00 0.00 ? 68  LYS A CD   5  
ATOM 7284  C CE   . LYS A 1 68  ? -6.994  -7.528  8.959   1.00 0.00 ? 68  LYS A CE   5  
ATOM 7285  N NZ   . LYS A 1 68  ? -7.804  -8.177  10.008  1.00 0.00 ? 68  LYS A NZ   5  
ATOM 7286  H H    . LYS A 1 68  ? -2.850  -10.567 5.431   1.00 0.00 ? 68  LYS A H    5  
ATOM 7287  H HA   . LYS A 1 68  ? -4.428  -8.447  4.526   1.00 0.00 ? 68  LYS A HA   5  
ATOM 7288  H HB2  . LYS A 1 68  ? -4.817  -9.886  6.476   1.00 0.00 ? 68  LYS A HB2  5  
ATOM 7289  H HB3  . LYS A 1 68  ? -3.510  -9.095  7.365   1.00 0.00 ? 68  LYS A HB3  5  
ATOM 7290  H HG2  . LYS A 1 68  ? -4.753  -7.028  7.484   1.00 0.00 ? 68  LYS A HG2  5  
ATOM 7291  H HG3  . LYS A 1 68  ? -5.969  -7.624  6.320   1.00 0.00 ? 68  LYS A HG3  5  
ATOM 7292  H HD2  . LYS A 1 68  ? -6.706  -9.351  7.857   1.00 0.00 ? 68  LYS A HD2  5  
ATOM 7293  H HD3  . LYS A 1 68  ? -5.397  -8.963  8.997   1.00 0.00 ? 68  LYS A HD3  5  
ATOM 7294  H HE2  . LYS A 1 68  ? -6.370  -6.751  9.405   1.00 0.00 ? 68  LYS A HE2  5  
ATOM 7295  H HE3  . LYS A 1 68  ? -7.651  -7.071  8.217   1.00 0.00 ? 68  LYS A HE3  5  
ATOM 7296  H HZ1  . LYS A 1 68  ? -8.543  -8.756  9.615   1.00 0.00 ? 68  LYS A HZ1  5  
ATOM 7297  H HZ2  . LYS A 1 68  ? -7.238  -8.789  10.587  1.00 0.00 ? 68  LYS A HZ2  5  
ATOM 7298  H HZ3  . LYS A 1 68  ? -8.263  -7.510  10.620  1.00 0.00 ? 68  LYS A HZ3  5  
ATOM 7299  N N    . GLY A 1 69  ? -1.590  -7.331  5.830   1.00 0.00 ? 69  GLY A N    5  
ATOM 7300  C CA   . GLY A 1 69  ? -0.702  -6.169  5.836   1.00 0.00 ? 69  GLY A CA   5  
ATOM 7301  C C    . GLY A 1 69  ? -0.119  -5.813  4.468   1.00 0.00 ? 69  GLY A C    5  
ATOM 7302  O O    . GLY A 1 69  ? 0.339   -4.693  4.270   1.00 0.00 ? 69  GLY A O    5  
ATOM 7303  H H    . GLY A 1 69  ? -1.229  -8.215  6.165   1.00 0.00 ? 69  GLY A H    5  
ATOM 7304  H HA2  . GLY A 1 69  ? -1.239  -5.300  6.216   1.00 0.00 ? 69  GLY A HA2  5  
ATOM 7305  H HA3  . GLY A 1 69  ? 0.132   -6.375  6.500   1.00 0.00 ? 69  GLY A HA3  5  
ATOM 7306  N N    . ARG A 1 70  ? -0.090  -6.751  3.521   1.00 0.00 ? 70  ARG A N    5  
ATOM 7307  C CA   . ARG A 1 70  ? 0.484   -6.564  2.194   1.00 0.00 ? 70  ARG A CA   5  
ATOM 7308  C C    . ARG A 1 70  ? -0.523  -5.938  1.247   1.00 0.00 ? 70  ARG A C    5  
ATOM 7309  O O    . ARG A 1 70  ? -0.090  -5.292  0.303   1.00 0.00 ? 70  ARG A O    5  
ATOM 7310  C CB   . ARG A 1 70  ? 0.959   -7.913  1.637   1.00 0.00 ? 70  ARG A CB   5  
ATOM 7311  C CG   . ARG A 1 70  ? 2.212   -8.422  2.362   1.00 0.00 ? 70  ARG A CG   5  
ATOM 7312  C CD   . ARG A 1 70  ? 2.430   -9.914  2.118   1.00 0.00 ? 70  ARG A CD   5  
ATOM 7313  N NE   . ARG A 1 70  ? 3.580   -10.406 2.889   1.00 0.00 ? 70  ARG A NE   5  
ATOM 7314  C CZ   . ARG A 1 70  ? 4.278   -11.518 2.643   1.00 0.00 ? 70  ARG A CZ   5  
ATOM 7315  N NH1  . ARG A 1 70  ? 3.929   -12.368 1.686   1.00 0.00 ? 70  ARG A NH1  5  
ATOM 7316  N NH2  . ARG A 1 70  ? 5.345   -11.764 3.391   1.00 0.00 ? 70  ARG A NH2  5  
ATOM 7317  H H    . ARG A 1 70  ? -0.440  -7.677  3.744   1.00 0.00 ? 70  ARG A H    5  
ATOM 7318  H HA   . ARG A 1 70  ? 1.338   -5.890  2.258   1.00 0.00 ? 70  ARG A HA   5  
ATOM 7319  H HB2  . ARG A 1 70  ? 0.157   -8.641  1.725   1.00 0.00 ? 70  ARG A HB2  5  
ATOM 7320  H HB3  . ARG A 1 70  ? 1.182   -7.811  0.577   1.00 0.00 ? 70  ARG A HB3  5  
ATOM 7321  H HG2  . ARG A 1 70  ? 3.082   -7.859  2.040   1.00 0.00 ? 70  ARG A HG2  5  
ATOM 7322  H HG3  . ARG A 1 70  ? 2.118   -8.257  3.425   1.00 0.00 ? 70  ARG A HG3  5  
ATOM 7323  H HD2  . ARG A 1 70  ? 1.536   -10.456 2.422   1.00 0.00 ? 70  ARG A HD2  5  
ATOM 7324  H HD3  . ARG A 1 70  ? 2.587   -10.080 1.053   1.00 0.00 ? 70  ARG A HD3  5  
ATOM 7325  H HE   . ARG A 1 70  ? 3.894   -9.821  3.651   1.00 0.00 ? 70  ARG A HE   5  
ATOM 7326  H HH11 . ARG A 1 70  ? 3.119   -12.203 1.078   1.00 0.00 ? 70  ARG A HH11 5  
ATOM 7327  H HH12 . ARG A 1 70  ? 4.540   -13.144 1.423   1.00 0.00 ? 70  ARG A HH12 5  
ATOM 7328  H HH21 . ARG A 1 70  ? 5.680   -11.038 4.019   1.00 0.00 ? 70  ARG A HH21 5  
ATOM 7329  H HH22 . ARG A 1 70  ? 5.897   -12.603 3.237   1.00 0.00 ? 70  ARG A HH22 5  
ATOM 7330  N N    . GLU A 1 71  ? -1.828  -6.073  1.493   1.00 0.00 ? 71  GLU A N    5  
ATOM 7331  C CA   . GLU A 1 71  ? -2.875  -5.546  0.618   1.00 0.00 ? 71  GLU A CA   5  
ATOM 7332  C C    . GLU A 1 71  ? -2.648  -4.093  0.156   1.00 0.00 ? 71  GLU A C    5  
ATOM 7333  O O    . GLU A 1 71  ? -2.752  -3.869  -1.053  1.00 0.00 ? 71  GLU A O    5  
ATOM 7334  C CB   . GLU A 1 71  ? -4.266  -5.737  1.241   1.00 0.00 ? 71  GLU A CB   5  
ATOM 7335  C CG   . GLU A 1 71  ? -4.737  -7.192  1.118   1.00 0.00 ? 71  GLU A CG   5  
ATOM 7336  C CD   . GLU A 1 71  ? -6.243  -7.339  1.324   1.00 0.00 ? 71  GLU A CD   5  
ATOM 7337  O OE1  . GLU A 1 71  ? -7.008  -6.843  0.464   1.00 0.00 ? 71  GLU A OE1  5  
ATOM 7338  O OE2  . GLU A 1 71  ? -6.654  -8.022  2.293   1.00 0.00 ? 71  GLU A OE2  5  
ATOM 7339  H H    . GLU A 1 71  ? -2.112  -6.627  2.290   1.00 0.00 ? 71  GLU A H    5  
ATOM 7340  H HA   . GLU A 1 71  ? -2.853  -6.149  -0.290  1.00 0.00 ? 71  GLU A HA   5  
ATOM 7341  H HB2  . GLU A 1 71  ? -4.264  -5.434  2.286   1.00 0.00 ? 71  GLU A HB2  5  
ATOM 7342  H HB3  . GLU A 1 71  ? -4.972  -5.102  0.712   1.00 0.00 ? 71  GLU A HB3  5  
ATOM 7343  H HG2  . GLU A 1 71  ? -4.490  -7.573  0.124   1.00 0.00 ? 71  GLU A HG2  5  
ATOM 7344  H HG3  . GLU A 1 71  ? -4.216  -7.794  1.857   1.00 0.00 ? 71  GLU A HG3  5  
ATOM 7345  N N    . PRO A 1 72  ? -2.328  -3.109  1.023   1.00 0.00 ? 72  PRO A N    5  
ATOM 7346  C CA   . PRO A 1 72  ? -2.046  -1.756  0.555   1.00 0.00 ? 72  PRO A CA   5  
ATOM 7347  C C    . PRO A 1 72  ? -0.746  -1.712  -0.262  1.00 0.00 ? 72  PRO A C    5  
ATOM 7348  O O    . PRO A 1 72  ? -0.715  -1.119  -1.340  1.00 0.00 ? 72  PRO A O    5  
ATOM 7349  C CB   . PRO A 1 72  ? -2.000  -0.883  1.812   1.00 0.00 ? 72  PRO A CB   5  
ATOM 7350  C CG   . PRO A 1 72  ? -1.669  -1.861  2.942   1.00 0.00 ? 72  PRO A CG   5  
ATOM 7351  C CD   . PRO A 1 72  ? -2.302  -3.173  2.481   1.00 0.00 ? 72  PRO A CD   5  
ATOM 7352  H HA   . PRO A 1 72  ? -2.864  -1.415  -0.084  1.00 0.00 ? 72  PRO A HA   5  
ATOM 7353  H HB2  . PRO A 1 72  ? -1.249  -0.096  1.725   1.00 0.00 ? 72  PRO A HB2  5  
ATOM 7354  H HB3  . PRO A 1 72  ? -2.990  -0.453  1.985   1.00 0.00 ? 72  PRO A HB3  5  
ATOM 7355  H HG2  . PRO A 1 72  ? -0.586  -1.991  3.019   1.00 0.00 ? 72  PRO A HG2  5  
ATOM 7356  H HG3  . PRO A 1 72  ? -2.092  -1.531  3.893   1.00 0.00 ? 72  PRO A HG3  5  
ATOM 7357  H HD2  . PRO A 1 72  ? -1.703  -4.004  2.849   1.00 0.00 ? 72  PRO A HD2  5  
ATOM 7358  H HD3  . PRO A 1 72  ? -3.324  -3.260  2.856   1.00 0.00 ? 72  PRO A HD3  5  
ATOM 7359  N N    . PHE A 1 73  ? 0.319   -2.378  0.193   1.00 0.00 ? 73  PHE A N    5  
ATOM 7360  C CA   . PHE A 1 73  ? 1.585   -2.435  -0.529  1.00 0.00 ? 73  PHE A CA   5  
ATOM 7361  C C    . PHE A 1 73  ? 1.425   -3.061  -1.916  1.00 0.00 ? 73  PHE A C    5  
ATOM 7362  O O    . PHE A 1 73  ? 2.157   -2.682  -2.820  1.00 0.00 ? 73  PHE A O    5  
ATOM 7363  C CB   . PHE A 1 73  ? 2.636   -3.205  0.284   1.00 0.00 ? 73  PHE A CB   5  
ATOM 7364  C CG   . PHE A 1 73  ? 3.190   -2.439  1.471   1.00 0.00 ? 73  PHE A CG   5  
ATOM 7365  C CD1  . PHE A 1 73  ? 4.170   -1.454  1.260   1.00 0.00 ? 73  PHE A CD1  5  
ATOM 7366  C CD2  . PHE A 1 73  ? 2.755   -2.708  2.782   1.00 0.00 ? 73  PHE A CD2  5  
ATOM 7367  C CE1  . PHE A 1 73  ? 4.729   -0.758  2.346   1.00 0.00 ? 73  PHE A CE1  5  
ATOM 7368  C CE2  . PHE A 1 73  ? 3.326   -2.023  3.873   1.00 0.00 ? 73  PHE A CE2  5  
ATOM 7369  C CZ   . PHE A 1 73  ? 4.331   -1.060  3.656   1.00 0.00 ? 73  PHE A CZ   5  
ATOM 7370  H H    . PHE A 1 73  ? 0.223   -2.930  1.030   1.00 0.00 ? 73  PHE A H    5  
ATOM 7371  H HA   . PHE A 1 73  ? 1.943   -1.415  -0.675  1.00 0.00 ? 73  PHE A HA   5  
ATOM 7372  H HB2  . PHE A 1 73  ? 2.223   -4.159  0.614   1.00 0.00 ? 73  PHE A HB2  5  
ATOM 7373  H HB3  . PHE A 1 73  ? 3.475   -3.440  -0.373  1.00 0.00 ? 73  PHE A HB3  5  
ATOM 7374  H HD1  . PHE A 1 73  ? 4.523   -1.248  0.258   1.00 0.00 ? 73  PHE A HD1  5  
ATOM 7375  H HD2  . PHE A 1 73  ? 1.988   -3.449  2.954   1.00 0.00 ? 73  PHE A HD2  5  
ATOM 7376  H HE1  . PHE A 1 73  ? 5.497   -0.016  2.174   1.00 0.00 ? 73  PHE A HE1  5  
ATOM 7377  H HE2  . PHE A 1 73  ? 2.988   -2.246  4.876   1.00 0.00 ? 73  PHE A HE2  5  
ATOM 7378  H HZ   . PHE A 1 73  ? 4.796   -0.529  4.476   1.00 0.00 ? 73  PHE A HZ   5  
ATOM 7379  N N    . ILE A 1 74  ? 0.511   -4.011  -2.105  1.00 0.00 ? 74  ILE A N    5  
ATOM 7380  C CA   . ILE A 1 74  ? 0.193   -4.626  -3.391  1.00 0.00 ? 74  ILE A CA   5  
ATOM 7381  C C    . ILE A 1 74  ? -0.358  -3.562  -4.337  1.00 0.00 ? 74  ILE A C    5  
ATOM 7382  O O    . ILE A 1 74  ? 0.077   -3.469  -5.483  1.00 0.00 ? 74  ILE A O    5  
ATOM 7383  C CB   . ILE A 1 74  ? -0.778  -5.805  -3.140  1.00 0.00 ? 74  ILE A CB   5  
ATOM 7384  C CG1  . ILE A 1 74  ? 0.049   -7.033  -2.705  1.00 0.00 ? 74  ILE A CG1  5  
ATOM 7385  C CG2  . ILE A 1 74  ? -1.678  -6.153  -4.338  1.00 0.00 ? 74  ILE A CG2  5  
ATOM 7386  C CD1  . ILE A 1 74  ? -0.753  -7.992  -1.828  1.00 0.00 ? 74  ILE A CD1  5  
ATOM 7387  H H    . ILE A 1 74  ? -0.007  -4.337  -1.295  1.00 0.00 ? 74  ILE A H    5  
ATOM 7388  H HA   . ILE A 1 74  ? 1.111   -5.009  -3.848  1.00 0.00 ? 74  ILE A HA   5  
ATOM 7389  H HB   . ILE A 1 74  ? -1.443  -5.537  -2.321  1.00 0.00 ? 74  ILE A HB   5  
ATOM 7390  H HG12 . ILE A 1 74  ? 0.413   -7.567  -3.585  1.00 0.00 ? 74  ILE A HG12 5  
ATOM 7391  H HG13 . ILE A 1 74  ? 0.911   -6.709  -2.121  1.00 0.00 ? 74  ILE A HG13 5  
ATOM 7392  H HG21 . ILE A 1 74  ? -2.363  -5.325  -4.539  1.00 0.00 ? 74  ILE A HG21 5  
ATOM 7393  H HG22 . ILE A 1 74  ? -1.073  -6.346  -5.227  1.00 0.00 ? 74  ILE A HG22 5  
ATOM 7394  H HG23 . ILE A 1 74  ? -2.286  -7.028  -4.109  1.00 0.00 ? 74  ILE A HG23 5  
ATOM 7395  H HD11 . ILE A 1 74  ? -0.117  -8.821  -1.523  1.00 0.00 ? 74  ILE A HD11 5  
ATOM 7396  H HD12 . ILE A 1 74  ? -1.081  -7.472  -0.933  1.00 0.00 ? 74  ILE A HD12 5  
ATOM 7397  H HD13 . ILE A 1 74  ? -1.620  -8.367  -2.369  1.00 0.00 ? 74  ILE A HD13 5  
ATOM 7398  N N    . ARG A 1 75  ? -1.294  -2.727  -3.879  1.00 0.00 ? 75  ARG A N    5  
ATOM 7399  C CA   . ARG A 1 75  ? -1.787  -1.639  -4.688  1.00 0.00 ? 75  ARG A CA   5  
ATOM 7400  C C    . ARG A 1 75  ? -0.644  -0.676  -4.999  1.00 0.00 ? 75  ARG A C    5  
ATOM 7401  O O    . ARG A 1 75  ? -0.543  -0.230  -6.135  1.00 0.00 ? 75  ARG A O    5  
ATOM 7402  C CB   . ARG A 1 75  ? -2.920  -0.946  -3.944  1.00 0.00 ? 75  ARG A CB   5  
ATOM 7403  C CG   . ARG A 1 75  ? -4.140  -1.836  -3.657  1.00 0.00 ? 75  ARG A CG   5  
ATOM 7404  C CD   . ARG A 1 75  ? -5.250  -0.976  -3.032  1.00 0.00 ? 75  ARG A CD   5  
ATOM 7405  N NE   . ARG A 1 75  ? -6.303  -1.751  -2.362  1.00 0.00 ? 75  ARG A NE   5  
ATOM 7406  C CZ   . ARG A 1 75  ? -7.487  -1.238  -1.993  1.00 0.00 ? 75  ARG A CZ   5  
ATOM 7407  N NH1  . ARG A 1 75  ? -7.749  0.060   -2.135  1.00 0.00 ? 75  ARG A NH1  5  
ATOM 7408  N NH2  . ARG A 1 75  ? -8.421  -2.019  -1.468  1.00 0.00 ? 75  ARG A NH2  5  
ATOM 7409  H H    . ARG A 1 75  ? -1.686  -2.780  -2.952  1.00 0.00 ? 75  ARG A H    5  
ATOM 7410  H HA   . ARG A 1 75  ? -2.169  -2.029  -5.638  1.00 0.00 ? 75  ARG A HA   5  
ATOM 7411  H HB2  . ARG A 1 75  ? -2.550  -0.522  -3.013  1.00 0.00 ? 75  ARG A HB2  5  
ATOM 7412  H HB3  . ARG A 1 75  ? -3.221  -0.137  -4.576  1.00 0.00 ? 75  ARG A HB3  5  
ATOM 7413  H HG2  . ARG A 1 75  ? -4.509  -2.276  -4.585  1.00 0.00 ? 75  ARG A HG2  5  
ATOM 7414  H HG3  . ARG A 1 75  ? -3.839  -2.635  -2.983  1.00 0.00 ? 75  ARG A HG3  5  
ATOM 7415  H HD2  . ARG A 1 75  ? -4.820  -0.283  -2.309  1.00 0.00 ? 75  ARG A HD2  5  
ATOM 7416  H HD3  . ARG A 1 75  ? -5.716  -0.407  -3.834  1.00 0.00 ? 75  ARG A HD3  5  
ATOM 7417  H HE   . ARG A 1 75  ? -6.101  -2.738  -2.211  1.00 0.00 ? 75  ARG A HE   5  
ATOM 7418  H HH11 . ARG A 1 75  ? -7.076  0.682   -2.557  1.00 0.00 ? 75  ARG A HH11 5  
ATOM 7419  H HH12 . ARG A 1 75  ? -8.662  0.433   -1.910  1.00 0.00 ? 75  ARG A HH12 5  
ATOM 7420  H HH21 . ARG A 1 75  ? -8.217  -2.979  -1.188  1.00 0.00 ? 75  ARG A HH21 5  
ATOM 7421  H HH22 . ARG A 1 75  ? -9.364  -1.662  -1.318  1.00 0.00 ? 75  ARG A HH22 5  
ATOM 7422  N N    . MET A 1 76  ? 0.254   -0.399  -4.042  1.00 0.00 ? 76  MET A N    5  
ATOM 7423  C CA   . MET A 1 76  ? 1.457   0.394   -4.274  1.00 0.00 ? 76  MET A CA   5  
ATOM 7424  C C    . MET A 1 76  ? 2.286   -0.171  -5.441  1.00 0.00 ? 76  MET A C    5  
ATOM 7425  O O    . MET A 1 76  ? 2.796   0.603   -6.250  1.00 0.00 ? 76  MET A O    5  
ATOM 7426  C CB   . MET A 1 76  ? 2.280   0.428   -2.970  1.00 0.00 ? 76  MET A CB   5  
ATOM 7427  C CG   . MET A 1 76  ? 2.826   1.809   -2.646  1.00 0.00 ? 76  MET A CG   5  
ATOM 7428  S SD   . MET A 1 76  ? 4.143   1.828   -1.393  1.00 0.00 ? 76  MET A SD   5  
ATOM 7429  C CE   . MET A 1 76  ? 3.132   1.717   0.098   1.00 0.00 ? 76  MET A CE   5  
ATOM 7430  H H    . MET A 1 76  ? 0.097   -0.717  -3.089  1.00 0.00 ? 76  MET A H    5  
ATOM 7431  H HA   . MET A 1 76  ? 1.145   1.408   -4.538  1.00 0.00 ? 76  MET A HA   5  
ATOM 7432  H HB2  . MET A 1 76  ? 1.659   0.138   -2.131  1.00 0.00 ? 76  MET A HB2  5  
ATOM 7433  H HB3  . MET A 1 76  ? 3.111   -0.273  -3.037  1.00 0.00 ? 76  MET A HB3  5  
ATOM 7434  H HG2  . MET A 1 76  ? 3.207   2.221   -3.570  1.00 0.00 ? 76  MET A HG2  5  
ATOM 7435  H HG3  . MET A 1 76  ? 2.006   2.433   -2.298  1.00 0.00 ? 76  MET A HG3  5  
ATOM 7436  H HE1  . MET A 1 76  ? 3.785   1.591   0.960   1.00 0.00 ? 76  MET A HE1  5  
ATOM 7437  H HE2  . MET A 1 76  ? 2.586   2.645   0.236   1.00 0.00 ? 76  MET A HE2  5  
ATOM 7438  H HE3  . MET A 1 76  ? 2.427   0.885   0.003   1.00 0.00 ? 76  MET A HE3  5  
ATOM 7439  N N    . GLN A 1 77  ? 2.437   -1.500  -5.511  1.00 0.00 ? 77  GLN A N    5  
ATOM 7440  C CA   . GLN A 1 77  ? 3.220   -2.197  -6.533  1.00 0.00 ? 77  GLN A CA   5  
ATOM 7441  C C    . GLN A 1 77  ? 2.559   -2.102  -7.893  1.00 0.00 ? 77  GLN A C    5  
ATOM 7442  O O    . GLN A 1 77  ? 3.250   -1.875  -8.884  1.00 0.00 ? 77  GLN A O    5  
ATOM 7443  C CB   . GLN A 1 77  ? 3.350   -3.684  -6.191  1.00 0.00 ? 77  GLN A CB   5  
ATOM 7444  C CG   . GLN A 1 77  ? 4.292   -3.918  -5.019  1.00 0.00 ? 77  GLN A CG   5  
ATOM 7445  C CD   . GLN A 1 77  ? 4.007   -5.236  -4.306  1.00 0.00 ? 77  GLN A CD   5  
ATOM 7446  O OE1  . GLN A 1 77  ? 4.087   -6.317  -4.872  1.00 0.00 ? 77  GLN A OE1  5  
ATOM 7447  N NE2  . GLN A 1 77  ? 3.677   -5.185  -3.024  1.00 0.00 ? 77  GLN A NE2  5  
ATOM 7448  H H    . GLN A 1 77  ? 1.993   -2.072  -4.799  1.00 0.00 ? 77  GLN A H    5  
ATOM 7449  H HA   . GLN A 1 77  ? 4.219   -1.761  -6.608  1.00 0.00 ? 77  GLN A HA   5  
ATOM 7450  H HB2  . GLN A 1 77  ? 2.377   -4.110  -5.974  1.00 0.00 ? 77  GLN A HB2  5  
ATOM 7451  H HB3  . GLN A 1 77  ? 3.732   -4.206  -7.062  1.00 0.00 ? 77  GLN A HB3  5  
ATOM 7452  H HG2  . GLN A 1 77  ? 5.315   -3.917  -5.392  1.00 0.00 ? 77  GLN A HG2  5  
ATOM 7453  H HG3  . GLN A 1 77  ? 4.163   -3.103  -4.313  1.00 0.00 ? 77  GLN A HG3  5  
ATOM 7454  H HE21 . GLN A 1 77  ? 3.523   -4.274  -2.616  1.00 0.00 ? 77  GLN A HE21 5  
ATOM 7455  H HE22 . GLN A 1 77  ? 3.495   -6.055  -2.541  1.00 0.00 ? 77  GLN A HE22 5  
ATOM 7456  N N    . LEU A 1 78  ? 1.247   -2.323  -7.951  1.00 0.00 ? 78  LEU A N    5  
ATOM 7457  C CA   . LEU A 1 78  ? 0.514   -2.269  -9.203  1.00 0.00 ? 78  LEU A CA   5  
ATOM 7458  C C    . LEU A 1 78  ? 0.540   -0.848  -9.717  1.00 0.00 ? 78  LEU A C    5  
ATOM 7459  O O    . LEU A 1 78  ? 0.924   -0.644  -10.863 1.00 0.00 ? 78  LEU A O    5  
ATOM 7460  C CB   . LEU A 1 78  ? -0.910  -2.818  -9.007  1.00 0.00 ? 78  LEU A CB   5  
ATOM 7461  C CG   . LEU A 1 78  ? -0.892  -4.360  -8.972  1.00 0.00 ? 78  LEU A CG   5  
ATOM 7462  C CD1  . LEU A 1 78  ? -2.034  -4.958  -8.152  1.00 0.00 ? 78  LEU A CD1  5  
ATOM 7463  C CD2  . LEU A 1 78  ? -0.914  -4.962  -10.382 1.00 0.00 ? 78  LEU A CD2  5  
ATOM 7464  H H    . LEU A 1 78  ? 0.743   -2.564  -7.101  1.00 0.00 ? 78  LEU A H    5  
ATOM 7465  H HA   . LEU A 1 78  ? 1.049   -2.855  -9.952  1.00 0.00 ? 78  LEU A HA   5  
ATOM 7466  H HB2  . LEU A 1 78  ? -1.315  -2.425  -8.074  1.00 0.00 ? 78  LEU A HB2  5  
ATOM 7467  H HB3  . LEU A 1 78  ? -1.557  -2.476  -9.814  1.00 0.00 ? 78  LEU A HB3  5  
ATOM 7468  H HG   . LEU A 1 78  ? 0.028   -4.665  -8.481  1.00 0.00 ? 78  LEU A HG   5  
ATOM 7469  H HD11 . LEU A 1 78  ? -2.982  -4.775  -8.648  1.00 0.00 ? 78  LEU A HD11 5  
ATOM 7470  H HD12 . LEU A 1 78  ? -1.900  -6.034  -8.050  1.00 0.00 ? 78  LEU A HD12 5  
ATOM 7471  H HD13 . LEU A 1 78  ? -2.055  -4.513  -7.158  1.00 0.00 ? 78  LEU A HD13 5  
ATOM 7472  H HD21 . LEU A 1 78  ? -0.903  -6.051  -10.326 1.00 0.00 ? 78  LEU A HD21 5  
ATOM 7473  H HD22 . LEU A 1 78  ? -1.818  -4.649  -10.907 1.00 0.00 ? 78  LEU A HD22 5  
ATOM 7474  H HD23 . LEU A 1 78  ? -0.046  -4.624  -10.945 1.00 0.00 ? 78  LEU A HD23 5  
ATOM 7475  N N    . TRP A 1 79  ? 0.247   0.133   -8.861  1.00 0.00 ? 79  TRP A N    5  
ATOM 7476  C CA   . TRP A 1 79  ? 0.194   1.541   -9.223  1.00 0.00 ? 79  TRP A CA   5  
ATOM 7477  C C    . TRP A 1 79  ? 1.435   2.026   -9.969  1.00 0.00 ? 79  TRP A C    5  
ATOM 7478  O O    . TRP A 1 79  ? 1.307   2.854   -10.870 1.00 0.00 ? 79  TRP A O    5  
ATOM 7479  C CB   . TRP A 1 79  ? -0.018  2.381   -7.956  1.00 0.00 ? 79  TRP A CB   5  
ATOM 7480  C CG   . TRP A 1 79  ? -0.049  3.851   -8.208  1.00 0.00 ? 79  TRP A CG   5  
ATOM 7481  C CD1  . TRP A 1 79  ? -1.098  4.591   -8.639  1.00 0.00 ? 79  TRP A CD1  5  
ATOM 7482  C CD2  . TRP A 1 79  ? 1.088   4.751   -8.143  1.00 0.00 ? 79  TRP A CD2  5  
ATOM 7483  N NE1  . TRP A 1 79  ? -0.675  5.888   -8.857  1.00 0.00 ? 79  TRP A NE1  5  
ATOM 7484  C CE2  . TRP A 1 79  ? 0.656   6.046   -8.545  1.00 0.00 ? 79  TRP A CE2  5  
ATOM 7485  C CE3  . TRP A 1 79  ? 2.449   4.580   -7.812  1.00 0.00 ? 79  TRP A CE3  5  
ATOM 7486  C CZ2  . TRP A 1 79  ? 1.527   7.136   -8.598  1.00 0.00 ? 79  TRP A CZ2  5  
ATOM 7487  C CZ3  . TRP A 1 79  ? 3.330   5.671   -7.852  1.00 0.00 ? 79  TRP A CZ3  5  
ATOM 7488  C CH2  . TRP A 1 79  ? 2.867   6.938   -8.243  1.00 0.00 ? 79  TRP A CH2  5  
ATOM 7489  H H    . TRP A 1 79  ? -0.029  -0.118  -7.915  1.00 0.00 ? 79  TRP A H    5  
ATOM 7490  H HA   . TRP A 1 79  ? -0.644  1.672   -9.901  1.00 0.00 ? 79  TRP A HA   5  
ATOM 7491  H HB2  . TRP A 1 79  ? -0.924  2.089   -7.436  1.00 0.00 ? 79  TRP A HB2  5  
ATOM 7492  H HB3  . TRP A 1 79  ? 0.806   2.181   -7.271  1.00 0.00 ? 79  TRP A HB3  5  
ATOM 7493  H HD1  . TRP A 1 79  ? -2.096  4.225   -8.837  1.00 0.00 ? 79  TRP A HD1  5  
ATOM 7494  H HE1  . TRP A 1 79  ? -1.223  6.611   -9.312  1.00 0.00 ? 79  TRP A HE1  5  
ATOM 7495  H HE3  . TRP A 1 79  ? 2.815   3.593   -7.559  1.00 0.00 ? 79  TRP A HE3  5  
ATOM 7496  H HZ2  . TRP A 1 79  ? 1.181   8.106   -8.926  1.00 0.00 ? 79  TRP A HZ2  5  
ATOM 7497  H HZ3  . TRP A 1 79  ? 4.368   5.531   -7.602  1.00 0.00 ? 79  TRP A HZ3  5  
ATOM 7498  H HH2  . TRP A 1 79  ? 3.548   7.767   -8.296  1.00 0.00 ? 79  TRP A HH2  5  
ATOM 7499  N N    . LEU A 1 80  ? 2.611   1.491   -9.634  1.00 0.00 ? 80  LEU A N    5  
ATOM 7500  C CA   . LEU A 1 80  ? 3.855   1.834   -10.302 1.00 0.00 ? 80  LEU A CA   5  
ATOM 7501  C C    . LEU A 1 80  ? 3.750   1.636   -11.817 1.00 0.00 ? 80  LEU A C    5  
ATOM 7502  O O    . LEU A 1 80  ? 4.145   2.531   -12.558 1.00 0.00 ? 80  LEU A O    5  
ATOM 7503  C CB   . LEU A 1 80  ? 5.001   1.017   -9.686  1.00 0.00 ? 80  LEU A CB   5  
ATOM 7504  C CG   . LEU A 1 80  ? 5.790   1.804   -8.623  1.00 0.00 ? 80  LEU A CG   5  
ATOM 7505  C CD1  . LEU A 1 80  ? 6.431   0.824   -7.639  1.00 0.00 ? 80  LEU A CD1  5  
ATOM 7506  C CD2  . LEU A 1 80  ? 6.878   2.674   -9.256  1.00 0.00 ? 80  LEU A CD2  5  
ATOM 7507  H H    . LEU A 1 80  ? 2.613   0.736   -8.961  1.00 0.00 ? 80  LEU A H    5  
ATOM 7508  H HA   . LEU A 1 80  ? 4.037   2.895   -10.133 1.00 0.00 ? 80  LEU A HA   5  
ATOM 7509  H HB2  . LEU A 1 80  ? 4.571   0.139   -9.208  1.00 0.00 ? 80  LEU A HB2  5  
ATOM 7510  H HB3  . LEU A 1 80  ? 5.678   0.665   -10.470 1.00 0.00 ? 80  LEU A HB3  5  
ATOM 7511  H HG   . LEU A 1 80  ? 5.113   2.449   -8.059  1.00 0.00 ? 80  LEU A HG   5  
ATOM 7512  H HD11 . LEU A 1 80  ? 6.870   -0.023  -8.164  1.00 0.00 ? 80  LEU A HD11 5  
ATOM 7513  H HD12 . LEU A 1 80  ? 7.189   1.323   -7.032  1.00 0.00 ? 80  LEU A HD12 5  
ATOM 7514  H HD13 . LEU A 1 80  ? 5.644   0.436   -6.992  1.00 0.00 ? 80  LEU A HD13 5  
ATOM 7515  H HD21 . LEU A 1 80  ? 7.349   3.299   -8.499  1.00 0.00 ? 80  LEU A HD21 5  
ATOM 7516  H HD22 . LEU A 1 80  ? 7.637   2.057   -9.732  1.00 0.00 ? 80  LEU A HD22 5  
ATOM 7517  H HD23 . LEU A 1 80  ? 6.440   3.317   -10.014 1.00 0.00 ? 80  LEU A HD23 5  
ATOM 7518  N N    . SER A 1 81  ? 3.240   0.496   -12.285 1.00 0.00 ? 81  SER A N    5  
ATOM 7519  C CA   . SER A 1 81  ? 3.122   0.205   -13.711 1.00 0.00 ? 81  SER A CA   5  
ATOM 7520  C C    . SER A 1 81  ? 1.720   0.563   -14.241 1.00 0.00 ? 81  SER A C    5  
ATOM 7521  O O    . SER A 1 81  ? 1.580   0.962   -15.401 1.00 0.00 ? 81  SER A O    5  
ATOM 7522  C CB   . SER A 1 81  ? 3.595   -1.250  -13.909 1.00 0.00 ? 81  SER A CB   5  
ATOM 7523  O OG   . SER A 1 81  ? 2.787   -2.061  -14.735 1.00 0.00 ? 81  SER A OG   5  
ATOM 7524  H H    . SER A 1 81  ? 2.853   -0.182  -11.636 1.00 0.00 ? 81  SER A H    5  
ATOM 7525  H HA   . SER A 1 81  ? 3.824   0.837   -14.259 1.00 0.00 ? 81  SER A HA   5  
ATOM 7526  H HB2  . SER A 1 81  ? 4.601   -1.217  -14.323 1.00 0.00 ? 81  SER A HB2  5  
ATOM 7527  H HB3  . SER A 1 81  ? 3.663   -1.736  -12.932 1.00 0.00 ? 81  SER A HB3  5  
ATOM 7528  H HG   . SER A 1 81  ? 2.427   -2.763  -14.144 1.00 0.00 ? 81  SER A HG   5  
ATOM 7529  N N    . ASP A 1 82  ? 0.693   0.471   -13.394 1.00 0.00 ? 82  ASP A N    5  
ATOM 7530  C CA   . ASP A 1 82  ? -0.729  0.495   -13.745 1.00 0.00 ? 82  ASP A CA   5  
ATOM 7531  C C    . ASP A 1 82  ? -1.376  1.881   -13.634 1.00 0.00 ? 82  ASP A C    5  
ATOM 7532  O O    . ASP A 1 82  ? -2.322  2.199   -14.351 1.00 0.00 ? 82  ASP A O    5  
ATOM 7533  C CB   . ASP A 1 82  ? -1.447  -0.471  -12.795 1.00 0.00 ? 82  ASP A CB   5  
ATOM 7534  C CG   . ASP A 1 82  ? -2.886  -0.734  -13.199 1.00 0.00 ? 82  ASP A CG   5  
ATOM 7535  O OD1  . ASP A 1 82  ? -3.099  -1.652  -14.028 1.00 0.00 ? 82  ASP A OD1  5  
ATOM 7536  O OD2  . ASP A 1 82  ? -3.799  -0.134  -12.607 1.00 0.00 ? 82  ASP A OD2  5  
ATOM 7537  H H    . ASP A 1 82  ? 0.912   0.148   -12.457 1.00 0.00 ? 82  ASP A H    5  
ATOM 7538  H HA   . ASP A 1 82  ? -0.851  0.131   -14.764 1.00 0.00 ? 82  ASP A HA   5  
ATOM 7539  H HB2  . ASP A 1 82  ? -0.924  -1.430  -12.781 1.00 0.00 ? 82  ASP A HB2  5  
ATOM 7540  H HB3  . ASP A 1 82  ? -1.448  -0.057  -11.786 1.00 0.00 ? 82  ASP A HB3  5  
ATOM 7541  N N    . GLN A 1 83  ? -0.896  2.715   -12.707 1.00 0.00 ? 83  GLN A N    5  
ATOM 7542  C CA   . GLN A 1 83  ? -1.455  4.006   -12.287 1.00 0.00 ? 83  GLN A CA   5  
ATOM 7543  C C    . GLN A 1 83  ? -2.919  3.955   -11.782 1.00 0.00 ? 83  GLN A C    5  
ATOM 7544  O O    . GLN A 1 83  ? -3.442  4.982   -11.335 1.00 0.00 ? 83  GLN A O    5  
ATOM 7545  C CB   . GLN A 1 83  ? -1.240  5.062   -13.390 1.00 0.00 ? 83  GLN A CB   5  
ATOM 7546  C CG   . GLN A 1 83  ? 0.245   5.270   -13.739 1.00 0.00 ? 83  GLN A CG   5  
ATOM 7547  C CD   . GLN A 1 83  ? 0.419   6.164   -14.968 1.00 0.00 ? 83  GLN A CD   5  
ATOM 7548  O OE1  . GLN A 1 83  ? -0.274  7.167   -15.148 1.00 0.00 ? 83  GLN A OE1  5  
ATOM 7549  N NE2  . GLN A 1 83  ? 1.379   5.876   -15.835 1.00 0.00 ? 83  GLN A NE2  5  
ATOM 7550  H H    . GLN A 1 83  ? -0.063  2.422   -12.210 1.00 0.00 ? 83  GLN A H    5  
ATOM 7551  H HA   . GLN A 1 83  ? -0.861  4.326   -11.427 1.00 0.00 ? 83  GLN A HA   5  
ATOM 7552  H HB2  . GLN A 1 83  ? -1.777  4.769   -14.293 1.00 0.00 ? 83  GLN A HB2  5  
ATOM 7553  H HB3  . GLN A 1 83  ? -1.648  6.012   -13.043 1.00 0.00 ? 83  GLN A HB3  5  
ATOM 7554  H HG2  . GLN A 1 83  ? 0.752   5.731   -12.888 1.00 0.00 ? 83  GLN A HG2  5  
ATOM 7555  H HG3  . GLN A 1 83  ? 0.715   4.305   -13.937 1.00 0.00 ? 83  GLN A HG3  5  
ATOM 7556  H HE21 . GLN A 1 83  ? 1.902   4.997   -15.739 1.00 0.00 ? 83  GLN A HE21 5  
ATOM 7557  H HE22 . GLN A 1 83  ? 1.413   6.404   -16.701 1.00 0.00 ? 83  GLN A HE22 5  
ATOM 7558  N N    . LEU A 1 84  ? -3.556  2.776   -11.751 1.00 0.00 ? 84  LEU A N    5  
ATOM 7559  C CA   . LEU A 1 84  ? -4.942  2.504   -11.372 1.00 0.00 ? 84  LEU A CA   5  
ATOM 7560  C C    . LEU A 1 84  ? -5.921  3.441   -12.050 1.00 0.00 ? 84  LEU A C    5  
ATOM 7561  O O    . LEU A 1 84  ? -6.426  4.400   -11.459 1.00 0.00 ? 84  LEU A O    5  
ATOM 7562  C CB   . LEU A 1 84  ? -5.135  2.414   -9.861  1.00 0.00 ? 84  LEU A CB   5  
ATOM 7563  C CG   . LEU A 1 84  ? -4.448  1.166   -9.277  1.00 0.00 ? 84  LEU A CG   5  
ATOM 7564  C CD1  . LEU A 1 84  ? -3.147  1.546   -8.600  1.00 0.00 ? 84  LEU A CD1  5  
ATOM 7565  C CD2  . LEU A 1 84  ? -5.326  0.499   -8.239  1.00 0.00 ? 84  LEU A CD2  5  
ATOM 7566  H H    . LEU A 1 84  ? -3.104  1.980   -12.183 1.00 0.00 ? 84  LEU A H    5  
ATOM 7567  H HA   . LEU A 1 84  ? -5.195  1.518   -11.751 1.00 0.00 ? 84  LEU A HA   5  
ATOM 7568  H HB2  . LEU A 1 84  ? -4.763  3.325   -9.395  1.00 0.00 ? 84  LEU A HB2  5  
ATOM 7569  H HB3  . LEU A 1 84  ? -6.206  2.347   -9.686  1.00 0.00 ? 84  LEU A HB3  5  
ATOM 7570  H HG   . LEU A 1 84  ? -4.237  0.439   -10.058 1.00 0.00 ? 84  LEU A HG   5  
ATOM 7571  H HD11 . LEU A 1 84  ? -2.557  2.110   -9.309  1.00 0.00 ? 84  LEU A HD11 5  
ATOM 7572  H HD12 . LEU A 1 84  ? -3.334  2.149   -7.711  1.00 0.00 ? 84  LEU A HD12 5  
ATOM 7573  H HD13 . LEU A 1 84  ? -2.610  0.641   -8.316  1.00 0.00 ? 84  LEU A HD13 5  
ATOM 7574  H HD21 . LEU A 1 84  ? -6.223  0.158   -8.746  1.00 0.00 ? 84  LEU A HD21 5  
ATOM 7575  H HD22 . LEU A 1 84  ? -4.812  -0.357  -7.805  1.00 0.00 ? 84  LEU A HD22 5  
ATOM 7576  H HD23 . LEU A 1 84  ? -5.568  1.204   -7.453  1.00 0.00 ? 84  LEU A HD23 5  
ATOM 7577  N N    . GLY A 1 85  ? -6.212  3.141   -13.308 1.00 0.00 ? 85  GLY A N    5  
ATOM 7578  C CA   . GLY A 1 85  ? -7.086  3.898   -14.139 1.00 0.00 ? 85  GLY A CA   5  
ATOM 7579  C C    . GLY A 1 85  ? -6.951  3.374   -15.556 1.00 0.00 ? 85  GLY A C    5  
ATOM 7580  O O    . GLY A 1 85  ? -6.034  2.619   -15.877 1.00 0.00 ? 85  GLY A O    5  
ATOM 7581  H H    . GLY A 1 85  ? -5.819  2.372   -13.829 1.00 0.00 ? 85  GLY A H    5  
ATOM 7582  H HA2  . GLY A 1 85  ? -8.108  3.784   -13.789 1.00 0.00 ? 85  GLY A HA2  5  
ATOM 7583  H HA3  . GLY A 1 85  ? -6.771  4.934   -14.090 1.00 0.00 ? 85  GLY A HA3  5  
ATOM 7584  N N    . GLN A 1 86  ? -7.873  3.798   -16.395 1.00 0.00 ? 86  GLN A N    5  
ATOM 7585  C CA   . GLN A 1 86  ? -7.940  3.440   -17.803 1.00 0.00 ? 86  GLN A CA   5  
ATOM 7586  C C    . GLN A 1 86  ? -6.953  4.246   -18.649 1.00 0.00 ? 86  GLN A C    5  
ATOM 7587  O O    . GLN A 1 86  ? -6.112  3.644   -19.318 1.00 0.00 ? 86  GLN A O    5  
ATOM 7588  C CB   . GLN A 1 86  ? -9.391  3.585   -18.299 1.00 0.00 ? 86  GLN A CB   5  
ATOM 7589  C CG   . GLN A 1 86  ? -10.009 2.192   -18.490 1.00 0.00 ? 86  GLN A CG   5  
ATOM 7590  C CD   . GLN A 1 86  ? -11.531 2.196   -18.602 1.00 0.00 ? 86  GLN A CD   5  
ATOM 7591  O OE1  . GLN A 1 86  ? -12.198 3.213   -18.389 1.00 0.00 ? 86  GLN A OE1  5  
ATOM 7592  N NE2  . GLN A 1 86  ? -12.115 1.039   -18.850 1.00 0.00 ? 86  GLN A NE2  5  
ATOM 7593  H H    . GLN A 1 86  ? -8.578  4.339   -15.930 1.00 0.00 ? 86  GLN A H    5  
ATOM 7594  H HA   . GLN A 1 86  ? -7.634  2.394   -17.891 1.00 0.00 ? 86  GLN A HA   5  
ATOM 7595  H HB2  . GLN A 1 86  ? -9.973  4.160   -17.575 1.00 0.00 ? 86  GLN A HB2  5  
ATOM 7596  H HB3  . GLN A 1 86  ? -9.418  4.111   -19.255 1.00 0.00 ? 86  GLN A HB3  5  
ATOM 7597  H HG2  . GLN A 1 86  ? -9.576  1.755   -19.391 1.00 0.00 ? 86  GLN A HG2  5  
ATOM 7598  H HG3  . GLN A 1 86  ? -9.741  1.559   -17.645 1.00 0.00 ? 86  GLN A HG3  5  
ATOM 7599  H HE21 . GLN A 1 86  ? -11.570 0.183   -18.928 1.00 0.00 ? 86  GLN A HE21 5  
ATOM 7600  H HE22 . GLN A 1 86  ? -13.125 0.996   -18.964 1.00 0.00 ? 86  GLN A HE22 5  
ATOM 7601  N N    . ALA A 1 87  ? -7.112  5.575   -18.726 1.00 0.00 ? 87  ALA A N    5  
ATOM 7602  C CA   . ALA A 1 87  ? -6.317  6.438   -19.599 1.00 0.00 ? 87  ALA A CA   5  
ATOM 7603  C C    . ALA A 1 87  ? -6.494  7.927   -19.256 1.00 0.00 ? 87  ALA A C    5  
ATOM 7604  O O    . ALA A 1 87  ? -6.909  8.731   -20.099 1.00 0.00 ? 87  ALA A O    5  
ATOM 7605  C CB   . ALA A 1 87  ? -6.686  6.159   -21.065 1.00 0.00 ? 87  ALA A CB   5  
ATOM 7606  H H    . ALA A 1 87  ? -7.781  6.011   -18.111 1.00 0.00 ? 87  ALA A H    5  
ATOM 7607  H HA   . ALA A 1 87  ? -5.262  6.191   -19.454 1.00 0.00 ? 87  ALA A HA   5  
ATOM 7608  H HB1  . ALA A 1 87  ? -7.757  6.303   -21.227 1.00 0.00 ? 87  ALA A HB1  5  
ATOM 7609  H HB2  . ALA A 1 87  ? -6.122  6.822   -21.715 1.00 0.00 ? 87  ALA A HB2  5  
ATOM 7610  H HB3  . ALA A 1 87  ? -6.400  5.145   -21.324 1.00 0.00 ? 87  ALA A HB3  5  
ATOM 7611  N N    . VAL A 1 88  ? -6.171  8.310   -18.025 1.00 0.00 ? 88  VAL A N    5  
ATOM 7612  C CA   . VAL A 1 88  ? -5.931  9.704   -17.657 1.00 0.00 ? 88  VAL A CA   5  
ATOM 7613  C C    . VAL A 1 88  ? -4.940  9.719   -16.489 1.00 0.00 ? 88  VAL A C    5  
ATOM 7614  O O    . VAL A 1 88  ? -4.856  8.750   -15.727 1.00 0.00 ? 88  VAL A O    5  
ATOM 7615  C CB   . VAL A 1 88  ? -7.268  10.434  -17.374 1.00 0.00 ? 88  VAL A CB   5  
ATOM 7616  C CG1  . VAL A 1 88  ? -8.075  9.831   -16.225 1.00 0.00 ? 88  VAL A CG1  5  
ATOM 7617  C CG2  . VAL A 1 88  ? -7.110  11.939  -17.139 1.00 0.00 ? 88  VAL A CG2  5  
ATOM 7618  H H    . VAL A 1 88  ? -5.857  7.613   -17.356 1.00 0.00 ? 88  VAL A H    5  
ATOM 7619  H HA   . VAL A 1 88  ? -5.454  10.189  -18.510 1.00 0.00 ? 88  VAL A HA   5  
ATOM 7620  H HB   . VAL A 1 88  ? -7.885  10.338  -18.264 1.00 0.00 ? 88  VAL A HB   5  
ATOM 7621  H HG11 . VAL A 1 88  ? -7.492  9.834   -15.305 1.00 0.00 ? 88  VAL A HG11 5  
ATOM 7622  H HG12 . VAL A 1 88  ? -8.992  10.398  -16.067 1.00 0.00 ? 88  VAL A HG12 5  
ATOM 7623  H HG13 . VAL A 1 88  ? -8.347  8.811   -16.489 1.00 0.00 ? 88  VAL A HG13 5  
ATOM 7624  H HG21 . VAL A 1 88  ? -6.642  12.409  -18.002 1.00 0.00 ? 88  VAL A HG21 5  
ATOM 7625  H HG22 . VAL A 1 88  ? -8.088  12.392  -16.984 1.00 0.00 ? 88  VAL A HG22 5  
ATOM 7626  H HG23 . VAL A 1 88  ? -6.512  12.131  -16.253 1.00 0.00 ? 88  VAL A HG23 5  
ATOM 7627  N N    . GLY A 1 89  ? -4.180  10.806  -16.345 1.00 0.00 ? 89  GLY A N    5  
ATOM 7628  C CA   . GLY A 1 89  ? -3.204  10.977  -15.278 1.00 0.00 ? 89  GLY A CA   5  
ATOM 7629  C C    . GLY A 1 89  ? -1.815  11.326  -15.798 1.00 0.00 ? 89  GLY A C    5  
ATOM 7630  O O    . GLY A 1 89  ? -0.835  10.874  -15.201 1.00 0.00 ? 89  GLY A O    5  
ATOM 7631  H H    . GLY A 1 89  ? -4.264  11.561  -17.022 1.00 0.00 ? 89  GLY A H    5  
ATOM 7632  H HA2  . GLY A 1 89  ? -3.540  11.773  -14.612 1.00 0.00 ? 89  GLY A HA2  5  
ATOM 7633  H HA3  . GLY A 1 89  ? -3.121  10.067  -14.688 1.00 0.00 ? 89  GLY A HA3  5  
ATOM 7634  N N    . GLN A 1 90  ? -1.742  12.113  -16.877 1.00 0.00 ? 90  GLN A N    5  
ATOM 7635  C CA   . GLN A 1 90  ? -0.574  12.759  -17.464 1.00 0.00 ? 90  GLN A CA   5  
ATOM 7636  C C    . GLN A 1 90  ? 0.137   11.790  -18.415 1.00 0.00 ? 90  GLN A C    5  
ATOM 7637  O O    . GLN A 1 90  ? 0.695   10.785  -17.968 1.00 0.00 ? 90  GLN A O    5  
ATOM 7638  C CB   . GLN A 1 90  ? 0.347   13.344  -16.371 1.00 0.00 ? 90  GLN A CB   5  
ATOM 7639  C CG   . GLN A 1 90  ? 1.221   14.512  -16.844 1.00 0.00 ? 90  GLN A CG   5  
ATOM 7640  C CD   . GLN A 1 90  ? 0.478   15.848  -16.900 1.00 0.00 ? 90  GLN A CD   5  
ATOM 7641  O OE1  . GLN A 1 90  ? -0.708  15.921  -17.231 1.00 0.00 ? 90  GLN A OE1  5  
ATOM 7642  N NE2  . GLN A 1 90  ? 1.149   16.937  -16.570 1.00 0.00 ? 90  GLN A NE2  5  
ATOM 7643  H H    . GLN A 1 90  ? -2.617  12.380  -17.313 1.00 0.00 ? 90  GLN A H    5  
ATOM 7644  H HA   . GLN A 1 90  ? -0.955  13.591  -18.056 1.00 0.00 ? 90  GLN A HA   5  
ATOM 7645  H HB2  . GLN A 1 90  ? -0.258  13.696  -15.535 1.00 0.00 ? 90  GLN A HB2  5  
ATOM 7646  H HB3  . GLN A 1 90  ? 1.002   12.557  -15.999 1.00 0.00 ? 90  GLN A HB3  5  
ATOM 7647  H HG2  . GLN A 1 90  ? 2.053   14.605  -16.143 1.00 0.00 ? 90  GLN A HG2  5  
ATOM 7648  H HG3  . GLN A 1 90  ? 1.623   14.287  -17.828 1.00 0.00 ? 90  GLN A HG3  5  
ATOM 7649  H HE21 . GLN A 1 90  ? 2.147   16.900  -16.394 1.00 0.00 ? 90  GLN A HE21 5  
ATOM 7650  H HE22 . GLN A 1 90  ? 0.703   17.840  -16.715 1.00 0.00 ? 90  GLN A HE22 5  
ATOM 7651  N N    . GLN A 1 91  ? 0.123   12.103  -19.717 1.00 0.00 ? 91  GLN A N    5  
ATOM 7652  C CA   . GLN A 1 91  ? 0.536   11.267  -20.849 1.00 0.00 ? 91  GLN A CA   5  
ATOM 7653  C C    . GLN A 1 91  ? -0.362  10.028  -21.037 1.00 0.00 ? 91  GLN A C    5  
ATOM 7654  O O    . GLN A 1 91  ? -1.099  9.632   -20.133 1.00 0.00 ? 91  GLN A O    5  
ATOM 7655  C CB   . GLN A 1 91  ? 2.043   10.908  -20.802 1.00 0.00 ? 91  GLN A CB   5  
ATOM 7656  C CG   . GLN A 1 91  ? 2.945   11.984  -21.425 1.00 0.00 ? 91  GLN A CG   5  
ATOM 7657  C CD   . GLN A 1 91  ? 3.451   12.978  -20.391 1.00 0.00 ? 91  GLN A CD   5  
ATOM 7658  O OE1  . GLN A 1 91  ? 4.481   12.752  -19.763 1.00 0.00 ? 91  GLN A OE1  5  
ATOM 7659  N NE2  . GLN A 1 91  ? 2.772   14.095  -20.198 1.00 0.00 ? 91  GLN A NE2  5  
ATOM 7660  H H    . GLN A 1 91  ? -0.402  12.927  -19.989 1.00 0.00 ? 91  GLN A H    5  
ATOM 7661  H HA   . GLN A 1 91  ? 0.373   11.877  -21.735 1.00 0.00 ? 91  GLN A HA   5  
ATOM 7662  H HB2  . GLN A 1 91  ? 2.369   10.692  -19.786 1.00 0.00 ? 91  GLN A HB2  5  
ATOM 7663  H HB3  . GLN A 1 91  ? 2.210   9.988   -21.360 1.00 0.00 ? 91  GLN A HB3  5  
ATOM 7664  H HG2  . GLN A 1 91  ? 3.814   11.486  -21.853 1.00 0.00 ? 91  GLN A HG2  5  
ATOM 7665  H HG3  . GLN A 1 91  ? 2.433   12.506  -22.236 1.00 0.00 ? 91  GLN A HG3  5  
ATOM 7666  H HE21 . GLN A 1 91  ? 1.986   14.369  -20.776 1.00 0.00 ? 91  GLN A HE21 5  
ATOM 7667  H HE22 . GLN A 1 91  ? 3.134   14.744  -19.504 1.00 0.00 ? 91  GLN A HE22 5  
ATOM 7668  N N    . PRO A 1 92  ? -0.312  9.379   -22.218 1.00 0.00 ? 92  PRO A N    5  
ATOM 7669  C CA   . PRO A 1 92  ? -0.987  8.105   -22.484 1.00 0.00 ? 92  PRO A CA   5  
ATOM 7670  C C    . PRO A 1 92  ? -0.275  6.886   -21.852 1.00 0.00 ? 92  PRO A C    5  
ATOM 7671  O O    . PRO A 1 92  ? -0.533  5.749   -22.262 1.00 0.00 ? 92  PRO A O    5  
ATOM 7672  C CB   . PRO A 1 92  ? -1.051  8.020   -24.013 1.00 0.00 ? 92  PRO A CB   5  
ATOM 7673  C CG   . PRO A 1 92  ? 0.223   8.724   -24.454 1.00 0.00 ? 92  PRO A CG   5  
ATOM 7674  C CD   . PRO A 1 92  ? 0.306   9.868   -23.450 1.00 0.00 ? 92  PRO A CD   5  
ATOM 7675  H HA   . PRO A 1 92  ? -2.006  8.133   -22.099 1.00 0.00 ? 92  PRO A HA   5  
ATOM 7676  H HB2  . PRO A 1 92  ? -1.088  6.997   -24.374 1.00 0.00 ? 92  PRO A HB2  5  
ATOM 7677  H HB3  . PRO A 1 92  ? -1.916  8.577   -24.375 1.00 0.00 ? 92  PRO A HB3  5  
ATOM 7678  H HG2  . PRO A 1 92  ? 1.076   8.057   -24.326 1.00 0.00 ? 92  PRO A HG2  5  
ATOM 7679  H HG3  . PRO A 1 92  ? 0.151   9.084   -25.480 1.00 0.00 ? 92  PRO A HG3  5  
ATOM 7680  H HD2  . PRO A 1 92  ? 1.347   10.148  -23.314 1.00 0.00 ? 92  PRO A HD2  5  
ATOM 7681  H HD3  . PRO A 1 92  ? -0.262  10.720  -23.826 1.00 0.00 ? 92  PRO A HD3  5  
ATOM 7682  N N    . GLY A 1 93  ? 0.618   7.097   -20.879 1.00 0.00 ? 93  GLY A N    5  
ATOM 7683  C CA   . GLY A 1 93  ? 1.356   6.038   -20.211 1.00 0.00 ? 93  GLY A CA   5  
ATOM 7684  C C    . GLY A 1 93  ? 2.610   5.666   -20.989 1.00 0.00 ? 93  GLY A C    5  
ATOM 7685  O O    . GLY A 1 93  ? 2.505   5.117   -22.089 1.00 0.00 ? 93  GLY A O    5  
ATOM 7686  H H    . GLY A 1 93  ? 0.716   8.026   -20.501 1.00 0.00 ? 93  GLY A H    5  
ATOM 7687  H HA2  . GLY A 1 93  ? 1.620   6.348   -19.203 1.00 0.00 ? 93  GLY A HA2  5  
ATOM 7688  H HA3  . GLY A 1 93  ? 0.724   5.155   -20.132 1.00 0.00 ? 93  GLY A HA3  5  
ATOM 7689  N N    . ALA A 1 94  ? 3.793   5.897   -20.410 1.00 0.00 ? 94  ALA A N    5  
ATOM 7690  C CA   . ALA A 1 94  ? 5.058   5.368   -20.912 1.00 0.00 ? 94  ALA A CA   5  
ATOM 7691  C C    . ALA A 1 94  ? 5.821   4.714   -19.759 1.00 0.00 ? 94  ALA A C    5  
ATOM 7692  O O    . ALA A 1 94  ? 6.258   5.400   -18.831 1.00 0.00 ? 94  ALA A O    5  
ATOM 7693  C CB   . ALA A 1 94  ? 5.887   6.464   -21.591 1.00 0.00 ? 94  ALA A CB   5  
ATOM 7694  H H    . ALA A 1 94  ? 3.816   6.354   -19.505 1.00 0.00 ? 94  ALA A H    5  
ATOM 7695  H HA   . ALA A 1 94  ? 4.843   4.605   -21.661 1.00 0.00 ? 94  ALA A HA   5  
ATOM 7696  H HB1  . ALA A 1 94  ? 6.192   7.211   -20.859 1.00 0.00 ? 94  ALA A HB1  5  
ATOM 7697  H HB2  . ALA A 1 94  ? 6.782   6.016   -22.027 1.00 0.00 ? 94  ALA A HB2  5  
ATOM 7698  H HB3  . ALA A 1 94  ? 5.300   6.939   -22.379 1.00 0.00 ? 94  ALA A HB3  5  
ATOM 7699  N N    . SER A 1 95  ? 5.992   3.392   -19.812 1.00 0.00 ? 95  SER A N    5  
ATOM 7700  C CA   . SER A 1 95  ? 6.671   2.598   -18.793 1.00 0.00 ? 95  SER A CA   5  
ATOM 7701  C C    . SER A 1 95  ? 7.498   1.510   -19.482 1.00 0.00 ? 95  SER A C    5  
ATOM 7702  O O    . SER A 1 95  ? 7.350   0.322   -19.190 1.00 0.00 ? 95  SER A O    5  
ATOM 7703  C CB   . SER A 1 95  ? 5.634   2.060   -17.790 1.00 0.00 ? 95  SER A CB   5  
ATOM 7704  O OG   . SER A 1 95  ? 6.230   1.287   -16.764 1.00 0.00 ? 95  SER A OG   5  
ATOM 7705  H H    . SER A 1 95  ? 5.637   2.903   -20.625 1.00 0.00 ? 95  SER A H    5  
ATOM 7706  H HA   . SER A 1 95  ? 7.366   3.236   -18.245 1.00 0.00 ? 95  SER A HA   5  
ATOM 7707  H HB2  . SER A 1 95  ? 5.127   2.907   -17.330 1.00 0.00 ? 95  SER A HB2  5  
ATOM 7708  H HB3  . SER A 1 95  ? 4.903   1.446   -18.319 1.00 0.00 ? 95  SER A HB3  5  
ATOM 7709  H HG   . SER A 1 95  ? 6.516   0.459   -17.185 1.00 0.00 ? 95  SER A HG   5  
ATOM 7710  N N    . SER A 1 96  ? 8.373   1.899   -20.408 1.00 0.00 ? 96  SER A N    5  
ATOM 7711  C CA   . SER A 1 96  ? 9.439   1.023   -20.879 1.00 0.00 ? 96  SER A CA   5  
ATOM 7712  C C    . SER A 1 96  ? 10.517  0.899   -19.786 1.00 0.00 ? 96  SER A C    5  
ATOM 7713  O O    . SER A 1 96  ? 10.541  1.683   -18.828 1.00 0.00 ? 96  SER A O    5  
ATOM 7714  C CB   . SER A 1 96  ? 10.010  1.605   -22.179 1.00 0.00 ? 96  SER A CB   5  
ATOM 7715  O OG   . SER A 1 96  ? 10.562  0.598   -22.996 1.00 0.00 ? 96  SER A OG   5  
ATOM 7716  H H    . SER A 1 96  ? 8.463   2.881   -20.620 1.00 0.00 ? 96  SER A H    5  
ATOM 7717  H HA   . SER A 1 96  ? 9.023   0.035   -21.087 1.00 0.00 ? 96  SER A HA   5  
ATOM 7718  H HB2  . SER A 1 96  ? 9.203   2.071   -22.743 1.00 0.00 ? 96  SER A HB2  5  
ATOM 7719  H HB3  . SER A 1 96  ? 10.772  2.347   -21.947 1.00 0.00 ? 96  SER A HB3  5  
ATOM 7720  H HG   . SER A 1 96  ? 9.801   0.092   -23.354 1.00 0.00 ? 96  SER A HG   5  
ATOM 7721  N N    . GLY A 1 97  ? 11.433  -0.053  -19.952 1.00 0.00 ? 97  GLY A N    5  
ATOM 7722  C CA   . GLY A 1 97  ? 12.646  -0.208  -19.168 1.00 0.00 ? 97  GLY A CA   5  
ATOM 7723  C C    . GLY A 1 97  ? 13.113  -1.668  -19.234 1.00 0.00 ? 97  GLY A C    5  
ATOM 7724  O O    . GLY A 1 97  ? 12.266  -2.567  -19.245 1.00 0.00 ? 97  GLY A O    5  
ATOM 7725  H H    . GLY A 1 97  ? 11.349  -0.714  -20.715 1.00 0.00 ? 97  GLY A H    5  
ATOM 7726  H HA2  . GLY A 1 97  ? 13.404  0.467   -19.562 1.00 0.00 ? 97  GLY A HA2  5  
ATOM 7727  H HA3  . GLY A 1 97  ? 12.443  0.048   -18.130 1.00 0.00 ? 97  GLY A HA3  5  
ATOM 7728  N N    . PRO A 1 98  ? 14.428  -1.942  -19.280 1.00 0.00 ? 98  PRO A N    5  
ATOM 7729  C CA   . PRO A 1 98  ? 14.956  -3.294  -19.157 1.00 0.00 ? 98  PRO A CA   5  
ATOM 7730  C C    . PRO A 1 98  ? 14.900  -3.740  -17.685 1.00 0.00 ? 98  PRO A C    5  
ATOM 7731  O O    . PRO A 1 98  ? 15.492  -3.082  -16.819 1.00 0.00 ? 98  PRO A O    5  
ATOM 7732  C CB   . PRO A 1 98  ? 16.387  -3.186  -19.695 1.00 0.00 ? 98  PRO A CB   5  
ATOM 7733  C CG   . PRO A 1 98  ? 16.813  -1.750  -19.382 1.00 0.00 ? 98  PRO A CG   5  
ATOM 7734  C CD   . PRO A 1 98  ? 15.501  -0.970  -19.453 1.00 0.00 ? 98  PRO A CD   5  
ATOM 7735  H HA   . PRO A 1 98  ? 14.385  -3.985  -19.781 1.00 0.00 ? 98  PRO A HA   5  
ATOM 7736  H HB2  . PRO A 1 98  ? 17.058  -3.907  -19.238 1.00 0.00 ? 98  PRO A HB2  5  
ATOM 7737  H HB3  . PRO A 1 98  ? 16.378  -3.335  -20.775 1.00 0.00 ? 98  PRO A HB3  5  
ATOM 7738  H HG2  . PRO A 1 98  ? 17.219  -1.694  -18.371 1.00 0.00 ? 98  PRO A HG2  5  
ATOM 7739  H HG3  . PRO A 1 98  ? 17.536  -1.377  -20.109 1.00 0.00 ? 98  PRO A HG3  5  
ATOM 7740  H HD2  . PRO A 1 98  ? 15.474  -0.218  -18.665 1.00 0.00 ? 98  PRO A HD2  5  
ATOM 7741  H HD3  . PRO A 1 98  ? 15.408  -0.488  -20.428 1.00 0.00 ? 98  PRO A HD3  5  
ATOM 7742  N N    . SER A 1 99  ? 14.226  -4.849  -17.384 1.00 0.00 ? 99  SER A N    5  
ATOM 7743  C CA   . SER A 1 99  ? 14.064  -5.392  -16.037 1.00 0.00 ? 99  SER A CA   5  
ATOM 7744  C C    . SER A 1 99  ? 14.504  -6.863  -15.970 1.00 0.00 ? 99  SER A C    5  
ATOM 7745  O O    . SER A 1 99  ? 14.533  -7.559  -16.994 1.00 0.00 ? 99  SER A O    5  
ATOM 7746  C CB   . SER A 1 99  ? 12.607  -5.204  -15.601 1.00 0.00 ? 99  SER A CB   5  
ATOM 7747  O OG   . SER A 1 99  ? 11.715  -5.868  -16.483 1.00 0.00 ? 99  SER A OG   5  
ATOM 7748  H H    . SER A 1 99  ? 13.816  -5.388  -18.141 1.00 0.00 ? 99  SER A H    5  
ATOM 7749  H HA   . SER A 1 99  ? 14.690  -4.827  -15.345 1.00 0.00 ? 99  SER A HA   5  
ATOM 7750  H HB2  . SER A 1 99  ? 12.483  -5.612  -14.597 1.00 0.00 ? 99  SER A HB2  5  
ATOM 7751  H HB3  . SER A 1 99  ? 12.369  -4.140  -15.572 1.00 0.00 ? 99  SER A HB3  5  
ATOM 7752  H HG   . SER A 1 99  ? 11.519  -5.291  -17.252 1.00 0.00 ? 99  SER A HG   5  
ATOM 7753  N N    . SER A 1 100 ? 14.826  -7.322  -14.760 1.00 0.00 ? 100 SER A N    5  
ATOM 7754  C CA   . SER A 1 100 ? 15.319  -8.648  -14.397 1.00 0.00 ? 100 SER A CA   5  
ATOM 7755  C C    . SER A 1 100 ? 14.153  -9.546  -13.936 1.00 0.00 ? 100 SER A C    5  
ATOM 7756  O O    . SER A 1 100 ? 12.991  -9.255  -14.236 1.00 0.00 ? 100 SER A O    5  
ATOM 7757  C CB   . SER A 1 100 ? 16.390  -8.481  -13.303 1.00 0.00 ? 100 SER A CB   5  
ATOM 7758  O OG   . SER A 1 100 ? 17.367  -7.520  -13.688 1.00 0.00 ? 100 SER A OG   5  
ATOM 7759  H H    . SER A 1 100 ? 14.716  -6.696  -13.968 1.00 0.00 ? 100 SER A H    5  
ATOM 7760  H HA   . SER A 1 100 ? 15.785  -9.104  -15.270 1.00 0.00 ? 100 SER A HA   5  
ATOM 7761  H HB2  . SER A 1 100 ? 15.913  -8.165  -12.374 1.00 0.00 ? 100 SER A HB2  5  
ATOM 7762  H HB3  . SER A 1 100 ? 16.883  -9.439  -13.128 1.00 0.00 ? 100 SER A HB3  5  
ATOM 7763  H HG   . SER A 1 100 ? 17.277  -6.747  -13.086 1.00 0.00 ? 100 SER A HG   5  
ATOM 7764  N N    . GLY A 1 101 ? 14.441  -10.656 -13.253 1.00 0.00 ? 101 GLY A N    5  
ATOM 7765  C CA   . GLY A 1 101 ? 13.470  -11.410 -12.469 1.00 0.00 ? 101 GLY A CA   5  
ATOM 7766  C C    . GLY A 1 101 ? 13.730  -11.116 -11.001 1.00 0.00 ? 101 GLY A C    5  
ATOM 7767  O O    . GLY A 1 101 ? 12.751  -11.124 -10.222 1.00 0.00 ? 101 GLY A O    5  
ATOM 7768  H H    . GLY A 1 101 ? 15.386  -10.800 -12.920 1.00 0.00 ? 101 GLY A H    5  
ATOM 7769  H HA2  . GLY A 1 101 ? 12.447  -11.125 -12.723 1.00 0.00 ? 101 GLY A HA2  5  
ATOM 7770  H HA3  . GLY A 1 101 ? 13.611  -12.474 -12.636 1.00 0.00 ? 101 GLY A HA3  5  
ATOM 7771  N N    . GLY A 1 1   ? 11.312  -17.685 -25.929 1.00 0.00 ? 1   GLY A N    6  
ATOM 7772  C CA   . GLY A 1 1   ? 10.210  -18.651 -25.991 1.00 0.00 ? 1   GLY A CA   6  
ATOM 7773  C C    . GLY A 1 1   ? 8.964   -18.038 -25.399 1.00 0.00 ? 1   GLY A C    6  
ATOM 7774  O O    . GLY A 1 1   ? 8.178   -17.426 -26.126 1.00 0.00 ? 1   GLY A O    6  
ATOM 7775  H H1   . GLY A 1 1   ? 11.538  -17.361 -25.011 1.00 0.00 ? 1   GLY A H1   6  
ATOM 7776  H HA2  . GLY A 1 1   ? 10.009  -18.920 -27.025 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 7777  H HA3  . GLY A 1 1   ? 10.483  -19.548 -25.440 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 7778  N N    . SER A 1 2   ? 8.804   -18.188 -24.082 1.00 0.00 ? 2   SER A N    6  
ATOM 7779  C CA   . SER A 1 2   ? 7.754   -17.562 -23.284 1.00 0.00 ? 2   SER A CA   6  
ATOM 7780  C C    . SER A 1 2   ? 6.349   -18.036 -23.689 1.00 0.00 ? 2   SER A C    6  
ATOM 7781  O O    . SER A 1 2   ? 6.182   -18.800 -24.643 1.00 0.00 ? 2   SER A O    6  
ATOM 7782  C CB   . SER A 1 2   ? 7.923   -16.034 -23.362 1.00 0.00 ? 2   SER A CB   6  
ATOM 7783  O OG   . SER A 1 2   ? 9.284   -15.690 -23.169 1.00 0.00 ? 2   SER A OG   6  
ATOM 7784  H H    . SER A 1 2   ? 9.519   -18.669 -23.554 1.00 0.00 ? 2   SER A H    6  
ATOM 7785  H HA   . SER A 1 2   ? 7.918   -17.856 -22.247 1.00 0.00 ? 2   SER A HA   6  
ATOM 7786  H HB2  . SER A 1 2   ? 7.595   -15.669 -24.336 1.00 0.00 ? 2   SER A HB2  6  
ATOM 7787  H HB3  . SER A 1 2   ? 7.315   -15.553 -22.599 1.00 0.00 ? 2   SER A HB3  6  
ATOM 7788  H HG   . SER A 1 2   ? 9.342   -14.715 -23.198 1.00 0.00 ? 2   SER A HG   6  
ATOM 7789  N N    . SER A 1 3   ? 5.324   -17.624 -22.943 1.00 0.00 ? 3   SER A N    6  
ATOM 7790  C CA   . SER A 1 3   ? 3.941   -17.853 -23.326 1.00 0.00 ? 3   SER A CA   6  
ATOM 7791  C C    . SER A 1 3   ? 3.083   -16.713 -22.786 1.00 0.00 ? 3   SER A C    6  
ATOM 7792  O O    . SER A 1 3   ? 2.648   -15.887 -23.591 1.00 0.00 ? 3   SER A O    6  
ATOM 7793  C CB   . SER A 1 3   ? 3.481   -19.255 -22.907 1.00 0.00 ? 3   SER A CB   6  
ATOM 7794  O OG   . SER A 1 3   ? 2.262   -19.567 -23.543 1.00 0.00 ? 3   SER A OG   6  
ATOM 7795  H H    . SER A 1 3   ? 5.505   -17.038 -22.135 1.00 0.00 ? 3   SER A H    6  
ATOM 7796  H HA   . SER A 1 3   ? 3.888   -17.816 -24.415 1.00 0.00 ? 3   SER A HA   6  
ATOM 7797  H HB2  . SER A 1 3   ? 4.225   -19.982 -23.229 1.00 0.00 ? 3   SER A HB2  6  
ATOM 7798  H HB3  . SER A 1 3   ? 3.368   -19.317 -21.825 1.00 0.00 ? 3   SER A HB3  6  
ATOM 7799  H HG   . SER A 1 3   ? 2.141   -20.536 -23.533 1.00 0.00 ? 3   SER A HG   6  
ATOM 7800  N N    . GLY A 1 4   ? 2.886   -16.617 -21.466 1.00 0.00 ? 4   GLY A N    6  
ATOM 7801  C CA   . GLY A 1 4   ? 2.033   -15.607 -20.842 1.00 0.00 ? 4   GLY A CA   6  
ATOM 7802  C C    . GLY A 1 4   ? 2.819   -14.630 -19.966 1.00 0.00 ? 4   GLY A C    6  
ATOM 7803  O O    . GLY A 1 4   ? 4.024   -14.807 -19.728 1.00 0.00 ? 4   GLY A O    6  
ATOM 7804  H H    . GLY A 1 4   ? 3.307   -17.289 -20.842 1.00 0.00 ? 4   GLY A H    6  
ATOM 7805  H HA2  . GLY A 1 4   ? 1.496   -15.044 -21.607 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 7806  H HA3  . GLY A 1 4   ? 1.295   -16.115 -20.220 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 7807  N N    . SER A 1 5   ? 2.122   -13.600 -19.478 1.00 0.00 ? 5   SER A N    6  
ATOM 7808  C CA   . SER A 1 5   ? 2.619   -12.601 -18.537 1.00 0.00 ? 5   SER A CA   6  
ATOM 7809  C C    . SER A 1 5   ? 1.430   -11.926 -17.843 1.00 0.00 ? 5   SER A C    6  
ATOM 7810  O O    . SER A 1 5   ? 0.940   -10.897 -18.320 1.00 0.00 ? 5   SER A O    6  
ATOM 7811  C CB   . SER A 1 5   ? 3.522   -11.585 -19.262 1.00 0.00 ? 5   SER A CB   6  
ATOM 7812  O OG   . SER A 1 5   ? 2.942   -11.106 -20.462 1.00 0.00 ? 5   SER A OG   6  
ATOM 7813  H H    . SER A 1 5   ? 1.148   -13.516 -19.736 1.00 0.00 ? 5   SER A H    6  
ATOM 7814  H HA   . SER A 1 5   ? 3.218   -13.100 -17.776 1.00 0.00 ? 5   SER A HA   6  
ATOM 7815  H HB2  . SER A 1 5   ? 3.732   -10.744 -18.600 1.00 0.00 ? 5   SER A HB2  6  
ATOM 7816  H HB3  . SER A 1 5   ? 4.464   -12.062 -19.523 1.00 0.00 ? 5   SER A HB3  6  
ATOM 7817  H HG   . SER A 1 5   ? 2.135   -10.631 -20.209 1.00 0.00 ? 5   SER A HG   6  
ATOM 7818  N N    . SER A 1 6   ? 0.930   -12.521 -16.760 1.00 0.00 ? 6   SER A N    6  
ATOM 7819  C CA   . SER A 1 6   ? -0.143  -11.957 -15.948 1.00 0.00 ? 6   SER A CA   6  
ATOM 7820  C C    . SER A 1 6   ? 0.368   -10.714 -15.206 1.00 0.00 ? 6   SER A C    6  
ATOM 7821  O O    . SER A 1 6   ? 1.335   -10.797 -14.444 1.00 0.00 ? 6   SER A O    6  
ATOM 7822  C CB   . SER A 1 6   ? -0.647  -13.026 -14.972 1.00 0.00 ? 6   SER A CB   6  
ATOM 7823  O OG   . SER A 1 6   ? -0.862  -14.248 -15.658 1.00 0.00 ? 6   SER A OG   6  
ATOM 7824  H H    . SER A 1 6   ? 1.276   -13.415 -16.448 1.00 0.00 ? 6   SER A H    6  
ATOM 7825  H HA   . SER A 1 6   ? -0.967  -11.676 -16.603 1.00 0.00 ? 6   SER A HA   6  
ATOM 7826  H HB2  . SER A 1 6   ? 0.101   -13.187 -14.193 1.00 0.00 ? 6   SER A HB2  6  
ATOM 7827  H HB3  . SER A 1 6   ? -1.578  -12.696 -14.508 1.00 0.00 ? 6   SER A HB3  6  
ATOM 7828  H HG   . SER A 1 6   ? -0.768  -14.958 -14.992 1.00 0.00 ? 6   SER A HG   6  
ATOM 7829  N N    . GLY A 1 7   ? -0.277  -9.568  -15.419 1.00 0.00 ? 7   GLY A N    6  
ATOM 7830  C CA   . GLY A 1 7   ? 0.074   -8.276  -14.848 1.00 0.00 ? 7   GLY A CA   6  
ATOM 7831  C C    . GLY A 1 7   ? -0.975  -7.883  -13.816 1.00 0.00 ? 7   GLY A C    6  
ATOM 7832  O O    . GLY A 1 7   ? -1.657  -6.867  -13.984 1.00 0.00 ? 7   GLY A O    6  
ATOM 7833  H H    . GLY A 1 7   ? -1.119  -9.589  -15.980 1.00 0.00 ? 7   GLY A H    6  
ATOM 7834  H HA2  . GLY A 1 7   ? 1.056   -8.322  -14.376 1.00 0.00 ? 7   GLY A HA2  6  
ATOM 7835  H HA3  . GLY A 1 7   ? 0.108   -7.526  -15.640 1.00 0.00 ? 7   GLY A HA3  6  
ATOM 7836  N N    . GLN A 1 8   ? -1.127  -8.716  -12.781 1.00 0.00 ? 8   GLN A N    6  
ATOM 7837  C CA   . GLN A 1 8   ? -2.028  -8.552  -11.642 1.00 0.00 ? 8   GLN A CA   6  
ATOM 7838  C C    . GLN A 1 8   ? -1.334  -9.025  -10.360 1.00 0.00 ? 8   GLN A C    6  
ATOM 7839  O O    . GLN A 1 8   ? -0.282  -9.674  -10.431 1.00 0.00 ? 8   GLN A O    6  
ATOM 7840  C CB   . GLN A 1 8   ? -3.308  -9.374  -11.877 1.00 0.00 ? 8   GLN A CB   6  
ATOM 7841  C CG   . GLN A 1 8   ? -4.311  -8.661  -12.790 1.00 0.00 ? 8   GLN A CG   6  
ATOM 7842  C CD   . GLN A 1 8   ? -5.349  -9.638  -13.301 1.00 0.00 ? 8   GLN A CD   6  
ATOM 7843  O OE1  . GLN A 1 8   ? -6.423  -9.783  -12.718 1.00 0.00 ? 8   GLN A OE1  6  
ATOM 7844  N NE2  . GLN A 1 8   ? -5.040  -10.356 -14.371 1.00 0.00 ? 8   GLN A NE2  6  
ATOM 7845  H H    . GLN A 1 8   ? -0.507  -9.510  -12.722 1.00 0.00 ? 8   GLN A H    6  
ATOM 7846  H HA   . GLN A 1 8   ? -2.278  -7.498  -11.532 1.00 0.00 ? 8   GLN A HA   6  
ATOM 7847  H HB2  . GLN A 1 8   ? -3.041  -10.343 -12.305 1.00 0.00 ? 8   GLN A HB2  6  
ATOM 7848  H HB3  . GLN A 1 8   ? -3.814  -9.558  -10.928 1.00 0.00 ? 8   GLN A HB3  6  
ATOM 7849  H HG2  . GLN A 1 8   ? -4.811  -7.873  -12.228 1.00 0.00 ? 8   GLN A HG2  6  
ATOM 7850  H HG3  . GLN A 1 8   ? -3.811  -8.207  -13.640 1.00 0.00 ? 8   GLN A HG3  6  
ATOM 7851  H HE21 . GLN A 1 8   ? -4.172  -10.194 -14.875 1.00 0.00 ? 8   GLN A HE21 6  
ATOM 7852  H HE22 . GLN A 1 8   ? -5.695  -11.049 -14.709 1.00 0.00 ? 8   GLN A HE22 6  
ATOM 7853  N N    . TYR A 1 9   ? -1.947  -8.740  -9.203  1.00 0.00 ? 9   TYR A N    6  
ATOM 7854  C CA   . TYR A 1 9   ? -1.432  -9.033  -7.859  1.00 0.00 ? 9   TYR A CA   6  
ATOM 7855  C C    . TYR A 1 9   ? -1.037  -10.496 -7.672  1.00 0.00 ? 9   TYR A C    6  
ATOM 7856  O O    . TYR A 1 9   ? -0.201  -10.804 -6.824  1.00 0.00 ? 9   TYR A O    6  
ATOM 7857  C CB   . TYR A 1 9   ? -2.469  -8.663  -6.782  1.00 0.00 ? 9   TYR A CB   6  
ATOM 7858  C CG   . TYR A 1 9   ? -3.849  -9.260  -6.995  1.00 0.00 ? 9   TYR A CG   6  
ATOM 7859  C CD1  . TYR A 1 9   ? -4.107  -10.606 -6.669  1.00 0.00 ? 9   TYR A CD1  6  
ATOM 7860  C CD2  . TYR A 1 9   ? -4.871  -8.473  -7.557  1.00 0.00 ? 9   TYR A CD2  6  
ATOM 7861  C CE1  . TYR A 1 9   ? -5.360  -11.174 -6.954  1.00 0.00 ? 9   TYR A CE1  6  
ATOM 7862  C CE2  . TYR A 1 9   ? -6.118  -9.039  -7.869  1.00 0.00 ? 9   TYR A CE2  6  
ATOM 7863  C CZ   . TYR A 1 9   ? -6.362  -10.398 -7.579  1.00 0.00 ? 9   TYR A CZ   6  
ATOM 7864  O OH   . TYR A 1 9   ? -7.582  -10.935 -7.848  1.00 0.00 ? 9   TYR A OH   6  
ATOM 7865  H H    . TYR A 1 9   ? -2.790  -8.172  -9.263  1.00 0.00 ? 9   TYR A H    6  
ATOM 7866  H HA   . TYR A 1 9   ? -0.542  -8.424  -7.699  1.00 0.00 ? 9   TYR A HA   6  
ATOM 7867  H HB2  . TYR A 1 9   ? -2.092  -9.003  -5.814  1.00 0.00 ? 9   TYR A HB2  6  
ATOM 7868  H HB3  . TYR A 1 9   ? -2.559  -7.579  -6.730  1.00 0.00 ? 9   TYR A HB3  6  
ATOM 7869  H HD1  . TYR A 1 9   ? -3.336  -11.222 -6.231  1.00 0.00 ? 9   TYR A HD1  6  
ATOM 7870  H HD2  . TYR A 1 9   ? -4.702  -7.427  -7.777  1.00 0.00 ? 9   TYR A HD2  6  
ATOM 7871  H HE1  . TYR A 1 9   ? -5.520  -12.217 -6.727  1.00 0.00 ? 9   TYR A HE1  6  
ATOM 7872  H HE2  . TYR A 1 9   ? -6.872  -8.432  -8.354  1.00 0.00 ? 9   TYR A HE2  6  
ATOM 7873  H HH   . TYR A 1 9   ? -7.529  -11.903 -7.947  1.00 0.00 ? 9   TYR A HH   6  
ATOM 7874  N N    . GLU A 1 10  ? -1.624  -11.405 -8.450  1.00 0.00 ? 10  GLU A N    6  
ATOM 7875  C CA   . GLU A 1 10  ? -1.373  -12.838 -8.406  1.00 0.00 ? 10  GLU A CA   6  
ATOM 7876  C C    . GLU A 1 10  ? 0.088   -13.180 -8.722  1.00 0.00 ? 10  GLU A C    6  
ATOM 7877  O O    . GLU A 1 10  ? 0.526   -14.303 -8.479  1.00 0.00 ? 10  GLU A O    6  
ATOM 7878  C CB   . GLU A 1 10  ? -2.288  -13.527 -9.418  1.00 0.00 ? 10  GLU A CB   6  
ATOM 7879  C CG   . GLU A 1 10  ? -3.781  -13.395 -9.077  1.00 0.00 ? 10  GLU A CG   6  
ATOM 7880  C CD   . GLU A 1 10  ? -4.696  -14.199 -10.004 1.00 0.00 ? 10  GLU A CD   6  
ATOM 7881  O OE1  . GLU A 1 10  ? -4.216  -14.720 -11.037 1.00 0.00 ? 10  GLU A OE1  6  
ATOM 7882  O OE2  . GLU A 1 10  ? -5.908  -14.286 -9.706  1.00 0.00 ? 10  GLU A OE2  6  
ATOM 7883  H H    . GLU A 1 10  ? -2.323  -11.066 -9.094  1.00 0.00 ? 10  GLU A H    6  
ATOM 7884  H HA   . GLU A 1 10  ? -1.605  -13.213 -7.408  1.00 0.00 ? 10  GLU A HA   6  
ATOM 7885  H HB2  . GLU A 1 10  ? -2.109  -13.097 -10.405 1.00 0.00 ? 10  GLU A HB2  6  
ATOM 7886  H HB3  . GLU A 1 10  ? -2.013  -14.576 -9.432  1.00 0.00 ? 10  GLU A HB3  6  
ATOM 7887  H HG2  . GLU A 1 10  ? -3.937  -13.730 -8.053  1.00 0.00 ? 10  GLU A HG2  6  
ATOM 7888  H HG3  . GLU A 1 10  ? -4.063  -12.346 -9.147  1.00 0.00 ? 10  GLU A HG3  6  
ATOM 7889  N N    . LEU A 1 11  ? 0.860   -12.242 -9.274  1.00 0.00 ? 11  LEU A N    6  
ATOM 7890  C CA   . LEU A 1 11  ? 2.310   -12.368 -9.390  1.00 0.00 ? 11  LEU A CA   6  
ATOM 7891  C C    . LEU A 1 11  ? 2.944   -12.308 -7.994  1.00 0.00 ? 11  LEU A C    6  
ATOM 7892  O O    . LEU A 1 11  ? 3.733   -13.176 -7.617  1.00 0.00 ? 11  LEU A O    6  
ATOM 7893  C CB   . LEU A 1 11  ? 2.849   -11.258 -10.320 1.00 0.00 ? 11  LEU A CB   6  
ATOM 7894  C CG   . LEU A 1 11  ? 4.193   -11.546 -11.021 1.00 0.00 ? 11  LEU A CG   6  
ATOM 7895  C CD1  . LEU A 1 11  ? 5.351   -11.890 -10.082 1.00 0.00 ? 11  LEU A CD1  6  
ATOM 7896  C CD2  . LEU A 1 11  ? 4.052   -12.663 -12.060 1.00 0.00 ? 11  LEU A CD2  6  
ATOM 7897  H H    . LEU A 1 11  ? 0.399   -11.378 -9.536  1.00 0.00 ? 11  LEU A H    6  
ATOM 7898  H HA   . LEU A 1 11  ? 2.528   -13.340 -9.822  1.00 0.00 ? 11  LEU A HA   6  
ATOM 7899  H HB2  . LEU A 1 11  ? 2.116   -11.072 -11.105 1.00 0.00 ? 11  LEU A HB2  6  
ATOM 7900  H HB3  . LEU A 1 11  ? 2.935   -10.326 -9.761  1.00 0.00 ? 11  LEU A HB3  6  
ATOM 7901  H HG   . LEU A 1 11  ? 4.475   -10.638 -11.551 1.00 0.00 ? 11  LEU A HG   6  
ATOM 7902  H HD11 . LEU A 1 11  ? 5.408   -11.176 -9.267  1.00 0.00 ? 11  LEU A HD11 6  
ATOM 7903  H HD12 . LEU A 1 11  ? 5.223   -12.889 -9.683  1.00 0.00 ? 11  LEU A HD12 6  
ATOM 7904  H HD13 . LEU A 1 11  ? 6.291   -11.861 -10.634 1.00 0.00 ? 11  LEU A HD13 6  
ATOM 7905  H HD21 . LEU A 1 11  ? 5.024   -12.844 -12.517 1.00 0.00 ? 11  LEU A HD21 6  
ATOM 7906  H HD22 . LEU A 1 11  ? 3.724   -13.588 -11.589 1.00 0.00 ? 11  LEU A HD22 6  
ATOM 7907  H HD23 . LEU A 1 11  ? 3.324   -12.365 -12.816 1.00 0.00 ? 11  LEU A HD23 6  
ATOM 7908  N N    . TYR A 1 12  ? 2.607   -11.275 -7.223  1.00 0.00 ? 12  TYR A N    6  
ATOM 7909  C CA   . TYR A 1 12  ? 3.254   -10.926 -5.960  1.00 0.00 ? 12  TYR A CA   6  
ATOM 7910  C C    . TYR A 1 12  ? 2.638   -11.652 -4.765  1.00 0.00 ? 12  TYR A C    6  
ATOM 7911  O O    . TYR A 1 12  ? 3.155   -11.527 -3.663  1.00 0.00 ? 12  TYR A O    6  
ATOM 7912  C CB   . TYR A 1 12  ? 3.222   -9.400  -5.754  1.00 0.00 ? 12  TYR A CB   6  
ATOM 7913  C CG   . TYR A 1 12  ? 3.713   -8.589  -6.945  1.00 0.00 ? 12  TYR A CG   6  
ATOM 7914  C CD1  . TYR A 1 12  ? 4.825   -9.028  -7.697  1.00 0.00 ? 12  TYR A CD1  6  
ATOM 7915  C CD2  . TYR A 1 12  ? 3.023   -7.423  -7.336  1.00 0.00 ? 12  TYR A CD2  6  
ATOM 7916  C CE1  . TYR A 1 12  ? 5.190   -8.360  -8.878  1.00 0.00 ? 12  TYR A CE1  6  
ATOM 7917  C CE2  . TYR A 1 12  ? 3.423   -6.714  -8.484  1.00 0.00 ? 12  TYR A CE2  6  
ATOM 7918  C CZ   . TYR A 1 12  ? 4.487   -7.203  -9.277  1.00 0.00 ? 12  TYR A CZ   6  
ATOM 7919  O OH   . TYR A 1 12  ? 4.863   -6.592  -10.433 1.00 0.00 ? 12  TYR A OH   6  
ATOM 7920  H H    . TYR A 1 12  ? 1.854   -10.681 -7.544  1.00 0.00 ? 12  TYR A H    6  
ATOM 7921  H HA   . TYR A 1 12  ? 4.298   -11.238 -6.010  1.00 0.00 ? 12  TYR A HA   6  
ATOM 7922  H HB2  . TYR A 1 12  ? 2.195   -9.107  -5.523  1.00 0.00 ? 12  TYR A HB2  6  
ATOM 7923  H HB3  . TYR A 1 12  ? 3.845   -9.154  -4.891  1.00 0.00 ? 12  TYR A HB3  6  
ATOM 7924  H HD1  . TYR A 1 12  ? 5.387   -9.902  -7.393  1.00 0.00 ? 12  TYR A HD1  6  
ATOM 7925  H HD2  . TYR A 1 12  ? 2.166   -7.074  -6.770  1.00 0.00 ? 12  TYR A HD2  6  
ATOM 7926  H HE1  . TYR A 1 12  ? 5.996   -8.748  -9.490  1.00 0.00 ? 12  TYR A HE1  6  
ATOM 7927  H HE2  . TYR A 1 12  ? 2.859   -5.833  -8.769  1.00 0.00 ? 12  TYR A HE2  6  
ATOM 7928  H HH   . TYR A 1 12  ? 4.266   -5.894  -10.763 1.00 0.00 ? 12  TYR A HH   6  
ATOM 7929  N N    . MET A 1 13  ? 1.569   -12.434 -4.951  1.00 0.00 ? 13  MET A N    6  
ATOM 7930  C CA   . MET A 1 13  ? 0.959   -13.200 -3.865  1.00 0.00 ? 13  MET A CA   6  
ATOM 7931  C C    . MET A 1 13  ? 1.970   -14.113 -3.166  1.00 0.00 ? 13  MET A C    6  
ATOM 7932  O O    . MET A 1 13  ? 1.935   -14.230 -1.939  1.00 0.00 ? 13  MET A O    6  
ATOM 7933  C CB   . MET A 1 13  ? -0.245  -14.003 -4.390  1.00 0.00 ? 13  MET A CB   6  
ATOM 7934  C CG   . MET A 1 13  ? -1.484  -13.107 -4.465  1.00 0.00 ? 13  MET A CG   6  
ATOM 7935  S SD   . MET A 1 13  ? -2.145  -12.642 -2.839  1.00 0.00 ? 13  MET A SD   6  
ATOM 7936  C CE   . MET A 1 13  ? -2.976  -11.099 -3.284  1.00 0.00 ? 13  MET A CE   6  
ATOM 7937  H H    . MET A 1 13  ? 1.137   -12.430 -5.866  1.00 0.00 ? 13  MET A H    6  
ATOM 7938  H HA   . MET A 1 13  ? 0.616   -12.487 -3.118  1.00 0.00 ? 13  MET A HA   6  
ATOM 7939  H HB2  . MET A 1 13  ? -0.018  -14.411 -5.378  1.00 0.00 ? 13  MET A HB2  6  
ATOM 7940  H HB3  . MET A 1 13  ? -0.460  -14.829 -3.710  1.00 0.00 ? 13  MET A HB3  6  
ATOM 7941  H HG2  . MET A 1 13  ? -1.226  -12.202 -5.013  1.00 0.00 ? 13  MET A HG2  6  
ATOM 7942  H HG3  . MET A 1 13  ? -2.265  -13.619 -5.025  1.00 0.00 ? 13  MET A HG3  6  
ATOM 7943  H HE1  . MET A 1 13  ? -3.821  -11.305 -3.938  1.00 0.00 ? 13  MET A HE1  6  
ATOM 7944  H HE2  . MET A 1 13  ? -3.324  -10.601 -2.378  1.00 0.00 ? 13  MET A HE2  6  
ATOM 7945  H HE3  . MET A 1 13  ? -2.274  -10.446 -3.803  1.00 0.00 ? 13  MET A HE3  6  
ATOM 7946  N N    . TYR A 1 14  ? 2.881   -14.721 -3.927  1.00 0.00 ? 14  TYR A N    6  
ATOM 7947  C CA   . TYR A 1 14  ? 3.772   -15.781 -3.455  1.00 0.00 ? 14  TYR A CA   6  
ATOM 7948  C C    . TYR A 1 14  ? 5.228   -15.300 -3.345  1.00 0.00 ? 14  TYR A C    6  
ATOM 7949  O O    . TYR A 1 14  ? 5.968   -15.673 -2.430  1.00 0.00 ? 14  TYR A O    6  
ATOM 7950  C CB   . TYR A 1 14  ? 3.670   -16.958 -4.433  1.00 0.00 ? 14  TYR A CB   6  
ATOM 7951  C CG   . TYR A 1 14  ? 2.319   -17.159 -5.100  1.00 0.00 ? 14  TYR A CG   6  
ATOM 7952  C CD1  . TYR A 1 14  ? 1.225   -17.651 -4.367  1.00 0.00 ? 14  TYR A CD1  6  
ATOM 7953  C CD2  . TYR A 1 14  ? 2.153   -16.809 -6.454  1.00 0.00 ? 14  TYR A CD2  6  
ATOM 7954  C CE1  . TYR A 1 14  ? -0.016  -17.842 -4.998  1.00 0.00 ? 14  TYR A CE1  6  
ATOM 7955  C CE2  . TYR A 1 14  ? 0.918   -17.019 -7.092  1.00 0.00 ? 14  TYR A CE2  6  
ATOM 7956  C CZ   . TYR A 1 14  ? -0.175  -17.535 -6.366  1.00 0.00 ? 14  TYR A CZ   6  
ATOM 7957  O OH   . TYR A 1 14  ? -1.374  -17.771 -6.970  1.00 0.00 ? 14  TYR A OH   6  
ATOM 7958  H H    . TYR A 1 14  ? 2.818   -14.579 -4.925  1.00 0.00 ? 14  TYR A H    6  
ATOM 7959  H HA   . TYR A 1 14  ? 3.444   -16.121 -2.474  1.00 0.00 ? 14  TYR A HA   6  
ATOM 7960  H HB2  . TYR A 1 14  ? 4.397   -16.796 -5.222  1.00 0.00 ? 14  TYR A HB2  6  
ATOM 7961  H HB3  . TYR A 1 14  ? 3.958   -17.870 -3.914  1.00 0.00 ? 14  TYR A HB3  6  
ATOM 7962  H HD1  . TYR A 1 14  ? 1.333   -17.879 -3.317  1.00 0.00 ? 14  TYR A HD1  6  
ATOM 7963  H HD2  . TYR A 1 14  ? 2.982   -16.395 -7.020  1.00 0.00 ? 14  TYR A HD2  6  
ATOM 7964  H HE1  . TYR A 1 14  ? -0.843  -18.237 -4.433  1.00 0.00 ? 14  TYR A HE1  6  
ATOM 7965  H HE2  . TYR A 1 14  ? 0.823   -16.782 -8.140  1.00 0.00 ? 14  TYR A HE2  6  
ATOM 7966  H HH   . TYR A 1 14  ? -1.389  -17.553 -7.923  1.00 0.00 ? 14  TYR A HH   6  
ATOM 7967  N N    . ARG A 1 15  ? 5.622   -14.442 -4.290  1.00 0.00 ? 15  ARG A N    6  
ATOM 7968  C CA   . ARG A 1 15  ? 6.908   -13.756 -4.330  1.00 0.00 ? 15  ARG A CA   6  
ATOM 7969  C C    . ARG A 1 15  ? 7.004   -12.778 -3.161  1.00 0.00 ? 15  ARG A C    6  
ATOM 7970  O O    . ARG A 1 15  ? 5.978   -12.308 -2.667  1.00 0.00 ? 15  ARG A O    6  
ATOM 7971  C CB   . ARG A 1 15  ? 6.995   -12.983 -5.664  1.00 0.00 ? 15  ARG A CB   6  
ATOM 7972  C CG   . ARG A 1 15  ? 8.083   -13.460 -6.628  1.00 0.00 ? 15  ARG A CG   6  
ATOM 7973  C CD   . ARG A 1 15  ? 9.520   -13.298 -6.101  1.00 0.00 ? 15  ARG A CD   6  
ATOM 7974  N NE   . ARG A 1 15  ? 10.462  -13.048 -7.205  1.00 0.00 ? 15  ARG A NE   6  
ATOM 7975  C CZ   . ARG A 1 15  ? 10.634  -13.834 -8.277  1.00 0.00 ? 15  ARG A CZ   6  
ATOM 7976  N NH1  . ARG A 1 15  ? 10.276  -15.113 -8.270  1.00 0.00 ? 15  ARG A NH1  6  
ATOM 7977  N NH2  . ARG A 1 15  ? 11.162  -13.335 -9.383  1.00 0.00 ? 15  ARG A NH2  6  
ATOM 7978  H H    . ARG A 1 15  ? 4.935   -14.150 -4.967  1.00 0.00 ? 15  ARG A H    6  
ATOM 7979  H HA   . ARG A 1 15  ? 7.711   -14.492 -4.247  1.00 0.00 ? 15  ARG A HA   6  
ATOM 7980  H HB2  . ARG A 1 15  ? 6.041   -13.060 -6.190  1.00 0.00 ? 15  ARG A HB2  6  
ATOM 7981  H HB3  . ARG A 1 15  ? 7.148   -11.920 -5.474  1.00 0.00 ? 15  ARG A HB3  6  
ATOM 7982  H HG2  . ARG A 1 15  ? 7.911   -14.508 -6.868  1.00 0.00 ? 15  ARG A HG2  6  
ATOM 7983  H HG3  . ARG A 1 15  ? 7.968   -12.879 -7.545  1.00 0.00 ? 15  ARG A HG3  6  
ATOM 7984  H HD2  . ARG A 1 15  ? 9.560   -12.443 -5.425  1.00 0.00 ? 15  ARG A HD2  6  
ATOM 7985  H HD3  . ARG A 1 15  ? 9.809   -14.199 -5.558  1.00 0.00 ? 15  ARG A HD3  6  
ATOM 7986  H HE   . ARG A 1 15  ? 10.786  -12.081 -7.244  1.00 0.00 ? 15  ARG A HE   6  
ATOM 7987  H HH11 . ARG A 1 15  ? 10.045  -15.603 -7.401  1.00 0.00 ? 15  ARG A HH11 6  
ATOM 7988  H HH12 . ARG A 1 15  ? 10.263  -15.650 -9.135  1.00 0.00 ? 15  ARG A HH12 6  
ATOM 7989  H HH21 . ARG A 1 15  ? 11.505  -12.373 -9.416  1.00 0.00 ? 15  ARG A HH21 6  
ATOM 7990  H HH22 . ARG A 1 15  ? 11.117  -13.866 -10.249 1.00 0.00 ? 15  ARG A HH22 6  
ATOM 7991  N N    . GLU A 1 16  ? 8.221   -12.404 -2.780  1.00 0.00 ? 16  GLU A N    6  
ATOM 7992  C CA   . GLU A 1 16  ? 8.463   -11.170 -2.042  1.00 0.00 ? 16  GLU A CA   6  
ATOM 7993  C C    . GLU A 1 16  ? 8.573   -9.985  -3.001  1.00 0.00 ? 16  GLU A C    6  
ATOM 7994  O O    . GLU A 1 16  ? 8.582   -10.145 -4.222  1.00 0.00 ? 16  GLU A O    6  
ATOM 7995  C CB   . GLU A 1 16  ? 9.724   -11.304 -1.168  1.00 0.00 ? 16  GLU A CB   6  
ATOM 7996  C CG   . GLU A 1 16  ? 9.502   -12.226 0.040   1.00 0.00 ? 16  GLU A CG   6  
ATOM 7997  C CD   . GLU A 1 16  ? 10.148  -13.604 -0.022  1.00 0.00 ? 16  GLU A CD   6  
ATOM 7998  O OE1  . GLU A 1 16  ? 11.285  -13.733 -0.533  1.00 0.00 ? 16  GLU A OE1  6  
ATOM 7999  O OE2  . GLU A 1 16  ? 9.571   -14.545 0.572   1.00 0.00 ? 16  GLU A OE2  6  
ATOM 8000  H H    . GLU A 1 16  ? 9.035   -12.864 -3.181  1.00 0.00 ? 16  GLU A H    6  
ATOM 8001  H HA   . GLU A 1 16  ? 7.617   -10.953 -1.404  1.00 0.00 ? 16  GLU A HA   6  
ATOM 8002  H HB2  . GLU A 1 16  ? 10.565  -11.636 -1.772  1.00 0.00 ? 16  GLU A HB2  6  
ATOM 8003  H HB3  . GLU A 1 16  ? 9.987   -10.324 -0.770  1.00 0.00 ? 16  GLU A HB3  6  
ATOM 8004  H HG2  . GLU A 1 16  ? 9.863   -11.719 0.935   1.00 0.00 ? 16  GLU A HG2  6  
ATOM 8005  H HG3  . GLU A 1 16  ? 8.442   -12.391 0.164   1.00 0.00 ? 16  GLU A HG3  6  
ATOM 8006  N N    . VAL A 1 17  ? 8.719   -8.791  -2.434  1.00 0.00 ? 17  VAL A N    6  
ATOM 8007  C CA   . VAL A 1 17  ? 9.222   -7.604  -3.101  1.00 0.00 ? 17  VAL A CA   6  
ATOM 8008  C C    . VAL A 1 17  ? 10.190  -6.941  -2.120  1.00 0.00 ? 17  VAL A C    6  
ATOM 8009  O O    . VAL A 1 17  ? 10.072  -7.125  -0.903  1.00 0.00 ? 17  VAL A O    6  
ATOM 8010  C CB   . VAL A 1 17  ? 8.041   -6.705  -3.531  1.00 0.00 ? 17  VAL A CB   6  
ATOM 8011  C CG1  . VAL A 1 17  ? 7.153   -6.298  -2.347  1.00 0.00 ? 17  VAL A CG1  6  
ATOM 8012  C CG2  . VAL A 1 17  ? 8.503   -5.438  -4.262  1.00 0.00 ? 17  VAL A CG2  6  
ATOM 8013  H H    . VAL A 1 17  ? 8.714   -8.724  -1.426  1.00 0.00 ? 17  VAL A H    6  
ATOM 8014  H HA   . VAL A 1 17  ? 9.770   -7.927  -3.984  1.00 0.00 ? 17  VAL A HA   6  
ATOM 8015  H HB   . VAL A 1 17  ? 7.426   -7.285  -4.220  1.00 0.00 ? 17  VAL A HB   6  
ATOM 8016  H HG11 . VAL A 1 17  ? 6.372   -5.620  -2.677  1.00 0.00 ? 17  VAL A HG11 6  
ATOM 8017  H HG12 . VAL A 1 17  ? 6.683   -7.187  -1.937  1.00 0.00 ? 17  VAL A HG12 6  
ATOM 8018  H HG13 . VAL A 1 17  ? 7.739   -5.804  -1.577  1.00 0.00 ? 17  VAL A HG13 6  
ATOM 8019  H HG21 . VAL A 1 17  ? 7.640   -4.928  -4.686  1.00 0.00 ? 17  VAL A HG21 6  
ATOM 8020  H HG22 . VAL A 1 17  ? 9.006   -4.750  -3.582  1.00 0.00 ? 17  VAL A HG22 6  
ATOM 8021  H HG23 . VAL A 1 17  ? 9.177   -5.709  -5.075  1.00 0.00 ? 17  VAL A HG23 6  
ATOM 8022  N N    . ASP A 1 18  ? 11.139  -6.157  -2.615  1.00 0.00 ? 18  ASP A N    6  
ATOM 8023  C CA   . ASP A 1 18  ? 11.948  -5.270  -1.796  1.00 0.00 ? 18  ASP A CA   6  
ATOM 8024  C C    . ASP A 1 18  ? 11.074  -4.102  -1.347  1.00 0.00 ? 18  ASP A C    6  
ATOM 8025  O O    . ASP A 1 18  ? 10.913  -3.135  -2.084  1.00 0.00 ? 18  ASP A O    6  
ATOM 8026  C CB   . ASP A 1 18  ? 13.199  -4.821  -2.566  1.00 0.00 ? 18  ASP A CB   6  
ATOM 8027  C CG   . ASP A 1 18  ? 14.343  -5.817  -2.386  1.00 0.00 ? 18  ASP A CG   6  
ATOM 8028  O OD1  . ASP A 1 18  ? 14.797  -5.967  -1.225  1.00 0.00 ? 18  ASP A OD1  6  
ATOM 8029  O OD2  . ASP A 1 18  ? 14.834  -6.406  -3.373  1.00 0.00 ? 18  ASP A OD2  6  
ATOM 8030  H H    . ASP A 1 18  ? 11.201  -6.050  -3.619  1.00 0.00 ? 18  ASP A H    6  
ATOM 8031  H HA   . ASP A 1 18  ? 12.280  -5.811  -0.917  1.00 0.00 ? 18  ASP A HA   6  
ATOM 8032  H HB2  . ASP A 1 18  ? 12.979  -4.662  -3.620  1.00 0.00 ? 18  ASP A HB2  6  
ATOM 8033  H HB3  . ASP A 1 18  ? 13.528  -3.860  -2.184  1.00 0.00 ? 18  ASP A HB3  6  
ATOM 8034  N N    . THR A 1 19  ? 10.442  -4.188  -0.171  1.00 0.00 ? 19  THR A N    6  
ATOM 8035  C CA   . THR A 1 19  ? 9.459   -3.183  0.240   1.00 0.00 ? 19  THR A CA   6  
ATOM 8036  C C    . THR A 1 19  ? 10.083  -1.793  0.442   1.00 0.00 ? 19  THR A C    6  
ATOM 8037  O O    . THR A 1 19  ? 9.405   -0.779  0.269   1.00 0.00 ? 19  THR A O    6  
ATOM 8038  C CB   . THR A 1 19  ? 8.716   -3.641  1.504   1.00 0.00 ? 19  THR A CB   6  
ATOM 8039  O OG1  . THR A 1 19  ? 9.614   -4.159  2.460   1.00 0.00 ? 19  THR A OG1  6  
ATOM 8040  C CG2  . THR A 1 19  ? 7.691   -4.727  1.187   1.00 0.00 ? 19  THR A CG2  6  
ATOM 8041  H H    . THR A 1 19  ? 10.542  -5.007  0.419   1.00 0.00 ? 19  THR A H    6  
ATOM 8042  H HA   . THR A 1 19  ? 8.726   -3.088  -0.561  1.00 0.00 ? 19  THR A HA   6  
ATOM 8043  H HB   . THR A 1 19  ? 8.190   -2.787  1.934   1.00 0.00 ? 19  THR A HB   6  
ATOM 8044  H HG1  . THR A 1 19  ? 9.165   -4.123  3.325   1.00 0.00 ? 19  THR A HG1  6  
ATOM 8045  H HG21 . THR A 1 19  ? 6.957   -4.336  0.479   1.00 0.00 ? 19  THR A HG21 6  
ATOM 8046  H HG22 . THR A 1 19  ? 8.196   -5.589  0.748   1.00 0.00 ? 19  THR A HG22 6  
ATOM 8047  H HG23 . THR A 1 19  ? 7.182   -5.023  2.106   1.00 0.00 ? 19  THR A HG23 6  
ATOM 8048  N N    . LEU A 1 20  ? 11.368  -1.710  0.788   1.00 0.00 ? 20  LEU A N    6  
ATOM 8049  C CA   . LEU A 1 20  ? 12.090  -0.467  0.943   1.00 0.00 ? 20  LEU A CA   6  
ATOM 8050  C C    . LEU A 1 20  ? 12.168  0.228   -0.415  1.00 0.00 ? 20  LEU A C    6  
ATOM 8051  O O    . LEU A 1 20  ? 11.831  1.411   -0.517  1.00 0.00 ? 20  LEU A O    6  
ATOM 8052  C CB   . LEU A 1 20  ? 13.489  -0.778  1.483   1.00 0.00 ? 20  LEU A CB   6  
ATOM 8053  C CG   . LEU A 1 20  ? 13.649  -1.076  2.984   1.00 0.00 ? 20  LEU A CG   6  
ATOM 8054  C CD1  . LEU A 1 20  ? 13.428  0.199   3.800   1.00 0.00 ? 20  LEU A CD1  6  
ATOM 8055  C CD2  . LEU A 1 20  ? 12.750  -2.209  3.501   1.00 0.00 ? 20  LEU A CD2  6  
ATOM 8056  H H    . LEU A 1 20  ? 11.934  -2.535  0.897   1.00 0.00 ? 20  LEU A H    6  
ATOM 8057  H HA   . LEU A 1 20  ? 11.567  0.186   1.632   1.00 0.00 ? 20  LEU A HA   6  
ATOM 8058  H HB2  . LEU A 1 20  ? 13.920  -1.596  0.913   1.00 0.00 ? 20  LEU A HB2  6  
ATOM 8059  H HB3  . LEU A 1 20  ? 14.084  0.093   1.274   1.00 0.00 ? 20  LEU A HB3  6  
ATOM 8060  H HG   . LEU A 1 20  ? 14.683  -1.386  3.141   1.00 0.00 ? 20  LEU A HG   6  
ATOM 8061  H HD11 . LEU A 1 20  ? 12.402  0.548   3.720   1.00 0.00 ? 20  LEU A HD11 6  
ATOM 8062  H HD12 . LEU A 1 20  ? 13.671  -0.005  4.841   1.00 0.00 ? 20  LEU A HD12 6  
ATOM 8063  H HD13 . LEU A 1 20  ? 14.095  0.979   3.433   1.00 0.00 ? 20  LEU A HD13 6  
ATOM 8064  H HD21 . LEU A 1 20  ? 12.978  -2.412  4.545   1.00 0.00 ? 20  LEU A HD21 6  
ATOM 8065  H HD22 . LEU A 1 20  ? 11.698  -1.949  3.425   1.00 0.00 ? 20  LEU A HD22 6  
ATOM 8066  H HD23 . LEU A 1 20  ? 12.938  -3.117  2.930   1.00 0.00 ? 20  LEU A HD23 6  
ATOM 8067  N N    . GLU A 1 21  ? 12.563  -0.523  -1.440  1.00 0.00 ? 21  GLU A N    6  
ATOM 8068  C CA   . GLU A 1 21  ? 12.688  -0.094  -2.824  1.00 0.00 ? 21  GLU A CA   6  
ATOM 8069  C C    . GLU A 1 21  ? 11.323  0.263   -3.397  1.00 0.00 ? 21  GLU A C    6  
ATOM 8070  O O    . GLU A 1 21  ? 11.173  1.290   -4.047  1.00 0.00 ? 21  GLU A O    6  
ATOM 8071  C CB   . GLU A 1 21  ? 13.332  -1.240  -3.600  1.00 0.00 ? 21  GLU A CB   6  
ATOM 8072  C CG   . GLU A 1 21  ? 13.520  -1.000  -5.092  1.00 0.00 ? 21  GLU A CG   6  
ATOM 8073  C CD   . GLU A 1 21  ? 14.767  -0.176  -5.389  1.00 0.00 ? 21  GLU A CD   6  
ATOM 8074  O OE1  . GLU A 1 21  ? 15.004  0.865   -4.729  1.00 0.00 ? 21  GLU A OE1  6  
ATOM 8075  O OE2  . GLU A 1 21  ? 15.517  -0.598  -6.293  1.00 0.00 ? 21  GLU A OE2  6  
ATOM 8076  H H    . GLU A 1 21  ? 12.780  -1.496  -1.273  1.00 0.00 ? 21  GLU A H    6  
ATOM 8077  H HA   . GLU A 1 21  ? 13.345  0.770   -2.884  1.00 0.00 ? 21  GLU A HA   6  
ATOM 8078  H HB2  . GLU A 1 21  ? 14.297  -1.436  -3.160  1.00 0.00 ? 21  GLU A HB2  6  
ATOM 8079  H HB3  . GLU A 1 21  ? 12.724  -2.126  -3.489  1.00 0.00 ? 21  GLU A HB3  6  
ATOM 8080  H HG2  . GLU A 1 21  ? 13.627  -1.975  -5.560  1.00 0.00 ? 21  GLU A HG2  6  
ATOM 8081  H HG3  . GLU A 1 21  ? 12.632  -0.552  -5.521  1.00 0.00 ? 21  GLU A HG3  6  
ATOM 8082  N N    . LEU A 1 22  ? 10.300  -0.533  -3.089  1.00 0.00 ? 22  LEU A N    6  
ATOM 8083  C CA   . LEU A 1 22  ? 8.929   -0.248  -3.477  1.00 0.00 ? 22  LEU A CA   6  
ATOM 8084  C C    . LEU A 1 22  ? 8.552   1.169   -3.051  1.00 0.00 ? 22  LEU A C    6  
ATOM 8085  O O    . LEU A 1 22  ? 8.182   1.979   -3.893  1.00 0.00 ? 22  LEU A O    6  
ATOM 8086  C CB   . LEU A 1 22  ? 8.012   -1.311  -2.870  1.00 0.00 ? 22  LEU A CB   6  
ATOM 8087  C CG   . LEU A 1 22  ? 6.516   -0.999  -2.982  1.00 0.00 ? 22  LEU A CG   6  
ATOM 8088  C CD1  . LEU A 1 22  ? 6.080   -0.840  -4.439  1.00 0.00 ? 22  LEU A CD1  6  
ATOM 8089  C CD2  . LEU A 1 22  ? 5.759   -2.127  -2.278  1.00 0.00 ? 22  LEU A CD2  6  
ATOM 8090  H H    . LEU A 1 22  ? 10.517  -1.417  -2.633  1.00 0.00 ? 22  LEU A H    6  
ATOM 8091  H HA   . LEU A 1 22  ? 8.866   -0.306  -4.565  1.00 0.00 ? 22  LEU A HA   6  
ATOM 8092  H HB2  . LEU A 1 22  ? 8.226   -2.268  -3.346  1.00 0.00 ? 22  LEU A HB2  6  
ATOM 8093  H HB3  . LEU A 1 22  ? 8.247   -1.401  -1.818  1.00 0.00 ? 22  LEU A HB3  6  
ATOM 8094  H HG   . LEU A 1 22  ? 6.294   -0.076  -2.449  1.00 0.00 ? 22  LEU A HG   6  
ATOM 8095  H HD11 . LEU A 1 22  ? 6.537   0.051   -4.870  1.00 0.00 ? 22  LEU A HD11 6  
ATOM 8096  H HD12 . LEU A 1 22  ? 6.394   -1.702  -5.027  1.00 0.00 ? 22  LEU A HD12 6  
ATOM 8097  H HD13 . LEU A 1 22  ? 5.003   -0.719  -4.492  1.00 0.00 ? 22  LEU A HD13 6  
ATOM 8098  H HD21 . LEU A 1 22  ? 4.689   -1.920  -2.308  1.00 0.00 ? 22  LEU A HD21 6  
ATOM 8099  H HD22 . LEU A 1 22  ? 5.970   -3.078  -2.767  1.00 0.00 ? 22  LEU A HD22 6  
ATOM 8100  H HD23 . LEU A 1 22  ? 6.085   -2.197  -1.241  1.00 0.00 ? 22  LEU A HD23 6  
ATOM 8101  N N    . THR A 1 23  ? 8.675   1.506   -1.764  1.00 0.00 ? 23  THR A N    6  
ATOM 8102  C CA   . THR A 1 23  ? 8.324   2.858   -1.320  1.00 0.00 ? 23  THR A CA   6  
ATOM 8103  C C    . THR A 1 23  ? 9.175   3.921   -2.029  1.00 0.00 ? 23  THR A C    6  
ATOM 8104  O O    . THR A 1 23  ? 8.682   5.011   -2.301  1.00 0.00 ? 23  THR A O    6  
ATOM 8105  C CB   . THR A 1 23  ? 8.466   3.008   0.193   1.00 0.00 ? 23  THR A CB   6  
ATOM 8106  O OG1  . THR A 1 23  ? 9.774   2.762   0.667   1.00 0.00 ? 23  THR A OG1  6  
ATOM 8107  C CG2  . THR A 1 23  ? 7.519   2.054   0.895   1.00 0.00 ? 23  THR A CG2  6  
ATOM 8108  H H    . THR A 1 23  ? 9.012   0.812   -1.105  1.00 0.00 ? 23  THR A H    6  
ATOM 8109  H HA   . THR A 1 23  ? 7.261   3.020   -1.552  1.00 0.00 ? 23  THR A HA   6  
ATOM 8110  H HB   . THR A 1 23  ? 8.186   4.026   0.465   1.00 0.00 ? 23  THR A HB   6  
ATOM 8111  H HG1  . THR A 1 23  ? 10.186  2.032   0.169   1.00 0.00 ? 23  THR A HG1  6  
ATOM 8112  H HG21 . THR A 1 23  ? 7.861   1.038   0.724   1.00 0.00 ? 23  THR A HG21 6  
ATOM 8113  H HG22 . THR A 1 23  ? 7.535   2.272   1.958   1.00 0.00 ? 23  THR A HG22 6  
ATOM 8114  H HG23 . THR A 1 23  ? 6.513   2.173   0.495   1.00 0.00 ? 23  THR A HG23 6  
ATOM 8115  N N    . ARG A 1 24  ? 10.448  3.616   -2.303  1.00 0.00 ? 24  ARG A N    6  
ATOM 8116  C CA   . ARG A 1 24  ? 11.365  4.497   -3.039  1.00 0.00 ? 24  ARG A CA   6  
ATOM 8117  C C    . ARG A 1 24  ? 10.812  4.845   -4.415  1.00 0.00 ? 24  ARG A C    6  
ATOM 8118  O O    . ARG A 1 24  ? 10.568  6.025   -4.678  1.00 0.00 ? 24  ARG A O    6  
ATOM 8119  C CB   . ARG A 1 24  ? 12.787  3.911   -3.121  1.00 0.00 ? 24  ARG A CB   6  
ATOM 8120  C CG   . ARG A 1 24  ? 13.569  4.334   -1.875  1.00 0.00 ? 24  ARG A CG   6  
ATOM 8121  C CD   . ARG A 1 24  ? 14.584  3.287   -1.417  1.00 0.00 ? 24  ARG A CD   6  
ATOM 8122  N NE   . ARG A 1 24  ? 15.182  3.719   -0.142  1.00 0.00 ? 24  ARG A NE   6  
ATOM 8123  C CZ   . ARG A 1 24  ? 14.545  3.808   1.032   1.00 0.00 ? 24  ARG A CZ   6  
ATOM 8124  N NH1  . ARG A 1 24  ? 13.348  3.255   1.213   1.00 0.00 ? 24  ARG A NH1  6  
ATOM 8125  N NH2  . ARG A 1 24  ? 15.078  4.515   2.015   1.00 0.00 ? 24  ARG A NH2  6  
ATOM 8126  H H    . ARG A 1 24  ? 10.721  2.674   -2.038  1.00 0.00 ? 24  ARG A H    6  
ATOM 8127  H HA   . ARG A 1 24  ? 11.436  5.428   -2.488  1.00 0.00 ? 24  ARG A HA   6  
ATOM 8128  H HB2  . ARG A 1 24  ? 12.766  2.825   -3.216  1.00 0.00 ? 24  ARG A HB2  6  
ATOM 8129  H HB3  . ARG A 1 24  ? 13.295  4.299   -4.004  1.00 0.00 ? 24  ARG A HB3  6  
ATOM 8130  H HG2  . ARG A 1 24  ? 14.087  5.266   -2.090  1.00 0.00 ? 24  ARG A HG2  6  
ATOM 8131  H HG3  . ARG A 1 24  ? 12.865  4.519   -1.060  1.00 0.00 ? 24  ARG A HG3  6  
ATOM 8132  H HD2  . ARG A 1 24  ? 14.059  2.342   -1.280  1.00 0.00 ? 24  ARG A HD2  6  
ATOM 8133  H HD3  . ARG A 1 24  ? 15.368  3.170   -2.172  1.00 0.00 ? 24  ARG A HD3  6  
ATOM 8134  H HE   . ARG A 1 24  ? 16.086  4.183   -0.202  1.00 0.00 ? 24  ARG A HE   6  
ATOM 8135  H HH11 . ARG A 1 24  ? 12.945  2.658   0.498   1.00 0.00 ? 24  ARG A HH11 6  
ATOM 8136  H HH12 . ARG A 1 24  ? 12.783  3.509   2.021   1.00 0.00 ? 24  ARG A HH12 6  
ATOM 8137  H HH21 . ARG A 1 24  ? 16.018  4.909   1.941   1.00 0.00 ? 24  ARG A HH21 6  
ATOM 8138  H HH22 . ARG A 1 24  ? 14.600  4.651   2.906   1.00 0.00 ? 24  ARG A HH22 6  
ATOM 8139  N N    . GLN A 1 25  ? 10.562  3.839   -5.246  1.00 0.00 ? 25  GLN A N    6  
ATOM 8140  C CA   . GLN A 1 25  ? 10.022  3.980   -6.593  1.00 0.00 ? 25  GLN A CA   6  
ATOM 8141  C C    . GLN A 1 25  ? 8.699   4.743   -6.560  1.00 0.00 ? 25  GLN A C    6  
ATOM 8142  O O    . GLN A 1 25  ? 8.451   5.620   -7.387  1.00 0.00 ? 25  GLN A O    6  
ATOM 8143  C CB   . GLN A 1 25  ? 9.819   2.588   -7.204  1.00 0.00 ? 25  GLN A CB   6  
ATOM 8144  C CG   . GLN A 1 25  ? 11.126  1.818   -7.385  1.00 0.00 ? 25  GLN A CG   6  
ATOM 8145  C CD   . GLN A 1 25  ? 11.965  2.253   -8.586  1.00 0.00 ? 25  GLN A CD   6  
ATOM 8146  O OE1  . GLN A 1 25  ? 11.628  3.185   -9.322  1.00 0.00 ? 25  GLN A OE1  6  
ATOM 8147  N NE2  . GLN A 1 25  ? 13.048  1.549   -8.854  1.00 0.00 ? 25  GLN A NE2  6  
ATOM 8148  H H    . GLN A 1 25  ? 10.812  2.906   -4.930  1.00 0.00 ? 25  GLN A H    6  
ATOM 8149  H HA   . GLN A 1 25  ? 10.739  4.524   -7.203  1.00 0.00 ? 25  GLN A HA   6  
ATOM 8150  H HB2  . GLN A 1 25  ? 9.170   2.009   -6.550  1.00 0.00 ? 25  GLN A HB2  6  
ATOM 8151  H HB3  . GLN A 1 25  ? 9.335   2.679   -8.170  1.00 0.00 ? 25  GLN A HB3  6  
ATOM 8152  H HG2  . GLN A 1 25  ? 11.709  1.929   -6.490  1.00 0.00 ? 25  GLN A HG2  6  
ATOM 8153  H HG3  . GLN A 1 25  ? 10.898  0.763   -7.468  1.00 0.00 ? 25  GLN A HG3  6  
ATOM 8154  H HE21 . GLN A 1 25  ? 13.351  0.829   -8.213  1.00 0.00 ? 25  GLN A HE21 6  
ATOM 8155  H HE22 . GLN A 1 25  ? 13.706  1.907   -9.537  1.00 0.00 ? 25  GLN A HE22 6  
ATOM 8156  N N    . VAL A 1 26  ? 7.842   4.412   -5.590  1.00 0.00 ? 26  VAL A N    6  
ATOM 8157  C CA   . VAL A 1 26  ? 6.548   5.048   -5.388  1.00 0.00 ? 26  VAL A CA   6  
ATOM 8158  C C    . VAL A 1 26  ? 6.761   6.542   -5.127  1.00 0.00 ? 26  VAL A C    6  
ATOM 8159  O O    . VAL A 1 26  ? 6.233   7.361   -5.876  1.00 0.00 ? 26  VAL A O    6  
ATOM 8160  C CB   . VAL A 1 26  ? 5.800   4.308   -4.261  1.00 0.00 ? 26  VAL A CB   6  
ATOM 8161  C CG1  . VAL A 1 26  ? 4.531   5.034   -3.795  1.00 0.00 ? 26  VAL A CG1  6  
ATOM 8162  C CG2  . VAL A 1 26  ? 5.445   2.885   -4.720  1.00 0.00 ? 26  VAL A CG2  6  
ATOM 8163  H H    . VAL A 1 26  ? 8.094   3.644   -4.972  1.00 0.00 ? 26  VAL A H    6  
ATOM 8164  H HA   . VAL A 1 26  ? 5.972   4.950   -6.312  1.00 0.00 ? 26  VAL A HA   6  
ATOM 8165  H HB   . VAL A 1 26  ? 6.462   4.226   -3.402  1.00 0.00 ? 26  VAL A HB   6  
ATOM 8166  H HG11 . VAL A 1 26  ? 3.889   5.258   -4.649  1.00 0.00 ? 26  VAL A HG11 6  
ATOM 8167  H HG12 . VAL A 1 26  ? 3.982   4.411   -3.091  1.00 0.00 ? 26  VAL A HG12 6  
ATOM 8168  H HG13 . VAL A 1 26  ? 4.801   5.962   -3.291  1.00 0.00 ? 26  VAL A HG13 6  
ATOM 8169  H HG21 . VAL A 1 26  ? 4.582   2.893   -5.376  1.00 0.00 ? 26  VAL A HG21 6  
ATOM 8170  H HG22 . VAL A 1 26  ? 6.258   2.437   -5.277  1.00 0.00 ? 26  VAL A HG22 6  
ATOM 8171  H HG23 . VAL A 1 26  ? 5.264   2.253   -3.853  1.00 0.00 ? 26  VAL A HG23 6  
ATOM 8172  N N    . LYS A 1 27  ? 7.531   6.924   -4.098  1.00 0.00 ? 27  LYS A N    6  
ATOM 8173  C CA   . LYS A 1 27  ? 7.814   8.321   -3.793  1.00 0.00 ? 27  LYS A CA   6  
ATOM 8174  C C    . LYS A 1 27  ? 8.389   9.053   -5.004  1.00 0.00 ? 27  LYS A C    6  
ATOM 8175  O O    . LYS A 1 27  ? 7.959   10.179  -5.258  1.00 0.00 ? 27  LYS A O    6  
ATOM 8176  C CB   . LYS A 1 27  ? 8.785   8.408   -2.614  1.00 0.00 ? 27  LYS A CB   6  
ATOM 8177  C CG   . LYS A 1 27  ? 8.147   8.014   -1.276  1.00 0.00 ? 27  LYS A CG   6  
ATOM 8178  C CD   . LYS A 1 27  ? 9.170   8.000   -0.133  1.00 0.00 ? 27  LYS A CD   6  
ATOM 8179  C CE   . LYS A 1 27  ? 10.343  7.025   -0.310  1.00 0.00 ? 27  LYS A CE   6  
ATOM 8180  N NZ   . LYS A 1 27  ? 11.300  7.095   0.817   1.00 0.00 ? 27  LYS A NZ   6  
ATOM 8181  H H    . LYS A 1 27  ? 7.971   6.237   -3.486  1.00 0.00 ? 27  LYS A H    6  
ATOM 8182  H HA   . LYS A 1 27  ? 6.881   8.809   -3.519  1.00 0.00 ? 27  LYS A HA   6  
ATOM 8183  H HB2  . LYS A 1 27  ? 9.620   7.748   -2.825  1.00 0.00 ? 27  LYS A HB2  6  
ATOM 8184  H HB3  . LYS A 1 27  ? 9.152   9.432   -2.537  1.00 0.00 ? 27  LYS A HB3  6  
ATOM 8185  H HG2  . LYS A 1 27  ? 7.376   8.748   -1.039  1.00 0.00 ? 27  LYS A HG2  6  
ATOM 8186  H HG3  . LYS A 1 27  ? 7.672   7.037   -1.346  1.00 0.00 ? 27  LYS A HG3  6  
ATOM 8187  H HD2  . LYS A 1 27  ? 9.558   9.008   -0.025  1.00 0.00 ? 27  LYS A HD2  6  
ATOM 8188  H HD3  . LYS A 1 27  ? 8.644   7.734   0.775   1.00 0.00 ? 27  LYS A HD3  6  
ATOM 8189  H HE2  . LYS A 1 27  ? 9.960   6.010   -0.405  1.00 0.00 ? 27  LYS A HE2  6  
ATOM 8190  H HE3  . LYS A 1 27  ? 10.871  7.276   -1.226  1.00 0.00 ? 27  LYS A HE3  6  
ATOM 8191  H HZ1  . LYS A 1 27  ? 11.038  7.838   1.460   1.00 0.00 ? 27  LYS A HZ1  6  
ATOM 8192  H HZ2  . LYS A 1 27  ? 11.330  6.222   1.334   1.00 0.00 ? 27  LYS A HZ2  6  
ATOM 8193  H HZ3  . LYS A 1 27  ? 12.243  7.313   0.503   1.00 0.00 ? 27  LYS A HZ3  6  
ATOM 8194  N N    . GLU A 1 28  ? 9.307   8.439   -5.753  1.00 0.00 ? 28  GLU A N    6  
ATOM 8195  C CA   . GLU A 1 28  ? 9.864   9.033   -6.964  1.00 0.00 ? 28  GLU A CA   6  
ATOM 8196  C C    . GLU A 1 28  ? 8.754   9.328   -7.971  1.00 0.00 ? 28  GLU A C    6  
ATOM 8197  O O    . GLU A 1 28  ? 8.577   10.478  -8.358  1.00 0.00 ? 28  GLU A O    6  
ATOM 8198  C CB   . GLU A 1 28  ? 10.936  8.126   -7.586  1.00 0.00 ? 28  GLU A CB   6  
ATOM 8199  C CG   . GLU A 1 28  ? 12.271  8.239   -6.845  1.00 0.00 ? 28  GLU A CG   6  
ATOM 8200  C CD   . GLU A 1 28  ? 13.283  7.241   -7.403  1.00 0.00 ? 28  GLU A CD   6  
ATOM 8201  O OE1  . GLU A 1 28  ? 13.747  7.413   -8.552  1.00 0.00 ? 28  GLU A OE1  6  
ATOM 8202  O OE2  . GLU A 1 28  ? 13.614  6.263   -6.698  1.00 0.00 ? 28  GLU A OE2  6  
ATOM 8203  H H    . GLU A 1 28  ? 9.604   7.501   -5.508  1.00 0.00 ? 28  GLU A H    6  
ATOM 8204  H HA   . GLU A 1 28  ? 10.325  9.987   -6.698  1.00 0.00 ? 28  GLU A HA   6  
ATOM 8205  H HB2  . GLU A 1 28  ? 10.597  7.088   -7.571  1.00 0.00 ? 28  GLU A HB2  6  
ATOM 8206  H HB3  . GLU A 1 28  ? 11.097  8.432   -8.623  1.00 0.00 ? 28  GLU A HB3  6  
ATOM 8207  H HG2  . GLU A 1 28  ? 12.666  9.250   -6.959  1.00 0.00 ? 28  GLU A HG2  6  
ATOM 8208  H HG3  . GLU A 1 28  ? 12.118  8.048   -5.782  1.00 0.00 ? 28  GLU A HG3  6  
ATOM 8209  N N    . LYS A 1 29  ? 7.982   8.322   -8.395  1.00 0.00 ? 29  LYS A N    6  
ATOM 8210  C CA   . LYS A 1 29  ? 6.938   8.526   -9.397  1.00 0.00 ? 29  LYS A CA   6  
ATOM 8211  C C    . LYS A 1 29  ? 5.868   9.518   -8.917  1.00 0.00 ? 29  LYS A C    6  
ATOM 8212  O O    . LYS A 1 29  ? 5.345   10.296  -9.712  1.00 0.00 ? 29  LYS A O    6  
ATOM 8213  C CB   . LYS A 1 29  ? 6.375   7.195   -9.854  1.00 0.00 ? 29  LYS A CB   6  
ATOM 8214  C CG   . LYS A 1 29  ? 5.551   7.439   -11.131 1.00 0.00 ? 29  LYS A CG   6  
ATOM 8215  C CD   . LYS A 1 29  ? 5.251   6.115   -11.798 1.00 0.00 ? 29  LYS A CD   6  
ATOM 8216  C CE   . LYS A 1 29  ? 6.379   5.660   -12.724 1.00 0.00 ? 29  LYS A CE   6  
ATOM 8217  N NZ   . LYS A 1 29  ? 5.914   4.615   -13.656 1.00 0.00 ? 29  LYS A NZ   6  
ATOM 8218  H H    . LYS A 1 29  ? 8.143   7.387   -8.028  1.00 0.00 ? 29  LYS A H    6  
ATOM 8219  H HA   . LYS A 1 29  ? 7.389   8.911   -10.300 1.00 0.00 ? 29  LYS A HA   6  
ATOM 8220  H HB2  . LYS A 1 29  ? 7.205   6.521   -10.079 1.00 0.00 ? 29  LYS A HB2  6  
ATOM 8221  H HB3  . LYS A 1 29  ? 5.760   6.762   -9.068  1.00 0.00 ? 29  LYS A HB3  6  
ATOM 8222  H HG2  . LYS A 1 29  ? 4.604   7.897   -10.859 1.00 0.00 ? 29  LYS A HG2  6  
ATOM 8223  H HG3  . LYS A 1 29  ? 6.077   8.088   -11.836 1.00 0.00 ? 29  LYS A HG3  6  
ATOM 8224  H HD2  . LYS A 1 29  ? 5.128   5.407   -10.994 1.00 0.00 ? 29  LYS A HD2  6  
ATOM 8225  H HD3  . LYS A 1 29  ? 4.325   6.214   -12.359 1.00 0.00 ? 29  LYS A HD3  6  
ATOM 8226  H HE2  . LYS A 1 29  ? 6.727   6.513   -13.310 1.00 0.00 ? 29  LYS A HE2  6  
ATOM 8227  H HE3  . LYS A 1 29  ? 7.204   5.303   -12.110 1.00 0.00 ? 29  LYS A HE3  6  
ATOM 8228  H HZ1  . LYS A 1 29  ? 5.167   4.979   -14.243 1.00 0.00 ? 29  LYS A HZ1  6  
ATOM 8229  H HZ2  . LYS A 1 29  ? 6.664   4.297   -14.264 1.00 0.00 ? 29  LYS A HZ2  6  
ATOM 8230  H HZ3  . LYS A 1 29  ? 5.541   3.815   -13.162 1.00 0.00 ? 29  LYS A HZ3  6  
ATOM 8231  N N    . LEU A 1 30  ? 5.548   9.523   -7.623  1.00 0.00 ? 30  LEU A N    6  
ATOM 8232  C CA   . LEU A 1 30  ? 4.618   10.488  -7.046  1.00 0.00 ? 30  LEU A CA   6  
ATOM 8233  C C    . LEU A 1 30  ? 5.191   11.896  -7.181  1.00 0.00 ? 30  LEU A C    6  
ATOM 8234  O O    . LEU A 1 30  ? 4.460   12.800  -7.574  1.00 0.00 ? 30  LEU A O    6  
ATOM 8235  C CB   . LEU A 1 30  ? 4.353   10.172  -5.564  1.00 0.00 ? 30  LEU A CB   6  
ATOM 8236  C CG   . LEU A 1 30  ? 3.471   8.937   -5.333  1.00 0.00 ? 30  LEU A CG   6  
ATOM 8237  C CD1  . LEU A 1 30  ? 3.531   8.552   -3.852  1.00 0.00 ? 30  LEU A CD1  6  
ATOM 8238  C CD2  . LEU A 1 30  ? 2.016   9.183   -5.726  1.00 0.00 ? 30  LEU A CD2  6  
ATOM 8239  H H    . LEU A 1 30  ? 5.996   8.836   -7.026  1.00 0.00 ? 30  LEU A H    6  
ATOM 8240  H HA   . LEU A 1 30  ? 3.679   10.463  -7.606  1.00 0.00 ? 30  LEU A HA   6  
ATOM 8241  H HB2  . LEU A 1 30  ? 5.310   10.027  -5.064  1.00 0.00 ? 30  LEU A HB2  6  
ATOM 8242  H HB3  . LEU A 1 30  ? 3.868   11.032  -5.103  1.00 0.00 ? 30  LEU A HB3  6  
ATOM 8243  H HG   . LEU A 1 30  ? 3.843   8.105   -5.925  1.00 0.00 ? 30  LEU A HG   6  
ATOM 8244  H HD11 . LEU A 1 30  ? 3.119   9.351   -3.238  1.00 0.00 ? 30  LEU A HD11 6  
ATOM 8245  H HD12 . LEU A 1 30  ? 2.965   7.634   -3.696  1.00 0.00 ? 30  LEU A HD12 6  
ATOM 8246  H HD13 . LEU A 1 30  ? 4.567   8.365   -3.571  1.00 0.00 ? 30  LEU A HD13 6  
ATOM 8247  H HD21 . LEU A 1 30  ? 1.461   8.255   -5.611  1.00 0.00 ? 30  LEU A HD21 6  
ATOM 8248  H HD22 . LEU A 1 30  ? 1.584   9.958   -5.097  1.00 0.00 ? 30  LEU A HD22 6  
ATOM 8249  H HD23 . LEU A 1 30  ? 1.948   9.480   -6.769  1.00 0.00 ? 30  LEU A HD23 6  
ATOM 8250  N N    . ALA A 1 31  ? 6.472   12.091  -6.848  1.00 0.00 ? 31  ALA A N    6  
ATOM 8251  C CA   . ALA A 1 31  ? 7.145   13.379  -6.983  1.00 0.00 ? 31  ALA A CA   6  
ATOM 8252  C C    . ALA A 1 31  ? 7.134   13.824  -8.445  1.00 0.00 ? 31  ALA A C    6  
ATOM 8253  O O    . ALA A 1 31  ? 6.723   14.947  -8.741  1.00 0.00 ? 31  ALA A O    6  
ATOM 8254  C CB   . ALA A 1 31  ? 8.586   13.281  -6.471  1.00 0.00 ? 31  ALA A CB   6  
ATOM 8255  H H    . ALA A 1 31  ? 7.024   11.295  -6.544  1.00 0.00 ? 31  ALA A H    6  
ATOM 8256  H HA   . ALA A 1 31  ? 6.606   14.121  -6.390  1.00 0.00 ? 31  ALA A HA   6  
ATOM 8257  H HB1  . ALA A 1 31  ? 9.028   14.276  -6.489  1.00 0.00 ? 31  ALA A HB1  6  
ATOM 8258  H HB2  . ALA A 1 31  ? 8.601   12.890  -5.456  1.00 0.00 ? 31  ALA A HB2  6  
ATOM 8259  H HB3  . ALA A 1 31  ? 9.184   12.631  -7.111  1.00 0.00 ? 31  ALA A HB3  6  
ATOM 8260  N N    . LYS A 1 32  ? 7.540   12.920  -9.341  1.00 0.00 ? 32  LYS A N    6  
ATOM 8261  C CA   . LYS A 1 32  ? 7.605   13.087  -10.790 1.00 0.00 ? 32  LYS A CA   6  
ATOM 8262  C C    . LYS A 1 32  ? 6.298   13.668  -11.316 1.00 0.00 ? 32  LYS A C    6  
ATOM 8263  O O    . LYS A 1 32  ? 6.309   14.682  -12.012 1.00 0.00 ? 32  LYS A O    6  
ATOM 8264  C CB   . LYS A 1 32  ? 7.913   11.710  -11.403 1.00 0.00 ? 32  LYS A CB   6  
ATOM 8265  C CG   . LYS A 1 32  ? 8.366   11.739  -12.861 1.00 0.00 ? 32  LYS A CG   6  
ATOM 8266  C CD   . LYS A 1 32  ? 8.333   10.317  -13.434 1.00 0.00 ? 32  LYS A CD   6  
ATOM 8267  C CE   . LYS A 1 32  ? 9.141   10.267  -14.732 1.00 0.00 ? 32  LYS A CE   6  
ATOM 8268  N NZ   . LYS A 1 32  ? 9.044   8.942   -15.367 1.00 0.00 ? 32  LYS A NZ   6  
ATOM 8269  H H    . LYS A 1 32  ? 7.871   12.033  -8.971  1.00 0.00 ? 32  LYS A H    6  
ATOM 8270  H HA   . LYS A 1 32  ? 8.418   13.772  -11.040 1.00 0.00 ? 32  LYS A HA   6  
ATOM 8271  H HB2  . LYS A 1 32  ? 8.701   11.225  -10.828 1.00 0.00 ? 32  LYS A HB2  6  
ATOM 8272  H HB3  . LYS A 1 32  ? 7.028   11.086  -11.340 1.00 0.00 ? 32  LYS A HB3  6  
ATOM 8273  H HG2  . LYS A 1 32  ? 7.718   12.389  -13.450 1.00 0.00 ? 32  LYS A HG2  6  
ATOM 8274  H HG3  . LYS A 1 32  ? 9.387   12.114  -12.888 1.00 0.00 ? 32  LYS A HG3  6  
ATOM 8275  H HD2  . LYS A 1 32  ? 8.778   9.622   -12.717 1.00 0.00 ? 32  LYS A HD2  6  
ATOM 8276  H HD3  . LYS A 1 32  ? 7.293   10.035  -13.625 1.00 0.00 ? 32  LYS A HD3  6  
ATOM 8277  H HE2  . LYS A 1 32  ? 8.767   11.023  -15.427 1.00 0.00 ? 32  LYS A HE2  6  
ATOM 8278  H HE3  . LYS A 1 32  ? 10.187  10.484  -14.506 1.00 0.00 ? 32  LYS A HE3  6  
ATOM 8279  H HZ1  . LYS A 1 32  ? 9.158   8.199   -14.683 1.00 0.00 ? 32  LYS A HZ1  6  
ATOM 8280  H HZ2  . LYS A 1 32  ? 8.152   8.819   -15.834 1.00 0.00 ? 32  LYS A HZ2  6  
ATOM 8281  H HZ3  . LYS A 1 32  ? 9.797   8.811   -16.038 1.00 0.00 ? 32  LYS A HZ3  6  
ATOM 8282  N N    . ASN A 1 33  ? 5.168   13.045  -10.967 1.00 0.00 ? 33  ASN A N    6  
ATOM 8283  C CA   . ASN A 1 33  ? 3.859   13.435  -11.483 1.00 0.00 ? 33  ASN A CA   6  
ATOM 8284  C C    . ASN A 1 33  ? 3.165   14.487  -10.608 1.00 0.00 ? 33  ASN A C    6  
ATOM 8285  O O    . ASN A 1 33  ? 1.989   14.788  -10.833 1.00 0.00 ? 33  ASN A O    6  
ATOM 8286  C CB   . ASN A 1 33  ? 3.006   12.178  -11.721 1.00 0.00 ? 33  ASN A CB   6  
ATOM 8287  C CG   . ASN A 1 33  ? 3.526   11.338  -12.884 1.00 0.00 ? 33  ASN A CG   6  
ATOM 8288  O OD1  . ASN A 1 33  ? 4.593   11.587  -13.441 1.00 0.00 ? 33  ASN A OD1  6  
ATOM 8289  N ND2  . ASN A 1 33  ? 2.782   10.334  -13.292 1.00 0.00 ? 33  ASN A ND2  6  
ATOM 8290  H H    . ASN A 1 33  ? 5.209   12.176  -10.441 1.00 0.00 ? 33  ASN A H    6  
ATOM 8291  H HA   . ASN A 1 33  ? 4.004   13.899  -12.459 1.00 0.00 ? 33  ASN A HA   6  
ATOM 8292  H HB2  . ASN A 1 33  ? 2.981   11.570  -10.819 1.00 0.00 ? 33  ASN A HB2  6  
ATOM 8293  H HB3  . ASN A 1 33  ? 1.985   12.478  -11.958 1.00 0.00 ? 33  ASN A HB3  6  
ATOM 8294  H HD21 . ASN A 1 33  ? 1.884   10.131  -12.863 1.00 0.00 ? 33  ASN A HD21 6  
ATOM 8295  H HD22 . ASN A 1 33  ? 3.098   9.752   -14.059 1.00 0.00 ? 33  ASN A HD22 6  
ATOM 8296  N N    . GLY A 1 34  ? 3.859   15.064  -9.621  1.00 0.00 ? 34  GLY A N    6  
ATOM 8297  C CA   . GLY A 1 34  ? 3.374   16.168  -8.800  1.00 0.00 ? 34  GLY A CA   6  
ATOM 8298  C C    . GLY A 1 34  ? 2.231   15.783  -7.862  1.00 0.00 ? 34  GLY A C    6  
ATOM 8299  O O    . GLY A 1 34  ? 1.339   16.601  -7.615  1.00 0.00 ? 34  GLY A O    6  
ATOM 8300  H H    . GLY A 1 34  ? 4.818   14.779  -9.467  1.00 0.00 ? 34  GLY A H    6  
ATOM 8301  H HA2  . GLY A 1 34  ? 4.200   16.545  -8.200  1.00 0.00 ? 34  GLY A HA2  6  
ATOM 8302  H HA3  . GLY A 1 34  ? 3.041   16.971  -9.454  1.00 0.00 ? 34  GLY A HA3  6  
ATOM 8303  N N    . ILE A 1 35  ? 2.239   14.547  -7.363  1.00 0.00 ? 35  ILE A N    6  
ATOM 8304  C CA   . ILE A 1 35  ? 1.178   13.926  -6.585  1.00 0.00 ? 35  ILE A CA   6  
ATOM 8305  C C    . ILE A 1 35  ? 1.578   14.002  -5.111  1.00 0.00 ? 35  ILE A C    6  
ATOM 8306  O O    . ILE A 1 35  ? 2.583   13.412  -4.701  1.00 0.00 ? 35  ILE A O    6  
ATOM 8307  C CB   . ILE A 1 35  ? 0.923   12.479  -7.046  1.00 0.00 ? 35  ILE A CB   6  
ATOM 8308  C CG1  . ILE A 1 35  ? 0.624   12.468  -8.560  1.00 0.00 ? 35  ILE A CG1  6  
ATOM 8309  C CG2  . ILE A 1 35  ? -0.250  11.882  -6.242  1.00 0.00 ? 35  ILE A CG2  6  
ATOM 8310  C CD1  . ILE A 1 35  ? 0.419   11.072  -9.131  1.00 0.00 ? 35  ILE A CD1  6  
ATOM 8311  H H    . ILE A 1 35  ? 3.045   13.966  -7.568  1.00 0.00 ? 35  ILE A H    6  
ATOM 8312  H HA   . ILE A 1 35  ? 0.250   14.462  -6.769  1.00 0.00 ? 35  ILE A HA   6  
ATOM 8313  H HB   . ILE A 1 35  ? 1.821   11.892  -6.862  1.00 0.00 ? 35  ILE A HB   6  
ATOM 8314  H HG12 . ILE A 1 35  ? -0.251  13.080  -8.772  1.00 0.00 ? 35  ILE A HG12 6  
ATOM 8315  H HG13 . ILE A 1 35  ? 1.465   12.896  -9.092  1.00 0.00 ? 35  ILE A HG13 6  
ATOM 8316  H HG21 . ILE A 1 35  ? -0.415  10.845  -6.530  1.00 0.00 ? 35  ILE A HG21 6  
ATOM 8317  H HG22 . ILE A 1 35  ? -0.031  11.901  -5.174  1.00 0.00 ? 35  ILE A HG22 6  
ATOM 8318  H HG23 . ILE A 1 35  ? -1.162  12.451  -6.430  1.00 0.00 ? 35  ILE A HG23 6  
ATOM 8319  H HD11 . ILE A 1 35  ? 0.351   11.139  -10.215 1.00 0.00 ? 35  ILE A HD11 6  
ATOM 8320  H HD12 . ILE A 1 35  ? 1.270   10.451  -8.860  1.00 0.00 ? 35  ILE A HD12 6  
ATOM 8321  H HD13 . ILE A 1 35  ? -0.506  10.653  -8.742  1.00 0.00 ? 35  ILE A HD13 6  
ATOM 8322  N N    . CYS A 1 36  ? 0.793   14.716  -4.306  1.00 0.00 ? 36  CYS A N    6  
ATOM 8323  C CA   . CYS A 1 36  ? 0.924   14.733  -2.857  1.00 0.00 ? 36  CYS A CA   6  
ATOM 8324  C C    . CYS A 1 36  ? 0.679   13.328  -2.302  1.00 0.00 ? 36  CYS A C    6  
ATOM 8325  O O    . CYS A 1 36  ? -0.447  12.827  -2.364  1.00 0.00 ? 36  CYS A O    6  
ATOM 8326  C CB   . CYS A 1 36  ? -0.067  15.726  -2.237  1.00 0.00 ? 36  CYS A CB   6  
ATOM 8327  S SG   . CYS A 1 36  ? 0.454   17.431  -2.553  1.00 0.00 ? 36  CYS A SG   6  
ATOM 8328  H H    . CYS A 1 36  ? 0.023   15.220  -4.734  1.00 0.00 ? 36  CYS A H    6  
ATOM 8329  H HA   . CYS A 1 36  ? 1.943   15.035  -2.611  1.00 0.00 ? 36  CYS A HA   6  
ATOM 8330  H HB2  . CYS A 1 36  ? -1.069  15.552  -2.634  1.00 0.00 ? 36  CYS A HB2  6  
ATOM 8331  H HB3  . CYS A 1 36  ? -0.080  15.573  -1.160  1.00 0.00 ? 36  CYS A HB3  6  
ATOM 8332  H HG   . CYS A 1 36  ? 0.184   17.453  -3.869  1.00 0.00 ? 36  CYS A HG   6  
ATOM 8333  N N    . GLN A 1 37  ? 1.714   12.703  -1.733  1.00 0.00 ? 37  GLN A N    6  
ATOM 8334  C CA   . GLN A 1 37  ? 1.664   11.324  -1.248  1.00 0.00 ? 37  GLN A CA   6  
ATOM 8335  C C    . GLN A 1 37  ? 0.544   11.103  -0.225  1.00 0.00 ? 37  GLN A C    6  
ATOM 8336  O O    . GLN A 1 37  ? -0.022  10.021  -0.172  1.00 0.00 ? 37  GLN A O    6  
ATOM 8337  C CB   . GLN A 1 37  ? 2.992   10.875  -0.602  1.00 0.00 ? 37  GLN A CB   6  
ATOM 8338  C CG   . GLN A 1 37  ? 4.298   11.297  -1.296  1.00 0.00 ? 37  GLN A CG   6  
ATOM 8339  C CD   . GLN A 1 37  ? 4.896   12.574  -0.699  1.00 0.00 ? 37  GLN A CD   6  
ATOM 8340  O OE1  . GLN A 1 37  ? 4.207   13.581  -0.539  1.00 0.00 ? 37  GLN A OE1  6  
ATOM 8341  N NE2  . GLN A 1 37  ? 6.142   12.558  -0.270  1.00 0.00 ? 37  GLN A NE2  6  
ATOM 8342  H H    . GLN A 1 37  ? 2.614   13.168  -1.732  1.00 0.00 ? 37  GLN A H    6  
ATOM 8343  H HA   . GLN A 1 37  ? 1.459   10.687  -2.114  1.00 0.00 ? 37  GLN A HA   6  
ATOM 8344  H HB2  . GLN A 1 37  ? 3.028   11.205  0.440   1.00 0.00 ? 37  GLN A HB2  6  
ATOM 8345  H HB3  . GLN A 1 37  ? 2.958   9.786   -0.596  1.00 0.00 ? 37  GLN A HB3  6  
ATOM 8346  H HG2  . GLN A 1 37  ? 5.019   10.484  -1.181  1.00 0.00 ? 37  GLN A HG2  6  
ATOM 8347  H HG3  . GLN A 1 37  ? 4.124   11.442  -2.361  1.00 0.00 ? 37  GLN A HG3  6  
ATOM 8348  H HE21 . GLN A 1 37  ? 6.678   11.698  -0.325  1.00 0.00 ? 37  GLN A HE21 6  
ATOM 8349  H HE22 . GLN A 1 37  ? 6.622   13.390  0.066   1.00 0.00 ? 37  GLN A HE22 6  
ATOM 8350  N N    . ARG A 1 38  ? 0.203   12.103  0.594   1.00 0.00 ? 38  ARG A N    6  
ATOM 8351  C CA   . ARG A 1 38  ? -0.927  12.047  1.526   1.00 0.00 ? 38  ARG A CA   6  
ATOM 8352  C C    . ARG A 1 38  ? -2.222  11.670  0.799   1.00 0.00 ? 38  ARG A C    6  
ATOM 8353  O O    . ARG A 1 38  ? -2.917  10.756  1.232   1.00 0.00 ? 38  ARG A O    6  
ATOM 8354  C CB   . ARG A 1 38  ? -1.042  13.375  2.312   1.00 0.00 ? 38  ARG A CB   6  
ATOM 8355  C CG   . ARG A 1 38  ? -1.336  14.578  1.414   1.00 0.00 ? 38  ARG A CG   6  
ATOM 8356  C CD   . ARG A 1 38  ? -0.902  15.947  1.937   1.00 0.00 ? 38  ARG A CD   6  
ATOM 8357  N NE   . ARG A 1 38  ? -1.497  16.998  1.092   1.00 0.00 ? 38  ARG A NE   6  
ATOM 8358  C CZ   . ARG A 1 38  ? -1.221  18.308  1.142   1.00 0.00 ? 38  ARG A CZ   6  
ATOM 8359  N NH1  . ARG A 1 38  ? -0.175  18.772  1.822   1.00 0.00 ? 38  ARG A NH1  6  
ATOM 8360  N NH2  . ARG A 1 38  ? -2.004  19.158  0.496   1.00 0.00 ? 38  ARG A NH2  6  
ATOM 8361  H H    . ARG A 1 38  ? 0.751   12.956  0.549   1.00 0.00 ? 38  ARG A H    6  
ATOM 8362  H HA   . ARG A 1 38  ? -0.734  11.250  2.244   1.00 0.00 ? 38  ARG A HA   6  
ATOM 8363  H HB2  . ARG A 1 38  ? -1.883  13.300  2.996   1.00 0.00 ? 38  ARG A HB2  6  
ATOM 8364  H HB3  . ARG A 1 38  ? -0.118  13.543  2.873   1.00 0.00 ? 38  ARG A HB3  6  
ATOM 8365  H HG2  . ARG A 1 38  ? -0.831  14.413  0.478   1.00 0.00 ? 38  ARG A HG2  6  
ATOM 8366  H HG3  . ARG A 1 38  ? -2.409  14.602  1.227   1.00 0.00 ? 38  ARG A HG3  6  
ATOM 8367  H HD2  . ARG A 1 38  ? -1.253  16.076  2.961   1.00 0.00 ? 38  ARG A HD2  6  
ATOM 8368  H HD3  . ARG A 1 38  ? 0.186   16.016  1.921   1.00 0.00 ? 38  ARG A HD3  6  
ATOM 8369  H HE   . ARG A 1 38  ? -2.295  16.694  0.545   1.00 0.00 ? 38  ARG A HE   6  
ATOM 8370  H HH11 . ARG A 1 38  ? 0.535   18.136  2.181   1.00 0.00 ? 38  ARG A HH11 6  
ATOM 8371  H HH12 . ARG A 1 38  ? 0.037   19.760  1.886   1.00 0.00 ? 38  ARG A HH12 6  
ATOM 8372  H HH21 . ARG A 1 38  ? -2.812  18.891  -0.064  1.00 0.00 ? 38  ARG A HH21 6  
ATOM 8373  H HH22 . ARG A 1 38  ? -1.892  20.163  0.602   1.00 0.00 ? 38  ARG A HH22 6  
ATOM 8374  N N    . ILE A 1 39  ? -2.537  12.333  -0.311  1.00 0.00 ? 39  ILE A N    6  
ATOM 8375  C CA   . ILE A 1 39  ? -3.798  12.144  -1.011  1.00 0.00 ? 39  ILE A CA   6  
ATOM 8376  C C    . ILE A 1 39  ? -3.730  10.810  -1.728  1.00 0.00 ? 39  ILE A C    6  
ATOM 8377  O O    . ILE A 1 39  ? -4.651  10.009  -1.605  1.00 0.00 ? 39  ILE A O    6  
ATOM 8378  C CB   . ILE A 1 39  ? -4.039  13.305  -1.996  1.00 0.00 ? 39  ILE A CB   6  
ATOM 8379  C CG1  . ILE A 1 39  ? -4.024  14.645  -1.226  1.00 0.00 ? 39  ILE A CG1  6  
ATOM 8380  C CG2  . ILE A 1 39  ? -5.326  13.043  -2.806  1.00 0.00 ? 39  ILE A CG2  6  
ATOM 8381  C CD1  . ILE A 1 39  ? -4.450  15.854  -2.053  1.00 0.00 ? 39  ILE A CD1  6  
ATOM 8382  H H    . ILE A 1 39  ? -1.865  12.961  -0.722  1.00 0.00 ? 39  ILE A H    6  
ATOM 8383  H HA   . ILE A 1 39  ? -4.614  12.081  -0.279  1.00 0.00 ? 39  ILE A HA   6  
ATOM 8384  H HB   . ILE A 1 39  ? -3.203  13.352  -2.697  1.00 0.00 ? 39  ILE A HB   6  
ATOM 8385  H HG12 . ILE A 1 39  ? -4.640  14.581  -0.328  1.00 0.00 ? 39  ILE A HG12 6  
ATOM 8386  H HG13 . ILE A 1 39  ? -3.001  14.843  -0.912  1.00 0.00 ? 39  ILE A HG13 6  
ATOM 8387  H HG21 . ILE A 1 39  ? -6.195  13.058  -2.145  1.00 0.00 ? 39  ILE A HG21 6  
ATOM 8388  H HG22 . ILE A 1 39  ? -5.431  13.797  -3.586  1.00 0.00 ? 39  ILE A HG22 6  
ATOM 8389  H HG23 . ILE A 1 39  ? -5.278  12.069  -3.309  1.00 0.00 ? 39  ILE A HG23 6  
ATOM 8390  H HD11 . ILE A 1 39  ? -5.518  15.808  -2.265  1.00 0.00 ? 39  ILE A HD11 6  
ATOM 8391  H HD12 . ILE A 1 39  ? -4.234  16.764  -1.496  1.00 0.00 ? 39  ILE A HD12 6  
ATOM 8392  H HD13 . ILE A 1 39  ? -3.883  15.864  -2.983  1.00 0.00 ? 39  ILE A HD13 6  
ATOM 8393  N N    . PHE A 1 40  ? -2.633  10.546  -2.439  1.00 0.00 ? 40  PHE A N    6  
ATOM 8394  C CA   . PHE A 1 40  ? -2.384  9.237   -3.027  1.00 0.00 ? 40  PHE A CA   6  
ATOM 8395  C C    . PHE A 1 40  ? -2.647  8.139   -1.991  1.00 0.00 ? 40  PHE A C    6  
ATOM 8396  O O    . PHE A 1 40  ? -3.378  7.189   -2.264  1.00 0.00 ? 40  PHE A O    6  
ATOM 8397  C CB   . PHE A 1 40  ? -0.937  9.168   -3.534  1.00 0.00 ? 40  PHE A CB   6  
ATOM 8398  C CG   . PHE A 1 40  ? -0.385  7.762   -3.636  1.00 0.00 ? 40  PHE A CG   6  
ATOM 8399  C CD1  . PHE A 1 40  ? -0.663  6.965   -4.758  1.00 0.00 ? 40  PHE A CD1  6  
ATOM 8400  C CD2  . PHE A 1 40  ? 0.345   7.228   -2.558  1.00 0.00 ? 40  PHE A CD2  6  
ATOM 8401  C CE1  . PHE A 1 40  ? -0.245  5.626   -4.784  1.00 0.00 ? 40  PHE A CE1  6  
ATOM 8402  C CE2  . PHE A 1 40  ? 0.772   5.893   -2.591  1.00 0.00 ? 40  PHE A CE2  6  
ATOM 8403  C CZ   . PHE A 1 40  ? 0.455   5.086   -3.694  1.00 0.00 ? 40  PHE A CZ   6  
ATOM 8404  H H    . PHE A 1 40  ? -1.927  11.267  -2.527  1.00 0.00 ? 40  PHE A H    6  
ATOM 8405  H HA   . PHE A 1 40  ? -3.073  9.098   -3.862  1.00 0.00 ? 40  PHE A HA   6  
ATOM 8406  H HB2  . PHE A 1 40  ? -0.843  9.681   -4.488  1.00 0.00 ? 40  PHE A HB2  6  
ATOM 8407  H HB3  . PHE A 1 40  ? -0.314  9.702   -2.834  1.00 0.00 ? 40  PHE A HB3  6  
ATOM 8408  H HD1  . PHE A 1 40  ? -1.199  7.383   -5.597  1.00 0.00 ? 40  PHE A HD1  6  
ATOM 8409  H HD2  . PHE A 1 40  ? 0.558   7.835   -1.688  1.00 0.00 ? 40  PHE A HD2  6  
ATOM 8410  H HE1  . PHE A 1 40  ? -0.464  5.009   -5.642  1.00 0.00 ? 40  PHE A HE1  6  
ATOM 8411  H HE2  . PHE A 1 40  ? 1.336   5.492   -1.765  1.00 0.00 ? 40  PHE A HE2  6  
ATOM 8412  H HZ   . PHE A 1 40  ? 0.758   4.052   -3.714  1.00 0.00 ? 40  PHE A HZ   6  
ATOM 8413  N N    . GLY A 1 41  ? -2.109  8.298   -0.781  1.00 0.00 ? 41  GLY A N    6  
ATOM 8414  C CA   . GLY A 1 41  ? -2.177  7.325   0.271   1.00 0.00 ? 41  GLY A CA   6  
ATOM 8415  C C    . GLY A 1 41  ? -3.490  7.335   1.038   1.00 0.00 ? 41  GLY A C    6  
ATOM 8416  O O    . GLY A 1 41  ? -3.740  6.395   1.782   1.00 0.00 ? 41  GLY A O    6  
ATOM 8417  H H    . GLY A 1 41  ? -1.491  9.071   -0.560  1.00 0.00 ? 41  GLY A H    6  
ATOM 8418  H HA2  . GLY A 1 41  ? -2.024  6.341   -0.162  1.00 0.00 ? 41  GLY A HA2  6  
ATOM 8419  H HA3  . GLY A 1 41  ? -1.363  7.524   0.945   1.00 0.00 ? 41  GLY A HA3  6  
ATOM 8420  N N    . GLU A 1 42  ? -4.405  8.258   0.742   1.00 0.00 ? 42  GLU A N    6  
ATOM 8421  C CA   . GLU A 1 42  ? -5.819  8.207   1.119   1.00 0.00 ? 42  GLU A CA   6  
ATOM 8422  C C    . GLU A 1 42  ? -6.693  7.523   0.064   1.00 0.00 ? 42  GLU A C    6  
ATOM 8423  O O    . GLU A 1 42  ? -7.636  6.816   0.417   1.00 0.00 ? 42  GLU A O    6  
ATOM 8424  C CB   . GLU A 1 42  ? -6.301  9.653   1.352   1.00 0.00 ? 42  GLU A CB   6  
ATOM 8425  C CG   . GLU A 1 42  ? -6.200  10.109  2.808   1.00 0.00 ? 42  GLU A CG   6  
ATOM 8426  C CD   . GLU A 1 42  ? -7.566  10.458  3.385   1.00 0.00 ? 42  GLU A CD   6  
ATOM 8427  O OE1  . GLU A 1 42  ? -8.268  11.325  2.815   1.00 0.00 ? 42  GLU A OE1  6  
ATOM 8428  O OE2  . GLU A 1 42  ? -7.911  9.893   4.445   1.00 0.00 ? 42  GLU A OE2  6  
ATOM 8429  H H    . GLU A 1 42  ? -4.142  9.011   0.115   1.00 0.00 ? 42  GLU A H    6  
ATOM 8430  H HA   . GLU A 1 42  ? -5.951  7.590   2.004   1.00 0.00 ? 42  GLU A HA   6  
ATOM 8431  H HB2  . GLU A 1 42  ? -5.713  10.331  0.732   1.00 0.00 ? 42  GLU A HB2  6  
ATOM 8432  H HB3  . GLU A 1 42  ? -7.329  9.742   1.015   1.00 0.00 ? 42  GLU A HB3  6  
ATOM 8433  H HG2  . GLU A 1 42  ? -5.730  9.333   3.407   1.00 0.00 ? 42  GLU A HG2  6  
ATOM 8434  H HG3  . GLU A 1 42  ? -5.559  10.983  2.859   1.00 0.00 ? 42  GLU A HG3  6  
ATOM 8435  N N    . LYS A 1 43  ? -6.408  7.749   -1.220  1.00 0.00 ? 43  LYS A N    6  
ATOM 8436  C CA   . LYS A 1 43  ? -7.251  7.332   -2.329  1.00 0.00 ? 43  LYS A CA   6  
ATOM 8437  C C    . LYS A 1 43  ? -6.852  5.927   -2.793  1.00 0.00 ? 43  LYS A C    6  
ATOM 8438  O O    . LYS A 1 43  ? -7.629  4.995   -2.593  1.00 0.00 ? 43  LYS A O    6  
ATOM 8439  C CB   . LYS A 1 43  ? -7.182  8.436   -3.404  1.00 0.00 ? 43  LYS A CB   6  
ATOM 8440  C CG   . LYS A 1 43  ? -8.076  9.662   -3.099  1.00 0.00 ? 43  LYS A CG   6  
ATOM 8441  C CD   . LYS A 1 43  ? -8.100  10.156  -1.639  1.00 0.00 ? 43  LYS A CD   6  
ATOM 8442  C CE   . LYS A 1 43  ? -9.005  11.365  -1.412  1.00 0.00 ? 43  LYS A CE   6  
ATOM 8443  N NZ   . LYS A 1 43  ? -9.084  11.746  0.017   1.00 0.00 ? 43  LYS A NZ   6  
ATOM 8444  H H    . LYS A 1 43  ? -5.642  8.380   -1.433  1.00 0.00 ? 43  LYS A H    6  
ATOM 8445  H HA   . LYS A 1 43  ? -8.283  7.260   -1.980  1.00 0.00 ? 43  LYS A HA   6  
ATOM 8446  H HB2  . LYS A 1 43  ? -6.148  8.759   -3.527  1.00 0.00 ? 43  LYS A HB2  6  
ATOM 8447  H HB3  . LYS A 1 43  ? -7.504  8.026   -4.358  1.00 0.00 ? 43  LYS A HB3  6  
ATOM 8448  H HG2  . LYS A 1 43  ? -7.754  10.480  -3.743  1.00 0.00 ? 43  LYS A HG2  6  
ATOM 8449  H HG3  . LYS A 1 43  ? -9.092  9.390   -3.370  1.00 0.00 ? 43  LYS A HG3  6  
ATOM 8450  H HD2  . LYS A 1 43  ? -8.483  9.355   -1.005  1.00 0.00 ? 43  LYS A HD2  6  
ATOM 8451  H HD3  . LYS A 1 43  ? -7.092  10.430  -1.338  1.00 0.00 ? 43  LYS A HD3  6  
ATOM 8452  H HE2  . LYS A 1 43  ? -8.642  12.210  -2.002  1.00 0.00 ? 43  LYS A HE2  6  
ATOM 8453  H HE3  . LYS A 1 43  ? -10.010 11.116  -1.756  1.00 0.00 ? 43  LYS A HE3  6  
ATOM 8454  H HZ1  . LYS A 1 43  ? -8.199  12.080  0.380   1.00 0.00 ? 43  LYS A HZ1  6  
ATOM 8455  H HZ2  . LYS A 1 43  ? -9.769  12.492  0.112   1.00 0.00 ? 43  LYS A HZ2  6  
ATOM 8456  H HZ3  . LYS A 1 43  ? -9.432  10.985  0.608   1.00 0.00 ? 43  LYS A HZ3  6  
ATOM 8457  N N    . VAL A 1 44  ? -5.676  5.771   -3.402  1.00 0.00 ? 44  VAL A N    6  
ATOM 8458  C CA   . VAL A 1 44  ? -5.220  4.554   -4.077  1.00 0.00 ? 44  VAL A CA   6  
ATOM 8459  C C    . VAL A 1 44  ? -5.201  3.314   -3.158  1.00 0.00 ? 44  VAL A C    6  
ATOM 8460  O O    . VAL A 1 44  ? -5.868  2.324   -3.436  1.00 0.00 ? 44  VAL A O    6  
ATOM 8461  C CB   . VAL A 1 44  ? -3.845  4.815   -4.731  1.00 0.00 ? 44  VAL A CB   6  
ATOM 8462  C CG1  . VAL A 1 44  ? -3.474  3.658   -5.661  1.00 0.00 ? 44  VAL A CG1  6  
ATOM 8463  C CG2  . VAL A 1 44  ? -3.828  6.111   -5.558  1.00 0.00 ? 44  VAL A CG2  6  
ATOM 8464  H H    . VAL A 1 44  ? -5.079  6.585   -3.452  1.00 0.00 ? 44  VAL A H    6  
ATOM 8465  H HA   . VAL A 1 44  ? -5.935  4.364   -4.875  1.00 0.00 ? 44  VAL A HA   6  
ATOM 8466  H HB   . VAL A 1 44  ? -3.084  4.908   -3.957  1.00 0.00 ? 44  VAL A HB   6  
ATOM 8467  H HG11 . VAL A 1 44  ? -4.232  3.566   -6.437  1.00 0.00 ? 44  VAL A HG11 6  
ATOM 8468  H HG12 . VAL A 1 44  ? -2.504  3.839   -6.118  1.00 0.00 ? 44  VAL A HG12 6  
ATOM 8469  H HG13 . VAL A 1 44  ? -3.417  2.725   -5.104  1.00 0.00 ? 44  VAL A HG13 6  
ATOM 8470  H HG21 . VAL A 1 44  ? -3.807  6.990   -4.910  1.00 0.00 ? 44  VAL A HG21 6  
ATOM 8471  H HG22 . VAL A 1 44  ? -2.944  6.144   -6.192  1.00 0.00 ? 44  VAL A HG22 6  
ATOM 8472  H HG23 . VAL A 1 44  ? -4.706  6.146   -6.200  1.00 0.00 ? 44  VAL A HG23 6  
ATOM 8473  N N    . LEU A 1 45  ? -4.382  3.353   -2.109  1.00 0.00 ? 45  LEU A N    6  
ATOM 8474  C CA   . LEU A 1 45  ? -4.180  2.366   -1.047  1.00 0.00 ? 45  LEU A CA   6  
ATOM 8475  C C    . LEU A 1 45  ? -5.353  2.326   -0.048  1.00 0.00 ? 45  LEU A C    6  
ATOM 8476  O O    . LEU A 1 45  ? -5.443  1.391   0.745   1.00 0.00 ? 45  LEU A O    6  
ATOM 8477  C CB   . LEU A 1 45  ? -2.903  2.743   -0.251  1.00 0.00 ? 45  LEU A CB   6  
ATOM 8478  C CG   . LEU A 1 45  ? -1.629  3.009   -1.080  1.00 0.00 ? 45  LEU A CG   6  
ATOM 8479  C CD1  . LEU A 1 45  ? -0.498  3.614   -0.243  1.00 0.00 ? 45  LEU A CD1  6  
ATOM 8480  C CD2  . LEU A 1 45  ? -1.071  1.723   -1.653  1.00 0.00 ? 45  LEU A CD2  6  
ATOM 8481  H H    . LEU A 1 45  ? -3.978  4.262   -1.921  1.00 0.00 ? 45  LEU A H    6  
ATOM 8482  H HA   . LEU A 1 45  ? -4.067  1.374   -1.490  1.00 0.00 ? 45  LEU A HA   6  
ATOM 8483  H HB2  . LEU A 1 45  ? -3.104  3.637   0.342   1.00 0.00 ? 45  LEU A HB2  6  
ATOM 8484  H HB3  . LEU A 1 45  ? -2.699  1.937   0.452   1.00 0.00 ? 45  LEU A HB3  6  
ATOM 8485  H HG   . LEU A 1 45  ? -1.845  3.696   -1.895  1.00 0.00 ? 45  LEU A HG   6  
ATOM 8486  H HD11 . LEU A 1 45  ? 0.434   3.595   -0.814  1.00 0.00 ? 45  LEU A HD11 6  
ATOM 8487  H HD12 . LEU A 1 45  ? -0.736  4.650   -0.027  1.00 0.00 ? 45  LEU A HD12 6  
ATOM 8488  H HD13 . LEU A 1 45  ? -0.363  3.049   0.679   1.00 0.00 ? 45  LEU A HD13 6  
ATOM 8489  H HD21 . LEU A 1 45  ? -0.272  1.958   -2.354  1.00 0.00 ? 45  LEU A HD21 6  
ATOM 8490  H HD22 . LEU A 1 45  ? -0.678  1.129   -0.829  1.00 0.00 ? 45  LEU A HD22 6  
ATOM 8491  H HD23 . LEU A 1 45  ? -1.846  1.176   -2.183  1.00 0.00 ? 45  LEU A HD23 6  
ATOM 8492  N N    . GLY A 1 46  ? -6.196  3.361   -0.003  1.00 0.00 ? 46  GLY A N    6  
ATOM 8493  C CA   . GLY A 1 46  ? -7.346  3.514   0.877   1.00 0.00 ? 46  GLY A CA   6  
ATOM 8494  C C    . GLY A 1 46  ? -7.020  3.738   2.354   1.00 0.00 ? 46  GLY A C    6  
ATOM 8495  O O    . GLY A 1 46  ? -7.917  3.621   3.187   1.00 0.00 ? 46  GLY A O    6  
ATOM 8496  H H    . GLY A 1 46  ? -5.980  4.158   -0.589  1.00 0.00 ? 46  GLY A H    6  
ATOM 8497  H HA2  . GLY A 1 46  ? -7.904  4.380   0.535   1.00 0.00 ? 46  GLY A HA2  6  
ATOM 8498  H HA3  . GLY A 1 46  ? -7.983  2.634   0.785   1.00 0.00 ? 46  GLY A HA3  6  
ATOM 8499  N N    . LEU A 1 47  ? -5.763  4.010   2.711   1.00 0.00 ? 47  LEU A N    6  
ATOM 8500  C CA   . LEU A 1 47  ? -5.335  4.096   4.107   1.00 0.00 ? 47  LEU A CA   6  
ATOM 8501  C C    . LEU A 1 47  ? -5.623  5.475   4.705   1.00 0.00 ? 47  LEU A C    6  
ATOM 8502  O O    . LEU A 1 47  ? -5.845  6.446   3.982   1.00 0.00 ? 47  LEU A O    6  
ATOM 8503  C CB   . LEU A 1 47  ? -3.836  3.789   4.178   1.00 0.00 ? 47  LEU A CB   6  
ATOM 8504  C CG   . LEU A 1 47  ? -3.502  2.320   3.877   1.00 0.00 ? 47  LEU A CG   6  
ATOM 8505  C CD1  . LEU A 1 47  ? -2.036  2.217   3.476   1.00 0.00 ? 47  LEU A CD1  6  
ATOM 8506  C CD2  . LEU A 1 47  ? -3.755  1.423   5.092   1.00 0.00 ? 47  LEU A CD2  6  
ATOM 8507  H H    . LEU A 1 47  ? -5.095  4.231   1.987   1.00 0.00 ? 47  LEU A H    6  
ATOM 8508  H HA   . LEU A 1 47  ? -5.879  3.358   4.693   1.00 0.00 ? 47  LEU A HA   6  
ATOM 8509  H HB2  . LEU A 1 47  ? -3.319  4.442   3.479   1.00 0.00 ? 47  LEU A HB2  6  
ATOM 8510  H HB3  . LEU A 1 47  ? -3.457  4.040   5.163   1.00 0.00 ? 47  LEU A HB3  6  
ATOM 8511  H HG   . LEU A 1 47  ? -4.104  1.969   3.045   1.00 0.00 ? 47  LEU A HG   6  
ATOM 8512  H HD11 . LEU A 1 47  ? -1.731  1.172   3.432   1.00 0.00 ? 47  LEU A HD11 6  
ATOM 8513  H HD12 . LEU A 1 47  ? -1.892  2.677   2.498   1.00 0.00 ? 47  LEU A HD12 6  
ATOM 8514  H HD13 . LEU A 1 47  ? -1.435  2.747   4.211   1.00 0.00 ? 47  LEU A HD13 6  
ATOM 8515  H HD21 . LEU A 1 47  ? -3.605  0.378   4.809   1.00 0.00 ? 47  LEU A HD21 6  
ATOM 8516  H HD22 . LEU A 1 47  ? -3.044  1.688   5.872   1.00 0.00 ? 47  LEU A HD22 6  
ATOM 8517  H HD23 . LEU A 1 47  ? -4.780  1.544   5.448   1.00 0.00 ? 47  LEU A HD23 6  
ATOM 8518  N N    . SER A 1 48  ? -5.570  5.596   6.030   1.00 0.00 ? 48  SER A N    6  
ATOM 8519  C CA   . SER A 1 48  ? -5.437  6.886   6.686   1.00 0.00 ? 48  SER A CA   6  
ATOM 8520  C C    . SER A 1 48  ? -4.007  7.403   6.509   1.00 0.00 ? 48  SER A C    6  
ATOM 8521  O O    . SER A 1 48  ? -3.035  6.641   6.479   1.00 0.00 ? 48  SER A O    6  
ATOM 8522  C CB   . SER A 1 48  ? -5.810  6.759   8.169   1.00 0.00 ? 48  SER A CB   6  
ATOM 8523  O OG   . SER A 1 48  ? -7.221  6.792   8.290   1.00 0.00 ? 48  SER A OG   6  
ATOM 8524  H H    . SER A 1 48  ? -5.443  4.773   6.602   1.00 0.00 ? 48  SER A H    6  
ATOM 8525  H HA   . SER A 1 48  ? -6.121  7.595   6.215   1.00 0.00 ? 48  SER A HA   6  
ATOM 8526  H HB2  . SER A 1 48  ? -5.413  5.829   8.581   1.00 0.00 ? 48  SER A HB2  6  
ATOM 8527  H HB3  . SER A 1 48  ? -5.394  7.599   8.728   1.00 0.00 ? 48  SER A HB3  6  
ATOM 8528  H HG   . SER A 1 48  ? -7.497  6.175   9.003   1.00 0.00 ? 48  SER A HG   6  
ATOM 8529  N N    . GLN A 1 49  ? -3.882  8.728   6.462   1.00 0.00 ? 49  GLN A N    6  
ATOM 8530  C CA   . GLN A 1 49  ? -2.622  9.452   6.301   1.00 0.00 ? 49  GLN A CA   6  
ATOM 8531  C C    . GLN A 1 49  ? -1.669  9.168   7.448   1.00 0.00 ? 49  GLN A C    6  
ATOM 8532  O O    . GLN A 1 49  ? -0.454  9.204   7.245   1.00 0.00 ? 49  GLN A O    6  
ATOM 8533  C CB   . GLN A 1 49  ? -2.936  10.955  6.179   1.00 0.00 ? 49  GLN A CB   6  
ATOM 8534  C CG   . GLN A 1 49  ? -1.809  11.845  5.610   1.00 0.00 ? 49  GLN A CG   6  
ATOM 8535  C CD   . GLN A 1 49  ? -1.077  12.656  6.683   1.00 0.00 ? 49  GLN A CD   6  
ATOM 8536  O OE1  . GLN A 1 49  ? -1.304  13.855  6.829   1.00 0.00 ? 49  GLN A OE1  6  
ATOM 8537  N NE2  . GLN A 1 49  ? -0.226  12.041  7.491   1.00 0.00 ? 49  GLN A NE2  6  
ATOM 8538  H H    . GLN A 1 49  ? -4.749  9.257   6.454   1.00 0.00 ? 49  GLN A H    6  
ATOM 8539  H HA   . GLN A 1 49  ? -2.126  9.099   5.402   1.00 0.00 ? 49  GLN A HA   6  
ATOM 8540  H HB2  . GLN A 1 49  ? -3.787  11.058  5.507   1.00 0.00 ? 49  GLN A HB2  6  
ATOM 8541  H HB3  . GLN A 1 49  ? -3.240  11.321  7.162   1.00 0.00 ? 49  GLN A HB3  6  
ATOM 8542  H HG2  . GLN A 1 49  ? -1.104  11.260  5.018   1.00 0.00 ? 49  GLN A HG2  6  
ATOM 8543  H HG3  . GLN A 1 49  ? -2.261  12.558  4.918   1.00 0.00 ? 49  GLN A HG3  6  
ATOM 8544  H HE21 . GLN A 1 49  ? -0.044  11.041  7.396   1.00 0.00 ? 49  GLN A HE21 6  
ATOM 8545  H HE22 . GLN A 1 49  ? 0.376   12.597  8.089   1.00 0.00 ? 49  GLN A HE22 6  
ATOM 8546  N N    . GLY A 1 50  ? -2.211  8.890   8.632   1.00 0.00 ? 50  GLY A N    6  
ATOM 8547  C CA   . GLY A 1 50  ? -1.438  8.510   9.792   1.00 0.00 ? 50  GLY A CA   6  
ATOM 8548  C C    . GLY A 1 50  ? -0.670  7.216   9.532   1.00 0.00 ? 50  GLY A C    6  
ATOM 8549  O O    . GLY A 1 50  ? 0.483   7.114   9.948   1.00 0.00 ? 50  GLY A O    6  
ATOM 8550  H H    . GLY A 1 50  ? -3.215  8.916   8.720   1.00 0.00 ? 50  GLY A H    6  
ATOM 8551  H HA2  . GLY A 1 50  ? -0.731  9.303   10.037  1.00 0.00 ? 50  GLY A HA2  6  
ATOM 8552  H HA3  . GLY A 1 50  ? -2.123  8.383   10.625  1.00 0.00 ? 50  GLY A HA3  6  
ATOM 8553  N N    . SER A 1 51  ? -1.267  6.250   8.830   1.00 0.00 ? 51  SER A N    6  
ATOM 8554  C CA   . SER A 1 51  ? -0.584  5.026   8.444   1.00 0.00 ? 51  SER A CA   6  
ATOM 8555  C C    . SER A 1 51  ? 0.387   5.342   7.308   1.00 0.00 ? 51  SER A C    6  
ATOM 8556  O O    . SER A 1 51  ? 1.575   5.038   7.397   1.00 0.00 ? 51  SER A O    6  
ATOM 8557  C CB   . SER A 1 51  ? -1.593  3.949   8.011   1.00 0.00 ? 51  SER A CB   6  
ATOM 8558  O OG   . SER A 1 51  ? -2.648  3.799   8.943   1.00 0.00 ? 51  SER A OG   6  
ATOM 8559  H H    . SER A 1 51  ? -2.202  6.374   8.468   1.00 0.00 ? 51  SER A H    6  
ATOM 8560  H HA   . SER A 1 51  ? -0.015  4.649   9.296   1.00 0.00 ? 51  SER A HA   6  
ATOM 8561  H HB2  . SER A 1 51  ? -2.020  4.209   7.042   1.00 0.00 ? 51  SER A HB2  6  
ATOM 8562  H HB3  . SER A 1 51  ? -1.070  2.999   7.912   1.00 0.00 ? 51  SER A HB3  6  
ATOM 8563  H HG   . SER A 1 51  ? -3.037  2.909   8.806   1.00 0.00 ? 51  SER A HG   6  
ATOM 8564  N N    . VAL A 1 52  ? -0.111  5.937   6.216   1.00 0.00 ? 52  VAL A N    6  
ATOM 8565  C CA   . VAL A 1 52  ? 0.640   5.996   4.968   1.00 0.00 ? 52  VAL A CA   6  
ATOM 8566  C C    . VAL A 1 52  ? 1.948   6.789   5.092   1.00 0.00 ? 52  VAL A C    6  
ATOM 8567  O O    . VAL A 1 52  ? 2.889   6.533   4.334   1.00 0.00 ? 52  VAL A O    6  
ATOM 8568  C CB   . VAL A 1 52  ? -0.271  6.495   3.818   1.00 0.00 ? 52  VAL A CB   6  
ATOM 8569  C CG1  . VAL A 1 52  ? 0.054   7.928   3.361   1.00 0.00 ? 52  VAL A CG1  6  
ATOM 8570  C CG2  . VAL A 1 52  ? -0.190  5.453   2.693   1.00 0.00 ? 52  VAL A CG2  6  
ATOM 8571  H H    . VAL A 1 52  ? -1.100  6.175   6.188   1.00 0.00 ? 52  VAL A H    6  
ATOM 8572  H HA   . VAL A 1 52  ? 0.925   4.968   4.749   1.00 0.00 ? 52  VAL A HA   6  
ATOM 8573  H HB   . VAL A 1 52  ? -1.309  6.524   4.140   1.00 0.00 ? 52  VAL A HB   6  
ATOM 8574  H HG11 . VAL A 1 52  ? 0.007   8.591   4.223   1.00 0.00 ? 52  VAL A HG11 6  
ATOM 8575  H HG12 . VAL A 1 52  ? 1.043   7.966   2.902   1.00 0.00 ? 52  VAL A HG12 6  
ATOM 8576  H HG13 . VAL A 1 52  ? -0.690  8.286   2.656   1.00 0.00 ? 52  VAL A HG13 6  
ATOM 8577  H HG21 . VAL A 1 52  ? -0.836  5.722   1.872   1.00 0.00 ? 52  VAL A HG21 6  
ATOM 8578  H HG22 . VAL A 1 52  ? 0.829   5.312   2.342   1.00 0.00 ? 52  VAL A HG22 6  
ATOM 8579  H HG23 . VAL A 1 52  ? -0.545  4.493   3.055   1.00 0.00 ? 52  VAL A HG23 6  
ATOM 8580  N N    . SER A 1 53  ? 1.982   7.782   5.987   1.00 0.00 ? 53  SER A N    6  
ATOM 8581  C CA   . SER A 1 53  ? 3.139   8.643   6.161   1.00 0.00 ? 53  SER A CA   6  
ATOM 8582  C C    . SER A 1 53  ? 4.310   7.808   6.683   1.00 0.00 ? 53  SER A C    6  
ATOM 8583  O O    . SER A 1 53  ? 5.365   7.788   6.043   1.00 0.00 ? 53  SER A O    6  
ATOM 8584  C CB   . SER A 1 53  ? 2.769   9.804   7.090   1.00 0.00 ? 53  SER A CB   6  
ATOM 8585  O OG   . SER A 1 53  ? 3.617   10.913  6.889   1.00 0.00 ? 53  SER A OG   6  
ATOM 8586  H H    . SER A 1 53  ? 1.149   7.942   6.549   1.00 0.00 ? 53  SER A H    6  
ATOM 8587  H HA   . SER A 1 53  ? 3.412   9.044   5.183   1.00 0.00 ? 53  SER A HA   6  
ATOM 8588  H HB2  . SER A 1 53  ? 1.758   10.130  6.863   1.00 0.00 ? 53  SER A HB2  6  
ATOM 8589  H HB3  . SER A 1 53  ? 2.811   9.480   8.130   1.00 0.00 ? 53  SER A HB3  6  
ATOM 8590  H HG   . SER A 1 53  ? 3.323   11.611  7.518   1.00 0.00 ? 53  SER A HG   6  
ATOM 8591  N N    . ASP A 1 54  ? 4.114   7.074   7.788   1.00 0.00 ? 54  ASP A N    6  
ATOM 8592  C CA   . ASP A 1 54  ? 5.115   6.146   8.324   1.00 0.00 ? 54  ASP A CA   6  
ATOM 8593  C C    . ASP A 1 54  ? 5.498   5.116   7.272   1.00 0.00 ? 54  ASP A C    6  
ATOM 8594  O O    . ASP A 1 54  ? 6.674   4.816   7.110   1.00 0.00 ? 54  ASP A O    6  
ATOM 8595  C CB   . ASP A 1 54  ? 4.579   5.411   9.560   1.00 0.00 ? 54  ASP A CB   6  
ATOM 8596  C CG   . ASP A 1 54  ? 5.518   4.267   9.970   1.00 0.00 ? 54  ASP A CG   6  
ATOM 8597  O OD1  . ASP A 1 54  ? 6.640   4.520   10.482  1.00 0.00 ? 54  ASP A OD1  6  
ATOM 8598  O OD2  . ASP A 1 54  ? 5.163   3.092   9.713   1.00 0.00 ? 54  ASP A OD2  6  
ATOM 8599  H H    . ASP A 1 54  ? 3.209   7.074   8.239   1.00 0.00 ? 54  ASP A H    6  
ATOM 8600  H HA   . ASP A 1 54  ? 6.008   6.702   8.607   1.00 0.00 ? 54  ASP A HA   6  
ATOM 8601  H HB2  . ASP A 1 54  ? 4.474   6.125   10.374  1.00 0.00 ? 54  ASP A HB2  6  
ATOM 8602  H HB3  . ASP A 1 54  ? 3.595   4.992   9.328   1.00 0.00 ? 54  ASP A HB3  6  
ATOM 8603  N N    . MET A 1 55  ? 4.512   4.620   6.528   1.00 0.00 ? 55  MET A N    6  
ATOM 8604  C CA   . MET A 1 55  ? 4.659   3.578   5.525   1.00 0.00 ? 55  MET A CA   6  
ATOM 8605  C C    . MET A 1 55  ? 5.714   3.941   4.493   1.00 0.00 ? 55  MET A C    6  
ATOM 8606  O O    . MET A 1 55  ? 6.715   3.247   4.344   1.00 0.00 ? 55  MET A O    6  
ATOM 8607  C CB   . MET A 1 55  ? 3.305   3.379   4.851   1.00 0.00 ? 55  MET A CB   6  
ATOM 8608  C CG   . MET A 1 55  ? 3.051   1.933   4.479   1.00 0.00 ? 55  MET A CG   6  
ATOM 8609  S SD   . MET A 1 55  ? 1.323   1.724   4.029   1.00 0.00 ? 55  MET A SD   6  
ATOM 8610  C CE   . MET A 1 55  ? 0.565   1.777   5.675   1.00 0.00 ? 55  MET A CE   6  
ATOM 8611  H H    . MET A 1 55  ? 3.576   4.935   6.766   1.00 0.00 ? 55  MET A H    6  
ATOM 8612  H HA   . MET A 1 55  ? 4.960   2.666   6.040   1.00 0.00 ? 55  MET A HA   6  
ATOM 8613  H HB2  . MET A 1 55  ? 2.541   3.715   5.533   1.00 0.00 ? 55  MET A HB2  6  
ATOM 8614  H HB3  . MET A 1 55  ? 3.196   3.984   3.952   1.00 0.00 ? 55  MET A HB3  6  
ATOM 8615  H HG2  . MET A 1 55  ? 3.686   1.670   3.633   1.00 0.00 ? 55  MET A HG2  6  
ATOM 8616  H HG3  . MET A 1 55  ? 3.289   1.283   5.323   1.00 0.00 ? 55  MET A HG3  6  
ATOM 8617  H HE1  . MET A 1 55  ? 1.180   1.230   6.390   1.00 0.00 ? 55  MET A HE1  6  
ATOM 8618  H HE2  . MET A 1 55  ? 0.469   2.810   6.008   1.00 0.00 ? 55  MET A HE2  6  
ATOM 8619  H HE3  . MET A 1 55  ? -0.421  1.311   5.614   1.00 0.00 ? 55  MET A HE3  6  
ATOM 8620  N N    . LEU A 1 56  ? 5.458   5.016   3.749   1.00 0.00 ? 56  LEU A N    6  
ATOM 8621  C CA   . LEU A 1 56  ? 6.397   5.514   2.752   1.00 0.00 ? 56  LEU A CA   6  
ATOM 8622  C C    . LEU A 1 56  ? 7.712   5.969   3.383   1.00 0.00 ? 56  LEU A C    6  
ATOM 8623  O O    . LEU A 1 56  ? 8.749   5.823   2.739   1.00 0.00 ? 56  LEU A O    6  
ATOM 8624  C CB   . LEU A 1 56  ? 5.802   6.669   1.934   1.00 0.00 ? 56  LEU A CB   6  
ATOM 8625  C CG   . LEU A 1 56  ? 4.668   6.296   0.964   1.00 0.00 ? 56  LEU A CG   6  
ATOM 8626  C CD1  . LEU A 1 56  ? 4.405   7.508   0.066   1.00 0.00 ? 56  LEU A CD1  6  
ATOM 8627  C CD2  . LEU A 1 56  ? 4.984   5.091   0.068   1.00 0.00 ? 56  LEU A CD2  6  
ATOM 8628  H H    . LEU A 1 56  ? 4.533   5.418   3.885   1.00 0.00 ? 56  LEU A H    6  
ATOM 8629  H HA   . LEU A 1 56  ? 6.650   4.694   2.083   1.00 0.00 ? 56  LEU A HA   6  
ATOM 8630  H HB2  . LEU A 1 56  ? 5.450   7.446   2.615   1.00 0.00 ? 56  LEU A HB2  6  
ATOM 8631  H HB3  . LEU A 1 56  ? 6.613   7.096   1.347   1.00 0.00 ? 56  LEU A HB3  6  
ATOM 8632  H HG   . LEU A 1 56  ? 3.759   6.083   1.534   1.00 0.00 ? 56  LEU A HG   6  
ATOM 8633  H HD11 . LEU A 1 56  ? 4.106   8.352   0.690   1.00 0.00 ? 56  LEU A HD11 6  
ATOM 8634  H HD12 . LEU A 1 56  ? 5.313   7.777   -0.476  1.00 0.00 ? 56  LEU A HD12 6  
ATOM 8635  H HD13 . LEU A 1 56  ? 3.634   7.290   -0.675  1.00 0.00 ? 56  LEU A HD13 6  
ATOM 8636  H HD21 . LEU A 1 56  ? 5.051   4.182   0.663   1.00 0.00 ? 56  LEU A HD21 6  
ATOM 8637  H HD22 . LEU A 1 56  ? 4.191   4.948   -0.664  1.00 0.00 ? 56  LEU A HD22 6  
ATOM 8638  H HD23 . LEU A 1 56  ? 5.925   5.244   -0.464  1.00 0.00 ? 56  LEU A HD23 6  
ATOM 8639  N N    . SER A 1 57  ? 7.695   6.521   4.599   1.00 0.00 ? 57  SER A N    6  
ATOM 8640  C CA   . SER A 1 57  ? 8.904   6.972   5.276   1.00 0.00 ? 57  SER A CA   6  
ATOM 8641  C C    . SER A 1 57  ? 9.819   5.779   5.590   1.00 0.00 ? 57  SER A C    6  
ATOM 8642  O O    . SER A 1 57  ? 11.012  5.803   5.277   1.00 0.00 ? 57  SER A O    6  
ATOM 8643  C CB   . SER A 1 57  ? 8.497   7.739   6.544   1.00 0.00 ? 57  SER A CB   6  
ATOM 8644  O OG   . SER A 1 57  ? 9.546   8.542   7.034   1.00 0.00 ? 57  SER A OG   6  
ATOM 8645  H H    . SER A 1 57  ? 6.811   6.637   5.085   1.00 0.00 ? 57  SER A H    6  
ATOM 8646  H HA   . SER A 1 57  ? 9.434   7.654   4.609   1.00 0.00 ? 57  SER A HA   6  
ATOM 8647  H HB2  . SER A 1 57  ? 7.674   8.411   6.308   1.00 0.00 ? 57  SER A HB2  6  
ATOM 8648  H HB3  . SER A 1 57  ? 8.172   7.043   7.317   1.00 0.00 ? 57  SER A HB3  6  
ATOM 8649  H HG   . SER A 1 57  ? 9.404   9.439   6.655   1.00 0.00 ? 57  SER A HG   6  
ATOM 8650  N N    . ARG A 1 58  ? 9.267   4.736   6.212   1.00 0.00 ? 58  ARG A N    6  
ATOM 8651  C CA   . ARG A 1 58  ? 9.953   3.559   6.723   1.00 0.00 ? 58  ARG A CA   6  
ATOM 8652  C C    . ARG A 1 58  ? 8.995   2.367   6.571   1.00 0.00 ? 58  ARG A C    6  
ATOM 8653  O O    . ARG A 1 58  ? 8.233   2.081   7.503   1.00 0.00 ? 58  ARG A O    6  
ATOM 8654  C CB   . ARG A 1 58  ? 10.334  3.749   8.207   1.00 0.00 ? 58  ARG A CB   6  
ATOM 8655  C CG   . ARG A 1 58  ? 11.102  5.018   8.596   1.00 0.00 ? 58  ARG A CG   6  
ATOM 8656  C CD   . ARG A 1 58  ? 11.487  4.897   10.078  1.00 0.00 ? 58  ARG A CD   6  
ATOM 8657  N NE   . ARG A 1 58  ? 11.534  6.193   10.769  1.00 0.00 ? 58  ARG A NE   6  
ATOM 8658  C CZ   . ARG A 1 58  ? 11.909  6.381   12.040  1.00 0.00 ? 58  ARG A CZ   6  
ATOM 8659  N NH1  . ARG A 1 58  ? 12.283  5.351   12.793  1.00 0.00 ? 58  ARG A NH1  6  
ATOM 8660  N NH2  . ARG A 1 58  ? 11.883  7.599   12.564  1.00 0.00 ? 58  ARG A NH2  6  
ATOM 8661  H H    . ARG A 1 58  ? 8.266   4.768   6.393   1.00 0.00 ? 58  ARG A H    6  
ATOM 8662  H HA   . ARG A 1 58  ? 10.866  3.384   6.153   1.00 0.00 ? 58  ARG A HA   6  
ATOM 8663  H HB2  . ARG A 1 58  ? 9.420   3.774   8.797   1.00 0.00 ? 58  ARG A HB2  6  
ATOM 8664  H HB3  . ARG A 1 58  ? 10.922  2.882   8.511   1.00 0.00 ? 58  ARG A HB3  6  
ATOM 8665  H HG2  . ARG A 1 58  ? 11.999  5.127   7.986   1.00 0.00 ? 58  ARG A HG2  6  
ATOM 8666  H HG3  . ARG A 1 58  ? 10.452  5.881   8.453   1.00 0.00 ? 58  ARG A HG3  6  
ATOM 8667  H HD2  . ARG A 1 58  ? 10.748  4.284   10.594  1.00 0.00 ? 58  ARG A HD2  6  
ATOM 8668  H HD3  . ARG A 1 58  ? 12.459  4.405   10.151  1.00 0.00 ? 58  ARG A HD3  6  
ATOM 8669  H HE   . ARG A 1 58  ? 11.256  7.021   10.242  1.00 0.00 ? 58  ARG A HE   6  
ATOM 8670  H HH11 . ARG A 1 58  ? 12.206  4.389   12.474  1.00 0.00 ? 58  ARG A HH11 6  
ATOM 8671  H HH12 . ARG A 1 58  ? 12.677  5.498   13.724  1.00 0.00 ? 58  ARG A HH12 6  
ATOM 8672  H HH21 . ARG A 1 58  ? 11.624  8.417   12.012  1.00 0.00 ? 58  ARG A HH21 6  
ATOM 8673  H HH22 . ARG A 1 58  ? 12.314  7.792   13.462  1.00 0.00 ? 58  ARG A HH22 6  
ATOM 8674  N N    . PRO A 1 59  ? 8.990   1.638   5.447   1.00 0.00 ? 59  PRO A N    6  
ATOM 8675  C CA   . PRO A 1 59  ? 8.215   0.408   5.336   1.00 0.00 ? 59  PRO A CA   6  
ATOM 8676  C C    . PRO A 1 59  ? 8.806   -0.678  6.245   1.00 0.00 ? 59  PRO A C    6  
ATOM 8677  O O    . PRO A 1 59  ? 9.816   -0.473  6.926   1.00 0.00 ? 59  PRO A O    6  
ATOM 8678  C CB   . PRO A 1 59  ? 8.229   0.034   3.856   1.00 0.00 ? 59  PRO A CB   6  
ATOM 8679  C CG   . PRO A 1 59  ? 9.554   0.617   3.392   1.00 0.00 ? 59  PRO A CG   6  
ATOM 8680  C CD   . PRO A 1 59  ? 9.737   1.883   4.227   1.00 0.00 ? 59  PRO A CD   6  
ATOM 8681  H HA   . PRO A 1 59  ? 7.185   0.599   5.643   1.00 0.00 ? 59  PRO A HA   6  
ATOM 8682  H HB2  . PRO A 1 59  ? 8.177   -1.041  3.685   1.00 0.00 ? 59  PRO A HB2  6  
ATOM 8683  H HB3  . PRO A 1 59  ? 7.402   0.532   3.355   1.00 0.00 ? 59  PRO A HB3  6  
ATOM 8684  H HG2  . PRO A 1 59  ? 10.332  -0.099  3.624   1.00 0.00 ? 59  PRO A HG2  6  
ATOM 8685  H HG3  . PRO A 1 59  ? 9.553   0.827   2.331   1.00 0.00 ? 59  PRO A HG3  6  
ATOM 8686  H HD2  . PRO A 1 59  ? 10.794  2.057   4.429   1.00 0.00 ? 59  PRO A HD2  6  
ATOM 8687  H HD3  . PRO A 1 59  ? 9.303   2.739   3.710   1.00 0.00 ? 59  PRO A HD3  6  
ATOM 8688  N N    . LYS A 1 60  ? 8.134   -1.829  6.295   1.00 0.00 ? 60  LYS A N    6  
ATOM 8689  C CA   . LYS A 1 60  ? 8.553   -3.026  7.017   1.00 0.00 ? 60  LYS A CA   6  
ATOM 8690  C C    . LYS A 1 60  ? 8.923   -4.078  5.970   1.00 0.00 ? 60  LYS A C    6  
ATOM 8691  O O    . LYS A 1 60  ? 8.404   -4.002  4.849   1.00 0.00 ? 60  LYS A O    6  
ATOM 8692  C CB   . LYS A 1 60  ? 7.406   -3.489  7.928   1.00 0.00 ? 60  LYS A CB   6  
ATOM 8693  C CG   . LYS A 1 60  ? 7.138   -2.429  9.006   1.00 0.00 ? 60  LYS A CG   6  
ATOM 8694  C CD   . LYS A 1 60  ? 5.928   -2.776  9.869   1.00 0.00 ? 60  LYS A CD   6  
ATOM 8695  C CE   . LYS A 1 60  ? 5.591   -1.535  10.701  1.00 0.00 ? 60  LYS A CE   6  
ATOM 8696  N NZ   . LYS A 1 60  ? 4.306   -1.665  11.410  1.00 0.00 ? 60  LYS A NZ   6  
ATOM 8697  H H    . LYS A 1 60  ? 7.374   -1.974  5.651   1.00 0.00 ? 60  LYS A H    6  
ATOM 8698  H HA   . LYS A 1 60  ? 9.429   -2.803  7.628   1.00 0.00 ? 60  LYS A HA   6  
ATOM 8699  H HB2  . LYS A 1 60  ? 6.508   -3.643  7.327   1.00 0.00 ? 60  LYS A HB2  6  
ATOM 8700  H HB3  . LYS A 1 60  ? 7.668   -4.430  8.412   1.00 0.00 ? 60  LYS A HB3  6  
ATOM 8701  H HG2  . LYS A 1 60  ? 8.019   -2.332  9.639   1.00 0.00 ? 60  LYS A HG2  6  
ATOM 8702  H HG3  . LYS A 1 60  ? 6.947   -1.467  8.532   1.00 0.00 ? 60  LYS A HG3  6  
ATOM 8703  H HD2  . LYS A 1 60  ? 5.084   -3.026  9.223   1.00 0.00 ? 60  LYS A HD2  6  
ATOM 8704  H HD3  . LYS A 1 60  ? 6.172   -3.622  10.512  1.00 0.00 ? 60  LYS A HD3  6  
ATOM 8705  H HE2  . LYS A 1 60  ? 6.395   -1.344  11.415  1.00 0.00 ? 60  LYS A HE2  6  
ATOM 8706  H HE3  . LYS A 1 60  ? 5.527   -0.674  10.030  1.00 0.00 ? 60  LYS A HE3  6  
ATOM 8707  H HZ1  . LYS A 1 60  ? 4.353   -2.372  12.135  1.00 0.00 ? 60  LYS A HZ1  6  
ATOM 8708  H HZ2  . LYS A 1 60  ? 4.050   -0.773  11.821  1.00 0.00 ? 60  LYS A HZ2  6  
ATOM 8709  H HZ3  . LYS A 1 60  ? 3.577   -1.944  10.759  1.00 0.00 ? 60  LYS A HZ3  6  
ATOM 8710  N N    . PRO A 1 61  ? 9.779   -5.061  6.286   1.00 0.00 ? 61  PRO A N    6  
ATOM 8711  C CA   . PRO A 1 61  ? 10.168  -6.080  5.316   1.00 0.00 ? 61  PRO A CA   6  
ATOM 8712  C C    . PRO A 1 61  ? 8.960   -6.946  4.954   1.00 0.00 ? 61  PRO A C    6  
ATOM 8713  O O    . PRO A 1 61  ? 8.088   -7.174  5.795   1.00 0.00 ? 61  PRO A O    6  
ATOM 8714  C CB   . PRO A 1 61  ? 11.276  -6.889  5.987   1.00 0.00 ? 61  PRO A CB   6  
ATOM 8715  C CG   . PRO A 1 61  ? 11.064  -6.655  7.471   1.00 0.00 ? 61  PRO A CG   6  
ATOM 8716  C CD   . PRO A 1 61  ? 10.415  -5.285  7.576   1.00 0.00 ? 61  PRO A CD   6  
ATOM 8717  H HA   . PRO A 1 61  ? 10.566  -5.610  4.417   1.00 0.00 ? 61  PRO A HA   6  
ATOM 8718  H HB2  . PRO A 1 61  ? 11.210  -7.947  5.738   1.00 0.00 ? 61  PRO A HB2  6  
ATOM 8719  H HB3  . PRO A 1 61  ? 12.242  -6.497  5.698   1.00 0.00 ? 61  PRO A HB3  6  
ATOM 8720  H HG2  . PRO A 1 61  ? 10.342  -7.383  7.797   1.00 0.00 ? 61  PRO A HG2  6  
ATOM 8721  H HG3  . PRO A 1 61  ? 11.984  -6.736  8.050   1.00 0.00 ? 61  PRO A HG3  6  
ATOM 8722  H HD2  . PRO A 1 61  ? 9.685   -5.312  8.390   1.00 0.00 ? 61  PRO A HD2  6  
ATOM 8723  H HD3  . PRO A 1 61  ? 11.175  -4.523  7.754   1.00 0.00 ? 61  PRO A HD3  6  
ATOM 8724  N N    . TRP A 1 62  ? 8.922   -7.471  3.726   1.00 0.00 ? 62  TRP A N    6  
ATOM 8725  C CA   . TRP A 1 62  ? 7.744   -8.153  3.194   1.00 0.00 ? 62  TRP A CA   6  
ATOM 8726  C C    . TRP A 1 62  ? 7.286   -9.309  4.080   1.00 0.00 ? 62  TRP A C    6  
ATOM 8727  O O    . TRP A 1 62  ? 6.086   -9.468  4.319   1.00 0.00 ? 62  TRP A O    6  
ATOM 8728  C CB   . TRP A 1 62  ? 8.020   -8.654  1.780   1.00 0.00 ? 62  TRP A CB   6  
ATOM 8729  C CG   . TRP A 1 62  ? 6.854   -9.302  1.104   1.00 0.00 ? 62  TRP A CG   6  
ATOM 8730  C CD1  . TRP A 1 62  ? 6.635   -10.633 1.050   1.00 0.00 ? 62  TRP A CD1  6  
ATOM 8731  C CD2  . TRP A 1 62  ? 5.723   -8.691  0.411   1.00 0.00 ? 62  TRP A CD2  6  
ATOM 8732  N NE1  . TRP A 1 62  ? 5.561   -10.890 0.228   1.00 0.00 ? 62  TRP A NE1  6  
ATOM 8733  C CE2  . TRP A 1 62  ? 4.966   -9.729  -0.203  1.00 0.00 ? 62  TRP A CE2  6  
ATOM 8734  C CE3  . TRP A 1 62  ? 5.249   -7.372  0.240   1.00 0.00 ? 62  TRP A CE3  6  
ATOM 8735  C CZ2  . TRP A 1 62  ? 3.857   -9.470  -1.014  1.00 0.00 ? 62  TRP A CZ2  6  
ATOM 8736  C CZ3  . TRP A 1 62  ? 4.117   -7.097  -0.551  1.00 0.00 ? 62  TRP A CZ3  6  
ATOM 8737  C CH2  . TRP A 1 62  ? 3.437   -8.147  -1.195  1.00 0.00 ? 62  TRP A CH2  6  
ATOM 8738  H H    . TRP A 1 62  ? 9.689   -7.297  3.085   1.00 0.00 ? 62  TRP A H    6  
ATOM 8739  H HA   . TRP A 1 62  ? 6.934   -7.432  3.141   1.00 0.00 ? 62  TRP A HA   6  
ATOM 8740  H HB2  . TRP A 1 62  ? 8.337   -7.817  1.160   1.00 0.00 ? 62  TRP A HB2  6  
ATOM 8741  H HB3  . TRP A 1 62  ? 8.839   -9.376  1.813   1.00 0.00 ? 62  TRP A HB3  6  
ATOM 8742  H HD1  . TRP A 1 62  ? 7.246   -11.392 1.517   1.00 0.00 ? 62  TRP A HD1  6  
ATOM 8743  H HE1  . TRP A 1 62  ? 5.252   -11.828 -0.037  1.00 0.00 ? 62  TRP A HE1  6  
ATOM 8744  H HE3  . TRP A 1 62  ? 5.783   -6.563  0.704   1.00 0.00 ? 62  TRP A HE3  6  
ATOM 8745  H HZ2  . TRP A 1 62  ? 3.323   -10.288 -1.478  1.00 0.00 ? 62  TRP A HZ2  6  
ATOM 8746  H HZ3  . TRP A 1 62  ? 3.790   -6.076  -0.677  1.00 0.00 ? 62  TRP A HZ3  6  
ATOM 8747  H HH2  . TRP A 1 62  ? 2.584   -7.963  -1.823  1.00 0.00 ? 62  TRP A HH2  6  
ATOM 8748  N N    . SER A 1 63  ? 8.225   -10.089 4.625   1.00 0.00 ? 63  SER A N    6  
ATOM 8749  C CA   . SER A 1 63  ? 7.858   -11.225 5.459   1.00 0.00 ? 63  SER A CA   6  
ATOM 8750  C C    . SER A 1 63  ? 7.034   -10.785 6.667   1.00 0.00 ? 63  SER A C    6  
ATOM 8751  O O    . SER A 1 63  ? 6.069   -11.447 7.037   1.00 0.00 ? 63  SER A O    6  
ATOM 8752  C CB   . SER A 1 63  ? 9.094   -11.962 5.962   1.00 0.00 ? 63  SER A CB   6  
ATOM 8753  O OG   . SER A 1 63  ? 10.122  -12.067 4.991   1.00 0.00 ? 63  SER A OG   6  
ATOM 8754  H H    . SER A 1 63  ? 9.203   -9.939  4.411   1.00 0.00 ? 63  SER A H    6  
ATOM 8755  H HA   . SER A 1 63  ? 7.265   -11.909 4.857   1.00 0.00 ? 63  SER A HA   6  
ATOM 8756  H HB2  . SER A 1 63  ? 9.499   -11.437 6.827   1.00 0.00 ? 63  SER A HB2  6  
ATOM 8757  H HB3  . SER A 1 63  ? 8.790   -12.954 6.289   1.00 0.00 ? 63  SER A HB3  6  
ATOM 8758  H HG   . SER A 1 63  ? 9.767   -12.600 4.234   1.00 0.00 ? 63  SER A HG   6  
ATOM 8759  N N    . LYS A 1 64  ? 7.401   -9.647  7.265   1.00 0.00 ? 64  LYS A N    6  
ATOM 8760  C CA   . LYS A 1 64  ? 6.816   -9.173  8.520   1.00 0.00 ? 64  LYS A CA   6  
ATOM 8761  C C    . LYS A 1 64  ? 5.375   -8.705  8.305   1.00 0.00 ? 64  LYS A C    6  
ATOM 8762  O O    . LYS A 1 64  ? 4.616   -8.600  9.269   1.00 0.00 ? 64  LYS A O    6  
ATOM 8763  C CB   . LYS A 1 64  ? 7.696   -8.046  9.100   1.00 0.00 ? 64  LYS A CB   6  
ATOM 8764  C CG   . LYS A 1 64  ? 9.014   -8.506  9.760   1.00 0.00 ? 64  LYS A CG   6  
ATOM 8765  C CD   . LYS A 1 64  ? 9.764   -9.668  9.077   1.00 0.00 ? 64  LYS A CD   6  
ATOM 8766  C CE   . LYS A 1 64  ? 11.113  -9.952  9.730   1.00 0.00 ? 64  LYS A CE   6  
ATOM 8767  N NZ   . LYS A 1 64  ? 11.887  -10.980 8.999   1.00 0.00 ? 64  LYS A NZ   6  
ATOM 8768  H H    . LYS A 1 64  ? 8.118   -9.078  6.822   1.00 0.00 ? 64  LYS A H    6  
ATOM 8769  H HA   . LYS A 1 64  ? 6.781   -9.997  9.237   1.00 0.00 ? 64  LYS A HA   6  
ATOM 8770  H HB2  . LYS A 1 64  ? 7.932   -7.325  8.318   1.00 0.00 ? 64  LYS A HB2  6  
ATOM 8771  H HB3  . LYS A 1 64  ? 7.125   -7.510  9.862   1.00 0.00 ? 64  LYS A HB3  6  
ATOM 8772  H HG2  . LYS A 1 64  ? 9.675   -7.644  9.846   1.00 0.00 ? 64  LYS A HG2  6  
ATOM 8773  H HG3  . LYS A 1 64  ? 8.794   -8.787  10.777  1.00 0.00 ? 64  LYS A HG3  6  
ATOM 8774  H HD2  . LYS A 1 64  ? 9.164   -10.569 9.147   1.00 0.00 ? 64  LYS A HD2  6  
ATOM 8775  H HD3  . LYS A 1 64  ? 9.928   -9.442  8.027   1.00 0.00 ? 64  LYS A HD3  6  
ATOM 8776  H HE2  . LYS A 1 64  ? 11.693  -9.028  9.757   1.00 0.00 ? 64  LYS A HE2  6  
ATOM 8777  H HE3  . LYS A 1 64  ? 10.943  -10.279 10.756  1.00 0.00 ? 64  LYS A HE3  6  
ATOM 8778  H HZ1  . LYS A 1 64  ? 11.400  -11.868 8.934   1.00 0.00 ? 64  LYS A HZ1  6  
ATOM 8779  H HZ2  . LYS A 1 64  ? 12.093  -10.671 8.053   1.00 0.00 ? 64  LYS A HZ2  6  
ATOM 8780  H HZ3  . LYS A 1 64  ? 12.777  -11.142 9.454   1.00 0.00 ? 64  LYS A HZ3  6  
ATOM 8781  N N    . LEU A 1 65  ? 4.985   -8.402  7.065   1.00 0.00 ? 65  LEU A N    6  
ATOM 8782  C CA   . LEU A 1 65  ? 3.631   -8.023  6.689   1.00 0.00 ? 65  LEU A CA   6  
ATOM 8783  C C    . LEU A 1 65  ? 2.839   -9.300  6.426   1.00 0.00 ? 65  LEU A C    6  
ATOM 8784  O O    . LEU A 1 65  ? 3.296   -10.152 5.663   1.00 0.00 ? 65  LEU A O    6  
ATOM 8785  C CB   . LEU A 1 65  ? 3.668   -7.175  5.409   1.00 0.00 ? 65  LEU A CB   6  
ATOM 8786  C CG   . LEU A 1 65  ? 4.440   -5.851  5.536   1.00 0.00 ? 65  LEU A CG   6  
ATOM 8787  C CD1  . LEU A 1 65  ? 4.724   -5.318  4.132   1.00 0.00 ? 65  LEU A CD1  6  
ATOM 8788  C CD2  . LEU A 1 65  ? 3.645   -4.821  6.348   1.00 0.00 ? 65  LEU A CD2  6  
ATOM 8789  H H    . LEU A 1 65  ? 5.629   -8.579  6.305   1.00 0.00 ? 65  LEU A H    6  
ATOM 8790  H HA   . LEU A 1 65  ? 3.163   -7.452  7.488   1.00 0.00 ? 65  LEU A HA   6  
ATOM 8791  H HB2  . LEU A 1 65  ? 4.124   -7.772  4.621   1.00 0.00 ? 65  LEU A HB2  6  
ATOM 8792  H HB3  . LEU A 1 65  ? 2.644   -6.958  5.102   1.00 0.00 ? 65  LEU A HB3  6  
ATOM 8793  H HG   . LEU A 1 65  ? 5.400   -6.018  6.024   1.00 0.00 ? 65  LEU A HG   6  
ATOM 8794  H HD11 . LEU A 1 65  ? 3.796   -5.212  3.576   1.00 0.00 ? 65  LEU A HD11 6  
ATOM 8795  H HD12 . LEU A 1 65  ? 5.239   -4.360  4.186   1.00 0.00 ? 65  LEU A HD12 6  
ATOM 8796  H HD13 . LEU A 1 65  ? 5.364   -6.014  3.596   1.00 0.00 ? 65  LEU A HD13 6  
ATOM 8797  H HD21 . LEU A 1 65  ? 4.208   -3.890  6.410   1.00 0.00 ? 65  LEU A HD21 6  
ATOM 8798  H HD22 . LEU A 1 65  ? 2.681   -4.624  5.876   1.00 0.00 ? 65  LEU A HD22 6  
ATOM 8799  H HD23 . LEU A 1 65  ? 3.483   -5.186  7.362   1.00 0.00 ? 65  LEU A HD23 6  
ATOM 8800  N N    . THR A 1 66  ? 1.657   -9.456  7.010   1.00 0.00 ? 66  THR A N    6  
ATOM 8801  C CA   . THR A 1 66  ? 0.713   -10.514 6.635   1.00 0.00 ? 66  THR A CA   6  
ATOM 8802  C C    . THR A 1 66  ? 0.050   -10.172 5.293   1.00 0.00 ? 66  THR A C    6  
ATOM 8803  O O    . THR A 1 66  ? 0.240   -9.067  4.791   1.00 0.00 ? 66  THR A O    6  
ATOM 8804  C CB   . THR A 1 66  ? -0.317  -10.665 7.763   1.00 0.00 ? 66  THR A CB   6  
ATOM 8805  O OG1  . THR A 1 66  ? -0.821  -9.392  8.130   1.00 0.00 ? 66  THR A OG1  6  
ATOM 8806  C CG2  . THR A 1 66  ? 0.341   -11.348 8.966   1.00 0.00 ? 66  THR A CG2  6  
ATOM 8807  H H    . THR A 1 66  ? 1.290   -8.762  7.653   1.00 0.00 ? 66  THR A H    6  
ATOM 8808  H HA   . THR A 1 66  ? 1.252   -11.453 6.527   1.00 0.00 ? 66  THR A HA   6  
ATOM 8809  H HB   . THR A 1 66  ? -1.144  -11.287 7.428   1.00 0.00 ? 66  THR A HB   6  
ATOM 8810  H HG1  . THR A 1 66  ? -1.421  -9.518  8.890   1.00 0.00 ? 66  THR A HG1  6  
ATOM 8811  H HG21 . THR A 1 66  ? 0.570   -12.383 8.713   1.00 0.00 ? 66  THR A HG21 6  
ATOM 8812  H HG22 . THR A 1 66  ? 1.269   -10.848 9.229   1.00 0.00 ? 66  THR A HG22 6  
ATOM 8813  H HG23 . THR A 1 66  ? -0.323  -11.340 9.827   1.00 0.00 ? 66  THR A HG23 6  
ATOM 8814  N N    . GLN A 1 67  ? -0.783  -11.053 4.728   1.00 0.00 ? 67  GLN A N    6  
ATOM 8815  C CA   . GLN A 1 67  ? -1.582  -10.748 3.535   1.00 0.00 ? 67  GLN A CA   6  
ATOM 8816  C C    . GLN A 1 67  ? -2.394  -9.465  3.732   1.00 0.00 ? 67  GLN A C    6  
ATOM 8817  O O    . GLN A 1 67  ? -2.416  -8.610  2.851   1.00 0.00 ? 67  GLN A O    6  
ATOM 8818  C CB   . GLN A 1 67  ? -2.520  -11.918 3.209   1.00 0.00 ? 67  GLN A CB   6  
ATOM 8819  C CG   . GLN A 1 67  ? -1.798  -13.152 2.652   1.00 0.00 ? 67  GLN A CG   6  
ATOM 8820  C CD   . GLN A 1 67  ? -1.582  -13.049 1.146   1.00 0.00 ? 67  GLN A CD   6  
ATOM 8821  O OE1  . GLN A 1 67  ? -0.919  -12.144 0.660   1.00 0.00 ? 67  GLN A OE1  6  
ATOM 8822  N NE2  . GLN A 1 67  ? -2.149  -13.945 0.357   1.00 0.00 ? 67  GLN A NE2  6  
ATOM 8823  H H    . GLN A 1 67  ? -0.847  -11.981 5.126   1.00 0.00 ? 67  GLN A H    6  
ATOM 8824  H HA   . GLN A 1 67  ? -0.913  -10.587 2.688   1.00 0.00 ? 67  GLN A HA   6  
ATOM 8825  H HB2  . GLN A 1 67  ? -3.053  -12.194 4.115   1.00 0.00 ? 67  GLN A HB2  6  
ATOM 8826  H HB3  . GLN A 1 67  ? -3.261  -11.596 2.477   1.00 0.00 ? 67  GLN A HB3  6  
ATOM 8827  H HG2  . GLN A 1 67  ? -0.839  -13.289 3.146   1.00 0.00 ? 67  GLN A HG2  6  
ATOM 8828  H HG3  . GLN A 1 67  ? -2.401  -14.030 2.862   1.00 0.00 ? 67  GLN A HG3  6  
ATOM 8829  H HE21 . GLN A 1 67  ? -2.770  -14.650 0.735   1.00 0.00 ? 67  GLN A HE21 6  
ATOM 8830  H HE22 . GLN A 1 67  ? -2.044  -13.797 -0.637  1.00 0.00 ? 67  GLN A HE22 6  
ATOM 8831  N N    . LYS A 1 68  ? -3.021  -9.298  4.903   1.00 0.00 ? 68  LYS A N    6  
ATOM 8832  C CA   . LYS A 1 68  ? -3.712  -8.063  5.272   1.00 0.00 ? 68  LYS A CA   6  
ATOM 8833  C C    . LYS A 1 68  ? -2.746  -6.881  5.200   1.00 0.00 ? 68  LYS A C    6  
ATOM 8834  O O    . LYS A 1 68  ? -3.027  -5.893  4.529   1.00 0.00 ? 68  LYS A O    6  
ATOM 8835  C CB   . LYS A 1 68  ? -4.313  -8.240  6.673   1.00 0.00 ? 68  LYS A CB   6  
ATOM 8836  C CG   . LYS A 1 68  ? -5.183  -7.077  7.157   1.00 0.00 ? 68  LYS A CG   6  
ATOM 8837  C CD   . LYS A 1 68  ? -6.472  -6.907  6.341   1.00 0.00 ? 68  LYS A CD   6  
ATOM 8838  C CE   . LYS A 1 68  ? -7.385  -5.906  7.053   1.00 0.00 ? 68  LYS A CE   6  
ATOM 8839  N NZ   . LYS A 1 68  ? -8.045  -6.472  8.252   1.00 0.00 ? 68  LYS A NZ   6  
ATOM 8840  H H    . LYS A 1 68  ? -2.977  -10.053 5.573   1.00 0.00 ? 68  LYS A H    6  
ATOM 8841  H HA   . LYS A 1 68  ? -4.508  -7.888  4.544   1.00 0.00 ? 68  LYS A HA   6  
ATOM 8842  H HB2  . LYS A 1 68  ? -4.931  -9.132  6.667   1.00 0.00 ? 68  LYS A HB2  6  
ATOM 8843  H HB3  . LYS A 1 68  ? -3.507  -8.387  7.395   1.00 0.00 ? 68  LYS A HB3  6  
ATOM 8844  H HG2  . LYS A 1 68  ? -5.447  -7.271  8.196   1.00 0.00 ? 68  LYS A HG2  6  
ATOM 8845  H HG3  . LYS A 1 68  ? -4.615  -6.150  7.127   1.00 0.00 ? 68  LYS A HG3  6  
ATOM 8846  H HD2  . LYS A 1 68  ? -6.220  -6.505  5.357   1.00 0.00 ? 68  LYS A HD2  6  
ATOM 8847  H HD3  . LYS A 1 68  ? -6.986  -7.862  6.220   1.00 0.00 ? 68  LYS A HD3  6  
ATOM 8848  H HE2  . LYS A 1 68  ? -6.789  -5.038  7.346   1.00 0.00 ? 68  LYS A HE2  6  
ATOM 8849  H HE3  . LYS A 1 68  ? -8.156  -5.564  6.359   1.00 0.00 ? 68  LYS A HE3  6  
ATOM 8850  H HZ1  . LYS A 1 68  ? -8.814  -7.083  8.000   1.00 0.00 ? 68  LYS A HZ1  6  
ATOM 8851  H HZ2  . LYS A 1 68  ? -7.411  -6.961  8.865   1.00 0.00 ? 68  LYS A HZ2  6  
ATOM 8852  H HZ3  . LYS A 1 68  ? -8.455  -5.717  8.803   1.00 0.00 ? 68  LYS A HZ3  6  
ATOM 8853  N N    . GLY A 1 69  ? -1.583  -7.012  5.845   1.00 0.00 ? 69  GLY A N    6  
ATOM 8854  C CA   . GLY A 1 69  ? -0.500  -6.043  5.762   1.00 0.00 ? 69  GLY A CA   6  
ATOM 8855  C C    . GLY A 1 69  ? -0.159  -5.679  4.312   1.00 0.00 ? 69  GLY A C    6  
ATOM 8856  O O    . GLY A 1 69  ? 0.085   -4.512  4.013   1.00 0.00 ? 69  GLY A O    6  
ATOM 8857  H H    . GLY A 1 69  ? -1.411  -7.852  6.381   1.00 0.00 ? 69  GLY A H    6  
ATOM 8858  H HA2  . GLY A 1 69  ? -0.778  -5.149  6.316   1.00 0.00 ? 69  GLY A HA2  6  
ATOM 8859  H HA3  . GLY A 1 69  ? 0.388   -6.472  6.227   1.00 0.00 ? 69  GLY A HA3  6  
ATOM 8860  N N    . ARG A 1 70  ? -0.100  -6.668  3.419   1.00 0.00 ? 70  ARG A N    6  
ATOM 8861  C CA   . ARG A 1 70  ? 0.399   -6.552  2.051   1.00 0.00 ? 70  ARG A CA   6  
ATOM 8862  C C    . ARG A 1 70  ? -0.625  -5.968  1.089   1.00 0.00 ? 70  ARG A C    6  
ATOM 8863  O O    . ARG A 1 70  ? -0.197  -5.381  0.103   1.00 0.00 ? 70  ARG A O    6  
ATOM 8864  C CB   . ARG A 1 70  ? 0.844   -7.935  1.539   1.00 0.00 ? 70  ARG A CB   6  
ATOM 8865  C CG   . ARG A 1 70  ? 2.092   -8.458  2.266   1.00 0.00 ? 70  ARG A CG   6  
ATOM 8866  C CD   . ARG A 1 70  ? 2.237   -9.965  2.064   1.00 0.00 ? 70  ARG A CD   6  
ATOM 8867  N NE   . ARG A 1 70  ? 3.324   -10.518 2.882   1.00 0.00 ? 70  ARG A NE   6  
ATOM 8868  C CZ   . ARG A 1 70  ? 3.879   -11.723 2.737   1.00 0.00 ? 70  ARG A CZ   6  
ATOM 8869  N NH1  . ARG A 1 70  ? 3.444   -12.574 1.823   1.00 0.00 ? 70  ARG A NH1  6  
ATOM 8870  N NH2  . ARG A 1 70  ? 4.880   -12.081 3.527   1.00 0.00 ? 70  ARG A NH2  6  
ATOM 8871  H H    . ARG A 1 70  ? -0.310  -7.603  3.752   1.00 0.00 ? 70  ARG A H    6  
ATOM 8872  H HA   . ARG A 1 70  ? 1.257   -5.885  2.050   1.00 0.00 ? 70  ARG A HA   6  
ATOM 8873  H HB2  . ARG A 1 70  ? 0.018   -8.638  1.664   1.00 0.00 ? 70  ARG A HB2  6  
ATOM 8874  H HB3  . ARG A 1 70  ? 1.071   -7.871  0.473   1.00 0.00 ? 70  ARG A HB3  6  
ATOM 8875  H HG2  . ARG A 1 70  ? 2.977   -7.949  1.889   1.00 0.00 ? 70  ARG A HG2  6  
ATOM 8876  H HG3  . ARG A 1 70  ? 2.023   -8.259  3.330   1.00 0.00 ? 70  ARG A HG3  6  
ATOM 8877  H HD2  . ARG A 1 70  ? 1.307   -10.461 2.341   1.00 0.00 ? 70  ARG A HD2  6  
ATOM 8878  H HD3  . ARG A 1 70  ? 2.430   -10.160 1.013   1.00 0.00 ? 70  ARG A HD3  6  
ATOM 8879  H HE   . ARG A 1 70  ? 3.641   -9.954  3.664   1.00 0.00 ? 70  ARG A HE   6  
ATOM 8880  H HH11 . ARG A 1 70  ? 2.755   -12.299 1.119   1.00 0.00 ? 70  ARG A HH11 6  
ATOM 8881  H HH12 . ARG A 1 70  ? 3.994   -13.405 1.598   1.00 0.00 ? 70  ARG A HH12 6  
ATOM 8882  H HH21 . ARG A 1 70  ? 5.273   -11.411 4.177   1.00 0.00 ? 70  ARG A HH21 6  
ATOM 8883  H HH22 . ARG A 1 70  ? 5.330   -12.992 3.389   1.00 0.00 ? 70  ARG A HH22 6  
ATOM 8884  N N    . GLU A 1 71  ? -1.932  -6.080  1.335   1.00 0.00 ? 71  GLU A N    6  
ATOM 8885  C CA   . GLU A 1 71  ? -2.995  -5.592  0.468   1.00 0.00 ? 71  GLU A CA   6  
ATOM 8886  C C    . GLU A 1 71  ? -2.759  -4.164  -0.069  1.00 0.00 ? 71  GLU A C    6  
ATOM 8887  O O    . GLU A 1 71  ? -2.792  -3.988  -1.295  1.00 0.00 ? 71  GLU A O    6  
ATOM 8888  C CB   . GLU A 1 71  ? -4.311  -5.762  1.239   1.00 0.00 ? 71  GLU A CB   6  
ATOM 8889  C CG   . GLU A 1 71  ? -5.392  -6.449  0.417   1.00 0.00 ? 71  GLU A CG   6  
ATOM 8890  C CD   . GLU A 1 71  ? -6.339  -5.415  -0.204  1.00 0.00 ? 71  GLU A CD   6  
ATOM 8891  O OE1  . GLU A 1 71  ? -7.220  -4.891  0.515   1.00 0.00 ? 71  GLU A OE1  6  
ATOM 8892  O OE2  . GLU A 1 71  ? -6.185  -5.072  -1.397  1.00 0.00 ? 71  GLU A OE2  6  
ATOM 8893  H H    . GLU A 1 71  ? -2.301  -6.603  2.124   1.00 0.00 ? 71  GLU A H    6  
ATOM 8894  H HA   . GLU A 1 71  ? -3.006  -6.259  -0.395  1.00 0.00 ? 71  GLU A HA   6  
ATOM 8895  H HB2  . GLU A 1 71  ? -4.139  -6.402  2.109   1.00 0.00 ? 71  GLU A HB2  6  
ATOM 8896  H HB3  . GLU A 1 71  ? -4.674  -4.805  1.616   1.00 0.00 ? 71  GLU A HB3  6  
ATOM 8897  H HG2  . GLU A 1 71  ? -4.964  -7.100  -0.354  1.00 0.00 ? 71  GLU A HG2  6  
ATOM 8898  H HG3  . GLU A 1 71  ? -5.915  -7.071  1.140   1.00 0.00 ? 71  GLU A HG3  6  
ATOM 8899  N N    . PRO A 1 72  ? -2.459  -3.155  0.780   1.00 0.00 ? 72  PRO A N    6  
ATOM 8900  C CA   . PRO A 1 72  ? -2.097  -1.825  0.303   1.00 0.00 ? 72  PRO A CA   6  
ATOM 8901  C C    . PRO A 1 72  ? -0.747  -1.834  -0.435  1.00 0.00 ? 72  PRO A C    6  
ATOM 8902  O O    . PRO A 1 72  ? -0.649  -1.258  -1.515  1.00 0.00 ? 72  PRO A O    6  
ATOM 8903  C CB   . PRO A 1 72  ? -2.139  -0.906  1.535   1.00 0.00 ? 72  PRO A CB   6  
ATOM 8904  C CG   . PRO A 1 72  ? -1.937  -1.857  2.712   1.00 0.00 ? 72  PRO A CG   6  
ATOM 8905  C CD   . PRO A 1 72  ? -2.543  -3.172  2.237   1.00 0.00 ? 72  PRO A CD   6  
ATOM 8906  H HA   . PRO A 1 72  ? -2.858  -1.487  -0.402  1.00 0.00 ? 72  PRO A HA   6  
ATOM 8907  H HB2  . PRO A 1 72  ? -1.369  -0.128  1.527   1.00 0.00 ? 72  PRO A HB2  6  
ATOM 8908  H HB3  . PRO A 1 72  ? -3.134  -0.457  1.604   1.00 0.00 ? 72  PRO A HB3  6  
ATOM 8909  H HG2  . PRO A 1 72  ? -0.870  -2.010  2.880   1.00 0.00 ? 72  PRO A HG2  6  
ATOM 8910  H HG3  . PRO A 1 72  ? -2.435  -1.486  3.609   1.00 0.00 ? 72  PRO A HG3  6  
ATOM 8911  H HD2  . PRO A 1 72  ? -1.987  -3.999  2.672   1.00 0.00 ? 72  PRO A HD2  6  
ATOM 8912  H HD3  . PRO A 1 72  ? -3.586  -3.239  2.544   1.00 0.00 ? 72  PRO A HD3  6  
ATOM 8913  N N    . PHE A 1 73  ? 0.297   -2.502  0.073   1.00 0.00 ? 73  PHE A N    6  
ATOM 8914  C CA   . PHE A 1 73  ? 1.594   -2.560  -0.609  1.00 0.00 ? 73  PHE A CA   6  
ATOM 8915  C C    . PHE A 1 73  ? 1.481   -3.151  -2.016  1.00 0.00 ? 73  PHE A C    6  
ATOM 8916  O O    . PHE A 1 73  ? 2.265   -2.791  -2.885  1.00 0.00 ? 73  PHE A O    6  
ATOM 8917  C CB   . PHE A 1 73  ? 2.625   -3.367  0.198   1.00 0.00 ? 73  PHE A CB   6  
ATOM 8918  C CG   . PHE A 1 73  ? 3.263   -2.602  1.344   1.00 0.00 ? 73  PHE A CG   6  
ATOM 8919  C CD1  . PHE A 1 73  ? 4.198   -1.582  1.077   1.00 0.00 ? 73  PHE A CD1  6  
ATOM 8920  C CD2  . PHE A 1 73  ? 2.908   -2.875  2.677   1.00 0.00 ? 73  PHE A CD2  6  
ATOM 8921  C CE1  . PHE A 1 73  ? 4.789   -0.859  2.129   1.00 0.00 ? 73  PHE A CE1  6  
ATOM 8922  C CE2  . PHE A 1 73  ? 3.497   -2.148  3.729   1.00 0.00 ? 73  PHE A CE2  6  
ATOM 8923  C CZ   . PHE A 1 73  ? 4.444   -1.145  3.460   1.00 0.00 ? 73  PHE A CZ   6  
ATOM 8924  H H    . PHE A 1 73  ? 0.189   -2.977  0.955   1.00 0.00 ? 73  PHE A H    6  
ATOM 8925  H HA   . PHE A 1 73  ? 1.964   -1.540  -0.719  1.00 0.00 ? 73  PHE A HA   6  
ATOM 8926  H HB2  . PHE A 1 73  ? 2.163   -4.301  0.541   1.00 0.00 ? 73  PHE A HB2  6  
ATOM 8927  H HB3  . PHE A 1 73  ? 3.438   -3.650  -0.476  1.00 0.00 ? 73  PHE A HB3  6  
ATOM 8928  H HD1  . PHE A 1 73  ? 4.472   -1.345  0.059   1.00 0.00 ? 73  PHE A HD1  6  
ATOM 8929  H HD2  . PHE A 1 73  ? 2.173   -3.635  2.902   1.00 0.00 ? 73  PHE A HD2  6  
ATOM 8930  H HE1  . PHE A 1 73  ? 5.518   -0.091  1.904   1.00 0.00 ? 73  PHE A HE1  6  
ATOM 8931  H HE2  . PHE A 1 73  ? 3.211   -2.364  4.751   1.00 0.00 ? 73  PHE A HE2  6  
ATOM 8932  H HZ   . PHE A 1 73  ? 4.898   -0.593  4.272   1.00 0.00 ? 73  PHE A HZ   6  
ATOM 8933  N N    . ILE A 1 74  ? 0.553   -4.067  -2.262  1.00 0.00 ? 74  ILE A N    6  
ATOM 8934  C CA   . ILE A 1 74  ? 0.291   -4.638  -3.575  1.00 0.00 ? 74  ILE A CA   6  
ATOM 8935  C C    . ILE A 1 74  ? -0.262  -3.547  -4.487  1.00 0.00 ? 74  ILE A C    6  
ATOM 8936  O O    . ILE A 1 74  ? 0.262   -3.373  -5.584  1.00 0.00 ? 74  ILE A O    6  
ATOM 8937  C CB   . ILE A 1 74  ? -0.646  -5.849  -3.388  1.00 0.00 ? 74  ILE A CB   6  
ATOM 8938  C CG1  . ILE A 1 74  ? 0.175   -7.018  -2.806  1.00 0.00 ? 74  ILE A CG1  6  
ATOM 8939  C CG2  . ILE A 1 74  ? -1.355  -6.278  -4.676  1.00 0.00 ? 74  ILE A CG2  6  
ATOM 8940  C CD1  . ILE A 1 74  ? -0.688  -8.067  -2.108  1.00 0.00 ? 74  ILE A CD1  6  
ATOM 8941  H H    . ILE A 1 74  ? -0.023  -4.380  -1.485  1.00 0.00 ? 74  ILE A H    6  
ATOM 8942  H HA   . ILE A 1 74  ? 1.236   -4.964  -4.024  1.00 0.00 ? 74  ILE A HA   6  
ATOM 8943  H HB   . ILE A 1 74  ? -1.416  -5.578  -2.669  1.00 0.00 ? 74  ILE A HB   6  
ATOM 8944  H HG12 . ILE A 1 74  ? 0.759   -7.490  -3.597  1.00 0.00 ? 74  ILE A HG12 6  
ATOM 8945  H HG13 . ILE A 1 74  ? 0.867   -6.637  -2.059  1.00 0.00 ? 74  ILE A HG13 6  
ATOM 8946  H HG21 . ILE A 1 74  ? -2.001  -5.475  -5.033  1.00 0.00 ? 74  ILE A HG21 6  
ATOM 8947  H HG22 . ILE A 1 74  ? -0.624  -6.539  -5.446  1.00 0.00 ? 74  ILE A HG22 6  
ATOM 8948  H HG23 . ILE A 1 74  ? -2.003  -7.127  -4.460  1.00 0.00 ? 74  ILE A HG23 6  
ATOM 8949  H HD11 . ILE A 1 74  ? -1.397  -8.500  -2.814  1.00 0.00 ? 74  ILE A HD11 6  
ATOM 8950  H HD12 . ILE A 1 74  ? -0.045  -8.850  -1.708  1.00 0.00 ? 74  ILE A HD12 6  
ATOM 8951  H HD13 . ILE A 1 74  ? -1.222  -7.593  -1.284  1.00 0.00 ? 74  ILE A HD13 6  
ATOM 8952  N N    . ARG A 1 75  ? -1.250  -2.764  -4.041  1.00 0.00 ? 75  ARG A N    6  
ATOM 8953  C CA   . ARG A 1 75  ? -1.753  -1.633  -4.797  1.00 0.00 ? 75  ARG A CA   6  
ATOM 8954  C C    . ARG A 1 75  ? -0.620  -0.638  -5.059  1.00 0.00 ? 75  ARG A C    6  
ATOM 8955  O O    . ARG A 1 75  ? -0.534  -0.127  -6.172  1.00 0.00 ? 75  ARG A O    6  
ATOM 8956  C CB   . ARG A 1 75  ? -2.944  -1.038  -4.033  1.00 0.00 ? 75  ARG A CB   6  
ATOM 8957  C CG   . ARG A 1 75  ? -4.150  -1.989  -4.039  1.00 0.00 ? 75  ARG A CG   6  
ATOM 8958  C CD   . ARG A 1 75  ? -5.328  -1.482  -3.195  1.00 0.00 ? 75  ARG A CD   6  
ATOM 8959  N NE   . ARG A 1 75  ? -6.273  -2.579  -2.949  1.00 0.00 ? 75  ARG A NE   6  
ATOM 8960  C CZ   . ARG A 1 75  ? -7.165  -3.081  -3.806  1.00 0.00 ? 75  ARG A CZ   6  
ATOM 8961  N NH1  . ARG A 1 75  ? -7.503  -2.454  -4.923  1.00 0.00 ? 75  ARG A NH1  6  
ATOM 8962  N NH2  . ARG A 1 75  ? -7.740  -4.234  -3.509  1.00 0.00 ? 75  ARG A NH2  6  
ATOM 8963  H H    . ARG A 1 75  ? -1.666  -2.877  -3.127  1.00 0.00 ? 75  ARG A H    6  
ATOM 8964  H HA   . ARG A 1 75  ? -2.104  -1.987  -5.771  1.00 0.00 ? 75  ARG A HA   6  
ATOM 8965  H HB2  . ARG A 1 75  ? -2.661  -0.819  -3.005  1.00 0.00 ? 75  ARG A HB2  6  
ATOM 8966  H HB3  . ARG A 1 75  ? -3.222  -0.114  -4.508  1.00 0.00 ? 75  ARG A HB3  6  
ATOM 8967  H HG2  . ARG A 1 75  ? -4.482  -2.151  -5.066  1.00 0.00 ? 75  ARG A HG2  6  
ATOM 8968  H HG3  . ARG A 1 75  ? -3.837  -2.949  -3.633  1.00 0.00 ? 75  ARG A HG3  6  
ATOM 8969  H HD2  . ARG A 1 75  ? -4.963  -1.128  -2.230  1.00 0.00 ? 75  ARG A HD2  6  
ATOM 8970  H HD3  . ARG A 1 75  ? -5.825  -0.658  -3.706  1.00 0.00 ? 75  ARG A HD3  6  
ATOM 8971  H HE   . ARG A 1 75  ? -6.127  -3.112  -2.093  1.00 0.00 ? 75  ARG A HE   6  
ATOM 8972  H HH11 . ARG A 1 75  ? -7.269  -1.476  -5.058  1.00 0.00 ? 75  ARG A HH11 6  
ATOM 8973  H HH12 . ARG A 1 75  ? -8.197  -2.862  -5.549  1.00 0.00 ? 75  ARG A HH12 6  
ATOM 8974  H HH21 . ARG A 1 75  ? -7.414  -4.726  -2.666  1.00 0.00 ? 75  ARG A HH21 6  
ATOM 8975  H HH22 . ARG A 1 75  ? -8.187  -4.812  -4.223  1.00 0.00 ? 75  ARG A HH22 6  
ATOM 8976  N N    . MET A 1 76  ? 0.302   -0.427  -4.107  1.00 0.00 ? 76  MET A N    6  
ATOM 8977  C CA   . MET A 1 76  ? 1.515   0.347   -4.333  1.00 0.00 ? 76  MET A CA   6  
ATOM 8978  C C    . MET A 1 76  ? 2.338   -0.194  -5.520  1.00 0.00 ? 76  MET A C    6  
ATOM 8979  O O    . MET A 1 76  ? 2.716   0.589   -6.395  1.00 0.00 ? 76  MET A O    6  
ATOM 8980  C CB   . MET A 1 76  ? 2.337   0.384   -3.028  1.00 0.00 ? 76  MET A CB   6  
ATOM 8981  C CG   . MET A 1 76  ? 2.795   1.783   -2.632  1.00 0.00 ? 76  MET A CG   6  
ATOM 8982  S SD   . MET A 1 76  ? 4.106   1.818   -1.383  1.00 0.00 ? 76  MET A SD   6  
ATOM 8983  C CE   . MET A 1 76  ? 3.106   1.701   0.105   1.00 0.00 ? 76  MET A CE   6  
ATOM 8984  H H    . MET A 1 76  ? 0.168   -0.775  -3.158  1.00 0.00 ? 76  MET A H    6  
ATOM 8985  H HA   . MET A 1 76  ? 1.191   1.355   -4.592  1.00 0.00 ? 76  MET A HA   6  
ATOM 8986  H HB2  . MET A 1 76  ? 1.741   0.009   -2.202  1.00 0.00 ? 76  MET A HB2  6  
ATOM 8987  H HB3  . MET A 1 76  ? 3.210   -0.256  -3.127  1.00 0.00 ? 76  MET A HB3  6  
ATOM 8988  H HG2  . MET A 1 76  ? 3.161   2.283   -3.518  1.00 0.00 ? 76  MET A HG2  6  
ATOM 8989  H HG3  . MET A 1 76  ? 1.940   2.342   -2.258  1.00 0.00 ? 76  MET A HG3  6  
ATOM 8990  H HE1  . MET A 1 76  ? 2.544   2.627   0.217   1.00 0.00 ? 76  MET A HE1  6  
ATOM 8991  H HE2  . MET A 1 76  ? 2.426   0.847   -0.005  1.00 0.00 ? 76  MET A HE2  6  
ATOM 8992  H HE3  . MET A 1 76  ? 3.784   1.597   0.955   1.00 0.00 ? 76  MET A HE3  6  
ATOM 8993  N N    . GLN A 1 77  ? 2.614   -1.507  -5.544  1.00 0.00 ? 77  GLN A N    6  
ATOM 8994  C CA   . GLN A 1 77  ? 3.427   -2.179  -6.566  1.00 0.00 ? 77  GLN A CA   6  
ATOM 8995  C C    . GLN A 1 77  ? 2.781   -2.081  -7.938  1.00 0.00 ? 77  GLN A C    6  
ATOM 8996  O O    . GLN A 1 77  ? 3.478   -1.867  -8.931  1.00 0.00 ? 77  GLN A O    6  
ATOM 8997  C CB   . GLN A 1 77  ? 3.593   -3.677  -6.253  1.00 0.00 ? 77  GLN A CB   6  
ATOM 8998  C CG   . GLN A 1 77  ? 4.475   -3.929  -5.034  1.00 0.00 ? 77  GLN A CG   6  
ATOM 8999  C CD   . GLN A 1 77  ? 4.362   -5.345  -4.491  1.00 0.00 ? 77  GLN A CD   6  
ATOM 9000  O OE1  . GLN A 1 77  ? 4.991   -6.265  -4.990  1.00 0.00 ? 77  GLN A OE1  6  
ATOM 9001  N NE2  . GLN A 1 77  ? 3.613   -5.542  -3.422  1.00 0.00 ? 77  GLN A NE2  6  
ATOM 9002  H H    . GLN A 1 77  ? 2.239   -2.081  -4.798  1.00 0.00 ? 77  GLN A H    6  
ATOM 9003  H HA   . GLN A 1 77  ? 4.408   -1.703  -6.617  1.00 0.00 ? 77  GLN A HA   6  
ATOM 9004  H HB2  . GLN A 1 77  ? 2.615   -4.137  -6.103  1.00 0.00 ? 77  GLN A HB2  6  
ATOM 9005  H HB3  . GLN A 1 77  ? 4.068   -4.149  -7.114  1.00 0.00 ? 77  GLN A HB3  6  
ATOM 9006  H HG2  . GLN A 1 77  ? 5.506   -3.762  -5.316  1.00 0.00 ? 77  GLN A HG2  6  
ATOM 9007  H HG3  . GLN A 1 77  ? 4.225   -3.223  -4.253  1.00 0.00 ? 77  GLN A HG3  6  
ATOM 9008  H HE21 . GLN A 1 77  ? 3.093   -4.766  -3.041  1.00 0.00 ? 77  GLN A HE21 6  
ATOM 9009  H HE22 . GLN A 1 77  ? 3.618   -6.473  -3.027  1.00 0.00 ? 77  GLN A HE22 6  
ATOM 9010  N N    . LEU A 1 78  ? 1.465   -2.280  -7.990  1.00 0.00 ? 78  LEU A N    6  
ATOM 9011  C CA   . LEU A 1 78  ? 0.678   -2.200  -9.205  1.00 0.00 ? 78  LEU A CA   6  
ATOM 9012  C C    . LEU A 1 78  ? 0.723   -0.800  -9.737  1.00 0.00 ? 78  LEU A C    6  
ATOM 9013  O O    . LEU A 1 78  ? 1.196   -0.630  -10.853 1.00 0.00 ? 78  LEU A O    6  
ATOM 9014  C CB   . LEU A 1 78  ? -0.768  -2.633  -8.924  1.00 0.00 ? 78  LEU A CB   6  
ATOM 9015  C CG   . LEU A 1 78  ? -0.888  -4.157  -9.026  1.00 0.00 ? 78  LEU A CG   6  
ATOM 9016  C CD1  . LEU A 1 78  ? -1.971  -4.684  -8.094  1.00 0.00 ? 78  LEU A CD1  6  
ATOM 9017  C CD2  . LEU A 1 78  ? -1.164  -4.571  -10.480 1.00 0.00 ? 78  LEU A CD2  6  
ATOM 9018  H H    . LEU A 1 78  ? 0.978   -2.492  -7.123  1.00 0.00 ? 78  LEU A H    6  
ATOM 9019  H HA   . LEU A 1 78  ? 1.138   -2.812  -9.983  1.00 0.00 ? 78  LEU A HA   6  
ATOM 9020  H HB2  . LEU A 1 78  ? -1.060  -2.291  -7.929  1.00 0.00 ? 78  LEU A HB2  6  
ATOM 9021  H HB3  . LEU A 1 78  ? -1.453  -2.163  -9.633  1.00 0.00 ? 78  LEU A HB3  6  
ATOM 9022  H HG   . LEU A 1 78  ? 0.052   -4.597  -8.698  1.00 0.00 ? 78  LEU A HG   6  
ATOM 9023  H HD11 . LEU A 1 78  ? -1.737  -4.395  -7.070  1.00 0.00 ? 78  LEU A HD11 6  
ATOM 9024  H HD12 . LEU A 1 78  ? -2.936  -4.272  -8.382  1.00 0.00 ? 78  LEU A HD12 6  
ATOM 9025  H HD13 . LEU A 1 78  ? -2.001  -5.772  -8.162  1.00 0.00 ? 78  LEU A HD13 6  
ATOM 9026  H HD21 . LEU A 1 78  ? -2.038  -4.035  -10.856 1.00 0.00 ? 78  LEU A HD21 6  
ATOM 9027  H HD22 . LEU A 1 78  ? -0.308  -4.341  -11.117 1.00 0.00 ? 78  LEU A HD22 6  
ATOM 9028  H HD23 . LEU A 1 78  ? -1.394  -5.632  -10.545 1.00 0.00 ? 78  LEU A HD23 6  
ATOM 9029  N N    . TRP A 1 79  ? 0.287   0.181   -8.948  1.00 0.00 ? 79  TRP A N    6  
ATOM 9030  C CA   . TRP A 1 79  ? 0.149   1.571   -9.349  1.00 0.00 ? 79  TRP A CA   6  
ATOM 9031  C C    . TRP A 1 79  ? 1.395   2.101   -10.077 1.00 0.00 ? 79  TRP A C    6  
ATOM 9032  O O    . TRP A 1 79  ? 1.280   2.957   -10.954 1.00 0.00 ? 79  TRP A O    6  
ATOM 9033  C CB   . TRP A 1 79  ? -0.127  2.384   -8.082  1.00 0.00 ? 79  TRP A CB   6  
ATOM 9034  C CG   . TRP A 1 79  ? -0.167  3.861   -8.280  1.00 0.00 ? 79  TRP A CG   6  
ATOM 9035  C CD1  . TRP A 1 79  ? -1.250  4.606   -8.584  1.00 0.00 ? 79  TRP A CD1  6  
ATOM 9036  C CD2  . TRP A 1 79  ? 0.961   4.776   -8.262  1.00 0.00 ? 79  TRP A CD2  6  
ATOM 9037  N NE1  . TRP A 1 79  ? -0.873  5.927   -8.724  1.00 0.00 ? 79  TRP A NE1  6  
ATOM 9038  C CE2  . TRP A 1 79  ? 0.486   6.091   -8.538  1.00 0.00 ? 79  TRP A CE2  6  
ATOM 9039  C CE3  . TRP A 1 79  ? 2.348   4.604   -8.067  1.00 0.00 ? 79  TRP A CE3  6  
ATOM 9040  C CZ2  . TRP A 1 79  ? 1.359   7.185   -8.617  1.00 0.00 ? 79  TRP A CZ2  6  
ATOM 9041  C CZ3  . TRP A 1 79  ? 3.223   5.702   -8.109  1.00 0.00 ? 79  TRP A CZ3  6  
ATOM 9042  C CH2  . TRP A 1 79  ? 2.734   6.990   -8.388  1.00 0.00 ? 79  TRP A CH2  6  
ATOM 9043  H H    . TRP A 1 79  ? -0.054  -0.061  -8.022  1.00 0.00 ? 79  TRP A H    6  
ATOM 9044  H HA   . TRP A 1 79  ? -0.717  1.644   -10.011 1.00 0.00 ? 79  TRP A HA   6  
ATOM 9045  H HB2  . TRP A 1 79  ? -1.061  2.059   -7.635  1.00 0.00 ? 79  TRP A HB2  6  
ATOM 9046  H HB3  . TRP A 1 79  ? 0.661   2.168   -7.362  1.00 0.00 ? 79  TRP A HB3  6  
ATOM 9047  H HD1  . TRP A 1 79  ? -2.260  4.233   -8.709  1.00 0.00 ? 79  TRP A HD1  6  
ATOM 9048  H HE1  . TRP A 1 79  ? -1.553  6.635   -8.996  1.00 0.00 ? 79  TRP A HE1  6  
ATOM 9049  H HE3  . TRP A 1 79  ? 2.741   3.610   -7.875  1.00 0.00 ? 79  TRP A HE3  6  
ATOM 9050  H HZ2  . TRP A 1 79  ? 0.971   8.165   -8.851  1.00 0.00 ? 79  TRP A HZ2  6  
ATOM 9051  H HZ3  . TRP A 1 79  ? 4.278   5.556   -7.926  1.00 0.00 ? 79  TRP A HZ3  6  
ATOM 9052  H HH2  . TRP A 1 79  ? 3.420   7.824   -8.419  1.00 0.00 ? 79  TRP A HH2  6  
ATOM 9053  N N    . LEU A 1 80  ? 2.584   1.590   -9.743  1.00 0.00 ? 80  LEU A N    6  
ATOM 9054  C CA   . LEU A 1 80  ? 3.833   1.921   -10.425 1.00 0.00 ? 80  LEU A CA   6  
ATOM 9055  C C    . LEU A 1 80  ? 3.730   1.713   -11.939 1.00 0.00 ? 80  LEU A C    6  
ATOM 9056  O O    . LEU A 1 80  ? 4.210   2.569   -12.681 1.00 0.00 ? 80  LEU A O    6  
ATOM 9057  C CB   . LEU A 1 80  ? 4.991   1.088   -9.843  1.00 0.00 ? 80  LEU A CB   6  
ATOM 9058  C CG   . LEU A 1 80  ? 5.757   1.846   -8.744  1.00 0.00 ? 80  LEU A CG   6  
ATOM 9059  C CD1  . LEU A 1 80  ? 6.428   0.863   -7.788  1.00 0.00 ? 80  LEU A CD1  6  
ATOM 9060  C CD2  . LEU A 1 80  ? 6.826   2.775   -9.324  1.00 0.00 ? 80  LEU A CD2  6  
ATOM 9061  H H    . LEU A 1 80  ? 2.586   0.852   -9.050  1.00 0.00 ? 80  LEU A H    6  
ATOM 9062  H HA   . LEU A 1 80  ? 4.039   2.981   -10.262 1.00 0.00 ? 80  LEU A HA   6  
ATOM 9063  H HB2  . LEU A 1 80  ? 4.586   0.175   -9.414  1.00 0.00 ? 80  LEU A HB2  6  
ATOM 9064  H HB3  . LEU A 1 80  ? 5.678   0.793   -10.644 1.00 0.00 ? 80  LEU A HB3  6  
ATOM 9065  H HG   . LEU A 1 80  ? 5.051   2.442   -8.164  1.00 0.00 ? 80  LEU A HG   6  
ATOM 9066  H HD11 . LEU A 1 80  ? 5.670   0.279   -7.271  1.00 0.00 ? 80  LEU A HD11 6  
ATOM 9067  H HD12 . LEU A 1 80  ? 7.092   0.191   -8.331  1.00 0.00 ? 80  LEU A HD12 6  
ATOM 9068  H HD13 . LEU A 1 80  ? 7.006   1.412   -7.049  1.00 0.00 ? 80  LEU A HD13 6  
ATOM 9069  H HD21 . LEU A 1 80  ? 7.243   3.394   -8.528  1.00 0.00 ? 80  LEU A HD21 6  
ATOM 9070  H HD22 . LEU A 1 80  ? 7.639   2.189   -9.760  1.00 0.00 ? 80  LEU A HD22 6  
ATOM 9071  H HD23 . LEU A 1 80  ? 6.395   3.419   -10.088 1.00 0.00 ? 80  LEU A HD23 6  
ATOM 9072  N N    . SER A 1 81  ? 3.214   0.572   -12.409 1.00 0.00 ? 81  SER A N    6  
ATOM 9073  C CA   . SER A 1 81  ? 2.918   0.352   -13.826 1.00 0.00 ? 81  SER A CA   6  
ATOM 9074  C C    . SER A 1 81  ? 1.446   0.614   -14.181 1.00 0.00 ? 81  SER A C    6  
ATOM 9075  O O    . SER A 1 81  ? 1.146   1.274   -15.177 1.00 0.00 ? 81  SER A O    6  
ATOM 9076  C CB   . SER A 1 81  ? 3.380   -1.047  -14.234 1.00 0.00 ? 81  SER A CB   6  
ATOM 9077  O OG   . SER A 1 81  ? 3.381   -1.108  -15.644 1.00 0.00 ? 81  SER A OG   6  
ATOM 9078  H H    . SER A 1 81  ? 2.804   -0.084  -11.745 1.00 0.00 ? 81  SER A H    6  
ATOM 9079  H HA   . SER A 1 81  ? 3.509   1.059   -14.406 1.00 0.00 ? 81  SER A HA   6  
ATOM 9080  H HB2  . SER A 1 81  ? 4.396   -1.194  -13.864 1.00 0.00 ? 81  SER A HB2  6  
ATOM 9081  H HB3  . SER A 1 81  ? 2.712   -1.806  -13.821 1.00 0.00 ? 81  SER A HB3  6  
ATOM 9082  H HG   . SER A 1 81  ? 3.659   -2.004  -15.933 1.00 0.00 ? 81  SER A HG   6  
ATOM 9083  N N    . ASP A 1 82  ? 0.534   0.045   -13.398 1.00 0.00 ? 82  ASP A N    6  
ATOM 9084  C CA   . ASP A 1 82  ? -0.905  -0.041  -13.644 1.00 0.00 ? 82  ASP A CA   6  
ATOM 9085  C C    . ASP A 1 82  ? -1.594  1.312   -13.524 1.00 0.00 ? 82  ASP A C    6  
ATOM 9086  O O    . ASP A 1 82  ? -2.650  1.510   -14.119 1.00 0.00 ? 82  ASP A O    6  
ATOM 9087  C CB   . ASP A 1 82  ? -1.519  -1.002  -12.616 1.00 0.00 ? 82  ASP A CB   6  
ATOM 9088  C CG   . ASP A 1 82  ? -3.018  -1.194  -12.826 1.00 0.00 ? 82  ASP A CG   6  
ATOM 9089  O OD1  . ASP A 1 82  ? -3.407  -1.728  -13.887 1.00 0.00 ? 82  ASP A OD1  6  
ATOM 9090  O OD2  . ASP A 1 82  ? -3.803  -0.817  -11.929 1.00 0.00 ? 82  ASP A OD2  6  
ATOM 9091  H H    . ASP A 1 82  ? 0.863   -0.453  -12.580 1.00 0.00 ? 82  ASP A H    6  
ATOM 9092  H HA   . ASP A 1 82  ? -1.087  -0.435  -14.645 1.00 0.00 ? 82  ASP A HA   6  
ATOM 9093  H HB2  . ASP A 1 82  ? -1.029  -1.971  -12.688 1.00 0.00 ? 82  ASP A HB2  6  
ATOM 9094  H HB3  . ASP A 1 82  ? -1.352  -0.610  -11.613 1.00 0.00 ? 82  ASP A HB3  6  
ATOM 9095  N N    . GLN A 1 83  ? -1.006  2.241   -12.761 1.00 0.00 ? 83  GLN A N    6  
ATOM 9096  C CA   . GLN A 1 83  ? -1.460  3.613   -12.512 1.00 0.00 ? 83  GLN A CA   6  
ATOM 9097  C C    . GLN A 1 83  ? -2.833  3.721   -11.826 1.00 0.00 ? 83  GLN A C    6  
ATOM 9098  O O    . GLN A 1 83  ? -3.155  4.800   -11.325 1.00 0.00 ? 83  GLN A O    6  
ATOM 9099  C CB   . GLN A 1 83  ? -1.384  4.433   -13.812 1.00 0.00 ? 83  GLN A CB   6  
ATOM 9100  C CG   . GLN A 1 83  ? 0.046   4.534   -14.374 1.00 0.00 ? 83  GLN A CG   6  
ATOM 9101  C CD   . GLN A 1 83  ? 0.029   4.823   -15.869 1.00 0.00 ? 83  GLN A CD   6  
ATOM 9102  O OE1  . GLN A 1 83  ? 0.054   5.977   -16.300 1.00 0.00 ? 83  GLN A OE1  6  
ATOM 9103  N NE2  . GLN A 1 83  ? -0.041  3.778   -16.678 1.00 0.00 ? 83  GLN A NE2  6  
ATOM 9104  H H    . GLN A 1 83  ? -0.108  2.002   -12.367 1.00 0.00 ? 83  GLN A H    6  
ATOM 9105  H HA   . GLN A 1 83  ? -0.750  4.070   -11.826 1.00 0.00 ? 83  GLN A HA   6  
ATOM 9106  H HB2  . GLN A 1 83  ? -2.033  3.973   -14.556 1.00 0.00 ? 83  GLN A HB2  6  
ATOM 9107  H HB3  . GLN A 1 83  ? -1.751  5.443   -13.628 1.00 0.00 ? 83  GLN A HB3  6  
ATOM 9108  H HG2  . GLN A 1 83  ? 0.570   5.328   -13.853 1.00 0.00 ? 83  GLN A HG2  6  
ATOM 9109  H HG3  . GLN A 1 83  ? 0.601   3.612   -14.207 1.00 0.00 ? 83  GLN A HG3  6  
ATOM 9110  H HE21 . GLN A 1 83  ? -0.032  2.842   -16.290 1.00 0.00 ? 83  GLN A HE21 6  
ATOM 9111  H HE22 . GLN A 1 83  ? -0.158  3.887   -17.680 1.00 0.00 ? 83  GLN A HE22 6  
ATOM 9112  N N    . LEU A 1 84  ? -3.584  2.618   -11.699 1.00 0.00 ? 84  LEU A N    6  
ATOM 9113  C CA   . LEU A 1 84  ? -4.989  2.558   -11.331 1.00 0.00 ? 84  LEU A CA   6  
ATOM 9114  C C    . LEU A 1 84  ? -5.788  3.596   -12.101 1.00 0.00 ? 84  LEU A C    6  
ATOM 9115  O O    . LEU A 1 84  ? -6.195  4.631   -11.563 1.00 0.00 ? 84  LEU A O    6  
ATOM 9116  C CB   . LEU A 1 84  ? -5.191  2.631   -9.819  1.00 0.00 ? 84  LEU A CB   6  
ATOM 9117  C CG   . LEU A 1 84  ? -4.810  1.290   -9.155  1.00 0.00 ? 84  LEU A CG   6  
ATOM 9118  C CD1  . LEU A 1 84  ? -3.399  1.297   -8.583  1.00 0.00 ? 84  LEU A CD1  6  
ATOM 9119  C CD2  . LEU A 1 84  ? -5.810  0.946   -8.060  1.00 0.00 ? 84  LEU A CD2  6  
ATOM 9120  H H    . LEU A 1 84  ? -3.250  1.759   -12.113 1.00 0.00 ? 84  LEU A H    6  
ATOM 9121  H HA   . LEU A 1 84  ? -5.377  1.584   -11.640 1.00 0.00 ? 84  LEU A HA   6  
ATOM 9122  H HB2  . LEU A 1 84  ? -4.635  3.463   -9.385  1.00 0.00 ? 84  LEU A HB2  6  
ATOM 9123  H HB3  . LEU A 1 84  ? -6.253  2.834   -9.687  1.00 0.00 ? 84  LEU A HB3  6  
ATOM 9124  H HG   . LEU A 1 84  ? -4.819  0.496   -9.895  1.00 0.00 ? 84  LEU A HG   6  
ATOM 9125  H HD11 . LEU A 1 84  ? -2.709  1.500   -9.393  1.00 0.00 ? 84  LEU A HD11 6  
ATOM 9126  H HD12 . LEU A 1 84  ? -3.311  2.058   -7.816  1.00 0.00 ? 84  LEU A HD12 6  
ATOM 9127  H HD13 . LEU A 1 84  ? -3.169  0.315   -8.163  1.00 0.00 ? 84  LEU A HD13 6  
ATOM 9128  H HD21 . LEU A 1 84  ? -5.815  1.721   -7.296  1.00 0.00 ? 84  LEU A HD21 6  
ATOM 9129  H HD22 . LEU A 1 84  ? -6.796  0.868   -8.516  1.00 0.00 ? 84  LEU A HD22 6  
ATOM 9130  H HD23 . LEU A 1 84  ? -5.553  -0.018  -7.625  1.00 0.00 ? 84  LEU A HD23 6  
ATOM 9131  N N    . GLY A 1 85  ? -6.010  3.310   -13.381 1.00 0.00 ? 85  GLY A N    6  
ATOM 9132  C CA   . GLY A 1 85  ? -6.792  4.163   -14.250 1.00 0.00 ? 85  GLY A CA   6  
ATOM 9133  C C    . GLY A 1 85  ? -8.275  3.927   -14.017 1.00 0.00 ? 85  GLY A C    6  
ATOM 9134  O O    . GLY A 1 85  ? -8.951  3.345   -14.861 1.00 0.00 ? 85  GLY A O    6  
ATOM 9135  H H    . GLY A 1 85  ? -5.666  2.440   -13.759 1.00 0.00 ? 85  GLY A H    6  
ATOM 9136  H HA2  . GLY A 1 85  ? -6.552  5.194   -14.009 1.00 0.00 ? 85  GLY A HA2  6  
ATOM 9137  H HA3  . GLY A 1 85  ? -6.542  3.957   -15.287 1.00 0.00 ? 85  GLY A HA3  6  
ATOM 9138  N N    . GLN A 1 86  ? -8.764  4.368   -12.855 1.00 0.00 ? 86  GLN A N    6  
ATOM 9139  C CA   . GLN A 1 86  ? -10.114 4.112   -12.370 1.00 0.00 ? 86  GLN A CA   6  
ATOM 9140  C C    . GLN A 1 86  ? -11.172 4.474   -13.405 1.00 0.00 ? 86  GLN A C    6  
ATOM 9141  O O    . GLN A 1 86  ? -12.176 3.766   -13.489 1.00 0.00 ? 86  GLN A O    6  
ATOM 9142  C CB   . GLN A 1 86  ? -10.351 4.844   -11.030 1.00 0.00 ? 86  GLN A CB   6  
ATOM 9143  C CG   . GLN A 1 86  ? -10.747 3.915   -9.869  1.00 0.00 ? 86  GLN A CG   6  
ATOM 9144  C CD   . GLN A 1 86  ? -9.583  3.106   -9.289  1.00 0.00 ? 86  GLN A CD   6  
ATOM 9145  O OE1  . GLN A 1 86  ? -8.772  2.537   -10.011 1.00 0.00 ? 86  GLN A OE1  6  
ATOM 9146  N NE2  . GLN A 1 86  ? -9.478  3.005   -7.972  1.00 0.00 ? 86  GLN A NE2  6  
ATOM 9147  H H    . GLN A 1 86  ? -8.091  4.764   -12.209 1.00 0.00 ? 86  GLN A H    6  
ATOM 9148  H HA   . GLN A 1 86  ? -10.226 3.044   -12.219 1.00 0.00 ? 86  GLN A HA   6  
ATOM 9149  H HB2  . GLN A 1 86  ? -9.464  5.410   -10.742 1.00 0.00 ? 86  GLN A HB2  6  
ATOM 9150  H HB3  . GLN A 1 86  ? -11.157 5.566   -11.165 1.00 0.00 ? 86  GLN A HB3  6  
ATOM 9151  H HG2  . GLN A 1 86  ? -11.162 4.539   -9.078  1.00 0.00 ? 86  GLN A HG2  6  
ATOM 9152  H HG3  . GLN A 1 86  ? -11.529 3.235   -10.206 1.00 0.00 ? 86  GLN A HG3  6  
ATOM 9153  H HE21 . GLN A 1 86  ? -10.184 3.364   -7.344  1.00 0.00 ? 86  GLN A HE21 6  
ATOM 9154  H HE22 . GLN A 1 86  ? -8.691  2.511   -7.576  1.00 0.00 ? 86  GLN A HE22 6  
ATOM 9155  N N    . ALA A 1 87  ? -10.983 5.554   -14.166 1.00 0.00 ? 87  ALA A N    6  
ATOM 9156  C CA   . ALA A 1 87  ? -11.890 5.989   -15.217 1.00 0.00 ? 87  ALA A CA   6  
ATOM 9157  C C    . ALA A 1 87  ? -11.200 7.101   -16.003 1.00 0.00 ? 87  ALA A C    6  
ATOM 9158  O O    . ALA A 1 87  ? -11.034 8.204   -15.477 1.00 0.00 ? 87  ALA A O    6  
ATOM 9159  C CB   . ALA A 1 87  ? -13.181 6.494   -14.570 1.00 0.00 ? 87  ALA A CB   6  
ATOM 9160  H H    . ALA A 1 87  ? -10.135 6.089   -14.038 1.00 0.00 ? 87  ALA A H    6  
ATOM 9161  H HA   . ALA A 1 87  ? -12.121 5.154   -15.878 1.00 0.00 ? 87  ALA A HA   6  
ATOM 9162  H HB1  . ALA A 1 87  ? -12.938 7.269   -13.849 1.00 0.00 ? 87  ALA A HB1  6  
ATOM 9163  H HB2  . ALA A 1 87  ? -13.853 6.891   -15.330 1.00 0.00 ? 87  ALA A HB2  6  
ATOM 9164  H HB3  . ALA A 1 87  ? -13.660 5.668   -14.045 1.00 0.00 ? 87  ALA A HB3  6  
ATOM 9165  N N    . VAL A 1 88  ? -10.717 6.824   -17.213 1.00 0.00 ? 88  VAL A N    6  
ATOM 9166  C CA   . VAL A 1 88  ? -9.962  7.776   -18.021 1.00 0.00 ? 88  VAL A CA   6  
ATOM 9167  C C    . VAL A 1 88  ? -10.091 7.362   -19.495 1.00 0.00 ? 88  VAL A C    6  
ATOM 9168  O O    . VAL A 1 88  ? -10.363 6.197   -19.790 1.00 0.00 ? 88  VAL A O    6  
ATOM 9169  C CB   . VAL A 1 88  ? -8.503  7.780   -17.498 1.00 0.00 ? 88  VAL A CB   6  
ATOM 9170  C CG1  . VAL A 1 88  ? -7.789  6.431   -17.655 1.00 0.00 ? 88  VAL A CG1  6  
ATOM 9171  C CG2  . VAL A 1 88  ? -7.647  8.891   -18.112 1.00 0.00 ? 88  VAL A CG2  6  
ATOM 9172  H H    . VAL A 1 88  ? -10.851 5.919   -17.649 1.00 0.00 ? 88  VAL A H    6  
ATOM 9173  H HA   . VAL A 1 88  ? -10.392 8.773   -17.893 1.00 0.00 ? 88  VAL A HA   6  
ATOM 9174  H HB   . VAL A 1 88  ? -8.540  7.988   -16.430 1.00 0.00 ? 88  VAL A HB   6  
ATOM 9175  H HG11 . VAL A 1 88  ? -6.784  6.485   -17.235 1.00 0.00 ? 88  VAL A HG11 6  
ATOM 9176  H HG12 . VAL A 1 88  ? -8.335  5.642   -17.136 1.00 0.00 ? 88  VAL A HG12 6  
ATOM 9177  H HG13 . VAL A 1 88  ? -7.718  6.175   -18.710 1.00 0.00 ? 88  VAL A HG13 6  
ATOM 9178  H HG21 . VAL A 1 88  ? -6.671  8.898   -17.629 1.00 0.00 ? 88  VAL A HG21 6  
ATOM 9179  H HG22 . VAL A 1 88  ? -7.492  8.722   -19.173 1.00 0.00 ? 88  VAL A HG22 6  
ATOM 9180  H HG23 . VAL A 1 88  ? -8.125  9.858   -17.961 1.00 0.00 ? 88  VAL A HG23 6  
ATOM 9181  N N    . GLY A 1 89  ? -9.878  8.287   -20.432 1.00 0.00 ? 89  GLY A N    6  
ATOM 9182  C CA   . GLY A 1 89  ? -9.821  7.957   -21.852 1.00 0.00 ? 89  GLY A CA   6  
ATOM 9183  C C    . GLY A 1 89  ? -8.452  7.379   -22.201 1.00 0.00 ? 89  GLY A C    6  
ATOM 9184  O O    . GLY A 1 89  ? -8.351  6.341   -22.853 1.00 0.00 ? 89  GLY A O    6  
ATOM 9185  H H    . GLY A 1 89  ? -9.715  9.251   -20.166 1.00 0.00 ? 89  GLY A H    6  
ATOM 9186  H HA2  . GLY A 1 89  ? -10.598 7.234   -22.103 1.00 0.00 ? 89  GLY A HA2  6  
ATOM 9187  H HA3  . GLY A 1 89  ? -9.992  8.857   -22.441 1.00 0.00 ? 89  GLY A HA3  6  
ATOM 9188  N N    . GLN A 1 90  ? -7.382  8.042   -21.755 1.00 0.00 ? 90  GLN A N    6  
ATOM 9189  C CA   . GLN A 1 90  ? -6.002  7.604   -21.928 1.00 0.00 ? 90  GLN A CA   6  
ATOM 9190  C C    . GLN A 1 90  ? -5.682  6.497   -20.922 1.00 0.00 ? 90  GLN A C    6  
ATOM 9191  O O    . GLN A 1 90  ? -5.319  6.761   -19.777 1.00 0.00 ? 90  GLN A O    6  
ATOM 9192  C CB   . GLN A 1 90  ? -5.074  8.819   -21.811 1.00 0.00 ? 90  GLN A CB   6  
ATOM 9193  C CG   . GLN A 1 90  ? -3.611  8.523   -22.180 1.00 0.00 ? 90  GLN A CG   6  
ATOM 9194  C CD   . GLN A 1 90  ? -2.773  9.798   -22.328 1.00 0.00 ? 90  GLN A CD   6  
ATOM 9195  O OE1  . GLN A 1 90  ? -3.290  10.904  -22.489 1.00 0.00 ? 90  GLN A OE1  6  
ATOM 9196  N NE2  . GLN A 1 90  ? -1.459  9.691   -22.331 1.00 0.00 ? 90  GLN A NE2  6  
ATOM 9197  H H    . GLN A 1 90  ? -7.537  8.874   -21.205 1.00 0.00 ? 90  GLN A H    6  
ATOM 9198  H HA   . GLN A 1 90  ? -5.896  7.196   -22.932 1.00 0.00 ? 90  GLN A HA   6  
ATOM 9199  H HB2  . GLN A 1 90  ? -5.453  9.574   -22.499 1.00 0.00 ? 90  GLN A HB2  6  
ATOM 9200  H HB3  . GLN A 1 90  ? -5.119  9.212   -20.796 1.00 0.00 ? 90  GLN A HB3  6  
ATOM 9201  H HG2  . GLN A 1 90  ? -3.170  7.891   -21.407 1.00 0.00 ? 90  GLN A HG2  6  
ATOM 9202  H HG3  . GLN A 1 90  ? -3.586  7.986   -23.129 1.00 0.00 ? 90  GLN A HG3  6  
ATOM 9203  H HE21 . GLN A 1 90  ? -1.003  8.797   -22.145 1.00 0.00 ? 90  GLN A HE21 6  
ATOM 9204  H HE22 . GLN A 1 90  ? -0.889  10.516  -22.380 1.00 0.00 ? 90  GLN A HE22 6  
ATOM 9205  N N    . GLN A 1 91  ? -5.831  5.255   -21.365 1.00 0.00 ? 91  GLN A N    6  
ATOM 9206  C CA   . GLN A 1 91  ? -5.579  4.003   -20.655 1.00 0.00 ? 91  GLN A CA   6  
ATOM 9207  C C    . GLN A 1 91  ? -5.157  2.957   -21.699 1.00 0.00 ? 91  GLN A C    6  
ATOM 9208  O O    . GLN A 1 91  ? -5.219  3.252   -22.896 1.00 0.00 ? 91  GLN A O    6  
ATOM 9209  C CB   . GLN A 1 91  ? -6.843  3.560   -19.883 1.00 0.00 ? 91  GLN A CB   6  
ATOM 9210  C CG   . GLN A 1 91  ? -8.162  3.764   -20.643 1.00 0.00 ? 91  GLN A CG   6  
ATOM 9211  C CD   . GLN A 1 91  ? -9.323  3.076   -19.937 1.00 0.00 ? 91  GLN A CD   6  
ATOM 9212  O OE1  . GLN A 1 91  ? -9.639  3.354   -18.784 1.00 0.00 ? 91  GLN A OE1  6  
ATOM 9213  N NE2  . GLN A 1 91  ? -9.970  2.132   -20.599 1.00 0.00 ? 91  GLN A NE2  6  
ATOM 9214  H H    . GLN A 1 91  ? -6.115  5.134   -22.329 1.00 0.00 ? 91  GLN A H    6  
ATOM 9215  H HA   . GLN A 1 91  ? -4.762  4.141   -19.949 1.00 0.00 ? 91  GLN A HA   6  
ATOM 9216  H HB2  . GLN A 1 91  ? -6.767  2.505   -19.627 1.00 0.00 ? 91  GLN A HB2  6  
ATOM 9217  H HB3  . GLN A 1 91  ? -6.887  4.108   -18.943 1.00 0.00 ? 91  GLN A HB3  6  
ATOM 9218  H HG2  . GLN A 1 91  ? -8.382  4.826   -20.705 1.00 0.00 ? 91  GLN A HG2  6  
ATOM 9219  H HG3  . GLN A 1 91  ? -8.061  3.373   -21.657 1.00 0.00 ? 91  GLN A HG3  6  
ATOM 9220  H HE21 . GLN A 1 91  ? -9.711  1.918   -21.553 1.00 0.00 ? 91  GLN A HE21 6  
ATOM 9221  H HE22 . GLN A 1 91  ? -10.732 1.646   -20.152 1.00 0.00 ? 91  GLN A HE22 6  
ATOM 9222  N N    . PRO A 1 92  ? -4.721  1.751   -21.304 1.00 0.00 ? 92  PRO A N    6  
ATOM 9223  C CA   . PRO A 1 92  ? -4.718  0.592   -22.192 1.00 0.00 ? 92  PRO A CA   6  
ATOM 9224  C C    . PRO A 1 92  ? -6.151  0.138   -22.527 1.00 0.00 ? 92  PRO A C    6  
ATOM 9225  O O    . PRO A 1 92  ? -7.144  0.672   -22.011 1.00 0.00 ? 92  PRO A O    6  
ATOM 9226  C CB   . PRO A 1 92  ? -3.929  -0.484  -21.438 1.00 0.00 ? 92  PRO A CB   6  
ATOM 9227  C CG   . PRO A 1 92  ? -4.153  -0.124  -19.971 1.00 0.00 ? 92  PRO A CG   6  
ATOM 9228  C CD   . PRO A 1 92  ? -4.201  1.400   -19.990 1.00 0.00 ? 92  PRO A CD   6  
ATOM 9229  H HA   . PRO A 1 92  ? -4.198  0.836   -23.118 1.00 0.00 ? 92  PRO A HA   6  
ATOM 9230  H HB2  . PRO A 1 92  ? -4.279  -1.493  -21.656 1.00 0.00 ? 92  PRO A HB2  6  
ATOM 9231  H HB3  . PRO A 1 92  ? -2.869  -0.394  -21.680 1.00 0.00 ? 92  PRO A HB3  6  
ATOM 9232  H HG2  . PRO A 1 92  ? -5.118  -0.510  -19.643 1.00 0.00 ? 92  PRO A HG2  6  
ATOM 9233  H HG3  . PRO A 1 92  ? -3.352  -0.495  -19.331 1.00 0.00 ? 92  PRO A HG3  6  
ATOM 9234  H HD2  . PRO A 1 92  ? -4.823  1.762   -19.172 1.00 0.00 ? 92  PRO A HD2  6  
ATOM 9235  H HD3  . PRO A 1 92  ? -3.192  1.801   -19.889 1.00 0.00 ? 92  PRO A HD3  6  
ATOM 9236  N N    . GLY A 1 93  ? -6.278  -0.879  -23.378 1.00 0.00 ? 93  GLY A N    6  
ATOM 9237  C CA   . GLY A 1 93  ? -7.538  -1.517  -23.705 1.00 0.00 ? 93  GLY A CA   6  
ATOM 9238  C C    . GLY A 1 93  ? -7.318  -2.601  -24.745 1.00 0.00 ? 93  GLY A C    6  
ATOM 9239  O O    . GLY A 1 93  ? -7.346  -2.288  -25.938 1.00 0.00 ? 93  GLY A O    6  
ATOM 9240  H H    . GLY A 1 93  ? -5.450  -1.299  -23.794 1.00 0.00 ? 93  GLY A H    6  
ATOM 9241  H HA2  . GLY A 1 93  ? -7.974  -1.945  -22.804 1.00 0.00 ? 93  GLY A HA2  6  
ATOM 9242  H HA3  . GLY A 1 93  ? -8.221  -0.776  -24.112 1.00 0.00 ? 93  GLY A HA3  6  
ATOM 9243  N N    . ALA A 1 94  ? -7.102  -3.835  -24.293 1.00 0.00 ? 94  ALA A N    6  
ATOM 9244  C CA   . ALA A 1 94  ? -6.847  -5.032  -25.076 1.00 0.00 ? 94  ALA A CA   6  
ATOM 9245  C C    . ALA A 1 94  ? -8.048  -5.971  -24.940 1.00 0.00 ? 94  ALA A C    6  
ATOM 9246  O O    . ALA A 1 94  ? -8.193  -6.678  -23.935 1.00 0.00 ? 94  ALA A O    6  
ATOM 9247  C CB   . ALA A 1 94  ? -5.559  -5.695  -24.575 1.00 0.00 ? 94  ALA A CB   6  
ATOM 9248  H H    . ALA A 1 94  ? -7.105  -3.952  -23.284 1.00 0.00 ? 94  ALA A H    6  
ATOM 9249  H HA   . ALA A 1 94  ? -6.715  -4.758  -26.125 1.00 0.00 ? 94  ALA A HA   6  
ATOM 9250  H HB1  . ALA A 1 94  ? -5.470  -6.677  -25.029 1.00 0.00 ? 94  ALA A HB1  6  
ATOM 9251  H HB2  . ALA A 1 94  ? -4.696  -5.094  -24.857 1.00 0.00 ? 94  ALA A HB2  6  
ATOM 9252  H HB3  . ALA A 1 94  ? -5.591  -5.812  -23.491 1.00 0.00 ? 94  ALA A HB3  6  
ATOM 9253  N N    . SER A 1 95  ? -8.940  -5.973  -25.925 1.00 0.00 ? 95  SER A N    6  
ATOM 9254  C CA   . SER A 1 95  ? -10.146 -6.801  -25.919 1.00 0.00 ? 95  SER A CA   6  
ATOM 9255  C C    . SER A 1 95  ? -9.892  -8.125  -26.668 1.00 0.00 ? 95  SER A C    6  
ATOM 9256  O O    . SER A 1 95  ? -9.037  -8.165  -27.557 1.00 0.00 ? 95  SER A O    6  
ATOM 9257  C CB   . SER A 1 95  ? -11.281 -5.976  -26.535 1.00 0.00 ? 95  SER A CB   6  
ATOM 9258  O OG   . SER A 1 95  ? -11.326 -4.683  -25.947 1.00 0.00 ? 95  SER A OG   6  
ATOM 9259  H H    . SER A 1 95  ? -8.762  -5.415  -26.749 1.00 0.00 ? 95  SER A H    6  
ATOM 9260  H HA   . SER A 1 95  ? -10.421 -7.032  -24.889 1.00 0.00 ? 95  SER A HA   6  
ATOM 9261  H HB2  . SER A 1 95  ? -11.124 -5.880  -27.610 1.00 0.00 ? 95  SER A HB2  6  
ATOM 9262  H HB3  . SER A 1 95  ? -12.231 -6.470  -26.358 1.00 0.00 ? 95  SER A HB3  6  
ATOM 9263  H HG   . SER A 1 95  ? -10.972 -4.072  -26.632 1.00 0.00 ? 95  SER A HG   6  
ATOM 9264  N N    . SER A 1 96  ? -10.607 -9.201  -26.318 1.00 0.00 ? 96  SER A N    6  
ATOM 9265  C CA   . SER A 1 96  ? -10.467 -10.533 -26.914 1.00 0.00 ? 96  SER A CA   6  
ATOM 9266  C C    . SER A 1 96  ? -11.811 -11.271 -26.949 1.00 0.00 ? 96  SER A C    6  
ATOM 9267  O O    . SER A 1 96  ? -12.760 -10.894 -26.256 1.00 0.00 ? 96  SER A O    6  
ATOM 9268  C CB   . SER A 1 96  ? -9.464  -11.367 -26.105 1.00 0.00 ? 96  SER A CB   6  
ATOM 9269  O OG   . SER A 1 96  ? -8.184  -10.762 -26.059 1.00 0.00 ? 96  SER A OG   6  
ATOM 9270  H H    . SER A 1 96  ? -11.330 -9.118  -25.609 1.00 0.00 ? 96  SER A H    6  
ATOM 9271  H HA   . SER A 1 96  ? -10.110 -10.426 -27.938 1.00 0.00 ? 96  SER A HA   6  
ATOM 9272  H HB2  . SER A 1 96  ? -9.840  -11.501 -25.088 1.00 0.00 ? 96  SER A HB2  6  
ATOM 9273  H HB3  . SER A 1 96  ? -9.363  -12.346 -26.577 1.00 0.00 ? 96  SER A HB3  6  
ATOM 9274  H HG   . SER A 1 96  ? -7.530  -11.451 -26.288 1.00 0.00 ? 96  SER A HG   6  
ATOM 9275  N N    . GLY A 1 97  ? -11.907 -12.345 -27.738 1.00 0.00 ? 97  GLY A N    6  
ATOM 9276  C CA   . GLY A 1 97  ? -13.030 -13.273 -27.698 1.00 0.00 ? 97  GLY A CA   6  
ATOM 9277  C C    . GLY A 1 97  ? -12.887 -14.241 -26.523 1.00 0.00 ? 97  GLY A C    6  
ATOM 9278  O O    . GLY A 1 97  ? -11.799 -14.340 -25.947 1.00 0.00 ? 97  GLY A O    6  
ATOM 9279  H H    . GLY A 1 97  ? -11.102 -12.664 -28.266 1.00 0.00 ? 97  GLY A H    6  
ATOM 9280  H HA2  . GLY A 1 97  ? -13.966 -12.730 -27.607 1.00 0.00 ? 97  GLY A HA2  6  
ATOM 9281  H HA3  . GLY A 1 97  ? -13.045 -13.846 -28.626 1.00 0.00 ? 97  GLY A HA3  6  
ATOM 9282  N N    . PRO A 1 98  ? -13.946 -14.998 -26.190 1.00 0.00 ? 98  PRO A N    6  
ATOM 9283  C CA   . PRO A 1 98  ? -13.848 -16.111 -25.256 1.00 0.00 ? 98  PRO A CA   6  
ATOM 9284  C C    . PRO A 1 98  ? -13.026 -17.252 -25.873 1.00 0.00 ? 98  PRO A C    6  
ATOM 9285  O O    . PRO A 1 98  ? -12.612 -17.189 -27.039 1.00 0.00 ? 98  PRO A O    6  
ATOM 9286  C CB   . PRO A 1 98  ? -15.300 -16.513 -24.965 1.00 0.00 ? 98  PRO A CB   6  
ATOM 9287  C CG   . PRO A 1 98  ? -16.018 -16.182 -26.271 1.00 0.00 ? 98  PRO A CG   6  
ATOM 9288  C CD   . PRO A 1 98  ? -15.285 -14.930 -26.759 1.00 0.00 ? 98  PRO A CD   6  
ATOM 9289  H HA   . PRO A 1 98  ? -13.363 -15.787 -24.336 1.00 0.00 ? 98  PRO A HA   6  
ATOM 9290  H HB2  . PRO A 1 98  ? -15.404 -17.567 -24.700 1.00 0.00 ? 98  PRO A HB2  6  
ATOM 9291  H HB3  . PRO A 1 98  ? -15.694 -15.882 -24.167 1.00 0.00 ? 98  PRO A HB3  6  
ATOM 9292  H HG2  . PRO A 1 98  ? -15.873 -16.994 -26.986 1.00 0.00 ? 98  PRO A HG2  6  
ATOM 9293  H HG3  . PRO A 1 98  ? -17.080 -15.991 -26.110 1.00 0.00 ? 98  PRO A HG3  6  
ATOM 9294  H HD2  . PRO A 1 98  ? -15.259 -14.912 -27.849 1.00 0.00 ? 98  PRO A HD2  6  
ATOM 9295  H HD3  . PRO A 1 98  ? -15.782 -14.040 -26.378 1.00 0.00 ? 98  PRO A HD3  6  
ATOM 9296  N N    . SER A 1 99  ? -12.807 -18.317 -25.105 1.00 0.00 ? 99  SER A N    6  
ATOM 9297  C CA   . SER A 1 99  ? -12.201 -19.550 -25.587 1.00 0.00 ? 99  SER A CA   6  
ATOM 9298  C C    . SER A 1 99  ? -12.704 -20.716 -24.732 1.00 0.00 ? 99  SER A C    6  
ATOM 9299  O O    . SER A 1 99  ? -13.276 -20.485 -23.663 1.00 0.00 ? 99  SER A O    6  
ATOM 9300  C CB   . SER A 1 99  ? -10.676 -19.417 -25.509 1.00 0.00 ? 99  SER A CB   6  
ATOM 9301  O OG   . SER A 1 99  ? -10.266 -19.067 -24.202 1.00 0.00 ? 99  SER A OG   6  
ATOM 9302  H H    . SER A 1 99  ? -13.154 -18.363 -24.153 1.00 0.00 ? 99  SER A H    6  
ATOM 9303  H HA   . SER A 1 99  ? -12.495 -19.713 -26.627 1.00 0.00 ? 99  SER A HA   6  
ATOM 9304  H HB2  . SER A 1 99  ? -10.215 -20.366 -25.790 1.00 0.00 ? 99  SER A HB2  6  
ATOM 9305  H HB3  . SER A 1 99  ? -10.343 -18.646 -26.204 1.00 0.00 ? 99  SER A HB3  6  
ATOM 9306  H HG   . SER A 1 99  ? -10.690 -18.230 -23.936 1.00 0.00 ? 99  SER A HG   6  
ATOM 9307  N N    . SER A 1 100 ? -12.444 -21.952 -25.166 1.00 0.00 ? 100 SER A N    6  
ATOM 9308  C CA   . SER A 1 100 ? -12.854 -23.174 -24.467 1.00 0.00 ? 100 SER A CA   6  
ATOM 9309  C C    . SER A 1 100 ? -14.369 -23.201 -24.149 1.00 0.00 ? 100 SER A C    6  
ATOM 9310  O O    . SER A 1 100 ? -15.151 -22.474 -24.765 1.00 0.00 ? 100 SER A O    6  
ATOM 9311  C CB   . SER A 1 100 ? -11.950 -23.377 -23.235 1.00 0.00 ? 100 SER A CB   6  
ATOM 9312  O OG   . SER A 1 100 ? -10.581 -23.226 -23.588 1.00 0.00 ? 100 SER A OG   6  
ATOM 9313  H H    . SER A 1 100 ? -11.975 -22.074 -26.048 1.00 0.00 ? 100 SER A H    6  
ATOM 9314  H HA   . SER A 1 100 ? -12.667 -24.004 -25.148 1.00 0.00 ? 100 SER A HA   6  
ATOM 9315  H HB2  . SER A 1 100 ? -12.207 -22.653 -22.459 1.00 0.00 ? 100 SER A HB2  6  
ATOM 9316  H HB3  . SER A 1 100 ? -12.106 -24.382 -22.843 1.00 0.00 ? 100 SER A HB3  6  
ATOM 9317  H HG   . SER A 1 100 ? -10.331 -22.306 -23.442 1.00 0.00 ? 100 SER A HG   6  
ATOM 9318  N N    . GLY A 1 101 ? -14.803 -24.067 -23.231 1.00 0.00 ? 101 GLY A N    6  
ATOM 9319  C CA   . GLY A 1 101 ? -16.153 -24.217 -22.707 1.00 0.00 ? 101 GLY A CA   6  
ATOM 9320  C C    . GLY A 1 101 ? -16.029 -24.669 -21.259 1.00 0.00 ? 101 GLY A C    6  
ATOM 9321  O O    . GLY A 1 101 ? -15.020 -25.341 -20.952 1.00 0.00 ? 101 GLY A O    6  
ATOM 9322  H H    . GLY A 1 101 ? -14.161 -24.638 -22.697 1.00 0.00 ? 101 GLY A H    6  
ATOM 9323  H HA2  . GLY A 1 101 ? -16.718 -23.287 -22.764 1.00 0.00 ? 101 GLY A HA2  6  
ATOM 9324  H HA3  . GLY A 1 101 ? -16.677 -24.989 -23.269 1.00 0.00 ? 101 GLY A HA3  6  
ATOM 9325  N N    . GLY A 1 1   ? 16.196  -6.559  -13.537 1.00 0.00 ? 1   GLY A N    7  
ATOM 9326  C CA   . GLY A 1 1   ? 15.407  -6.596  -12.298 1.00 0.00 ? 1   GLY A CA   7  
ATOM 9327  C C    . GLY A 1 1   ? 14.090  -5.850  -12.430 1.00 0.00 ? 1   GLY A C    7  
ATOM 9328  O O    . GLY A 1 1   ? 13.072  -6.448  -12.787 1.00 0.00 ? 1   GLY A O    7  
ATOM 9329  H H1   . GLY A 1 1   ? 16.564  -5.661  -13.777 1.00 0.00 ? 1   GLY A H1   7  
ATOM 9330  H HA2  . GLY A 1 1   ? 15.176  -7.632  -12.059 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 9331  H HA3  . GLY A 1 1   ? 15.987  -6.173  -11.478 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 9332  N N    . SER A 1 2   ? 14.076  -4.565  -12.098 1.00 0.00 ? 2   SER A N    7  
ATOM 9333  C CA   . SER A 1 2   ? 12.862  -3.800  -11.862 1.00 0.00 ? 2   SER A CA   7  
ATOM 9334  C C    . SER A 1 2   ? 12.541  -2.984  -13.113 1.00 0.00 ? 2   SER A C    7  
ATOM 9335  O O    . SER A 1 2   ? 13.005  -1.853  -13.269 1.00 0.00 ? 2   SER A O    7  
ATOM 9336  C CB   . SER A 1 2   ? 13.043  -2.954  -10.597 1.00 0.00 ? 2   SER A CB   7  
ATOM 9337  O OG   . SER A 1 2   ? 13.588  -3.768  -9.569  1.00 0.00 ? 2   SER A OG   7  
ATOM 9338  H H    . SER A 1 2   ? 14.928  -4.117  -11.787 1.00 0.00 ? 2   SER A H    7  
ATOM 9339  H HA   . SER A 1 2   ? 12.039  -4.486  -11.663 1.00 0.00 ? 2   SER A HA   7  
ATOM 9340  H HB2  . SER A 1 2   ? 13.727  -2.131  -10.800 1.00 0.00 ? 2   SER A HB2  7  
ATOM 9341  H HB3  . SER A 1 2   ? 12.077  -2.553  -10.287 1.00 0.00 ? 2   SER A HB3  7  
ATOM 9342  H HG   . SER A 1 2   ? 13.406  -3.330  -8.695  1.00 0.00 ? 2   SER A HG   7  
ATOM 9343  N N    . SER A 1 3   ? 11.840  -3.605  -14.062 1.00 0.00 ? 3   SER A N    7  
ATOM 9344  C CA   . SER A 1 3   ? 11.235  -2.987  -15.235 1.00 0.00 ? 3   SER A CA   7  
ATOM 9345  C C    . SER A 1 3   ? 10.227  -3.977  -15.828 1.00 0.00 ? 3   SER A C    7  
ATOM 9346  O O    . SER A 1 3   ? 10.305  -5.182  -15.562 1.00 0.00 ? 3   SER A O    7  
ATOM 9347  C CB   . SER A 1 3   ? 12.320  -2.613  -16.252 1.00 0.00 ? 3   SER A CB   7  
ATOM 9348  O OG   . SER A 1 3   ? 12.917  -1.386  -15.867 1.00 0.00 ? 3   SER A OG   7  
ATOM 9349  H H    . SER A 1 3   ? 11.550  -4.566  -13.924 1.00 0.00 ? 3   SER A H    7  
ATOM 9350  H HA   . SER A 1 3   ? 10.699  -2.085  -14.941 1.00 0.00 ? 3   SER A HA   7  
ATOM 9351  H HB2  . SER A 1 3   ? 13.071  -3.400  -16.285 1.00 0.00 ? 3   SER A HB2  7  
ATOM 9352  H HB3  . SER A 1 3   ? 11.885  -2.498  -17.246 1.00 0.00 ? 3   SER A HB3  7  
ATOM 9353  H HG   . SER A 1 3   ? 13.018  -1.422  -14.891 1.00 0.00 ? 3   SER A HG   7  
ATOM 9354  N N    . GLY A 1 4   ? 9.297   -3.454  -16.634 1.00 0.00 ? 4   GLY A N    7  
ATOM 9355  C CA   . GLY A 1 4   ? 8.185   -4.156  -17.256 1.00 0.00 ? 4   GLY A CA   7  
ATOM 9356  C C    . GLY A 1 4   ? 7.480   -5.047  -16.247 1.00 0.00 ? 4   GLY A C    7  
ATOM 9357  O O    . GLY A 1 4   ? 6.910   -4.535  -15.275 1.00 0.00 ? 4   GLY A O    7  
ATOM 9358  H H    . GLY A 1 4   ? 9.256   -2.446  -16.721 1.00 0.00 ? 4   GLY A H    7  
ATOM 9359  H HA2  . GLY A 1 4   ? 7.473   -3.423  -17.637 1.00 0.00 ? 4   GLY A HA2  7  
ATOM 9360  H HA3  . GLY A 1 4   ? 8.552   -4.752  -18.088 1.00 0.00 ? 4   GLY A HA3  7  
ATOM 9361  N N    . SER A 1 5   ? 7.596   -6.360  -16.461 1.00 0.00 ? 5   SER A N    7  
ATOM 9362  C CA   . SER A 1 5   ? 6.961   -7.421  -15.693 1.00 0.00 ? 5   SER A CA   7  
ATOM 9363  C C    . SER A 1 5   ? 5.442   -7.438  -15.930 1.00 0.00 ? 5   SER A C    7  
ATOM 9364  O O    . SER A 1 5   ? 4.834   -6.450  -16.349 1.00 0.00 ? 5   SER A O    7  
ATOM 9365  C CB   . SER A 1 5   ? 7.370   -7.295  -14.210 1.00 0.00 ? 5   SER A CB   7  
ATOM 9366  O OG   . SER A 1 5   ? 6.997   -8.403  -13.421 1.00 0.00 ? 5   SER A OG   7  
ATOM 9367  H H    . SER A 1 5   ? 8.090   -6.646  -17.293 1.00 0.00 ? 5   SER A H    7  
ATOM 9368  H HA   . SER A 1 5   ? 7.364   -8.361  -16.069 1.00 0.00 ? 5   SER A HA   7  
ATOM 9369  H HB2  . SER A 1 5   ? 8.450   -7.181  -14.150 1.00 0.00 ? 5   SER A HB2  7  
ATOM 9370  H HB3  . SER A 1 5   ? 6.930   -6.410  -13.767 1.00 0.00 ? 5   SER A HB3  7  
ATOM 9371  H HG   . SER A 1 5   ? 7.688   -9.079  -13.535 1.00 0.00 ? 5   SER A HG   7  
ATOM 9372  N N    . SER A 1 6   ? 4.828   -8.578  -15.636 1.00 0.00 ? 6   SER A N    7  
ATOM 9373  C CA   . SER A 1 6   ? 3.390   -8.775  -15.556 1.00 0.00 ? 6   SER A CA   7  
ATOM 9374  C C    . SER A 1 6   ? 3.161   -9.748  -14.396 1.00 0.00 ? 6   SER A C    7  
ATOM 9375  O O    . SER A 1 6   ? 4.053   -10.531 -14.059 1.00 0.00 ? 6   SER A O    7  
ATOM 9376  C CB   . SER A 1 6   ? 2.848   -9.354  -16.872 1.00 0.00 ? 6   SER A CB   7  
ATOM 9377  O OG   . SER A 1 6   ? 3.368   -8.705  -18.025 1.00 0.00 ? 6   SER A OG   7  
ATOM 9378  H H    . SER A 1 6   ? 5.362   -9.354  -15.253 1.00 0.00 ? 6   SER A H    7  
ATOM 9379  H HA   . SER A 1 6   ? 2.899   -7.825  -15.343 1.00 0.00 ? 6   SER A HA   7  
ATOM 9380  H HB2  . SER A 1 6   ? 3.133   -10.405 -16.930 1.00 0.00 ? 6   SER A HB2  7  
ATOM 9381  H HB3  . SER A 1 6   ? 1.758   -9.297  -16.867 1.00 0.00 ? 6   SER A HB3  7  
ATOM 9382  H HG   . SER A 1 6   ? 2.725   -8.039  -18.336 1.00 0.00 ? 6   SER A HG   7  
ATOM 9383  N N    . GLY A 1 7   ? 1.981   -9.725  -13.793 1.00 0.00 ? 7   GLY A N    7  
ATOM 9384  C CA   . GLY A 1 7   ? 1.653   -10.561 -12.650 1.00 0.00 ? 7   GLY A CA   7  
ATOM 9385  C C    . GLY A 1 7   ? 0.226   -10.243 -12.245 1.00 0.00 ? 7   GLY A C    7  
ATOM 9386  O O    . GLY A 1 7   ? -0.581  -9.861  -13.098 1.00 0.00 ? 7   GLY A O    7  
ATOM 9387  H H    . GLY A 1 7   ? 1.275   -9.042  -14.050 1.00 0.00 ? 7   GLY A H    7  
ATOM 9388  H HA2  . GLY A 1 7   ? 1.736   -11.614 -12.921 1.00 0.00 ? 7   GLY A HA2  7  
ATOM 9389  H HA3  . GLY A 1 7   ? 2.338   -10.338 -11.830 1.00 0.00 ? 7   GLY A HA3  7  
ATOM 9390  N N    . GLN A 1 8   ? -0.088  -10.387 -10.960 1.00 0.00 ? 8   GLN A N    7  
ATOM 9391  C CA   . GLN A 1 8   ? -1.180  -9.668  -10.330 1.00 0.00 ? 8   GLN A CA   7  
ATOM 9392  C C    . GLN A 1 8   ? -0.988  -9.702  -8.818  1.00 0.00 ? 8   GLN A C    7  
ATOM 9393  O O    . GLN A 1 8   ? -0.022  -10.281 -8.312  1.00 0.00 ? 8   GLN A O    7  
ATOM 9394  C CB   . GLN A 1 8   ? -2.549  -10.217 -10.800 1.00 0.00 ? 8   GLN A CB   7  
ATOM 9395  C CG   . GLN A 1 8   ? -3.305  -9.073  -11.493 1.00 0.00 ? 8   GLN A CG   7  
ATOM 9396  C CD   . GLN A 1 8   ? -4.435  -9.537  -12.402 1.00 0.00 ? 8   GLN A CD   7  
ATOM 9397  O OE1  . GLN A 1 8   ? -5.082  -10.559 -12.182 1.00 0.00 ? 8   GLN A OE1  7  
ATOM 9398  N NE2  . GLN A 1 8   ? -4.687  -8.789  -13.460 1.00 0.00 ? 8   GLN A NE2  7  
ATOM 9399  H H    . GLN A 1 8   ? 0.628   -10.661 -10.302 1.00 0.00 ? 8   GLN A H    7  
ATOM 9400  H HA   . GLN A 1 8   ? -1.087  -8.621  -10.621 1.00 0.00 ? 8   GLN A HA   7  
ATOM 9401  H HB2  . GLN A 1 8   ? -2.406  -11.033 -11.512 1.00 0.00 ? 8   GLN A HB2  7  
ATOM 9402  H HB3  . GLN A 1 8   ? -3.140  -10.594 -9.962  1.00 0.00 ? 8   GLN A HB3  7  
ATOM 9403  H HG2  . GLN A 1 8   ? -3.704  -8.392  -10.741 1.00 0.00 ? 8   GLN A HG2  7  
ATOM 9404  H HG3  . GLN A 1 8   ? -2.604  -8.510  -12.108 1.00 0.00 ? 8   GLN A HG3  7  
ATOM 9405  H HE21 . GLN A 1 8   ? -4.124  -7.951  -13.586 1.00 0.00 ? 8   GLN A HE21 7  
ATOM 9406  H HE22 . GLN A 1 8   ? -5.612  -8.809  -13.891 1.00 0.00 ? 8   GLN A HE22 7  
ATOM 9407  N N    . TYR A 1 9   ? -1.951  -9.118  -8.104  1.00 0.00 ? 9   TYR A N    7  
ATOM 9408  C CA   . TYR A 1 9   ? -2.100  -9.202  -6.658  1.00 0.00 ? 9   TYR A CA   7  
ATOM 9409  C C    . TYR A 1 9   ? -1.893  -10.630 -6.148  1.00 0.00 ? 9   TYR A C    7  
ATOM 9410  O O    . TYR A 1 9   ? -1.232  -10.810 -5.132  1.00 0.00 ? 9   TYR A O    7  
ATOM 9411  C CB   . TYR A 1 9   ? -3.479  -8.640  -6.260  1.00 0.00 ? 9   TYR A CB   7  
ATOM 9412  C CG   . TYR A 1 9   ? -4.617  -9.071  -7.175  1.00 0.00 ? 9   TYR A CG   7  
ATOM 9413  C CD1  . TYR A 1 9   ? -5.180  -10.352 -7.033  1.00 0.00 ? 9   TYR A CD1  7  
ATOM 9414  C CD2  . TYR A 1 9   ? -5.055  -8.231  -8.220  1.00 0.00 ? 9   TYR A CD2  7  
ATOM 9415  C CE1  . TYR A 1 9   ? -6.137  -10.816 -7.948  1.00 0.00 ? 9   TYR A CE1  7  
ATOM 9416  C CE2  . TYR A 1 9   ? -6.034  -8.681  -9.126  1.00 0.00 ? 9   TYR A CE2  7  
ATOM 9417  C CZ   . TYR A 1 9   ? -6.572  -9.982  -8.998  1.00 0.00 ? 9   TYR A CZ   7  
ATOM 9418  O OH   . TYR A 1 9   ? -7.506  -10.442 -9.871  1.00 0.00 ? 9   TYR A OH   7  
ATOM 9419  H H    . TYR A 1 9   ? -2.707  -8.676  -8.607  1.00 0.00 ? 9   TYR A H    7  
ATOM 9420  H HA   . TYR A 1 9   ? -1.326  -8.589  -6.204  1.00 0.00 ? 9   TYR A HA   7  
ATOM 9421  H HB2  . TYR A 1 9   ? -3.707  -8.936  -5.235  1.00 0.00 ? 9   TYR A HB2  7  
ATOM 9422  H HB3  . TYR A 1 9   ? -3.417  -7.554  -6.273  1.00 0.00 ? 9   TYR A HB3  7  
ATOM 9423  H HD1  . TYR A 1 9   ? -4.886  -10.995 -6.216  1.00 0.00 ? 9   TYR A HD1  7  
ATOM 9424  H HD2  . TYR A 1 9   ? -4.657  -7.229  -8.331  1.00 0.00 ? 9   TYR A HD2  7  
ATOM 9425  H HE1  . TYR A 1 9   ? -6.547  -11.811 -7.841  1.00 0.00 ? 9   TYR A HE1  7  
ATOM 9426  H HE2  . TYR A 1 9   ? -6.379  -8.019  -9.909  1.00 0.00 ? 9   TYR A HE2  7  
ATOM 9427  H HH   . TYR A 1 9   ? -7.297  -10.203 -10.785 1.00 0.00 ? 9   TYR A HH   7  
ATOM 9428  N N    . GLU A 1 10  ? -2.422  -11.629 -6.861  1.00 0.00 ? 10  GLU A N    7  
ATOM 9429  C CA   . GLU A 1 10  ? -2.292  -13.050 -6.546  1.00 0.00 ? 10  GLU A CA   7  
ATOM 9430  C C    . GLU A 1 10  ? -0.836  -13.484 -6.576  1.00 0.00 ? 10  GLU A C    7  
ATOM 9431  O O    . GLU A 1 10  ? -0.334  -13.999 -5.583  1.00 0.00 ? 10  GLU A O    7  
ATOM 9432  C CB   . GLU A 1 10  ? -3.132  -13.897 -7.511  1.00 0.00 ? 10  GLU A CB   7  
ATOM 9433  C CG   . GLU A 1 10  ? -4.461  -14.251 -6.837  1.00 0.00 ? 10  GLU A CG   7  
ATOM 9434  C CD   . GLU A 1 10  ? -5.353  -15.086 -7.750  1.00 0.00 ? 10  GLU A CD   7  
ATOM 9435  O OE1  . GLU A 1 10  ? -4.886  -16.074 -8.355  1.00 0.00 ? 10  GLU A OE1  7  
ATOM 9436  O OE2  . GLU A 1 10  ? -6.568  -14.782 -7.795  1.00 0.00 ? 10  GLU A OE2  7  
ATOM 9437  H H    . GLU A 1 10  ? -2.972  -11.362 -7.662  1.00 0.00 ? 10  GLU A H    7  
ATOM 9438  H HA   . GLU A 1 10  ? -2.646  -13.220 -5.532  1.00 0.00 ? 10  GLU A HA   7  
ATOM 9439  H HB2  . GLU A 1 10  ? -3.307  -13.348 -8.440  1.00 0.00 ? 10  GLU A HB2  7  
ATOM 9440  H HB3  . GLU A 1 10  ? -2.597  -14.819 -7.750  1.00 0.00 ? 10  GLU A HB3  7  
ATOM 9441  H HG2  . GLU A 1 10  ? -4.268  -14.835 -5.934  1.00 0.00 ? 10  GLU A HG2  7  
ATOM 9442  H HG3  . GLU A 1 10  ? -4.974  -13.327 -6.549  1.00 0.00 ? 10  GLU A HG3  7  
ATOM 9443  N N    . LEU A 1 11  ? -0.152  -13.236 -7.693  1.00 0.00 ? 11  LEU A N    7  
ATOM 9444  C CA   . LEU A 1 11  ? 1.260   -13.552 -7.852  1.00 0.00 ? 11  LEU A CA   7  
ATOM 9445  C C    . LEU A 1 11  ? 2.064   -12.943 -6.697  1.00 0.00 ? 11  LEU A C    7  
ATOM 9446  O O    . LEU A 1 11  ? 2.871   -13.632 -6.072  1.00 0.00 ? 11  LEU A O    7  
ATOM 9447  C CB   . LEU A 1 11  ? 1.688   -13.174 -9.282  1.00 0.00 ? 11  LEU A CB   7  
ATOM 9448  C CG   . LEU A 1 11  ? 3.185   -13.109 -9.640  1.00 0.00 ? 11  LEU A CG   7  
ATOM 9449  C CD1  . LEU A 1 11  ? 3.767   -11.785 -9.185  1.00 0.00 ? 11  LEU A CD1  7  
ATOM 9450  C CD2  . LEU A 1 11  ? 4.089   -14.201 -9.064  1.00 0.00 ? 11  LEU A CD2  7  
ATOM 9451  H H    . LEU A 1 11  ? -0.619  -12.761 -8.450  1.00 0.00 ? 11  LEU A H    7  
ATOM 9452  H HA   . LEU A 1 11  ? 1.366   -14.623 -7.779  1.00 0.00 ? 11  LEU A HA   7  
ATOM 9453  H HB2  . LEU A 1 11  ? 1.238   -13.910 -9.949  1.00 0.00 ? 11  LEU A HB2  7  
ATOM 9454  H HB3  . LEU A 1 11  ? 1.246   -12.214 -9.538  1.00 0.00 ? 11  LEU A HB3  7  
ATOM 9455  H HG   . LEU A 1 11  ? 3.253   -13.137 -10.728 1.00 0.00 ? 11  LEU A HG   7  
ATOM 9456  H HD11 . LEU A 1 11  ? 3.099   -10.966 -9.436  1.00 0.00 ? 11  LEU A HD11 7  
ATOM 9457  H HD12 . LEU A 1 11  ? 3.915   -11.827 -8.113  1.00 0.00 ? 11  LEU A HD12 7  
ATOM 9458  H HD13 . LEU A 1 11  ? 4.724   -11.620 -9.670  1.00 0.00 ? 11  LEU A HD13 7  
ATOM 9459  H HD21 . LEU A 1 11  ? 5.008   -14.222 -9.648  1.00 0.00 ? 11  LEU A HD21 7  
ATOM 9460  H HD22 . LEU A 1 11  ? 4.349   -13.973 -8.030  1.00 0.00 ? 11  LEU A HD22 7  
ATOM 9461  H HD23 . LEU A 1 11  ? 3.585   -15.159 -9.129  1.00 0.00 ? 11  LEU A HD23 7  
ATOM 9462  N N    . TYR A 1 12  ? 1.809   -11.679 -6.352  1.00 0.00 ? 12  TYR A N    7  
ATOM 9463  C CA   . TYR A 1 12  ? 2.468   -11.043 -5.214  1.00 0.00 ? 12  TYR A CA   7  
ATOM 9464  C C    . TYR A 1 12  ? 2.115   -11.738 -3.895  1.00 0.00 ? 12  TYR A C    7  
ATOM 9465  O O    . TYR A 1 12  ? 3.006   -11.932 -3.068  1.00 0.00 ? 12  TYR A O    7  
ATOM 9466  C CB   . TYR A 1 12  ? 2.170   -9.535  -5.167  1.00 0.00 ? 12  TYR A CB   7  
ATOM 9467  C CG   . TYR A 1 12  ? 2.530   -8.733  -6.413  1.00 0.00 ? 12  TYR A CG   7  
ATOM 9468  C CD1  . TYR A 1 12  ? 3.568   -9.142  -7.271  1.00 0.00 ? 12  TYR A CD1  7  
ATOM 9469  C CD2  . TYR A 1 12  ? 1.812   -7.566  -6.727  1.00 0.00 ? 12  TYR A CD2  7  
ATOM 9470  C CE1  . TYR A 1 12  ? 3.825   -8.474  -8.479  1.00 0.00 ? 12  TYR A CE1  7  
ATOM 9471  C CE2  . TYR A 1 12  ? 2.111   -6.841  -7.894  1.00 0.00 ? 12  TYR A CE2  7  
ATOM 9472  C CZ   . TYR A 1 12  ? 3.104   -7.297  -8.789  1.00 0.00 ? 12  TYR A CZ   7  
ATOM 9473  O OH   . TYR A 1 12  ? 3.383   -6.556  -9.896  1.00 0.00 ? 12  TYR A OH   7  
ATOM 9474  H H    . TYR A 1 12  ? 1.123   -11.174 -6.903  1.00 0.00 ? 12  TYR A H    7  
ATOM 9475  H HA   . TYR A 1 12  ? 3.540   -11.171 -5.344  1.00 0.00 ? 12  TYR A HA   7  
ATOM 9476  H HB2  . TYR A 1 12  ? 1.107   -9.406  -4.970  1.00 0.00 ? 12  TYR A HB2  7  
ATOM 9477  H HB3  . TYR A 1 12  ? 2.713   -9.106  -4.325  1.00 0.00 ? 12  TYR A HB3  7  
ATOM 9478  H HD1  . TYR A 1 12  ? 4.161   -10.007 -7.037  1.00 0.00 ? 12  TYR A HD1  7  
ATOM 9479  H HD2  . TYR A 1 12  ? 1.017   -7.222  -6.085  1.00 0.00 ? 12  TYR A HD2  7  
ATOM 9480  H HE1  . TYR A 1 12  ? 4.558   -8.912  -9.150  1.00 0.00 ? 12  TYR A HE1  7  
ATOM 9481  H HE2  . TYR A 1 12  ? 1.563   -5.945  -8.132  1.00 0.00 ? 12  TYR A HE2  7  
ATOM 9482  H HH   . TYR A 1 12  ? 4.074   -6.911  -10.493 1.00 0.00 ? 12  TYR A HH   7  
ATOM 9483  N N    . MET A 1 13  ? 0.856   -12.147 -3.704  1.00 0.00 ? 13  MET A N    7  
ATOM 9484  C CA   . MET A 1 13  ? 0.333   -12.829 -2.523  1.00 0.00 ? 13  MET A CA   7  
ATOM 9485  C C    . MET A 1 13  ? 1.133   -14.079 -2.148  1.00 0.00 ? 13  MET A C    7  
ATOM 9486  O O    . MET A 1 13  ? 1.079   -14.483 -0.984  1.00 0.00 ? 13  MET A O    7  
ATOM 9487  C CB   . MET A 1 13  ? -1.128  -13.260 -2.782  1.00 0.00 ? 13  MET A CB   7  
ATOM 9488  C CG   . MET A 1 13  ? -2.094  -12.929 -1.644  1.00 0.00 ? 13  MET A CG   7  
ATOM 9489  S SD   . MET A 1 13  ? -2.952  -11.329 -1.774  1.00 0.00 ? 13  MET A SD   7  
ATOM 9490  C CE   . MET A 1 13  ? -4.032  -11.640 -3.210  1.00 0.00 ? 13  MET A CE   7  
ATOM 9491  H H    . MET A 1 13  ? 0.171   -11.976 -4.434  1.00 0.00 ? 13  MET A H    7  
ATOM 9492  H HA   . MET A 1 13  ? 0.376   -12.127 -1.689  1.00 0.00 ? 13  MET A HA   7  
ATOM 9493  H HB2  . MET A 1 13  ? -1.504  -12.798 -3.686  1.00 0.00 ? 13  MET A HB2  7  
ATOM 9494  H HB3  . MET A 1 13  ? -1.161  -14.340 -2.947  1.00 0.00 ? 13  MET A HB3  7  
ATOM 9495  H HG2  . MET A 1 13  ? -2.852  -13.711 -1.625  1.00 0.00 ? 13  MET A HG2  7  
ATOM 9496  H HG3  . MET A 1 13  ? -1.549  -12.966 -0.702  1.00 0.00 ? 13  MET A HG3  7  
ATOM 9497  H HE1  . MET A 1 13  ? -4.639  -10.763 -3.436  1.00 0.00 ? 13  MET A HE1  7  
ATOM 9498  H HE2  . MET A 1 13  ? -3.431  -11.853 -4.088  1.00 0.00 ? 13  MET A HE2  7  
ATOM 9499  H HE3  . MET A 1 13  ? -4.687  -12.488 -3.008  1.00 0.00 ? 13  MET A HE3  7  
ATOM 9500  N N    . TYR A 1 14  ? 1.801   -14.719 -3.112  1.00 0.00 ? 14  TYR A N    7  
ATOM 9501  C CA   . TYR A 1 14  ? 2.523   -15.972 -2.910  1.00 0.00 ? 14  TYR A CA   7  
ATOM 9502  C C    . TYR A 1 14  ? 3.999   -15.769 -2.590  1.00 0.00 ? 14  TYR A C    7  
ATOM 9503  O O    . TYR A 1 14  ? 4.644   -16.695 -2.092  1.00 0.00 ? 14  TYR A O    7  
ATOM 9504  C CB   . TYR A 1 14  ? 2.460   -16.814 -4.187  1.00 0.00 ? 14  TYR A CB   7  
ATOM 9505  C CG   . TYR A 1 14  ? 1.087   -16.964 -4.801  1.00 0.00 ? 14  TYR A CG   7  
ATOM 9506  C CD1  . TYR A 1 14  ? -0.007  -17.352 -4.003  1.00 0.00 ? 14  TYR A CD1  7  
ATOM 9507  C CD2  . TYR A 1 14  ? 0.911   -16.698 -6.173  1.00 0.00 ? 14  TYR A CD2  7  
ATOM 9508  C CE1  . TYR A 1 14  ? -1.286  -17.465 -4.571  1.00 0.00 ? 14  TYR A CE1  7  
ATOM 9509  C CE2  . TYR A 1 14  ? -0.364  -16.853 -6.753  1.00 0.00 ? 14  TYR A CE2  7  
ATOM 9510  C CZ   . TYR A 1 14  ? -1.465  -17.241 -5.954  1.00 0.00 ? 14  TYR A CZ   7  
ATOM 9511  O OH   . TYR A 1 14  ? -2.691  -17.408 -6.517  1.00 0.00 ? 14  TYR A OH   7  
ATOM 9512  H H    . TYR A 1 14  ? 1.733   -14.360 -4.059  1.00 0.00 ? 14  TYR A H    7  
ATOM 9513  H HA   . TYR A 1 14  ? 2.061   -16.527 -2.098  1.00 0.00 ? 14  TYR A HA   7  
ATOM 9514  H HB2  . TYR A 1 14  ? 3.120   -16.355 -4.924  1.00 0.00 ? 14  TYR A HB2  7  
ATOM 9515  H HB3  . TYR A 1 14  ? 2.847   -17.810 -3.965  1.00 0.00 ? 14  TYR A HB3  7  
ATOM 9516  H HD1  . TYR A 1 14  ? 0.127   -17.542 -2.947  1.00 0.00 ? 14  TYR A HD1  7  
ATOM 9517  H HD2  . TYR A 1 14  ? 1.751   -16.321 -6.757  1.00 0.00 ? 14  TYR A HD2  7  
ATOM 9518  H HE1  . TYR A 1 14  ? -2.123  -17.726 -3.941  1.00 0.00 ? 14  TYR A HE1  7  
ATOM 9519  H HE2  . TYR A 1 14  ? -0.528  -16.624 -7.795  1.00 0.00 ? 14  TYR A HE2  7  
ATOM 9520  H HH   . TYR A 1 14  ? -3.360  -17.709 -5.893  1.00 0.00 ? 14  TYR A HH   7  
ATOM 9521  N N    . ARG A 1 15  ? 4.553   -14.606 -2.931  1.00 0.00 ? 15  ARG A N    7  
ATOM 9522  C CA   . ARG A 1 15  ? 5.991   -14.408 -3.065  1.00 0.00 ? 15  ARG A CA   7  
ATOM 9523  C C    . ARG A 1 15  ? 6.415   -13.248 -2.178  1.00 0.00 ? 15  ARG A C    7  
ATOM 9524  O O    . ARG A 1 15  ? 5.777   -13.022 -1.154  1.00 0.00 ? 15  ARG A O    7  
ATOM 9525  C CB   . ARG A 1 15  ? 6.343   -14.304 -4.570  1.00 0.00 ? 15  ARG A CB   7  
ATOM 9526  C CG   . ARG A 1 15  ? 7.166   -15.507 -5.056  1.00 0.00 ? 15  ARG A CG   7  
ATOM 9527  C CD   . ARG A 1 15  ? 8.504   -15.610 -4.312  1.00 0.00 ? 15  ARG A CD   7  
ATOM 9528  N NE   . ARG A 1 15  ? 9.496   -16.381 -5.066  1.00 0.00 ? 15  ARG A NE   7  
ATOM 9529  C CZ   . ARG A 1 15  ? 10.814  -16.260 -4.899  1.00 0.00 ? 15  ARG A CZ   7  
ATOM 9530  N NH1  . ARG A 1 15  ? 11.318  -15.614 -3.855  1.00 0.00 ? 15  ARG A NH1  7  
ATOM 9531  N NH2  . ARG A 1 15  ? 11.658  -16.759 -5.785  1.00 0.00 ? 15  ARG A NH2  7  
ATOM 9532  H H    . ARG A 1 15  ? 3.946   -13.851 -3.236  1.00 0.00 ? 15  ARG A H    7  
ATOM 9533  H HA   . ARG A 1 15  ? 6.479   -15.286 -2.642  1.00 0.00 ? 15  ARG A HA   7  
ATOM 9534  H HB2  . ARG A 1 15  ? 5.430   -14.259 -5.168  1.00 0.00 ? 15  ARG A HB2  7  
ATOM 9535  H HB3  . ARG A 1 15  ? 6.892   -13.390 -4.789  1.00 0.00 ? 15  ARG A HB3  7  
ATOM 9536  H HG2  . ARG A 1 15  ? 6.596   -16.425 -4.913  1.00 0.00 ? 15  ARG A HG2  7  
ATOM 9537  H HG3  . ARG A 1 15  ? 7.349   -15.384 -6.124  1.00 0.00 ? 15  ARG A HG3  7  
ATOM 9538  H HD2  . ARG A 1 15  ? 8.894   -14.602 -4.161  1.00 0.00 ? 15  ARG A HD2  7  
ATOM 9539  H HD3  . ARG A 1 15  ? 8.358   -16.080 -3.339  1.00 0.00 ? 15  ARG A HD3  7  
ATOM 9540  H HE   . ARG A 1 15  ? 9.124   -16.986 -5.803  1.00 0.00 ? 15  ARG A HE   7  
ATOM 9541  H HH11 . ARG A 1 15  ? 10.765  -15.415 -3.024  1.00 0.00 ? 15  ARG A HH11 7  
ATOM 9542  H HH12 . ARG A 1 15  ? 12.301  -15.353 -3.845  1.00 0.00 ? 15  ARG A HH12 7  
ATOM 9543  H HH21 . ARG A 1 15  ? 11.328  -17.277 -6.599  1.00 0.00 ? 15  ARG A HH21 7  
ATOM 9544  H HH22 . ARG A 1 15  ? 12.654  -16.706 -5.648  1.00 0.00 ? 15  ARG A HH22 7  
ATOM 9545  N N    . GLU A 1 16  ? 7.523   -12.576 -2.476  1.00 0.00 ? 16  GLU A N    7  
ATOM 9546  C CA   . GLU A 1 16  ? 8.017   -11.442 -1.707  1.00 0.00 ? 16  GLU A CA   7  
ATOM 9547  C C    . GLU A 1 16  ? 8.361   -10.313 -2.661  1.00 0.00 ? 16  GLU A C    7  
ATOM 9548  O O    . GLU A 1 16  ? 8.363   -10.496 -3.881  1.00 0.00 ? 16  GLU A O    7  
ATOM 9549  C CB   . GLU A 1 16  ? 9.230   -11.846 -0.847  1.00 0.00 ? 16  GLU A CB   7  
ATOM 9550  C CG   . GLU A 1 16  ? 8.819   -12.843 0.239   1.00 0.00 ? 16  GLU A CG   7  
ATOM 9551  C CD   . GLU A 1 16  ? 9.928   -13.164 1.233   1.00 0.00 ? 16  GLU A CD   7  
ATOM 9552  O OE1  . GLU A 1 16  ? 10.975  -13.698 0.800   1.00 0.00 ? 16  GLU A OE1  7  
ATOM 9553  O OE2  . GLU A 1 16  ? 9.696   -12.985 2.454   1.00 0.00 ? 16  GLU A OE2  7  
ATOM 9554  H H    . GLU A 1 16  ? 7.972   -12.724 -3.367  1.00 0.00 ? 16  GLU A H    7  
ATOM 9555  H HA   . GLU A 1 16  ? 7.225   -11.062 -1.064  1.00 0.00 ? 16  GLU A HA   7  
ATOM 9556  H HB2  . GLU A 1 16  ? 10.005  -12.280 -1.481  1.00 0.00 ? 16  GLU A HB2  7  
ATOM 9557  H HB3  . GLU A 1 16  ? 9.628   -10.953 -0.365  1.00 0.00 ? 16  GLU A HB3  7  
ATOM 9558  H HG2  . GLU A 1 16  ? 7.987   -12.410 0.779   1.00 0.00 ? 16  GLU A HG2  7  
ATOM 9559  H HG3  . GLU A 1 16  ? 8.487   -13.775 -0.217  1.00 0.00 ? 16  GLU A HG3  7  
ATOM 9560  N N    . VAL A 1 17  ? 8.643   -9.145  -2.104  1.00 0.00 ? 17  VAL A N    7  
ATOM 9561  C CA   . VAL A 1 17  ? 9.080   -7.968  -2.836  1.00 0.00 ? 17  VAL A CA   7  
ATOM 9562  C C    . VAL A 1 17  ? 10.063  -7.199  -1.946  1.00 0.00 ? 17  VAL A C    7  
ATOM 9563  O O    . VAL A 1 17  ? 10.059  -7.370  -0.721  1.00 0.00 ? 17  VAL A O    7  
ATOM 9564  C CB   . VAL A 1 17  ? 7.837   -7.152  -3.279  1.00 0.00 ? 17  VAL A CB   7  
ATOM 9565  C CG1  . VAL A 1 17  ? 6.934   -6.784  -2.093  1.00 0.00 ? 17  VAL A CG1  7  
ATOM 9566  C CG2  . VAL A 1 17  ? 8.182   -5.879  -4.061  1.00 0.00 ? 17  VAL A CG2  7  
ATOM 9567  H H    . VAL A 1 17  ? 8.605   -9.057  -1.096  1.00 0.00 ? 17  VAL A H    7  
ATOM 9568  H HA   . VAL A 1 17  ? 9.611   -8.306  -3.723  1.00 0.00 ? 17  VAL A HA   7  
ATOM 9569  H HB   . VAL A 1 17  ? 7.256   -7.787  -3.950  1.00 0.00 ? 17  VAL A HB   7  
ATOM 9570  H HG11 . VAL A 1 17  ? 6.531   -7.698  -1.657  1.00 0.00 ? 17  VAL A HG11 7  
ATOM 9571  H HG12 . VAL A 1 17  ? 7.498   -6.232  -1.341  1.00 0.00 ? 17  VAL A HG12 7  
ATOM 9572  H HG13 . VAL A 1 17  ? 6.101   -6.173  -2.434  1.00 0.00 ? 17  VAL A HG13 7  
ATOM 9573  H HG21 . VAL A 1 17  ? 7.281   -5.471  -4.519  1.00 0.00 ? 17  VAL A HG21 7  
ATOM 9574  H HG22 . VAL A 1 17  ? 8.606   -5.121  -3.403  1.00 0.00 ? 17  VAL A HG22 7  
ATOM 9575  H HG23 . VAL A 1 17  ? 8.887   -6.112  -4.857  1.00 0.00 ? 17  VAL A HG23 7  
ATOM 9576  N N    . ASP A 1 18  ? 10.894  -6.345  -2.542  1.00 0.00 ? 18  ASP A N    7  
ATOM 9577  C CA   . ASP A 1 18  ? 11.687  -5.349  -1.830  1.00 0.00 ? 18  ASP A CA   7  
ATOM 9578  C C    . ASP A 1 18  ? 10.740  -4.245  -1.402  1.00 0.00 ? 18  ASP A C    7  
ATOM 9579  O O    . ASP A 1 18  ? 10.491  -3.326  -2.180  1.00 0.00 ? 18  ASP A O    7  
ATOM 9580  C CB   . ASP A 1 18  ? 12.790  -4.735  -2.718  1.00 0.00 ? 18  ASP A CB   7  
ATOM 9581  C CG   . ASP A 1 18  ? 14.121  -5.453  -2.582  1.00 0.00 ? 18  ASP A CG   7  
ATOM 9582  O OD1  . ASP A 1 18  ? 14.134  -6.695  -2.438  1.00 0.00 ? 18  ASP A OD1  7  
ATOM 9583  O OD2  . ASP A 1 18  ? 15.168  -4.777  -2.595  1.00 0.00 ? 18  ASP A OD2  7  
ATOM 9584  H H    . ASP A 1 18  ? 10.845  -6.248  -3.545  1.00 0.00 ? 18  ASP A H    7  
ATOM 9585  H HA   . ASP A 1 18  ? 12.154  -5.794  -0.950  1.00 0.00 ? 18  ASP A HA   7  
ATOM 9586  H HB2  . ASP A 1 18  ? 12.472  -4.684  -3.770  1.00 0.00 ? 18  ASP A HB2  7  
ATOM 9587  H HB3  . ASP A 1 18  ? 12.985  -3.719  -2.369  1.00 0.00 ? 18  ASP A HB3  7  
ATOM 9588  N N    . THR A 1 19  ? 10.214  -4.286  -0.178  1.00 0.00 ? 19  THR A N    7  
ATOM 9589  C CA   . THR A 1 19  ? 9.325   -3.222  0.277   1.00 0.00 ? 19  THR A CA   7  
ATOM 9590  C C    . THR A 1 19  ? 10.045  -1.860  0.316   1.00 0.00 ? 19  THR A C    7  
ATOM 9591  O O    . THR A 1 19  ? 9.378   -0.826  0.305   1.00 0.00 ? 19  THR A O    7  
ATOM 9592  C CB   . THR A 1 19  ? 8.672   -3.598  1.618   1.00 0.00 ? 19  THR A CB   7  
ATOM 9593  O OG1  . THR A 1 19  ? 9.630   -4.005  2.575   1.00 0.00 ? 19  THR A OG1  7  
ATOM 9594  C CG2  . THR A 1 19  ? 7.667   -4.741  1.435   1.00 0.00 ? 19  THR A CG2  7  
ATOM 9595  H H    . THR A 1 19  ? 10.412  -5.055  0.452   1.00 0.00 ? 19  THR A H    7  
ATOM 9596  H HA   . THR A 1 19  ? 8.527   -3.132  -0.461  1.00 0.00 ? 19  THR A HA   7  
ATOM 9597  H HB   . THR A 1 19  ? 8.139   -2.728  2.002   1.00 0.00 ? 19  THR A HB   7  
ATOM 9598  H HG1  . THR A 1 19  ? 9.180   -4.020  3.438   1.00 0.00 ? 19  THR A HG1  7  
ATOM 9599  H HG21 . THR A 1 19  ? 8.175   -5.642  1.086   1.00 0.00 ? 19  THR A HG21 7  
ATOM 9600  H HG22 . THR A 1 19  ? 7.170   -4.951  2.382   1.00 0.00 ? 19  THR A HG22 7  
ATOM 9601  H HG23 . THR A 1 19  ? 6.915   -4.452  0.698   1.00 0.00 ? 19  THR A HG23 7  
ATOM 9602  N N    . LEU A 1 20  ? 11.385  -1.832  0.321   1.00 0.00 ? 20  LEU A N    7  
ATOM 9603  C CA   . LEU A 1 20  ? 12.188  -0.623  0.407   1.00 0.00 ? 20  LEU A CA   7  
ATOM 9604  C C    . LEU A 1 20  ? 12.484  -0.023  -0.960  1.00 0.00 ? 20  LEU A C    7  
ATOM 9605  O O    . LEU A 1 20  ? 12.365  1.190   -1.109  1.00 0.00 ? 20  LEU A O    7  
ATOM 9606  C CB   . LEU A 1 20  ? 13.504  -0.948  1.121   1.00 0.00 ? 20  LEU A CB   7  
ATOM 9607  C CG   . LEU A 1 20  ? 13.477  -0.769  2.645   1.00 0.00 ? 20  LEU A CG   7  
ATOM 9608  C CD1  . LEU A 1 20  ? 13.221  0.680   3.079   1.00 0.00 ? 20  LEU A CD1  7  
ATOM 9609  C CD2  . LEU A 1 20  ? 12.528  -1.745  3.345   1.00 0.00 ? 20  LEU A CD2  7  
ATOM 9610  H H    . LEU A 1 20  ? 11.892  -2.700  0.296   1.00 0.00 ? 20  LEU A H    7  
ATOM 9611  H HA   . LEU A 1 20  ? 11.636  0.129   0.966   1.00 0.00 ? 20  LEU A HA   7  
ATOM 9612  H HB2  . LEU A 1 20  ? 13.817  -1.965  0.879   1.00 0.00 ? 20  LEU A HB2  7  
ATOM 9613  H HB3  . LEU A 1 20  ? 14.272  -0.296  0.718   1.00 0.00 ? 20  LEU A HB3  7  
ATOM 9614  H HG   . LEU A 1 20  ? 14.467  -1.019  2.996   1.00 0.00 ? 20  LEU A HG   7  
ATOM 9615  H HD11 . LEU A 1 20  ? 13.936  1.336   2.585   1.00 0.00 ? 20  LEU A HD11 7  
ATOM 9616  H HD12 . LEU A 1 20  ? 12.219  1.004   2.808   1.00 0.00 ? 20  LEU A HD12 7  
ATOM 9617  H HD13 . LEU A 1 20  ? 13.347  0.772   4.157   1.00 0.00 ? 20  LEU A HD13 7  
ATOM 9618  H HD21 . LEU A 1 20  ? 12.519  -1.531  4.412   1.00 0.00 ? 20  LEU A HD21 7  
ATOM 9619  H HD22 . LEU A 1 20  ? 11.520  -1.659  2.947   1.00 0.00 ? 20  LEU A HD22 7  
ATOM 9620  H HD23 . LEU A 1 20  ? 12.884  -2.763  3.181   1.00 0.00 ? 20  LEU A HD23 7  
ATOM 9621  N N    . GLU A 1 21  ? 12.858  -0.837  -1.952  1.00 0.00 ? 21  GLU A N    7  
ATOM 9622  C CA   . GLU A 1 21  ? 12.948  -0.337  -3.321  1.00 0.00 ? 21  GLU A CA   7  
ATOM 9623  C C    . GLU A 1 21  ? 11.552  0.107   -3.757  1.00 0.00 ? 21  GLU A C    7  
ATOM 9624  O O    . GLU A 1 21  ? 11.406  1.130   -4.422  1.00 0.00 ? 21  GLU A O    7  
ATOM 9625  C CB   . GLU A 1 21  ? 13.492  -1.423  -4.268  1.00 0.00 ? 21  GLU A CB   7  
ATOM 9626  C CG   . GLU A 1 21  ? 13.476  -0.950  -5.721  1.00 0.00 ? 21  GLU A CG   7  
ATOM 9627  C CD   . GLU A 1 21  ? 13.976  -1.976  -6.730  1.00 0.00 ? 21  GLU A CD   7  
ATOM 9628  O OE1  . GLU A 1 21  ? 13.140  -2.734  -7.259  1.00 0.00 ? 21  GLU A OE1  7  
ATOM 9629  O OE2  . GLU A 1 21  ? 15.147  -1.869  -7.176  1.00 0.00 ? 21  GLU A OE2  7  
ATOM 9630  H H    . GLU A 1 21  ? 12.954  -1.832  -1.810  1.00 0.00 ? 21  GLU A H    7  
ATOM 9631  H HA   . GLU A 1 21  ? 13.616  0.533   -3.334  1.00 0.00 ? 21  GLU A HA   7  
ATOM 9632  H HB2  . GLU A 1 21  ? 14.508  -1.685  -3.979  1.00 0.00 ? 21  GLU A HB2  7  
ATOM 9633  H HB3  . GLU A 1 21  ? 12.876  -2.313  -4.204  1.00 0.00 ? 21  GLU A HB3  7  
ATOM 9634  H HG2  . GLU A 1 21  ? 12.457  -0.706  -6.006  1.00 0.00 ? 21  GLU A HG2  7  
ATOM 9635  H HG3  . GLU A 1 21  ? 14.060  -0.041  -5.801  1.00 0.00 ? 21  GLU A HG3  7  
ATOM 9636  N N    . LEU A 1 22  ? 10.519  -0.633  -3.346  1.00 0.00 ? 22  LEU A N    7  
ATOM 9637  C CA   . LEU A 1 22  ? 9.141   -0.292  -3.620  1.00 0.00 ? 22  LEU A CA   7  
ATOM 9638  C C    . LEU A 1 22  ? 8.809   1.106   -3.100  1.00 0.00 ? 22  LEU A C    7  
ATOM 9639  O O    . LEU A 1 22  ? 8.350   1.918   -3.894  1.00 0.00 ? 22  LEU A O    7  
ATOM 9640  C CB   . LEU A 1 22  ? 8.237   -1.384  -3.050  1.00 0.00 ? 22  LEU A CB   7  
ATOM 9641  C CG   . LEU A 1 22  ? 6.733   -1.134  -3.188  1.00 0.00 ? 22  LEU A CG   7  
ATOM 9642  C CD1  . LEU A 1 22  ? 6.296   -0.998  -4.637  1.00 0.00 ? 22  LEU A CD1  7  
ATOM 9643  C CD2  . LEU A 1 22  ? 5.989   -2.300  -2.531  1.00 0.00 ? 22  LEU A CD2  7  
ATOM 9644  H H    . LEU A 1 22  ? 10.704  -1.503  -2.857  1.00 0.00 ? 22  LEU A H    7  
ATOM 9645  H HA   . LEU A 1 22  ? 9.022   -0.282  -4.704  1.00 0.00 ? 22  LEU A HA   7  
ATOM 9646  H HB2  . LEU A 1 22  ? 8.485   -2.321  -3.547  1.00 0.00 ? 22  LEU A HB2  7  
ATOM 9647  H HB3  . LEU A 1 22  ? 8.465   -1.488  -1.996  1.00 0.00 ? 22  LEU A HB3  7  
ATOM 9648  H HG   . LEU A 1 22  ? 6.469   -0.212  -2.676  1.00 0.00 ? 22  LEU A HG   7  
ATOM 9649  H HD11 . LEU A 1 22  ? 6.751   -0.114  -5.080  1.00 0.00 ? 22  LEU A HD11 7  
ATOM 9650  H HD12 . LEU A 1 22  ? 6.591   -1.878  -5.206  1.00 0.00 ? 22  LEU A HD12 7  
ATOM 9651  H HD13 . LEU A 1 22  ? 5.220   -0.874  -4.669  1.00 0.00 ? 22  LEU A HD13 7  
ATOM 9652  H HD21 . LEU A 1 22  ? 6.173   -3.223  -3.081  1.00 0.00 ? 22  LEU A HD21 7  
ATOM 9653  H HD22 . LEU A 1 22  ? 6.354   -2.447  -1.519  1.00 0.00 ? 22  LEU A HD22 7  
ATOM 9654  H HD23 . LEU A 1 22  ? 4.925   -2.065  -2.496  1.00 0.00 ? 22  LEU A HD23 7  
ATOM 9655  N N    . THR A 1 23  ? 9.038   1.443   -1.820  1.00 0.00 ? 23  THR A N    7  
ATOM 9656  C CA   . THR A 1 23  ? 8.766   2.810   -1.372  1.00 0.00 ? 23  THR A CA   7  
ATOM 9657  C C    . THR A 1 23  ? 9.603   3.795   -2.190  1.00 0.00 ? 23  THR A C    7  
ATOM 9658  O O    . THR A 1 23  ? 9.093   4.841   -2.575  1.00 0.00 ? 23  THR A O    7  
ATOM 9659  C CB   . THR A 1 23  ? 9.041   2.990   0.128   1.00 0.00 ? 23  THR A CB   7  
ATOM 9660  O OG1  . THR A 1 23  ? 10.311  2.475   0.448   1.00 0.00 ? 23  THR A OG1  7  
ATOM 9661  C CG2  . THR A 1 23  ? 8.004   2.244   0.954   1.00 0.00 ? 23  THR A CG2  7  
ATOM 9662  H H    . THR A 1 23  ? 9.549   0.855   -1.167  1.00 0.00 ? 23  THR A H    7  
ATOM 9663  H HA   . THR A 1 23  ? 7.705   3.023   -1.550  1.00 0.00 ? 23  THR A HA   7  
ATOM 9664  H HB   . THR A 1 23  ? 8.988   4.051   0.379   1.00 0.00 ? 23  THR A HB   7  
ATOM 9665  H HG1  . THR A 1 23  ? 10.595  2.779   1.325   1.00 0.00 ? 23  THR A HG1  7  
ATOM 9666  H HG21 . THR A 1 23  ? 8.011   2.598   1.981   1.00 0.00 ? 23  THR A HG21 7  
ATOM 9667  H HG22 . THR A 1 23  ? 7.015   2.358   0.508   1.00 0.00 ? 23  THR A HG22 7  
ATOM 9668  H HG23 . THR A 1 23  ? 8.275   1.197   0.973   1.00 0.00 ? 23  THR A HG23 7  
ATOM 9669  N N    . ARG A 1 24  ? 10.872  3.475   -2.449  1.00 0.00 ? 24  ARG A N    7  
ATOM 9670  C CA   . ARG A 1 24  ? 11.786  4.278   -3.280  1.00 0.00 ? 24  ARG A CA   7  
ATOM 9671  C C    . ARG A 1 24  ? 11.128  4.678   -4.606  1.00 0.00 ? 24  ARG A C    7  
ATOM 9672  O O    . ARG A 1 24  ? 10.958  5.873   -4.856  1.00 0.00 ? 24  ARG A O    7  
ATOM 9673  C CB   . ARG A 1 24  ? 13.121  3.546   -3.526  1.00 0.00 ? 24  ARG A CB   7  
ATOM 9674  C CG   . ARG A 1 24  ? 14.340  4.468   -3.391  1.00 0.00 ? 24  ARG A CG   7  
ATOM 9675  C CD   . ARG A 1 24  ? 15.018  4.236   -2.037  1.00 0.00 ? 24  ARG A CD   7  
ATOM 9676  N NE   . ARG A 1 24  ? 16.186  5.125   -1.860  1.00 0.00 ? 24  ARG A NE   7  
ATOM 9677  C CZ   . ARG A 1 24  ? 17.475  4.774   -2.012  1.00 0.00 ? 24  ARG A CZ   7  
ATOM 9678  N NH1  . ARG A 1 24  ? 17.816  3.514   -2.254  1.00 0.00 ? 24  ARG A NH1  7  
ATOM 9679  N NH2  . ARG A 1 24  ? 18.437  5.686   -1.927  1.00 0.00 ? 24  ARG A NH2  7  
ATOM 9680  H H    . ARG A 1 24  ? 11.158  2.612   -1.987  1.00 0.00 ? 24  ARG A H    7  
ATOM 9681  H HA   . ARG A 1 24  ? 12.011  5.191   -2.738  1.00 0.00 ? 24  ARG A HA   7  
ATOM 9682  H HB2  . ARG A 1 24  ? 13.232  2.711   -2.841  1.00 0.00 ? 24  ARG A HB2  7  
ATOM 9683  H HB3  . ARG A 1 24  ? 13.128  3.119   -4.526  1.00 0.00 ? 24  ARG A HB3  7  
ATOM 9684  H HG2  . ARG A 1 24  ? 15.038  4.222   -4.183  1.00 0.00 ? 24  ARG A HG2  7  
ATOM 9685  H HG3  . ARG A 1 24  ? 14.055  5.517   -3.508  1.00 0.00 ? 24  ARG A HG3  7  
ATOM 9686  H HD2  . ARG A 1 24  ? 14.281  4.395   -1.253  1.00 0.00 ? 24  ARG A HD2  7  
ATOM 9687  H HD3  . ARG A 1 24  ? 15.318  3.193   -1.962  1.00 0.00 ? 24  ARG A HD3  7  
ATOM 9688  H HE   . ARG A 1 24  ? 15.953  6.096   -1.682  1.00 0.00 ? 24  ARG A HE   7  
ATOM 9689  H HH11 . ARG A 1 24  ? 17.109  2.804   -2.425  1.00 0.00 ? 24  ARG A HH11 7  
ATOM 9690  H HH12 . ARG A 1 24  ? 18.770  3.224   -2.468  1.00 0.00 ? 24  ARG A HH12 7  
ATOM 9691  H HH21 . ARG A 1 24  ? 18.245  6.666   -1.716  1.00 0.00 ? 24  ARG A HH21 7  
ATOM 9692  H HH22 . ARG A 1 24  ? 19.396  5.454   -2.189  1.00 0.00 ? 24  ARG A HH22 7  
ATOM 9693  N N    . GLN A 1 25  ? 10.743  3.693   -5.420  1.00 0.00 ? 25  GLN A N    7  
ATOM 9694  C CA   . GLN A 1 25  ? 10.147  3.860   -6.743  1.00 0.00 ? 25  GLN A CA   7  
ATOM 9695  C C    . GLN A 1 25  ? 8.860   4.681   -6.652  1.00 0.00 ? 25  GLN A C    7  
ATOM 9696  O O    . GLN A 1 25  ? 8.597   5.523   -7.512  1.00 0.00 ? 25  GLN A O    7  
ATOM 9697  C CB   . GLN A 1 25  ? 9.837   2.472   -7.333  1.00 0.00 ? 25  GLN A CB   7  
ATOM 9698  C CG   . GLN A 1 25  ? 11.077  1.704   -7.808  1.00 0.00 ? 25  GLN A CG   7  
ATOM 9699  C CD   . GLN A 1 25  ? 11.422  1.977   -9.272  1.00 0.00 ? 25  GLN A CD   7  
ATOM 9700  O OE1  . GLN A 1 25  ? 11.490  3.121   -9.721  1.00 0.00 ? 25  GLN A OE1  7  
ATOM 9701  N NE2  . GLN A 1 25  ? 11.654  0.948   -10.067 1.00 0.00 ? 25  GLN A NE2  7  
ATOM 9702  H H    . GLN A 1 25  ? 10.914  2.745   -5.094  1.00 0.00 ? 25  GLN A H    7  
ATOM 9703  H HA   . GLN A 1 25  ? 10.851  4.386   -7.391  1.00 0.00 ? 25  GLN A HA   7  
ATOM 9704  H HB2  . GLN A 1 25  ? 9.323   1.880   -6.573  1.00 0.00 ? 25  GLN A HB2  7  
ATOM 9705  H HB3  . GLN A 1 25  ? 9.171   2.587   -8.184  1.00 0.00 ? 25  GLN A HB3  7  
ATOM 9706  H HG2  . GLN A 1 25  ? 11.920  1.972   -7.187  1.00 0.00 ? 25  GLN A HG2  7  
ATOM 9707  H HG3  . GLN A 1 25  ? 10.883  0.641   -7.680  1.00 0.00 ? 25  GLN A HG3  7  
ATOM 9708  H HE21 . GLN A 1 25  ? 11.742  0.024   -9.665  1.00 0.00 ? 25  GLN A HE21 7  
ATOM 9709  H HE22 . GLN A 1 25  ? 11.842  1.072   -11.052 1.00 0.00 ? 25  GLN A HE22 7  
ATOM 9710  N N    . VAL A 1 26  ? 8.057   4.431   -5.618  1.00 0.00 ? 26  VAL A N    7  
ATOM 9711  C CA   . VAL A 1 26  ? 6.786   5.091   -5.356  1.00 0.00 ? 26  VAL A CA   7  
ATOM 9712  C C    . VAL A 1 26  ? 7.039   6.577   -5.088  1.00 0.00 ? 26  VAL A C    7  
ATOM 9713  O O    . VAL A 1 26  ? 6.466   7.425   -5.774  1.00 0.00 ? 26  VAL A O    7  
ATOM 9714  C CB   . VAL A 1 26  ? 6.107   4.352   -4.183  1.00 0.00 ? 26  VAL A CB   7  
ATOM 9715  C CG1  . VAL A 1 26  ? 4.895   5.081   -3.601  1.00 0.00 ? 26  VAL A CG1  7  
ATOM 9716  C CG2  . VAL A 1 26  ? 5.685   2.948   -4.636  1.00 0.00 ? 26  VAL A CG2  7  
ATOM 9717  H H    . VAL A 1 26  ? 8.329   3.694   -4.974  1.00 0.00 ? 26  VAL A H    7  
ATOM 9718  H HA   . VAL A 1 26  ? 6.153   4.999   -6.242  1.00 0.00 ? 26  VAL A HA   7  
ATOM 9719  H HB   . VAL A 1 26  ? 6.824   4.243   -3.373  1.00 0.00 ? 26  VAL A HB   7  
ATOM 9720  H HG11 . VAL A 1 26  ? 5.195   6.028   -3.156  1.00 0.00 ? 26  VAL A HG11 7  
ATOM 9721  H HG12 . VAL A 1 26  ? 4.182   5.269   -4.395  1.00 0.00 ? 26  VAL A HG12 7  
ATOM 9722  H HG13 . VAL A 1 26  ? 4.415   4.476   -2.833  1.00 0.00 ? 26  VAL A HG13 7  
ATOM 9723  H HG21 . VAL A 1 26  ? 4.761   2.973   -5.205  1.00 0.00 ? 26  VAL A HG21 7  
ATOM 9724  H HG22 . VAL A 1 26  ? 6.441   2.505   -5.271  1.00 0.00 ? 26  VAL A HG22 7  
ATOM 9725  H HG23 . VAL A 1 26  ? 5.593   2.308   -3.762  1.00 0.00 ? 26  VAL A HG23 7  
ATOM 9726  N N    . LYS A 1 27  ? 7.919   6.901   -4.131  1.00 0.00 ? 27  LYS A N    7  
ATOM 9727  C CA   . LYS A 1 27  ? 8.285   8.267   -3.775  1.00 0.00 ? 27  LYS A CA   7  
ATOM 9728  C C    . LYS A 1 27  ? 8.746   9.044   -5.005  1.00 0.00 ? 27  LYS A C    7  
ATOM 9729  O O    . LYS A 1 27  ? 8.347   10.203  -5.154  1.00 0.00 ? 27  LYS A O    7  
ATOM 9730  C CB   . LYS A 1 27  ? 9.370   8.232   -2.683  1.00 0.00 ? 27  LYS A CB   7  
ATOM 9731  C CG   . LYS A 1 27  ? 8.793   7.814   -1.323  1.00 0.00 ? 27  LYS A CG   7  
ATOM 9732  C CD   . LYS A 1 27  ? 9.852   7.603   -0.231  1.00 0.00 ? 27  LYS A CD   7  
ATOM 9733  C CE   . LYS A 1 27  ? 10.669  6.318   -0.377  1.00 0.00 ? 27  LYS A CE   7  
ATOM 9734  N NZ   . LYS A 1 27  ? 11.441  6.003   0.844   1.00 0.00 ? 27  LYS A NZ   7  
ATOM 9735  H H    . LYS A 1 27  ? 8.393   6.167   -3.608  1.00 0.00 ? 27  LYS A H    7  
ATOM 9736  H HA   . LYS A 1 27  ? 7.401   8.770   -3.383  1.00 0.00 ? 27  LYS A HA   7  
ATOM 9737  H HB2  . LYS A 1 27  ? 10.153  7.535   -2.976  1.00 0.00 ? 27  LYS A HB2  7  
ATOM 9738  H HB3  . LYS A 1 27  ? 9.810   9.225   -2.580  1.00 0.00 ? 27  LYS A HB3  7  
ATOM 9739  H HG2  . LYS A 1 27  ? 8.117   8.603   -0.998  1.00 0.00 ? 27  LYS A HG2  7  
ATOM 9740  H HG3  . LYS A 1 27  ? 8.201   6.906   -1.416  1.00 0.00 ? 27  LYS A HG3  7  
ATOM 9741  H HD2  . LYS A 1 27  ? 10.530  8.453   -0.225  1.00 0.00 ? 27  LYS A HD2  7  
ATOM 9742  H HD3  . LYS A 1 27  ? 9.325   7.564   0.719   1.00 0.00 ? 27  LYS A HD3  7  
ATOM 9743  H HE2  . LYS A 1 27  ? 9.986   5.498   -0.577  1.00 0.00 ? 27  LYS A HE2  7  
ATOM 9744  H HE3  . LYS A 1 27  ? 11.351  6.426   -1.224  1.00 0.00 ? 27  LYS A HE3  7  
ATOM 9745  H HZ1  . LYS A 1 27  ? 12.079  6.764   1.076   1.00 0.00 ? 27  LYS A HZ1  7  
ATOM 9746  H HZ2  . LYS A 1 27  ? 10.837  5.856   1.643   1.00 0.00 ? 27  LYS A HZ2  7  
ATOM 9747  H HZ3  . LYS A 1 27  ? 12.012  5.176   0.727   1.00 0.00 ? 27  LYS A HZ3  7  
ATOM 9748  N N    . GLU A 1 28  ? 9.522   8.410   -5.889  1.00 0.00 ? 28  GLU A N    7  
ATOM 9749  C CA   . GLU A 1 28  ? 9.947   9.015   -7.148  1.00 0.00 ? 28  GLU A CA   7  
ATOM 9750  C C    . GLU A 1 28  ? 8.745   9.281   -8.053  1.00 0.00 ? 28  GLU A C    7  
ATOM 9751  O O    . GLU A 1 28  ? 8.533   10.427  -8.432  1.00 0.00 ? 28  GLU A O    7  
ATOM 9752  C CB   . GLU A 1 28  ? 11.005  8.158   -7.860  1.00 0.00 ? 28  GLU A CB   7  
ATOM 9753  C CG   . GLU A 1 28  ? 12.301  8.144   -7.044  1.00 0.00 ? 28  GLU A CG   7  
ATOM 9754  C CD   . GLU A 1 28  ? 13.464  7.392   -7.678  1.00 0.00 ? 28  GLU A CD   7  
ATOM 9755  O OE1  . GLU A 1 28  ? 13.267  6.407   -8.428  1.00 0.00 ? 28  GLU A OE1  7  
ATOM 9756  O OE2  . GLU A 1 28  ? 14.617  7.713   -7.312  1.00 0.00 ? 28  GLU A OE2  7  
ATOM 9757  H H    . GLU A 1 28  ? 9.818   7.462   -5.683  1.00 0.00 ? 28  GLU A H    7  
ATOM 9758  H HA   . GLU A 1 28  ? 10.398  9.983   -6.926  1.00 0.00 ? 28  GLU A HA   7  
ATOM 9759  H HB2  . GLU A 1 28  ? 10.638  7.141   -7.985  1.00 0.00 ? 28  GLU A HB2  7  
ATOM 9760  H HB3  . GLU A 1 28  ? 11.216  8.587   -8.840  1.00 0.00 ? 28  GLU A HB3  7  
ATOM 9761  H HG2  . GLU A 1 28  ? 12.616  9.167   -6.852  1.00 0.00 ? 28  GLU A HG2  7  
ATOM 9762  H HG3  . GLU A 1 28  ? 12.104  7.674   -6.089  1.00 0.00 ? 28  GLU A HG3  7  
ATOM 9763  N N    . LYS A 1 29  ? 7.927   8.273   -8.383  1.00 0.00 ? 29  LYS A N    7  
ATOM 9764  C CA   . LYS A 1 29  ? 6.806   8.458   -9.313  1.00 0.00 ? 29  LYS A CA   7  
ATOM 9765  C C    . LYS A 1 29  ? 5.807   9.507   -8.822  1.00 0.00 ? 29  LYS A C    7  
ATOM 9766  O O    . LYS A 1 29  ? 5.156   10.162  -9.635  1.00 0.00 ? 29  LYS A O    7  
ATOM 9767  C CB   . LYS A 1 29  ? 6.109   7.151   -9.606  1.00 0.00 ? 29  LYS A CB   7  
ATOM 9768  C CG   . LYS A 1 29  ? 5.339   7.263   -10.937 1.00 0.00 ? 29  LYS A CG   7  
ATOM 9769  C CD   . LYS A 1 29  ? 4.959   5.849   -11.323 1.00 0.00 ? 29  LYS A CD   7  
ATOM 9770  C CE   . LYS A 1 29  ? 3.948   5.766   -12.467 1.00 0.00 ? 29  LYS A CE   7  
ATOM 9771  N NZ   . LYS A 1 29  ? 4.584   5.861   -13.796 1.00 0.00 ? 29  LYS A NZ   7  
ATOM 9772  H H    . LYS A 1 29  ? 8.117   7.350   -8.008  1.00 0.00 ? 29  LYS A H    7  
ATOM 9773  H HA   . LYS A 1 29  ? 7.194   8.739   -10.282 1.00 0.00 ? 29  LYS A HA   7  
ATOM 9774  H HB2  . LYS A 1 29  ? 6.840   6.357   -9.690  1.00 0.00 ? 29  LYS A HB2  7  
ATOM 9775  H HB3  . LYS A 1 29  ? 5.443   6.917   -8.785  1.00 0.00 ? 29  LYS A HB3  7  
ATOM 9776  H HG2  . LYS A 1 29  ? 4.438   7.858   -10.790 1.00 0.00 ? 29  LYS A HG2  7  
ATOM 9777  H HG3  . LYS A 1 29  ? 5.948   7.701   -11.729 1.00 0.00 ? 29  LYS A HG3  7  
ATOM 9778  H HD2  . LYS A 1 29  ? 5.846   5.264   -11.564 1.00 0.00 ? 29  LYS A HD2  7  
ATOM 9779  H HD3  . LYS A 1 29  ? 4.530   5.456   -10.417 1.00 0.00 ? 29  LYS A HD3  7  
ATOM 9780  H HE2  . LYS A 1 29  ? 3.438   4.802   -12.406 1.00 0.00 ? 29  LYS A HE2  7  
ATOM 9781  H HE3  . LYS A 1 29  ? 3.207   6.552   -12.349 1.00 0.00 ? 29  LYS A HE3  7  
ATOM 9782  H HZ1  . LYS A 1 29  ? 3.946   5.484   -14.495 1.00 0.00 ? 29  LYS A HZ1  7  
ATOM 9783  H HZ2  . LYS A 1 29  ? 4.807   6.812   -14.072 1.00 0.00 ? 29  LYS A HZ2  7  
ATOM 9784  H HZ3  . LYS A 1 29  ? 5.416   5.278   -13.830 1.00 0.00 ? 29  LYS A HZ3  7  
ATOM 9785  N N    . LEU A 1 30  ? 5.647   9.652   -7.507  1.00 0.00 ? 30  LEU A N    7  
ATOM 9786  C CA   . LEU A 1 30  ? 4.868   10.723  -6.908  1.00 0.00 ? 30  LEU A CA   7  
ATOM 9787  C C    . LEU A 1 30  ? 5.549   12.056  -7.200  1.00 0.00 ? 30  LEU A C    7  
ATOM 9788  O O    . LEU A 1 30  ? 4.928   12.920  -7.817  1.00 0.00 ? 30  LEU A O    7  
ATOM 9789  C CB   . LEU A 1 30  ? 4.704   10.491  -5.398  1.00 0.00 ? 30  LEU A CB   7  
ATOM 9790  C CG   . LEU A 1 30  ? 3.740   9.339   -5.058  1.00 0.00 ? 30  LEU A CG   7  
ATOM 9791  C CD1  . LEU A 1 30  ? 3.884   8.979   -3.581  1.00 0.00 ? 30  LEU A CD1  7  
ATOM 9792  C CD2  . LEU A 1 30  ? 2.279   9.722   -5.331  1.00 0.00 ? 30  LEU A CD2  7  
ATOM 9793  H H    . LEU A 1 30  ? 6.174   9.039   -6.895  1.00 0.00 ? 30  LEU A H    7  
ATOM 9794  H HA   . LEU A 1 30  ? 3.888   10.744  -7.380  1.00 0.00 ? 30  LEU A HA   7  
ATOM 9795  H HB2  . LEU A 1 30  ? 5.683   10.275  -4.969  1.00 0.00 ? 30  LEU A HB2  7  
ATOM 9796  H HB3  . LEU A 1 30  ? 4.340   11.414  -4.942  1.00 0.00 ? 30  LEU A HB3  7  
ATOM 9797  H HG   . LEU A 1 30  ? 3.997   8.465   -5.653  1.00 0.00 ? 30  LEU A HG   7  
ATOM 9798  H HD11 . LEU A 1 30  ? 4.911   8.671   -3.379  1.00 0.00 ? 30  LEU A HD11 7  
ATOM 9799  H HD12 . LEU A 1 30  ? 3.640   9.854   -2.989  1.00 0.00 ? 30  LEU A HD12 7  
ATOM 9800  H HD13 . LEU A 1 30  ? 3.211   8.158   -3.330  1.00 0.00 ? 30  LEU A HD13 7  
ATOM 9801  H HD21 . LEU A 1 30  ? 2.112   9.824   -6.401  1.00 0.00 ? 30  LEU A HD21 7  
ATOM 9802  H HD22 . LEU A 1 30  ? 1.614   8.944   -4.960  1.00 0.00 ? 30  LEU A HD22 7  
ATOM 9803  H HD23 . LEU A 1 30  ? 2.039   10.656  -4.822  1.00 0.00 ? 30  LEU A HD23 7  
ATOM 9804  N N    . ALA A 1 31  ? 6.817   12.214  -6.802  1.00 0.00 ? 31  ALA A N    7  
ATOM 9805  C CA   . ALA A 1 31  ? 7.611   13.427  -6.998  1.00 0.00 ? 31  ALA A CA   7  
ATOM 9806  C C    . ALA A 1 31  ? 7.748   13.824  -8.477  1.00 0.00 ? 31  ALA A C    7  
ATOM 9807  O O    . ALA A 1 31  ? 7.859   15.008  -8.800  1.00 0.00 ? 31  ALA A O    7  
ATOM 9808  C CB   . ALA A 1 31  ? 8.992   13.219  -6.370  1.00 0.00 ? 31  ALA A CB   7  
ATOM 9809  H H    . ALA A 1 31  ? 7.285   11.430  -6.358  1.00 0.00 ? 31  ALA A H    7  
ATOM 9810  H HA   . ALA A 1 31  ? 7.113   14.247  -6.478  1.00 0.00 ? 31  ALA A HA   7  
ATOM 9811  H HB1  . ALA A 1 31  ? 8.884   12.978  -5.313  1.00 0.00 ? 31  ALA A HB1  7  
ATOM 9812  H HB2  . ALA A 1 31  ? 9.520   12.411  -6.879  1.00 0.00 ? 31  ALA A HB2  7  
ATOM 9813  H HB3  . ALA A 1 31  ? 9.568   14.138  -6.466  1.00 0.00 ? 31  ALA A HB3  7  
ATOM 9814  N N    . LYS A 1 32  ? 7.661   12.856  -9.395  1.00 0.00 ? 32  LYS A N    7  
ATOM 9815  C CA   . LYS A 1 32  ? 7.696   13.051  -10.841 1.00 0.00 ? 32  LYS A CA   7  
ATOM 9816  C C    . LYS A 1 32  ? 6.697   14.117  -11.277 1.00 0.00 ? 32  LYS A C    7  
ATOM 9817  O O    . LYS A 1 32  ? 6.988   14.857  -12.218 1.00 0.00 ? 32  LYS A O    7  
ATOM 9818  C CB   . LYS A 1 32  ? 7.396   11.716  -11.550 1.00 0.00 ? 32  LYS A CB   7  
ATOM 9819  C CG   . LYS A 1 32  ? 8.132   11.570  -12.888 1.00 0.00 ? 32  LYS A CG   7  
ATOM 9820  C CD   . LYS A 1 32  ? 7.601   10.389  -13.723 1.00 0.00 ? 32  LYS A CD   7  
ATOM 9821  C CE   . LYS A 1 32  ? 6.674   10.876  -14.848 1.00 0.00 ? 32  LYS A CE   7  
ATOM 9822  N NZ   . LYS A 1 32  ? 7.424   11.323  -16.041 1.00 0.00 ? 32  LYS A NZ   7  
ATOM 9823  H H    . LYS A 1 32  ? 7.673   11.904  -9.046  1.00 0.00 ? 32  LYS A H    7  
ATOM 9824  H HA   . LYS A 1 32  ? 8.704   13.380  -11.095 1.00 0.00 ? 32  LYS A HA   7  
ATOM 9825  H HB2  . LYS A 1 32  ? 7.711   10.888  -10.918 1.00 0.00 ? 32  LYS A HB2  7  
ATOM 9826  H HB3  . LYS A 1 32  ? 6.321   11.623  -11.709 1.00 0.00 ? 32  LYS A HB3  7  
ATOM 9827  H HG2  . LYS A 1 32  ? 8.053   12.492  -13.459 1.00 0.00 ? 32  LYS A HG2  7  
ATOM 9828  H HG3  . LYS A 1 32  ? 9.185   11.405  -12.672 1.00 0.00 ? 32  LYS A HG3  7  
ATOM 9829  H HD2  . LYS A 1 32  ? 8.440   9.838   -14.152 1.00 0.00 ? 32  LYS A HD2  7  
ATOM 9830  H HD3  . LYS A 1 32  ? 7.055   9.699   -13.078 1.00 0.00 ? 32  LYS A HD3  7  
ATOM 9831  H HE2  . LYS A 1 32  ? 6.010   10.063  -15.137 1.00 0.00 ? 32  LYS A HE2  7  
ATOM 9832  H HE3  . LYS A 1 32  ? 6.067   11.703  -14.475 1.00 0.00 ? 32  LYS A HE3  7  
ATOM 9833  H HZ1  . LYS A 1 32  ? 7.737   10.534  -16.586 1.00 0.00 ? 32  LYS A HZ1  7  
ATOM 9834  H HZ2  . LYS A 1 32  ? 6.850   11.934  -16.620 1.00 0.00 ? 32  LYS A HZ2  7  
ATOM 9835  H HZ3  . LYS A 1 32  ? 8.263   11.835  -15.770 1.00 0.00 ? 32  LYS A HZ3  7  
ATOM 9836  N N    . ASN A 1 33  ? 5.535   14.168  -10.620 1.00 0.00 ? 33  ASN A N    7  
ATOM 9837  C CA   . ASN A 1 33  ? 4.437   15.093  -10.875 1.00 0.00 ? 33  ASN A CA   7  
ATOM 9838  C C    . ASN A 1 33  ? 4.029   15.837  -9.593  1.00 0.00 ? 33  ASN A C    7  
ATOM 9839  O O    . ASN A 1 33  ? 2.959   16.441  -9.553  1.00 0.00 ? 33  ASN A O    7  
ATOM 9840  C CB   . ASN A 1 33  ? 3.255   14.298  -11.456 1.00 0.00 ? 33  ASN A CB   7  
ATOM 9841  C CG   . ASN A 1 33  ? 3.549   13.715  -12.828 1.00 0.00 ? 33  ASN A CG   7  
ATOM 9842  O OD1  . ASN A 1 33  ? 3.903   14.428  -13.766 1.00 0.00 ? 33  ASN A OD1  7  
ATOM 9843  N ND2  . ASN A 1 33  ? 3.430   12.411  -12.991 1.00 0.00 ? 33  ASN A ND2  7  
ATOM 9844  H H    . ASN A 1 33  ? 5.388   13.531  -9.845  1.00 0.00 ? 33  ASN A H    7  
ATOM 9845  H HA   . ASN A 1 33  ? 4.751   15.843  -11.603 1.00 0.00 ? 33  ASN A HA   7  
ATOM 9846  H HB2  . ASN A 1 33  ? 2.970   13.511  -10.761 1.00 0.00 ? 33  ASN A HB2  7  
ATOM 9847  H HB3  . ASN A 1 33  ? 2.395   14.954  -11.564 1.00 0.00 ? 33  ASN A HB3  7  
ATOM 9848  H HD21 . ASN A 1 33  ? 3.144   11.798  -12.224 1.00 0.00 ? 33  ASN A HD21 7  
ATOM 9849  H HD22 . ASN A 1 33  ? 3.475   11.978  -13.907 1.00 0.00 ? 33  ASN A HD22 7  
ATOM 9850  N N    . GLY A 1 34  ? 4.836   15.748  -8.528  1.00 0.00 ? 34  GLY A N    7  
ATOM 9851  C CA   . GLY A 1 34  ? 4.530   16.204  -7.176  1.00 0.00 ? 34  GLY A CA   7  
ATOM 9852  C C    . GLY A 1 34  ? 3.101   15.864  -6.755  1.00 0.00 ? 34  GLY A C    7  
ATOM 9853  O O    . GLY A 1 34  ? 2.323   16.770  -6.455  1.00 0.00 ? 34  GLY A O    7  
ATOM 9854  H H    . GLY A 1 34  ? 5.747   15.332  -8.663  1.00 0.00 ? 34  GLY A H    7  
ATOM 9855  H HA2  . GLY A 1 34  ? 5.225   15.743  -6.475  1.00 0.00 ? 34  GLY A HA2  7  
ATOM 9856  H HA3  . GLY A 1 34  ? 4.668   17.283  -7.131  1.00 0.00 ? 34  GLY A HA3  7  
ATOM 9857  N N    . ILE A 1 35  ? 2.714   14.589  -6.790  1.00 0.00 ? 35  ILE A N    7  
ATOM 9858  C CA   . ILE A 1 35  ? 1.377   14.158  -6.379  1.00 0.00 ? 35  ILE A CA   7  
ATOM 9859  C C    . ILE A 1 35  ? 1.285   14.233  -4.849  1.00 0.00 ? 35  ILE A C    7  
ATOM 9860  O O    . ILE A 1 35  ? 2.225   13.857  -4.145  1.00 0.00 ? 35  ILE A O    7  
ATOM 9861  C CB   . ILE A 1 35  ? 1.071   12.758  -6.958  1.00 0.00 ? 35  ILE A CB   7  
ATOM 9862  C CG1  . ILE A 1 35  ? 0.886   12.905  -8.485  1.00 0.00 ? 35  ILE A CG1  7  
ATOM 9863  C CG2  . ILE A 1 35  ? -0.178  12.099  -6.336  1.00 0.00 ? 35  ILE A CG2  7  
ATOM 9864  C CD1  . ILE A 1 35  ? 0.794   11.580  -9.239  1.00 0.00 ? 35  ILE A CD1  7  
ATOM 9865  H H    . ILE A 1 35  ? 3.403   13.896  -7.057  1.00 0.00 ? 35  ILE A H    7  
ATOM 9866  H HA   . ILE A 1 35  ? 0.654   14.848  -6.806  1.00 0.00 ? 35  ILE A HA   7  
ATOM 9867  H HB   . ILE A 1 35  ? 1.933   12.122  -6.767  1.00 0.00 ? 35  ILE A HB   7  
ATOM 9868  H HG12 . ILE A 1 35  ? -0.013  13.484  -8.693  1.00 0.00 ? 35  ILE A HG12 7  
ATOM 9869  H HG13 . ILE A 1 35  ? 1.734   13.452  -8.892  1.00 0.00 ? 35  ILE A HG13 7  
ATOM 9870  H HG21 . ILE A 1 35  ? -1.064  12.710  -6.515  1.00 0.00 ? 35  ILE A HG21 7  
ATOM 9871  H HG22 . ILE A 1 35  ? -0.345  11.107  -6.755  1.00 0.00 ? 35  ILE A HG22 7  
ATOM 9872  H HG23 . ILE A 1 35  ? -0.047  11.968  -5.262  1.00 0.00 ? 35  ILE A HG23 7  
ATOM 9873  H HD11 . ILE A 1 35  ? -0.139  11.074  -8.997  1.00 0.00 ? 35  ILE A HD11 7  
ATOM 9874  H HD12 . ILE A 1 35  ? 0.812   11.784  -10.311 1.00 0.00 ? 35  ILE A HD12 7  
ATOM 9875  H HD13 . ILE A 1 35  ? 1.641   10.950  -8.971  1.00 0.00 ? 35  ILE A HD13 7  
ATOM 9876  N N    . CYS A 1 36  ? 0.128   14.674  -4.340  1.00 0.00 ? 36  CYS A N    7  
ATOM 9877  C CA   . CYS A 1 36  ? -0.177  14.676  -2.915  1.00 0.00 ? 36  CYS A CA   7  
ATOM 9878  C C    . CYS A 1 36  ? -0.187  13.243  -2.376  1.00 0.00 ? 36  CYS A C    7  
ATOM 9879  O O    . CYS A 1 36  ? -1.155  12.509  -2.595  1.00 0.00 ? 36  CYS A O    7  
ATOM 9880  C CB   . CYS A 1 36  ? -1.534  15.344  -2.643  1.00 0.00 ? 36  CYS A CB   7  
ATOM 9881  S SG   . CYS A 1 36  ? -1.350  17.137  -2.426  1.00 0.00 ? 36  CYS A SG   7  
ATOM 9882  H H    . CYS A 1 36  ? -0.612  14.929  -4.981  1.00 0.00 ? 36  CYS A H    7  
ATOM 9883  H HA   . CYS A 1 36  ? 0.600   15.239  -2.399  1.00 0.00 ? 36  CYS A HA   7  
ATOM 9884  H HB2  . CYS A 1 36  ? -2.234  15.115  -3.447  1.00 0.00 ? 36  CYS A HB2  7  
ATOM 9885  H HB3  . CYS A 1 36  ? -1.939  14.946  -1.713  1.00 0.00 ? 36  CYS A HB3  7  
ATOM 9886  H HG   . CYS A 1 36  ? -0.900  17.465  -3.649  1.00 0.00 ? 36  CYS A HG   7  
ATOM 9887  N N    . GLN A 1 37  ? 0.846   12.879  -1.611  1.00 0.00 ? 37  GLN A N    7  
ATOM 9888  C CA   . GLN A 1 37  ? 0.955   11.618  -0.882  1.00 0.00 ? 37  GLN A CA   7  
ATOM 9889  C C    . GLN A 1 37  ? -0.323  11.333  -0.087  1.00 0.00 ? 37  GLN A C    7  
ATOM 9890  O O    . GLN A 1 37  ? -0.791  10.199  -0.085  1.00 0.00 ? 37  GLN A O    7  
ATOM 9891  C CB   . GLN A 1 37  ? 2.153   11.650  0.083   1.00 0.00 ? 37  GLN A CB   7  
ATOM 9892  C CG   . GLN A 1 37  ? 3.517   11.394  -0.577  1.00 0.00 ? 37  GLN A CG   7  
ATOM 9893  C CD   . GLN A 1 37  ? 4.678   11.506  0.413   1.00 0.00 ? 37  GLN A CD   7  
ATOM 9894  O OE1  . GLN A 1 37  ? 4.512   11.336  1.617   1.00 0.00 ? 37  GLN A OE1  7  
ATOM 9895  N NE2  . GLN A 1 37  ? 5.890   11.742  -0.045  1.00 0.00 ? 37  GLN A NE2  7  
ATOM 9896  H H    . GLN A 1 37  ? 1.573   13.571  -1.491  1.00 0.00 ? 37  GLN A H    7  
ATOM 9897  H HA   . GLN A 1 37  ? 1.096   10.809  -1.601  1.00 0.00 ? 37  GLN A HA   7  
ATOM 9898  H HB2  . GLN A 1 37  ? 2.167   12.602  0.614   1.00 0.00 ? 37  GLN A HB2  7  
ATOM 9899  H HB3  . GLN A 1 37  ? 2.001   10.863  0.820   1.00 0.00 ? 37  GLN A HB3  7  
ATOM 9900  H HG2  . GLN A 1 37  ? 3.516   10.374  -0.953  1.00 0.00 ? 37  GLN A HG2  7  
ATOM 9901  H HG3  . GLN A 1 37  ? 3.667   12.091  -1.404  1.00 0.00 ? 37  GLN A HG3  7  
ATOM 9902  H HE21 . GLN A 1 37  ? 6.096   11.789  -1.041  1.00 0.00 ? 37  GLN A HE21 7  
ATOM 9903  H HE22 . GLN A 1 37  ? 6.622   11.897  0.630   1.00 0.00 ? 37  GLN A HE22 7  
ATOM 9904  N N    . ARG A 1 38  ? -0.911  12.347  0.563   1.00 0.00 ? 38  ARG A N    7  
ATOM 9905  C CA   . ARG A 1 38  ? -2.128  12.176  1.355   1.00 0.00 ? 38  ARG A CA   7  
ATOM 9906  C C    . ARG A 1 38  ? -3.294  11.667  0.513   1.00 0.00 ? 38  ARG A C    7  
ATOM 9907  O O    . ARG A 1 38  ? -4.044  10.816  0.980   1.00 0.00 ? 38  ARG A O    7  
ATOM 9908  C CB   . ARG A 1 38  ? -2.483  13.503  2.049   1.00 0.00 ? 38  ARG A CB   7  
ATOM 9909  C CG   . ARG A 1 38  ? -3.666  13.407  3.016   1.00 0.00 ? 38  ARG A CG   7  
ATOM 9910  C CD   . ARG A 1 38  ? -4.996  13.802  2.376   1.00 0.00 ? 38  ARG A CD   7  
ATOM 9911  N NE   . ARG A 1 38  ? -5.004  15.213  1.955   1.00 0.00 ? 38  ARG A NE   7  
ATOM 9912  C CZ   . ARG A 1 38  ? -5.177  16.272  2.758   1.00 0.00 ? 38  ARG A CZ   7  
ATOM 9913  N NH1  . ARG A 1 38  ? -5.656  16.135  3.996   1.00 0.00 ? 38  ARG A NH1  7  
ATOM 9914  N NH2  . ARG A 1 38  ? -4.843  17.475  2.317   1.00 0.00 ? 38  ARG A NH2  7  
ATOM 9915  H H    . ARG A 1 38  ? -0.446  13.245  0.543   1.00 0.00 ? 38  ARG A H    7  
ATOM 9916  H HA   . ARG A 1 38  ? -1.929  11.416  2.115   1.00 0.00 ? 38  ARG A HA   7  
ATOM 9917  H HB2  . ARG A 1 38  ? -1.653  13.816  2.662   1.00 0.00 ? 38  ARG A HB2  7  
ATOM 9918  H HB3  . ARG A 1 38  ? -2.658  14.278  1.298   1.00 0.00 ? 38  ARG A HB3  7  
ATOM 9919  H HG2  . ARG A 1 38  ? -3.737  12.395  3.409   1.00 0.00 ? 38  ARG A HG2  7  
ATOM 9920  H HG3  . ARG A 1 38  ? -3.483  14.075  3.860   1.00 0.00 ? 38  ARG A HG3  7  
ATOM 9921  H HD2  . ARG A 1 38  ? -5.205  13.163  1.522   1.00 0.00 ? 38  ARG A HD2  7  
ATOM 9922  H HD3  . ARG A 1 38  ? -5.751  13.634  3.129   1.00 0.00 ? 38  ARG A HD3  7  
ATOM 9923  H HE   . ARG A 1 38  ? -4.735  15.385  0.993   1.00 0.00 ? 38  ARG A HE   7  
ATOM 9924  H HH11 . ARG A 1 38  ? -5.936  15.230  4.376   1.00 0.00 ? 38  ARG A HH11 7  
ATOM 9925  H HH12 . ARG A 1 38  ? -5.822  16.934  4.591   1.00 0.00 ? 38  ARG A HH12 7  
ATOM 9926  H HH21 . ARG A 1 38  ? -4.447  17.628  1.386   1.00 0.00 ? 38  ARG A HH21 7  
ATOM 9927  H HH22 . ARG A 1 38  ? -4.857  18.281  2.941   1.00 0.00 ? 38  ARG A HH22 7  
ATOM 9928  N N    . ILE A 1 39  ? -3.516  12.231  -0.676  1.00 0.00 ? 39  ILE A N    7  
ATOM 9929  C CA   . ILE A 1 39  ? -4.667  11.874  -1.501  1.00 0.00 ? 39  ILE A CA   7  
ATOM 9930  C C    . ILE A 1 39  ? -4.414  10.504  -2.100  1.00 0.00 ? 39  ILE A C    7  
ATOM 9931  O O    . ILE A 1 39  ? -5.314  9.667   -2.032  1.00 0.00 ? 39  ILE A O    7  
ATOM 9932  C CB   . ILE A 1 39  ? -4.922  12.935  -2.588  1.00 0.00 ? 39  ILE A CB   7  
ATOM 9933  C CG1  . ILE A 1 39  ? -5.353  14.251  -1.899  1.00 0.00 ? 39  ILE A CG1  7  
ATOM 9934  C CG2  . ILE A 1 39  ? -5.946  12.412  -3.625  1.00 0.00 ? 39  ILE A CG2  7  
ATOM 9935  C CD1  . ILE A 1 39  ? -5.511  15.423  -2.868  1.00 0.00 ? 39  ILE A CD1  7  
ATOM 9936  H H    . ILE A 1 39  ? -2.806  12.819  -1.087  1.00 0.00 ? 39  ILE A H    7  
ATOM 9937  H HA   . ILE A 1 39  ? -5.553  11.785  -0.862  1.00 0.00 ? 39  ILE A HA   7  
ATOM 9938  H HB   . ILE A 1 39  ? -3.982  13.125  -3.105  1.00 0.00 ? 39  ILE A HB   7  
ATOM 9939  H HG12 . ILE A 1 39  ? -6.286  14.102  -1.357  1.00 0.00 ? 39  ILE A HG12 7  
ATOM 9940  H HG13 . ILE A 1 39  ? -4.592  14.543  -1.175  1.00 0.00 ? 39  ILE A HG13 7  
ATOM 9941  H HG21 . ILE A 1 39  ? -6.149  13.169  -4.378  1.00 0.00 ? 39  ILE A HG21 7  
ATOM 9942  H HG22 . ILE A 1 39  ? -5.558  11.531  -4.149  1.00 0.00 ? 39  ILE A HG22 7  
ATOM 9943  H HG23 . ILE A 1 39  ? -6.875  12.115  -3.146  1.00 0.00 ? 39  ILE A HG23 7  
ATOM 9944  H HD11 . ILE A 1 39  ? -5.681  16.335  -2.298  1.00 0.00 ? 39  ILE A HD11 7  
ATOM 9945  H HD12 . ILE A 1 39  ? -4.607  15.537  -3.465  1.00 0.00 ? 39  ILE A HD12 7  
ATOM 9946  H HD13 . ILE A 1 39  ? -6.364  15.260  -3.521  1.00 0.00 ? 39  ILE A HD13 7  
ATOM 9947  N N    . PHE A 1 40  ? -3.205  10.280  -2.631  1.00 0.00 ? 40  PHE A N    7  
ATOM 9948  C CA   . PHE A 1 40  ? -2.778  8.963   -3.069  1.00 0.00 ? 40  PHE A CA   7  
ATOM 9949  C C    . PHE A 1 40  ? -3.147  7.971   -1.975  1.00 0.00 ? 40  PHE A C    7  
ATOM 9950  O O    . PHE A 1 40  ? -3.925  7.053   -2.233  1.00 0.00 ? 40  PHE A O    7  
ATOM 9951  C CB   . PHE A 1 40  ? -1.271  8.953   -3.391  1.00 0.00 ? 40  PHE A CB   7  
ATOM 9952  C CG   . PHE A 1 40  ? -0.664  7.563   -3.521  1.00 0.00 ? 40  PHE A CG   7  
ATOM 9953  C CD1  . PHE A 1 40  ? -1.075  6.694   -4.553  1.00 0.00 ? 40  PHE A CD1  7  
ATOM 9954  C CD2  . PHE A 1 40  ? 0.273   7.110   -2.571  1.00 0.00 ? 40  PHE A CD2  7  
ATOM 9955  C CE1  . PHE A 1 40  ? -0.587  5.373   -4.601  1.00 0.00 ? 40  PHE A CE1  7  
ATOM 9956  C CE2  . PHE A 1 40  ? 0.761   5.792   -2.624  1.00 0.00 ? 40  PHE A CE2  7  
ATOM 9957  C CZ   . PHE A 1 40  ? 0.310   4.910   -3.621  1.00 0.00 ? 40  PHE A CZ   7  
ATOM 9958  H H    . PHE A 1 40  ? -2.544  11.047  -2.692  1.00 0.00 ? 40  PHE A H    7  
ATOM 9959  H HA   . PHE A 1 40  ? -3.336  8.692   -3.969  1.00 0.00 ? 40  PHE A HA   7  
ATOM 9960  H HB2  . PHE A 1 40  ? -1.112  9.499   -4.317  1.00 0.00 ? 40  PHE A HB2  7  
ATOM 9961  H HB3  . PHE A 1 40  ? -0.734  9.496   -2.614  1.00 0.00 ? 40  PHE A HB3  7  
ATOM 9962  H HD1  . PHE A 1 40  ? -1.774  7.032   -5.308  1.00 0.00 ? 40  PHE A HD1  7  
ATOM 9963  H HD2  . PHE A 1 40  ? 0.619   7.755   -1.773  1.00 0.00 ? 40  PHE A HD2  7  
ATOM 9964  H HE1  . PHE A 1 40  ? -0.897  4.708   -5.396  1.00 0.00 ? 40  PHE A HE1  7  
ATOM 9965  H HE2  . PHE A 1 40  ? 1.481   5.467   -1.886  1.00 0.00 ? 40  PHE A HE2  7  
ATOM 9966  H HZ   . PHE A 1 40  ? 0.681   3.889   -3.654  1.00 0.00 ? 40  PHE A HZ   7  
ATOM 9967  N N    . GLY A 1 41  ? -2.611  8.153   -0.767  1.00 0.00 ? 41  GLY A N    7  
ATOM 9968  C CA   . GLY A 1 41  ? -2.782  7.266   0.374   1.00 0.00 ? 41  GLY A CA   7  
ATOM 9969  C C    . GLY A 1 41  ? -4.235  7.044   0.753   1.00 0.00 ? 41  GLY A C    7  
ATOM 9970  O O    . GLY A 1 41  ? -4.629  5.907   1.004   1.00 0.00 ? 41  GLY A O    7  
ATOM 9971  H H    . GLY A 1 41  ? -1.952  8.916   -0.649  1.00 0.00 ? 41  GLY A H    7  
ATOM 9972  H HA2  . GLY A 1 41  ? -2.329  6.301   0.159   1.00 0.00 ? 41  GLY A HA2  7  
ATOM 9973  H HA3  . GLY A 1 41  ? -2.275  7.705   1.225   1.00 0.00 ? 41  GLY A HA3  7  
ATOM 9974  N N    . GLU A 1 42  ? -5.041  8.107   0.772   1.00 0.00 ? 42  GLU A N    7  
ATOM 9975  C CA   . GLU A 1 42  ? -6.471  8.028   1.026   1.00 0.00 ? 42  GLU A CA   7  
ATOM 9976  C C    . GLU A 1 42  ? -7.148  7.062   0.053   1.00 0.00 ? 42  GLU A C    7  
ATOM 9977  O O    . GLU A 1 42  ? -8.029  6.301   0.451   1.00 0.00 ? 42  GLU A O    7  
ATOM 9978  C CB   . GLU A 1 42  ? -7.113  9.414   0.842   1.00 0.00 ? 42  GLU A CB   7  
ATOM 9979  C CG   . GLU A 1 42  ? -7.246  10.242  2.127   1.00 0.00 ? 42  GLU A CG   7  
ATOM 9980  C CD   . GLU A 1 42  ? -8.538  11.060  2.200   1.00 0.00 ? 42  GLU A CD   7  
ATOM 9981  O OE1  . GLU A 1 42  ? -9.197  11.287  1.156   1.00 0.00 ? 42  GLU A OE1  7  
ATOM 9982  O OE2  . GLU A 1 42  ? -8.926  11.466  3.315   1.00 0.00 ? 42  GLU A OE2  7  
ATOM 9983  H H    . GLU A 1 42  ? -4.644  9.029   0.615   1.00 0.00 ? 42  GLU A H    7  
ATOM 9984  H HA   . GLU A 1 42  ? -6.643  7.667   2.044   1.00 0.00 ? 42  GLU A HA   7  
ATOM 9985  H HB2  . GLU A 1 42  ? -6.569  9.992   0.101   1.00 0.00 ? 42  GLU A HB2  7  
ATOM 9986  H HB3  . GLU A 1 42  ? -8.097  9.263   0.411   1.00 0.00 ? 42  GLU A HB3  7  
ATOM 9987  H HG2  . GLU A 1 42  ? -7.217  9.572   2.983   1.00 0.00 ? 42  GLU A HG2  7  
ATOM 9988  H HG3  . GLU A 1 42  ? -6.406  10.930  2.198   1.00 0.00 ? 42  GLU A HG3  7  
ATOM 9989  N N    . LYS A 1 43  ? -6.800  7.140   -1.231  1.00 0.00 ? 43  LYS A N    7  
ATOM 9990  C CA   . LYS A 1 43  ? -7.644  6.631   -2.300  1.00 0.00 ? 43  LYS A CA   7  
ATOM 9991  C C    . LYS A 1 43  ? -7.147  5.302   -2.833  1.00 0.00 ? 43  LYS A C    7  
ATOM 9992  O O    . LYS A 1 43  ? -7.955  4.377   -2.944  1.00 0.00 ? 43  LYS A O    7  
ATOM 9993  C CB   . LYS A 1 43  ? -7.789  7.715   -3.363  1.00 0.00 ? 43  LYS A CB   7  
ATOM 9994  C CG   . LYS A 1 43  ? -8.739  8.793   -2.820  1.00 0.00 ? 43  LYS A CG   7  
ATOM 9995  C CD   . LYS A 1 43  ? -9.393  9.552   -3.965  1.00 0.00 ? 43  LYS A CD   7  
ATOM 9996  C CE   . LYS A 1 43  ? -10.501 10.469  -3.440  1.00 0.00 ? 43  LYS A CE   7  
ATOM 9997  N NZ   . LYS A 1 43  ? -11.808 9.795   -3.287  1.00 0.00 ? 43  LYS A NZ   7  
ATOM 9998  H H    . LYS A 1 43  ? -6.040  7.768   -1.477  1.00 0.00 ? 43  LYS A H    7  
ATOM 9999  H HA   . LYS A 1 43  ? -8.651  6.456   -1.923  1.00 0.00 ? 43  LYS A HA   7  
ATOM 10000 H HB2  . LYS A 1 43  ? -6.820  8.143   -3.622  1.00 0.00 ? 43  LYS A HB2  7  
ATOM 10001 H HB3  . LYS A 1 43  ? -8.219  7.277   -4.255  1.00 0.00 ? 43  LYS A HB3  7  
ATOM 10002 H HG2  . LYS A 1 43  ? -9.531  8.333   -2.229  1.00 0.00 ? 43  LYS A HG2  7  
ATOM 10003 H HG3  . LYS A 1 43  ? -8.181  9.478   -2.183  1.00 0.00 ? 43  LYS A HG3  7  
ATOM 10004 H HD2  . LYS A 1 43  ? -8.627  10.139  -4.472  1.00 0.00 ? 43  LYS A HD2  7  
ATOM 10005 H HD3  . LYS A 1 43  ? -9.811  8.830   -4.661  1.00 0.00 ? 43  LYS A HD3  7  
ATOM 10006 H HE2  . LYS A 1 43  ? -10.198 10.878  -2.475  1.00 0.00 ? 43  LYS A HE2  7  
ATOM 10007 H HE3  . LYS A 1 43  ? -10.630 11.303  -4.127  1.00 0.00 ? 43  LYS A HE3  7  
ATOM 10008 H HZ1  . LYS A 1 43  ? -11.745 8.937   -2.746  1.00 0.00 ? 43  LYS A HZ1  7  
ATOM 10009 H HZ2  . LYS A 1 43  ? -12.415 10.425  -2.769  1.00 0.00 ? 43  LYS A HZ2  7  
ATOM 10010 H HZ3  . LYS A 1 43  ? -12.244 9.600   -4.183  1.00 0.00 ? 43  LYS A HZ3  7  
ATOM 10011 N N    . VAL A 1 44  ? -5.864  5.191   -3.160  1.00 0.00 ? 44  VAL A N    7  
ATOM 10012 C CA   . VAL A 1 44  ? -5.294  3.943   -3.651  1.00 0.00 ? 44  VAL A CA   7  
ATOM 10013 C C    . VAL A 1 44  ? -5.090  2.990   -2.463  1.00 0.00 ? 44  VAL A C    7  
ATOM 10014 O O    . VAL A 1 44  ? -5.841  2.023   -2.335  1.00 0.00 ? 44  VAL A O    7  
ATOM 10015 C CB   . VAL A 1 44  ? -4.029  4.217   -4.489  1.00 0.00 ? 44  VAL A CB   7  
ATOM 10016 C CG1  . VAL A 1 44  ? -3.397  2.914   -4.998  1.00 0.00 ? 44  VAL A CG1  7  
ATOM 10017 C CG2  . VAL A 1 44  ? -4.337  5.125   -5.688  1.00 0.00 ? 44  VAL A CG2  7  
ATOM 10018 H H    . VAL A 1 44  ? -5.273  6.012   -3.048  1.00 0.00 ? 44  VAL A H    7  
ATOM 10019 H HA   . VAL A 1 44  ? -6.026  3.479   -4.316  1.00 0.00 ? 44  VAL A HA   7  
ATOM 10020 H HB   . VAL A 1 44  ? -3.312  4.739   -3.865  1.00 0.00 ? 44  VAL A HB   7  
ATOM 10021 H HG11 . VAL A 1 44  ? -3.010  2.340   -4.157  1.00 0.00 ? 44  VAL A HG11 7  
ATOM 10022 H HG12 . VAL A 1 44  ? -4.140  2.320   -5.533  1.00 0.00 ? 44  VAL A HG12 7  
ATOM 10023 H HG13 . VAL A 1 44  ? -2.568  3.131   -5.671  1.00 0.00 ? 44  VAL A HG13 7  
ATOM 10024 H HG21 . VAL A 1 44  ? -5.097  4.667   -6.323  1.00 0.00 ? 44  VAL A HG21 7  
ATOM 10025 H HG22 . VAL A 1 44  ? -4.690  6.093   -5.336  1.00 0.00 ? 44  VAL A HG22 7  
ATOM 10026 H HG23 . VAL A 1 44  ? -3.436  5.299   -6.276  1.00 0.00 ? 44  VAL A HG23 7  
ATOM 10027 N N    . LEU A 1 45  ? -4.104  3.230   -1.589  1.00 0.00 ? 45  LEU A N    7  
ATOM 10028 C CA   . LEU A 1 45  ? -3.752  2.314   -0.500  1.00 0.00 ? 45  LEU A CA   7  
ATOM 10029 C C    . LEU A 1 45  ? -4.844  2.255   0.578   1.00 0.00 ? 45  LEU A C    7  
ATOM 10030 O O    . LEU A 1 45  ? -4.906  1.266   1.309   1.00 0.00 ? 45  LEU A O    7  
ATOM 10031 C CB   . LEU A 1 45  ? -2.415  2.705   0.159   1.00 0.00 ? 45  LEU A CB   7  
ATOM 10032 C CG   . LEU A 1 45  ? -1.154  2.680   -0.735  1.00 0.00 ? 45  LEU A CG   7  
ATOM 10033 C CD1  . LEU A 1 45  ? 0.001   3.456   -0.092  1.00 0.00 ? 45  LEU A CD1  7  
ATOM 10034 C CD2  . LEU A 1 45  ? -0.664  1.286   -1.013  1.00 0.00 ? 45  LEU A CD2  7  
ATOM 10035 H H    . LEU A 1 45  ? -3.503  4.037   -1.724  1.00 0.00 ? 45  LEU A H    7  
ATOM 10036 H HA   . LEU A 1 45  ? -3.655  1.313   -0.922  1.00 0.00 ? 45  LEU A HA   7  
ATOM 10037 H HB2  . LEU A 1 45  ? -2.534  3.704   0.586   1.00 0.00 ? 45  LEU A HB2  7  
ATOM 10038 H HB3  . LEU A 1 45  ? -2.260  1.997   0.971   1.00 0.00 ? 45  LEU A HB3  7  
ATOM 10039 H HG   . LEU A 1 45  ? -1.363  3.071   -1.722  1.00 0.00 ? 45  LEU A HG   7  
ATOM 10040 H HD11 . LEU A 1 45  ? 0.205   3.076   0.908   1.00 0.00 ? 45  LEU A HD11 7  
ATOM 10041 H HD12 . LEU A 1 45  ? 0.891   3.371   -0.712  1.00 0.00 ? 45  LEU A HD12 7  
ATOM 10042 H HD13 . LEU A 1 45  ? -0.263  4.512   -0.035  1.00 0.00 ? 45  LEU A HD13 7  
ATOM 10043 H HD21 . LEU A 1 45  ? -0.305  0.819   -0.100  1.00 0.00 ? 45  LEU A HD21 7  
ATOM 10044 H HD22 . LEU A 1 45  ? -1.494  0.730   -1.441  1.00 0.00 ? 45  LEU A HD22 7  
ATOM 10045 H HD23 . LEU A 1 45  ? 0.141   1.320   -1.749  1.00 0.00 ? 45  LEU A HD23 7  
ATOM 10046 N N    . GLY A 1 46  ? -5.711  3.267   0.675   1.00 0.00 ? 46  GLY A N    7  
ATOM 10047 C CA   . GLY A 1 46  ? -6.886  3.246   1.538   1.00 0.00 ? 46  GLY A CA   7  
ATOM 10048 C C    . GLY A 1 46  ? -6.557  3.498   3.010   1.00 0.00 ? 46  GLY A C    7  
ATOM 10049 O O    . GLY A 1 46  ? -7.115  2.824   3.882   1.00 0.00 ? 46  GLY A O    7  
ATOM 10050 H H    . GLY A 1 46  ? -5.523  4.115   0.155   1.00 0.00 ? 46  GLY A H    7  
ATOM 10051 H HA2  . GLY A 1 46  ? -7.595  3.999   1.200   1.00 0.00 ? 46  GLY A HA2  7  
ATOM 10052 H HA3  . GLY A 1 46  ? -7.366  2.272   1.446   1.00 0.00 ? 46  GLY A HA3  7  
ATOM 10053 N N    . LEU A 1 47  ? -5.653  4.433   3.319   1.00 0.00 ? 47  LEU A N    7  
ATOM 10054 C CA   . LEU A 1 47  ? -5.105  4.650   4.662   1.00 0.00 ? 47  LEU A CA   7  
ATOM 10055 C C    . LEU A 1 47  ? -5.092  6.138   5.019   1.00 0.00 ? 47  LEU A C    7  
ATOM 10056 O O    . LEU A 1 47  ? -5.033  6.984   4.125   1.00 0.00 ? 47  LEU A O    7  
ATOM 10057 C CB   . LEU A 1 47  ? -3.670  4.097   4.710   1.00 0.00 ? 47  LEU A CB   7  
ATOM 10058 C CG   . LEU A 1 47  ? -3.559  2.570   4.526   1.00 0.00 ? 47  LEU A CG   7  
ATOM 10059 C CD1  . LEU A 1 47  ? -2.094  2.216   4.269   1.00 0.00 ? 47  LEU A CD1  7  
ATOM 10060 C CD2  . LEU A 1 47  ? -4.072  1.803   5.749   1.00 0.00 ? 47  LEU A CD2  7  
ATOM 10061 H H    . LEU A 1 47  ? -5.284  5.014   2.571   1.00 0.00 ? 47  LEU A H    7  
ATOM 10062 H HA   . LEU A 1 47  ? -5.711  4.132   5.405   1.00 0.00 ? 47  LEU A HA   7  
ATOM 10063 H HB2  . LEU A 1 47  ? -3.093  4.591   3.926   1.00 0.00 ? 47  LEU A HB2  7  
ATOM 10064 H HB3  . LEU A 1 47  ? -3.223  4.370   5.666   1.00 0.00 ? 47  LEU A HB3  7  
ATOM 10065 H HG   . LEU A 1 47  ? -4.127  2.257   3.654   1.00 0.00 ? 47  LEU A HG   7  
ATOM 10066 H HD11 . LEU A 1 47  ? -1.961  1.134   4.276   1.00 0.00 ? 47  LEU A HD11 7  
ATOM 10067 H HD12 . LEU A 1 47  ? -1.792  2.591   3.292   1.00 0.00 ? 47  LEU A HD12 7  
ATOM 10068 H HD13 . LEU A 1 47  ? -1.474  2.671   5.036   1.00 0.00 ? 47  LEU A HD13 7  
ATOM 10069 H HD21 . LEU A 1 47  ? -3.528  2.112   6.642   1.00 0.00 ? 47  LEU A HD21 7  
ATOM 10070 H HD22 . LEU A 1 47  ? -5.138  1.991   5.886   1.00 0.00 ? 47  LEU A HD22 7  
ATOM 10071 H HD23 . LEU A 1 47  ? -3.930  0.732   5.595   1.00 0.00 ? 47  LEU A HD23 7  
ATOM 10072 N N    . SER A 1 48  ? -5.057  6.463   6.316   1.00 0.00 ? 48  SER A N    7  
ATOM 10073 C CA   . SER A 1 48  ? -4.848  7.814   6.827   1.00 0.00 ? 48  SER A CA   7  
ATOM 10074 C C    . SER A 1 48  ? -3.466  8.364   6.452   1.00 0.00 ? 48  SER A C    7  
ATOM 10075 O O    . SER A 1 48  ? -2.535  7.636   6.087   1.00 0.00 ? 48  SER A O    7  
ATOM 10076 C CB   . SER A 1 48  ? -4.993  7.824   8.357   1.00 0.00 ? 48  SER A CB   7  
ATOM 10077 O OG   . SER A 1 48  ? -6.346  7.858   8.784   1.00 0.00 ? 48  SER A OG   7  
ATOM 10078 H H    . SER A 1 48  ? -5.126  5.728   7.011   1.00 0.00 ? 48  SER A H    7  
ATOM 10079 H HA   . SER A 1 48  ? -5.604  8.471   6.394   1.00 0.00 ? 48  SER A HA   7  
ATOM 10080 H HB2  . SER A 1 48  ? -4.488  6.955   8.777   1.00 0.00 ? 48  SER A HB2  7  
ATOM 10081 H HB3  . SER A 1 48  ? -4.504  8.710   8.766   1.00 0.00 ? 48  SER A HB3  7  
ATOM 10082 H HG   . SER A 1 48  ? -6.915  7.324   8.184   1.00 0.00 ? 48  SER A HG   7  
ATOM 10083 N N    . GLN A 1 49  ? -3.349  9.685   6.578   1.00 0.00 ? 49  GLN A N    7  
ATOM 10084 C CA   . GLN A 1 49  ? -2.215  10.503  6.167   1.00 0.00 ? 49  GLN A CA   7  
ATOM 10085 C C    . GLN A 1 49  ? -0.933  9.989   6.817   1.00 0.00 ? 49  GLN A C    7  
ATOM 10086 O O    . GLN A 1 49  ? 0.014   9.635   6.115   1.00 0.00 ? 49  GLN A O    7  
ATOM 10087 C CB   . GLN A 1 49  ? -2.520  11.972  6.521   1.00 0.00 ? 49  GLN A CB   7  
ATOM 10088 C CG   . GLN A 1 49  ? -1.378  12.950  6.183   1.00 0.00 ? 49  GLN A CG   7  
ATOM 10089 C CD   . GLN A 1 49  ? -1.665  14.380  6.654   1.00 0.00 ? 49  GLN A CD   7  
ATOM 10090 O OE1  . GLN A 1 49  ? -1.624  15.335  5.878   1.00 0.00 ? 49  GLN A OE1  7  
ATOM 10091 N NE2  . GLN A 1 49  ? -1.921  14.570  7.936   1.00 0.00 ? 49  GLN A NE2  7  
ATOM 10092 H H    . GLN A 1 49  ? -4.210  10.173  6.787   1.00 0.00 ? 49  GLN A H    7  
ATOM 10093 H HA   . GLN A 1 49  ? -2.100  10.431  5.085   1.00 0.00 ? 49  GLN A HA   7  
ATOM 10094 H HB2  . GLN A 1 49  ? -3.416  12.289  5.987   1.00 0.00 ? 49  GLN A HB2  7  
ATOM 10095 H HB3  . GLN A 1 49  ? -2.740  12.034  7.585   1.00 0.00 ? 49  GLN A HB3  7  
ATOM 10096 H HG2  . GLN A 1 49  ? -0.456  12.621  6.659   1.00 0.00 ? 49  GLN A HG2  7  
ATOM 10097 H HG3  . GLN A 1 49  ? -1.214  12.946  5.105   1.00 0.00 ? 49  GLN A HG3  7  
ATOM 10098 H HE21 . GLN A 1 49  ? -1.863  13.791  8.596   1.00 0.00 ? 49  GLN A HE21 7  
ATOM 10099 H HE22 . GLN A 1 49  ? -2.044  15.495  8.316   1.00 0.00 ? 49  GLN A HE22 7  
ATOM 10100 N N    . GLY A 1 50  ? -0.893  9.940   8.148   1.00 0.00 ? 50  GLY A N    7  
ATOM 10101 C CA   . GLY A 1 50  ? 0.312   9.605   8.884   1.00 0.00 ? 50  GLY A CA   7  
ATOM 10102 C C    . GLY A 1 50  ? 0.637   8.119   8.796   1.00 0.00 ? 50  GLY A C    7  
ATOM 10103 O O    . GLY A 1 50  ? 1.814   7.771   8.800   1.00 0.00 ? 50  GLY A O    7  
ATOM 10104 H H    . GLY A 1 50  ? -1.699  10.238  8.687   1.00 0.00 ? 50  GLY A H    7  
ATOM 10105 H HA2  . GLY A 1 50  ? 1.148   10.177  8.481   1.00 0.00 ? 50  GLY A HA2  7  
ATOM 10106 H HA3  . GLY A 1 50  ? 0.179   9.889   9.925   1.00 0.00 ? 50  GLY A HA3  7  
ATOM 10107 N N    . SER A 1 51  ? -0.375  7.254   8.655   1.00 0.00 ? 51  SER A N    7  
ATOM 10108 C CA   . SER A 1 51  ? -0.190  5.832   8.402   1.00 0.00 ? 51  SER A CA   7  
ATOM 10109 C C    . SER A 1 51  ? 0.659   5.637   7.151   1.00 0.00 ? 51  SER A C    7  
ATOM 10110 O O    . SER A 1 51  ? 1.701   4.983   7.206   1.00 0.00 ? 51  SER A O    7  
ATOM 10111 C CB   . SER A 1 51  ? -1.549  5.148   8.227   1.00 0.00 ? 51  SER A CB   7  
ATOM 10112 O OG   . SER A 1 51  ? -2.276  5.181   9.435   1.00 0.00 ? 51  SER A OG   7  
ATOM 10113 H H    . SER A 1 51  ? -1.317  7.614   8.639   1.00 0.00 ? 51  SER A H    7  
ATOM 10114 H HA   . SER A 1 51  ? 0.336   5.383   9.248   1.00 0.00 ? 51  SER A HA   7  
ATOM 10115 H HB2  . SER A 1 51  ? -2.126  5.636   7.444   1.00 0.00 ? 51  SER A HB2  7  
ATOM 10116 H HB3  . SER A 1 51  ? -1.387  4.114   7.926   1.00 0.00 ? 51  SER A HB3  7  
ATOM 10117 H HG   . SER A 1 51  ? -2.806  4.360   9.457   1.00 0.00 ? 51  SER A HG   7  
ATOM 10118 N N    . VAL A 1 52  ? 0.211   6.199   6.028   1.00 0.00 ? 52  VAL A N    7  
ATOM 10119 C CA   . VAL A 1 52  ? 0.872   6.066   4.749   1.00 0.00 ? 52  VAL A CA   7  
ATOM 10120 C C    . VAL A 1 52  ? 2.227   6.789   4.757   1.00 0.00 ? 52  VAL A C    7  
ATOM 10121 O O    . VAL A 1 52  ? 3.173   6.308   4.128   1.00 0.00 ? 52  VAL A O    7  
ATOM 10122 C CB   . VAL A 1 52  ? -0.124  6.544   3.663   1.00 0.00 ? 52  VAL A CB   7  
ATOM 10123 C CG1  . VAL A 1 52  ? 0.175   7.924   3.075   1.00 0.00 ? 52  VAL A CG1  7  
ATOM 10124 C CG2  . VAL A 1 52  ? -0.214  5.465   2.597   1.00 0.00 ? 52  VAL A CG2  7  
ATOM 10125 H H    . VAL A 1 52  ? -0.674  6.692   6.023   1.00 0.00 ? 52  VAL A H    7  
ATOM 10126 H HA   . VAL A 1 52  ? 1.079   4.999   4.619   1.00 0.00 ? 52  VAL A HA   7  
ATOM 10127 H HB   . VAL A 1 52  ? -1.126  6.609   4.085   1.00 0.00 ? 52  VAL A HB   7  
ATOM 10128 H HG11 . VAL A 1 52  ? -0.570  8.194   2.331   1.00 0.00 ? 52  VAL A HG11 7  
ATOM 10129 H HG12 . VAL A 1 52  ? 0.176   8.679   3.857   1.00 0.00 ? 52  VAL A HG12 7  
ATOM 10130 H HG13 . VAL A 1 52  ? 1.146   7.905   2.597   1.00 0.00 ? 52  VAL A HG13 7  
ATOM 10131 H HG21 . VAL A 1 52  ? 0.761   5.304   2.139   1.00 0.00 ? 52  VAL A HG21 7  
ATOM 10132 H HG22 . VAL A 1 52  ? -0.557  4.543   3.065   1.00 0.00 ? 52  VAL A HG22 7  
ATOM 10133 H HG23 . VAL A 1 52  ? -0.933  5.760   1.838   1.00 0.00 ? 52  VAL A HG23 7  
ATOM 10134 N N    . SER A 1 53  ? 2.334   7.905   5.491   1.00 0.00 ? 53  SER A N    7  
ATOM 10135 C CA   . SER A 1 53  ? 3.565   8.660   5.642   1.00 0.00 ? 53  SER A CA   7  
ATOM 10136 C C    . SER A 1 53  ? 4.621   7.769   6.282   1.00 0.00 ? 53  SER A C    7  
ATOM 10137 O O    . SER A 1 53  ? 5.678   7.551   5.691   1.00 0.00 ? 53  SER A O    7  
ATOM 10138 C CB   . SER A 1 53  ? 3.300   9.944   6.434   1.00 0.00 ? 53  SER A CB   7  
ATOM 10139 O OG   . SER A 1 53  ? 4.267   10.918  6.109   1.00 0.00 ? 53  SER A OG   7  
ATOM 10140 H H    . SER A 1 53  ? 1.506   8.267   5.950   1.00 0.00 ? 53  SER A H    7  
ATOM 10141 H HA   . SER A 1 53  ? 3.913   8.936   4.653   1.00 0.00 ? 53  SER A HA   7  
ATOM 10142 H HB2  . SER A 1 53  ? 2.325   10.342  6.159   1.00 0.00 ? 53  SER A HB2  7  
ATOM 10143 H HB3  . SER A 1 53  ? 3.318   9.738   7.505   1.00 0.00 ? 53  SER A HB3  7  
ATOM 10144 H HG   . SER A 1 53  ? 4.278   11.580  6.829   1.00 0.00 ? 53  SER A HG   7  
ATOM 10145 N N    . ASP A 1 54  ? 4.321   7.183   7.444   1.00 0.00 ? 54  ASP A N    7  
ATOM 10146 C CA   . ASP A 1 54  ? 5.277   6.335   8.146   1.00 0.00 ? 54  ASP A CA   7  
ATOM 10147 C C    . ASP A 1 54  ? 5.609   5.069   7.358   1.00 0.00 ? 54  ASP A C    7  
ATOM 10148 O O    . ASP A 1 54  ? 6.676   4.492   7.543   1.00 0.00 ? 54  ASP A O    7  
ATOM 10149 C CB   . ASP A 1 54  ? 4.757   5.976   9.539   1.00 0.00 ? 54  ASP A CB   7  
ATOM 10150 C CG   . ASP A 1 54  ? 5.909   5.557   10.453  1.00 0.00 ? 54  ASP A CG   7  
ATOM 10151 O OD1  . ASP A 1 54  ? 6.840   6.377   10.630  1.00 0.00 ? 54  ASP A OD1  7  
ATOM 10152 O OD2  . ASP A 1 54  ? 5.850   4.471   11.072  1.00 0.00 ? 54  ASP A OD2  7  
ATOM 10153 H H    . ASP A 1 54  ? 3.425   7.357   7.892   1.00 0.00 ? 54  ASP A H    7  
ATOM 10154 H HA   . ASP A 1 54  ? 6.193   6.910   8.263   1.00 0.00 ? 54  ASP A HA   7  
ATOM 10155 H HB2  . ASP A 1 54  ? 4.272   6.848   9.977   1.00 0.00 ? 54  ASP A HB2  7  
ATOM 10156 H HB3  . ASP A 1 54  ? 4.017   5.178   9.461   1.00 0.00 ? 54  ASP A HB3  7  
ATOM 10157 N N    . MET A 1 55  ? 4.724   4.654   6.449   1.00 0.00 ? 55  MET A N    7  
ATOM 10158 C CA   . MET A 1 55  ? 4.972   3.575   5.508   1.00 0.00 ? 55  MET A CA   7  
ATOM 10159 C C    . MET A 1 55  ? 6.079   3.951   4.535   1.00 0.00 ? 55  MET A C    7  
ATOM 10160 O O    . MET A 1 55  ? 7.100   3.273   4.510   1.00 0.00 ? 55  MET A O    7  
ATOM 10161 C CB   . MET A 1 55  ? 3.671   3.181   4.790   1.00 0.00 ? 55  MET A CB   7  
ATOM 10162 C CG   . MET A 1 55  ? 3.446   1.687   5.003   1.00 0.00 ? 55  MET A CG   7  
ATOM 10163 S SD   . MET A 1 55  ? 1.798   1.038   4.667   1.00 0.00 ? 55  MET A SD   7  
ATOM 10164 C CE   . MET A 1 55  ? 0.865   1.755   6.046   1.00 0.00 ? 55  MET A CE   7  
ATOM 10165 H H    . MET A 1 55  ? 3.877   5.201   6.353   1.00 0.00 ? 55  MET A H    7  
ATOM 10166 H HA   . MET A 1 55  ? 5.343   2.731   6.088   1.00 0.00 ? 55  MET A HA   7  
ATOM 10167 H HB2  . MET A 1 55  ? 2.841   3.743   5.203   1.00 0.00 ? 55  MET A HB2  7  
ATOM 10168 H HB3  . MET A 1 55  ? 3.725   3.389   3.721   1.00 0.00 ? 55  MET A HB3  7  
ATOM 10169 H HG2  . MET A 1 55  ? 4.161   1.162   4.372   1.00 0.00 ? 55  MET A HG2  7  
ATOM 10170 H HG3  . MET A 1 55  ? 3.660   1.460   6.042   1.00 0.00 ? 55  MET A HG3  7  
ATOM 10171 H HE1  . MET A 1 55  ? -0.108  1.267   6.109   1.00 0.00 ? 55  MET A HE1  7  
ATOM 10172 H HE2  . MET A 1 55  ? 1.392   1.611   6.987   1.00 0.00 ? 55  MET A HE2  7  
ATOM 10173 H HE3  . MET A 1 55  ? 0.721   2.823   5.886   1.00 0.00 ? 55  MET A HE3  7  
ATOM 10174 N N    . LEU A 1 56  ? 5.889   5.006   3.739   1.00 0.00 ? 56  LEU A N    7  
ATOM 10175 C CA   . LEU A 1 56  ? 6.917   5.485   2.811   1.00 0.00 ? 56  LEU A CA   7  
ATOM 10176 C C    . LEU A 1 56  ? 8.237   5.815   3.520   1.00 0.00 ? 56  LEU A C    7  
ATOM 10177 O O    . LEU A 1 56  ? 9.306   5.511   2.979   1.00 0.00 ? 56  LEU A O    7  
ATOM 10178 C CB   . LEU A 1 56  ? 6.439   6.711   2.021   1.00 0.00 ? 56  LEU A CB   7  
ATOM 10179 C CG   . LEU A 1 56  ? 5.228   6.498   1.087   1.00 0.00 ? 56  LEU A CG   7  
ATOM 10180 C CD1  . LEU A 1 56  ? 5.177   7.637   0.061   1.00 0.00 ? 56  LEU A CD1  7  
ATOM 10181 C CD2  . LEU A 1 56  ? 5.250   5.165   0.325   1.00 0.00 ? 56  LEU A CD2  7  
ATOM 10182 H H    . LEU A 1 56  ? 4.966   5.431   3.754   1.00 0.00 ? 56  LEU A H    7  
ATOM 10183 H HA   . LEU A 1 56  ? 7.132   4.683   2.109   1.00 0.00 ? 56  LEU A HA   7  
ATOM 10184 H HB2  . LEU A 1 56  ? 6.227   7.513   2.734   1.00 0.00 ? 56  LEU A HB2  7  
ATOM 10185 H HB3  . LEU A 1 56  ? 7.280   7.041   1.414   1.00 0.00 ? 56  LEU A HB3  7  
ATOM 10186 H HG   . LEU A 1 56  ? 4.318   6.531   1.690   1.00 0.00 ? 56  LEU A HG   7  
ATOM 10187 H HD11 . LEU A 1 56  ? 6.035   7.585   -0.608  1.00 0.00 ? 56  LEU A HD11 7  
ATOM 10188 H HD12 . LEU A 1 56  ? 4.275   7.556   -0.547  1.00 0.00 ? 56  LEU A HD12 7  
ATOM 10189 H HD13 . LEU A 1 56  ? 5.185   8.602   0.566   1.00 0.00 ? 56  LEU A HD13 7  
ATOM 10190 H HD21 . LEU A 1 56  ? 4.407   5.124   -0.366  1.00 0.00 ? 56  LEU A HD21 7  
ATOM 10191 H HD22 . LEU A 1 56  ? 6.176   5.071   -0.247  1.00 0.00 ? 56  LEU A HD22 7  
ATOM 10192 H HD23 . LEU A 1 56  ? 5.155   4.327   1.017   1.00 0.00 ? 56  LEU A HD23 7  
ATOM 10193 N N    . SER A 1 57  ? 8.178   6.415   4.711   1.00 0.00 ? 57  SER A N    7  
ATOM 10194 C CA   . SER A 1 57  ? 9.354   6.741   5.506   1.00 0.00 ? 57  SER A CA   7  
ATOM 10195 C C    . SER A 1 57  ? 10.103  5.480   5.949   1.00 0.00 ? 57  SER A C    7  
ATOM 10196 O O    . SER A 1 57  ? 11.304  5.361   5.701   1.00 0.00 ? 57  SER A O    7  
ATOM 10197 C CB   . SER A 1 57  ? 8.910   7.513   6.753   1.00 0.00 ? 57  SER A CB   7  
ATOM 10198 O OG   . SER A 1 57  ? 8.319   8.765   6.463   1.00 0.00 ? 57  SER A OG   7  
ATOM 10199 H H    . SER A 1 57  ? 7.275   6.707   5.073   1.00 0.00 ? 57  SER A H    7  
ATOM 10200 H HA   . SER A 1 57  ? 10.030  7.360   4.919   1.00 0.00 ? 57  SER A HA   7  
ATOM 10201 H HB2  . SER A 1 57  ? 8.175   6.909   7.279   1.00 0.00 ? 57  SER A HB2  7  
ATOM 10202 H HB3  . SER A 1 57  ? 9.768   7.670   7.405   1.00 0.00 ? 57  SER A HB3  7  
ATOM 10203 H HG   . SER A 1 57  ? 7.862   9.040   7.271   1.00 0.00 ? 57  SER A HG   7  
ATOM 10204 N N    . ARG A 1 58  ? 9.414   4.533   6.598   1.00 0.00 ? 58  ARG A N    7  
ATOM 10205 C CA   . ARG A 1 58  ? 10.039  3.402   7.281   1.00 0.00 ? 58  ARG A CA   7  
ATOM 10206 C C    . ARG A 1 58  ? 9.148   2.160   7.137   1.00 0.00 ? 58  ARG A C    7  
ATOM 10207 O O    . ARG A 1 58  ? 8.485   1.761   8.095   1.00 0.00 ? 58  ARG A O    7  
ATOM 10208 C CB   . ARG A 1 58  ? 10.384  3.776   8.746   1.00 0.00 ? 58  ARG A CB   7  
ATOM 10209 C CG   . ARG A 1 58  ? 9.229   4.313   9.619   1.00 0.00 ? 58  ARG A CG   7  
ATOM 10210 C CD   . ARG A 1 58  ? 9.706   4.639   11.043  1.00 0.00 ? 58  ARG A CD   7  
ATOM 10211 N NE   . ARG A 1 58  ? 8.644   4.398   12.032  1.00 0.00 ? 58  ARG A NE   7  
ATOM 10212 C CZ   . ARG A 1 58  ? 8.816   4.163   13.337  1.00 0.00 ? 58  ARG A CZ   7  
ATOM 10213 N NH1  . ARG A 1 58  ? 9.977   4.421   13.934  1.00 0.00 ? 58  ARG A NH1  7  
ATOM 10214 N NH2  . ARG A 1 58  ? 7.821   3.662   14.054  1.00 0.00 ? 58  ARG A NH2  7  
ATOM 10215 H H    . ARG A 1 58  ? 8.405   4.621   6.712   1.00 0.00 ? 58  ARG A H    7  
ATOM 10216 H HA   . ARG A 1 58  ? 10.987  3.180   6.792   1.00 0.00 ? 58  ARG A HA   7  
ATOM 10217 H HB2  . ARG A 1 58  ? 10.801  2.890   9.230   1.00 0.00 ? 58  ARG A HB2  7  
ATOM 10218 H HB3  . ARG A 1 58  ? 11.166  4.537   8.721   1.00 0.00 ? 58  ARG A HB3  7  
ATOM 10219 H HG2  . ARG A 1 58  ? 8.820   5.220   9.172   1.00 0.00 ? 58  ARG A HG2  7  
ATOM 10220 H HG3  . ARG A 1 58  ? 8.436   3.570   9.685   1.00 0.00 ? 58  ARG A HG3  7  
ATOM 10221 H HD2  . ARG A 1 58  ? 10.556  4.003   11.290  1.00 0.00 ? 58  ARG A HD2  7  
ATOM 10222 H HD3  . ARG A 1 58  ? 10.011  5.684   11.089  1.00 0.00 ? 58  ARG A HD3  7  
ATOM 10223 H HE   . ARG A 1 58  ? 7.694   4.390   11.649  1.00 0.00 ? 58  ARG A HE   7  
ATOM 10224 H HH11 . ARG A 1 58  ? 10.730  4.870   13.437  1.00 0.00 ? 58  ARG A HH11 7  
ATOM 10225 H HH12 . ARG A 1 58  ? 10.140  4.166   14.899  1.00 0.00 ? 58  ARG A HH12 7  
ATOM 10226 H HH21 . ARG A 1 58  ? 6.988   3.309   13.586  1.00 0.00 ? 58  ARG A HH21 7  
ATOM 10227 H HH22 . ARG A 1 58  ? 7.863   3.535   15.065  1.00 0.00 ? 58  ARG A HH22 7  
ATOM 10228 N N    . PRO A 1 59  ? 9.124   1.499   5.971   1.00 0.00 ? 59  PRO A N    7  
ATOM 10229 C CA   . PRO A 1 59  ? 8.276   0.330   5.765   1.00 0.00 ? 59  PRO A CA   7  
ATOM 10230 C C    . PRO A 1 59  ? 8.774   -0.864  6.587   1.00 0.00 ? 59  PRO A C    7  
ATOM 10231 O O    . PRO A 1 59  ? 9.875   -0.834  7.148   1.00 0.00 ? 59  PRO A O    7  
ATOM 10232 C CB   . PRO A 1 59  ? 8.293   0.073   4.255   1.00 0.00 ? 59  PRO A CB   7  
ATOM 10233 C CG   . PRO A 1 59  ? 9.641   0.634   3.823   1.00 0.00 ? 59  PRO A CG   7  
ATOM 10234 C CD   . PRO A 1 59  ? 9.881   1.806   4.769   1.00 0.00 ? 59  PRO A CD   7  
ATOM 10235 H HA   . PRO A 1 59  ? 7.259   0.560   6.076   1.00 0.00 ? 59  PRO A HA   7  
ATOM 10236 H HB2  . PRO A 1 59  ? 8.202   -0.985  4.014   1.00 0.00 ? 59  PRO A HB2  7  
ATOM 10237 H HB3  . PRO A 1 59  ? 7.496   0.637   3.769   1.00 0.00 ? 59  PRO A HB3  7  
ATOM 10238 H HG2  . PRO A 1 59  ? 10.397  -0.117  3.995   1.00 0.00 ? 59  PRO A HG2  7  
ATOM 10239 H HG3  . PRO A 1 59  ? 9.652   0.940   2.781   1.00 0.00 ? 59  PRO A HG3  7  
ATOM 10240 H HD2  . PRO A 1 59  ? 10.945  1.900   4.978   1.00 0.00 ? 59  PRO A HD2  7  
ATOM 10241 H HD3  . PRO A 1 59  ? 9.516   2.729   4.325   1.00 0.00 ? 59  PRO A HD3  7  
ATOM 10242 N N    . LYS A 1 60  ? 7.957   -1.920  6.648   1.00 0.00 ? 60  LYS A N    7  
ATOM 10243 C CA   . LYS A 1 60  ? 8.275   -3.199  7.279   1.00 0.00 ? 60  LYS A CA   7  
ATOM 10244 C C    . LYS A 1 60  ? 8.759   -4.179  6.205   1.00 0.00 ? 60  LYS A C    7  
ATOM 10245 O O    . LYS A 1 60  ? 8.456   -3.955  5.025   1.00 0.00 ? 60  LYS A O    7  
ATOM 10246 C CB   . LYS A 1 60  ? 7.005   -3.745  7.962   1.00 0.00 ? 60  LYS A CB   7  
ATOM 10247 C CG   . LYS A 1 60  ? 6.550   -2.965  9.207   1.00 0.00 ? 60  LYS A CG   7  
ATOM 10248 C CD   . LYS A 1 60  ? 7.410   -3.220  10.457  1.00 0.00 ? 60  LYS A CD   7  
ATOM 10249 C CE   . LYS A 1 60  ? 6.785   -2.457  11.635  1.00 0.00 ? 60  LYS A CE   7  
ATOM 10250 N NZ   . LYS A 1 60  ? 7.372   -2.800  12.945  1.00 0.00 ? 60  LYS A NZ   7  
ATOM 10251 H H    . LYS A 1 60  ? 7.133   -1.917  6.068   1.00 0.00 ? 60  LYS A H    7  
ATOM 10252 H HA   . LYS A 1 60  ? 9.070   -3.056  8.005   1.00 0.00 ? 60  LYS A HA   7  
ATOM 10253 H HB2  . LYS A 1 60  ? 6.188   -3.746  7.238   1.00 0.00 ? 60  LYS A HB2  7  
ATOM 10254 H HB3  . LYS A 1 60  ? 7.165   -4.781  8.247   1.00 0.00 ? 60  LYS A HB3  7  
ATOM 10255 H HG2  . LYS A 1 60  ? 6.530   -1.898  8.984   1.00 0.00 ? 60  LYS A HG2  7  
ATOM 10256 H HG3  . LYS A 1 60  ? 5.528   -3.274  9.431   1.00 0.00 ? 60  LYS A HG3  7  
ATOM 10257 H HD2  . LYS A 1 60  ? 7.418   -4.291  10.670  1.00 0.00 ? 60  LYS A HD2  7  
ATOM 10258 H HD3  . LYS A 1 60  ? 8.432   -2.872  10.291  1.00 0.00 ? 60  LYS A HD3  7  
ATOM 10259 H HE2  . LYS A 1 60  ? 6.911   -1.386  11.472  1.00 0.00 ? 60  LYS A HE2  7  
ATOM 10260 H HE3  . LYS A 1 60  ? 5.717   -2.685  11.671  1.00 0.00 ? 60  LYS A HE3  7  
ATOM 10261 H HZ1  . LYS A 1 60  ? 6.811   -2.377  13.677  1.00 0.00 ? 60  LYS A HZ1  7  
ATOM 10262 H HZ2  . LYS A 1 60  ? 7.329   -3.802  13.117  1.00 0.00 ? 60  LYS A HZ2  7  
ATOM 10263 H HZ3  . LYS A 1 60  ? 8.313   -2.444  13.058  1.00 0.00 ? 60  LYS A HZ3  7  
ATOM 10264 N N    . PRO A 1 61  ? 9.419   -5.289  6.581   1.00 0.00 ? 61  PRO A N    7  
ATOM 10265 C CA   . PRO A 1 61  ? 9.704   -6.360  5.635   1.00 0.00 ? 61  PRO A CA   7  
ATOM 10266 C C    . PRO A 1 61  ? 8.391   -7.037  5.239   1.00 0.00 ? 61  PRO A C    7  
ATOM 10267 O O    . PRO A 1 61  ? 7.467   -7.106  6.055   1.00 0.00 ? 61  PRO A O    7  
ATOM 10268 C CB   . PRO A 1 61  ? 10.642  -7.319  6.377   1.00 0.00 ? 61  PRO A CB   7  
ATOM 10269 C CG   . PRO A 1 61  ? 10.344  -7.077  7.852   1.00 0.00 ? 61  PRO A CG   7  
ATOM 10270 C CD   . PRO A 1 61  ? 9.918   -5.612  7.914   1.00 0.00 ? 61  PRO A CD   7  
ATOM 10271 H HA   . PRO A 1 61  ? 10.204  -5.963  4.750   1.00 0.00 ? 61  PRO A HA   7  
ATOM 10272 H HB2  . PRO A 1 61  ? 10.453  -8.365  6.126   1.00 0.00 ? 61  PRO A HB2  7  
ATOM 10273 H HB3  . PRO A 1 61  ? 11.676  -7.044  6.169   1.00 0.00 ? 61  PRO A HB3  7  
ATOM 10274 H HG2  . PRO A 1 61  ? 9.512   -7.712  8.150   1.00 0.00 ? 61  PRO A HG2  7  
ATOM 10275 H HG3  . PRO A 1 61  ? 11.214  -7.274  8.476   1.00 0.00 ? 61  PRO A HG3  7  
ATOM 10276 H HD2  . PRO A 1 61  ? 9.167   -5.485  8.697   1.00 0.00 ? 61  PRO A HD2  7  
ATOM 10277 H HD3  . PRO A 1 61  ? 10.780  -4.980  8.124   1.00 0.00 ? 61  PRO A HD3  7  
ATOM 10278 N N    . TRP A 1 62  ? 8.329   -7.618  4.037   1.00 0.00 ? 62  TRP A N    7  
ATOM 10279 C CA   . TRP A 1 62  ? 7.147   -8.343  3.570   1.00 0.00 ? 62  TRP A CA   7  
ATOM 10280 C C    . TRP A 1 62  ? 6.767   -9.476  4.533   1.00 0.00 ? 62  TRP A C    7  
ATOM 10281 O O    . TRP A 1 62  ? 5.582   -9.748  4.747   1.00 0.00 ? 62  TRP A O    7  
ATOM 10282 C CB   . TRP A 1 62  ? 7.417   -8.878  2.164   1.00 0.00 ? 62  TRP A CB   7  
ATOM 10283 C CG   . TRP A 1 62  ? 6.234   -9.443  1.461   1.00 0.00 ? 62  TRP A CG   7  
ATOM 10284 C CD1  . TRP A 1 62  ? 5.949   -10.756 1.380   1.00 0.00 ? 62  TRP A CD1  7  
ATOM 10285 C CD2  . TRP A 1 62  ? 5.206   -8.764  0.684   1.00 0.00 ? 62  TRP A CD2  7  
ATOM 10286 N NE1  . TRP A 1 62  ? 4.887   -10.950 0.530   1.00 0.00 ? 62  TRP A NE1  7  
ATOM 10287 C CE2  . TRP A 1 62  ? 4.413   -9.757  0.042   1.00 0.00 ? 62  TRP A CE2  7  
ATOM 10288 C CE3  . TRP A 1 62  ? 4.881   -7.416  0.426   1.00 0.00 ? 62  TRP A CE3  7  
ATOM 10289 C CZ2  . TRP A 1 62  ? 3.402   -9.436  -0.866  1.00 0.00 ? 62  TRP A CZ2  7  
ATOM 10290 C CZ3  . TRP A 1 62  ? 3.849   -7.082  -0.469  1.00 0.00 ? 62  TRP A CZ3  7  
ATOM 10291 C CH2  . TRP A 1 62  ? 3.135   -8.091  -1.137  1.00 0.00 ? 62  TRP A CH2  7  
ATOM 10292 H H    . TRP A 1 62  ? 9.130   -7.571  3.418   1.00 0.00 ? 62  TRP A H    7  
ATOM 10293 H HA   . TRP A 1 62  ? 6.312   -7.645  3.524   1.00 0.00 ? 62  TRP A HA   7  
ATOM 10294 H HB2  . TRP A 1 62  ? 7.825   -8.090  1.534   1.00 0.00 ? 62  TRP A HB2  7  
ATOM 10295 H HB3  . TRP A 1 62  ? 8.181   -9.651  2.216   1.00 0.00 ? 62  TRP A HB3  7  
ATOM 10296 H HD1  . TRP A 1 62  ? 6.526   -11.540 1.840   1.00 0.00 ? 62  TRP A HD1  7  
ATOM 10297 H HE1  . TRP A 1 62  ? 4.625   -11.874 0.185   1.00 0.00 ? 62  TRP A HE1  7  
ATOM 10298 H HE3  . TRP A 1 62  ? 5.461   -6.634  0.891   1.00 0.00 ? 62  TRP A HE3  7  
ATOM 10299 H HZ2  . TRP A 1 62  ? 2.843   -10.218 -1.354  1.00 0.00 ? 62  TRP A HZ2  7  
ATOM 10300 H HZ3  . TRP A 1 62  ? 3.640   -6.045  -0.669  1.00 0.00 ? 62  TRP A HZ3  7  
ATOM 10301 H HH2  . TRP A 1 62  ? 2.386   -7.861  -1.872  1.00 0.00 ? 62  TRP A HH2  7  
ATOM 10302 N N    . SER A 1 63  ? 7.766   -10.078 5.179   1.00 0.00 ? 63  SER A N    7  
ATOM 10303 C CA   . SER A 1 63  ? 7.634   -11.058 6.240   1.00 0.00 ? 63  SER A CA   7  
ATOM 10304 C C    . SER A 1 63  ? 6.713   -10.574 7.364   1.00 0.00 ? 63  SER A C    7  
ATOM 10305 O O    . SER A 1 63  ? 5.858   -11.331 7.821   1.00 0.00 ? 63  SER A O    7  
ATOM 10306 C CB   . SER A 1 63  ? 9.038   -11.334 6.791   1.00 0.00 ? 63  SER A CB   7  
ATOM 10307 O OG   . SER A 1 63  ? 9.109   -12.629 7.351   1.00 0.00 ? 63  SER A OG   7  
ATOM 10308 H H    . SER A 1 63  ? 8.704   -9.915  4.820   1.00 0.00 ? 63  SER A H    7  
ATOM 10309 H HA   . SER A 1 63  ? 7.227   -11.970 5.796   1.00 0.00 ? 63  SER A HA   7  
ATOM 10310 H HB2  . SER A 1 63  ? 9.760   -11.284 5.977   1.00 0.00 ? 63  SER A HB2  7  
ATOM 10311 H HB3  . SER A 1 63  ? 9.305   -10.582 7.538   1.00 0.00 ? 63  SER A HB3  7  
ATOM 10312 H HG   . SER A 1 63  ? 9.055   -13.233 6.572   1.00 0.00 ? 63  SER A HG   7  
ATOM 10313 N N    . LYS A 1 64  ? 6.885   -9.332  7.830   1.00 0.00 ? 64  LYS A N    7  
ATOM 10314 C CA   . LYS A 1 64  ? 6.135   -8.784  8.959   1.00 0.00 ? 64  LYS A CA   7  
ATOM 10315 C C    . LYS A 1 64  ? 4.717   -8.381  8.567   1.00 0.00 ? 64  LYS A C    7  
ATOM 10316 O O    . LYS A 1 64  ? 3.919   -8.050  9.448   1.00 0.00 ? 64  LYS A O    7  
ATOM 10317 C CB   . LYS A 1 64  ? 6.897   -7.583  9.548   1.00 0.00 ? 64  LYS A CB   7  
ATOM 10318 C CG   . LYS A 1 64  ? 8.008   -8.007  10.523  1.00 0.00 ? 64  LYS A CG   7  
ATOM 10319 C CD   . LYS A 1 64  ? 7.392   -8.380  11.883  1.00 0.00 ? 64  LYS A CD   7  
ATOM 10320 C CE   . LYS A 1 64  ? 8.370   -8.910  12.937  1.00 0.00 ? 64  LYS A CE   7  
ATOM 10321 N NZ   . LYS A 1 64  ? 9.405   -7.928  13.319  1.00 0.00 ? 64  LYS A NZ   7  
ATOM 10322 H H    . LYS A 1 64  ? 7.484   -8.701  7.312   1.00 0.00 ? 64  LYS A H    7  
ATOM 10323 H HA   . LYS A 1 64  ? 6.033   -9.565  9.711   1.00 0.00 ? 64  LYS A HA   7  
ATOM 10324 H HB2  . LYS A 1 64  ? 7.331   -7.009  8.732   1.00 0.00 ? 64  LYS A HB2  7  
ATOM 10325 H HB3  . LYS A 1 64  ? 6.204   -6.925  10.074  1.00 0.00 ? 64  LYS A HB3  7  
ATOM 10326 H HG2  . LYS A 1 64  ? 8.577   -8.837  10.093  1.00 0.00 ? 64  LYS A HG2  7  
ATOM 10327 H HG3  . LYS A 1 64  ? 8.682   -7.162  10.667  1.00 0.00 ? 64  LYS A HG3  7  
ATOM 10328 H HD2  . LYS A 1 64  ? 6.905   -7.492  12.276  1.00 0.00 ? 64  LYS A HD2  7  
ATOM 10329 H HD3  . LYS A 1 64  ? 6.628   -9.143  11.740  1.00 0.00 ? 64  LYS A HD3  7  
ATOM 10330 H HE2  . LYS A 1 64  ? 7.800   -9.185  13.827  1.00 0.00 ? 64  LYS A HE2  7  
ATOM 10331 H HE3  . LYS A 1 64  ? 8.854   -9.811  12.550  1.00 0.00 ? 64  LYS A HE3  7  
ATOM 10332 H HZ1  . LYS A 1 64  ? 10.066  -7.832  12.552  1.00 0.00 ? 64  LYS A HZ1  7  
ATOM 10333 H HZ2  . LYS A 1 64  ? 9.025   -7.020  13.545  1.00 0.00 ? 64  LYS A HZ2  7  
ATOM 10334 H HZ3  . LYS A 1 64  ? 9.936   -8.287  14.111  1.00 0.00 ? 64  LYS A HZ3  7  
ATOM 10335 N N    . LEU A 1 65  ? 4.407   -8.363  7.271   1.00 0.00 ? 65  LEU A N    7  
ATOM 10336 C CA   . LEU A 1 65  ? 3.088   -8.025  6.778   1.00 0.00 ? 65  LEU A CA   7  
ATOM 10337 C C    . LEU A 1 65  ? 2.292   -9.324  6.666   1.00 0.00 ? 65  LEU A C    7  
ATOM 10338 O O    . LEU A 1 65  ? 2.724   -10.291 6.035   1.00 0.00 ? 65  LEU A O    7  
ATOM 10339 C CB   . LEU A 1 65  ? 3.182   -7.312  5.420   1.00 0.00 ? 65  LEU A CB   7  
ATOM 10340 C CG   . LEU A 1 65  ? 4.010   -6.014  5.390   1.00 0.00 ? 65  LEU A CG   7  
ATOM 10341 C CD1  . LEU A 1 65  ? 4.095   -5.515  3.944   1.00 0.00 ? 65  LEU A CD1  7  
ATOM 10342 C CD2  . LEU A 1 65  ? 3.396   -4.922  6.274   1.00 0.00 ? 65  LEU A CD2  7  
ATOM 10343 H H    . LEU A 1 65  ? 5.065   -8.734  6.596   1.00 0.00 ? 65  LEU A H    7  
ATOM 10344 H HA   . LEU A 1 65  ? 2.593   -7.360  7.486   1.00 0.00 ? 65  LEU A HA   7  
ATOM 10345 H HB2  . LEU A 1 65  ? 3.617   -8.007  4.702   1.00 0.00 ? 65  LEU A HB2  7  
ATOM 10346 H HB3  . LEU A 1 65  ? 2.167   -7.075  5.104   1.00 0.00 ? 65  LEU A HB3  7  
ATOM 10347 H HG   . LEU A 1 65  ? 5.022   -6.213  5.737   1.00 0.00 ? 65  LEU A HG   7  
ATOM 10348 H HD11 . LEU A 1 65  ? 4.536   -6.283  3.310   1.00 0.00 ? 65  LEU A HD11 7  
ATOM 10349 H HD12 . LEU A 1 65  ? 3.101   -5.276  3.567   1.00 0.00 ? 65  LEU A HD12 7  
ATOM 10350 H HD13 . LEU A 1 65  ? 4.729   -4.628  3.894   1.00 0.00 ? 65  LEU A HD13 7  
ATOM 10351 H HD21 . LEU A 1 65  ? 3.957   -3.997  6.153   1.00 0.00 ? 65  LEU A HD21 7  
ATOM 10352 H HD22 . LEU A 1 65  ? 2.357   -4.760  5.997   1.00 0.00 ? 65  LEU A HD22 7  
ATOM 10353 H HD23 . LEU A 1 65  ? 3.448   -5.216  7.324   1.00 0.00 ? 65  LEU A HD23 7  
ATOM 10354 N N    . THR A 1 66  ? 1.100   -9.346  7.245   1.00 0.00 ? 66  THR A N    7  
ATOM 10355 C CA   . THR A 1 66  ? 0.059   -10.320 6.936   1.00 0.00 ? 66  THR A CA   7  
ATOM 10356 C C    . THR A 1 66  ? -0.413  -10.092 5.490   1.00 0.00 ? 66  THR A C    7  
ATOM 10357 O O    . THR A 1 66  ? -0.096  -9.053  4.914   1.00 0.00 ? 66  THR A O    7  
ATOM 10358 C CB   . THR A 1 66  ? -1.073  -10.090 7.950   1.00 0.00 ? 66  THR A CB   7  
ATOM 10359 O OG1  . THR A 1 66  ? -1.442  -8.726  7.939   1.00 0.00 ? 66  THR A OG1  7  
ATOM 10360 C CG2  . THR A 1 66  ? -0.614  -10.441 9.369   1.00 0.00 ? 66  THR A CG2  7  
ATOM 10361 H H    . THR A 1 66  ? 0.751   -8.539  7.741   1.00 0.00 ? 66  THR A H    7  
ATOM 10362 H HA   . THR A 1 66  ? 0.448   -11.332 7.042   1.00 0.00 ? 66  THR A HA   7  
ATOM 10363 H HB   . THR A 1 66  ? -1.937  -10.697 7.685   1.00 0.00 ? 66  THR A HB   7  
ATOM 10364 H HG1  . THR A 1 66  ? -2.152  -8.619  8.616   1.00 0.00 ? 66  THR A HG1  7  
ATOM 10365 H HG21 . THR A 1 66  ? -0.286  -11.479 9.400   1.00 0.00 ? 66  THR A HG21 7  
ATOM 10366 H HG22 . THR A 1 66  ? 0.208   -9.796  9.686   1.00 0.00 ? 66  THR A HG22 7  
ATOM 10367 H HG23 . THR A 1 66  ? -1.444  -10.304 10.061  1.00 0.00 ? 66  THR A HG23 7  
ATOM 10368 N N    . GLN A 1 67  ? -1.233  -10.972 4.897   1.00 0.00 ? 67  GLN A N    7  
ATOM 10369 C CA   . GLN A 1 67  ? -1.913  -10.626 3.637   1.00 0.00 ? 67  GLN A CA   7  
ATOM 10370 C C    . GLN A 1 67  ? -2.695  -9.312  3.795   1.00 0.00 ? 67  GLN A C    7  
ATOM 10371 O O    . GLN A 1 67  ? -2.626  -8.433  2.939   1.00 0.00 ? 67  GLN A O    7  
ATOM 10372 C CB   . GLN A 1 67  ? -2.862  -11.735 3.181   1.00 0.00 ? 67  GLN A CB   7  
ATOM 10373 C CG   . GLN A 1 67  ? -2.166  -13.003 2.652   1.00 0.00 ? 67  GLN A CG   7  
ATOM 10374 C CD   . GLN A 1 67  ? -2.889  -14.276 3.088   1.00 0.00 ? 67  GLN A CD   7  
ATOM 10375 O OE1  . GLN A 1 67  ? -3.183  -14.435 4.273   1.00 0.00 ? 67  GLN A OE1  7  
ATOM 10376 N NE2  . GLN A 1 67  ? -3.120  -15.224 2.198   1.00 0.00 ? 67  GLN A NE2  7  
ATOM 10377 H H    . GLN A 1 67  ? -1.441  -11.858 5.342   1.00 0.00 ? 67  GLN A H    7  
ATOM 10378 H HA   . GLN A 1 67  ? -1.170  -10.483 2.858   1.00 0.00 ? 67  GLN A HA   7  
ATOM 10379 H HB2  . GLN A 1 67  ? -3.535  -11.967 4.003   1.00 0.00 ? 67  GLN A HB2  7  
ATOM 10380 H HB3  . GLN A 1 67  ? -3.470  -11.334 2.374   1.00 0.00 ? 67  GLN A HB3  7  
ATOM 10381 H HG2  . GLN A 1 67  ? -2.119  -12.952 1.564   1.00 0.00 ? 67  GLN A HG2  7  
ATOM 10382 H HG3  . GLN A 1 67  ? -1.144  -13.055 3.028   1.00 0.00 ? 67  GLN A HG3  7  
ATOM 10383 H HE21 . GLN A 1 67  ? -2.847  -15.124 1.233   1.00 0.00 ? 67  GLN A HE21 7  
ATOM 10384 H HE22 . GLN A 1 67  ? -3.449  -16.118 2.534   1.00 0.00 ? 67  GLN A HE22 7  
ATOM 10385 N N    . LYS A 1 68  ? -3.377  -9.139  4.929   1.00 0.00 ? 68  LYS A N    7  
ATOM 10386 C CA   . LYS A 1 68  ? -4.127  -7.928  5.246   1.00 0.00 ? 68  LYS A CA   7  
ATOM 10387 C C    . LYS A 1 68  ? -3.220  -6.693  5.284   1.00 0.00 ? 68  LYS A C    7  
ATOM 10388 O O    . LYS A 1 68  ? -3.629  -5.621  4.846   1.00 0.00 ? 68  LYS A O    7  
ATOM 10389 C CB   . LYS A 1 68  ? -4.863  -8.155  6.577   1.00 0.00 ? 68  LYS A CB   7  
ATOM 10390 C CG   . LYS A 1 68  ? -6.312  -7.646  6.585   1.00 0.00 ? 68  LYS A CG   7  
ATOM 10391 C CD   . LYS A 1 68  ? -6.500  -6.380  7.423   1.00 0.00 ? 68  LYS A CD   7  
ATOM 10392 C CE   . LYS A 1 68  ? -7.996  -6.084  7.491   1.00 0.00 ? 68  LYS A CE   7  
ATOM 10393 N NZ   . LYS A 1 68  ? -8.325  -4.992  8.428   1.00 0.00 ? 68  LYS A NZ   7  
ATOM 10394 H H    . LYS A 1 68  ? -3.403  -9.897  5.594   1.00 0.00 ? 68  LYS A H    7  
ATOM 10395 H HA   . LYS A 1 68  ? -4.852  -7.775  4.444   1.00 0.00 ? 68  LYS A HA   7  
ATOM 10396 H HB2  . LYS A 1 68  ? -4.903  -9.226  6.789   1.00 0.00 ? 68  LYS A HB2  7  
ATOM 10397 H HB3  . LYS A 1 68  ? -4.297  -7.694  7.386   1.00 0.00 ? 68  LYS A HB3  7  
ATOM 10398 H HG2  . LYS A 1 68  ? -6.672  -7.462  5.571   1.00 0.00 ? 68  LYS A HG2  7  
ATOM 10399 H HG3  . LYS A 1 68  ? -6.932  -8.431  7.017   1.00 0.00 ? 68  LYS A HG3  7  
ATOM 10400 H HD2  . LYS A 1 68  ? -6.108  -6.547  8.427   1.00 0.00 ? 68  LYS A HD2  7  
ATOM 10401 H HD3  . LYS A 1 68  ? -5.981  -5.548  6.954   1.00 0.00 ? 68  LYS A HD3  7  
ATOM 10402 H HE2  . LYS A 1 68  ? -8.350  -5.821  6.491   1.00 0.00 ? 68  LYS A HE2  7  
ATOM 10403 H HE3  . LYS A 1 68  ? -8.517  -6.988  7.808   1.00 0.00 ? 68  LYS A HE3  7  
ATOM 10404 H HZ1  . LYS A 1 68  ? -7.942  -4.108  8.115   1.00 0.00 ? 68  LYS A HZ1  7  
ATOM 10405 H HZ2  . LYS A 1 68  ? -9.336  -4.906  8.485   1.00 0.00 ? 68  LYS A HZ2  7  
ATOM 10406 H HZ3  . LYS A 1 68  ? -7.996  -5.189  9.361   1.00 0.00 ? 68  LYS A HZ3  7  
ATOM 10407 N N    . GLY A 1 69  ? -1.979  -6.831  5.755   1.00 0.00 ? 69  GLY A N    7  
ATOM 10408 C CA   . GLY A 1 69  ? -0.984  -5.769  5.745   1.00 0.00 ? 69  GLY A CA   7  
ATOM 10409 C C    . GLY A 1 69  ? -0.281  -5.628  4.392   1.00 0.00 ? 69  GLY A C    7  
ATOM 10410 O O    . GLY A 1 69  ? 0.301   -4.576  4.132   1.00 0.00 ? 69  GLY A O    7  
ATOM 10411 H H    . GLY A 1 69  ? -1.713  -7.711  6.176   1.00 0.00 ? 69  GLY A H    7  
ATOM 10412 H HA2  . GLY A 1 69  ? -1.464  -4.821  5.993   1.00 0.00 ? 69  GLY A HA2  7  
ATOM 10413 H HA3  . GLY A 1 69  ? -0.234  -5.984  6.506   1.00 0.00 ? 69  GLY A HA3  7  
ATOM 10414 N N    . ARG A 1 70  ? -0.304  -6.648  3.528   1.00 0.00 ? 70  ARG A N    7  
ATOM 10415 C CA   . ARG A 1 70  ? 0.235   -6.602  2.169   1.00 0.00 ? 70  ARG A CA   7  
ATOM 10416 C C    . ARG A 1 70  ? -0.748  -5.932  1.220   1.00 0.00 ? 70  ARG A C    7  
ATOM 10417 O O    . ARG A 1 70  ? -0.277  -5.352  0.250   1.00 0.00 ? 70  ARG A O    7  
ATOM 10418 C CB   . ARG A 1 70  ? 0.576   -8.018  1.661   1.00 0.00 ? 70  ARG A CB   7  
ATOM 10419 C CG   . ARG A 1 70  ? 1.791   -8.616  2.385   1.00 0.00 ? 70  ARG A CG   7  
ATOM 10420 C CD   . ARG A 1 70  ? 1.876   -10.139 2.264   1.00 0.00 ? 70  ARG A CD   7  
ATOM 10421 N NE   . ARG A 1 70  ? 2.963   -10.686 3.093   1.00 0.00 ? 70  ARG A NE   7  
ATOM 10422 C CZ   . ARG A 1 70  ? 3.217   -11.981 3.313   1.00 0.00 ? 70  ARG A CZ   7  
ATOM 10423 N NH1  . ARG A 1 70  ? 2.509   -12.921 2.702   1.00 0.00 ? 70  ARG A NH1  7  
ATOM 10424 N NH2  . ARG A 1 70  ? 4.172   -12.331 4.163   1.00 0.00 ? 70  ARG A NH2  7  
ATOM 10425 H H    . ARG A 1 70  ? -0.740  -7.516  3.816   1.00 0.00 ? 70  ARG A H    7  
ATOM 10426 H HA   . ARG A 1 70  ? 1.146   -6.004  2.172   1.00 0.00 ? 70  ARG A HA   7  
ATOM 10427 H HB2  . ARG A 1 70  ? -0.292  -8.663  1.784   1.00 0.00 ? 70  ARG A HB2  7  
ATOM 10428 H HB3  . ARG A 1 70  ? 0.803   -7.978  0.595   1.00 0.00 ? 70  ARG A HB3  7  
ATOM 10429 H HG2  . ARG A 1 70  ? 2.702   -8.158  2.002   1.00 0.00 ? 70  ARG A HG2  7  
ATOM 10430 H HG3  . ARG A 1 70  ? 1.720   -8.388  3.437   1.00 0.00 ? 70  ARG A HG3  7  
ATOM 10431 H HD2  . ARG A 1 70  ? 0.939   -10.572 2.609   1.00 0.00 ? 70  ARG A HD2  7  
ATOM 10432 H HD3  . ARG A 1 70  ? 2.024   -10.411 1.222   1.00 0.00 ? 70  ARG A HD3  7  
ATOM 10433 H HE   . ARG A 1 70  ? 3.537   -10.018 3.596   1.00 0.00 ? 70  ARG A HE   7  
ATOM 10434 H HH11 . ARG A 1 70  ? 2.014   -12.708 1.851   1.00 0.00 ? 70  ARG A HH11 7  
ATOM 10435 H HH12 . ARG A 1 70  ? 2.713   -13.908 2.831   1.00 0.00 ? 70  ARG A HH12 7  
ATOM 10436 H HH21 . ARG A 1 70  ? 4.684   -11.606 4.660   1.00 0.00 ? 70  ARG A HH21 7  
ATOM 10437 H HH22 . ARG A 1 70  ? 4.447   -13.306 4.256   1.00 0.00 ? 70  ARG A HH22 7  
ATOM 10438 N N    . GLU A 1 71  ? -2.059  -5.954  1.493   1.00 0.00 ? 71  GLU A N    7  
ATOM 10439 C CA   . GLU A 1 71  ? -3.081  -5.313  0.658   1.00 0.00 ? 71  GLU A CA   7  
ATOM 10440 C C    . GLU A 1 71  ? -2.702  -3.899  0.205   1.00 0.00 ? 71  GLU A C    7  
ATOM 10441 O O    . GLU A 1 71  ? -2.803  -3.624  -0.991  1.00 0.00 ? 71  GLU A O    7  
ATOM 10442 C CB   . GLU A 1 71  ? -4.436  -5.251  1.375   1.00 0.00 ? 71  GLU A CB   7  
ATOM 10443 C CG   . GLU A 1 71  ? -5.327  -6.468  1.128   1.00 0.00 ? 71  GLU A CG   7  
ATOM 10444 C CD   . GLU A 1 71  ? -6.784  -6.021  1.115   1.00 0.00 ? 71  GLU A CD   7  
ATOM 10445 O OE1  . GLU A 1 71  ? -7.202  -5.487  0.062   1.00 0.00 ? 71  GLU A OE1  7  
ATOM 10446 O OE2  . GLU A 1 71  ? -7.478  -6.218  2.140   1.00 0.00 ? 71  GLU A OE2  7  
ATOM 10447 H H    . GLU A 1 71  ? -2.388  -6.491  2.287   1.00 0.00 ? 71  GLU A H    7  
ATOM 10448 H HA   . GLU A 1 71  ? -3.195  -5.903  -0.253  1.00 0.00 ? 71  GLU A HA   7  
ATOM 10449 H HB2  . GLU A 1 71  ? -4.298  -5.114  2.444   1.00 0.00 ? 71  GLU A HB2  7  
ATOM 10450 H HB3  . GLU A 1 71  ? -4.962  -4.367  1.013   1.00 0.00 ? 71  GLU A HB3  7  
ATOM 10451 H HG2  . GLU A 1 71  ? -5.097  -6.916  0.161   1.00 0.00 ? 71  GLU A HG2  7  
ATOM 10452 H HG3  . GLU A 1 71  ? -5.157  -7.220  1.899   1.00 0.00 ? 71  GLU A HG3  7  
ATOM 10453 N N    . PRO A 1 72  ? -2.287  -2.979  1.095   1.00 0.00 ? 72  PRO A N    7  
ATOM 10454 C CA   . PRO A 1 72  ? -1.833  -1.678  0.647   1.00 0.00 ? 72  PRO A CA   7  
ATOM 10455 C C    . PRO A 1 72  ? -0.552  -1.855  -0.189  1.00 0.00 ? 72  PRO A C    7  
ATOM 10456 O O    . PRO A 1 72  ? -0.546  -1.495  -1.362  1.00 0.00 ? 72  PRO A O    7  
ATOM 10457 C CB   . PRO A 1 72  ? -1.755  -0.815  1.916   1.00 0.00 ? 72  PRO A CB   7  
ATOM 10458 C CG   . PRO A 1 72  ? -1.543  -1.815  3.049   1.00 0.00 ? 72  PRO A CG   7  
ATOM 10459 C CD   . PRO A 1 72  ? -2.291  -3.051  2.551   1.00 0.00 ? 72  PRO A CD   7  
ATOM 10460 H HA   . PRO A 1 72  ? -2.591  -1.238  -0.001  1.00 0.00 ? 72  PRO A HA   7  
ATOM 10461 H HB2  . PRO A 1 72  ? -0.976  -0.059  1.889   1.00 0.00 ? 72  PRO A HB2  7  
ATOM 10462 H HB3  . PRO A 1 72  ? -2.718  -0.321  2.065   1.00 0.00 ? 72  PRO A HB3  7  
ATOM 10463 H HG2  . PRO A 1 72  ? -0.480  -2.036  3.145   1.00 0.00 ? 72  PRO A HG2  7  
ATOM 10464 H HG3  . PRO A 1 72  ? -1.951  -1.452  3.995   1.00 0.00 ? 72  PRO A HG3  7  
ATOM 10465 H HD2  . PRO A 1 72  ? -1.802  -3.943  2.922   1.00 0.00 ? 72  PRO A HD2  7  
ATOM 10466 H HD3  . PRO A 1 72  ? -3.320  -3.041  2.904   1.00 0.00 ? 72  PRO A HD3  7  
ATOM 10467 N N    . PHE A 1 73  ? 0.507   -2.485  0.323   1.00 0.00 ? 73  PHE A N    7  
ATOM 10468 C CA   . PHE A 1 73  ? 1.769   -2.630  -0.409  1.00 0.00 ? 73  PHE A CA   7  
ATOM 10469 C C    . PHE A 1 73  ? 1.616   -3.223  -1.819  1.00 0.00 ? 73  PHE A C    7  
ATOM 10470 O O    . PHE A 1 73  ? 2.393   -2.886  -2.705  1.00 0.00 ? 73  PHE A O    7  
ATOM 10471 C CB   . PHE A 1 73  ? 2.731   -3.505  0.398   1.00 0.00 ? 73  PHE A CB   7  
ATOM 10472 C CG   . PHE A 1 73  ? 3.438   -2.776  1.530   1.00 0.00 ? 73  PHE A CG   7  
ATOM 10473 C CD1  . PHE A 1 73  ? 2.841   -2.615  2.796   1.00 0.00 ? 73  PHE A CD1  7  
ATOM 10474 C CD2  . PHE A 1 73  ? 4.709   -2.217  1.297   1.00 0.00 ? 73  PHE A CD2  7  
ATOM 10475 C CE1  . PHE A 1 73  ? 3.514   -1.913  3.818   1.00 0.00 ? 73  PHE A CE1  7  
ATOM 10476 C CE2  . PHE A 1 73  ? 5.387   -1.539  2.325   1.00 0.00 ? 73  PHE A CE2  7  
ATOM 10477 C CZ   . PHE A 1 73  ? 4.792   -1.372  3.580   1.00 0.00 ? 73  PHE A CZ   7  
ATOM 10478 H H    . PHE A 1 73  ? 0.458   -2.824  1.268   1.00 0.00 ? 73  PHE A H    7  
ATOM 10479 H HA   . PHE A 1 73  ? 2.199   -1.630  -0.531  1.00 0.00 ? 73  PHE A HA   7  
ATOM 10480 H HB2  . PHE A 1 73  ? 2.199   -4.401  0.743   1.00 0.00 ? 73  PHE A HB2  7  
ATOM 10481 H HB3  . PHE A 1 73  ? 3.509   -3.847  -0.284  1.00 0.00 ? 73  PHE A HB3  7  
ATOM 10482 H HD1  . PHE A 1 73  ? 1.856   -3.018  2.970   1.00 0.00 ? 73  PHE A HD1  7  
ATOM 10483 H HD2  . PHE A 1 73  ? 5.167   -2.275  0.317   1.00 0.00 ? 73  PHE A HD2  7  
ATOM 10484 H HE1  . PHE A 1 73  ? 3.044   -1.779  4.780   1.00 0.00 ? 73  PHE A HE1  7  
ATOM 10485 H HE2  . PHE A 1 73  ? 6.360   -1.111  2.138   1.00 0.00 ? 73  PHE A HE2  7  
ATOM 10486 H HZ   . PHE A 1 73  ? 5.332   -0.800  4.321   1.00 0.00 ? 73  PHE A HZ   7  
ATOM 10487 N N    . ILE A 1 74  ? 0.653   -4.109  -2.057  1.00 0.00 ? 74  ILE A N    7  
ATOM 10488 C CA   . ILE A 1 74  ? 0.312   -4.659  -3.370  1.00 0.00 ? 74  ILE A CA   7  
ATOM 10489 C C    . ILE A 1 74  ? -0.129  -3.536  -4.291  1.00 0.00 ? 74  ILE A C    7  
ATOM 10490 O O    . ILE A 1 74  ? 0.366   -3.431  -5.406  1.00 0.00 ? 74  ILE A O    7  
ATOM 10491 C CB   . ILE A 1 74  ? -0.805  -5.717  -3.166  1.00 0.00 ? 74  ILE A CB   7  
ATOM 10492 C CG1  . ILE A 1 74  ? -0.134  -7.006  -2.658  1.00 0.00 ? 74  ILE A CG1  7  
ATOM 10493 C CG2  . ILE A 1 74  ? -1.681  -5.984  -4.406  1.00 0.00 ? 74  ILE A CG2  7  
ATOM 10494 C CD1  . ILE A 1 74  ? -1.062  -7.927  -1.870  1.00 0.00 ? 74  ILE A CD1  7  
ATOM 10495 H H    . ILE A 1 74  ? 0.066   -4.384  -1.274  1.00 0.00 ? 74  ILE A H    7  
ATOM 10496 H HA   . ILE A 1 74  ? 1.200   -5.105  -3.840  1.00 0.00 ? 74  ILE A HA   7  
ATOM 10497 H HB   . ILE A 1 74  ? -1.478  -5.357  -2.386  1.00 0.00 ? 74  ILE A HB   7  
ATOM 10498 H HG12 . ILE A 1 74  ? 0.314   -7.553  -3.488  1.00 0.00 ? 74  ILE A HG12 7  
ATOM 10499 H HG13 . ILE A 1 74  ? 0.652   -6.726  -1.963  1.00 0.00 ? 74  ILE A HG13 7  
ATOM 10500 H HG21 . ILE A 1 74  ? -1.062  -6.241  -5.268  1.00 0.00 ? 74  ILE A HG21 7  
ATOM 10501 H HG22 . ILE A 1 74  ? -2.382  -6.795  -4.205  1.00 0.00 ? 74  ILE A HG22 7  
ATOM 10502 H HG23 . ILE A 1 74  ? -2.275  -5.092  -4.636  1.00 0.00 ? 74  ILE A HG23 7  
ATOM 10503 H HD11 . ILE A 1 74  ? -1.886  -8.271  -2.492  1.00 0.00 ? 74  ILE A HD11 7  
ATOM 10504 H HD12 . ILE A 1 74  ? -0.492  -8.783  -1.510  1.00 0.00 ? 74  ILE A HD12 7  
ATOM 10505 H HD13 . ILE A 1 74  ? -1.441  -7.386  -1.005  1.00 0.00 ? 74  ILE A HD13 7  
ATOM 10506 N N    . ARG A 1 75  ? -1.052  -2.692  -3.848  1.00 0.00 ? 75  ARG A N    7  
ATOM 10507 C CA   . ARG A 1 75  ? -1.507  -1.557  -4.614  1.00 0.00 ? 75  ARG A CA   7  
ATOM 10508 C C    . ARG A 1 75  ? -0.360  -0.596  -4.884  1.00 0.00 ? 75  ARG A C    7  
ATOM 10509 O O    . ARG A 1 75  ? -0.303  -0.045  -5.980  1.00 0.00 ? 75  ARG A O    7  
ATOM 10510 C CB   . ARG A 1 75  ? -2.655  -0.916  -3.849  1.00 0.00 ? 75  ARG A CB   7  
ATOM 10511 C CG   . ARG A 1 75  ? -3.843  -1.873  -3.741  1.00 0.00 ? 75  ARG A CG   7  
ATOM 10512 C CD   . ARG A 1 75  ? -4.989  -1.179  -3.008  1.00 0.00 ? 75  ARG A CD   7  
ATOM 10513 N NE   . ARG A 1 75  ? -6.241  -1.891  -3.279  1.00 0.00 ? 75  ARG A NE   7  
ATOM 10514 C CZ   . ARG A 1 75  ? -6.772  -2.944  -2.657  1.00 0.00 ? 75  ARG A CZ   7  
ATOM 10515 N NH1  . ARG A 1 75  ? -6.186  -3.480  -1.593  1.00 0.00 ? 75  ARG A NH1  7  
ATOM 10516 N NH2  . ARG A 1 75  ? -7.902  -3.438  -3.138  1.00 0.00 ? 75  ARG A NH2  7  
ATOM 10517 H H    . ARG A 1 75  ? -1.399  -2.736  -2.898  1.00 0.00 ? 75  ARG A H    7  
ATOM 10518 H HA   . ARG A 1 75  ? -1.879  -1.903  -5.579  1.00 0.00 ? 75  ARG A HA   7  
ATOM 10519 H HB2  . ARG A 1 75  ? -2.340  -0.634  -2.853  1.00 0.00 ? 75  ARG A HB2  7  
ATOM 10520 H HB3  . ARG A 1 75  ? -2.947  -0.020  -4.371  1.00 0.00 ? 75  ARG A HB3  7  
ATOM 10521 H HG2  . ARG A 1 75  ? -4.143  -2.194  -4.739  1.00 0.00 ? 75  ARG A HG2  7  
ATOM 10522 H HG3  . ARG A 1 75  ? -3.568  -2.771  -3.194  1.00 0.00 ? 75  ARG A HG3  7  
ATOM 10523 H HD2  . ARG A 1 75  ? -4.774  -1.120  -1.934  1.00 0.00 ? 75  ARG A HD2  7  
ATOM 10524 H HD3  . ARG A 1 75  ? -5.090  -0.162  -3.392  1.00 0.00 ? 75  ARG A HD3  7  
ATOM 10525 H HE   . ARG A 1 75  ? -6.748  -1.553  -4.093  1.00 0.00 ? 75  ARG A HE   7  
ATOM 10526 H HH11 . ARG A 1 75  ? -5.320  -3.103  -1.245  1.00 0.00 ? 75  ARG A HH11 7  
ATOM 10527 H HH12 . ARG A 1 75  ? -6.640  -4.204  -1.027  1.00 0.00 ? 75  ARG A HH12 7  
ATOM 10528 H HH21 . ARG A 1 75  ? -8.260  -3.042  -4.011  1.00 0.00 ? 75  ARG A HH21 7  
ATOM 10529 H HH22 . ARG A 1 75  ? -8.413  -4.203  -2.702  1.00 0.00 ? 75  ARG A HH22 7  
ATOM 10530 N N    . MET A 1 76  ? 0.589   -0.447  -3.947  1.00 0.00 ? 76  MET A N    7  
ATOM 10531 C CA   . MET A 1 76  ? 1.809   0.303   -4.206  1.00 0.00 ? 76  MET A CA   7  
ATOM 10532 C C    . MET A 1 76  ? 2.561   -0.262  -5.425  1.00 0.00 ? 76  MET A C    7  
ATOM 10533 O O    . MET A 1 76  ? 2.963   0.505   -6.305  1.00 0.00 ? 76  MET A O    7  
ATOM 10534 C CB   . MET A 1 76  ? 2.684   0.318   -2.936  1.00 0.00 ? 76  MET A CB   7  
ATOM 10535 C CG   . MET A 1 76  ? 3.137   1.723   -2.560  1.00 0.00 ? 76  MET A CG   7  
ATOM 10536 S SD   . MET A 1 76  ? 4.518   1.840   -1.387  1.00 0.00 ? 76  MET A SD   7  
ATOM 10537 C CE   . MET A 1 76  ? 3.626   1.547   0.140   1.00 0.00 ? 76  MET A CE   7  
ATOM 10538 H H    . MET A 1 76  ? 0.480   -0.844  -3.016  1.00 0.00 ? 76  MET A H    7  
ATOM 10539 H HA   . MET A 1 76  ? 1.493   1.315   -4.449  1.00 0.00 ? 76  MET A HA   7  
ATOM 10540 H HB2  . MET A 1 76  ? 2.113   -0.051  -2.093  1.00 0.00 ? 76  MET A HB2  7  
ATOM 10541 H HB3  . MET A 1 76  ? 3.552   -0.323  -3.072  1.00 0.00 ? 76  MET A HB3  7  
ATOM 10542 H HG2  . MET A 1 76  ? 3.446   2.215   -3.471  1.00 0.00 ? 76  MET A HG2  7  
ATOM 10543 H HG3  . MET A 1 76  ? 2.278   2.238   -2.135  1.00 0.00 ? 76  MET A HG3  7  
ATOM 10544 H HE1  . MET A 1 76  ? 2.992   0.669   -0.008  1.00 0.00 ? 76  MET A HE1  7  
ATOM 10545 H HE2  . MET A 1 76  ? 4.344   1.391   0.946   1.00 0.00 ? 76  MET A HE2  7  
ATOM 10546 H HE3  . MET A 1 76  ? 3.013   2.419   0.372   1.00 0.00 ? 76  MET A HE3  7  
ATOM 10547 N N    . GLN A 1 77  ? 2.729   -1.594  -5.479  1.00 0.00 ? 77  GLN A N    7  
ATOM 10548 C CA   . GLN A 1 77  ? 3.418   -2.302  -6.564  1.00 0.00 ? 77  GLN A CA   7  
ATOM 10549 C C    . GLN A 1 77  ? 2.665   -2.139  -7.875  1.00 0.00 ? 77  GLN A C    7  
ATOM 10550 O O    . GLN A 1 77  ? 3.282   -1.918  -8.913  1.00 0.00 ? 77  GLN A O    7  
ATOM 10551 C CB   . GLN A 1 77  ? 3.548   -3.813  -6.276  1.00 0.00 ? 77  GLN A CB   7  
ATOM 10552 C CG   . GLN A 1 77  ? 4.409   -4.096  -5.044  1.00 0.00 ? 77  GLN A CG   7  
ATOM 10553 C CD   . GLN A 1 77  ? 4.218   -5.479  -4.435  1.00 0.00 ? 77  GLN A CD   7  
ATOM 10554 O OE1  . GLN A 1 77  ? 4.717   -6.484  -4.921  1.00 0.00 ? 77  GLN A OE1  7  
ATOM 10555 N NE2  . GLN A 1 77  ? 3.558   -5.547  -3.297  1.00 0.00 ? 77  GLN A NE2  7  
ATOM 10556 H H    . GLN A 1 77  ? 2.334   -2.164  -4.740  1.00 0.00 ? 77  GLN A H    7  
ATOM 10557 H HA   . GLN A 1 77  ? 4.415   -1.878  -6.690  1.00 0.00 ? 77  GLN A HA   7  
ATOM 10558 H HB2  . GLN A 1 77  ? 2.564   -4.256  -6.142  1.00 0.00 ? 77  GLN A HB2  7  
ATOM 10559 H HB3  . GLN A 1 77  ? 4.011   -4.289  -7.144  1.00 0.00 ? 77  GLN A HB3  7  
ATOM 10560 H HG2  . GLN A 1 77  ? 5.444   -4.008  -5.326  1.00 0.00 ? 77  GLN A HG2  7  
ATOM 10561 H HG3  . GLN A 1 77  ? 4.208   -3.349  -4.284  1.00 0.00 ? 77  GLN A HG3  7  
ATOM 10562 H HE21 . GLN A 1 77  ? 3.153   -4.694  -2.928  1.00 0.00 ? 77  GLN A HE21 7  
ATOM 10563 H HE22 . GLN A 1 77  ? 3.506   -6.440  -2.833  1.00 0.00 ? 77  GLN A HE22 7  
ATOM 10564 N N    . LEU A 1 78  ? 1.343   -2.286  -7.848  1.00 0.00 ? 78  LEU A N    7  
ATOM 10565 C CA   . LEU A 1 78  ? 0.520   -2.232  -9.041  1.00 0.00 ? 78  LEU A CA   7  
ATOM 10566 C C    . LEU A 1 78  ? 0.539   -0.829  -9.595  1.00 0.00 ? 78  LEU A C    7  
ATOM 10567 O O    . LEU A 1 78  ? 1.016   -0.672  -10.715 1.00 0.00 ? 78  LEU A O    7  
ATOM 10568 C CB   . LEU A 1 78  ? -0.908  -2.722  -8.752  1.00 0.00 ? 78  LEU A CB   7  
ATOM 10569 C CG   . LEU A 1 78  ? -0.987  -4.230  -8.438  1.00 0.00 ? 78  LEU A CG   7  
ATOM 10570 C CD1  . LEU A 1 78  ? -2.356  -4.592  -7.856  1.00 0.00 ? 78  LEU A CD1  7  
ATOM 10571 C CD2  . LEU A 1 78  ? -0.713  -5.087  -9.675  1.00 0.00 ? 78  LEU A CD2  7  
ATOM 10572 H H    . LEU A 1 78  ? 0.907   -2.509  -6.961  1.00 0.00 ? 78  LEU A H    7  
ATOM 10573 H HA   . LEU A 1 78  ? 0.993   -2.833  -9.816  1.00 0.00 ? 78  LEU A HA   7  
ATOM 10574 H HB2  . LEU A 1 78  ? -1.281  -2.163  -7.895  1.00 0.00 ? 78  LEU A HB2  7  
ATOM 10575 H HB3  . LEU A 1 78  ? -1.547  -2.490  -9.609  1.00 0.00 ? 78  LEU A HB3  7  
ATOM 10576 H HG   . LEU A 1 78  ? -0.238  -4.480  -7.689  1.00 0.00 ? 78  LEU A HG   7  
ATOM 10577 H HD11 . LEU A 1 78  ? -2.529  -4.018  -6.947  1.00 0.00 ? 78  LEU A HD11 7  
ATOM 10578 H HD12 . LEU A 1 78  ? -3.141  -4.361  -8.577  1.00 0.00 ? 78  LEU A HD12 7  
ATOM 10579 H HD13 . LEU A 1 78  ? -2.394  -5.655  -7.618  1.00 0.00 ? 78  LEU A HD13 7  
ATOM 10580 H HD21 . LEU A 1 78  ? -0.801  -6.146  -9.433  1.00 0.00 ? 78  LEU A HD21 7  
ATOM 10581 H HD22 . LEU A 1 78  ? -1.424  -4.848  -10.462 1.00 0.00 ? 78  LEU A HD22 7  
ATOM 10582 H HD23 . LEU A 1 78  ? 0.294   -4.913  -10.049 1.00 0.00 ? 78  LEU A HD23 7  
ATOM 10583 N N    . TRP A 1 79  ? 0.106   0.171   -8.822  1.00 0.00 ? 79  TRP A N    7  
ATOM 10584 C CA   . TRP A 1 79  ? 0.013   1.574   -9.216  1.00 0.00 ? 79  TRP A CA   7  
ATOM 10585 C C    . TRP A 1 79  ? 1.256   2.061   -9.967  1.00 0.00 ? 79  TRP A C    7  
ATOM 10586 O O    . TRP A 1 79  ? 1.115   2.856   -10.893 1.00 0.00 ? 79  TRP A O    7  
ATOM 10587 C CB   . TRP A 1 79  ? -0.246  2.417   -7.956  1.00 0.00 ? 79  TRP A CB   7  
ATOM 10588 C CG   . TRP A 1 79  ? -0.248  3.910   -8.117  1.00 0.00 ? 79  TRP A CG   7  
ATOM 10589 C CD1  . TRP A 1 79  ? -1.327  4.717   -8.249  1.00 0.00 ? 79  TRP A CD1  7  
ATOM 10590 C CD2  . TRP A 1 79  ? 0.906   4.801   -8.113  1.00 0.00 ? 79  TRP A CD2  7  
ATOM 10591 N NE1  . TRP A 1 79  ? -0.918  6.038   -8.276  1.00 0.00 ? 79  TRP A NE1  7  
ATOM 10592 C CE2  . TRP A 1 79  ? 0.451   6.146   -8.219  1.00 0.00 ? 79  TRP A CE2  7  
ATOM 10593 C CE3  . TRP A 1 79  ? 2.296   4.603   -7.985  1.00 0.00 ? 79  TRP A CE3  7  
ATOM 10594 C CZ2  . TRP A 1 79  ? 1.327   7.243   -8.207  1.00 0.00 ? 79  TRP A CZ2  7  
ATOM 10595 C CZ3  . TRP A 1 79  ? 3.184   5.692   -7.973  1.00 0.00 ? 79  TRP A CZ3  7  
ATOM 10596 C CH2  . TRP A 1 79  ? 2.709   7.012   -8.102  1.00 0.00 ? 79  TRP A CH2  7  
ATOM 10597 H H    . TRP A 1 79  ? -0.217  -0.056  -7.884  1.00 0.00 ? 79  TRP A H    7  
ATOM 10598 H HA   . TRP A 1 79  ? -0.840  1.680   -9.885  1.00 0.00 ? 79  TRP A HA   7  
ATOM 10599 H HB2  . TRP A 1 79  ? -1.191  2.104   -7.512  1.00 0.00 ? 79  TRP A HB2  7  
ATOM 10600 H HB3  . TRP A 1 79  ? 0.534   2.185   -7.230  1.00 0.00 ? 79  TRP A HB3  7  
ATOM 10601 H HD1  . TRP A 1 79  ? -2.358  4.397   -8.282  1.00 0.00 ? 79  TRP A HD1  7  
ATOM 10602 H HE1  . TRP A 1 79  ? -1.548  6.842   -8.257  1.00 0.00 ? 79  TRP A HE1  7  
ATOM 10603 H HE3  . TRP A 1 79  ? 2.666   3.596   -7.844  1.00 0.00 ? 79  TRP A HE3  7  
ATOM 10604 H HZ2  . TRP A 1 79  ? 0.930   8.250   -8.262  1.00 0.00 ? 79  TRP A HZ2  7  
ATOM 10605 H HZ3  . TRP A 1 79  ? 4.233   5.498   -7.810  1.00 0.00 ? 79  TRP A HZ3  7  
ATOM 10606 H HH2  . TRP A 1 79  ? 3.398   7.845   -8.065  1.00 0.00 ? 79  TRP A HH2  7  
ATOM 10607 N N    . LEU A 1 80  ? 2.446   1.558   -9.615  1.00 0.00 ? 80  LEU A N    7  
ATOM 10608 C CA   . LEU A 1 80  ? 3.700   1.878   -10.289 1.00 0.00 ? 80  LEU A CA   7  
ATOM 10609 C C    . LEU A 1 80  ? 3.604   1.667   -11.800 1.00 0.00 ? 80  LEU A C    7  
ATOM 10610 O O    . LEU A 1 80  ? 3.987   2.576   -12.537 1.00 0.00 ? 80  LEU A O    7  
ATOM 10611 C CB   . LEU A 1 80  ? 4.868   1.066   -9.698  1.00 0.00 ? 80  LEU A CB   7  
ATOM 10612 C CG   . LEU A 1 80  ? 5.641   1.857   -8.631  1.00 0.00 ? 80  LEU A CG   7  
ATOM 10613 C CD1  . LEU A 1 80  ? 6.381   0.884   -7.719  1.00 0.00 ? 80  LEU A CD1  7  
ATOM 10614 C CD2  . LEU A 1 80  ? 6.658   2.826   -9.245  1.00 0.00 ? 80  LEU A CD2  7  
ATOM 10615 H H    . LEU A 1 80  ? 2.448   0.844   -8.899  1.00 0.00 ? 80  LEU A H    7  
ATOM 10616 H HA   . LEU A 1 80  ? 3.895   2.937   -10.120 1.00 0.00 ? 80  LEU A HA   7  
ATOM 10617 H HB2  . LEU A 1 80  ? 4.487   0.143   -9.260  1.00 0.00 ? 80  LEU A HB2  7  
ATOM 10618 H HB3  . LEU A 1 80  ? 5.562   0.789   -10.495 1.00 0.00 ? 80  LEU A HB3  7  
ATOM 10619 H HG   . LEU A 1 80  ? 4.936   2.424   -8.020  1.00 0.00 ? 80  LEU A HG   7  
ATOM 10620 H HD11 . LEU A 1 80  ? 7.001   0.205   -8.306  1.00 0.00 ? 80  LEU A HD11 7  
ATOM 10621 H HD12 . LEU A 1 80  ? 7.015   1.435   -7.030  1.00 0.00 ? 80  LEU A HD12 7  
ATOM 10622 H HD13 . LEU A 1 80  ? 5.647   0.312   -7.152  1.00 0.00 ? 80  LEU A HD13 7  
ATOM 10623 H HD21 . LEU A 1 80  ? 6.178   3.464   -9.984  1.00 0.00 ? 80  LEU A HD21 7  
ATOM 10624 H HD22 . LEU A 1 80  ? 7.090   3.451   -8.463  1.00 0.00 ? 80  LEU A HD22 7  
ATOM 10625 H HD23 . LEU A 1 80  ? 7.467   2.267   -9.726  1.00 0.00 ? 80  LEU A HD23 7  
ATOM 10626 N N    . SER A 1 81  ? 3.159   0.492   -12.270 1.00 0.00 ? 81  SER A N    7  
ATOM 10627 C CA   . SER A 1 81  ? 2.940   0.280   -13.706 1.00 0.00 ? 81  SER A CA   7  
ATOM 10628 C C    . SER A 1 81  ? 1.482   0.483   -14.150 1.00 0.00 ? 81  SER A C    7  
ATOM 10629 O O    . SER A 1 81  ? 1.238   0.733   -15.329 1.00 0.00 ? 81  SER A O    7  
ATOM 10630 C CB   . SER A 1 81  ? 3.521   -1.074  -14.143 1.00 0.00 ? 81  SER A CB   7  
ATOM 10631 O OG   . SER A 1 81  ? 4.458   -0.903  -15.197 1.00 0.00 ? 81  SER A OG   7  
ATOM 10632 H H    . SER A 1 81  ? 2.790   -0.207  -11.621 1.00 0.00 ? 81  SER A H    7  
ATOM 10633 H HA   . SER A 1 81  ? 3.508   1.040   -14.242 1.00 0.00 ? 81  SER A HA   7  
ATOM 10634 H HB2  . SER A 1 81  ? 4.037   -1.548  -13.310 1.00 0.00 ? 81  SER A HB2  7  
ATOM 10635 H HB3  . SER A 1 81  ? 2.719   -1.734  -14.474 1.00 0.00 ? 81  SER A HB3  7  
ATOM 10636 H HG   . SER A 1 81  ? 5.331   -1.243  -14.887 1.00 0.00 ? 81  SER A HG   7  
ATOM 10637 N N    . ASP A 1 82  ? 0.520   0.337   -13.239 1.00 0.00 ? 82  ASP A N    7  
ATOM 10638 C CA   . ASP A 1 82  ? -0.905  0.193   -13.542 1.00 0.00 ? 82  ASP A CA   7  
ATOM 10639 C C    . ASP A 1 82  ? -1.585  1.560   -13.668 1.00 0.00 ? 82  ASP A C    7  
ATOM 10640 O O    . ASP A 1 82  ? -2.374  1.781   -14.592 1.00 0.00 ? 82  ASP A O    7  
ATOM 10641 C CB   . ASP A 1 82  ? -1.563  -0.646  -12.431 1.00 0.00 ? 82  ASP A CB   7  
ATOM 10642 C CG   . ASP A 1 82  ? -3.036  -0.986  -12.671 1.00 0.00 ? 82  ASP A CG   7  
ATOM 10643 O OD1  . ASP A 1 82  ? -3.857  -0.052  -12.780 1.00 0.00 ? 82  ASP A OD1  7  
ATOM 10644 O OD2  . ASP A 1 82  ? -3.392  -2.184  -12.642 1.00 0.00 ? 82  ASP A OD2  7  
ATOM 10645 H H    . ASP A 1 82  ? 0.798   0.150   -12.284 1.00 0.00 ? 82  ASP A H    7  
ATOM 10646 H HA   . ASP A 1 82  ? -1.013  -0.347  -14.481 1.00 0.00 ? 82  ASP A HA   7  
ATOM 10647 H HB2  . ASP A 1 82  ? -1.008  -1.581  -12.329 1.00 0.00 ? 82  ASP A HB2  7  
ATOM 10648 H HB3  . ASP A 1 82  ? -1.497  -0.104  -11.486 1.00 0.00 ? 82  ASP A HB3  7  
ATOM 10649 N N    . GLN A 1 83  ? -1.246  2.475   -12.754 1.00 0.00 ? 83  GLN A N    7  
ATOM 10650 C CA   . GLN A 1 83  ? -1.817  3.799   -12.503 1.00 0.00 ? 83  GLN A CA   7  
ATOM 10651 C C    . GLN A 1 83  ? -3.312  3.831   -12.126 1.00 0.00 ? 83  GLN A C    7  
ATOM 10652 O O    . GLN A 1 83  ? -3.804  4.914   -11.817 1.00 0.00 ? 83  GLN A O    7  
ATOM 10653 C CB   . GLN A 1 83  ? -1.453  4.786   -13.627 1.00 0.00 ? 83  GLN A CB   7  
ATOM 10654 C CG   . GLN A 1 83  ? 0.061   5.043   -13.697 1.00 0.00 ? 83  GLN A CG   7  
ATOM 10655 C CD   . GLN A 1 83  ? 0.382   6.233   -14.601 1.00 0.00 ? 83  GLN A CD   7  
ATOM 10656 O OE1  . GLN A 1 83  ? 0.062   6.227   -15.786 1.00 0.00 ? 83  GLN A OE1  7  
ATOM 10657 N NE2  . GLN A 1 83  ? 1.008   7.280   -14.084 1.00 0.00 ? 83  GLN A NE2  7  
ATOM 10658 H H    . GLN A 1 83  ? -0.472  2.232   -12.150 1.00 0.00 ? 83  GLN A H    7  
ATOM 10659 H HA   . GLN A 1 83  ? -1.308  4.169   -11.611 1.00 0.00 ? 83  GLN A HA   7  
ATOM 10660 H HB2  . GLN A 1 83  ? -1.814  4.415   -14.586 1.00 0.00 ? 83  GLN A HB2  7  
ATOM 10661 H HB3  . GLN A 1 83  ? -1.941  5.740   -13.432 1.00 0.00 ? 83  GLN A HB3  7  
ATOM 10662 H HG2  . GLN A 1 83  ? 0.433   5.233   -12.688 1.00 0.00 ? 83  GLN A HG2  7  
ATOM 10663 H HG3  . GLN A 1 83  ? 0.558   4.158   -14.096 1.00 0.00 ? 83  GLN A HG3  7  
ATOM 10664 H HE21 . GLN A 1 83  ? 1.215   7.330   -13.091 1.00 0.00 ? 83  GLN A HE21 7  
ATOM 10665 H HE22 . GLN A 1 83  ? 1.183   8.080   -14.673 1.00 0.00 ? 83  GLN A HE22 7  
ATOM 10666 N N    . LEU A 1 84  ? -4.009  2.688   -12.025 1.00 0.00 ? 84  LEU A N    7  
ATOM 10667 C CA   . LEU A 1 84  ? -5.416  2.552   -11.627 1.00 0.00 ? 84  LEU A CA   7  
ATOM 10668 C C    . LEU A 1 84  ? -6.342  3.508   -12.372 1.00 0.00 ? 84  LEU A C    7  
ATOM 10669 O O    . LEU A 1 84  ? -6.684  4.581   -11.873 1.00 0.00 ? 84  LEU A O    7  
ATOM 10670 C CB   . LEU A 1 84  ? -5.616  2.724   -10.127 1.00 0.00 ? 84  LEU A CB   7  
ATOM 10671 C CG   . LEU A 1 84  ? -5.049  1.557   -9.299  1.00 0.00 ? 84  LEU A CG   7  
ATOM 10672 C CD1  . LEU A 1 84  ? -3.691  1.917   -8.699  1.00 0.00 ? 84  LEU A CD1  7  
ATOM 10673 C CD2  . LEU A 1 84  ? -6.024  1.217   -8.177  1.00 0.00 ? 84  LEU A CD2  7  
ATOM 10674 H H    . LEU A 1 84  ? -3.565  1.811   -12.283 1.00 0.00 ? 84  LEU A H    7  
ATOM 10675 H HA   . LEU A 1 84  ? -5.742  1.532   -11.841 1.00 0.00 ? 84  LEU A HA   7  
ATOM 10676 H HB2  . LEU A 1 84  ? -5.193  3.672   -9.793  1.00 0.00 ? 84  LEU A HB2  7  
ATOM 10677 H HB3  . LEU A 1 84  ? -6.701  2.787   -10.029 1.00 0.00 ? 84  LEU A HB3  7  
ATOM 10678 H HG   . LEU A 1 84  ? -4.922  0.676   -9.930  1.00 0.00 ? 84  LEU A HG   7  
ATOM 10679 H HD11 . LEU A 1 84  ? -3.011  2.209   -9.495  1.00 0.00 ? 84  LEU A HD11 7  
ATOM 10680 H HD12 . LEU A 1 84  ? -3.798  2.733   -7.987  1.00 0.00 ? 84  LEU A HD12 7  
ATOM 10681 H HD13 . LEU A 1 84  ? -3.281  1.048   -8.182  1.00 0.00 ? 84  LEU A HD13 7  
ATOM 10682 H HD21 . LEU A 1 84  ? -6.948  0.865   -8.631  1.00 0.00 ? 84  LEU A HD21 7  
ATOM 10683 H HD22 . LEU A 1 84  ? -5.611  0.427   -7.550  1.00 0.00 ? 84  LEU A HD22 7  
ATOM 10684 H HD23 . LEU A 1 84  ? -6.218  2.099   -7.566  1.00 0.00 ? 84  LEU A HD23 7  
ATOM 10685 N N    . GLY A 1 85  ? -6.778  3.114   -13.564 1.00 0.00 ? 85  GLY A N    7  
ATOM 10686 C CA   . GLY A 1 85  ? -7.210  4.076   -14.560 1.00 0.00 ? 85  GLY A CA   7  
ATOM 10687 C C    . GLY A 1 85  ? -8.470  4.898   -14.261 1.00 0.00 ? 85  GLY A C    7  
ATOM 10688 O O    . GLY A 1 85  ? -8.699  5.908   -14.931 1.00 0.00 ? 85  GLY A O    7  
ATOM 10689 H H    . GLY A 1 85  ? -6.348  2.267   -13.920 1.00 0.00 ? 85  GLY A H    7  
ATOM 10690 H HA2  . GLY A 1 85  ? -6.384  4.773   -14.622 1.00 0.00 ? 85  GLY A HA2  7  
ATOM 10691 H HA3  . GLY A 1 85  ? -7.325  3.565   -15.511 1.00 0.00 ? 85  GLY A HA3  7  
ATOM 10692 N N    . GLN A 1 86  ? -9.278  4.523   -13.266 1.00 0.00 ? 86  GLN A N    7  
ATOM 10693 C CA   . GLN A 1 86  ? -10.258 5.372   -12.631 1.00 0.00 ? 86  GLN A CA   7  
ATOM 10694 C C    . GLN A 1 86  ? -10.072 5.167   -11.133 1.00 0.00 ? 86  GLN A C    7  
ATOM 10695 O O    . GLN A 1 86  ? -9.341  5.918   -10.481 1.00 0.00 ? 86  GLN A O    7  
ATOM 10696 C CB   . GLN A 1 86  ? -11.685 5.080   -13.128 1.00 0.00 ? 86  GLN A CB   7  
ATOM 10697 C CG   . GLN A 1 86  ? -11.951 3.747   -13.842 1.00 0.00 ? 86  GLN A CG   7  
ATOM 10698 C CD   . GLN A 1 86  ? -11.690 3.809   -15.344 1.00 0.00 ? 86  GLN A CD   7  
ATOM 10699 O OE1  . GLN A 1 86  ? -12.297 4.606   -16.055 1.00 0.00 ? 86  GLN A OE1  7  
ATOM 10700 N NE2  . GLN A 1 86  ? -10.829 2.952   -15.871 1.00 0.00 ? 86  GLN A NE2  7  
ATOM 10701 H H    . GLN A 1 86  ? -9.134  3.687   -12.730 1.00 0.00 ? 86  GLN A H    7  
ATOM 10702 H HA   . GLN A 1 86  ? -10.045 6.414   -12.819 1.00 0.00 ? 86  GLN A HA   7  
ATOM 10703 H HB2  . GLN A 1 86  ? -12.295 5.052   -12.242 1.00 0.00 ? 86  GLN A HB2  7  
ATOM 10704 H HB3  . GLN A 1 86  ? -12.027 5.910   -13.747 1.00 0.00 ? 86  GLN A HB3  7  
ATOM 10705 H HG2  . GLN A 1 86  ? -11.374 2.950   -13.374 1.00 0.00 ? 86  GLN A HG2  7  
ATOM 10706 H HG3  . GLN A 1 86  ? -13.004 3.504   -13.706 1.00 0.00 ? 86  GLN A HG3  7  
ATOM 10707 H HE21 . GLN A 1 86  ? -10.270 2.327   -15.312 1.00 0.00 ? 86  GLN A HE21 7  
ATOM 10708 H HE22 . GLN A 1 86  ? -10.803 2.874   -16.886 1.00 0.00 ? 86  GLN A HE22 7  
ATOM 10709 N N    . ALA A 1 87  ? -10.683 4.095   -10.639 1.00 0.00 ? 87  ALA A N    7  
ATOM 10710 C CA   . ALA A 1 87  ? -10.735 3.588   -9.291  1.00 0.00 ? 87  ALA A CA   7  
ATOM 10711 C C    . ALA A 1 87  ? -11.121 2.116   -9.446  1.00 0.00 ? 87  ALA A C    7  
ATOM 10712 O O    . ALA A 1 87  ? -11.767 1.749   -10.441 1.00 0.00 ? 87  ALA A O    7  
ATOM 10713 C CB   . ALA A 1 87  ? -11.808 4.361   -8.519  1.00 0.00 ? 87  ALA A CB   7  
ATOM 10714 H H    . ALA A 1 87  ? -11.233 3.514   -11.258 1.00 0.00 ? 87  ALA A H    7  
ATOM 10715 H HA   . ALA A 1 87  ? -9.772  3.689   -8.792  1.00 0.00 ? 87  ALA A HA   7  
ATOM 10716 H HB1  . ALA A 1 87  ? -11.537 5.413   -8.458  1.00 0.00 ? 87  ALA A HB1  7  
ATOM 10717 H HB2  . ALA A 1 87  ? -12.766 4.291   -9.028  1.00 0.00 ? 87  ALA A HB2  7  
ATOM 10718 H HB3  . ALA A 1 87  ? -11.918 3.968   -7.512  1.00 0.00 ? 87  ALA A HB3  7  
ATOM 10719 N N    . VAL A 1 88  ? -10.736 1.275   -8.494  1.00 0.00 ? 88  VAL A N    7  
ATOM 10720 C CA   . VAL A 1 88  ? -10.885 -0.178  -8.584  1.00 0.00 ? 88  VAL A CA   7  
ATOM 10721 C C    . VAL A 1 88  ? -11.183 -0.674  -7.162  1.00 0.00 ? 88  VAL A C    7  
ATOM 10722 O O    . VAL A 1 88  ? -10.399 -1.421  -6.579  1.00 0.00 ? 88  VAL A O    7  
ATOM 10723 C CB   . VAL A 1 88  ? -9.603  -0.804  -9.200  1.00 0.00 ? 88  VAL A CB   7  
ATOM 10724 C CG1  . VAL A 1 88  ? -9.796  -2.283  -9.567  1.00 0.00 ? 88  VAL A CG1  7  
ATOM 10725 C CG2  . VAL A 1 88  ? -9.072  -0.103  -10.469 1.00 0.00 ? 88  VAL A CG2  7  
ATOM 10726 H H    . VAL A 1 88  ? -10.249 1.639   -7.677  1.00 0.00 ? 88  VAL A H    7  
ATOM 10727 H HA   . VAL A 1 88  ? -11.731 -0.434  -9.225  1.00 0.00 ? 88  VAL A HA   7  
ATOM 10728 H HB   . VAL A 1 88  ? -8.821  -0.738  -8.449  1.00 0.00 ? 88  VAL A HB   7  
ATOM 10729 H HG11 . VAL A 1 88  ? -8.866  -2.713  -9.942  1.00 0.00 ? 88  VAL A HG11 7  
ATOM 10730 H HG12 . VAL A 1 88  ? -10.094 -2.851  -8.688  1.00 0.00 ? 88  VAL A HG12 7  
ATOM 10731 H HG13 . VAL A 1 88  ? -10.566 -2.381  -10.329 1.00 0.00 ? 88  VAL A HG13 7  
ATOM 10732 H HG21 . VAL A 1 88  ? -9.835  -0.117  -11.244 1.00 0.00 ? 88  VAL A HG21 7  
ATOM 10733 H HG22 . VAL A 1 88  ? -8.783  0.924   -10.255 1.00 0.00 ? 88  VAL A HG22 7  
ATOM 10734 H HG23 . VAL A 1 88  ? -8.184  -0.622  -10.837 1.00 0.00 ? 88  VAL A HG23 7  
ATOM 10735 N N    . GLY A 1 89  ? -12.275 -0.188  -6.569  1.00 0.00 ? 89  GLY A N    7  
ATOM 10736 C CA   . GLY A 1 89  ? -12.561 -0.393  -5.153  1.00 0.00 ? 89  GLY A CA   7  
ATOM 10737 C C    . GLY A 1 89  ? -12.376 0.907   -4.391  1.00 0.00 ? 89  GLY A C    7  
ATOM 10738 O O    . GLY A 1 89  ? -11.236 1.279   -4.103  1.00 0.00 ? 89  GLY A O    7  
ATOM 10739 H H    . GLY A 1 89  ? -12.917 0.383   -7.111  1.00 0.00 ? 89  GLY A H    7  
ATOM 10740 H HA2  . GLY A 1 89  ? -13.570 -0.765  -5.026  1.00 0.00 ? 89  GLY A HA2  7  
ATOM 10741 H HA3  . GLY A 1 89  ? -11.870 -1.123  -4.729  1.00 0.00 ? 89  GLY A HA3  7  
ATOM 10742 N N    . GLN A 1 90  ? -13.449 1.642   -4.103  1.00 0.00 ? 90  GLN A N    7  
ATOM 10743 C CA   . GLN A 1 90  ? -13.373 2.937   -3.426  1.00 0.00 ? 90  GLN A CA   7  
ATOM 10744 C C    . GLN A 1 90  ? -14.560 3.109   -2.483  1.00 0.00 ? 90  GLN A C    7  
ATOM 10745 O O    . GLN A 1 90  ? -15.628 2.547   -2.738  1.00 0.00 ? 90  GLN A O    7  
ATOM 10746 C CB   . GLN A 1 90  ? -13.266 4.058   -4.479  1.00 0.00 ? 90  GLN A CB   7  
ATOM 10747 C CG   . GLN A 1 90  ? -14.466 4.222   -5.430  1.00 0.00 ? 90  GLN A CG   7  
ATOM 10748 C CD   . GLN A 1 90  ? -15.516 5.221   -4.946  1.00 0.00 ? 90  GLN A CD   7  
ATOM 10749 O OE1  . GLN A 1 90  ? -15.597 5.568   -3.770  1.00 0.00 ? 90  GLN A OE1  7  
ATOM 10750 N NE2  . GLN A 1 90  ? -16.332 5.731   -5.850  1.00 0.00 ? 90  GLN A NE2  7  
ATOM 10751 H H    . GLN A 1 90  ? -14.378 1.288   -4.301  1.00 0.00 ? 90  GLN A H    7  
ATOM 10752 H HA   . GLN A 1 90  ? -12.468 2.960   -2.818  1.00 0.00 ? 90  GLN A HA   7  
ATOM 10753 H HB2  . GLN A 1 90  ? -13.071 5.004   -3.977  1.00 0.00 ? 90  GLN A HB2  7  
ATOM 10754 H HB3  . GLN A 1 90  ? -12.396 3.835   -5.094  1.00 0.00 ? 90  GLN A HB3  7  
ATOM 10755 H HG2  . GLN A 1 90  ? -14.081 4.585   -6.385  1.00 0.00 ? 90  GLN A HG2  7  
ATOM 10756 H HG3  . GLN A 1 90  ? -14.939 3.254   -5.605  1.00 0.00 ? 90  GLN A HG3  7  
ATOM 10757 H HE21 . GLN A 1 90  ? -16.133 5.608   -6.849  1.00 0.00 ? 90  GLN A HE21 7  
ATOM 10758 H HE22 . GLN A 1 90  ? -16.973 6.480   -5.599  1.00 0.00 ? 90  GLN A HE22 7  
ATOM 10759 N N    . GLN A 1 91  ? -14.385 3.897   -1.419  1.00 0.00 ? 91  GLN A N    7  
ATOM 10760 C CA   . GLN A 1 91  ? -15.426 4.272   -0.466  1.00 0.00 ? 91  GLN A CA   7  
ATOM 10761 C C    . GLN A 1 91  ? -15.238 5.738   -0.036  1.00 0.00 ? 91  GLN A C    7  
ATOM 10762 O O    . GLN A 1 91  ? -14.100 6.226   -0.004  1.00 0.00 ? 91  GLN A O    7  
ATOM 10763 C CB   . GLN A 1 91  ? -15.380 3.335   0.757   1.00 0.00 ? 91  GLN A CB   7  
ATOM 10764 C CG   . GLN A 1 91  ? -16.188 2.033   0.579   1.00 0.00 ? 91  GLN A CG   7  
ATOM 10765 C CD   . GLN A 1 91  ? -15.383 0.769   0.860   1.00 0.00 ? 91  GLN A CD   7  
ATOM 10766 O OE1  . GLN A 1 91  ? -15.398 -0.187  0.086   1.00 0.00 ? 91  GLN A OE1  7  
ATOM 10767 N NE2  . GLN A 1 91  ? -14.685 0.700   1.980   1.00 0.00 ? 91  GLN A NE2  7  
ATOM 10768 H H    . GLN A 1 91  ? -13.499 4.374   -1.316  1.00 0.00 ? 91  GLN A H    7  
ATOM 10769 H HA   . GLN A 1 91  ? -16.392 4.179   -0.953  1.00 0.00 ? 91  GLN A HA   7  
ATOM 10770 H HB2  . GLN A 1 91  ? -14.337 3.113   0.984   1.00 0.00 ? 91  GLN A HB2  7  
ATOM 10771 H HB3  . GLN A 1 91  ? -15.794 3.856   1.621   1.00 0.00 ? 91  GLN A HB3  7  
ATOM 10772 H HG2  . GLN A 1 91  ? -17.040 2.052   1.257   1.00 0.00 ? 91  GLN A HG2  7  
ATOM 10773 H HG3  . GLN A 1 91  ? -16.577 1.972   -0.435  1.00 0.00 ? 91  GLN A HG3  7  
ATOM 10774 H HE21 . GLN A 1 91  ? -14.708 1.459   2.643   1.00 0.00 ? 91  GLN A HE21 7  
ATOM 10775 H HE22 . GLN A 1 91  ? -13.879 0.079   1.964   1.00 0.00 ? 91  GLN A HE22 7  
ATOM 10776 N N    . PRO A 1 92  ? -16.322 6.437   0.342   1.00 0.00 ? 92  PRO A N    7  
ATOM 10777 C CA   . PRO A 1 92  ? -16.276 7.807   0.828   1.00 0.00 ? 92  PRO A CA   7  
ATOM 10778 C C    . PRO A 1 92  ? -15.796 7.878   2.283   1.00 0.00 ? 92  PRO A C    7  
ATOM 10779 O O    . PRO A 1 92  ? -15.931 6.917   3.049   1.00 0.00 ? 92  PRO A O    7  
ATOM 10780 C CB   . PRO A 1 92  ? -17.722 8.297   0.717   1.00 0.00 ? 92  PRO A CB   7  
ATOM 10781 C CG   . PRO A 1 92  ? -18.525 7.036   1.022   1.00 0.00 ? 92  PRO A CG   7  
ATOM 10782 C CD   . PRO A 1 92  ? -17.692 5.953   0.347   1.00 0.00 ? 92  PRO A CD   7  
ATOM 10783 H HA   . PRO A 1 92  ? -15.628 8.414   0.196   1.00 0.00 ? 92  PRO A HA   7  
ATOM 10784 H HB2  . PRO A 1 92  ? -17.939 9.097   1.423   1.00 0.00 ? 92  PRO A HB2  7  
ATOM 10785 H HB3  . PRO A 1 92  ? -17.925 8.621   -0.303  1.00 0.00 ? 92  PRO A HB3  7  
ATOM 10786 H HG2  . PRO A 1 92  ? -18.545 6.854   2.096   1.00 0.00 ? 92  PRO A HG2  7  
ATOM 10787 H HG3  . PRO A 1 92  ? -19.538 7.083   0.626   1.00 0.00 ? 92  PRO A HG3  7  
ATOM 10788 H HD2  . PRO A 1 92  ? -17.763 5.027   0.911   1.00 0.00 ? 92  PRO A HD2  7  
ATOM 10789 H HD3  . PRO A 1 92  ? -18.033 5.811   -0.677  1.00 0.00 ? 92  PRO A HD3  7  
ATOM 10790 N N    . GLY A 1 93  ? -15.313 9.056   2.671   1.00 0.00 ? 93  GLY A N    7  
ATOM 10791 C CA   . GLY A 1 93  ? -14.908 9.422   4.016   1.00 0.00 ? 93  GLY A CA   7  
ATOM 10792 C C    . GLY A 1 93  ? -15.161 10.916  4.200   1.00 0.00 ? 93  GLY A C    7  
ATOM 10793 O O    . GLY A 1 93  ? -16.260 11.388  3.891   1.00 0.00 ? 93  GLY A O    7  
ATOM 10794 H H    . GLY A 1 93  ? -15.156 9.769   1.964   1.00 0.00 ? 93  GLY A H    7  
ATOM 10795 H HA2  . GLY A 1 93  ? -15.496 8.871   4.747   1.00 0.00 ? 93  GLY A HA2  7  
ATOM 10796 H HA3  . GLY A 1 93  ? -13.852 9.186   4.143   1.00 0.00 ? 93  GLY A HA3  7  
ATOM 10797 N N    . ALA A 1 94  ? -14.186 11.648  4.740   1.00 0.00 ? 94  ALA A N    7  
ATOM 10798 C CA   . ALA A 1 94  ? -14.063 13.106  4.758   1.00 0.00 ? 94  ALA A CA   7  
ATOM 10799 C C    . ALA A 1 94  ? -12.614 13.406  5.146   1.00 0.00 ? 94  ALA A C    7  
ATOM 10800 O O    . ALA A 1 94  ? -12.163 12.883  6.170   1.00 0.00 ? 94  ALA A O    7  
ATOM 10801 C CB   . ALA A 1 94  ? -15.003 13.724  5.797   1.00 0.00 ? 94  ALA A CB   7  
ATOM 10802 H H    . ALA A 1 94  ? -13.331 11.171  5.012   1.00 0.00 ? 94  ALA A H    7  
ATOM 10803 H HA   . ALA A 1 94  ? -14.278 13.516  3.770   1.00 0.00 ? 94  ALA A HA   7  
ATOM 10804 H HB1  . ALA A 1 94  ? -14.643 14.717  6.062   1.00 0.00 ? 94  ALA A HB1  7  
ATOM 10805 H HB2  . ALA A 1 94  ? -16.000 13.826  5.375   1.00 0.00 ? 94  ALA A HB2  7  
ATOM 10806 H HB3  . ALA A 1 94  ? -15.033 13.117  6.702   1.00 0.00 ? 94  ALA A HB3  7  
ATOM 10807 N N    . SER A 1 95  ? -11.870 14.175  4.343   1.00 0.00 ? 95  SER A N    7  
ATOM 10808 C CA   . SER A 1 95  ? -10.425 14.267  4.541   1.00 0.00 ? 95  SER A CA   7  
ATOM 10809 C C    . SER A 1 95  ? -10.052 15.031  5.817   1.00 0.00 ? 95  SER A C    7  
ATOM 10810 O O    . SER A 1 95  ? -9.175  14.573  6.555   1.00 0.00 ? 95  SER A O    7  
ATOM 10811 C CB   . SER A 1 95  ? -9.714  14.809  3.293   1.00 0.00 ? 95  SER A CB   7  
ATOM 10812 O OG   . SER A 1 95  ? -10.231 16.043  2.831   1.00 0.00 ? 95  SER A OG   7  
ATOM 10813 H H    . SER A 1 95  ? -12.277 14.616  3.529   1.00 0.00 ? 95  SER A H    7  
ATOM 10814 H HA   . SER A 1 95  ? -10.052 13.254  4.687   1.00 0.00 ? 95  SER A HA   7  
ATOM 10815 H HB2  . SER A 1 95  ? -8.659  14.928  3.540   1.00 0.00 ? 95  SER A HB2  7  
ATOM 10816 H HB3  . SER A 1 95  ? -9.786  14.081  2.486   1.00 0.00 ? 95  SER A HB3  7  
ATOM 10817 H HG   . SER A 1 95  ? -11.109 15.904  2.415   1.00 0.00 ? 95  SER A HG   7  
ATOM 10818 N N    . SER A 1 96  ? -10.713 16.161  6.086   1.00 0.00 ? 96  SER A N    7  
ATOM 10819 C CA   . SER A 1 96  ? -10.407 17.088  7.173   1.00 0.00 ? 96  SER A CA   7  
ATOM 10820 C C    . SER A 1 96  ? -8.925  17.522  7.174   1.00 0.00 ? 96  SER A C    7  
ATOM 10821 O O    . SER A 1 96  ? -8.131  17.181  6.287   1.00 0.00 ? 96  SER A O    7  
ATOM 10822 C CB   . SER A 1 96  ? -10.917 16.507  8.507   1.00 0.00 ? 96  SER A CB   7  
ATOM 10823 O OG   . SER A 1 96  ? -11.111 17.516  9.486   1.00 0.00 ? 96  SER A OG   7  
ATOM 10824 H H    . SER A 1 96  ? -11.393 16.484  5.410   1.00 0.00 ? 96  SER A H    7  
ATOM 10825 H HA   . SER A 1 96  ? -11.002 17.977  6.987   1.00 0.00 ? 96  SER A HA   7  
ATOM 10826 H HB2  . SER A 1 96  ? -11.880 16.024  8.338   1.00 0.00 ? 96  SER A HB2  7  
ATOM 10827 H HB3  . SER A 1 96  ? -10.215 15.760  8.878   1.00 0.00 ? 96  SER A HB3  7  
ATOM 10828 H HG   . SER A 1 96  ? -11.809 17.188  10.099  1.00 0.00 ? 96  SER A HG   7  
ATOM 10829 N N    . GLY A 1 97  ? -8.524  18.303  8.174   1.00 0.00 ? 97  GLY A N    7  
ATOM 10830 C CA   . GLY A 1 97  ? -7.151  18.753  8.363   1.00 0.00 ? 97  GLY A CA   7  
ATOM 10831 C C    . GLY A 1 97  ? -6.762  18.648  9.833   1.00 0.00 ? 97  GLY A C    7  
ATOM 10832 O O    . GLY A 1 97  ? -7.648  18.610  10.690  1.00 0.00 ? 97  GLY A O    7  
ATOM 10833 H H    . GLY A 1 97  ? -9.186  18.511  8.916   1.00 0.00 ? 97  GLY A H    7  
ATOM 10834 H HA2  . GLY A 1 97  ? -6.469  18.164  7.755   1.00 0.00 ? 97  GLY A HA2  7  
ATOM 10835 H HA3  . GLY A 1 97  ? -7.080  19.795  8.059   1.00 0.00 ? 97  GLY A HA3  7  
ATOM 10836 N N    . PRO A 1 98  ? -5.462  18.624  10.162  1.00 0.00 ? 98  PRO A N    7  
ATOM 10837 C CA   . PRO A 1 98  ? -5.004  18.897  11.510  1.00 0.00 ? 98  PRO A CA   7  
ATOM 10838 C C    . PRO A 1 98  ? -5.319  20.353  11.840  1.00 0.00 ? 98  PRO A C    7  
ATOM 10839 O O    . PRO A 1 98  ? -4.682  21.265  11.302  1.00 0.00 ? 98  PRO A O    7  
ATOM 10840 C CB   . PRO A 1 98  ? -3.504  18.605  11.527  1.00 0.00 ? 98  PRO A CB   7  
ATOM 10841 C CG   . PRO A 1 98  ? -3.084  18.737  10.063  1.00 0.00 ? 98  PRO A CG   7  
ATOM 10842 C CD   . PRO A 1 98  ? -4.341  18.369  9.273   1.00 0.00 ? 98  PRO A CD   7  
ATOM 10843 H HA   . PRO A 1 98  ? -5.507  18.240  12.219  1.00 0.00 ? 98  PRO A HA   7  
ATOM 10844 H HB2  . PRO A 1 98  ? -2.959  19.298  12.168  1.00 0.00 ? 98  PRO A HB2  7  
ATOM 10845 H HB3  . PRO A 1 98  ? -3.339  17.586  11.867  1.00 0.00 ? 98  PRO A HB3  7  
ATOM 10846 H HG2  . PRO A 1 98  ? -2.805  19.771  9.861   1.00 0.00 ? 98  PRO A HG2  7  
ATOM 10847 H HG3  . PRO A 1 98  ? -2.258  18.073  9.822   1.00 0.00 ? 98  PRO A HG3  7  
ATOM 10848 H HD2  . PRO A 1 98  ? -4.410  18.961  8.363   1.00 0.00 ? 98  PRO A HD2  7  
ATOM 10849 H HD3  . PRO A 1 98  ? -4.319  17.308  9.022   1.00 0.00 ? 98  PRO A HD3  7  
ATOM 10850 N N    . SER A 1 99  ? -6.286  20.568  12.724  1.00 0.00 ? 99  SER A N    7  
ATOM 10851 C CA   . SER A 1 99  ? -6.628  21.867  13.272  1.00 0.00 ? 99  SER A CA   7  
ATOM 10852 C C    . SER A 1 99  ? -6.671  21.675  14.786  1.00 0.00 ? 99  SER A C    7  
ATOM 10853 O O    . SER A 1 99  ? -7.701  21.290  15.337  1.00 0.00 ? 99  SER A O    7  
ATOM 10854 C CB   . SER A 1 99  ? -7.932  22.381  12.652  1.00 0.00 ? 99  SER A CB   7  
ATOM 10855 O OG   . SER A 1 99  ? -7.829  22.412  11.233  1.00 0.00 ? 99  SER A OG   7  
ATOM 10856 H H    . SER A 1 99  ? -6.799  19.778  13.090  1.00 0.00 ? 99  SER A H    7  
ATOM 10857 H HA   . SER A 1 99  ? -5.849  22.591  13.036  1.00 0.00 ? 99  SER A HA   7  
ATOM 10858 H HB2  . SER A 1 99  ? -8.752  21.722  12.942  1.00 0.00 ? 99  SER A HB2  7  
ATOM 10859 H HB3  . SER A 1 99  ? -8.130  23.386  13.031  1.00 0.00 ? 99  SER A HB3  7  
ATOM 10860 H HG   . SER A 1 99  ? -6.999  22.869  10.978  1.00 0.00 ? 99  SER A HG   7  
ATOM 10861 N N    . SER A 1 100 ? -5.517  21.856  15.432  1.00 0.00 ? 100 SER A N    7  
ATOM 10862 C CA   . SER A 1 100 ? -5.221  21.452  16.800  1.00 0.00 ? 100 SER A CA   7  
ATOM 10863 C C    . SER A 1 100 ? -5.255  19.920  16.958  1.00 0.00 ? 100 SER A C    7  
ATOM 10864 O O    . SER A 1 100 ? -5.372  19.155  15.992  1.00 0.00 ? 100 SER A O    7  
ATOM 10865 C CB   . SER A 1 100 ? -6.138  22.202  17.786  1.00 0.00 ? 100 SER A CB   7  
ATOM 10866 O OG   . SER A 1 100 ? -5.509  22.359  19.046  1.00 0.00 ? 100 SER A OG   7  
ATOM 10867 H H    . SER A 1 100 ? -4.712  22.102  14.861  1.00 0.00 ? 100 SER A H    7  
ATOM 10868 H HA   . SER A 1 100 ? -4.195  21.771  16.987  1.00 0.00 ? 100 SER A HA   7  
ATOM 10869 H HB2  . SER A 1 100 ? -6.362  23.197  17.399  1.00 0.00 ? 100 SER A HB2  7  
ATOM 10870 H HB3  . SER A 1 100 ? -7.075  21.656  17.902  1.00 0.00 ? 100 SER A HB3  7  
ATOM 10871 H HG   . SER A 1 100 ? -4.881  23.088  18.977  1.00 0.00 ? 100 SER A HG   7  
ATOM 10872 N N    . GLY A 1 101 ? -5.061  19.449  18.183  1.00 0.00 ? 101 GLY A N    7  
ATOM 10873 C CA   . GLY A 1 101 ? -5.049  18.052  18.579  1.00 0.00 ? 101 GLY A CA   7  
ATOM 10874 C C    . GLY A 1 101 ? -4.771  18.041  20.059  1.00 0.00 ? 101 GLY A C    7  
ATOM 10875 O O    . GLY A 1 101 ? -5.576  18.644  20.802  1.00 0.00 ? 101 GLY A O    7  
ATOM 10876 H H    . GLY A 1 101 ? -4.999  20.121  18.937  1.00 0.00 ? 101 GLY A H    7  
ATOM 10877 H HA2  . GLY A 1 101 ? -6.018  17.587  18.388  1.00 0.00 ? 101 GLY A HA2  7  
ATOM 10878 H HA3  . GLY A 1 101 ? -4.271  17.509  18.049  1.00 0.00 ? 101 GLY A HA3  7  
ATOM 10879 N N    . GLY A 1 1   ? 9.065   -24.194 -21.060 1.00 0.00 ? 1   GLY A N    8  
ATOM 10880 C CA   . GLY A 1 1   ? 8.665   -23.425 -19.879 1.00 0.00 ? 1   GLY A CA   8  
ATOM 10881 C C    . GLY A 1 1   ? 8.224   -22.063 -20.357 1.00 0.00 ? 1   GLY A C    8  
ATOM 10882 O O    . GLY A 1 1   ? 7.337   -22.010 -21.207 1.00 0.00 ? 1   GLY A O    8  
ATOM 10883 H H1   . GLY A 1 1   ? 8.366   -24.268 -21.772 1.00 0.00 ? 1   GLY A H1   8  
ATOM 10884 H HA2  . GLY A 1 1   ? 7.831   -23.919 -19.379 1.00 0.00 ? 1   GLY A HA2  8  
ATOM 10885 H HA3  . GLY A 1 1   ? 9.505   -23.333 -19.192 1.00 0.00 ? 1   GLY A HA3  8  
ATOM 10886 N N    . SER A 1 2   ? 8.892   -20.999 -19.906 1.00 0.00 ? 2   SER A N    8  
ATOM 10887 C CA   . SER A 1 2   ? 8.714   -19.648 -20.427 1.00 0.00 ? 2   SER A CA   8  
ATOM 10888 C C    . SER A 1 2   ? 7.253   -19.205 -20.291 1.00 0.00 ? 2   SER A C    8  
ATOM 10889 O O    . SER A 1 2   ? 6.622   -18.772 -21.258 1.00 0.00 ? 2   SER A O    8  
ATOM 10890 C CB   . SER A 1 2   ? 9.276   -19.565 -21.857 1.00 0.00 ? 2   SER A CB   8  
ATOM 10891 O OG   . SER A 1 2   ? 10.532  -20.229 -21.945 1.00 0.00 ? 2   SER A OG   8  
ATOM 10892 H H    . SER A 1 2   ? 9.610   -21.091 -19.194 1.00 0.00 ? 2   SER A H    8  
ATOM 10893 H HA   . SER A 1 2   ? 9.312   -18.980 -19.809 1.00 0.00 ? 2   SER A HA   8  
ATOM 10894 H HB2  . SER A 1 2   ? 8.579   -20.041 -22.548 1.00 0.00 ? 2   SER A HB2  8  
ATOM 10895 H HB3  . SER A 1 2   ? 9.386   -18.517 -22.144 1.00 0.00 ? 2   SER A HB3  8  
ATOM 10896 H HG   . SER A 1 2   ? 11.231  -19.591 -21.744 1.00 0.00 ? 2   SER A HG   8  
ATOM 10897 N N    . SER A 1 3   ? 6.716   -19.330 -19.073 1.00 0.00 ? 3   SER A N    8  
ATOM 10898 C CA   . SER A 1 3   ? 5.383   -18.871 -18.714 1.00 0.00 ? 3   SER A CA   8  
ATOM 10899 C C    . SER A 1 3   ? 5.255   -17.391 -19.065 1.00 0.00 ? 3   SER A C    8  
ATOM 10900 O O    . SER A 1 3   ? 6.170   -16.606 -18.799 1.00 0.00 ? 3   SER A O    8  
ATOM 10901 C CB   . SER A 1 3   ? 5.173   -19.102 -17.210 1.00 0.00 ? 3   SER A CB   8  
ATOM 10902 O OG   . SER A 1 3   ? 3.899   -18.672 -16.767 1.00 0.00 ? 3   SER A OG   8  
ATOM 10903 H H    . SER A 1 3   ? 7.309   -19.658 -18.326 1.00 0.00 ? 3   SER A H    8  
ATOM 10904 H HA   . SER A 1 3   ? 4.647   -19.447 -19.275 1.00 0.00 ? 3   SER A HA   8  
ATOM 10905 H HB2  . SER A 1 3   ? 5.277   -20.166 -16.996 1.00 0.00 ? 3   SER A HB2  8  
ATOM 10906 H HB3  . SER A 1 3   ? 5.938   -18.558 -16.661 1.00 0.00 ? 3   SER A HB3  8  
ATOM 10907 H HG   . SER A 1 3   ? 3.916   -17.703 -16.705 1.00 0.00 ? 3   SER A HG   8  
ATOM 10908 N N    . GLY A 1 4   ? 4.109   -16.996 -19.614 1.00 0.00 ? 4   GLY A N    8  
ATOM 10909 C CA   . GLY A 1 4   ? 3.745   -15.597 -19.734 1.00 0.00 ? 4   GLY A CA   8  
ATOM 10910 C C    . GLY A 1 4   ? 3.576   -14.960 -18.351 1.00 0.00 ? 4   GLY A C    8  
ATOM 10911 O O    . GLY A 1 4   ? 3.561   -15.662 -17.329 1.00 0.00 ? 4   GLY A O    8  
ATOM 10912 H H    . GLY A 1 4   ? 3.411   -17.681 -19.878 1.00 0.00 ? 4   GLY A H    8  
ATOM 10913 H HA2  . GLY A 1 4   ? 4.520   -15.068 -20.292 1.00 0.00 ? 4   GLY A HA2  8  
ATOM 10914 H HA3  . GLY A 1 4   ? 2.807   -15.541 -20.276 1.00 0.00 ? 4   GLY A HA3  8  
ATOM 10915 N N    . SER A 1 5   ? 3.449   -13.635 -18.316 1.00 0.00 ? 5   SER A N    8  
ATOM 10916 C CA   . SER A 1 5   ? 3.429   -12.828 -17.106 1.00 0.00 ? 5   SER A CA   8  
ATOM 10917 C C    . SER A 1 5   ? 2.490   -11.643 -17.351 1.00 0.00 ? 5   SER A C    8  
ATOM 10918 O O    . SER A 1 5   ? 2.726   -10.858 -18.279 1.00 0.00 ? 5   SER A O    8  
ATOM 10919 C CB   . SER A 1 5   ? 4.873   -12.396 -16.800 1.00 0.00 ? 5   SER A CB   8  
ATOM 10920 O OG   . SER A 1 5   ? 5.084   -12.012 -15.459 1.00 0.00 ? 5   SER A OG   8  
ATOM 10921 H H    . SER A 1 5   ? 3.410   -13.110 -19.180 1.00 0.00 ? 5   SER A H    8  
ATOM 10922 H HA   . SER A 1 5   ? 3.058   -13.436 -16.283 1.00 0.00 ? 5   SER A HA   8  
ATOM 10923 H HB2  . SER A 1 5   ? 5.543   -13.230 -16.994 1.00 0.00 ? 5   SER A HB2  8  
ATOM 10924 H HB3  . SER A 1 5   ? 5.158   -11.581 -17.460 1.00 0.00 ? 5   SER A HB3  8  
ATOM 10925 H HG   . SER A 1 5   ? 4.715   -11.100 -15.353 1.00 0.00 ? 5   SER A HG   8  
ATOM 10926 N N    . SER A 1 6   ? 1.421   -11.540 -16.560 1.00 0.00 ? 6   SER A N    8  
ATOM 10927 C CA   . SER A 1 6   ? 0.418   -10.487 -16.675 1.00 0.00 ? 6   SER A CA   8  
ATOM 10928 C C    . SER A 1 6   ? 0.875   -9.221  -15.947 1.00 0.00 ? 6   SER A C    8  
ATOM 10929 O O    . SER A 1 6   ? 1.117   -8.202  -16.597 1.00 0.00 ? 6   SER A O    8  
ATOM 10930 C CB   . SER A 1 6   ? -0.957  -10.982 -16.180 1.00 0.00 ? 6   SER A CB   8  
ATOM 10931 O OG   . SER A 1 6   ? -0.878  -12.096 -15.293 1.00 0.00 ? 6   SER A OG   8  
ATOM 10932 H H    . SER A 1 6   ? 1.305   -12.195 -15.797 1.00 0.00 ? 6   SER A H    8  
ATOM 10933 H HA   . SER A 1 6   ? 0.304   -10.224 -17.730 1.00 0.00 ? 6   SER A HA   8  
ATOM 10934 H HB2  . SER A 1 6   ? -1.506  -10.169 -15.705 1.00 0.00 ? 6   SER A HB2  8  
ATOM 10935 H HB3  . SER A 1 6   ? -1.537  -11.285 -17.050 1.00 0.00 ? 6   SER A HB3  8  
ATOM 10936 H HG   . SER A 1 6   ? -0.512  -11.792 -14.432 1.00 0.00 ? 6   SER A HG   8  
ATOM 10937 N N    . GLY A 1 7   ? 0.962   -9.281  -14.616 1.00 0.00 ? 7   GLY A N    8  
ATOM 10938 C CA   . GLY A 1 7   ? 1.119   -8.133  -13.739 1.00 0.00 ? 7   GLY A CA   8  
ATOM 10939 C C    . GLY A 1 7   ? -0.182  -7.925  -12.977 1.00 0.00 ? 7   GLY A C    8  
ATOM 10940 O O    . GLY A 1 7   ? -0.905  -6.970  -13.252 1.00 0.00 ? 7   GLY A O    8  
ATOM 10941 H H    . GLY A 1 7   ? 0.776   -10.158 -14.150 1.00 0.00 ? 7   GLY A H    8  
ATOM 10942 H HA2  . GLY A 1 7   ? 1.934   -8.311  -13.038 1.00 0.00 ? 7   GLY A HA2  8  
ATOM 10943 H HA3  . GLY A 1 7   ? 1.348   -7.238  -14.318 1.00 0.00 ? 7   GLY A HA3  8  
ATOM 10944 N N    . GLN A 1 8   ? -0.521  -8.842  -12.070 1.00 0.00 ? 8   GLN A N    8  
ATOM 10945 C CA   . GLN A 1 8   ? -1.588  -8.674  -11.089 1.00 0.00 ? 8   GLN A CA   8  
ATOM 10946 C C    . GLN A 1 8   ? -1.031  -9.013  -9.705  1.00 0.00 ? 8   GLN A C    8  
ATOM 10947 O O    . GLN A 1 8   ? 0.056   -9.582  -9.576  1.00 0.00 ? 8   GLN A O    8  
ATOM 10948 C CB   . GLN A 1 8   ? -2.821  -9.551  -11.412 1.00 0.00 ? 8   GLN A CB   8  
ATOM 10949 C CG   . GLN A 1 8   ? -3.855  -8.885  -12.337 1.00 0.00 ? 8   GLN A CG   8  
ATOM 10950 C CD   . GLN A 1 8   ? -5.276  -9.403  -12.066 1.00 0.00 ? 8   GLN A CD   8  
ATOM 10951 O OE1  . GLN A 1 8   ? -5.499  -10.593 -11.859 1.00 0.00 ? 8   GLN A OE1  8  
ATOM 10952 N NE2  . GLN A 1 8   ? -6.272  -8.529  -12.027 1.00 0.00 ? 8   GLN A NE2  8  
ATOM 10953 H H    . GLN A 1 8   ? 0.112   -9.614  -11.891 1.00 0.00 ? 8   GLN A H    8  
ATOM 10954 H HA   . GLN A 1 8   ? -1.892  -7.625  -11.068 1.00 0.00 ? 8   GLN A HA   8  
ATOM 10955 H HB2  . GLN A 1 8   ? -2.505  -10.506 -11.835 1.00 0.00 ? 8   GLN A HB2  8  
ATOM 10956 H HB3  . GLN A 1 8   ? -3.335  -9.776  -10.477 1.00 0.00 ? 8   GLN A HB3  8  
ATOM 10957 H HG2  . GLN A 1 8   ? -3.839  -7.808  -12.167 1.00 0.00 ? 8   GLN A HG2  8  
ATOM 10958 H HG3  . GLN A 1 8   ? -3.586  -9.074  -13.377 1.00 0.00 ? 8   GLN A HG3  8  
ATOM 10959 H HE21 . GLN A 1 8   ? -6.138  -7.589  -12.388 1.00 0.00 ? 8   GLN A HE21 8  
ATOM 10960 H HE22 . GLN A 1 8   ? -7.212  -8.883  -11.910 1.00 0.00 ? 8   GLN A HE22 8  
ATOM 10961 N N    . TYR A 1 9   ? -1.823  -8.697  -8.676  1.00 0.00 ? 9   TYR A N    8  
ATOM 10962 C CA   . TYR A 1 9   ? -1.546  -8.950  -7.267  1.00 0.00 ? 9   TYR A CA   8  
ATOM 10963 C C    . TYR A 1 9   ? -1.097  -10.382 -6.996  1.00 0.00 ? 9   TYR A C    8  
ATOM 10964 O O    . TYR A 1 9   ? -0.296  -10.607 -6.091  1.00 0.00 ? 9   TYR A O    8  
ATOM 10965 C CB   . TYR A 1 9   ? -2.796  -8.640  -6.424  1.00 0.00 ? 9   TYR A CB   8  
ATOM 10966 C CG   . TYR A 1 9   ? -4.057  -9.349  -6.890  1.00 0.00 ? 9   TYR A CG   8  
ATOM 10967 C CD1  . TYR A 1 9   ? -4.891  -8.746  -7.851  1.00 0.00 ? 9   TYR A CD1  8  
ATOM 10968 C CD2  . TYR A 1 9   ? -4.373  -10.630 -6.399  1.00 0.00 ? 9   TYR A CD2  8  
ATOM 10969 C CE1  . TYR A 1 9   ? -6.012  -9.436  -8.347  1.00 0.00 ? 9   TYR A CE1  8  
ATOM 10970 C CE2  . TYR A 1 9   ? -5.496  -11.320 -6.887  1.00 0.00 ? 9   TYR A CE2  8  
ATOM 10971 C CZ   . TYR A 1 9   ? -6.319  -10.730 -7.869  1.00 0.00 ? 9   TYR A CZ   8  
ATOM 10972 O OH   . TYR A 1 9   ? -7.429  -11.373 -8.330  1.00 0.00 ? 9   TYR A OH   8  
ATOM 10973 H H    . TYR A 1 9   ? -2.716  -8.278  -8.885  1.00 0.00 ? 9   TYR A H    8  
ATOM 10974 H HA   . TYR A 1 9   ? -0.743  -8.292  -6.957  1.00 0.00 ? 9   TYR A HA   8  
ATOM 10975 H HB2  . TYR A 1 9   ? -2.597  -8.932  -5.392  1.00 0.00 ? 9   TYR A HB2  8  
ATOM 10976 H HB3  . TYR A 1 9   ? -2.971  -7.565  -6.422  1.00 0.00 ? 9   TYR A HB3  8  
ATOM 10977 H HD1  . TYR A 1 9   ? -4.682  -7.747  -8.206  1.00 0.00 ? 9   TYR A HD1  8  
ATOM 10978 H HD2  . TYR A 1 9   ? -3.755  -11.107 -5.651  1.00 0.00 ? 9   TYR A HD2  8  
ATOM 10979 H HE1  . TYR A 1 9   ? -6.654  -8.980  -9.086  1.00 0.00 ? 9   TYR A HE1  8  
ATOM 10980 H HE2  . TYR A 1 9   ? -5.726  -12.301 -6.503  1.00 0.00 ? 9   TYR A HE2  8  
ATOM 10981 H HH   . TYR A 1 9   ? -7.523  -12.278 -8.005  1.00 0.00 ? 9   TYR A HH   8  
ATOM 10982 N N    . GLU A 1 10  ? -1.628  -11.349 -7.745  1.00 0.00 ? 10  GLU A N    8  
ATOM 10983 C CA   . GLU A 1 10  ? -1.476  -12.750 -7.393  1.00 0.00 ? 10  GLU A CA   8  
ATOM 10984 C C    . GLU A 1 10  ? -0.032  -13.229 -7.534  1.00 0.00 ? 10  GLU A C    8  
ATOM 10985 O O    . GLU A 1 10  ? 0.380   -14.120 -6.798  1.00 0.00 ? 10  GLU A O    8  
ATOM 10986 C CB   . GLU A 1 10  ? -2.431  -13.636 -8.197  1.00 0.00 ? 10  GLU A CB   8  
ATOM 10987 C CG   . GLU A 1 10  ? -2.987  -14.721 -7.279  1.00 0.00 ? 10  GLU A CG   8  
ATOM 10988 C CD   . GLU A 1 10  ? -3.608  -15.879 -8.044  1.00 0.00 ? 10  GLU A CD   8  
ATOM 10989 O OE1  . GLU A 1 10  ? -2.850  -16.818 -8.388  1.00 0.00 ? 10  GLU A OE1  8  
ATOM 10990 O OE2  . GLU A 1 10  ? -4.844  -15.885 -8.242  1.00 0.00 ? 10  GLU A OE2  8  
ATOM 10991 H H    . GLU A 1 10  ? -2.298  -11.095 -8.456  1.00 0.00 ? 10  GLU A H    8  
ATOM 10992 H HA   . GLU A 1 10  ? -1.747  -12.836 -6.345  1.00 0.00 ? 10  GLU A HA   8  
ATOM 10993 H HB2  . GLU A 1 10  ? -3.260  -13.054 -8.600  1.00 0.00 ? 10  GLU A HB2  8  
ATOM 10994 H HB3  . GLU A 1 10  ? -1.882  -14.102 -9.011  1.00 0.00 ? 10  GLU A HB3  8  
ATOM 10995 H HG2  . GLU A 1 10  ? -2.178  -15.115 -6.671  1.00 0.00 ? 10  GLU A HG2  8  
ATOM 10996 H HG3  . GLU A 1 10  ? -3.721  -14.276 -6.610  1.00 0.00 ? 10  GLU A HG3  8  
ATOM 10997 N N    . LEU A 1 11  ? 0.776   -12.605 -8.397  1.00 0.00 ? 11  LEU A N    8  
ATOM 10998 C CA   . LEU A 1 11  ? 2.212   -12.883 -8.472  1.00 0.00 ? 11  LEU A CA   8  
ATOM 10999 C C    . LEU A 1 11  ? 2.821   -12.712 -7.075  1.00 0.00 ? 11  LEU A C    8  
ATOM 11000 O O    . LEU A 1 11  ? 3.533   -13.582 -6.561  1.00 0.00 ? 11  LEU A O    8  
ATOM 11001 C CB   . LEU A 1 11  ? 2.839   -11.931 -9.511  1.00 0.00 ? 11  LEU A CB   8  
ATOM 11002 C CG   . LEU A 1 11  ? 4.263   -12.243 -10.015 1.00 0.00 ? 11  LEU A CG   8  
ATOM 11003 C CD1  . LEU A 1 11  ? 5.367   -12.204 -8.954  1.00 0.00 ? 11  LEU A CD1  8  
ATOM 11004 C CD2  . LEU A 1 11  ? 4.317   -13.596 -10.727 1.00 0.00 ? 11  LEU A CD2  8  
ATOM 11005 H H    . LEU A 1 11  ? 0.408   -11.825 -8.926  1.00 0.00 ? 11  LEU A H    8  
ATOM 11006 H HA   . LEU A 1 11  ? 2.344   -13.914 -8.791  1.00 0.00 ? 11  LEU A HA   8  
ATOM 11007 H HB2  . LEU A 1 11  ? 2.191   -11.918 -10.388 1.00 0.00 ? 11  LEU A HB2  8  
ATOM 11008 H HB3  . LEU A 1 11  ? 2.827   -10.918 -9.112  1.00 0.00 ? 11  LEU A HB3  8  
ATOM 11009 H HG   . LEU A 1 11  ? 4.500   -11.479 -10.754 1.00 0.00 ? 11  LEU A HG   8  
ATOM 11010 H HD11 . LEU A 1 11  ? 5.298   -13.052 -8.280  1.00 0.00 ? 11  LEU A HD11 8  
ATOM 11011 H HD12 . LEU A 1 11  ? 6.342   -12.228 -9.434  1.00 0.00 ? 11  LEU A HD12 8  
ATOM 11012 H HD13 . LEU A 1 11  ? 5.308   -11.280 -8.389  1.00 0.00 ? 11  LEU A HD13 8  
ATOM 11013 H HD21 . LEU A 1 11  ? 5.253   -13.685 -11.271 1.00 0.00 ? 11  LEU A HD21 8  
ATOM 11014 H HD22 . LEU A 1 11  ? 4.240   -14.410 -10.010 1.00 0.00 ? 11  LEU A HD22 8  
ATOM 11015 H HD23 . LEU A 1 11  ? 3.499   -13.672 -11.441 1.00 0.00 ? 11  LEU A HD23 8  
ATOM 11016 N N    . TYR A 1 12  ? 2.452   -11.604 -6.432  1.00 0.00 ? 12  TYR A N    8  
ATOM 11017 C CA   . TYR A 1 12  ? 2.940   -11.151 -5.142  1.00 0.00 ? 12  TYR A CA   8  
ATOM 11018 C C    . TYR A 1 12  ? 2.242   -11.874 -3.983  1.00 0.00 ? 12  TYR A C    8  
ATOM 11019 O O    . TYR A 1 12  ? 2.569   -11.626 -2.826  1.00 0.00 ? 12  TYR A O    8  
ATOM 11020 C CB   . TYR A 1 12  ? 2.741   -9.622  -5.048  1.00 0.00 ? 12  TYR A CB   8  
ATOM 11021 C CG   . TYR A 1 12  ? 2.995   -8.844  -6.339  1.00 0.00 ? 12  TYR A CG   8  
ATOM 11022 C CD1  . TYR A 1 12  ? 4.113   -9.153  -7.135  1.00 0.00 ? 12  TYR A CD1  8  
ATOM 11023 C CD2  . TYR A 1 12  ? 2.066   -7.887  -6.797  1.00 0.00 ? 12  TYR A CD2  8  
ATOM 11024 C CE1  . TYR A 1 12  ? 4.252   -8.601  -8.419  1.00 0.00 ? 12  TYR A CE1  8  
ATOM 11025 C CE2  . TYR A 1 12  ? 2.218   -7.294  -8.067  1.00 0.00 ? 12  TYR A CE2  8  
ATOM 11026 C CZ   . TYR A 1 12  ? 3.303   -7.671  -8.893  1.00 0.00 ? 12  TYR A CZ   8  
ATOM 11027 O OH   . TYR A 1 12  ? 3.475   -7.147  -10.138 1.00 0.00 ? 12  TYR A OH   8  
ATOM 11028 H H    . TYR A 1 12  ? 1.733   -11.020 -6.843  1.00 0.00 ? 12  TYR A H    8  
ATOM 11029 H HA   . TYR A 1 12  ? 4.009   -11.358 -5.079  1.00 0.00 ? 12  TYR A HA   8  
ATOM 11030 H HB2  . TYR A 1 12  ? 1.721   -9.425  -4.720  1.00 0.00 ? 12  TYR A HB2  8  
ATOM 11031 H HB3  . TYR A 1 12  ? 3.395   -9.247  -4.266  1.00 0.00 ? 12  TYR A HB3  8  
ATOM 11032 H HD1  . TYR A 1 12  ? 4.838   -9.869  -6.777  1.00 0.00 ? 12  TYR A HD1  8  
ATOM 11033 H HD2  . TYR A 1 12  ? 1.217   -7.627  -6.184  1.00 0.00 ? 12  TYR A HD2  8  
ATOM 11034 H HE1  . TYR A 1 12  ? 5.074   -8.906  -9.053  1.00 0.00 ? 12  TYR A HE1  8  
ATOM 11035 H HE2  . TYR A 1 12  ? 1.493   -6.577  -8.420  1.00 0.00 ? 12  TYR A HE2  8  
ATOM 11036 H HH   . TYR A 1 12  ? 2.740   -6.620  -10.510 1.00 0.00 ? 12  TYR A HH   8  
ATOM 11037 N N    . MET A 1 13  ? 1.282   -12.764 -4.242  1.00 0.00 ? 13  MET A N    8  
ATOM 11038 C CA   . MET A 1 13  ? 0.675   -13.578 -3.189  1.00 0.00 ? 13  MET A CA   8  
ATOM 11039 C C    . MET A 1 13  ? 1.603   -14.700 -2.727  1.00 0.00 ? 13  MET A C    8  
ATOM 11040 O O    . MET A 1 13  ? 1.363   -15.273 -1.664  1.00 0.00 ? 13  MET A O    8  
ATOM 11041 C CB   . MET A 1 13  ? -0.673  -14.158 -3.631  1.00 0.00 ? 13  MET A CB   8  
ATOM 11042 C CG   . MET A 1 13  ? -1.734  -13.058 -3.685  1.00 0.00 ? 13  MET A CG   8  
ATOM 11043 S SD   . MET A 1 13  ? -2.196  -12.382 -2.067  1.00 0.00 ? 13  MET A SD   8  
ATOM 11044 C CE   . MET A 1 13  ? -3.147  -10.953 -2.636  1.00 0.00 ? 13  MET A CE   8  
ATOM 11045 H H    . MET A 1 13  ? 1.027   -12.927 -5.209  1.00 0.00 ? 13  MET A H    8  
ATOM 11046 H HA   . MET A 1 13  ? 0.493   -12.935 -2.330  1.00 0.00 ? 13  MET A HA   8  
ATOM 11047 H HB2  . MET A 1 13  ? -0.579  -14.647 -4.597  1.00 0.00 ? 13  MET A HB2  8  
ATOM 11048 H HB3  . MET A 1 13  ? -0.989  -14.908 -2.909  1.00 0.00 ? 13  MET A HB3  8  
ATOM 11049 H HG2  . MET A 1 13  ? -1.362  -12.244 -4.305  1.00 0.00 ? 13  MET A HG2  8  
ATOM 11050 H HG3  . MET A 1 13  ? -2.625  -13.461 -4.162  1.00 0.00 ? 13  MET A HG3  8  
ATOM 11051 H HE1  . MET A 1 13  ? -2.533  -10.361 -3.318  1.00 0.00 ? 13  MET A HE1  8  
ATOM 11052 H HE2  . MET A 1 13  ? -4.044  -11.294 -3.153  1.00 0.00 ? 13  MET A HE2  8  
ATOM 11053 H HE3  . MET A 1 13  ? -3.434  -10.345 -1.777  1.00 0.00 ? 13  MET A HE3  8  
ATOM 11054 N N    . TYR A 1 14  ? 2.658   -15.012 -3.486  1.00 0.00 ? 14  TYR A N    8  
ATOM 11055 C CA   . TYR A 1 14  ? 3.517   -16.160 -3.204  1.00 0.00 ? 14  TYR A CA   8  
ATOM 11056 C C    . TYR A 1 14  ? 5.000   -15.794 -3.215  1.00 0.00 ? 14  TYR A C    8  
ATOM 11057 O O    . TYR A 1 14  ? 5.817   -16.459 -2.568  1.00 0.00 ? 14  TYR A O    8  
ATOM 11058 C CB   . TYR A 1 14  ? 3.267   -17.242 -4.257  1.00 0.00 ? 14  TYR A CB   8  
ATOM 11059 C CG   . TYR A 1 14  ? 1.848   -17.402 -4.759  1.00 0.00 ? 14  TYR A CG   8  
ATOM 11060 C CD1  . TYR A 1 14  ? 0.853   -17.937 -3.923  1.00 0.00 ? 14  TYR A CD1  8  
ATOM 11061 C CD2  . TYR A 1 14  ? 1.524   -16.980 -6.063  1.00 0.00 ? 14  TYR A CD2  8  
ATOM 11062 C CE1  . TYR A 1 14  ? -0.461  -18.080 -4.398  1.00 0.00 ? 14  TYR A CE1  8  
ATOM 11063 C CE2  . TYR A 1 14  ? 0.213   -17.145 -6.551  1.00 0.00 ? 14  TYR A CE2  8  
ATOM 11064 C CZ   . TYR A 1 14  ? -0.784  -17.699 -5.716  1.00 0.00 ? 14  TYR A CZ   8  
ATOM 11065 O OH   . TYR A 1 14  ? -2.061  -17.870 -6.153  1.00 0.00 ? 14  TYR A OH   8  
ATOM 11066 H H    . TYR A 1 14  ? 2.736   -14.551 -4.382  1.00 0.00 ? 14  TYR A H    8  
ATOM 11067 H HA   . TYR A 1 14  ? 3.274   -16.577 -2.225  1.00 0.00 ? 14  TYR A HA   8  
ATOM 11068 H HB2  . TYR A 1 14  ? 3.877   -17.007 -5.122  1.00 0.00 ? 14  TYR A HB2  8  
ATOM 11069 H HB3  . TYR A 1 14  ? 3.616   -18.193 -3.858  1.00 0.00 ? 14  TYR A HB3  8  
ATOM 11070 H HD1  . TYR A 1 14  ? 1.087   -18.221 -2.905  1.00 0.00 ? 14  TYR A HD1  8  
ATOM 11071 H HD2  . TYR A 1 14  ? 2.276   -16.491 -6.678  1.00 0.00 ? 14  TYR A HD2  8  
ATOM 11072 H HE1  . TYR A 1 14  ? -1.228  -18.478 -3.748  1.00 0.00 ? 14  TYR A HE1  8  
ATOM 11073 H HE2  . TYR A 1 14  ? -0.036  -16.798 -7.545  1.00 0.00 ? 14  TYR A HE2  8  
ATOM 11074 H HH   . TYR A 1 14  ? -2.259  -17.468 -7.034  1.00 0.00 ? 14  TYR A HH   8  
ATOM 11075 N N    . ARG A 1 15  ? 5.369   -14.763 -3.974  1.00 0.00 ? 15  ARG A N    8  
ATOM 11076 C CA   . ARG A 1 15  ? 6.734   -14.265 -4.077  1.00 0.00 ? 15  ARG A CA   8  
ATOM 11077 C C    . ARG A 1 15  ? 7.002   -13.273 -2.939  1.00 0.00 ? 15  ARG A C    8  
ATOM 11078 O O    . ARG A 1 15  ? 6.192   -13.161 -2.020  1.00 0.00 ? 15  ARG A O    8  
ATOM 11079 C CB   . ARG A 1 15  ? 6.929   -13.686 -5.490  1.00 0.00 ? 15  ARG A CB   8  
ATOM 11080 C CG   . ARG A 1 15  ? 8.132   -14.281 -6.237  1.00 0.00 ? 15  ARG A CG   8  
ATOM 11081 C CD   . ARG A 1 15  ? 9.495   -13.986 -5.596  1.00 0.00 ? 15  ARG A CD   8  
ATOM 11082 N NE   . ARG A 1 15  ? 10.572  -14.588 -6.390  1.00 0.00 ? 15  ARG A NE   8  
ATOM 11083 C CZ   . ARG A 1 15  ? 11.885  -14.547 -6.142  1.00 0.00 ? 15  ARG A CZ   8  
ATOM 11084 N NH1  . ARG A 1 15  ? 12.377  -14.125 -4.981  1.00 0.00 ? 15  ARG A NH1  8  
ATOM 11085 N NH2  . ARG A 1 15  ? 12.717  -14.938 -7.099  1.00 0.00 ? 15  ARG A NH2  8  
ATOM 11086 H H    . ARG A 1 15  ? 4.656   -14.257 -4.479  1.00 0.00 ? 15  ARG A H    8  
ATOM 11087 H HA   . ARG A 1 15  ? 7.402   -15.111 -3.944  1.00 0.00 ? 15  ARG A HA   8  
ATOM 11088 H HB2  . ARG A 1 15  ? 6.041   -13.900 -6.092  1.00 0.00 ? 15  ARG A HB2  8  
ATOM 11089 H HB3  . ARG A 1 15  ? 7.026   -12.608 -5.440  1.00 0.00 ? 15  ARG A HB3  8  
ATOM 11090 H HG2  . ARG A 1 15  ? 7.994   -15.359 -6.308  1.00 0.00 ? 15  ARG A HG2  8  
ATOM 11091 H HG3  . ARG A 1 15  ? 8.130   -13.875 -7.250  1.00 0.00 ? 15  ARG A HG3  8  
ATOM 11092 H HD2  . ARG A 1 15  ? 9.644   -12.907 -5.555  1.00 0.00 ? 15  ARG A HD2  8  
ATOM 11093 H HD3  . ARG A 1 15  ? 9.527   -14.384 -4.585  1.00 0.00 ? 15  ARG A HD3  8  
ATOM 11094 H HE   . ARG A 1 15  ? 10.270  -14.969 -7.282  1.00 0.00 ? 15  ARG A HE   8  
ATOM 11095 H HH11 . ARG A 1 15  ? 11.810  -13.902 -4.165  1.00 0.00 ? 15  ARG A HH11 8  
ATOM 11096 H HH12 . ARG A 1 15  ? 13.369  -14.124 -4.792  1.00 0.00 ? 15  ARG A HH12 8  
ATOM 11097 H HH21 . ARG A 1 15  ? 12.382  -15.282 -7.987  1.00 0.00 ? 15  ARG A HH21 8  
ATOM 11098 H HH22 . ARG A 1 15  ? 13.729  -14.858 -6.982  1.00 0.00 ? 15  ARG A HH22 8  
ATOM 11099 N N    . GLU A 1 16  ? 8.126   -12.562 -2.990  1.00 0.00 ? 16  GLU A N    8  
ATOM 11100 C CA   . GLU A 1 16  ? 8.432   -11.433 -2.125  1.00 0.00 ? 16  GLU A CA   8  
ATOM 11101 C C    . GLU A 1 16  ? 8.907   -10.273 -3.005  1.00 0.00 ? 16  GLU A C    8  
ATOM 11102 O O    . GLU A 1 16  ? 9.294   -10.466 -4.165  1.00 0.00 ? 16  GLU A O    8  
ATOM 11103 C CB   . GLU A 1 16  ? 9.500   -11.811 -1.083  1.00 0.00 ? 16  GLU A CB   8  
ATOM 11104 C CG   . GLU A 1 16  ? 9.044   -12.788 0.015   1.00 0.00 ? 16  GLU A CG   8  
ATOM 11105 C CD   . GLU A 1 16  ? 9.638   -14.201 -0.089  1.00 0.00 ? 16  GLU A CD   8  
ATOM 11106 O OE1  . GLU A 1 16  ? 10.884  -14.346 -0.137  1.00 0.00 ? 16  GLU A OE1  8  
ATOM 11107 O OE2  . GLU A 1 16  ? 8.859   -15.182 -0.038  1.00 0.00 ? 16  GLU A OE2  8  
ATOM 11108 H H    . GLU A 1 16  ? 8.702   -12.596 -3.816  1.00 0.00 ? 16  GLU A H    8  
ATOM 11109 H HA   . GLU A 1 16  ? 7.530   -11.099 -1.616  1.00 0.00 ? 16  GLU A HA   8  
ATOM 11110 H HB2  . GLU A 1 16  ? 10.359  -12.218 -1.606  1.00 0.00 ? 16  GLU A HB2  8  
ATOM 11111 H HB3  . GLU A 1 16  ? 9.818   -10.893 -0.586  1.00 0.00 ? 16  GLU A HB3  8  
ATOM 11112 H HG2  . GLU A 1 16  ? 9.331   -12.361 0.978   1.00 0.00 ? 16  GLU A HG2  8  
ATOM 11113 H HG3  . GLU A 1 16  ? 7.957   -12.850 0.019   1.00 0.00 ? 16  GLU A HG3  8  
ATOM 11114 N N    . VAL A 1 17  ? 8.884   -9.074  -2.431  1.00 0.00 ? 17  VAL A N    8  
ATOM 11115 C CA   . VAL A 1 17  ? 9.257   -7.801  -3.025  1.00 0.00 ? 17  VAL A CA   8  
ATOM 11116 C C    . VAL A 1 17  ? 10.034  -7.031  -1.953  1.00 0.00 ? 17  VAL A C    8  
ATOM 11117 O O    . VAL A 1 17  ? 9.890   -7.301  -0.755  1.00 0.00 ? 17  VAL A O    8  
ATOM 11118 C CB   . VAL A 1 17  ? 7.983   -7.070  -3.514  1.00 0.00 ? 17  VAL A CB   8  
ATOM 11119 C CG1  . VAL A 1 17  ? 6.937   -6.937  -2.397  1.00 0.00 ? 17  VAL A CG1  8  
ATOM 11120 C CG2  . VAL A 1 17  ? 8.268   -5.673  -4.089  1.00 0.00 ? 17  VAL A CG2  8  
ATOM 11121 H H    . VAL A 1 17  ? 8.624   -9.003  -1.458  1.00 0.00 ? 17  VAL A H    8  
ATOM 11122 H HA   . VAL A 1 17  ? 9.904   -7.997  -3.879  1.00 0.00 ? 17  VAL A HA   8  
ATOM 11123 H HB   . VAL A 1 17  ? 7.538   -7.666  -4.312  1.00 0.00 ? 17  VAL A HB   8  
ATOM 11124 H HG11 . VAL A 1 17  ? 7.364   -6.464  -1.517  1.00 0.00 ? 17  VAL A HG11 8  
ATOM 11125 H HG12 . VAL A 1 17  ? 6.102   -6.337  -2.736  1.00 0.00 ? 17  VAL A HG12 8  
ATOM 11126 H HG13 . VAL A 1 17  ? 6.548   -7.918  -2.130  1.00 0.00 ? 17  VAL A HG13 8  
ATOM 11127 H HG21 . VAL A 1 17  ? 9.065   -5.739  -4.829  1.00 0.00 ? 17  VAL A HG21 8  
ATOM 11128 H HG22 . VAL A 1 17  ? 7.371   -5.295  -4.577  1.00 0.00 ? 17  VAL A HG22 8  
ATOM 11129 H HG23 . VAL A 1 17  ? 8.553   -4.973  -3.302  1.00 0.00 ? 17  VAL A HG23 8  
ATOM 11130 N N    . ASP A 1 18  ? 10.882  -6.089  -2.357  1.00 0.00 ? 18  ASP A N    8  
ATOM 11131 C CA   . ASP A 1 18  ? 11.667  -5.276  -1.434  1.00 0.00 ? 18  ASP A CA   8  
ATOM 11132 C C    . ASP A 1 18  ? 10.853  -4.041  -1.096  1.00 0.00 ? 18  ASP A C    8  
ATOM 11133 O O    . ASP A 1 18  ? 10.794  -3.101  -1.888  1.00 0.00 ? 18  ASP A O    8  
ATOM 11134 C CB   . ASP A 1 18  ? 13.026  -4.908  -2.041  1.00 0.00 ? 18  ASP A CB   8  
ATOM 11135 C CG   . ASP A 1 18  ? 13.963  -6.108  -2.138  1.00 0.00 ? 18  ASP A CG   8  
ATOM 11136 O OD1  . ASP A 1 18  ? 13.845  -7.032  -1.304  1.00 0.00 ? 18  ASP A OD1  8  
ATOM 11137 O OD2  . ASP A 1 18  ? 14.793  -6.149  -3.070  1.00 0.00 ? 18  ASP A OD2  8  
ATOM 11138 H H    . ASP A 1 18  ? 10.958  -5.867  -3.342  1.00 0.00 ? 18  ASP A H    8  
ATOM 11139 H HA   . ASP A 1 18  ? 11.859  -5.825  -0.511  1.00 0.00 ? 18  ASP A HA   8  
ATOM 11140 H HB2  . ASP A 1 18  ? 12.876  -4.473  -3.027  1.00 0.00 ? 18  ASP A HB2  8  
ATOM 11141 H HB3  . ASP A 1 18  ? 13.505  -4.155  -1.419  1.00 0.00 ? 18  ASP A HB3  8  
ATOM 11142 N N    . THR A 1 19  ? 10.181  -4.040  0.056   1.00 0.00 ? 19  THR A N    8  
ATOM 11143 C CA   . THR A 1 19  ? 9.273   -2.951  0.401   1.00 0.00 ? 19  THR A CA   8  
ATOM 11144 C C    . THR A 1 19  ? 9.981   -1.592  0.489   1.00 0.00 ? 19  THR A C    8  
ATOM 11145 O O    . THR A 1 19  ? 9.347   -0.584  0.184   1.00 0.00 ? 19  THR A O    8  
ATOM 11146 C CB   . THR A 1 19  ? 8.469   -3.264  1.669   1.00 0.00 ? 19  THR A CB   8  
ATOM 11147 O OG1  . THR A 1 19  ? 9.308   -3.642  2.741   1.00 0.00 ? 19  THR A OG1  8  
ATOM 11148 C CG2  . THR A 1 19  ? 7.485   -4.408  1.426   1.00 0.00 ? 19  THR A CG2  8  
ATOM 11149 H H    . THR A 1 19  ? 10.197  -4.871  0.635   1.00 0.00 ? 19  THR A H    8  
ATOM 11150 H HA   . THR A 1 19  ? 8.555   -2.871  -0.413  1.00 0.00 ? 19  THR A HA   8  
ATOM 11151 H HB   . THR A 1 19  ? 7.897   -2.380  1.953   1.00 0.00 ? 19  THR A HB   8  
ATOM 11152 H HG1  . THR A 1 19  ? 8.726   -3.767  3.520   1.00 0.00 ? 19  THR A HG1  8  
ATOM 11153 H HG21 . THR A 1 19  ? 6.806   -4.150  0.612   1.00 0.00 ? 19  THR A HG21 8  
ATOM 11154 H HG22 . THR A 1 19  ? 8.014   -5.326  1.168   1.00 0.00 ? 19  THR A HG22 8  
ATOM 11155 H HG23 . THR A 1 19  ? 6.895   -4.581  2.323   1.00 0.00 ? 19  THR A HG23 8  
ATOM 11156 N N    . LEU A 1 20  ? 11.272  -1.531  0.853   1.00 0.00 ? 20  LEU A N    8  
ATOM 11157 C CA   . LEU A 1 20  ? 12.022  -0.285  0.776   1.00 0.00 ? 20  LEU A CA   8  
ATOM 11158 C C    . LEU A 1 20  ? 12.022  0.238   -0.653  1.00 0.00 ? 20  LEU A C    8  
ATOM 11159 O O    . LEU A 1 20  ? 11.536  1.341   -0.899  1.00 0.00 ? 20  LEU A O    8  
ATOM 11160 C CB   . LEU A 1 20  ? 13.469  -0.486  1.268   1.00 0.00 ? 20  LEU A CB   8  
ATOM 11161 C CG   . LEU A 1 20  ? 13.776  0.224   2.588   1.00 0.00 ? 20  LEU A CG   8  
ATOM 11162 C CD1  . LEU A 1 20  ? 13.608  1.746   2.493   1.00 0.00 ? 20  LEU A CD1  8  
ATOM 11163 C CD2  . LEU A 1 20  ? 12.991  -0.356  3.770   1.00 0.00 ? 20  LEU A CD2  8  
ATOM 11164 H H    . LEU A 1 20  ? 11.778  -2.353  1.163   1.00 0.00 ? 20  LEU A H    8  
ATOM 11165 H HA   . LEU A 1 20  ? 11.499  0.451   1.388   1.00 0.00 ? 20  LEU A HA   8  
ATOM 11166 H HB2  . LEU A 1 20  ? 13.683  -1.547  1.382   1.00 0.00 ? 20  LEU A HB2  8  
ATOM 11167 H HB3  . LEU A 1 20  ? 14.179  -0.109  0.526   1.00 0.00 ? 20  LEU A HB3  8  
ATOM 11168 H HG   . LEU A 1 20  ? 14.823  0.022   2.785   1.00 0.00 ? 20  LEU A HG   8  
ATOM 11169 H HD11 . LEU A 1 20  ? 14.164  2.123   1.632   1.00 0.00 ? 20  LEU A HD11 8  
ATOM 11170 H HD12 . LEU A 1 20  ? 12.562  2.035   2.385   1.00 0.00 ? 20  LEU A HD12 8  
ATOM 11171 H HD13 . LEU A 1 20  ? 14.002  2.216   3.391   1.00 0.00 ? 20  LEU A HD13 8  
ATOM 11172 H HD21 . LEU A 1 20  ? 13.126  0.251   4.665   1.00 0.00 ? 20  LEU A HD21 8  
ATOM 11173 H HD22 . LEU A 1 20  ? 11.928  -0.414  3.545   1.00 0.00 ? 20  LEU A HD22 8  
ATOM 11174 H HD23 . LEU A 1 20  ? 13.349  -1.367  3.972   1.00 0.00 ? 20  LEU A HD23 8  
ATOM 11175 N N    . GLU A 1 21  ? 12.553  -0.554  -1.583  1.00 0.00 ? 21  GLU A N    8  
ATOM 11176 C CA   . GLU A 1 21  ? 12.727  -0.173  -2.978  1.00 0.00 ? 21  GLU A CA   8  
ATOM 11177 C C    . GLU A 1 21  ? 11.386  0.165   -3.630  1.00 0.00 ? 21  GLU A C    8  
ATOM 11178 O O    . GLU A 1 21  ? 11.292  1.114   -4.403  1.00 0.00 ? 21  GLU A O    8  
ATOM 11179 C CB   . GLU A 1 21  ? 13.449  -1.310  -3.704  1.00 0.00 ? 21  GLU A CB   8  
ATOM 11180 C CG   . GLU A 1 21  ? 13.857  -0.967  -5.141  1.00 0.00 ? 21  GLU A CG   8  
ATOM 11181 C CD   . GLU A 1 21  ? 14.737  0.271   -5.250  1.00 0.00 ? 21  GLU A CD   8  
ATOM 11182 O OE1  . GLU A 1 21  ? 15.615  0.462   -4.373  1.00 0.00 ? 21  GLU A OE1  8  
ATOM 11183 O OE2  . GLU A 1 21  ? 14.573  1.059   -6.201  1.00 0.00 ? 21  GLU A OE2  8  
ATOM 11184 H H    . GLU A 1 21  ? 12.906  -1.468  -1.333  1.00 0.00 ? 21  GLU A H    8  
ATOM 11185 H HA   . GLU A 1 21  ? 13.370  0.705   -3.019  1.00 0.00 ? 21  GLU A HA   8  
ATOM 11186 H HB2  . GLU A 1 21  ? 14.355  -1.543  -3.156  1.00 0.00 ? 21  GLU A HB2  8  
ATOM 11187 H HB3  . GLU A 1 21  ? 12.814  -2.198  -3.722  1.00 0.00 ? 21  GLU A HB3  8  
ATOM 11188 H HG2  . GLU A 1 21  ? 14.381  -1.804  -5.590  1.00 0.00 ? 21  GLU A HG2  8  
ATOM 11189 H HG3  . GLU A 1 21  ? 12.962  -0.824  -5.723  1.00 0.00 ? 21  GLU A HG3  8  
ATOM 11190 N N    . LEU A 1 22  ? 10.335  -0.569  -3.263  1.00 0.00 ? 22  LEU A N    8  
ATOM 11191 C CA   . LEU A 1 22  ? 8.964   -0.259  -3.629  1.00 0.00 ? 22  LEU A CA   8  
ATOM 11192 C C    . LEU A 1 22  ? 8.594   1.158   -3.190  1.00 0.00 ? 22  LEU A C    8  
ATOM 11193 O O    . LEU A 1 22  ? 8.242   1.974   -4.036  1.00 0.00 ? 22  LEU A O    8  
ATOM 11194 C CB   . LEU A 1 22  ? 8.033   -1.321  -3.035  1.00 0.00 ? 22  LEU A CB   8  
ATOM 11195 C CG   . LEU A 1 22  ? 6.545   -0.953  -3.096  1.00 0.00 ? 22  LEU A CG   8  
ATOM 11196 C CD1  . LEU A 1 22  ? 6.078   -0.799  -4.541  1.00 0.00 ? 22  LEU A CD1  8  
ATOM 11197 C CD2  . LEU A 1 22  ? 5.750   -2.025  -2.354  1.00 0.00 ? 22  LEU A CD2  8  
ATOM 11198 H H    . LEU A 1 22  ? 10.517  -1.363  -2.657  1.00 0.00 ? 22  LEU A H    8  
ATOM 11199 H HA   . LEU A 1 22  ? 8.891   -0.306  -4.714  1.00 0.00 ? 22  LEU A HA   8  
ATOM 11200 H HB2  . LEU A 1 22  ? 8.202   -2.266  -3.550  1.00 0.00 ? 22  LEU A HB2  8  
ATOM 11201 H HB3  . LEU A 1 22  ? 8.304   -1.467  -1.999  1.00 0.00 ? 22  LEU A HB3  8  
ATOM 11202 H HG   . LEU A 1 22  ? 6.369   -0.015  -2.573  1.00 0.00 ? 22  LEU A HG   8  
ATOM 11203 H HD11 . LEU A 1 22  ? 6.328   -1.683  -5.126  1.00 0.00 ? 22  LEU A HD11 8  
ATOM 11204 H HD12 . LEU A 1 22  ? 5.009   -0.626  -4.583  1.00 0.00 ? 22  LEU A HD12 8  
ATOM 11205 H HD13 . LEU A 1 22  ? 6.568   0.057   -4.999  1.00 0.00 ? 22  LEU A HD13 8  
ATOM 11206 H HD21 . LEU A 1 22  ? 5.883   -2.991  -2.839  1.00 0.00 ? 22  LEU A HD21 8  
ATOM 11207 H HD22 . LEU A 1 22  ? 6.122   -2.107  -1.336  1.00 0.00 ? 22  LEU A HD22 8  
ATOM 11208 H HD23 . LEU A 1 22  ? 4.698   -1.738  -2.342  1.00 0.00 ? 22  LEU A HD23 8  
ATOM 11209 N N    . THR A 1 23  ? 8.643   1.471   -1.889  1.00 0.00 ? 23  THR A N    8  
ATOM 11210 C CA   . THR A 1 23  ? 8.261   2.809   -1.429  1.00 0.00 ? 23  THR A CA   8  
ATOM 11211 C C    . THR A 1 23  ? 9.127   3.878   -2.108  1.00 0.00 ? 23  THR A C    8  
ATOM 11212 O O    . THR A 1 23  ? 8.631   4.948   -2.443  1.00 0.00 ? 23  THR A O    8  
ATOM 11213 C CB   . THR A 1 23  ? 8.325   2.936   0.098   1.00 0.00 ? 23  THR A CB   8  
ATOM 11214 O OG1  . THR A 1 23  ? 9.605   2.689   0.637   1.00 0.00 ? 23  THR A OG1  8  
ATOM 11215 C CG2  . THR A 1 23  ? 7.314   2.009   0.759   1.00 0.00 ? 23  THR A CG2  8  
ATOM 11216 H H    . THR A 1 23  ? 8.972   0.780   -1.224  1.00 0.00 ? 23  THR A H    8  
ATOM 11217 H HA   . THR A 1 23  ? 7.213   2.973   -1.708  1.00 0.00 ? 23  THR A HA   8  
ATOM 11218 H HB   . THR A 1 23  ? 8.050   3.956   0.357   1.00 0.00 ? 23  THR A HB   8  
ATOM 11219 H HG1  . THR A 1 23  ? 10.023  1.944   0.179   1.00 0.00 ? 23  THR A HG1  8  
ATOM 11220 H HG21 . THR A 1 23  ? 7.214   2.256   1.815   1.00 0.00 ? 23  THR A HG21 8  
ATOM 11221 H HG22 . THR A 1 23  ? 6.356   2.098   0.259   1.00 0.00 ? 23  THR A HG22 8  
ATOM 11222 H HG23 . THR A 1 23  ? 7.652   0.992   0.649   1.00 0.00 ? 23  THR A HG23 8  
ATOM 11223 N N    . ARG A 1 24  ? 10.411  3.585   -2.316  1.00 0.00 ? 24  ARG A N    8  
ATOM 11224 C CA   . ARG A 1 24  ? 11.375  4.416   -3.049  1.00 0.00 ? 24  ARG A CA   8  
ATOM 11225 C C    . ARG A 1 24  ? 10.870  4.761   -4.456  1.00 0.00 ? 24  ARG A C    8  
ATOM 11226 O O    . ARG A 1 24  ? 10.684  5.945   -4.746  1.00 0.00 ? 24  ARG A O    8  
ATOM 11227 C CB   . ARG A 1 24  ? 12.762  3.748   -3.054  1.00 0.00 ? 24  ARG A CB   8  
ATOM 11228 C CG   . ARG A 1 24  ? 13.639  4.260   -1.897  1.00 0.00 ? 24  ARG A CG   8  
ATOM 11229 C CD   . ARG A 1 24  ? 14.627  3.184   -1.447  1.00 0.00 ? 24  ARG A CD   8  
ATOM 11230 N NE   . ARG A 1 24  ? 15.715  3.720   -0.603  1.00 0.00 ? 24  ARG A NE   8  
ATOM 11231 C CZ   . ARG A 1 24  ? 16.950  4.045   -1.011  1.00 0.00 ? 24  ARG A CZ   8  
ATOM 11232 N NH1  . ARG A 1 24  ? 17.305  3.935   -2.286  1.00 0.00 ? 24  ARG A NH1  8  
ATOM 11233 N NH2  . ARG A 1 24  ? 17.825  4.513   -0.132  1.00 0.00 ? 24  ARG A NH2  8  
ATOM 11234 H H    . ARG A 1 24  ? 10.680  2.675   -1.944  1.00 0.00 ? 24  ARG A H    8  
ATOM 11235 H HA   . ARG A 1 24  ? 11.484  5.360   -2.525  1.00 0.00 ? 24  ARG A HA   8  
ATOM 11236 H HB2  . ARG A 1 24  ? 12.651  2.669   -2.980  1.00 0.00 ? 24  ARG A HB2  8  
ATOM 11237 H HB3  . ARG A 1 24  ? 13.275  3.958   -3.993  1.00 0.00 ? 24  ARG A HB3  8  
ATOM 11238 H HG2  . ARG A 1 24  ? 14.182  5.148   -2.224  1.00 0.00 ? 24  ARG A HG2  8  
ATOM 11239 H HG3  . ARG A 1 24  ? 13.016  4.522   -1.041  1.00 0.00 ? 24  ARG A HG3  8  
ATOM 11240 H HD2  . ARG A 1 24  ? 14.061  2.444   -0.885  1.00 0.00 ? 24  ARG A HD2  8  
ATOM 11241 H HD3  . ARG A 1 24  ? 15.047  2.688   -2.319  1.00 0.00 ? 24  ARG A HD3  8  
ATOM 11242 H HE   . ARG A 1 24  ? 15.520  3.799   0.387   1.00 0.00 ? 24  ARG A HE   8  
ATOM 11243 H HH11 . ARG A 1 24  ? 16.677  3.512   -2.971  1.00 0.00 ? 24  ARG A HH11 8  
ATOM 11244 H HH12 . ARG A 1 24  ? 18.262  4.075   -2.621  1.00 0.00 ? 24  ARG A HH12 8  
ATOM 11245 H HH21 . ARG A 1 24  ? 17.585  4.508   0.860   1.00 0.00 ? 24  ARG A HH21 8  
ATOM 11246 H HH22 . ARG A 1 24  ? 18.751  4.838   -0.400  1.00 0.00 ? 24  ARG A HH22 8  
ATOM 11247 N N    . GLN A 1 25  ? 10.617  3.759   -5.302  1.00 0.00 ? 25  GLN A N    8  
ATOM 11248 C CA   . GLN A 1 25  ? 10.063  3.905   -6.650  1.00 0.00 ? 25  GLN A CA   8  
ATOM 11249 C C    . GLN A 1 25  ? 8.753   4.693   -6.624  1.00 0.00 ? 25  GLN A C    8  
ATOM 11250 O O    . GLN A 1 25  ? 8.545   5.584   -7.446  1.00 0.00 ? 25  GLN A O    8  
ATOM 11251 C CB   . GLN A 1 25  ? 9.863   2.499   -7.238  1.00 0.00 ? 25  GLN A CB   8  
ATOM 11252 C CG   . GLN A 1 25  ? 11.160  1.907   -7.817  1.00 0.00 ? 25  GLN A CG   8  
ATOM 11253 C CD   . GLN A 1 25  ? 11.326  2.117   -9.329  1.00 0.00 ? 25  GLN A CD   8  
ATOM 11254 O OE1  . GLN A 1 25  ? 10.580  2.819   -10.015 1.00 0.00 ? 25  GLN A OE1  8  
ATOM 11255 N NE2  . GLN A 1 25  ? 12.327  1.485   -9.918  1.00 0.00 ? 25  GLN A NE2  8  
ATOM 11256 H H    . GLN A 1 25  ? 10.769  2.803   -4.989  1.00 0.00 ? 25  GLN A H    8  
ATOM 11257 H HA   . GLN A 1 25  ? 10.751  4.454   -7.293  1.00 0.00 ? 25  GLN A HA   8  
ATOM 11258 H HB2  . GLN A 1 25  ? 9.494   1.834   -6.456  1.00 0.00 ? 25  GLN A HB2  8  
ATOM 11259 H HB3  . GLN A 1 25  ? 9.106   2.524   -8.016  1.00 0.00 ? 25  GLN A HB3  8  
ATOM 11260 H HG2  . GLN A 1 25  ? 12.022  2.322   -7.297  1.00 0.00 ? 25  GLN A HG2  8  
ATOM 11261 H HG3  . GLN A 1 25  ? 11.146  0.830   -7.628  1.00 0.00 ? 25  GLN A HG3  8  
ATOM 11262 H HE21 . GLN A 1 25  ? 12.970  0.919   -9.355  1.00 0.00 ? 25  GLN A HE21 8  
ATOM 11263 H HE22 . GLN A 1 25  ? 12.169  1.171   -10.868 1.00 0.00 ? 25  GLN A HE22 8  
ATOM 11264 N N    . VAL A 1 26  ? 7.875   4.380   -5.674  1.00 0.00 ? 26  VAL A N    8  
ATOM 11265 C CA   . VAL A 1 26  ? 6.600   5.052   -5.476  1.00 0.00 ? 26  VAL A CA   8  
ATOM 11266 C C    . VAL A 1 26  ? 6.833   6.548   -5.223  1.00 0.00 ? 26  VAL A C    8  
ATOM 11267 O O    . VAL A 1 26  ? 6.293   7.374   -5.958  1.00 0.00 ? 26  VAL A O    8  
ATOM 11268 C CB   . VAL A 1 26  ? 5.845   4.307   -4.356  1.00 0.00 ? 26  VAL A CB   8  
ATOM 11269 C CG1  . VAL A 1 26  ? 4.636   5.061   -3.806  1.00 0.00 ? 26  VAL A CG1  8  
ATOM 11270 C CG2  . VAL A 1 26  ? 5.380   2.936   -4.871  1.00 0.00 ? 26  VAL A CG2  8  
ATOM 11271 H H    . VAL A 1 26  ? 8.098   3.605   -5.056  1.00 0.00 ? 26  VAL A H    8  
ATOM 11272 H HA   . VAL A 1 26  ? 6.020   4.967   -6.397  1.00 0.00 ? 26  VAL A HA   8  
ATOM 11273 H HB   . VAL A 1 26  ? 6.520   4.140   -3.522  1.00 0.00 ? 26  VAL A HB   8  
ATOM 11274 H HG11 . VAL A 1 26  ? 4.946   6.001   -3.355  1.00 0.00 ? 26  VAL A HG11 8  
ATOM 11275 H HG12 . VAL A 1 26  ? 3.956   5.267   -4.624  1.00 0.00 ? 26  VAL A HG12 8  
ATOM 11276 H HG13 . VAL A 1 26  ? 4.126   4.467   -3.051  1.00 0.00 ? 26  VAL A HG13 8  
ATOM 11277 H HG21 . VAL A 1 26  ? 5.159   2.283   -4.033  1.00 0.00 ? 26  VAL A HG21 8  
ATOM 11278 H HG22 . VAL A 1 26  ? 4.506   3.037   -5.517  1.00 0.00 ? 26  VAL A HG22 8  
ATOM 11279 H HG23 . VAL A 1 26  ? 6.168   2.453   -5.436  1.00 0.00 ? 26  VAL A HG23 8  
ATOM 11280 N N    . LYS A 1 27  ? 7.629   6.923   -4.211  1.00 0.00 ? 27  LYS A N    8  
ATOM 11281 C CA   . LYS A 1 27  ? 7.925   8.316   -3.889  1.00 0.00 ? 27  LYS A CA   8  
ATOM 11282 C C    . LYS A 1 27  ? 8.513   9.047   -5.093  1.00 0.00 ? 27  LYS A C    8  
ATOM 11283 O O    . LYS A 1 27  ? 8.076   10.159  -5.373  1.00 0.00 ? 27  LYS A O    8  
ATOM 11284 C CB   . LYS A 1 27  ? 8.876   8.386   -2.688  1.00 0.00 ? 27  LYS A CB   8  
ATOM 11285 C CG   . LYS A 1 27  ? 8.182   8.021   -1.365  1.00 0.00 ? 27  LYS A CG   8  
ATOM 11286 C CD   . LYS A 1 27  ? 9.196   7.872   -0.224  1.00 0.00 ? 27  LYS A CD   8  
ATOM 11287 C CE   . LYS A 1 27  ? 9.958   6.542   -0.286  1.00 0.00 ? 27  LYS A CE   8  
ATOM 11288 N NZ   . LYS A 1 27  ? 10.807  6.331   0.902   1.00 0.00 ? 27  LYS A NZ   8  
ATOM 11289 H H    . LYS A 1 27  ? 8.083   6.223   -3.631  1.00 0.00 ? 27  LYS A H    8  
ATOM 11290 H HA   . LYS A 1 27  ? 6.998   8.825   -3.630  1.00 0.00 ? 27  LYS A HA   8  
ATOM 11291 H HB2  . LYS A 1 27  ? 9.730   7.731   -2.865  1.00 0.00 ? 27  LYS A HB2  8  
ATOM 11292 H HB3  . LYS A 1 27  ? 9.247   9.408   -2.600  1.00 0.00 ? 27  LYS A HB3  8  
ATOM 11293 H HG2  . LYS A 1 27  ? 7.488   8.823   -1.112  1.00 0.00 ? 27  LYS A HG2  8  
ATOM 11294 H HG3  . LYS A 1 27  ? 7.609   7.099   -1.463  1.00 0.00 ? 27  LYS A HG3  8  
ATOM 11295 H HD2  . LYS A 1 27  ? 9.905   8.698   -0.277  1.00 0.00 ? 27  LYS A HD2  8  
ATOM 11296 H HD3  . LYS A 1 27  ? 8.658   7.926   0.719   1.00 0.00 ? 27  LYS A HD3  8  
ATOM 11297 H HE2  . LYS A 1 27  ? 9.238   5.728   -0.345  1.00 0.00 ? 27  LYS A HE2  8  
ATOM 11298 H HE3  . LYS A 1 27  ? 10.577  6.539   -1.184  1.00 0.00 ? 27  LYS A HE3  8  
ATOM 11299 H HZ1  . LYS A 1 27  ? 10.250  6.215   1.744   1.00 0.00 ? 27  LYS A HZ1  8  
ATOM 11300 H HZ2  . LYS A 1 27  ? 11.422  5.531   0.812   1.00 0.00 ? 27  LYS A HZ2  8  
ATOM 11301 H HZ3  . LYS A 1 27  ? 11.429  7.127   1.019   1.00 0.00 ? 27  LYS A HZ3  8  
ATOM 11302 N N    . GLU A 1 28  ? 9.450   8.431   -5.814  1.00 0.00 ? 28  GLU A N    8  
ATOM 11303 C CA   . GLU A 1 28  ? 10.041  9.006   -7.017  1.00 0.00 ? 28  GLU A CA   8  
ATOM 11304 C C    . GLU A 1 28  ? 8.965   9.301   -8.063  1.00 0.00 ? 28  GLU A C    8  
ATOM 11305 O O    . GLU A 1 28  ? 8.872   10.431  -8.540  1.00 0.00 ? 28  GLU A O    8  
ATOM 11306 C CB   . GLU A 1 28  ? 11.114  8.053   -7.570  1.00 0.00 ? 28  GLU A CB   8  
ATOM 11307 C CG   . GLU A 1 28  ? 12.503  8.377   -7.013  1.00 0.00 ? 28  GLU A CG   8  
ATOM 11308 C CD   . GLU A 1 28  ? 13.110  9.640   -7.633  1.00 0.00 ? 28  GLU A CD   8  
ATOM 11309 O OE1  . GLU A 1 28  ? 13.575  9.571   -8.796  1.00 0.00 ? 28  GLU A OE1  8  
ATOM 11310 O OE2  . GLU A 1 28  ? 13.180  10.679  -6.937  1.00 0.00 ? 28  GLU A OE2  8  
ATOM 11311 H H    . GLU A 1 28  ? 9.752   7.507   -5.528  1.00 0.00 ? 28  GLU A H    8  
ATOM 11312 H HA   . GLU A 1 28  ? 10.502  9.961   -6.755  1.00 0.00 ? 28  GLU A HA   8  
ATOM 11313 H HB2  . GLU A 1 28  ? 10.861  7.023   -7.314  1.00 0.00 ? 28  GLU A HB2  8  
ATOM 11314 H HB3  . GLU A 1 28  ? 11.147  8.119   -8.654  1.00 0.00 ? 28  GLU A HB3  8  
ATOM 11315 H HG2  . GLU A 1 28  ? 12.431  8.508   -5.934  1.00 0.00 ? 28  GLU A HG2  8  
ATOM 11316 H HG3  . GLU A 1 28  ? 13.163  7.533   -7.219  1.00 0.00 ? 28  GLU A HG3  8  
ATOM 11317 N N    . LYS A 1 29  ? 8.134   8.319   -8.422  1.00 0.00 ? 29  LYS A N    8  
ATOM 11318 C CA   . LYS A 1 29  ? 7.136   8.498   -9.476  1.00 0.00 ? 29  LYS A CA   8  
ATOM 11319 C C    . LYS A 1 29  ? 6.081   9.525   -9.064  1.00 0.00 ? 29  LYS A C    8  
ATOM 11320 O O    . LYS A 1 29  ? 5.682   10.355  -9.877  1.00 0.00 ? 29  LYS A O    8  
ATOM 11321 C CB   . LYS A 1 29  ? 6.550   7.137   -9.849  1.00 0.00 ? 29  LYS A CB   8  
ATOM 11322 C CG   . LYS A 1 29  ? 5.726   7.195   -11.149 1.00 0.00 ? 29  LYS A CG   8  
ATOM 11323 C CD   . LYS A 1 29  ? 5.500   5.781   -11.713 1.00 0.00 ? 29  LYS A CD   8  
ATOM 11324 C CE   . LYS A 1 29  ? 6.119   5.589   -13.109 1.00 0.00 ? 29  LYS A CE   8  
ATOM 11325 N NZ   . LYS A 1 29  ? 6.439   4.171   -13.391 1.00 0.00 ? 29  LYS A NZ   8  
ATOM 11326 H H    . LYS A 1 29  ? 8.247   7.399   -8.005  1.00 0.00 ? 29  LYS A H    8  
ATOM 11327 H HA   . LYS A 1 29  ? 7.652   8.869   -10.361 1.00 0.00 ? 29  LYS A HA   8  
ATOM 11328 H HB2  . LYS A 1 29  ? 7.389   6.454   -9.999  1.00 0.00 ? 29  LYS A HB2  8  
ATOM 11329 H HB3  . LYS A 1 29  ? 5.939   6.759   -9.031  1.00 0.00 ? 29  LYS A HB3  8  
ATOM 11330 H HG2  . LYS A 1 29  ? 4.764   7.666   -10.943 1.00 0.00 ? 29  LYS A HG2  8  
ATOM 11331 H HG3  . LYS A 1 29  ? 6.254   7.802   -11.885 1.00 0.00 ? 29  LYS A HG3  8  
ATOM 11332 H HD2  . LYS A 1 29  ? 5.957   5.080   -11.025 1.00 0.00 ? 29  LYS A HD2  8  
ATOM 11333 H HD3  . LYS A 1 29  ? 4.432   5.567   -11.755 1.00 0.00 ? 29  LYS A HD3  8  
ATOM 11334 H HE2  . LYS A 1 29  ? 5.434   5.979   -13.864 1.00 0.00 ? 29  LYS A HE2  8  
ATOM 11335 H HE3  . LYS A 1 29  ? 7.046   6.163   -13.162 1.00 0.00 ? 29  LYS A HE3  8  
ATOM 11336 H HZ1  . LYS A 1 29  ? 7.152   3.858   -12.740 1.00 0.00 ? 29  LYS A HZ1  8  
ATOM 11337 H HZ2  . LYS A 1 29  ? 5.620   3.569   -13.321 1.00 0.00 ? 29  LYS A HZ2  8  
ATOM 11338 H HZ3  . LYS A 1 29  ? 6.828   4.069   -14.327 1.00 0.00 ? 29  LYS A HZ3  8  
ATOM 11339 N N    . LEU A 1 30  ? 5.679   9.528   -7.791  1.00 0.00 ? 30  LEU A N    8  
ATOM 11340 C CA   . LEU A 1 30  ? 4.796   10.542  -7.220  1.00 0.00 ? 30  LEU A CA   8  
ATOM 11341 C C    . LEU A 1 30  ? 5.412   11.924  -7.385  1.00 0.00 ? 30  LEU A C    8  
ATOM 11342 O O    . LEU A 1 30  ? 4.747   12.835  -7.877  1.00 0.00 ? 30  LEU A O    8  
ATOM 11343 C CB   . LEU A 1 30  ? 4.561   10.278  -5.727  1.00 0.00 ? 30  LEU A CB   8  
ATOM 11344 C CG   . LEU A 1 30  ? 3.598   9.115   -5.460  1.00 0.00 ? 30  LEU A CG   8  
ATOM 11345 C CD1  . LEU A 1 30  ? 3.754   8.667   -4.012  1.00 0.00 ? 30  LEU A CD1  8  
ATOM 11346 C CD2  . LEU A 1 30  ? 2.150   9.555   -5.673  1.00 0.00 ? 30  LEU A CD2  8  
ATOM 11347 H H    . LEU A 1 30  ? 6.077   8.828   -7.174  1.00 0.00 ? 30  LEU A H    8  
ATOM 11348 H HA   . LEU A 1 30  ? 3.848   10.526  -7.756  1.00 0.00 ? 30  LEU A HA   8  
ATOM 11349 H HB2  . LEU A 1 30  ? 5.522   10.072  -5.258  1.00 0.00 ? 30  LEU A HB2  8  
ATOM 11350 H HB3  . LEU A 1 30  ? 4.164   11.183  -5.265  1.00 0.00 ? 30  LEU A HB3  8  
ATOM 11351 H HG   . LEU A 1 30  ? 3.832   8.281   -6.119  1.00 0.00 ? 30  LEU A HG   8  
ATOM 11352 H HD11 . LEU A 1 30  ? 4.785   8.377   -3.826  1.00 0.00 ? 30  LEU A HD11 8  
ATOM 11353 H HD12 . LEU A 1 30  ? 3.475   9.494   -3.367  1.00 0.00 ? 30  LEU A HD12 8  
ATOM 11354 H HD13 . LEU A 1 30  ? 3.114   7.805   -3.838  1.00 0.00 ? 30  LEU A HD13 8  
ATOM 11355 H HD21 . LEU A 1 30  ? 1.979   9.732   -6.733  1.00 0.00 ? 30  LEU A HD21 8  
ATOM 11356 H HD22 . LEU A 1 30  ? 1.468   8.771   -5.351  1.00 0.00 ? 30  LEU A HD22 8  
ATOM 11357 H HD23 . LEU A 1 30  ? 1.952   10.456  -5.089  1.00 0.00 ? 30  LEU A HD23 8  
ATOM 11358 N N    . ALA A 1 31  ? 6.675   12.083  -6.980  1.00 0.00 ? 31  ALA A N    8  
ATOM 11359 C CA   . ALA A 1 31  ? 7.415   13.325  -7.110  1.00 0.00 ? 31  ALA A CA   8  
ATOM 11360 C C    . ALA A 1 31  ? 7.606   13.710  -8.578  1.00 0.00 ? 31  ALA A C    8  
ATOM 11361 O O    . ALA A 1 31  ? 7.733   14.903  -8.854  1.00 0.00 ? 31  ALA A O    8  
ATOM 11362 C CB   . ALA A 1 31  ? 8.764   13.204  -6.391  1.00 0.00 ? 31  ALA A CB   8  
ATOM 11363 H H    . ALA A 1 31  ? 7.167   11.291  -6.579  1.00 0.00 ? 31  ALA A H    8  
ATOM 11364 H HA   . ALA A 1 31  ? 6.838   14.115  -6.627  1.00 0.00 ? 31  ALA A HA   8  
ATOM 11365 H HB1  . ALA A 1 31  ? 9.313   14.142  -6.483  1.00 0.00 ? 31  ALA A HB1  8  
ATOM 11366 H HB2  . ALA A 1 31  ? 8.612   12.984  -5.334  1.00 0.00 ? 31  ALA A HB2  8  
ATOM 11367 H HB3  . ALA A 1 31  ? 9.358   12.403  -6.833  1.00 0.00 ? 31  ALA A HB3  8  
ATOM 11368 N N    . LYS A 1 32  ? 7.604   12.753  -9.515  1.00 0.00 ? 32  LYS A N    8  
ATOM 11369 C CA   . LYS A 1 32  ? 7.705   13.022  -10.950 1.00 0.00 ? 32  LYS A CA   8  
ATOM 11370 C C    . LYS A 1 32  ? 6.425   13.634  -11.520 1.00 0.00 ? 32  LYS A C    8  
ATOM 11371 O O    . LYS A 1 32  ? 6.443   14.189  -12.613 1.00 0.00 ? 32  LYS A O    8  
ATOM 11372 C CB   . LYS A 1 32  ? 8.025   11.734  -11.733 1.00 0.00 ? 32  LYS A CB   8  
ATOM 11373 C CG   . LYS A 1 32  ? 8.903   12.091  -12.942 1.00 0.00 ? 32  LYS A CG   8  
ATOM 11374 C CD   . LYS A 1 32  ? 8.867   11.052  -14.072 1.00 0.00 ? 32  LYS A CD   8  
ATOM 11375 C CE   . LYS A 1 32  ? 8.368   11.756  -15.340 1.00 0.00 ? 32  LYS A CE   8  
ATOM 11376 N NZ   . LYS A 1 32  ? 8.089   10.826  -16.450 1.00 0.00 ? 32  LYS A NZ   8  
ATOM 11377 H H    . LYS A 1 32  ? 7.580   11.785  -9.211  1.00 0.00 ? 32  LYS A H    8  
ATOM 11378 H HA   . LYS A 1 32  ? 8.513   13.739  -11.092 1.00 0.00 ? 32  LYS A HA   8  
ATOM 11379 H HB2  . LYS A 1 32  ? 8.554   11.013  -11.113 1.00 0.00 ? 32  LYS A HB2  8  
ATOM 11380 H HB3  . LYS A 1 32  ? 7.091   11.276  -12.066 1.00 0.00 ? 32  LYS A HB3  8  
ATOM 11381 H HG2  . LYS A 1 32  ? 8.568   13.050  -13.328 1.00 0.00 ? 32  LYS A HG2  8  
ATOM 11382 H HG3  . LYS A 1 32  ? 9.930   12.229  -12.609 1.00 0.00 ? 32  LYS A HG3  8  
ATOM 11383 H HD2  . LYS A 1 32  ? 9.867   10.649  -14.233 1.00 0.00 ? 32  LYS A HD2  8  
ATOM 11384 H HD3  . LYS A 1 32  ? 8.202   10.229  -13.809 1.00 0.00 ? 32  LYS A HD3  8  
ATOM 11385 H HE2  . LYS A 1 32  ? 7.449   12.291  -15.092 1.00 0.00 ? 32  LYS A HE2  8  
ATOM 11386 H HE3  . LYS A 1 32  ? 9.099   12.502  -15.653 1.00 0.00 ? 32  LYS A HE3  8  
ATOM 11387 H HZ1  . LYS A 1 32  ? 7.742   11.346  -17.253 1.00 0.00 ? 32  LYS A HZ1  8  
ATOM 11388 H HZ2  . LYS A 1 32  ? 8.911   10.320  -16.738 1.00 0.00 ? 32  LYS A HZ2  8  
ATOM 11389 H HZ3  . LYS A 1 32  ? 7.341   10.186  -16.201 1.00 0.00 ? 32  LYS A HZ3  8  
ATOM 11390 N N    . ASN A 1 33  ? 5.308   13.487  -10.811 1.00 0.00 ? 33  ASN A N    8  
ATOM 11391 C CA   . ASN A 1 33  ? 3.985   13.931  -11.223 1.00 0.00 ? 33  ASN A CA   8  
ATOM 11392 C C    . ASN A 1 33  ? 3.397   14.954  -10.247 1.00 0.00 ? 33  ASN A C    8  
ATOM 11393 O O    . ASN A 1 33  ? 2.240   15.343  -10.403 1.00 0.00 ? 33  ASN A O    8  
ATOM 11394 C CB   . ASN A 1 33  ? 3.065   12.707  -11.408 1.00 0.00 ? 33  ASN A CB   8  
ATOM 11395 C CG   . ASN A 1 33  ? 3.319   11.980  -12.715 1.00 0.00 ? 33  ASN A CG   8  
ATOM 11396 O OD1  . ASN A 1 33  ? 3.697   10.810  -12.747 1.00 0.00 ? 33  ASN A OD1  8  
ATOM 11397 N ND2  . ASN A 1 33  ? 3.120   12.668  -13.824 1.00 0.00 ? 33  ASN A ND2  8  
ATOM 11398 H H    . ASN A 1 33  ? 5.368   12.918  -9.983  1.00 0.00 ? 33  ASN A H    8  
ATOM 11399 H HA   . ASN A 1 33  ? 4.068   14.447  -12.179 1.00 0.00 ? 33  ASN A HA   8  
ATOM 11400 H HB2  . ASN A 1 33  ? 3.190   12.019  -10.571 1.00 0.00 ? 33  ASN A HB2  8  
ATOM 11401 H HB3  . ASN A 1 33  ? 2.027   13.037  -11.428 1.00 0.00 ? 33  ASN A HB3  8  
ATOM 11402 H HD21 . ASN A 1 33  ? 2.828   13.635  -13.742 1.00 0.00 ? 33  ASN A HD21 8  
ATOM 11403 H HD22 . ASN A 1 33  ? 3.295   12.240  -14.722 1.00 0.00 ? 33  ASN A HD22 8  
ATOM 11404 N N    . GLY A 1 34  ? 4.146   15.403  -9.235  1.00 0.00 ? 34  GLY A N    8  
ATOM 11405 C CA   . GLY A 1 34  ? 3.670   16.395  -8.277  1.00 0.00 ? 34  GLY A CA   8  
ATOM 11406 C C    . GLY A 1 34  ? 2.438   15.904  -7.511  1.00 0.00 ? 34  GLY A C    8  
ATOM 11407 O O    . GLY A 1 34  ? 1.523   16.688  -7.226  1.00 0.00 ? 34  GLY A O    8  
ATOM 11408 H H    . GLY A 1 34  ? 5.100   15.081  -9.170  1.00 0.00 ? 34  GLY A H    8  
ATOM 11409 H HA2  . GLY A 1 34  ? 4.466   16.619  -7.570  1.00 0.00 ? 34  GLY A HA2  8  
ATOM 11410 H HA3  . GLY A 1 34  ? 3.415   17.307  -8.818  1.00 0.00 ? 34  GLY A HA3  8  
ATOM 11411 N N    . ILE A 1 35  ? 2.370   14.604  -7.220  1.00 0.00 ? 35  ILE A N    8  
ATOM 11412 C CA   . ILE A 1 35  ? 1.227   13.958  -6.588  1.00 0.00 ? 35  ILE A CA   8  
ATOM 11413 C C    . ILE A 1 35  ? 1.455   13.997  -5.073  1.00 0.00 ? 35  ILE A C    8  
ATOM 11414 O O    . ILE A 1 35  ? 2.444   13.463  -4.571  1.00 0.00 ? 35  ILE A O    8  
ATOM 11415 C CB   . ILE A 1 35  ? 1.014   12.548  -7.181  1.00 0.00 ? 35  ILE A CB   8  
ATOM 11416 C CG1  . ILE A 1 35  ? 0.687   12.666  -8.687  1.00 0.00 ? 35  ILE A CG1  8  
ATOM 11417 C CG2  . ILE A 1 35  ? -0.142  11.816  -6.481  1.00 0.00 ? 35  ILE A CG2  8  
ATOM 11418 C CD1  . ILE A 1 35  ? 0.507   11.326  -9.403  1.00 0.00 ? 35  ILE A CD1  8  
ATOM 11419 H H    . ILE A 1 35  ? 3.170   14.021  -7.448  1.00 0.00 ? 35  ILE A H    8  
ATOM 11420 H HA   . ILE A 1 35  ? 0.328   14.517  -6.822  1.00 0.00 ? 35  ILE A HA   8  
ATOM 11421 H HB   . ILE A 1 35  ? 1.935   11.982  -7.057  1.00 0.00 ? 35  ILE A HB   8  
ATOM 11422 H HG12 . ILE A 1 35  ? -0.219  13.260  -8.821  1.00 0.00 ? 35  ILE A HG12 8  
ATOM 11423 H HG13 . ILE A 1 35  ? 1.502   13.184  -9.178  1.00 0.00 ? 35  ILE A HG13 8  
ATOM 11424 H HG21 . ILE A 1 35  ? -1.081  12.316  -6.714  1.00 0.00 ? 35  ILE A HG21 8  
ATOM 11425 H HG22 . ILE A 1 35  ? -0.209  10.784  -6.823  1.00 0.00 ? 35  ILE A HG22 8  
ATOM 11426 H HG23 . ILE A 1 35  ? 0.015   11.793  -5.404  1.00 0.00 ? 35  ILE A HG23 8  
ATOM 11427 H HD11 . ILE A 1 35  ? -0.391  10.829  -9.046  1.00 0.00 ? 35  ILE A HD11 8  
ATOM 11428 H HD12 . ILE A 1 35  ? 0.394   11.505  -10.471 1.00 0.00 ? 35  ILE A HD12 8  
ATOM 11429 H HD13 . ILE A 1 35  ? 1.379   10.695  -9.229  1.00 0.00 ? 35  ILE A HD13 8  
ATOM 11430 N N    . CYS A 1 36  ? 0.533   14.629  -4.339  1.00 0.00 ? 36  CYS A N    8  
ATOM 11431 C CA   . CYS A 1 36  ? 0.558   14.700  -2.880  1.00 0.00 ? 36  CYS A CA   8  
ATOM 11432 C C    . CYS A 1 36  ? 0.490   13.281  -2.303  1.00 0.00 ? 36  CYS A C    8  
ATOM 11433 O O    . CYS A 1 36  ? -0.488  12.572  -2.568  1.00 0.00 ? 36  CYS A O    8  
ATOM 11434 C CB   . CYS A 1 36  ? -0.668  15.488  -2.388  1.00 0.00 ? 36  CYS A CB   8  
ATOM 11435 S SG   . CYS A 1 36  ? -0.316  17.242  -2.105  1.00 0.00 ? 36  CYS A SG   8  
ATOM 11436 H H    . CYS A 1 36  ? -0.266  15.031  -4.819  1.00 0.00 ? 36  CYS A H    8  
ATOM 11437 H HA   . CYS A 1 36  ? 1.479   15.186  -2.551  1.00 0.00 ? 36  CYS A HA   8  
ATOM 11438 H HB2  . CYS A 1 36  ? -1.493  15.385  -3.095  1.00 0.00 ? 36  CYS A HB2  8  
ATOM 11439 H HB3  . CYS A 1 36  ? -0.990  15.065  -1.444  1.00 0.00 ? 36  CYS A HB3  8  
ATOM 11440 H HG   . CYS A 1 36  ? 0.153   17.524  -3.329  1.00 0.00 ? 36  CYS A HG   8  
ATOM 11441 N N    . GLN A 1 37  ? 1.481   12.893  -1.491  1.00 0.00 ? 37  GLN A N    8  
ATOM 11442 C CA   . GLN A 1 37  ? 1.556   11.561  -0.892  1.00 0.00 ? 37  GLN A CA   8  
ATOM 11443 C C    . GLN A 1 37  ? 0.314   11.266  -0.049  1.00 0.00 ? 37  GLN A C    8  
ATOM 11444 O O    . GLN A 1 37  ? -0.307  10.220  -0.213  1.00 0.00 ? 37  GLN A O    8  
ATOM 11445 C CB   . GLN A 1 37  ? 2.830   11.400  -0.038  1.00 0.00 ? 37  GLN A CB   8  
ATOM 11446 C CG   . GLN A 1 37  ? 4.095   11.242  -0.894  1.00 0.00 ? 37  GLN A CG   8  
ATOM 11447 C CD   . GLN A 1 37  ? 5.367   11.115  -0.057  1.00 0.00 ? 37  GLN A CD   8  
ATOM 11448 O OE1  . GLN A 1 37  ? 5.398   10.493  1.007   1.00 0.00 ? 37  GLN A OE1  8  
ATOM 11449 N NE2  . GLN A 1 37  ? 6.461   11.667  -0.540  1.00 0.00 ? 37  GLN A NE2  8  
ATOM 11450 H H    . GLN A 1 37  ? 2.240   13.535  -1.304  1.00 0.00 ? 37  GLN A H    8  
ATOM 11451 H HA   . GLN A 1 37  ? 1.578   10.840  -1.708  1.00 0.00 ? 37  GLN A HA   8  
ATOM 11452 H HB2  . GLN A 1 37  ? 2.944   12.253  0.630   1.00 0.00 ? 37  GLN A HB2  8  
ATOM 11453 H HB3  . GLN A 1 37  ? 2.723   10.504  0.577   1.00 0.00 ? 37  GLN A HB3  8  
ATOM 11454 H HG2  . GLN A 1 37  ? 4.018   10.332  -1.478  1.00 0.00 ? 37  GLN A HG2  8  
ATOM 11455 H HG3  . GLN A 1 37  ? 4.179   12.079  -1.590  1.00 0.00 ? 37  GLN A HG3  8  
ATOM 11456 H HE21 . GLN A 1 37  ? 6.428   12.251  -1.374  1.00 0.00 ? 37  GLN A HE21 8  
ATOM 11457 H HE22 . GLN A 1 37  ? 7.315   11.643  0.000   1.00 0.00 ? 37  GLN A HE22 8  
ATOM 11458 N N    . ARG A 1 38  ? -0.090  12.218  0.801   1.00 0.00 ? 38  ARG A N    8  
ATOM 11459 C CA   . ARG A 1 38  ? -1.307  12.137  1.616   1.00 0.00 ? 38  ARG A CA   8  
ATOM 11460 C C    . ARG A 1 38  ? -2.499  11.586  0.831   1.00 0.00 ? 38  ARG A C    8  
ATOM 11461 O O    . ARG A 1 38  ? -3.131  10.621  1.236   1.00 0.00 ? 38  ARG A O    8  
ATOM 11462 C CB   . ARG A 1 38  ? -1.651  13.512  2.232   1.00 0.00 ? 38  ARG A CB   8  
ATOM 11463 C CG   . ARG A 1 38  ? -1.457  14.727  1.318   1.00 0.00 ? 38  ARG A CG   8  
ATOM 11464 C CD   . ARG A 1 38  ? -2.176  15.968  1.845   1.00 0.00 ? 38  ARG A CD   8  
ATOM 11465 N NE   . ARG A 1 38  ? -2.190  17.009  0.802   1.00 0.00 ? 38  ARG A NE   8  
ATOM 11466 C CZ   . ARG A 1 38  ? -3.181  17.869  0.542   1.00 0.00 ? 38  ARG A CZ   8  
ATOM 11467 N NH1  . ARG A 1 38  ? -4.307  17.854  1.249   1.00 0.00 ? 38  ARG A NH1  8  
ATOM 11468 N NH2  . ARG A 1 38  ? -3.045  18.716  -0.469  1.00 0.00 ? 38  ARG A NH2  8  
ATOM 11469 H H    . ARG A 1 38  ? 0.518   13.020  0.901   1.00 0.00 ? 38  ARG A H    8  
ATOM 11470 H HA   . ARG A 1 38  ? -1.130  11.425  2.425   1.00 0.00 ? 38  ARG A HA   8  
ATOM 11471 H HB2  . ARG A 1 38  ? -2.705  13.487  2.519   1.00 0.00 ? 38  ARG A HB2  8  
ATOM 11472 H HB3  . ARG A 1 38  ? -1.039  13.659  3.120   1.00 0.00 ? 38  ARG A HB3  8  
ATOM 11473 H HG2  . ARG A 1 38  ? -0.394  14.941  1.200   1.00 0.00 ? 38  ARG A HG2  8  
ATOM 11474 H HG3  . ARG A 1 38  ? -1.874  14.498  0.346   1.00 0.00 ? 38  ARG A HG3  8  
ATOM 11475 H HD2  . ARG A 1 38  ? -3.199  15.693  2.111   1.00 0.00 ? 38  ARG A HD2  8  
ATOM 11476 H HD3  . ARG A 1 38  ? -1.669  16.334  2.740   1.00 0.00 ? 38  ARG A HD3  8  
ATOM 11477 H HE   . ARG A 1 38  ? -1.399  16.995  0.168   1.00 0.00 ? 38  ARG A HE   8  
ATOM 11478 H HH11 . ARG A 1 38  ? -4.426  17.283  2.079   1.00 0.00 ? 38  ARG A HH11 8  
ATOM 11479 H HH12 . ARG A 1 38  ? -5.125  18.407  1.002   1.00 0.00 ? 38  ARG A HH12 8  
ATOM 11480 H HH21 . ARG A 1 38  ? -2.182  18.807  -0.992  1.00 0.00 ? 38  ARG A HH21 8  
ATOM 11481 H HH22 . ARG A 1 38  ? -3.808  19.335  -0.751  1.00 0.00 ? 38  ARG A HH22 8  
ATOM 11482 N N    . ILE A 1 39  ? -2.815  12.227  -0.287  1.00 0.00 ? 39  ILE A N    8  
ATOM 11483 C CA   . ILE A 1 39  ? -4.026  11.968  -1.040  1.00 0.00 ? 39  ILE A CA   8  
ATOM 11484 C C    . ILE A 1 39  ? -3.856  10.690  -1.852  1.00 0.00 ? 39  ILE A C    8  
ATOM 11485 O O    . ILE A 1 39  ? -4.830  9.973   -2.033  1.00 0.00 ? 39  ILE A O    8  
ATOM 11486 C CB   . ILE A 1 39  ? -4.327  13.203  -1.906  1.00 0.00 ? 39  ILE A CB   8  
ATOM 11487 C CG1  . ILE A 1 39  ? -4.768  14.375  -1.006  1.00 0.00 ? 39  ILE A CG1  8  
ATOM 11488 C CG2  . ILE A 1 39  ? -5.381  12.891  -2.988  1.00 0.00 ? 39  ILE A CG2  8  
ATOM 11489 C CD1  . ILE A 1 39  ? -4.599  15.698  -1.752  1.00 0.00 ? 39  ILE A CD1  8  
ATOM 11490 H H    . ILE A 1 39  ? -2.188  12.935  -0.623  1.00 0.00 ? 39  ILE A H    8  
ATOM 11491 H HA   . ILE A 1 39  ? -4.856  11.811  -0.345  1.00 0.00 ? 39  ILE A HA   8  
ATOM 11492 H HB   . ILE A 1 39  ? -3.395  13.519  -2.381  1.00 0.00 ? 39  ILE A HB   8  
ATOM 11493 H HG12 . ILE A 1 39  ? -5.795  14.243  -0.666  1.00 0.00 ? 39  ILE A HG12 8  
ATOM 11494 H HG13 . ILE A 1 39  ? -4.141  14.427  -0.119  1.00 0.00 ? 39  ILE A HG13 8  
ATOM 11495 H HG21 . ILE A 1 39  ? -5.627  13.774  -3.563  1.00 0.00 ? 39  ILE A HG21 8  
ATOM 11496 H HG22 . ILE A 1 39  ? -5.016  12.142  -3.691  1.00 0.00 ? 39  ILE A HG22 8  
ATOM 11497 H HG23 . ILE A 1 39  ? -6.290  12.500  -2.532  1.00 0.00 ? 39  ILE A HG23 8  
ATOM 11498 H HD11 . ILE A 1 39  ? -3.547  15.815  -2.016  1.00 0.00 ? 39  ILE A HD11 8  
ATOM 11499 H HD12 . ILE A 1 39  ? -5.197  15.713  -2.658  1.00 0.00 ? 39  ILE A HD12 8  
ATOM 11500 H HD13 . ILE A 1 39  ? -4.921  16.519  -1.117  1.00 0.00 ? 39  ILE A HD13 8  
ATOM 11501 N N    . PHE A 1 40  ? -2.648  10.400  -2.345  1.00 0.00 ? 40  PHE A N    8  
ATOM 11502 C CA   . PHE A 1 40  ? -2.393  9.088   -2.946  1.00 0.00 ? 40  PHE A CA   8  
ATOM 11503 C C    . PHE A 1 40  ? -2.786  7.992   -1.961  1.00 0.00 ? 40  PHE A C    8  
ATOM 11504 O O    . PHE A 1 40  ? -3.528  7.084   -2.311  1.00 0.00 ? 40  PHE A O    8  
ATOM 11505 C CB   . PHE A 1 40  ? -0.927  8.908   -3.352  1.00 0.00 ? 40  PHE A CB   8  
ATOM 11506 C CG   . PHE A 1 40  ? -0.555  7.462   -3.655  1.00 0.00 ? 40  PHE A CG   8  
ATOM 11507 C CD1  . PHE A 1 40  ? -0.903  6.858   -4.879  1.00 0.00 ? 40  PHE A CD1  8  
ATOM 11508 C CD2  . PHE A 1 40  ? 0.082   6.688   -2.665  1.00 0.00 ? 40  PHE A CD2  8  
ATOM 11509 C CE1  . PHE A 1 40  ? -0.615  5.495   -5.098  1.00 0.00 ? 40  PHE A CE1  8  
ATOM 11510 C CE2  . PHE A 1 40  ? 0.426   5.351   -2.912  1.00 0.00 ? 40  PHE A CE2  8  
ATOM 11511 C CZ   . PHE A 1 40  ? 0.056   4.738   -4.117  1.00 0.00 ? 40  PHE A CZ   8  
ATOM 11512 H H    . PHE A 1 40  ? -1.903  11.061  -2.147  1.00 0.00 ? 40  PHE A H    8  
ATOM 11513 H HA   . PHE A 1 40  ? -3.023  8.982   -3.832  1.00 0.00 ? 40  PHE A HA   8  
ATOM 11514 H HB2  . PHE A 1 40  ? -0.728  9.534   -4.209  1.00 0.00 ? 40  PHE A HB2  8  
ATOM 11515 H HB3  . PHE A 1 40  ? -0.285  9.263   -2.550  1.00 0.00 ? 40  PHE A HB3  8  
ATOM 11516 H HD1  . PHE A 1 40  ? -1.408  7.429   -5.648  1.00 0.00 ? 40  PHE A HD1  8  
ATOM 11517 H HD2  . PHE A 1 40  ? 0.285   7.104   -1.690  1.00 0.00 ? 40  PHE A HD2  8  
ATOM 11518 H HE1  . PHE A 1 40  ? -0.882  5.033   -6.036  1.00 0.00 ? 40  PHE A HE1  8  
ATOM 11519 H HE2  . PHE A 1 40  ? 0.959   4.791   -2.163  1.00 0.00 ? 40  PHE A HE2  8  
ATOM 11520 H HZ   . PHE A 1 40  ? 0.313   3.698   -4.280  1.00 0.00 ? 40  PHE A HZ   8  
ATOM 11521 N N    . GLY A 1 41  ? -2.279  8.077   -0.736  1.00 0.00 ? 41  GLY A N    8  
ATOM 11522 C CA   . GLY A 1 41  ? -2.566  7.104   0.300   1.00 0.00 ? 41  GLY A CA   8  
ATOM 11523 C C    . GLY A 1 41  ? -4.062  6.947   0.534   1.00 0.00 ? 41  GLY A C    8  
ATOM 11524 O O    . GLY A 1 41  ? -4.578  5.835   0.442   1.00 0.00 ? 41  GLY A O    8  
ATOM 11525 H H    . GLY A 1 41  ? -1.631  8.837   -0.559  1.00 0.00 ? 41  GLY A H    8  
ATOM 11526 H HA2  . GLY A 1 41  ? -2.158  6.144   -0.007  1.00 0.00 ? 41  GLY A HA2  8  
ATOM 11527 H HA3  . GLY A 1 41  ? -2.098  7.422   1.224   1.00 0.00 ? 41  GLY A HA3  8  
ATOM 11528 N N    . GLU A 1 42  ? -4.753  8.057   0.778   1.00 0.00 ? 42  GLU A N    8  
ATOM 11529 C CA   . GLU A 1 42  ? -6.192  8.113   0.973   1.00 0.00 ? 42  GLU A CA   8  
ATOM 11530 C C    . GLU A 1 42  ? -6.930  7.440   -0.192  1.00 0.00 ? 42  GLU A C    8  
ATOM 11531 O O    . GLU A 1 42  ? -7.652  6.462   0.004   1.00 0.00 ? 42  GLU A O    8  
ATOM 11532 C CB   . GLU A 1 42  ? -6.586  9.588   1.120   1.00 0.00 ? 42  GLU A CB   8  
ATOM 11533 C CG   . GLU A 1 42  ? -6.106  10.255  2.421   1.00 0.00 ? 42  GLU A CG   8  
ATOM 11534 C CD   . GLU A 1 42  ? -7.259  10.566  3.373   1.00 0.00 ? 42  GLU A CD   8  
ATOM 11535 O OE1  . GLU A 1 42  ? -8.040  11.510  3.079   1.00 0.00 ? 42  GLU A OE1  8  
ATOM 11536 O OE2  . GLU A 1 42  ? -7.362  9.948   4.452   1.00 0.00 ? 42  GLU A OE2  8  
ATOM 11537 H H    . GLU A 1 42  ? -4.248  8.929   0.901   1.00 0.00 ? 42  GLU A H    8  
ATOM 11538 H HA   . GLU A 1 42  ? -6.457  7.585   1.886   1.00 0.00 ? 42  GLU A HA   8  
ATOM 11539 H HB2  . GLU A 1 42  ? -6.185  10.147  0.276   1.00 0.00 ? 42  GLU A HB2  8  
ATOM 11540 H HB3  . GLU A 1 42  ? -7.662  9.661   1.057   1.00 0.00 ? 42  GLU A HB3  8  
ATOM 11541 H HG2  . GLU A 1 42  ? -5.369  9.630   2.928   1.00 0.00 ? 42  GLU A HG2  8  
ATOM 11542 H HG3  . GLU A 1 42  ? -5.622  11.200  2.165   1.00 0.00 ? 42  GLU A HG3  8  
ATOM 11543 N N    . LYS A 1 43  ? -6.740  7.960   -1.407  1.00 0.00 ? 43  LYS A N    8  
ATOM 11544 C CA   . LYS A 1 43  ? -7.533  7.603   -2.579  1.00 0.00 ? 43  LYS A CA   8  
ATOM 11545 C C    . LYS A 1 43  ? -7.175  6.217   -3.106  1.00 0.00 ? 43  LYS A C    8  
ATOM 11546 O O    . LYS A 1 43  ? -8.071  5.474   -3.502  1.00 0.00 ? 43  LYS A O    8  
ATOM 11547 C CB   . LYS A 1 43  ? -7.319  8.655   -3.688  1.00 0.00 ? 43  LYS A CB   8  
ATOM 11548 C CG   . LYS A 1 43  ? -7.745  10.090  -3.313  1.00 0.00 ? 43  LYS A CG   8  
ATOM 11549 C CD   . LYS A 1 43  ? -9.258  10.306  -3.230  1.00 0.00 ? 43  LYS A CD   8  
ATOM 11550 C CE   . LYS A 1 43  ? -9.886  10.309  -4.627  1.00 0.00 ? 43  LYS A CE   8  
ATOM 11551 N NZ   . LYS A 1 43  ? -11.361 10.349  -4.558  1.00 0.00 ? 43  LYS A NZ   8  
ATOM 11552 H H    . LYS A 1 43  ? -6.062  8.713   -1.499  1.00 0.00 ? 43  LYS A H    8  
ATOM 11553 H HA   . LYS A 1 43  ? -8.584  7.579   -2.286  1.00 0.00 ? 43  LYS A HA   8  
ATOM 11554 H HB2  . LYS A 1 43  ? -6.260  8.674   -3.945  1.00 0.00 ? 43  LYS A HB2  8  
ATOM 11555 H HB3  . LYS A 1 43  ? -7.857  8.341   -4.582  1.00 0.00 ? 43  LYS A HB3  8  
ATOM 11556 H HG2  . LYS A 1 43  ? -7.324  10.349  -2.343  1.00 0.00 ? 43  LYS A HG2  8  
ATOM 11557 H HG3  . LYS A 1 43  ? -7.330  10.780  -4.049  1.00 0.00 ? 43  LYS A HG3  8  
ATOM 11558 H HD2  . LYS A 1 43  ? -9.691  9.507   -2.628  1.00 0.00 ? 43  LYS A HD2  8  
ATOM 11559 H HD3  . LYS A 1 43  ? -9.452  11.267  -2.744  1.00 0.00 ? 43  LYS A HD3  8  
ATOM 11560 H HE2  . LYS A 1 43  ? -9.539  11.183  -5.177  1.00 0.00 ? 43  LYS A HE2  8  
ATOM 11561 H HE3  . LYS A 1 43  ? -9.555  9.418   -5.165  1.00 0.00 ? 43  LYS A HE3  8  
ATOM 11562 H HZ1  . LYS A 1 43  ? -11.712 9.550   -4.037  1.00 0.00 ? 43  LYS A HZ1  8  
ATOM 11563 H HZ2  . LYS A 1 43  ? -11.690 11.216  -4.140  1.00 0.00 ? 4