data_1WI5
# 
_entry.id   1WI5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1WI5         
RCSB  RCSB023604   
WWPDB D_1000023604 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002000182.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WI5 
_pdbx_database_status.recvd_initial_deposition_date   2004-05-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Suzuki, S.'                                             1 
'Muto, Y.'                                               2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Terada, T.'                                             5 
'Shirouzu, M.'                                           6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the S1 RNA binding domain from human hypothetical protein BAA11502' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Suzuki, S.'   1 
primary 'Muto, Y.'     2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Terada, T.'   5 
primary 'Shirouzu, M.' 6 
primary 'Yokoyama, S.' 7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'RRP5 protein homolog' 
_entity.formula_weight             12398.979 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'S1 domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Programmed cell death protein 11' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGKNVNRVLSAEALKPGMLLTGTVSSLEDHGYLVDIGVDGTRAFLPLLKAQEYIRQKNKGAKLKVGQYLNCIVEK
VKGNGGVVSLSVGHSEVSTAIATEQQSWNLNNLSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGKNVNRVLSAEALKPGMLLTGTVSSLEDHGYLVDIGVDGTRAFLPLLKAQEYIRQKNKGAKLKVGQYLNCIVEK
VKGNGGVVSLSVGHSEVSTAIATEQQSWNLNNLSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002000182.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   LYS n 
1 9   ASN n 
1 10  VAL n 
1 11  ASN n 
1 12  ARG n 
1 13  VAL n 
1 14  LEU n 
1 15  SER n 
1 16  ALA n 
1 17  GLU n 
1 18  ALA n 
1 19  LEU n 
1 20  LYS n 
1 21  PRO n 
1 22  GLY n 
1 23  MET n 
1 24  LEU n 
1 25  LEU n 
1 26  THR n 
1 27  GLY n 
1 28  THR n 
1 29  VAL n 
1 30  SER n 
1 31  SER n 
1 32  LEU n 
1 33  GLU n 
1 34  ASP n 
1 35  HIS n 
1 36  GLY n 
1 37  TYR n 
1 38  LEU n 
1 39  VAL n 
1 40  ASP n 
1 41  ILE n 
1 42  GLY n 
1 43  VAL n 
1 44  ASP n 
1 45  GLY n 
1 46  THR n 
1 47  ARG n 
1 48  ALA n 
1 49  PHE n 
1 50  LEU n 
1 51  PRO n 
1 52  LEU n 
1 53  LEU n 
1 54  LYS n 
1 55  ALA n 
1 56  GLN n 
1 57  GLU n 
1 58  TYR n 
1 59  ILE n 
1 60  ARG n 
1 61  GLN n 
1 62  LYS n 
1 63  ASN n 
1 64  LYS n 
1 65  GLY n 
1 66  ALA n 
1 67  LYS n 
1 68  LEU n 
1 69  LYS n 
1 70  VAL n 
1 71  GLY n 
1 72  GLN n 
1 73  TYR n 
1 74  LEU n 
1 75  ASN n 
1 76  CYS n 
1 77  ILE n 
1 78  VAL n 
1 79  GLU n 
1 80  LYS n 
1 81  VAL n 
1 82  LYS n 
1 83  GLY n 
1 84  ASN n 
1 85  GLY n 
1 86  GLY n 
1 87  VAL n 
1 88  VAL n 
1 89  SER n 
1 90  LEU n 
1 91  SER n 
1 92  VAL n 
1 93  GLY n 
1 94  HIS n 
1 95  SER n 
1 96  GLU n 
1 97  VAL n 
1 98  SER n 
1 99  THR n 
1 100 ALA n 
1 101 ILE n 
1 102 ALA n 
1 103 THR n 
1 104 GLU n 
1 105 GLN n 
1 106 GLN n 
1 107 SER n 
1 108 TRP n 
1 109 ASN n 
1 110 LEU n 
1 111 ASN n 
1 112 ASN n 
1 113 LEU n 
1 114 SER n 
1 115 GLY n 
1 116 PRO n 
1 117 SER n 
1 118 SER n 
1 119 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'RIKEN cDNA ha02717' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P030512-28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RRP5_HUMAN 
_struct_ref.pdbx_db_accession          Q14690 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KNVNRVLSAEALKPGMLLTGTVSSLEDHGYLVDIGVDGTRAFLPLLKAQEYIRQKNKGAKLKVGQYLNCIVEKVKGNGGV
VSLSVGHSEVSTAIATEQQSWNLNNL
;
_struct_ref.pdbx_align_begin           173 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WI5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 113 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14690 
_struct_ref_seq.db_align_beg                  173 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  278 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       186 
_struct_ref_seq.pdbx_auth_seq_align_end       291 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WI5 GLY A 1   ? UNP Q14690 ? ? 'CLONING ARTIFACT' 179 1  
1 1WI5 SER A 2   ? UNP Q14690 ? ? 'CLONING ARTIFACT' 180 2  
1 1WI5 SER A 3   ? UNP Q14690 ? ? 'CLONING ARTIFACT' 181 3  
1 1WI5 GLY A 4   ? UNP Q14690 ? ? 'CLONING ARTIFACT' 182 4  
1 1WI5 SER A 5   ? UNP Q14690 ? ? 'CLONING ARTIFACT' 183 5  
1 1WI5 SER A 6   ? UNP Q14690 ? ? 'CLONING ARTIFACT' 184 6  
1 1WI5 GLY A 7   ? UNP Q14690 ? ? 'CLONING ARTIFACT' 185 7  
1 1WI5 SER A 114 ? UNP Q14690 ? ? 'CLONING ARTIFACT' 292 8  
1 1WI5 GLY A 115 ? UNP Q14690 ? ? 'CLONING ARTIFACT' 293 9  
1 1WI5 PRO A 116 ? UNP Q14690 ? ? 'CLONING ARTIFACT' 294 10 
1 1WI5 SER A 117 ? UNP Q14690 ? ? 'CLONING ARTIFACT' 295 11 
1 1WI5 SER A 118 ? UNP Q14690 ? ? 'CLONING ARTIFACT' 296 12 
1 1WI5 GLY A 119 ? UNP Q14690 ? ? 'CLONING ARTIFACT' 297 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      100mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.2mM 13C/15N-PROTEIN 20mM phosphate buffer Na; 100mM NaCl; 1mM d-DTT; 0.02% NaN3' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.field_strength    700 
# 
_pdbx_nmr_refine.entry_id           1WI5 
_pdbx_nmr_refine.method             'torsion angle dynamics, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1WI5 
_pdbx_nmr_details.text       'The structure was determined using triple-resonance NMR spectroscopy.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1WI5 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1WI5 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 3.5    collection           Bruker          1 
NMRPipe 2.3    processing           'Delaglio, F.'  2 
NMRView 5.0.4  'data analysis'      'Johnson, B.A.' 3 
Kujira  0.901  'data analysis'      'Kobayashi, N.' 4 
Olivia  1.9.12 'data analysis'      'Yokochi, M.'   5 
CYANA   2.0.17 'structure solution' 'Guentert, P.'  6 
CYANA   2.0.17 refinement           'Guentert, P.'  7 
# 
_exptl.entry_id          1WI5 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1WI5 
_struct.title                     'Solution structure of the S1 RNA binding domain from human hypothetical protein BAA11502' 
_struct.pdbx_descriptor           'RRP5 protein homolog' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WI5 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
'S1 domain, OB-fold, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       LEU 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        52 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        61 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        LEU 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         230 
_struct_conf.end_auth_comp_id        GLN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         239 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 24 ? GLU A 33 ? LEU A 202 GLU A 211 
A 2 GLY A 36 ? ASP A 40 ? GLY A 214 ASP A 218 
A 3 ARG A 47 ? PRO A 51 ? ARG A 225 PRO A 229 
A 4 GLN A 72 ? LYS A 82 ? GLN A 250 LYS A 260 
A 5 VAL A 87 ? SER A 91 ? VAL A 265 SER A 269 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 28 ? N THR A 206 O ASP A 40 ? O ASP A 218 
A 2 3 N TYR A 37 ? N TYR A 215 O LEU A 50 ? O LEU A 228 
A 3 4 O SER A 89 ? O SER A 267 N GLU A 79 ? N GLU A 257 
A 4 5 N ARG A 47 ? N ARG A 225 O VAL A 88 ? O VAL A 266 
# 
_database_PDB_matrix.entry_id          1WI5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WI5 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -17.573 38.937  -24.029 1.00 0.00 ? 179 GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -16.375 39.689  -23.700 1.00 0.00 ? 179 GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -15.186 38.791  -23.420 1.00 0.00 ? 179 GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -14.207 38.796  -24.166 1.00 0.00 ? 179 GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -17.598 37.969  -23.879 1.00 0.00 ? 179 GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -16.134 40.341  -24.527 1.00 0.00 ? 179 GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -16.571 40.290  -22.825 1.00 0.00 ? 179 GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -15.270 38.019  -22.341 1.00 0.00 ? 180 SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -14.190 37.116  -21.962 1.00 0.00 ? 180 SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -14.705 35.688  -21.809 1.00 0.00 ? 180 SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -15.813 35.464  -21.322 1.00 0.00 ? 180 SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -13.545 37.580  -20.654 1.00 0.00 ? 180 SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -12.969 38.866  -20.798 1.00 0.00 ? 180 SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -16.077 38.060  -21.786 1.00 0.00 ? 180 SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -13.449 37.138  -22.746 1.00 0.00 ? 180 SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -14.296 37.621  -19.880 1.00 0.00 ? 180 SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -12.772 36.881  -20.370 1.00 0.00 ? 180 SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -12.688 38.992  -21.708 1.00 0.00 ? 180 SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -13.891 34.725  -22.230 1.00 0.00 ? 181 SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -14.264 33.318  -22.145 1.00 0.00 ? 181 SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -14.294 32.851  -20.693 1.00 0.00 ? 181 SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -13.871 33.570  -19.789 1.00 0.00 ? 181 SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -13.285 32.459  -22.949 1.00 0.00 ? 181 SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -13.620 32.458  -24.326 1.00 0.00 ? 181 SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -13.020 34.967  -22.610 1.00 0.00 ? 181 SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -15.253 33.211  -22.566 1.00 0.00 ? 181 SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -12.287 32.853  -22.834 1.00 0.00 ? 181 SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -13.317 31.444  -22.582 1.00 0.00 ? 181 SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -12.907 32.859  -24.829 1.00 0.00 ? 181 SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -14.797 31.639  -20.478 1.00 0.00 ? 182 GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -14.873 31.095  -19.134 1.00 0.00 ? 182 GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -14.565 29.611  -19.091 1.00 0.00 ? 182 GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -15.021 28.851  -19.945 1.00 0.00 ? 182 GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -15.119 31.110  -21.237 1.00 0.00 ? 182 GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -14.168 31.617  -18.506 1.00 0.00 ? 182 GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -15.870 31.255  -18.750 1.00 0.00 ? 182 GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -13.788 29.199  -18.094 1.00 0.00 ? 183 SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -13.415 27.797  -17.946 1.00 0.00 ? 183 SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -14.176 27.151  -16.792 1.00 0.00 ? 183 SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -14.160 27.650  -15.667 1.00 0.00 ? 183 SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -11.908 27.671  -17.712 1.00 0.00 ? 183 SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -11.565 28.041  -16.388 1.00 0.00 ? 183 SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -13.456 29.854  -17.445 1.00 0.00 ? 183 SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -13.673 27.287  -18.862 1.00 0.00 ? 183 SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -11.606 26.648  -17.877 1.00 0.00 ? 183 SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -11.385 28.317  -18.402 1.00 0.00 ? 183 SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -10.799 27.537  -16.103 1.00 0.00 ? 183 SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -14.843 26.038  -17.081 1.00 0.00 ? 184 SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -15.614 25.325  -16.069 1.00 0.00 ? 184 SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -14.709 24.831  -14.945 1.00 0.00 ? 184 SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -13.651 24.254  -15.192 1.00 0.00 ? 184 SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -16.353 24.143  -16.700 1.00 0.00 ? 184 SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -15.461 23.084  -16.998 1.00 0.00 ? 184 SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -14.817 25.690  -17.997 1.00 0.00 ? 184 SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -16.337 26.013  -15.658 1.00 0.00 ? 184 SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -17.104 23.784  -16.014 1.00 0.00 ? 184 SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -16.827 24.467  -17.616 1.00 0.00 ? 184 SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -15.939 22.251  -16.992 1.00 0.00 ? 184 SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -15.134 25.064  -13.706 1.00 0.00 ? 185 GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -14.352 24.637  -12.561 1.00 0.00 ? 185 GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -14.334 23.130  -12.400 1.00 0.00 ? 185 GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -13.671 22.424  -13.160 1.00 0.00 ? 185 GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -15.986 25.529  -13.569 1.00 0.00 ? 185 GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -13.337 24.987  -12.681 1.00 0.00 ? 185 GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -14.771 25.078  -11.669 1.00 0.00 ? 185 GLY A HA3  1  
ATOM 66    N N    . LYS A 1 8   ? -15.064 22.634  -11.406 1.00 0.00 ? 186 LYS A N    1  
ATOM 67    C CA   . LYS A 1 8   ? -15.131 21.201  -11.146 1.00 0.00 ? 186 LYS A CA   1  
ATOM 68    C C    . LYS A 1 8   ? -16.143 20.528  -12.066 1.00 0.00 ? 186 LYS A C    1  
ATOM 69    O O    . LYS A 1 8   ? -16.875 21.196  -12.794 1.00 0.00 ? 186 LYS A O    1  
ATOM 70    C CB   . LYS A 1 8   ? -15.504 20.944  -9.684  1.00 0.00 ? 186 LYS A CB   1  
ATOM 71    C CG   . LYS A 1 8   ? -14.440 21.391  -8.697  1.00 0.00 ? 186 LYS A CG   1  
ATOM 72    C CD   . LYS A 1 8   ? -14.957 21.361  -7.268  1.00 0.00 ? 186 LYS A CD   1  
ATOM 73    C CE   . LYS A 1 8   ? -13.849 21.657  -6.269  1.00 0.00 ? 186 LYS A CE   1  
ATOM 74    N NZ   . LYS A 1 8   ? -14.389 22.164  -4.976  1.00 0.00 ? 186 LYS A NZ   1  
ATOM 75    H H    . LYS A 1 8   ? -15.571 23.248  -10.834 1.00 0.00 ? 186 LYS A H    1  
ATOM 76    H HA   . LYS A 1 8   ? -14.154 20.783  -11.338 1.00 0.00 ? 186 LYS A HA   1  
ATOM 77    H HB2  . LYS A 1 8   ? -16.418 21.474  -9.460  1.00 0.00 ? 186 LYS A HB2  1  
ATOM 78    H HB3  . LYS A 1 8   ? -15.669 19.885  -9.548  1.00 0.00 ? 186 LYS A HB3  1  
ATOM 79    H HG2  . LYS A 1 8   ? -13.589 20.731  -8.774  1.00 0.00 ? 186 LYS A HG2  1  
ATOM 80    H HG3  . LYS A 1 8   ? -14.138 22.400  -8.940  1.00 0.00 ? 186 LYS A HG3  1  
ATOM 81    H HD2  . LYS A 1 8   ? -15.732 22.105  -7.159  1.00 0.00 ? 186 LYS A HD2  1  
ATOM 82    H HD3  . LYS A 1 8   ? -15.363 20.381  -7.062  1.00 0.00 ? 186 LYS A HD3  1  
ATOM 83    H HE2  . LYS A 1 8   ? -13.295 20.750  -6.086  1.00 0.00 ? 186 LYS A HE2  1  
ATOM 84    H HE3  . LYS A 1 8   ? -13.191 22.402  -6.691  1.00 0.00 ? 186 LYS A HE3  1  
ATOM 85    H HZ1  . LYS A 1 8   ? -14.640 23.170  -5.064  1.00 0.00 ? 186 LYS A HZ1  1  
ATOM 86    H HZ2  . LYS A 1 8   ? -13.676 22.060  -4.226  1.00 0.00 ? 186 LYS A HZ2  1  
ATOM 87    H HZ3  . LYS A 1 8   ? -15.239 21.627  -4.709  1.00 0.00 ? 186 LYS A HZ3  1  
ATOM 88    N N    . ASN A 1 9   ? -16.180 19.199  -12.027 1.00 0.00 ? 187 ASN A N    1  
ATOM 89    C CA   . ASN A 1 9   ? -17.104 18.436  -12.857 1.00 0.00 ? 187 ASN A CA   1  
ATOM 90    C C    . ASN A 1 9   ? -18.481 18.354  -12.205 1.00 0.00 ? 187 ASN A C    1  
ATOM 91    O O    . ASN A 1 9   ? -18.608 18.446  -10.984 1.00 0.00 ? 187 ASN A O    1  
ATOM 92    C CB   . ASN A 1 9   ? -16.559 17.027  -13.100 1.00 0.00 ? 187 ASN A CB   1  
ATOM 93    C CG   . ASN A 1 9   ? -15.456 17.006  -14.141 1.00 0.00 ? 187 ASN A CG   1  
ATOM 94    O OD1  . ASN A 1 9   ? -15.545 16.294  -15.142 1.00 0.00 ? 187 ASN A OD1  1  
ATOM 95    N ND2  . ASN A 1 9   ? -14.408 17.788  -13.908 1.00 0.00 ? 187 ASN A ND2  1  
ATOM 96    H H    . ASN A 1 9   ? -15.571 18.722  -11.426 1.00 0.00 ? 187 ASN A H    1  
ATOM 97    H HA   . ASN A 1 9   ? -17.197 18.945  -13.805 1.00 0.00 ? 187 ASN A HA   1  
ATOM 98    H HB2  . ASN A 1 9   ? -16.161 16.637  -12.175 1.00 0.00 ? 187 ASN A HB2  1  
ATOM 99    H HB3  . ASN A 1 9   ? -17.362 16.390  -13.440 1.00 0.00 ? 187 ASN A HB3  1  
ATOM 100   H HD21 . ASN A 1 9   ? -14.405 18.327  -13.090 1.00 0.00 ? 187 ASN A HD21 1  
ATOM 101   H HD22 . ASN A 1 9   ? -13.681 17.794  -14.565 1.00 0.00 ? 187 ASN A HD22 1  
ATOM 102   N N    . VAL A 1 10  ? -19.510 18.181  -13.029 1.00 0.00 ? 188 VAL A N    1  
ATOM 103   C CA   . VAL A 1 10  ? -20.878 18.086  -12.533 1.00 0.00 ? 188 VAL A CA   1  
ATOM 104   C C    . VAL A 1 10  ? -21.048 16.880  -11.616 1.00 0.00 ? 188 VAL A C    1  
ATOM 105   O O    . VAL A 1 10  ? -21.449 17.017  -10.461 1.00 0.00 ? 188 VAL A O    1  
ATOM 106   C CB   . VAL A 1 10  ? -21.889 17.982  -13.691 1.00 0.00 ? 188 VAL A CB   1  
ATOM 107   C CG1  . VAL A 1 10  ? -23.302 17.820  -13.153 1.00 0.00 ? 188 VAL A CG1  1  
ATOM 108   C CG2  . VAL A 1 10  ? -21.791 19.202  -14.594 1.00 0.00 ? 188 VAL A CG2  1  
ATOM 109   H H    . VAL A 1 10  ? -19.346 18.116  -13.992 1.00 0.00 ? 188 VAL A H    1  
ATOM 110   H HA   . VAL A 1 10  ? -21.094 18.985  -11.973 1.00 0.00 ? 188 VAL A HA   1  
ATOM 111   H HB   . VAL A 1 10  ? -21.647 17.107  -14.275 1.00 0.00 ? 188 VAL A HB   1  
ATOM 112   H HG11 . VAL A 1 10  ? -23.732 16.908  -13.542 1.00 0.00 ? 188 VAL A HG11 1  
ATOM 113   H HG12 . VAL A 1 10  ? -23.274 17.774  -12.074 1.00 0.00 ? 188 VAL A HG12 1  
ATOM 114   H HG13 . VAL A 1 10  ? -23.904 18.661  -13.463 1.00 0.00 ? 188 VAL A HG13 1  
ATOM 115   H HG21 . VAL A 1 10  ? -21.855 18.892  -15.626 1.00 0.00 ? 188 VAL A HG21 1  
ATOM 116   H HG22 . VAL A 1 10  ? -22.601 19.882  -14.371 1.00 0.00 ? 188 VAL A HG22 1  
ATOM 117   H HG23 . VAL A 1 10  ? -20.847 19.700  -14.426 1.00 0.00 ? 188 VAL A HG23 1  
ATOM 118   N N    . ASN A 1 11  ? -20.737 15.698  -12.138 1.00 0.00 ? 189 ASN A N    1  
ATOM 119   C CA   . ASN A 1 11  ? -20.855 14.466  -11.366 1.00 0.00 ? 189 ASN A CA   1  
ATOM 120   C C    . ASN A 1 11  ? -19.498 13.784  -11.219 1.00 0.00 ? 189 ASN A C    1  
ATOM 121   O O    . ASN A 1 11  ? -18.924 13.306  -12.197 1.00 0.00 ? 189 ASN A O    1  
ATOM 122   C CB   . ASN A 1 11  ? -21.848 13.513  -12.035 1.00 0.00 ? 189 ASN A CB   1  
ATOM 123   C CG   . ASN A 1 11  ? -22.437 12.514  -11.059 1.00 0.00 ? 189 ASN A CG   1  
ATOM 124   O OD1  . ASN A 1 11  ? -23.420 12.802  -10.375 1.00 0.00 ? 189 ASN A OD1  1  
ATOM 125   N ND2  . ASN A 1 11  ? -21.837 11.331  -10.989 1.00 0.00 ? 189 ASN A ND2  1  
ATOM 126   H H    . ASN A 1 11  ? -20.422 15.652  -13.065 1.00 0.00 ? 189 ASN A H    1  
ATOM 127   H HA   . ASN A 1 11  ? -21.223 14.724  -10.385 1.00 0.00 ? 189 ASN A HA   1  
ATOM 128   H HB2  . ASN A 1 11  ? -22.656 14.088  -12.463 1.00 0.00 ? 189 ASN A HB2  1  
ATOM 129   H HB3  . ASN A 1 11  ? -21.343 12.969  -12.819 1.00 0.00 ? 189 ASN A HB3  1  
ATOM 130   H HD21 . ASN A 1 11  ? -21.059 11.171  -11.563 1.00 0.00 ? 189 ASN A HD21 1  
ATOM 131   H HD22 . ASN A 1 11  ? -22.198 10.665  -10.367 1.00 0.00 ? 189 ASN A HD22 1  
ATOM 132   N N    . ARG A 1 12  ? -18.992 13.743  -9.991  1.00 0.00 ? 190 ARG A N    1  
ATOM 133   C CA   . ARG A 1 12  ? -17.703 13.121  -9.716  1.00 0.00 ? 190 ARG A CA   1  
ATOM 134   C C    . ARG A 1 12  ? -17.652 11.704  -10.280 1.00 0.00 ? 190 ARG A C    1  
ATOM 135   O O    . ARG A 1 12  ? -18.666 11.007  -10.328 1.00 0.00 ? 190 ARG A O    1  
ATOM 136   C CB   . ARG A 1 12  ? -17.438 13.091  -8.210  1.00 0.00 ? 190 ARG A CB   1  
ATOM 137   C CG   . ARG A 1 12  ? -16.729 14.332  -7.692  1.00 0.00 ? 190 ARG A CG   1  
ATOM 138   C CD   . ARG A 1 12  ? -15.940 14.035  -6.426  1.00 0.00 ? 190 ARG A CD   1  
ATOM 139   N NE   . ARG A 1 12  ? -16.747 14.216  -5.223  1.00 0.00 ? 190 ARG A NE   1  
ATOM 140   C CZ   . ARG A 1 12  ? -17.224 15.391  -4.827  1.00 0.00 ? 190 ARG A CZ   1  
ATOM 141   N NH1  . ARG A 1 12  ? -16.976 16.483  -5.536  1.00 0.00 ? 190 ARG A NH1  1  
ATOM 142   N NH2  . ARG A 1 12  ? -17.950 15.474  -3.720  1.00 0.00 ? 190 ARG A NH2  1  
ATOM 143   H H    . ARG A 1 12  ? -19.498 14.142  -9.252  1.00 0.00 ? 190 ARG A H    1  
ATOM 144   H HA   . ARG A 1 12  ? -16.939 13.714  -10.196 1.00 0.00 ? 190 ARG A HA   1  
ATOM 145   H HB2  . ARG A 1 12  ? -18.381 12.999  -7.692  1.00 0.00 ? 190 ARG A HB2  1  
ATOM 146   H HB3  . ARG A 1 12  ? -16.826 12.232  -7.981  1.00 0.00 ? 190 ARG A HB3  1  
ATOM 147   H HG2  . ARG A 1 12  ? -16.050 14.691  -8.451  1.00 0.00 ? 190 ARG A HG2  1  
ATOM 148   H HG3  . ARG A 1 12  ? -17.466 15.092  -7.477  1.00 0.00 ? 190 ARG A HG3  1  
ATOM 149   H HD2  . ARG A 1 12  ? -15.593 13.014  -6.466  1.00 0.00 ? 190 ARG A HD2  1  
ATOM 150   H HD3  . ARG A 1 12  ? -15.091 14.702  -6.383  1.00 0.00 ? 190 ARG A HD3  1  
ATOM 151   H HE   . ARG A 1 12  ? -16.942 13.421  -4.684  1.00 0.00 ? 190 ARG A HE   1  
ATOM 152   H HH11 . ARG A 1 12  ? -16.430 16.423  -6.371  1.00 0.00 ? 190 ARG A HH11 1  
ATOM 153   H HH12 . ARG A 1 12  ? -17.337 17.367  -5.236  1.00 0.00 ? 190 ARG A HH12 1  
ATOM 154   H HH21 . ARG A 1 12  ? -18.139 14.652  -3.183  1.00 0.00 ? 190 ARG A HH21 1  
ATOM 155   H HH22 . ARG A 1 12  ? -18.308 16.358  -3.422  1.00 0.00 ? 190 ARG A HH22 1  
ATOM 156   N N    . VAL A 1 13  ? -16.465 11.285  -10.707 1.00 0.00 ? 191 VAL A N    1  
ATOM 157   C CA   . VAL A 1 13  ? -16.282 9.951   -11.268 1.00 0.00 ? 191 VAL A CA   1  
ATOM 158   C C    . VAL A 1 13  ? -15.672 9.003   -10.242 1.00 0.00 ? 191 VAL A C    1  
ATOM 159   O O    . VAL A 1 13  ? -16.094 7.853   -10.115 1.00 0.00 ? 191 VAL A O    1  
ATOM 160   C CB   . VAL A 1 13  ? -15.381 9.987   -12.517 1.00 0.00 ? 191 VAL A CB   1  
ATOM 161   C CG1  . VAL A 1 13  ? -15.062 8.575   -12.985 1.00 0.00 ? 191 VAL A CG1  1  
ATOM 162   C CG2  . VAL A 1 13  ? -16.043 10.789  -13.627 1.00 0.00 ? 191 VAL A CG2  1  
ATOM 163   H H    . VAL A 1 13  ? -15.694 11.886  -10.643 1.00 0.00 ? 191 VAL A H    1  
ATOM 164   H HA   . VAL A 1 13  ? -17.252 9.575   -11.559 1.00 0.00 ? 191 VAL A HA   1  
ATOM 165   H HB   . VAL A 1 13  ? -14.454 10.473  -12.254 1.00 0.00 ? 191 VAL A HB   1  
ATOM 166   H HG11 . VAL A 1 13  ? -15.978 8.011   -13.080 1.00 0.00 ? 191 VAL A HG11 1  
ATOM 167   H HG12 . VAL A 1 13  ? -14.563 8.617   -13.942 1.00 0.00 ? 191 VAL A HG12 1  
ATOM 168   H HG13 . VAL A 1 13  ? -14.417 8.094   -12.264 1.00 0.00 ? 191 VAL A HG13 1  
ATOM 169   H HG21 . VAL A 1 13  ? -15.742 11.823  -13.552 1.00 0.00 ? 191 VAL A HG21 1  
ATOM 170   H HG22 . VAL A 1 13  ? -15.739 10.395  -14.587 1.00 0.00 ? 191 VAL A HG22 1  
ATOM 171   H HG23 . VAL A 1 13  ? -17.116 10.717  -13.533 1.00 0.00 ? 191 VAL A HG23 1  
ATOM 172   N N    . LEU A 1 14  ? -14.677 9.492   -9.510  1.00 0.00 ? 192 LEU A N    1  
ATOM 173   C CA   . LEU A 1 14  ? -14.008 8.689   -8.493  1.00 0.00 ? 192 LEU A CA   1  
ATOM 174   C C    . LEU A 1 14  ? -13.946 7.223   -8.911  1.00 0.00 ? 192 LEU A C    1  
ATOM 175   O O    . LEU A 1 14  ? -14.242 6.329   -8.119  1.00 0.00 ? 192 LEU A O    1  
ATOM 176   C CB   . LEU A 1 14  ? -14.734 8.819   -7.153  1.00 0.00 ? 192 LEU A CB   1  
ATOM 177   C CG   . LEU A 1 14  ? -16.238 8.544   -7.175  1.00 0.00 ? 192 LEU A CG   1  
ATOM 178   C CD1  . LEU A 1 14  ? -16.509 7.051   -7.072  1.00 0.00 ? 192 LEU A CD1  1  
ATOM 179   C CD2  . LEU A 1 14  ? -16.933 9.293   -6.048  1.00 0.00 ? 192 LEU A CD2  1  
ATOM 180   H H    . LEU A 1 14  ? -14.384 10.416  -9.657  1.00 0.00 ? 192 LEU A H    1  
ATOM 181   H HA   . LEU A 1 14  ? -13.000 9.063   -8.385  1.00 0.00 ? 192 LEU A HA   1  
ATOM 182   H HB2  . LEU A 1 14  ? -14.281 8.124   -6.463  1.00 0.00 ? 192 LEU A HB2  1  
ATOM 183   H HB3  . LEU A 1 14  ? -14.586 9.828   -6.795  1.00 0.00 ? 192 LEU A HB3  1  
ATOM 184   H HG   . LEU A 1 14  ? -16.647 8.893   -8.113  1.00 0.00 ? 192 LEU A HG   1  
ATOM 185   H HD11 . LEU A 1 14  ? -17.452 6.890   -6.572  1.00 0.00 ? 192 LEU A HD11 1  
ATOM 186   H HD12 . LEU A 1 14  ? -15.718 6.580   -6.507  1.00 0.00 ? 192 LEU A HD12 1  
ATOM 187   H HD13 . LEU A 1 14  ? -16.547 6.623   -8.063  1.00 0.00 ? 192 LEU A HD13 1  
ATOM 188   H HD21 . LEU A 1 14  ? -16.433 10.236  -5.881  1.00 0.00 ? 192 LEU A HD21 1  
ATOM 189   H HD22 . LEU A 1 14  ? -16.896 8.701   -5.145  1.00 0.00 ? 192 LEU A HD22 1  
ATOM 190   H HD23 . LEU A 1 14  ? -17.963 9.475   -6.318  1.00 0.00 ? 192 LEU A HD23 1  
ATOM 191   N N    . SER A 1 15  ? -13.558 6.985   -10.159 1.00 0.00 ? 193 SER A N    1  
ATOM 192   C CA   . SER A 1 15  ? -13.459 5.627   -10.683 1.00 0.00 ? 193 SER A CA   1  
ATOM 193   C C    . SER A 1 15  ? -12.038 5.091   -10.537 1.00 0.00 ? 193 SER A C    1  
ATOM 194   O O    . SER A 1 15  ? -11.067 5.841   -10.637 1.00 0.00 ? 193 SER A O    1  
ATOM 195   C CB   . SER A 1 15  ? -13.880 5.593   -12.153 1.00 0.00 ? 193 SER A CB   1  
ATOM 196   O OG   . SER A 1 15  ? -15.278 5.782   -12.287 1.00 0.00 ? 193 SER A OG   1  
ATOM 197   H H    . SER A 1 15  ? -13.335 7.740   -10.743 1.00 0.00 ? 193 SER A H    1  
ATOM 198   H HA   . SER A 1 15  ? -14.127 5.001   -10.111 1.00 0.00 ? 193 SER A HA   1  
ATOM 199   H HB2  . SER A 1 15  ? -13.370 6.378   -12.690 1.00 0.00 ? 193 SER A HB2  1  
ATOM 200   H HB3  . SER A 1 15  ? -13.616 4.635   -12.578 1.00 0.00 ? 193 SER A HB3  1  
ATOM 201   H HG   . SER A 1 15  ? -15.598 5.285   -13.043 1.00 0.00 ? 193 SER A HG   1  
ATOM 202   N N    . ALA A 1 16  ? -11.925 3.788   -10.300 1.00 0.00 ? 194 ALA A N    1  
ATOM 203   C CA   . ALA A 1 16  ? -10.624 3.151   -10.142 1.00 0.00 ? 194 ALA A CA   1  
ATOM 204   C C    . ALA A 1 16  ? -9.660  3.591   -11.239 1.00 0.00 ? 194 ALA A C    1  
ATOM 205   O O    . ALA A 1 16  ? -8.447  3.625   -11.034 1.00 0.00 ? 194 ALA A O    1  
ATOM 206   C CB   . ALA A 1 16  ? -10.774 1.636   -10.146 1.00 0.00 ? 194 ALA A CB   1  
ATOM 207   H H    . ALA A 1 16  ? -12.736 3.243   -10.231 1.00 0.00 ? 194 ALA A H    1  
ATOM 208   H HA   . ALA A 1 16  ? -10.221 3.445   -9.184  1.00 0.00 ? 194 ALA A HA   1  
ATOM 209   H HB1  . ALA A 1 16  ? -10.182 1.215   -9.347  1.00 0.00 ? 194 ALA A HB1  1  
ATOM 210   H HB2  . ALA A 1 16  ? -11.812 1.378   -10.002 1.00 0.00 ? 194 ALA A HB2  1  
ATOM 211   H HB3  . ALA A 1 16  ? -10.433 1.244   -11.092 1.00 0.00 ? 194 ALA A HB3  1  
ATOM 212   N N    . GLU A 1 17  ? -10.208 3.926   -12.403 1.00 0.00 ? 195 GLU A N    1  
ATOM 213   C CA   . GLU A 1 17  ? -9.395  4.363   -13.532 1.00 0.00 ? 195 GLU A CA   1  
ATOM 214   C C    . GLU A 1 17  ? -9.174  5.872   -13.492 1.00 0.00 ? 195 GLU A C    1  
ATOM 215   O O    . GLU A 1 17  ? -8.162  6.375   -13.979 1.00 0.00 ? 195 GLU A O    1  
ATOM 216   C CB   . GLU A 1 17  ? -10.061 3.969   -14.852 1.00 0.00 ? 195 GLU A CB   1  
ATOM 217   C CG   . GLU A 1 17  ? -9.741  4.911   -16.000 1.00 0.00 ? 195 GLU A CG   1  
ATOM 218   C CD   . GLU A 1 17  ? -9.776  4.219   -17.349 1.00 0.00 ? 195 GLU A CD   1  
ATOM 219   O OE1  . GLU A 1 17  ? -10.832 3.650   -17.697 1.00 0.00 ? 195 GLU A OE1  1  
ATOM 220   O OE2  . GLU A 1 17  ? -8.747  4.247   -18.056 1.00 0.00 ? 195 GLU A OE2  1  
ATOM 221   H H    . GLU A 1 17  ? -11.181 3.878   -12.505 1.00 0.00 ? 195 GLU A H    1  
ATOM 222   H HA   . GLU A 1 17  ? -8.437  3.869   -13.461 1.00 0.00 ? 195 GLU A HA   1  
ATOM 223   H HB2  . GLU A 1 17  ? -9.733  2.977   -15.124 1.00 0.00 ? 195 GLU A HB2  1  
ATOM 224   H HB3  . GLU A 1 17  ? -11.132 3.958   -14.711 1.00 0.00 ? 195 GLU A HB3  1  
ATOM 225   H HG2  . GLU A 1 17  ? -10.465 5.712   -16.005 1.00 0.00 ? 195 GLU A HG2  1  
ATOM 226   H HG3  . GLU A 1 17  ? -8.754  5.321   -15.848 1.00 0.00 ? 195 GLU A HG3  1  
ATOM 227   N N    . ALA A 1 18  ? -10.129 6.589   -12.907 1.00 0.00 ? 196 ALA A N    1  
ATOM 228   C CA   . ALA A 1 18  ? -10.039 8.040   -12.802 1.00 0.00 ? 196 ALA A CA   1  
ATOM 229   C C    . ALA A 1 18  ? -8.921  8.453   -11.850 1.00 0.00 ? 196 ALA A C    1  
ATOM 230   O O    . ALA A 1 18  ? -8.457  9.593   -11.879 1.00 0.00 ? 196 ALA A O    1  
ATOM 231   C CB   . ALA A 1 18  ? -11.368 8.619   -12.341 1.00 0.00 ? 196 ALA A CB   1  
ATOM 232   H H    . ALA A 1 18  ? -10.911 6.130   -12.537 1.00 0.00 ? 196 ALA A H    1  
ATOM 233   H HA   . ALA A 1 18  ? -9.824  8.433   -13.785 1.00 0.00 ? 196 ALA A HA   1  
ATOM 234   H HB1  . ALA A 1 18  ? -11.342 9.695   -12.431 1.00 0.00 ? 196 ALA A HB1  1  
ATOM 235   H HB2  . ALA A 1 18  ? -12.164 8.225   -12.954 1.00 0.00 ? 196 ALA A HB2  1  
ATOM 236   H HB3  . ALA A 1 18  ? -11.540 8.348   -11.310 1.00 0.00 ? 196 ALA A HB3  1  
ATOM 237   N N    . LEU A 1 19  ? -8.493  7.519   -11.007 1.00 0.00 ? 197 LEU A N    1  
ATOM 238   C CA   . LEU A 1 19  ? -7.429  7.787   -10.046 1.00 0.00 ? 197 LEU A CA   1  
ATOM 239   C C    . LEU A 1 19  ? -6.244  8.470   -10.720 1.00 0.00 ? 197 LEU A C    1  
ATOM 240   O O    . LEU A 1 19  ? -6.031  8.322   -11.924 1.00 0.00 ? 197 LEU A O    1  
ATOM 241   C CB   . LEU A 1 19  ? -6.973  6.485   -9.385  1.00 0.00 ? 197 LEU A CB   1  
ATOM 242   C CG   . LEU A 1 19  ? -7.969  5.835   -8.423  1.00 0.00 ? 197 LEU A CG   1  
ATOM 243   C CD1  . LEU A 1 19  ? -7.282  4.770   -7.583  1.00 0.00 ? 197 LEU A CD1  1  
ATOM 244   C CD2  . LEU A 1 19  ? -8.612  6.887   -7.532  1.00 0.00 ? 197 LEU A CD2  1  
ATOM 245   H H    . LEU A 1 19  ? -8.901  6.629   -11.032 1.00 0.00 ? 197 LEU A H    1  
ATOM 246   H HA   . LEU A 1 19  ? -7.826  8.446   -9.288  1.00 0.00 ? 197 LEU A HA   1  
ATOM 247   H HB2  . LEU A 1 19  ? -6.759  5.774   -10.168 1.00 0.00 ? 197 LEU A HB2  1  
ATOM 248   H HB3  . LEU A 1 19  ? -6.067  6.694   -8.833  1.00 0.00 ? 197 LEU A HB3  1  
ATOM 249   H HG   . LEU A 1 19  ? -8.752  5.356   -8.995  1.00 0.00 ? 197 LEU A HG   1  
ATOM 250   H HD11 . LEU A 1 19  ? -7.850  4.601   -6.681  1.00 0.00 ? 197 LEU A HD11 1  
ATOM 251   H HD12 . LEU A 1 19  ? -6.287  5.100   -7.326  1.00 0.00 ? 197 LEU A HD12 1  
ATOM 252   H HD13 . LEU A 1 19  ? -7.221  3.851   -8.148  1.00 0.00 ? 197 LEU A HD13 1  
ATOM 253   H HD21 . LEU A 1 19  ? -8.970  6.421   -6.625  1.00 0.00 ? 197 LEU A HD21 1  
ATOM 254   H HD22 . LEU A 1 19  ? -9.442  7.343   -8.053  1.00 0.00 ? 197 LEU A HD22 1  
ATOM 255   H HD23 . LEU A 1 19  ? -7.883  7.644   -7.284  1.00 0.00 ? 197 LEU A HD23 1  
ATOM 256   N N    . LYS A 1 20  ? -5.474  9.217   -9.937  1.00 0.00 ? 198 LYS A N    1  
ATOM 257   C CA   . LYS A 1 20  ? -4.308  9.921   -10.457 1.00 0.00 ? 198 LYS A CA   1  
ATOM 258   C C    . LYS A 1 20  ? -3.102  9.726   -9.542  1.00 0.00 ? 198 LYS A C    1  
ATOM 259   O O    . LYS A 1 20  ? -3.229  9.625   -8.322  1.00 0.00 ? 198 LYS A O    1  
ATOM 260   C CB   . LYS A 1 20  ? -4.612  11.414  -10.606 1.00 0.00 ? 198 LYS A CB   1  
ATOM 261   C CG   . LYS A 1 20  ? -5.798  11.705  -11.509 1.00 0.00 ? 198 LYS A CG   1  
ATOM 262   C CD   . LYS A 1 20  ? -5.992  13.199  -11.709 1.00 0.00 ? 198 LYS A CD   1  
ATOM 263   C CE   . LYS A 1 20  ? -6.912  13.788  -10.650 1.00 0.00 ? 198 LYS A CE   1  
ATOM 264   N NZ   . LYS A 1 20  ? -6.951  15.276  -10.715 1.00 0.00 ? 198 LYS A NZ   1  
ATOM 265   H H    . LYS A 1 20  ? -5.695  9.297   -8.985  1.00 0.00 ? 198 LYS A H    1  
ATOM 266   H HA   . LYS A 1 20  ? -4.078  9.511   -11.428 1.00 0.00 ? 198 LYS A HA   1  
ATOM 267   H HB2  . LYS A 1 20  ? -4.819  11.826  -9.630  1.00 0.00 ? 198 LYS A HB2  1  
ATOM 268   H HB3  . LYS A 1 20  ? -3.743  11.906  -11.018 1.00 0.00 ? 198 LYS A HB3  1  
ATOM 269   H HG2  . LYS A 1 20  ? -5.630  11.243  -12.470 1.00 0.00 ? 198 LYS A HG2  1  
ATOM 270   H HG3  . LYS A 1 20  ? -6.690  11.292  -11.060 1.00 0.00 ? 198 LYS A HG3  1  
ATOM 271   H HD2  . LYS A 1 20  ? -5.032  13.690  -11.649 1.00 0.00 ? 198 LYS A HD2  1  
ATOM 272   H HD3  . LYS A 1 20  ? -6.426  13.369  -12.684 1.00 0.00 ? 198 LYS A HD3  1  
ATOM 273   H HE2  . LYS A 1 20  ? -7.908  13.403  -10.802 1.00 0.00 ? 198 LYS A HE2  1  
ATOM 274   H HE3  . LYS A 1 20  ? -6.555  13.488  -9.676  1.00 0.00 ? 198 LYS A HE3  1  
ATOM 275   H HZ1  . LYS A 1 20  ? -7.901  15.596  -10.992 1.00 0.00 ? 198 LYS A HZ1  1  
ATOM 276   H HZ2  . LYS A 1 20  ? -6.264  15.621  -11.415 1.00 0.00 ? 198 LYS A HZ2  1  
ATOM 277   H HZ3  . LYS A 1 20  ? -6.717  15.681  -9.787  1.00 0.00 ? 198 LYS A HZ3  1  
ATOM 278   N N    . PRO A 1 21  ? -1.905  9.674   -10.143 1.00 0.00 ? 199 PRO A N    1  
ATOM 279   C CA   . PRO A 1 21  ? -0.654  9.493   -9.401  1.00 0.00 ? 199 PRO A CA   1  
ATOM 280   C C    . PRO A 1 21  ? -0.291  10.718  -8.568  1.00 0.00 ? 199 PRO A C    1  
ATOM 281   O O    . PRO A 1 21  ? -0.022  11.790  -9.108  1.00 0.00 ? 199 PRO A O    1  
ATOM 282   C CB   . PRO A 1 21  ? 0.384   9.271   -10.504 1.00 0.00 ? 199 PRO A CB   1  
ATOM 283   C CG   . PRO A 1 21  ? -0.188  9.943   -11.704 1.00 0.00 ? 199 PRO A CG   1  
ATOM 284   C CD   . PRO A 1 21  ? -1.679  9.788   -11.594 1.00 0.00 ? 199 PRO A CD   1  
ATOM 285   H HA   . PRO A 1 21  ? -0.694  8.624   -8.761  1.00 0.00 ? 199 PRO A HA   1  
ATOM 286   H HB2  . PRO A 1 21  ? 1.325   9.715   -10.211 1.00 0.00 ? 199 PRO A HB2  1  
ATOM 287   H HB3  . PRO A 1 21  ? 0.516   8.212   -10.670 1.00 0.00 ? 199 PRO A HB3  1  
ATOM 288   H HG2  . PRO A 1 21  ? 0.082   10.989  -11.702 1.00 0.00 ? 199 PRO A HG2  1  
ATOM 289   H HG3  . PRO A 1 21  ? 0.174   9.463   -12.601 1.00 0.00 ? 199 PRO A HG3  1  
ATOM 290   H HD2  . PRO A 1 21  ? -2.180  10.657  -11.995 1.00 0.00 ? 199 PRO A HD2  1  
ATOM 291   H HD3  . PRO A 1 21  ? -2.004  8.894   -12.105 1.00 0.00 ? 199 PRO A HD3  1  
ATOM 292   N N    . GLY A 1 22  ? -0.286  10.551  -7.249  1.00 0.00 ? 200 GLY A N    1  
ATOM 293   C CA   . GLY A 1 22  ? 0.045   11.652  -6.363  1.00 0.00 ? 200 GLY A CA   1  
ATOM 294   C C    . GLY A 1 22  ? -0.836  11.689  -5.130  1.00 0.00 ? 200 GLY A C    1  
ATOM 295   O O    . GLY A 1 22  ? -0.563  12.430  -4.186  1.00 0.00 ? 200 GLY A O    1  
ATOM 296   H H    . GLY A 1 22  ? -0.510  9.673   -6.874  1.00 0.00 ? 200 GLY A H    1  
ATOM 297   H HA2  . GLY A 1 22  ? 1.075   11.554  -6.054  1.00 0.00 ? 200 GLY A HA2  1  
ATOM 298   H HA3  . GLY A 1 22  ? -0.072  12.580  -6.902  1.00 0.00 ? 200 GLY A HA3  1  
ATOM 299   N N    . MET A 1 23  ? -1.897  10.889  -5.139  1.00 0.00 ? 201 MET A N    1  
ATOM 300   C CA   . MET A 1 23  ? -2.822  10.834  -4.012  1.00 0.00 ? 201 MET A CA   1  
ATOM 301   C C    . MET A 1 23  ? -2.201  10.088  -2.835  1.00 0.00 ? 201 MET A C    1  
ATOM 302   O O    . MET A 1 23  ? -1.636  9.006   -3.001  1.00 0.00 ? 201 MET A O    1  
ATOM 303   C CB   . MET A 1 23  ? -4.128  10.156  -4.429  1.00 0.00 ? 201 MET A CB   1  
ATOM 304   C CG   . MET A 1 23  ? -5.065  11.066  -5.206  1.00 0.00 ? 201 MET A CG   1  
ATOM 305   S SD   . MET A 1 23  ? -6.762  10.458  -5.233  1.00 0.00 ? 201 MET A SD   1  
ATOM 306   C CE   . MET A 1 23  ? -7.328  11.102  -6.805  1.00 0.00 ? 201 MET A CE   1  
ATOM 307   H H    . MET A 1 23  ? -2.063  10.321  -5.920  1.00 0.00 ? 201 MET A H    1  
ATOM 308   H HA   . MET A 1 23  ? -3.034  11.848  -3.709  1.00 0.00 ? 201 MET A HA   1  
ATOM 309   H HB2  . MET A 1 23  ? -3.895  9.302   -5.048  1.00 0.00 ? 201 MET A HB2  1  
ATOM 310   H HB3  . MET A 1 23  ? -4.644  9.818   -3.543  1.00 0.00 ? 201 MET A HB3  1  
ATOM 311   H HG2  . MET A 1 23  ? -5.056  12.045  -4.750  1.00 0.00 ? 201 MET A HG2  1  
ATOM 312   H HG3  . MET A 1 23  ? -4.708  11.143  -6.223  1.00 0.00 ? 201 MET A HG3  1  
ATOM 313   H HE1  . MET A 1 23  ? -8.122  10.476  -7.186  1.00 0.00 ? 201 MET A HE1  1  
ATOM 314   H HE2  . MET A 1 23  ? -7.696  12.108  -6.671  1.00 0.00 ? 201 MET A HE2  1  
ATOM 315   H HE3  . MET A 1 23  ? -6.507  11.109  -7.508  1.00 0.00 ? 201 MET A HE3  1  
ATOM 316   N N    . LEU A 1 24  ? -2.309  10.672  -1.647  1.00 0.00 ? 202 LEU A N    1  
ATOM 317   C CA   . LEU A 1 24  ? -1.758  10.062  -0.442  1.00 0.00 ? 202 LEU A CA   1  
ATOM 318   C C    . LEU A 1 24  ? -2.809  9.218   0.271   1.00 0.00 ? 202 LEU A C    1  
ATOM 319   O O    . LEU A 1 24  ? -3.798  9.742   0.785   1.00 0.00 ? 202 LEU A O    1  
ATOM 320   C CB   . LEU A 1 24  ? -1.228  11.142  0.503   1.00 0.00 ? 202 LEU A CB   1  
ATOM 321   C CG   . LEU A 1 24  ? -0.147  12.061  -0.067  1.00 0.00 ? 202 LEU A CG   1  
ATOM 322   C CD1  . LEU A 1 24  ? -0.776  13.260  -0.759  1.00 0.00 ? 202 LEU A CD1  1  
ATOM 323   C CD2  . LEU A 1 24  ? 0.801   12.515  1.033   1.00 0.00 ? 202 LEU A CD2  1  
ATOM 324   H H    . LEU A 1 24  ? -2.770  11.533  -1.577  1.00 0.00 ? 202 LEU A H    1  
ATOM 325   H HA   . LEU A 1 24  ? -0.940  9.422   -0.739  1.00 0.00 ? 202 LEU A HA   1  
ATOM 326   H HB2  . LEU A 1 24  ? -2.062  11.758  0.802   1.00 0.00 ? 202 LEU A HB2  1  
ATOM 327   H HB3  . LEU A 1 24  ? -0.818  10.647  1.373   1.00 0.00 ? 202 LEU A HB3  1  
ATOM 328   H HG   . LEU A 1 24  ? 0.429   11.516  -0.802  1.00 0.00 ? 202 LEU A HG   1  
ATOM 329   H HD11 . LEU A 1 24  ? -0.430  14.169  -0.291  1.00 0.00 ? 202 LEU A HD11 1  
ATOM 330   H HD12 . LEU A 1 24  ? -1.851  13.200  -0.676  1.00 0.00 ? 202 LEU A HD12 1  
ATOM 331   H HD13 . LEU A 1 24  ? -0.495  13.262  -1.802  1.00 0.00 ? 202 LEU A HD13 1  
ATOM 332   H HD21 . LEU A 1 24  ? 1.799   12.612  0.630   1.00 0.00 ? 202 LEU A HD21 1  
ATOM 333   H HD22 . LEU A 1 24  ? 0.805   11.785  1.830   1.00 0.00 ? 202 LEU A HD22 1  
ATOM 334   H HD23 . LEU A 1 24  ? 0.474   13.469  1.419   1.00 0.00 ? 202 LEU A HD23 1  
ATOM 335   N N    . LEU A 1 25  ? -2.588  7.908   0.300   1.00 0.00 ? 203 LEU A N    1  
ATOM 336   C CA   . LEU A 1 25  ? -3.516  6.990   0.952   1.00 0.00 ? 203 LEU A CA   1  
ATOM 337   C C    . LEU A 1 25  ? -2.774  6.041   1.888   1.00 0.00 ? 203 LEU A C    1  
ATOM 338   O O    . LEU A 1 25  ? -1.743  5.474   1.527   1.00 0.00 ? 203 LEU A O    1  
ATOM 339   C CB   . LEU A 1 25  ? -4.292  6.189   -0.095  1.00 0.00 ? 203 LEU A CB   1  
ATOM 340   C CG   . LEU A 1 25  ? -5.006  7.007   -1.171  1.00 0.00 ? 203 LEU A CG   1  
ATOM 341   C CD1  . LEU A 1 25  ? -4.001  7.601   -2.145  1.00 0.00 ? 203 LEU A CD1  1  
ATOM 342   C CD2  . LEU A 1 25  ? -6.021  6.146   -1.909  1.00 0.00 ? 203 LEU A CD2  1  
ATOM 343   H H    . LEU A 1 25  ? -1.783  7.549   -0.127  1.00 0.00 ? 203 LEU A H    1  
ATOM 344   H HA   . LEU A 1 25  ? -4.211  7.578   1.532   1.00 0.00 ? 203 LEU A HA   1  
ATOM 345   H HB2  . LEU A 1 25  ? -3.596  5.529   -0.588  1.00 0.00 ? 203 LEU A HB2  1  
ATOM 346   H HB3  . LEU A 1 25  ? -5.037  5.602   0.425   1.00 0.00 ? 203 LEU A HB3  1  
ATOM 347   H HG   . LEU A 1 25  ? -5.537  7.823   -0.702  1.00 0.00 ? 203 LEU A HG   1  
ATOM 348   H HD11 . LEU A 1 25  ? -3.066  7.066   -2.068  1.00 0.00 ? 203 LEU A HD11 1  
ATOM 349   H HD12 . LEU A 1 25  ? -3.841  8.642   -1.907  1.00 0.00 ? 203 LEU A HD12 1  
ATOM 350   H HD13 . LEU A 1 25  ? -4.382  7.517   -3.153  1.00 0.00 ? 203 LEU A HD13 1  
ATOM 351   H HD21 . LEU A 1 25  ? -5.647  5.914   -2.896  1.00 0.00 ? 203 LEU A HD21 1  
ATOM 352   H HD22 . LEU A 1 25  ? -6.954  6.684   -1.995  1.00 0.00 ? 203 LEU A HD22 1  
ATOM 353   H HD23 . LEU A 1 25  ? -6.183  5.230   -1.361  1.00 0.00 ? 203 LEU A HD23 1  
ATOM 354   N N    . THR A 1 26  ? -3.308  5.871   3.094   1.00 0.00 ? 204 THR A N    1  
ATOM 355   C CA   . THR A 1 26  ? -2.699  4.990   4.082   1.00 0.00 ? 204 THR A CA   1  
ATOM 356   C C    . THR A 1 26  ? -3.110  3.539   3.854   1.00 0.00 ? 204 THR A C    1  
ATOM 357   O O    . THR A 1 26  ? -4.289  3.199   3.929   1.00 0.00 ? 204 THR A O    1  
ATOM 358   C CB   . THR A 1 26  ? -3.084  5.401   5.515   1.00 0.00 ? 204 THR A CB   1  
ATOM 359   O OG1  . THR A 1 26  ? -2.989  6.822   5.660   1.00 0.00 ? 204 THR A OG1  1  
ATOM 360   C CG2  . THR A 1 26  ? -2.182  4.721   6.535   1.00 0.00 ? 204 THR A CG2  1  
ATOM 361   H H    . THR A 1 26  ? -4.132  6.350   3.323   1.00 0.00 ? 204 THR A H    1  
ATOM 362   H HA   . THR A 1 26  ? -1.626  5.069   3.983   1.00 0.00 ? 204 THR A HA   1  
ATOM 363   H HB   . THR A 1 26  ? -4.104  5.096   5.699   1.00 0.00 ? 204 THR A HB   1  
ATOM 364   H HG1  . THR A 1 26  ? -3.117  7.240   4.804   1.00 0.00 ? 204 THR A HG1  1  
ATOM 365   H HG21 . THR A 1 26  ? -2.775  4.388   7.374   1.00 0.00 ? 204 THR A HG21 1  
ATOM 366   H HG22 . THR A 1 26  ? -1.434  5.421   6.876   1.00 0.00 ? 204 THR A HG22 1  
ATOM 367   H HG23 . THR A 1 26  ? -1.699  3.872   6.077   1.00 0.00 ? 204 THR A HG23 1  
ATOM 368   N N    . GLY A 1 27  ? -2.127  2.687   3.575   1.00 0.00 ? 205 GLY A N    1  
ATOM 369   C CA   . GLY A 1 27  ? -2.408  1.283   3.341   1.00 0.00 ? 205 GLY A CA   1  
ATOM 370   C C    . GLY A 1 27  ? -1.802  0.386   4.402   1.00 0.00 ? 205 GLY A C    1  
ATOM 371   O O    . GLY A 1 27  ? -0.882  0.788   5.115   1.00 0.00 ? 205 GLY A O    1  
ATOM 372   H H    . GLY A 1 27  ? -1.205  3.015   3.529   1.00 0.00 ? 205 GLY A H    1  
ATOM 373   H HA2  . GLY A 1 27  ? -3.478  1.138   3.330   1.00 0.00 ? 205 GLY A HA2  1  
ATOM 374   H HA3  . GLY A 1 27  ? -2.007  1.004   2.378   1.00 0.00 ? 205 GLY A HA3  1  
ATOM 375   N N    . THR A 1 28  ? -2.319  -0.834  4.509   1.00 0.00 ? 206 THR A N    1  
ATOM 376   C CA   . THR A 1 28  ? -1.825  -1.790  5.492   1.00 0.00 ? 206 THR A CA   1  
ATOM 377   C C    . THR A 1 28  ? -1.350  -3.074  4.821   1.00 0.00 ? 206 THR A C    1  
ATOM 378   O O    . THR A 1 28  ? -2.003  -3.590  3.914   1.00 0.00 ? 206 THR A O    1  
ATOM 379   C CB   . THR A 1 28  ? -2.908  -2.138  6.531   1.00 0.00 ? 206 THR A CB   1  
ATOM 380   O OG1  . THR A 1 28  ? -4.149  -2.412  5.871   1.00 0.00 ? 206 THR A OG1  1  
ATOM 381   C CG2  . THR A 1 28  ? -3.095  -0.998  7.520   1.00 0.00 ? 206 THR A CG2  1  
ATOM 382   H H    . THR A 1 28  ? -3.051  -1.096  3.912   1.00 0.00 ? 206 THR A H    1  
ATOM 383   H HA   . THR A 1 28  ? -0.992  -1.336  6.009   1.00 0.00 ? 206 THR A HA   1  
ATOM 384   H HB   . THR A 1 28  ? -2.595  -3.018  7.074   1.00 0.00 ? 206 THR A HB   1  
ATOM 385   H HG1  . THR A 1 28  ? -4.615  -1.588  5.712   1.00 0.00 ? 206 THR A HG1  1  
ATOM 386   H HG21 . THR A 1 28  ? -3.205  -1.400  8.516   1.00 0.00 ? 206 THR A HG21 1  
ATOM 387   H HG22 . THR A 1 28  ? -3.978  -0.435  7.258   1.00 0.00 ? 206 THR A HG22 1  
ATOM 388   H HG23 . THR A 1 28  ? -2.232  -0.349  7.488   1.00 0.00 ? 206 THR A HG23 1  
ATOM 389   N N    . VAL A 1 29  ? -0.209  -3.585  5.272   1.00 0.00 ? 207 VAL A N    1  
ATOM 390   C CA   . VAL A 1 29  ? 0.353   -4.810  4.716   1.00 0.00 ? 207 VAL A CA   1  
ATOM 391   C C    . VAL A 1 29  ? -0.573  -5.997  4.955   1.00 0.00 ? 207 VAL A C    1  
ATOM 392   O O    . VAL A 1 29  ? -0.883  -6.335  6.097   1.00 0.00 ? 207 VAL A O    1  
ATOM 393   C CB   . VAL A 1 29  ? 1.734   -5.120  5.323   1.00 0.00 ? 207 VAL A CB   1  
ATOM 394   C CG1  . VAL A 1 29  ? 2.298   -6.407  4.739   1.00 0.00 ? 207 VAL A CG1  1  
ATOM 395   C CG2  . VAL A 1 29  ? 2.689   -3.958  5.094   1.00 0.00 ? 207 VAL A CG2  1  
ATOM 396   H H    . VAL A 1 29  ? 0.266   -3.128  5.997   1.00 0.00 ? 207 VAL A H    1  
ATOM 397   H HA   . VAL A 1 29  ? 0.474   -4.669  3.652   1.00 0.00 ? 207 VAL A HA   1  
ATOM 398   H HB   . VAL A 1 29  ? 1.615   -5.256  6.387   1.00 0.00 ? 207 VAL A HB   1  
ATOM 399   H HG11 . VAL A 1 29  ? 2.094   -6.440  3.678   1.00 0.00 ? 207 VAL A HG11 1  
ATOM 400   H HG12 . VAL A 1 29  ? 3.365   -6.440  4.903   1.00 0.00 ? 207 VAL A HG12 1  
ATOM 401   H HG13 . VAL A 1 29  ? 1.832   -7.254  5.220   1.00 0.00 ? 207 VAL A HG13 1  
ATOM 402   H HG21 . VAL A 1 29  ? 3.428   -4.240  4.359   1.00 0.00 ? 207 VAL A HG21 1  
ATOM 403   H HG22 . VAL A 1 29  ? 2.136   -3.101  4.737   1.00 0.00 ? 207 VAL A HG22 1  
ATOM 404   H HG23 . VAL A 1 29  ? 3.181   -3.707  6.022   1.00 0.00 ? 207 VAL A HG23 1  
ATOM 405   N N    . SER A 1 30  ? -1.011  -6.627  3.870   1.00 0.00 ? 208 SER A N    1  
ATOM 406   C CA   . SER A 1 30  ? -1.905  -7.776  3.961   1.00 0.00 ? 208 SER A CA   1  
ATOM 407   C C    . SER A 1 30  ? -1.113  -9.068  4.139   1.00 0.00 ? 208 SER A C    1  
ATOM 408   O O    . SER A 1 30  ? -1.449  -9.904  4.977   1.00 0.00 ? 208 SER A O    1  
ATOM 409   C CB   . SER A 1 30  ? -2.780  -7.868  2.710   1.00 0.00 ? 208 SER A CB   1  
ATOM 410   O OG   . SER A 1 30  ? -3.515  -9.080  2.690   1.00 0.00 ? 208 SER A OG   1  
ATOM 411   H H    . SER A 1 30  ? -0.728  -6.310  2.987   1.00 0.00 ? 208 SER A H    1  
ATOM 412   H HA   . SER A 1 30  ? -2.539  -7.634  4.824   1.00 0.00 ? 208 SER A HA   1  
ATOM 413   H HB2  . SER A 1 30  ? -3.473  -7.041  2.696   1.00 0.00 ? 208 SER A HB2  1  
ATOM 414   H HB3  . SER A 1 30  ? -2.152  -7.827  1.831   1.00 0.00 ? 208 SER A HB3  1  
ATOM 415   H HG   . SER A 1 30  ? -4.433  -8.901  2.904   1.00 0.00 ? 208 SER A HG   1  
ATOM 416   N N    . SER A 1 31  ? -0.060  -9.223  3.343   1.00 0.00 ? 209 SER A N    1  
ATOM 417   C CA   . SER A 1 31  ? 0.779   -10.414 3.408   1.00 0.00 ? 209 SER A CA   1  
ATOM 418   C C    . SER A 1 31  ? 2.171   -10.129 2.853   1.00 0.00 ? 209 SER A C    1  
ATOM 419   O O    . SER A 1 31  ? 2.357   -9.214  2.050   1.00 0.00 ? 209 SER A O    1  
ATOM 420   C CB   . SER A 1 31  ? 0.132   -11.562 2.631   1.00 0.00 ? 209 SER A CB   1  
ATOM 421   O OG   . SER A 1 31  ? -0.932  -12.140 3.367   1.00 0.00 ? 209 SER A OG   1  
ATOM 422   H H    . SER A 1 31  ? 0.156   -8.520  2.694   1.00 0.00 ? 209 SER A H    1  
ATOM 423   H HA   . SER A 1 31  ? 0.869   -10.699 4.446   1.00 0.00 ? 209 SER A HA   1  
ATOM 424   H HB2  . SER A 1 31  ? -0.255  -11.187 1.696   1.00 0.00 ? 209 SER A HB2  1  
ATOM 425   H HB3  . SER A 1 31  ? 0.874   -12.323 2.435   1.00 0.00 ? 209 SER A HB3  1  
ATOM 426   H HG   . SER A 1 31  ? -0.770  -13.080 3.479   1.00 0.00 ? 209 SER A HG   1  
ATOM 427   N N    . LEU A 1 32  ? 3.146   -10.920 3.286   1.00 0.00 ? 210 LEU A N    1  
ATOM 428   C CA   . LEU A 1 32  ? 4.523   -10.755 2.833   1.00 0.00 ? 210 LEU A CA   1  
ATOM 429   C C    . LEU A 1 32  ? 4.800   -11.618 1.606   1.00 0.00 ? 210 LEU A C    1  
ATOM 430   O O    . LEU A 1 32  ? 4.605   -12.833 1.634   1.00 0.00 ? 210 LEU A O    1  
ATOM 431   C CB   . LEU A 1 32  ? 5.497   -11.116 3.955   1.00 0.00 ? 210 LEU A CB   1  
ATOM 432   C CG   . LEU A 1 32  ? 5.512   -10.174 5.160   1.00 0.00 ? 210 LEU A CG   1  
ATOM 433   C CD1  . LEU A 1 32  ? 6.211   -8.870  4.810   1.00 0.00 ? 210 LEU A CD1  1  
ATOM 434   C CD2  . LEU A 1 32  ? 4.094   -9.908  5.646   1.00 0.00 ? 210 LEU A CD2  1  
ATOM 435   H H    . LEU A 1 32  ? 2.937   -11.632 3.925   1.00 0.00 ? 210 LEU A H    1  
ATOM 436   H HA   . LEU A 1 32  ? 4.662   -9.717  2.566   1.00 0.00 ? 210 LEU A HA   1  
ATOM 437   H HB2  . LEU A 1 32  ? 5.242   -12.102 4.310   1.00 0.00 ? 210 LEU A HB2  1  
ATOM 438   H HB3  . LEU A 1 32  ? 6.493   -11.132 3.535   1.00 0.00 ? 210 LEU A HB3  1  
ATOM 439   H HG   . LEU A 1 32  ? 6.061   -10.640 5.967   1.00 0.00 ? 210 LEU A HG   1  
ATOM 440   H HD11 . LEU A 1 32  ? 7.023   -8.700  5.500   1.00 0.00 ? 210 LEU A HD11 1  
ATOM 441   H HD12 . LEU A 1 32  ? 5.506   -8.054  4.877   1.00 0.00 ? 210 LEU A HD12 1  
ATOM 442   H HD13 . LEU A 1 32  ? 6.598   -8.928  3.803   1.00 0.00 ? 210 LEU A HD13 1  
ATOM 443   H HD21 . LEU A 1 32  ? 3.583   -10.847 5.793   1.00 0.00 ? 210 LEU A HD21 1  
ATOM 444   H HD22 . LEU A 1 32  ? 3.565   -9.322  4.908   1.00 0.00 ? 210 LEU A HD22 1  
ATOM 445   H HD23 . LEU A 1 32  ? 4.129   -9.366  6.579   1.00 0.00 ? 210 LEU A HD23 1  
ATOM 446   N N    . GLU A 1 33  ? 5.258   -10.983 0.532   1.00 0.00 ? 211 GLU A N    1  
ATOM 447   C CA   . GLU A 1 33  ? 5.563   -11.694 -0.704  1.00 0.00 ? 211 GLU A CA   1  
ATOM 448   C C    . GLU A 1 33  ? 7.071   -11.778 -0.925  1.00 0.00 ? 211 GLU A C    1  
ATOM 449   O O    . GLU A 1 33  ? 7.844   -11.063 -0.286  1.00 0.00 ? 211 GLU A O    1  
ATOM 450   C CB   . GLU A 1 33  ? 4.900   -11.000 -1.895  1.00 0.00 ? 211 GLU A CB   1  
ATOM 451   C CG   . GLU A 1 33  ? 3.478   -11.468 -2.157  1.00 0.00 ? 211 GLU A CG   1  
ATOM 452   C CD   . GLU A 1 33  ? 3.422   -12.872 -2.728  1.00 0.00 ? 211 GLU A CD   1  
ATOM 453   O OE1  . GLU A 1 33  ? 4.490   -13.509 -2.844  1.00 0.00 ? 211 GLU A OE1  1  
ATOM 454   O OE2  . GLU A 1 33  ? 2.309   -13.334 -3.057  1.00 0.00 ? 211 GLU A OE2  1  
ATOM 455   H H    . GLU A 1 33  ? 5.393   -10.013 0.572   1.00 0.00 ? 211 GLU A H    1  
ATOM 456   H HA   . GLU A 1 33  ? 5.169   -12.695 -0.616  1.00 0.00 ? 211 GLU A HA   1  
ATOM 457   H HB2  . GLU A 1 33  ? 4.879   -9.936  -1.711  1.00 0.00 ? 211 GLU A HB2  1  
ATOM 458   H HB3  . GLU A 1 33  ? 5.488   -11.191 -2.780  1.00 0.00 ? 211 GLU A HB3  1  
ATOM 459   H HG2  . GLU A 1 33  ? 2.930   -11.452 -1.227  1.00 0.00 ? 211 GLU A HG2  1  
ATOM 460   H HG3  . GLU A 1 33  ? 3.014   -10.791 -2.859  1.00 0.00 ? 211 GLU A HG3  1  
ATOM 461   N N    . ASP A 1 34  ? 7.481   -12.656 -1.833  1.00 0.00 ? 212 ASP A N    1  
ATOM 462   C CA   . ASP A 1 34  ? 8.896   -12.834 -2.140  1.00 0.00 ? 212 ASP A CA   1  
ATOM 463   C C    . ASP A 1 34  ? 9.375   -11.774 -3.127  1.00 0.00 ? 212 ASP A C    1  
ATOM 464   O O    . ASP A 1 34  ? 10.568  -11.476 -3.204  1.00 0.00 ? 212 ASP A O    1  
ATOM 465   C CB   . ASP A 1 34  ? 9.144   -14.231 -2.712  1.00 0.00 ? 212 ASP A CB   1  
ATOM 466   C CG   . ASP A 1 34  ? 9.017   -14.269 -4.222  1.00 0.00 ? 212 ASP A CG   1  
ATOM 467   O OD1  . ASP A 1 34  ? 9.987   -13.887 -4.909  1.00 0.00 ? 212 ASP A OD1  1  
ATOM 468   O OD2  . ASP A 1 34  ? 7.947   -14.680 -4.718  1.00 0.00 ? 212 ASP A OD2  1  
ATOM 469   H H    . ASP A 1 34  ? 6.817   -13.197 -2.310  1.00 0.00 ? 212 ASP A H    1  
ATOM 470   H HA   . ASP A 1 34  ? 9.451   -12.728 -1.220  1.00 0.00 ? 212 ASP A HA   1  
ATOM 471   H HB2  . ASP A 1 34  ? 10.141  -14.550 -2.446  1.00 0.00 ? 212 ASP A HB2  1  
ATOM 472   H HB3  . ASP A 1 34  ? 8.425   -14.918 -2.291  1.00 0.00 ? 212 ASP A HB3  1  
ATOM 473   N N    . HIS A 1 35  ? 8.439   -11.209 -3.882  1.00 0.00 ? 213 HIS A N    1  
ATOM 474   C CA   . HIS A 1 35  ? 8.766   -10.182 -4.865  1.00 0.00 ? 213 HIS A CA   1  
ATOM 475   C C    . HIS A 1 35  ? 8.506   -8.788  -4.302  1.00 0.00 ? 213 HIS A C    1  
ATOM 476   O O    . HIS A 1 35  ? 9.050   -7.799  -4.791  1.00 0.00 ? 213 HIS A O    1  
ATOM 477   C CB   . HIS A 1 35  ? 7.949   -10.389 -6.141  1.00 0.00 ? 213 HIS A CB   1  
ATOM 478   C CG   . HIS A 1 35  ? 6.521   -10.759 -5.885  1.00 0.00 ? 213 HIS A CG   1  
ATOM 479   N ND1  . HIS A 1 35  ? 5.465   -9.912  -6.147  1.00 0.00 ? 213 HIS A ND1  1  
ATOM 480   C CD2  . HIS A 1 35  ? 5.975   -11.894 -5.387  1.00 0.00 ? 213 HIS A CD2  1  
ATOM 481   C CE1  . HIS A 1 35  ? 4.332   -10.508 -5.821  1.00 0.00 ? 213 HIS A CE1  1  
ATOM 482   N NE2  . HIS A 1 35  ? 4.614   -11.713 -5.358  1.00 0.00 ? 213 HIS A NE2  1  
ATOM 483   H H    . HIS A 1 35  ? 7.506   -11.488 -3.775  1.00 0.00 ? 213 HIS A H    1  
ATOM 484   H HA   . HIS A 1 35  ? 9.815   -10.272 -5.102  1.00 0.00 ? 213 HIS A HA   1  
ATOM 485   H HB2  . HIS A 1 35  ? 7.956   -9.476  -6.718  1.00 0.00 ? 213 HIS A HB2  1  
ATOM 486   H HB3  . HIS A 1 35  ? 8.398   -11.181 -6.724  1.00 0.00 ? 213 HIS A HB3  1  
ATOM 487   H HD1  . HIS A 1 35  ? 5.536   -9.007  -6.516  1.00 0.00 ? 213 HIS A HD1  1  
ATOM 488   H HD2  . HIS A 1 35  ? 6.511   -12.778 -5.071  1.00 0.00 ? 213 HIS A HD2  1  
ATOM 489   H HE1  . HIS A 1 35  ? 3.344   -10.085 -5.917  1.00 0.00 ? 213 HIS A HE1  1  
ATOM 490   H HE2  . HIS A 1 35  ? 3.965   -12.333 -4.966  1.00 0.00 ? 213 HIS A HE2  1  
ATOM 491   N N    . GLY A 1 36  ? 7.671   -8.718  -3.270  1.00 0.00 ? 214 GLY A N    1  
ATOM 492   C CA   . GLY A 1 36  ? 7.353   -7.441  -2.658  1.00 0.00 ? 214 GLY A CA   1  
ATOM 493   C C    . GLY A 1 36  ? 6.386   -7.578  -1.499  1.00 0.00 ? 214 GLY A C    1  
ATOM 494   O O    . GLY A 1 36  ? 6.379   -8.595  -0.805  1.00 0.00 ? 214 GLY A O    1  
ATOM 495   H H    . GLY A 1 36  ? 7.266   -9.540  -2.922  1.00 0.00 ? 214 GLY A H    1  
ATOM 496   H HA2  . GLY A 1 36  ? 8.266   -6.989  -2.301  1.00 0.00 ? 214 GLY A HA2  1  
ATOM 497   H HA3  . GLY A 1 36  ? 6.913   -6.797  -3.405  1.00 0.00 ? 214 GLY A HA3  1  
ATOM 498   N N    . TYR A 1 37  ? 5.570   -6.552  -1.288  1.00 0.00 ? 215 TYR A N    1  
ATOM 499   C CA   . TYR A 1 37  ? 4.597   -6.560  -0.202  1.00 0.00 ? 215 TYR A CA   1  
ATOM 500   C C    . TYR A 1 37  ? 3.231   -6.085  -0.689  1.00 0.00 ? 215 TYR A C    1  
ATOM 501   O O    . TYR A 1 37  ? 3.132   -5.128  -1.459  1.00 0.00 ? 215 TYR A O    1  
ATOM 502   C CB   . TYR A 1 37  ? 5.077   -5.673  0.948   1.00 0.00 ? 215 TYR A CB   1  
ATOM 503   C CG   . TYR A 1 37  ? 6.470   -6.009  1.431   1.00 0.00 ? 215 TYR A CG   1  
ATOM 504   C CD1  . TYR A 1 37  ? 7.590   -5.617  0.710   1.00 0.00 ? 215 TYR A CD1  1  
ATOM 505   C CD2  . TYR A 1 37  ? 6.665   -6.718  2.610   1.00 0.00 ? 215 TYR A CD2  1  
ATOM 506   C CE1  . TYR A 1 37  ? 8.864   -5.922  1.147   1.00 0.00 ? 215 TYR A CE1  1  
ATOM 507   C CE2  . TYR A 1 37  ? 7.935   -7.027  3.056   1.00 0.00 ? 215 TYR A CE2  1  
ATOM 508   C CZ   . TYR A 1 37  ? 9.032   -6.627  2.321   1.00 0.00 ? 215 TYR A CZ   1  
ATOM 509   O OH   . TYR A 1 37  ? 10.300  -6.932  2.761   1.00 0.00 ? 215 TYR A OH   1  
ATOM 510   H H    . TYR A 1 37  ? 5.623   -5.769  -1.875  1.00 0.00 ? 215 TYR A H    1  
ATOM 511   H HA   . TYR A 1 37  ? 4.506   -7.576  0.154   1.00 0.00 ? 215 TYR A HA   1  
ATOM 512   H HB2  . TYR A 1 37  ? 5.079   -4.644  0.623   1.00 0.00 ? 215 TYR A HB2  1  
ATOM 513   H HB3  . TYR A 1 37  ? 4.401   -5.781  1.783   1.00 0.00 ? 215 TYR A HB3  1  
ATOM 514   H HD1  . TYR A 1 37  ? 7.456   -5.064  -0.209  1.00 0.00 ? 215 TYR A HD1  1  
ATOM 515   H HD2  . TYR A 1 37  ? 5.804   -7.030  3.184   1.00 0.00 ? 215 TYR A HD2  1  
ATOM 516   H HE1  . TYR A 1 37  ? 9.723   -5.609  0.572   1.00 0.00 ? 215 TYR A HE1  1  
ATOM 517   H HE2  . TYR A 1 37  ? 8.067   -7.579  3.975   1.00 0.00 ? 215 TYR A HE2  1  
ATOM 518   H HH   . TYR A 1 37  ? 10.533  -6.354  3.491   1.00 0.00 ? 215 TYR A HH   1  
ATOM 519   N N    . LEU A 1 38  ? 2.181   -6.760  -0.236  1.00 0.00 ? 216 LEU A N    1  
ATOM 520   C CA   . LEU A 1 38  ? 0.820   -6.408  -0.624  1.00 0.00 ? 216 LEU A CA   1  
ATOM 521   C C    . LEU A 1 38  ? 0.258   -5.319  0.284   1.00 0.00 ? 216 LEU A C    1  
ATOM 522   O O    . LEU A 1 38  ? 0.365   -5.401  1.508   1.00 0.00 ? 216 LEU A O    1  
ATOM 523   C CB   . LEU A 1 38  ? -0.081  -7.644  -0.575  1.00 0.00 ? 216 LEU A CB   1  
ATOM 524   C CG   . LEU A 1 38  ? -0.151  -8.475  -1.857  1.00 0.00 ? 216 LEU A CG   1  
ATOM 525   C CD1  . LEU A 1 38  ? -1.048  -7.799  -2.883  1.00 0.00 ? 216 LEU A CD1  1  
ATOM 526   C CD2  . LEU A 1 38  ? 1.243   -8.694  -2.427  1.00 0.00 ? 216 LEU A CD2  1  
ATOM 527   H H    . LEU A 1 38  ? 2.323   -7.513  0.375   1.00 0.00 ? 216 LEU A H    1  
ATOM 528   H HA   . LEU A 1 38  ? 0.850   -6.035  -1.637  1.00 0.00 ? 216 LEU A HA   1  
ATOM 529   H HB2  . LEU A 1 38  ? 0.279   -8.284  0.215   1.00 0.00 ? 216 LEU A HB2  1  
ATOM 530   H HB3  . LEU A 1 38  ? -1.083  -7.312  -0.339  1.00 0.00 ? 216 LEU A HB3  1  
ATOM 531   H HG   . LEU A 1 38  ? -0.576  -9.442  -1.628  1.00 0.00 ? 216 LEU A HG   1  
ATOM 532   H HD11 . LEU A 1 38  ? -0.717  -6.784  -3.038  1.00 0.00 ? 216 LEU A HD11 1  
ATOM 533   H HD12 . LEU A 1 38  ? -2.066  -7.795  -2.522  1.00 0.00 ? 216 LEU A HD12 1  
ATOM 534   H HD13 . LEU A 1 38  ? -1.000  -8.342  -3.816  1.00 0.00 ? 216 LEU A HD13 1  
ATOM 535   H HD21 . LEU A 1 38  ? 1.195   -9.420  -3.225  1.00 0.00 ? 216 LEU A HD21 1  
ATOM 536   H HD22 . LEU A 1 38  ? 1.897   -9.058  -1.648  1.00 0.00 ? 216 LEU A HD22 1  
ATOM 537   H HD23 . LEU A 1 38  ? 1.625   -7.760  -2.812  1.00 0.00 ? 216 LEU A HD23 1  
ATOM 538   N N    . VAL A 1 39  ? -0.342  -4.300  -0.323  1.00 0.00 ? 217 VAL A N    1  
ATOM 539   C CA   . VAL A 1 39  ? -0.924  -3.196  0.432   1.00 0.00 ? 217 VAL A CA   1  
ATOM 540   C C    . VAL A 1 39  ? -2.444  -3.194  0.317   1.00 0.00 ? 217 VAL A C    1  
ATOM 541   O O    . VAL A 1 39  ? -2.994  -3.258  -0.782  1.00 0.00 ? 217 VAL A O    1  
ATOM 542   C CB   . VAL A 1 39  ? -0.381  -1.839  -0.052  1.00 0.00 ? 217 VAL A CB   1  
ATOM 543   C CG1  . VAL A 1 39  ? -0.867  -0.716  0.852   1.00 0.00 ? 217 VAL A CG1  1  
ATOM 544   C CG2  . VAL A 1 39  ? 1.139   -1.864  -0.115  1.00 0.00 ? 217 VAL A CG2  1  
ATOM 545   H H    . VAL A 1 39  ? -0.396  -4.292  -1.301  1.00 0.00 ? 217 VAL A H    1  
ATOM 546   H HA   . VAL A 1 39  ? -0.650  -3.320  1.469   1.00 0.00 ? 217 VAL A HA   1  
ATOM 547   H HB   . VAL A 1 39  ? -0.758  -1.657  -1.048  1.00 0.00 ? 217 VAL A HB   1  
ATOM 548   H HG11 . VAL A 1 39  ? -0.547  -0.908  1.866   1.00 0.00 ? 217 VAL A HG11 1  
ATOM 549   H HG12 . VAL A 1 39  ? -0.454  0.223   0.514   1.00 0.00 ? 217 VAL A HG12 1  
ATOM 550   H HG13 . VAL A 1 39  ? -1.945  -0.668  0.818   1.00 0.00 ? 217 VAL A HG13 1  
ATOM 551   H HG21 . VAL A 1 39  ? 1.528   -0.909  0.204   1.00 0.00 ? 217 VAL A HG21 1  
ATOM 552   H HG22 . VAL A 1 39  ? 1.513   -2.641  0.537   1.00 0.00 ? 217 VAL A HG22 1  
ATOM 553   H HG23 . VAL A 1 39  ? 1.455   -2.062  -1.128  1.00 0.00 ? 217 VAL A HG23 1  
ATOM 554   N N    . ASP A 1 40  ? -3.117  -3.118  1.460   1.00 0.00 ? 218 ASP A N    1  
ATOM 555   C CA   . ASP A 1 40  ? -4.575  -3.104  1.489   1.00 0.00 ? 218 ASP A CA   1  
ATOM 556   C C    . ASP A 1 40  ? -5.113  -1.714  1.166   1.00 0.00 ? 218 ASP A C    1  
ATOM 557   O O    . ASP A 1 40  ? -4.721  -0.726  1.788   1.00 0.00 ? 218 ASP A O    1  
ATOM 558   C CB   . ASP A 1 40  ? -5.083  -3.555  2.860   1.00 0.00 ? 218 ASP A CB   1  
ATOM 559   C CG   . ASP A 1 40  ? -6.441  -4.224  2.782   1.00 0.00 ? 218 ASP A CG   1  
ATOM 560   O OD1  . ASP A 1 40  ? -7.414  -3.550  2.382   1.00 0.00 ? 218 ASP A OD1  1  
ATOM 561   O OD2  . ASP A 1 40  ? -6.532  -5.423  3.121   1.00 0.00 ? 218 ASP A OD2  1  
ATOM 562   H H    . ASP A 1 40  ? -2.622  -3.068  2.305   1.00 0.00 ? 218 ASP A H    1  
ATOM 563   H HA   . ASP A 1 40  ? -4.928  -3.796  0.739   1.00 0.00 ? 218 ASP A HA   1  
ATOM 564   H HB2  . ASP A 1 40  ? -4.381  -4.257  3.284   1.00 0.00 ? 218 ASP A HB2  1  
ATOM 565   H HB3  . ASP A 1 40  ? -5.162  -2.695  3.508   1.00 0.00 ? 218 ASP A HB3  1  
ATOM 566   N N    . ILE A 1 41  ? -6.010  -1.645  0.188   1.00 0.00 ? 219 ILE A N    1  
ATOM 567   C CA   . ILE A 1 41  ? -6.601  -0.375  -0.217  1.00 0.00 ? 219 ILE A CA   1  
ATOM 568   C C    . ILE A 1 41  ? -8.116  -0.393  -0.042  1.00 0.00 ? 219 ILE A C    1  
ATOM 569   O O    . ILE A 1 41  ? -8.755  0.655   0.030   1.00 0.00 ? 219 ILE A O    1  
ATOM 570   C CB   . ILE A 1 41  ? -6.269  -0.043  -1.684  1.00 0.00 ? 219 ILE A CB   1  
ATOM 571   C CG1  . ILE A 1 41  ? -6.596  -1.235  -2.586  1.00 0.00 ? 219 ILE A CG1  1  
ATOM 572   C CG2  . ILE A 1 41  ? -4.804  0.345   -1.820  1.00 0.00 ? 219 ILE A CG2  1  
ATOM 573   C CD1  . ILE A 1 41  ? -6.505  -0.918  -4.063  1.00 0.00 ? 219 ILE A CD1  1  
ATOM 574   H H    . ILE A 1 41  ? -6.283  -2.467  -0.270  1.00 0.00 ? 219 ILE A H    1  
ATOM 575   H HA   . ILE A 1 41  ? -6.186  0.400   0.410   1.00 0.00 ? 219 ILE A HA   1  
ATOM 576   H HB   . ILE A 1 41  ? -6.870  0.802   -1.983  1.00 0.00 ? 219 ILE A HB   1  
ATOM 577   H HG12 . ILE A 1 41  ? -5.906  -2.037  -2.377  1.00 0.00 ? 219 ILE A HG12 1  
ATOM 578   H HG13 . ILE A 1 41  ? -7.603  -1.568  -2.379  1.00 0.00 ? 219 ILE A HG13 1  
ATOM 579   H HG21 . ILE A 1 41  ? -4.205  -0.546  -1.936  1.00 0.00 ? 219 ILE A HG21 1  
ATOM 580   H HG22 . ILE A 1 41  ? -4.679  0.977   -2.687  1.00 0.00 ? 219 ILE A HG22 1  
ATOM 581   H HG23 . ILE A 1 41  ? -4.489  0.879   -0.936  1.00 0.00 ? 219 ILE A HG23 1  
ATOM 582   H HD11 . ILE A 1 41  ? -6.986  0.029   -4.258  1.00 0.00 ? 219 ILE A HD11 1  
ATOM 583   H HD12 . ILE A 1 41  ? -5.468  -0.863  -4.356  1.00 0.00 ? 219 ILE A HD12 1  
ATOM 584   H HD13 . ILE A 1 41  ? -6.999  -1.695  -4.628  1.00 0.00 ? 219 ILE A HD13 1  
ATOM 585   N N    . GLY A 1 42  ? -8.684  -1.593  0.027   1.00 0.00 ? 220 GLY A N    1  
ATOM 586   C CA   . GLY A 1 42  ? -10.120 -1.725  0.195   1.00 0.00 ? 220 GLY A CA   1  
ATOM 587   C C    . GLY A 1 42  ? -10.871 -1.599  -1.116  1.00 0.00 ? 220 GLY A C    1  
ATOM 588   O O    . GLY A 1 42  ? -11.807 -0.807  -1.229  1.00 0.00 ? 220 GLY A O    1  
ATOM 589   H H    . GLY A 1 42  ? -8.124  -2.395  -0.037  1.00 0.00 ? 220 GLY A H    1  
ATOM 590   H HA2  . GLY A 1 42  ? -10.333 -2.691  0.628   1.00 0.00 ? 220 GLY A HA2  1  
ATOM 591   H HA3  . GLY A 1 42  ? -10.464 -0.955  0.870   1.00 0.00 ? 220 GLY A HA3  1  
ATOM 592   N N    . VAL A 1 43  ? -10.459 -2.379  -2.110  1.00 0.00 ? 221 VAL A N    1  
ATOM 593   C CA   . VAL A 1 43  ? -11.100 -2.351  -3.419  1.00 0.00 ? 221 VAL A CA   1  
ATOM 594   C C    . VAL A 1 43  ? -11.193 -3.750  -4.016  1.00 0.00 ? 221 VAL A C    1  
ATOM 595   O O    . VAL A 1 43  ? -10.277 -4.560  -3.873  1.00 0.00 ? 221 VAL A O    1  
ATOM 596   C CB   . VAL A 1 43  ? -10.336 -1.438  -4.397  1.00 0.00 ? 221 VAL A CB   1  
ATOM 597   C CG1  . VAL A 1 43  ? -10.975 -1.481  -5.777  1.00 0.00 ? 221 VAL A CG1  1  
ATOM 598   C CG2  . VAL A 1 43  ? -10.289 -0.012  -3.868  1.00 0.00 ? 221 VAL A CG2  1  
ATOM 599   H H    . VAL A 1 43  ? -9.708  -2.990  -1.958  1.00 0.00 ? 221 VAL A H    1  
ATOM 600   H HA   . VAL A 1 43  ? -12.097 -1.955  -3.295  1.00 0.00 ? 221 VAL A HA   1  
ATOM 601   H HB   . VAL A 1 43  ? -9.323  -1.802  -4.482  1.00 0.00 ? 221 VAL A HB   1  
ATOM 602   H HG11 . VAL A 1 43  ? -12.048 -1.415  -5.679  1.00 0.00 ? 221 VAL A HG11 1  
ATOM 603   H HG12 . VAL A 1 43  ? -10.614 -0.651  -6.367  1.00 0.00 ? 221 VAL A HG12 1  
ATOM 604   H HG13 . VAL A 1 43  ? -10.715 -2.409  -6.265  1.00 0.00 ? 221 VAL A HG13 1  
ATOM 605   H HG21 . VAL A 1 43  ? -9.339  0.434   -4.122  1.00 0.00 ? 221 VAL A HG21 1  
ATOM 606   H HG22 . VAL A 1 43  ? -11.087 0.564   -4.312  1.00 0.00 ? 221 VAL A HG22 1  
ATOM 607   H HG23 . VAL A 1 43  ? -10.407 -0.022  -2.794  1.00 0.00 ? 221 VAL A HG23 1  
ATOM 608   N N    . ASP A 1 44  ? -12.306 -4.029  -4.686  1.00 0.00 ? 222 ASP A N    1  
ATOM 609   C CA   . ASP A 1 44  ? -12.519 -5.331  -5.307  1.00 0.00 ? 222 ASP A CA   1  
ATOM 610   C C    . ASP A 1 44  ? -11.995 -5.343  -6.739  1.00 0.00 ? 222 ASP A C    1  
ATOM 611   O O    . ASP A 1 44  ? -12.486 -4.610  -7.597  1.00 0.00 ? 222 ASP A O    1  
ATOM 612   C CB   . ASP A 1 44  ? -14.006 -5.689  -5.292  1.00 0.00 ? 222 ASP A CB   1  
ATOM 613   C CG   . ASP A 1 44  ? -14.407 -6.444  -4.040  1.00 0.00 ? 222 ASP A CG   1  
ATOM 614   O OD1  . ASP A 1 44  ? -13.907 -7.571  -3.840  1.00 0.00 ? 222 ASP A OD1  1  
ATOM 615   O OD2  . ASP A 1 44  ? -15.220 -5.908  -3.259  1.00 0.00 ? 222 ASP A OD2  1  
ATOM 616   H H    . ASP A 1 44  ? -13.000 -3.342  -4.766  1.00 0.00 ? 222 ASP A H    1  
ATOM 617   H HA   . ASP A 1 44  ? -11.976 -6.066  -4.732  1.00 0.00 ? 222 ASP A HA   1  
ATOM 618   H HB2  . ASP A 1 44  ? -14.589 -4.782  -5.344  1.00 0.00 ? 222 ASP A HB2  1  
ATOM 619   H HB3  . ASP A 1 44  ? -14.229 -6.306  -6.150  1.00 0.00 ? 222 ASP A HB3  1  
ATOM 620   N N    . GLY A 1 45  ? -10.993 -6.180  -6.991  1.00 0.00 ? 223 GLY A N    1  
ATOM 621   C CA   . GLY A 1 45  ? -10.417 -6.270  -8.320  1.00 0.00 ? 223 GLY A CA   1  
ATOM 622   C C    . GLY A 1 45  ? -9.077  -5.571  -8.420  1.00 0.00 ? 223 GLY A C    1  
ATOM 623   O O    . GLY A 1 45  ? -8.139  -6.091  -9.026  1.00 0.00 ? 223 GLY A O    1  
ATOM 624   H H    . GLY A 1 45  ? -10.641 -6.741  -6.268  1.00 0.00 ? 223 GLY A H    1  
ATOM 625   H HA2  . GLY A 1 45  ? -10.288 -7.312  -8.574  1.00 0.00 ? 223 GLY A HA2  1  
ATOM 626   H HA3  . GLY A 1 45  ? -11.099 -5.819  -9.026  1.00 0.00 ? 223 GLY A HA3  1  
ATOM 627   N N    . THR A 1 46  ? -8.983  -4.385  -7.826  1.00 0.00 ? 224 THR A N    1  
ATOM 628   C CA   . THR A 1 46  ? -7.749  -3.611  -7.853  1.00 0.00 ? 224 THR A CA   1  
ATOM 629   C C    . THR A 1 46  ? -6.707  -4.205  -6.912  1.00 0.00 ? 224 THR A C    1  
ATOM 630   O O    . THR A 1 46  ? -6.967  -4.397  -5.724  1.00 0.00 ? 224 THR A O    1  
ATOM 631   C CB   . THR A 1 46  ? -7.997  -2.142  -7.463  1.00 0.00 ? 224 THR A CB   1  
ATOM 632   O OG1  . THR A 1 46  ? -9.032  -1.586  -8.282  1.00 0.00 ? 224 THR A OG1  1  
ATOM 633   C CG2  . THR A 1 46  ? -6.727  -1.319  -7.614  1.00 0.00 ? 224 THR A CG2  1  
ATOM 634   H H    . THR A 1 46  ? -9.765  -4.023  -7.359  1.00 0.00 ? 224 THR A H    1  
ATOM 635   H HA   . THR A 1 46  ? -7.363  -3.634  -8.862  1.00 0.00 ? 224 THR A HA   1  
ATOM 636   H HB   . THR A 1 46  ? -8.310  -2.108  -6.429  1.00 0.00 ? 224 THR A HB   1  
ATOM 637   H HG1  . THR A 1 46  ? -9.335  -0.760  -7.898  1.00 0.00 ? 224 THR A HG1  1  
ATOM 638   H HG21 . THR A 1 46  ? -6.348  -1.060  -6.637  1.00 0.00 ? 224 THR A HG21 1  
ATOM 639   H HG22 . THR A 1 46  ? -6.945  -0.418  -8.167  1.00 0.00 ? 224 THR A HG22 1  
ATOM 640   H HG23 . THR A 1 46  ? -5.986  -1.897  -8.145  1.00 0.00 ? 224 THR A HG23 1  
ATOM 641   N N    . ARG A 1 47  ? -5.526  -4.494  -7.451  1.00 0.00 ? 225 ARG A N    1  
ATOM 642   C CA   . ARG A 1 47  ? -4.445  -5.067  -6.658  1.00 0.00 ? 225 ARG A CA   1  
ATOM 643   C C    . ARG A 1 47  ? -3.270  -4.098  -6.560  1.00 0.00 ? 225 ARG A C    1  
ATOM 644   O O    . ARG A 1 47  ? -2.828  -3.539  -7.564  1.00 0.00 ? 225 ARG A O    1  
ATOM 645   C CB   . ARG A 1 47  ? -3.979  -6.389  -7.272  1.00 0.00 ? 225 ARG A CB   1  
ATOM 646   C CG   . ARG A 1 47  ? -5.097  -7.403  -7.454  1.00 0.00 ? 225 ARG A CG   1  
ATOM 647   C CD   . ARG A 1 47  ? -4.595  -8.670  -8.127  1.00 0.00 ? 225 ARG A CD   1  
ATOM 648   N NE   . ARG A 1 47  ? -4.690  -8.592  -9.583  1.00 0.00 ? 225 ARG A NE   1  
ATOM 649   C CZ   . ARG A 1 47  ? -5.839  -8.477  -10.239 1.00 0.00 ? 225 ARG A CZ   1  
ATOM 650   N NH1  . ARG A 1 47  ? -6.985  -8.427  -9.573  1.00 0.00 ? 225 ARG A NH1  1  
ATOM 651   N NH2  . ARG A 1 47  ? -5.844  -8.411  -11.564 1.00 0.00 ? 225 ARG A NH2  1  
ATOM 652   H H    . ARG A 1 47  ? -5.379  -4.318  -8.404  1.00 0.00 ? 225 ARG A H    1  
ATOM 653   H HA   . ARG A 1 47  ? -4.825  -5.255  -5.665  1.00 0.00 ? 225 ARG A HA   1  
ATOM 654   H HB2  . ARG A 1 47  ? -3.543  -6.189  -8.240  1.00 0.00 ? 225 ARG A HB2  1  
ATOM 655   H HB3  . ARG A 1 47  ? -3.228  -6.825  -6.631  1.00 0.00 ? 225 ARG A HB3  1  
ATOM 656   H HG2  . ARG A 1 47  ? -5.500  -7.659  -6.485  1.00 0.00 ? 225 ARG A HG2  1  
ATOM 657   H HG3  . ARG A 1 47  ? -5.872  -6.964  -8.064  1.00 0.00 ? 225 ARG A HG3  1  
ATOM 658   H HD2  . ARG A 1 47  ? -3.562  -8.824  -7.852  1.00 0.00 ? 225 ARG A HD2  1  
ATOM 659   H HD3  . ARG A 1 47  ? -5.187  -9.504  -7.782  1.00 0.00 ? 225 ARG A HD3  1  
ATOM 660   H HE   . ARG A 1 47  ? -3.856  -8.627  -10.095 1.00 0.00 ? 225 ARG A HE   1  
ATOM 661   H HH11 . ARG A 1 47  ? -6.984  -8.476  -8.574  1.00 0.00 ? 225 ARG A HH11 1  
ATOM 662   H HH12 . ARG A 1 47  ? -7.849  -8.340  -10.069 1.00 0.00 ? 225 ARG A HH12 1  
ATOM 663   H HH21 . ARG A 1 47  ? -4.983  -8.448  -12.070 1.00 0.00 ? 225 ARG A HH21 1  
ATOM 664   H HH22 . ARG A 1 47  ? -6.710  -8.325  -12.057 1.00 0.00 ? 225 ARG A HH22 1  
ATOM 665   N N    . ALA A 1 48  ? -2.770  -3.904  -5.344  1.00 0.00 ? 226 ALA A N    1  
ATOM 666   C CA   . ALA A 1 48  ? -1.647  -3.004  -5.115  1.00 0.00 ? 226 ALA A CA   1  
ATOM 667   C C    . ALA A 1 48  ? -0.422  -3.768  -4.624  1.00 0.00 ? 226 ALA A C    1  
ATOM 668   O O    . ALA A 1 48  ? -0.485  -4.484  -3.623  1.00 0.00 ? 226 ALA A O    1  
ATOM 669   C CB   . ALA A 1 48  ? -2.032  -1.922  -4.117  1.00 0.00 ? 226 ALA A CB   1  
ATOM 670   H H    . ALA A 1 48  ? -3.165  -4.378  -4.584  1.00 0.00 ? 226 ALA A H    1  
ATOM 671   H HA   . ALA A 1 48  ? -1.406  -2.525  -6.054  1.00 0.00 ? 226 ALA A HA   1  
ATOM 672   H HB1  . ALA A 1 48  ? -1.370  -1.076  -4.232  1.00 0.00 ? 226 ALA A HB1  1  
ATOM 673   H HB2  . ALA A 1 48  ? -3.050  -1.611  -4.299  1.00 0.00 ? 226 ALA A HB2  1  
ATOM 674   H HB3  . ALA A 1 48  ? -1.948  -2.312  -3.114  1.00 0.00 ? 226 ALA A HB3  1  
ATOM 675   N N    . PHE A 1 49  ? 0.691   -3.613  -5.333  1.00 0.00 ? 227 PHE A N    1  
ATOM 676   C CA   . PHE A 1 49  ? 1.930   -4.291  -4.969  1.00 0.00 ? 227 PHE A CA   1  
ATOM 677   C C    . PHE A 1 49  ? 3.058   -3.285  -4.760  1.00 0.00 ? 227 PHE A C    1  
ATOM 678   O O    . PHE A 1 49  ? 3.148   -2.280  -5.465  1.00 0.00 ? 227 PHE A O    1  
ATOM 679   C CB   . PHE A 1 49  ? 2.322   -5.298  -6.052  1.00 0.00 ? 227 PHE A CB   1  
ATOM 680   C CG   . PHE A 1 49  ? 3.777   -5.671  -6.025  1.00 0.00 ? 227 PHE A CG   1  
ATOM 681   C CD1  . PHE A 1 49  ? 4.713   -4.913  -6.710  1.00 0.00 ? 227 PHE A CD1  1  
ATOM 682   C CD2  . PHE A 1 49  ? 4.209   -6.779  -5.314  1.00 0.00 ? 227 PHE A CD2  1  
ATOM 683   C CE1  . PHE A 1 49  ? 6.052   -5.255  -6.687  1.00 0.00 ? 227 PHE A CE1  1  
ATOM 684   C CE2  . PHE A 1 49  ? 5.546   -7.125  -5.287  1.00 0.00 ? 227 PHE A CE2  1  
ATOM 685   C CZ   . PHE A 1 49  ? 6.469   -6.361  -5.974  1.00 0.00 ? 227 PHE A CZ   1  
ATOM 686   H H    . PHE A 1 49  ? 0.678   -3.030  -6.120  1.00 0.00 ? 227 PHE A H    1  
ATOM 687   H HA   . PHE A 1 49  ? 1.758   -4.819  -4.044  1.00 0.00 ? 227 PHE A HA   1  
ATOM 688   H HB2  . PHE A 1 49  ? 1.746   -6.201  -5.920  1.00 0.00 ? 227 PHE A HB2  1  
ATOM 689   H HB3  . PHE A 1 49  ? 2.105   -4.875  -7.022  1.00 0.00 ? 227 PHE A HB3  1  
ATOM 690   H HD1  . PHE A 1 49  ? 4.389   -4.047  -7.268  1.00 0.00 ? 227 PHE A HD1  1  
ATOM 691   H HD2  . PHE A 1 49  ? 3.487   -7.377  -4.775  1.00 0.00 ? 227 PHE A HD2  1  
ATOM 692   H HE1  . PHE A 1 49  ? 6.772   -4.655  -7.225  1.00 0.00 ? 227 PHE A HE1  1  
ATOM 693   H HE2  . PHE A 1 49  ? 5.869   -7.991  -4.728  1.00 0.00 ? 227 PHE A HE2  1  
ATOM 694   H HZ   . PHE A 1 49  ? 7.515   -6.630  -5.955  1.00 0.00 ? 227 PHE A HZ   1  
ATOM 695   N N    . LEU A 1 50  ? 3.918   -3.564  -3.786  1.00 0.00 ? 228 LEU A N    1  
ATOM 696   C CA   . LEU A 1 50  ? 5.041   -2.685  -3.483  1.00 0.00 ? 228 LEU A CA   1  
ATOM 697   C C    . LEU A 1 50  ? 6.368   -3.365  -3.805  1.00 0.00 ? 228 LEU A C    1  
ATOM 698   O O    . LEU A 1 50  ? 6.596   -4.527  -3.467  1.00 0.00 ? 228 LEU A O    1  
ATOM 699   C CB   . LEU A 1 50  ? 5.010   -2.274  -2.009  1.00 0.00 ? 228 LEU A CB   1  
ATOM 700   C CG   . LEU A 1 50  ? 5.821   -1.032  -1.641  1.00 0.00 ? 228 LEU A CG   1  
ATOM 701   C CD1  . LEU A 1 50  ? 5.188   0.215   -2.239  1.00 0.00 ? 228 LEU A CD1  1  
ATOM 702   C CD2  . LEU A 1 50  ? 5.939   -0.900  -0.130  1.00 0.00 ? 228 LEU A CD2  1  
ATOM 703   H H    . LEU A 1 50  ? 3.795   -4.380  -3.259  1.00 0.00 ? 228 LEU A H    1  
ATOM 704   H HA   . LEU A 1 50  ? 4.946   -1.801  -4.096  1.00 0.00 ? 228 LEU A HA   1  
ATOM 705   H HB2  . LEU A 1 50  ? 3.981   -2.090  -1.740  1.00 0.00 ? 228 LEU A HB2  1  
ATOM 706   H HB3  . LEU A 1 50  ? 5.389   -3.103  -1.428  1.00 0.00 ? 228 LEU A HB3  1  
ATOM 707   H HG   . LEU A 1 50  ? 6.818   -1.127  -2.048  1.00 0.00 ? 228 LEU A HG   1  
ATOM 708   H HD11 . LEU A 1 50  ? 5.961   0.858   -2.633  1.00 0.00 ? 228 LEU A HD11 1  
ATOM 709   H HD12 . LEU A 1 50  ? 4.637   0.742   -1.473  1.00 0.00 ? 228 LEU A HD12 1  
ATOM 710   H HD13 . LEU A 1 50  ? 4.515   -0.069  -3.035  1.00 0.00 ? 228 LEU A HD13 1  
ATOM 711   H HD21 . LEU A 1 50  ? 6.977   -0.973  0.157   1.00 0.00 ? 228 LEU A HD21 1  
ATOM 712   H HD22 . LEU A 1 50  ? 5.378   -1.692  0.345   1.00 0.00 ? 228 LEU A HD22 1  
ATOM 713   H HD23 . LEU A 1 50  ? 5.545   0.057   0.180   1.00 0.00 ? 228 LEU A HD23 1  
ATOM 714   N N    . PRO A 1 51  ? 7.267   -2.625  -4.471  1.00 0.00 ? 229 PRO A N    1  
ATOM 715   C CA   . PRO A 1 51  ? 8.587   -3.136  -4.851  1.00 0.00 ? 229 PRO A CA   1  
ATOM 716   C C    . PRO A 1 51  ? 9.500   -3.335  -3.645  1.00 0.00 ? 229 PRO A C    1  
ATOM 717   O O    . PRO A 1 51  ? 9.457   -2.563  -2.687  1.00 0.00 ? 229 PRO A O    1  
ATOM 718   C CB   . PRO A 1 51  ? 9.141   -2.041  -5.766  1.00 0.00 ? 229 PRO A CB   1  
ATOM 719   C CG   . PRO A 1 51  ? 8.435   -0.800  -5.342  1.00 0.00 ? 229 PRO A CG   1  
ATOM 720   C CD   . PRO A 1 51  ? 7.063   -1.233  -4.905  1.00 0.00 ? 229 PRO A CD   1  
ATOM 721   H HA   . PRO A 1 51  ? 8.511   -4.063  -5.400  1.00 0.00 ? 229 PRO A HA   1  
ATOM 722   H HB2  . PRO A 1 51  ? 10.210  -1.957  -5.624  1.00 0.00 ? 229 PRO A HB2  1  
ATOM 723   H HB3  . PRO A 1 51  ? 8.928   -2.285  -6.795  1.00 0.00 ? 229 PRO A HB3  1  
ATOM 724   H HG2  . PRO A 1 51  ? 8.962   -0.339  -4.520  1.00 0.00 ? 229 PRO A HG2  1  
ATOM 725   H HG3  . PRO A 1 51  ? 8.364   -0.116  -6.175  1.00 0.00 ? 229 PRO A HG3  1  
ATOM 726   H HD2  . PRO A 1 51  ? 6.717   -0.620  -4.086  1.00 0.00 ? 229 PRO A HD2  1  
ATOM 727   H HD3  . PRO A 1 51  ? 6.371   -1.186  -5.733  1.00 0.00 ? 229 PRO A HD3  1  
ATOM 728   N N    . LEU A 1 52  ? 10.325  -4.375  -3.700  1.00 0.00 ? 230 LEU A N    1  
ATOM 729   C CA   . LEU A 1 52  ? 11.250  -4.676  -2.612  1.00 0.00 ? 230 LEU A CA   1  
ATOM 730   C C    . LEU A 1 52  ? 12.259  -3.547  -2.427  1.00 0.00 ? 230 LEU A C    1  
ATOM 731   O O    . LEU A 1 52  ? 12.788  -3.346  -1.333  1.00 0.00 ? 230 LEU A O    1  
ATOM 732   C CB   . LEU A 1 52  ? 11.982  -5.990  -2.888  1.00 0.00 ? 230 LEU A CB   1  
ATOM 733   C CG   . LEU A 1 52  ? 11.200  -7.270  -2.588  1.00 0.00 ? 230 LEU A CG   1  
ATOM 734   C CD1  . LEU A 1 52  ? 11.770  -8.440  -3.375  1.00 0.00 ? 230 LEU A CD1  1  
ATOM 735   C CD2  . LEU A 1 52  ? 11.218  -7.569  -1.096  1.00 0.00 ? 230 LEU A CD2  1  
ATOM 736   H H    . LEU A 1 52  ? 10.314  -4.954  -4.490  1.00 0.00 ? 230 LEU A H    1  
ATOM 737   H HA   . LEU A 1 52  ? 10.672  -4.778  -1.705  1.00 0.00 ? 230 LEU A HA   1  
ATOM 738   H HB2  . LEU A 1 52  ? 12.253  -6.005  -3.932  1.00 0.00 ? 230 LEU A HB2  1  
ATOM 739   H HB3  . LEU A 1 52  ? 12.879  -6.000  -2.285  1.00 0.00 ? 230 LEU A HB3  1  
ATOM 740   H HG   . LEU A 1 52  ? 10.171  -7.134  -2.891  1.00 0.00 ? 230 LEU A HG   1  
ATOM 741   H HD11 . LEU A 1 52  ? 11.369  -8.430  -4.377  1.00 0.00 ? 230 LEU A HD11 1  
ATOM 742   H HD12 . LEU A 1 52  ? 11.501  -9.366  -2.888  1.00 0.00 ? 230 LEU A HD12 1  
ATOM 743   H HD13 . LEU A 1 52  ? 12.847  -8.355  -3.417  1.00 0.00 ? 230 LEU A HD13 1  
ATOM 744   H HD21 . LEU A 1 52  ? 11.001  -6.665  -0.546  1.00 0.00 ? 230 LEU A HD21 1  
ATOM 745   H HD22 . LEU A 1 52  ? 12.194  -7.936  -0.814  1.00 0.00 ? 230 LEU A HD22 1  
ATOM 746   H HD23 . LEU A 1 52  ? 10.472  -8.316  -0.870  1.00 0.00 ? 230 LEU A HD23 1  
ATOM 747   N N    . LEU A 1 53  ? 12.520  -2.812  -3.503  1.00 0.00 ? 231 LEU A N    1  
ATOM 748   C CA   . LEU A 1 53  ? 13.464  -1.701  -3.459  1.00 0.00 ? 231 LEU A CA   1  
ATOM 749   C C    . LEU A 1 53  ? 12.962  -0.595  -2.535  1.00 0.00 ? 231 LEU A C    1  
ATOM 750   O O    . LEU A 1 53  ? 13.721  -0.048  -1.735  1.00 0.00 ? 231 LEU A O    1  
ATOM 751   C CB   . LEU A 1 53  ? 13.690  -1.143  -4.865  1.00 0.00 ? 231 LEU A CB   1  
ATOM 752   C CG   . LEU A 1 53  ? 13.918  -2.176  -5.969  1.00 0.00 ? 231 LEU A CG   1  
ATOM 753   C CD1  . LEU A 1 53  ? 13.938  -1.504  -7.333  1.00 0.00 ? 231 LEU A CD1  1  
ATOM 754   C CD2  . LEU A 1 53  ? 15.214  -2.936  -5.728  1.00 0.00 ? 231 LEU A CD2  1  
ATOM 755   H H    . LEU A 1 53  ? 12.067  -3.020  -4.346  1.00 0.00 ? 231 LEU A H    1  
ATOM 756   H HA   . LEU A 1 53  ? 14.400  -2.077  -3.075  1.00 0.00 ? 231 LEU A HA   1  
ATOM 757   H HB2  . LEU A 1 53  ? 12.823  -0.559  -5.133  1.00 0.00 ? 231 LEU A HB2  1  
ATOM 758   H HB3  . LEU A 1 53  ? 14.558  -0.499  -4.829  1.00 0.00 ? 231 LEU A HB3  1  
ATOM 759   H HG   . LEU A 1 53  ? 13.105  -2.888  -5.960  1.00 0.00 ? 231 LEU A HG   1  
ATOM 760   H HD11 . LEU A 1 53  ? 12.934  -1.465  -7.729  1.00 0.00 ? 231 LEU A HD11 1  
ATOM 761   H HD12 . LEU A 1 53  ? 14.568  -2.070  -8.004  1.00 0.00 ? 231 LEU A HD12 1  
ATOM 762   H HD13 . LEU A 1 53  ? 14.326  -0.501  -7.235  1.00 0.00 ? 231 LEU A HD13 1  
ATOM 763   H HD21 . LEU A 1 53  ? 16.051  -2.263  -5.837  1.00 0.00 ? 231 LEU A HD21 1  
ATOM 764   H HD22 . LEU A 1 53  ? 15.300  -3.738  -6.448  1.00 0.00 ? 231 LEU A HD22 1  
ATOM 765   H HD23 . LEU A 1 53  ? 15.210  -3.348  -4.730  1.00 0.00 ? 231 LEU A HD23 1  
ATOM 766   N N    . LYS A 1 54  ? 11.678  -0.273  -2.650  1.00 0.00 ? 232 LYS A N    1  
ATOM 767   C CA   . LYS A 1 54  ? 11.072  0.764   -1.824  1.00 0.00 ? 232 LYS A CA   1  
ATOM 768   C C    . LYS A 1 54  ? 10.686  0.213   -0.455  1.00 0.00 ? 232 LYS A C    1  
ATOM 769   O O    . LYS A 1 54  ? 10.893  0.864   0.568   1.00 0.00 ? 232 LYS A O    1  
ATOM 770   C CB   . LYS A 1 54  ? 9.838   1.343   -2.519  1.00 0.00 ? 232 LYS A CB   1  
ATOM 771   C CG   . LYS A 1 54  ? 9.108   2.388   -1.693  1.00 0.00 ? 232 LYS A CG   1  
ATOM 772   C CD   . LYS A 1 54  ? 9.967   3.621   -1.469  1.00 0.00 ? 232 LYS A CD   1  
ATOM 773   C CE   . LYS A 1 54  ? 10.023  4.494   -2.713  1.00 0.00 ? 232 LYS A CE   1  
ATOM 774   N NZ   . LYS A 1 54  ? 11.267  5.311   -2.763  1.00 0.00 ? 232 LYS A NZ   1  
ATOM 775   H H    . LYS A 1 54  ? 11.124  -0.746  -3.307  1.00 0.00 ? 232 LYS A H    1  
ATOM 776   H HA   . LYS A 1 54  ? 11.801  1.549   -1.690  1.00 0.00 ? 232 LYS A HA   1  
ATOM 777   H HB2  . LYS A 1 54  ? 10.145  1.799   -3.449  1.00 0.00 ? 232 LYS A HB2  1  
ATOM 778   H HB3  . LYS A 1 54  ? 9.150   0.538   -2.733  1.00 0.00 ? 232 LYS A HB3  1  
ATOM 779   H HG2  . LYS A 1 54  ? 8.207   2.679   -2.212  1.00 0.00 ? 232 LYS A HG2  1  
ATOM 780   H HG3  . LYS A 1 54  ? 8.852   1.960   -0.734  1.00 0.00 ? 232 LYS A HG3  1  
ATOM 781   H HD2  . LYS A 1 54  ? 9.549   4.198   -0.657  1.00 0.00 ? 232 LYS A HD2  1  
ATOM 782   H HD3  . LYS A 1 54  ? 10.970  3.310   -1.213  1.00 0.00 ? 232 LYS A HD3  1  
ATOM 783   H HE2  . LYS A 1 54  ? 9.984   3.859   -3.585  1.00 0.00 ? 232 LYS A HE2  1  
ATOM 784   H HE3  . LYS A 1 54  ? 9.168   5.155   -2.712  1.00 0.00 ? 232 LYS A HE3  1  
ATOM 785   H HZ1  . LYS A 1 54  ? 11.610  5.497   -1.798  1.00 0.00 ? 232 LYS A HZ1  1  
ATOM 786   H HZ2  . LYS A 1 54  ? 11.081  6.218   -3.234  1.00 0.00 ? 232 LYS A HZ2  1  
ATOM 787   H HZ3  . LYS A 1 54  ? 12.007  4.804   -3.290  1.00 0.00 ? 232 LYS A HZ3  1  
ATOM 788   N N    . ALA A 1 55  ? 10.124  -0.992  -0.444  1.00 0.00 ? 233 ALA A N    1  
ATOM 789   C CA   . ALA A 1 55  ? 9.712   -1.632  0.799   1.00 0.00 ? 233 ALA A CA   1  
ATOM 790   C C    . ALA A 1 55  ? 10.915  -1.928  1.688   1.00 0.00 ? 233 ALA A C    1  
ATOM 791   O O    . ALA A 1 55  ? 10.912  -1.610  2.877   1.00 0.00 ? 233 ALA A O    1  
ATOM 792   C CB   . ALA A 1 55  ? 8.944   -2.911  0.504   1.00 0.00 ? 233 ALA A CB   1  
ATOM 793   H H    . ALA A 1 55  ? 9.985   -1.462  -1.293  1.00 0.00 ? 233 ALA A H    1  
ATOM 794   H HA   . ALA A 1 55  ? 9.050   -0.955  1.319   1.00 0.00 ? 233 ALA A HA   1  
ATOM 795   H HB1  . ALA A 1 55  ? 9.624   -3.660  0.126   1.00 0.00 ? 233 ALA A HB1  1  
ATOM 796   H HB2  . ALA A 1 55  ? 8.481   -3.270  1.411   1.00 0.00 ? 233 ALA A HB2  1  
ATOM 797   H HB3  . ALA A 1 55  ? 8.182   -2.711  -0.234  1.00 0.00 ? 233 ALA A HB3  1  
ATOM 798   N N    . GLN A 1 56  ? 11.941  -2.539  1.105   1.00 0.00 ? 234 GLN A N    1  
ATOM 799   C CA   . GLN A 1 56  ? 13.149  -2.879  1.846   1.00 0.00 ? 234 GLN A CA   1  
ATOM 800   C C    . GLN A 1 56  ? 13.843  -1.623  2.362   1.00 0.00 ? 234 GLN A C    1  
ATOM 801   O O    . GLN A 1 56  ? 14.439  -1.630  3.439   1.00 0.00 ? 234 GLN A O    1  
ATOM 802   C CB   . GLN A 1 56  ? 14.108  -3.679  0.962   1.00 0.00 ? 234 GLN A CB   1  
ATOM 803   C CG   . GLN A 1 56  ? 15.246  -4.329  1.731   1.00 0.00 ? 234 GLN A CG   1  
ATOM 804   C CD   . GLN A 1 56  ? 15.974  -5.381  0.918   1.00 0.00 ? 234 GLN A CD   1  
ATOM 805   O OE1  . GLN A 1 56  ? 16.683  -5.063  -0.037  1.00 0.00 ? 234 GLN A OE1  1  
ATOM 806   N NE2  . GLN A 1 56  ? 15.803  -6.643  1.293   1.00 0.00 ? 234 GLN A NE2  1  
ATOM 807   H H    . GLN A 1 56  ? 11.883  -2.767  0.154   1.00 0.00 ? 234 GLN A H    1  
ATOM 808   H HA   . GLN A 1 56  ? 12.860  -3.488  2.690   1.00 0.00 ? 234 GLN A HA   1  
ATOM 809   H HB2  . GLN A 1 56  ? 13.552  -4.455  0.459   1.00 0.00 ? 234 GLN A HB2  1  
ATOM 810   H HB3  . GLN A 1 56  ? 14.534  -3.016  0.223   1.00 0.00 ? 234 GLN A HB3  1  
ATOM 811   H HG2  . GLN A 1 56  ? 15.954  -3.565  2.017   1.00 0.00 ? 234 GLN A HG2  1  
ATOM 812   H HG3  . GLN A 1 56  ? 14.844  -4.795  2.618   1.00 0.00 ? 234 GLN A HG3  1  
ATOM 813   H HE21 . GLN A 1 56  ? 15.223  -6.822  2.064   1.00 0.00 ? 234 GLN A HE21 1  
ATOM 814   H HE22 . GLN A 1 56  ? 16.261  -7.344  0.785   1.00 0.00 ? 234 GLN A HE22 1  
ATOM 815   N N    . GLU A 1 57  ? 13.760  -0.546  1.587   1.00 0.00 ? 235 GLU A N    1  
ATOM 816   C CA   . GLU A 1 57  ? 14.381  0.717   1.967   1.00 0.00 ? 235 GLU A CA   1  
ATOM 817   C C    . GLU A 1 57  ? 13.718  1.297   3.213   1.00 0.00 ? 235 GLU A C    1  
ATOM 818   O O    . GLU A 1 57  ? 14.394  1.792   4.115   1.00 0.00 ? 235 GLU A O    1  
ATOM 819   C CB   . GLU A 1 57  ? 14.293  1.721   0.815   1.00 0.00 ? 235 GLU A CB   1  
ATOM 820   C CG   . GLU A 1 57  ? 15.139  2.965   1.026   1.00 0.00 ? 235 GLU A CG   1  
ATOM 821   C CD   . GLU A 1 57  ? 14.932  4.003   -0.060  1.00 0.00 ? 235 GLU A CD   1  
ATOM 822   O OE1  . GLU A 1 57  ? 14.020  4.843   0.090   1.00 0.00 ? 235 GLU A OE1  1  
ATOM 823   O OE2  . GLU A 1 57  ? 15.680  3.974   -1.060  1.00 0.00 ? 235 GLU A OE2  1  
ATOM 824   H H    . GLU A 1 57  ? 13.270  -0.603  0.740   1.00 0.00 ? 235 GLU A H    1  
ATOM 825   H HA   . GLU A 1 57  ? 15.421  0.523   2.184   1.00 0.00 ? 235 GLU A HA   1  
ATOM 826   H HB2  . GLU A 1 57  ? 14.620  1.237   -0.094  1.00 0.00 ? 235 GLU A HB2  1  
ATOM 827   H HB3  . GLU A 1 57  ? 13.264  2.027   0.699   1.00 0.00 ? 235 GLU A HB3  1  
ATOM 828   H HG2  . GLU A 1 57  ? 14.879  3.405   1.977   1.00 0.00 ? 235 GLU A HG2  1  
ATOM 829   H HG3  . GLU A 1 57  ? 16.181  2.679   1.036   1.00 0.00 ? 235 GLU A HG3  1  
ATOM 830   N N    . TYR A 1 58  ? 12.392  1.232   3.254   1.00 0.00 ? 236 TYR A N    1  
ATOM 831   C CA   . TYR A 1 58  ? 11.637  1.753   4.387   1.00 0.00 ? 236 TYR A CA   1  
ATOM 832   C C    . TYR A 1 58  ? 11.803  0.857   5.611   1.00 0.00 ? 236 TYR A C    1  
ATOM 833   O O    . TYR A 1 58  ? 11.882  1.340   6.741   1.00 0.00 ? 236 TYR A O    1  
ATOM 834   C CB   . TYR A 1 58  ? 10.155  1.873   4.027   1.00 0.00 ? 236 TYR A CB   1  
ATOM 835   C CG   . TYR A 1 58  ? 9.245   1.968   5.231   1.00 0.00 ? 236 TYR A CG   1  
ATOM 836   C CD1  . TYR A 1 58  ? 8.843   0.826   5.913   1.00 0.00 ? 236 TYR A CD1  1  
ATOM 837   C CD2  . TYR A 1 58  ? 8.786   3.198   5.685   1.00 0.00 ? 236 TYR A CD2  1  
ATOM 838   C CE1  . TYR A 1 58  ? 8.011   0.907   7.013   1.00 0.00 ? 236 TYR A CE1  1  
ATOM 839   C CE2  . TYR A 1 58  ? 7.955   3.288   6.785   1.00 0.00 ? 236 TYR A CE2  1  
ATOM 840   C CZ   . TYR A 1 58  ? 7.570   2.140   7.445   1.00 0.00 ? 236 TYR A CZ   1  
ATOM 841   O OH   . TYR A 1 58  ? 6.741   2.226   8.541   1.00 0.00 ? 236 TYR A OH   1  
ATOM 842   H H    . TYR A 1 58  ? 11.909  0.826   2.504   1.00 0.00 ? 236 TYR A H    1  
ATOM 843   H HA   . TYR A 1 58  ? 12.021  2.735   4.619   1.00 0.00 ? 236 TYR A HA   1  
ATOM 844   H HB2  . TYR A 1 58  ? 10.007  2.760   3.430   1.00 0.00 ? 236 TYR A HB2  1  
ATOM 845   H HB3  . TYR A 1 58  ? 9.859   1.006   3.454   1.00 0.00 ? 236 TYR A HB3  1  
ATOM 846   H HD1  . TYR A 1 58  ? 9.190   -0.139  5.573   1.00 0.00 ? 236 TYR A HD1  1  
ATOM 847   H HD2  . TYR A 1 58  ? 9.089   4.095   5.165   1.00 0.00 ? 236 TYR A HD2  1  
ATOM 848   H HE1  . TYR A 1 58  ? 7.710   0.008   7.531   1.00 0.00 ? 236 TYR A HE1  1  
ATOM 849   H HE2  . TYR A 1 58  ? 7.609   4.254   7.123   1.00 0.00 ? 236 TYR A HE2  1  
ATOM 850   H HH   . TYR A 1 58  ? 6.177   2.998   8.455   1.00 0.00 ? 236 TYR A HH   1  
ATOM 851   N N    . ILE A 1 59  ? 11.856  -0.450  5.377   1.00 0.00 ? 237 ILE A N    1  
ATOM 852   C CA   . ILE A 1 59  ? 12.014  -1.414  6.458   1.00 0.00 ? 237 ILE A CA   1  
ATOM 853   C C    . ILE A 1 59  ? 13.410  -1.331  7.068   1.00 0.00 ? 237 ILE A C    1  
ATOM 854   O O    . ILE A 1 59  ? 13.564  -1.290  8.288   1.00 0.00 ? 237 ILE A O    1  
ATOM 855   C CB   . ILE A 1 59  ? 11.763  -2.853  5.971   1.00 0.00 ? 237 ILE A CB   1  
ATOM 856   C CG1  . ILE A 1 59  ? 10.350  -2.981  5.398   1.00 0.00 ? 237 ILE A CG1  1  
ATOM 857   C CG2  . ILE A 1 59  ? 11.971  -3.841  7.109   1.00 0.00 ? 237 ILE A CG2  1  
ATOM 858   C CD1  . ILE A 1 59  ? 10.208  -4.098  4.388   1.00 0.00 ? 237 ILE A CD1  1  
ATOM 859   H H    . ILE A 1 59  ? 11.787  -0.773  4.454   1.00 0.00 ? 237 ILE A H    1  
ATOM 860   H HA   . ILE A 1 59  ? 11.285  -1.181  7.221   1.00 0.00 ? 237 ILE A HA   1  
ATOM 861   H HB   . ILE A 1 59  ? 12.480  -3.077  5.196   1.00 0.00 ? 237 ILE A HB   1  
ATOM 862   H HG12 . ILE A 1 59  ? 9.658   -3.172  6.203   1.00 0.00 ? 237 ILE A HG12 1  
ATOM 863   H HG13 . ILE A 1 59  ? 10.083  -2.055  4.910   1.00 0.00 ? 237 ILE A HG13 1  
ATOM 864   H HG21 . ILE A 1 59  ? 12.609  -3.397  7.860   1.00 0.00 ? 237 ILE A HG21 1  
ATOM 865   H HG22 . ILE A 1 59  ? 11.017  -4.088  7.550   1.00 0.00 ? 237 ILE A HG22 1  
ATOM 866   H HG23 . ILE A 1 59  ? 12.435  -4.738  6.728   1.00 0.00 ? 237 ILE A HG23 1  
ATOM 867   H HD11 . ILE A 1 59  ? 11.187  -4.447  4.096   1.00 0.00 ? 237 ILE A HD11 1  
ATOM 868   H HD12 . ILE A 1 59  ? 9.650   -4.912  4.827   1.00 0.00 ? 237 ILE A HD12 1  
ATOM 869   H HD13 . ILE A 1 59  ? 9.683   -3.731  3.518   1.00 0.00 ? 237 ILE A HD13 1  
ATOM 870   N N    . ARG A 1 60  ? 14.424  -1.305  6.209   1.00 0.00 ? 238 ARG A N    1  
ATOM 871   C CA   . ARG A 1 60  ? 15.807  -1.227  6.663   1.00 0.00 ? 238 ARG A CA   1  
ATOM 872   C C    . ARG A 1 60  ? 16.038  0.036   7.489   1.00 0.00 ? 238 ARG A C    1  
ATOM 873   O O    . ARG A 1 60  ? 16.734  0.006   8.503   1.00 0.00 ? 238 ARG A O    1  
ATOM 874   C CB   . ARG A 1 60  ? 16.760  -1.247  5.467   1.00 0.00 ? 238 ARG A CB   1  
ATOM 875   C CG   . ARG A 1 60  ? 17.071  0.133   4.912   1.00 0.00 ? 238 ARG A CG   1  
ATOM 876   C CD   . ARG A 1 60  ? 18.160  0.075   3.852   1.00 0.00 ? 238 ARG A CD   1  
ATOM 877   N NE   . ARG A 1 60  ? 17.929  -0.997  2.888   1.00 0.00 ? 238 ARG A NE   1  
ATOM 878   C CZ   . ARG A 1 60  ? 18.802  -1.340  1.947   1.00 0.00 ? 238 ARG A CZ   1  
ATOM 879   N NH1  . ARG A 1 60  ? 19.958  -0.699  1.844   1.00 0.00 ? 238 ARG A NH1  1  
ATOM 880   N NH2  . ARG A 1 60  ? 18.519  -2.327  1.106   1.00 0.00 ? 238 ARG A NH2  1  
ATOM 881   H H    . ARG A 1 60  ? 14.237  -1.340  5.248   1.00 0.00 ? 238 ARG A H    1  
ATOM 882   H HA   . ARG A 1 60  ? 16.003  -2.089  7.282   1.00 0.00 ? 238 ARG A HA   1  
ATOM 883   H HB2  . ARG A 1 60  ? 17.690  -1.707  5.769   1.00 0.00 ? 238 ARG A HB2  1  
ATOM 884   H HB3  . ARG A 1 60  ? 16.317  -1.837  4.678   1.00 0.00 ? 238 ARG A HB3  1  
ATOM 885   H HG2  . ARG A 1 60  ? 16.176  0.544   4.469   1.00 0.00 ? 238 ARG A HG2  1  
ATOM 886   H HG3  . ARG A 1 60  ? 17.400  0.770   5.719   1.00 0.00 ? 238 ARG A HG3  1  
ATOM 887   H HD2  . ARG A 1 60  ? 18.184  1.019   3.327   1.00 0.00 ? 238 ARG A HD2  1  
ATOM 888   H HD3  . ARG A 1 60  ? 19.110  -0.089  4.339   1.00 0.00 ? 238 ARG A HD3  1  
ATOM 889   H HE   . ARG A 1 60  ? 17.082  -1.485  2.946   1.00 0.00 ? 238 ARG A HE   1  
ATOM 890   H HH11 . ARG A 1 60  ? 20.173  0.045   2.477   1.00 0.00 ? 238 ARG A HH11 1  
ATOM 891   H HH12 . ARG A 1 60  ? 20.614  -0.960  1.136   1.00 0.00 ? 238 ARG A HH12 1  
ATOM 892   H HH21 . ARG A 1 60  ? 17.649  -2.814  1.181   1.00 0.00 ? 238 ARG A HH21 1  
ATOM 893   H HH22 . ARG A 1 60  ? 19.177  -2.585  0.399   1.00 0.00 ? 238 ARG A HH22 1  
ATOM 894   N N    . GLN A 1 61  ? 15.448  1.142   7.047   1.00 0.00 ? 239 GLN A N    1  
ATOM 895   C CA   . GLN A 1 61  ? 15.590  2.414   7.745   1.00 0.00 ? 239 GLN A CA   1  
ATOM 896   C C    . GLN A 1 61  ? 14.654  2.484   8.946   1.00 0.00 ? 239 GLN A C    1  
ATOM 897   O O    . GLN A 1 61  ? 14.875  3.260   9.876   1.00 0.00 ? 239 GLN A O    1  
ATOM 898   C CB   . GLN A 1 61  ? 15.305  3.577   6.793   1.00 0.00 ? 239 GLN A CB   1  
ATOM 899   C CG   . GLN A 1 61  ? 16.441  3.861   5.823   1.00 0.00 ? 239 GLN A CG   1  
ATOM 900   C CD   . GLN A 1 61  ? 16.278  5.188   5.107   1.00 0.00 ? 239 GLN A CD   1  
ATOM 901   O OE1  . GLN A 1 61  ? 15.175  5.726   5.015   1.00 0.00 ? 239 GLN A OE1  1  
ATOM 902   N NE2  . GLN A 1 61  ? 17.381  5.723   4.596   1.00 0.00 ? 239 GLN A NE2  1  
ATOM 903   H H    . GLN A 1 61  ? 14.905  1.101   6.233   1.00 0.00 ? 239 GLN A H    1  
ATOM 904   H HA   . GLN A 1 61  ? 16.609  2.488   8.094   1.00 0.00 ? 239 GLN A HA   1  
ATOM 905   H HB2  . GLN A 1 61  ? 14.419  3.349   6.220   1.00 0.00 ? 239 GLN A HB2  1  
ATOM 906   H HB3  . GLN A 1 61  ? 15.128  4.468   7.376   1.00 0.00 ? 239 GLN A HB3  1  
ATOM 907   H HG2  . GLN A 1 61  ? 17.371  3.878   6.371   1.00 0.00 ? 239 GLN A HG2  1  
ATOM 908   H HG3  . GLN A 1 61  ? 16.473  3.072   5.086   1.00 0.00 ? 239 GLN A HG3  1  
ATOM 909   H HE21 . GLN A 1 61  ? 18.225  5.238   4.707   1.00 0.00 ? 239 GLN A HE21 1  
ATOM 910   H HE22 . GLN A 1 61  ? 17.305  6.580   4.127   1.00 0.00 ? 239 GLN A HE22 1  
ATOM 911   N N    . LYS A 1 62  ? 13.605  1.668   8.921   1.00 0.00 ? 240 LYS A N    1  
ATOM 912   C CA   . LYS A 1 62  ? 12.634  1.635   10.008  1.00 0.00 ? 240 LYS A CA   1  
ATOM 913   C C    . LYS A 1 62  ? 12.912  0.469   10.951  1.00 0.00 ? 240 LYS A C    1  
ATOM 914   O O    . LYS A 1 62  ? 13.374  0.664   12.075  1.00 0.00 ? 240 LYS A O    1  
ATOM 915   C CB   . LYS A 1 62  ? 11.214  1.524   9.448   1.00 0.00 ? 240 LYS A CB   1  
ATOM 916   C CG   . LYS A 1 62  ? 10.737  2.785   8.747   1.00 0.00 ? 240 LYS A CG   1  
ATOM 917   C CD   . LYS A 1 62  ? 10.266  3.832   9.743   1.00 0.00 ? 240 LYS A CD   1  
ATOM 918   C CE   . LYS A 1 62  ? 9.826   5.108   9.043   1.00 0.00 ? 240 LYS A CE   1  
ATOM 919   N NZ   . LYS A 1 62  ? 10.984  5.878   8.512   1.00 0.00 ? 240 LYS A NZ   1  
ATOM 920   H H    . LYS A 1 62  ? 13.482  1.072   8.152   1.00 0.00 ? 240 LYS A H    1  
ATOM 921   H HA   . LYS A 1 62  ? 12.723  2.558   10.560  1.00 0.00 ? 240 LYS A HA   1  
ATOM 922   H HB2  . LYS A 1 62  ? 11.182  0.710   8.739   1.00 0.00 ? 240 LYS A HB2  1  
ATOM 923   H HB3  . LYS A 1 62  ? 10.535  1.310   10.261  1.00 0.00 ? 240 LYS A HB3  1  
ATOM 924   H HG2  . LYS A 1 62  ? 11.551  3.195   8.168   1.00 0.00 ? 240 LYS A HG2  1  
ATOM 925   H HG3  . LYS A 1 62  ? 9.917   2.532   8.090   1.00 0.00 ? 240 LYS A HG3  1  
ATOM 926   H HD2  . LYS A 1 62  ? 9.432   3.435   10.303  1.00 0.00 ? 240 LYS A HD2  1  
ATOM 927   H HD3  . LYS A 1 62  ? 11.078  4.063   10.419  1.00 0.00 ? 240 LYS A HD3  1  
ATOM 928   H HE2  . LYS A 1 62  ? 9.172   4.847   8.225   1.00 0.00 ? 240 LYS A HE2  1  
ATOM 929   H HE3  . LYS A 1 62  ? 9.289   5.724   9.750   1.00 0.00 ? 240 LYS A HE3  1  
ATOM 930   H HZ1  . LYS A 1 62  ? 10.752  6.891   8.472   1.00 0.00 ? 240 LYS A HZ1  1  
ATOM 931   H HZ2  . LYS A 1 62  ? 11.222  5.551   7.554   1.00 0.00 ? 240 LYS A HZ2  1  
ATOM 932   H HZ3  . LYS A 1 62  ? 11.813  5.747   9.127   1.00 0.00 ? 240 LYS A HZ3  1  
ATOM 933   N N    . ASN A 1 63  ? 12.629  -0.743  10.486  1.00 0.00 ? 241 ASN A N    1  
ATOM 934   C CA   . ASN A 1 63  ? 12.849  -1.941  11.288  1.00 0.00 ? 241 ASN A CA   1  
ATOM 935   C C    . ASN A 1 63  ? 14.299  -2.406  11.184  1.00 0.00 ? 241 ASN A C    1  
ATOM 936   O O    . ASN A 1 63  ? 14.579  -3.605  11.181  1.00 0.00 ? 241 ASN A O    1  
ATOM 937   C CB   . ASN A 1 63  ? 11.909  -3.061  10.839  1.00 0.00 ? 241 ASN A CB   1  
ATOM 938   C CG   . ASN A 1 63  ? 11.688  -4.099  11.922  1.00 0.00 ? 241 ASN A CG   1  
ATOM 939   O OD1  . ASN A 1 63  ? 12.505  -4.248  12.831  1.00 0.00 ? 241 ASN A OD1  1  
ATOM 940   N ND2  . ASN A 1 63  ? 10.578  -4.823  11.830  1.00 0.00 ? 241 ASN A ND2  1  
ATOM 941   H H    . ASN A 1 63  ? 12.262  -0.835  9.581   1.00 0.00 ? 241 ASN A H    1  
ATOM 942   H HA   . ASN A 1 63  ? 12.635  -1.695  12.317  1.00 0.00 ? 241 ASN A HA   1  
ATOM 943   H HB2  . ASN A 1 63  ? 10.952  -2.636  10.575  1.00 0.00 ? 241 ASN A HB2  1  
ATOM 944   H HB3  . ASN A 1 63  ? 12.331  -3.553  9.975   1.00 0.00 ? 241 ASN A HB3  1  
ATOM 945   H HD21 . ASN A 1 63  ? 9.973   -4.650  11.078  1.00 0.00 ? 241 ASN A HD21 1  
ATOM 946   H HD22 . ASN A 1 63  ? 10.410  -5.501  12.517  1.00 0.00 ? 241 ASN A HD22 1  
ATOM 947   N N    . LYS A 1 64  ? 15.217  -1.449  11.099  1.00 0.00 ? 242 LYS A N    1  
ATOM 948   C CA   . LYS A 1 64  ? 16.638  -1.758  10.997  1.00 0.00 ? 242 LYS A CA   1  
ATOM 949   C C    . LYS A 1 64  ? 16.860  -3.035  10.193  1.00 0.00 ? 242 LYS A C    1  
ATOM 950   O O    . LYS A 1 64  ? 17.789  -3.796  10.462  1.00 0.00 ? 242 LYS A O    1  
ATOM 951   C CB   . LYS A 1 64  ? 17.250  -1.908  12.392  1.00 0.00 ? 242 LYS A CB   1  
ATOM 952   C CG   . LYS A 1 64  ? 17.459  -0.586  13.109  1.00 0.00 ? 242 LYS A CG   1  
ATOM 953   C CD   . LYS A 1 64  ? 17.832  -0.796  14.567  1.00 0.00 ? 242 LYS A CD   1  
ATOM 954   C CE   . LYS A 1 64  ? 19.334  -0.969  14.739  1.00 0.00 ? 242 LYS A CE   1  
ATOM 955   N NZ   . LYS A 1 64  ? 20.040  0.341   14.794  1.00 0.00 ? 242 LYS A NZ   1  
ATOM 956   H H    . LYS A 1 64  ? 14.931  -0.511  11.106  1.00 0.00 ? 242 LYS A H    1  
ATOM 957   H HA   . LYS A 1 64  ? 17.120  -0.938  10.488  1.00 0.00 ? 242 LYS A HA   1  
ATOM 958   H HB2  . LYS A 1 64  ? 16.596  -2.521  12.994  1.00 0.00 ? 242 LYS A HB2  1  
ATOM 959   H HB3  . LYS A 1 64  ? 18.208  -2.400  12.301  1.00 0.00 ? 242 LYS A HB3  1  
ATOM 960   H HG2  . LYS A 1 64  ? 18.254  -0.043  12.620  1.00 0.00 ? 242 LYS A HG2  1  
ATOM 961   H HG3  . LYS A 1 64  ? 16.545  -0.011  13.060  1.00 0.00 ? 242 LYS A HG3  1  
ATOM 962   H HD2  . LYS A 1 64  ? 17.513  0.063   15.139  1.00 0.00 ? 242 LYS A HD2  1  
ATOM 963   H HD3  . LYS A 1 64  ? 17.332  -1.681  14.934  1.00 0.00 ? 242 LYS A HD3  1  
ATOM 964   H HE2  . LYS A 1 64  ? 19.518  -1.506  15.656  1.00 0.00 ? 242 LYS A HE2  1  
ATOM 965   H HE3  . LYS A 1 64  ? 19.715  -1.539  13.905  1.00 0.00 ? 242 LYS A HE3  1  
ATOM 966   H HZ1  . LYS A 1 64  ? 20.998  0.214   15.178  1.00 0.00 ? 242 LYS A HZ1  1  
ATOM 967   H HZ2  . LYS A 1 64  ? 19.520  1.003   15.405  1.00 0.00 ? 242 LYS A HZ2  1  
ATOM 968   H HZ3  . LYS A 1 64  ? 20.111  0.749   13.840  1.00 0.00 ? 242 LYS A HZ3  1  
ATOM 969   N N    . GLY A 1 65  ? 16.003  -3.263  9.203   1.00 0.00 ? 243 GLY A N    1  
ATOM 970   C CA   . GLY A 1 65  ? 16.124  -4.448  8.374   1.00 0.00 ? 243 GLY A CA   1  
ATOM 971   C C    . GLY A 1 65  ? 15.516  -5.675  9.024   1.00 0.00 ? 243 GLY A C    1  
ATOM 972   O O    . GLY A 1 65  ? 16.233  -6.584  9.442   1.00 0.00 ? 243 GLY A O    1  
ATOM 973   H H    . GLY A 1 65  ? 15.281  -2.621  9.034   1.00 0.00 ? 243 GLY A H    1  
ATOM 974   H HA2  . GLY A 1 65  ? 15.627  -4.268  7.433   1.00 0.00 ? 243 GLY A HA2  1  
ATOM 975   H HA3  . GLY A 1 65  ? 17.171  -4.636  8.186   1.00 0.00 ? 243 GLY A HA3  1  
ATOM 976   N N    . ALA A 1 66  ? 14.190  -5.701  9.111   1.00 0.00 ? 244 ALA A N    1  
ATOM 977   C CA   . ALA A 1 66  ? 13.486  -6.825  9.715   1.00 0.00 ? 244 ALA A CA   1  
ATOM 978   C C    . ALA A 1 66  ? 12.126  -7.038  9.059   1.00 0.00 ? 244 ALA A C    1  
ATOM 979   O O    . ALA A 1 66  ? 11.402  -6.081  8.783   1.00 0.00 ? 244 ALA A O    1  
ATOM 980   C CB   . ALA A 1 66  ? 13.324  -6.604  11.212  1.00 0.00 ? 244 ALA A CB   1  
ATOM 981   H H    . ALA A 1 66  ? 13.673  -4.946  8.760   1.00 0.00 ? 244 ALA A H    1  
ATOM 982   H HA   . ALA A 1 66  ? 14.087  -7.712  9.570   1.00 0.00 ? 244 ALA A HA   1  
ATOM 983   H HB1  . ALA A 1 66  ? 12.276  -6.477  11.444  1.00 0.00 ? 244 ALA A HB1  1  
ATOM 984   H HB2  . ALA A 1 66  ? 13.710  -7.459  11.746  1.00 0.00 ? 244 ALA A HB2  1  
ATOM 985   H HB3  . ALA A 1 66  ? 13.868  -5.719  11.506  1.00 0.00 ? 244 ALA A HB3  1  
ATOM 986   N N    . LYS A 1 67  ? 11.785  -8.298  8.811   1.00 0.00 ? 245 LYS A N    1  
ATOM 987   C CA   . LYS A 1 67  ? 10.511  -8.637  8.187   1.00 0.00 ? 245 LYS A CA   1  
ATOM 988   C C    . LYS A 1 67  ? 9.370   -7.840  8.811   1.00 0.00 ? 245 LYS A C    1  
ATOM 989   O O    . LYS A 1 67  ? 9.398   -7.524  10.002  1.00 0.00 ? 245 LYS A O    1  
ATOM 990   C CB   . LYS A 1 67  ? 10.235  -10.136 8.325   1.00 0.00 ? 245 LYS A CB   1  
ATOM 991   C CG   . LYS A 1 67  ? 11.306  -11.011 7.697   1.00 0.00 ? 245 LYS A CG   1  
ATOM 992   C CD   . LYS A 1 67  ? 10.930  -12.482 7.759   1.00 0.00 ? 245 LYS A CD   1  
ATOM 993   C CE   . LYS A 1 67  ? 9.979   -12.863 6.635   1.00 0.00 ? 245 LYS A CE   1  
ATOM 994   N NZ   . LYS A 1 67  ? 9.353   -14.194 6.864   1.00 0.00 ? 245 LYS A NZ   1  
ATOM 995   H H    . LYS A 1 67  ? 12.405  -9.017  9.054   1.00 0.00 ? 245 LYS A H    1  
ATOM 996   H HA   . LYS A 1 67  ? 10.578  -8.387  7.139   1.00 0.00 ? 245 LYS A HA   1  
ATOM 997   H HB2  . LYS A 1 67  ? 10.168  -10.382 9.375   1.00 0.00 ? 245 LYS A HB2  1  
ATOM 998   H HB3  . LYS A 1 67  ? 9.291   -10.361 7.850   1.00 0.00 ? 245 LYS A HB3  1  
ATOM 999   H HG2  . LYS A 1 67  ? 11.430  -10.726 6.663   1.00 0.00 ? 245 LYS A HG2  1  
ATOM 1000  H HG3  . LYS A 1 67  ? 12.236  -10.864 8.227   1.00 0.00 ? 245 LYS A HG3  1  
ATOM 1001  H HD2  . LYS A 1 67  ? 11.827  -13.078 7.674   1.00 0.00 ? 245 LYS A HD2  1  
ATOM 1002  H HD3  . LYS A 1 67  ? 10.451  -12.683 8.707   1.00 0.00 ? 245 LYS A HD3  1  
ATOM 1003  H HE2  . LYS A 1 67  ? 9.202   -12.116 6.569   1.00 0.00 ? 245 LYS A HE2  1  
ATOM 1004  H HE3  . LYS A 1 67  ? 10.532  -12.889 5.707   1.00 0.00 ? 245 LYS A HE3  1  
ATOM 1005  H HZ1  . LYS A 1 67  ? 10.003  -14.807 7.398   1.00 0.00 ? 245 LYS A HZ1  1  
ATOM 1006  H HZ2  . LYS A 1 67  ? 9.137   -14.649 5.954   1.00 0.00 ? 245 LYS A HZ2  1  
ATOM 1007  H HZ3  . LYS A 1 67  ? 8.471   -14.087 7.404   1.00 0.00 ? 245 LYS A HZ3  1  
ATOM 1008  N N    . LEU A 1 68  ? 8.367   -7.518  8.002   1.00 0.00 ? 246 LEU A N    1  
ATOM 1009  C CA   . LEU A 1 68  ? 7.215   -6.759  8.476   1.00 0.00 ? 246 LEU A CA   1  
ATOM 1010  C C    . LEU A 1 68  ? 6.160   -7.686  9.073   1.00 0.00 ? 246 LEU A C    1  
ATOM 1011  O O    . LEU A 1 68  ? 6.373   -8.893  9.191   1.00 0.00 ? 246 LEU A O    1  
ATOM 1012  C CB   . LEU A 1 68  ? 6.608   -5.948  7.330   1.00 0.00 ? 246 LEU A CB   1  
ATOM 1013  C CG   . LEU A 1 68  ? 7.511   -4.881  6.710   1.00 0.00 ? 246 LEU A CG   1  
ATOM 1014  C CD1  . LEU A 1 68  ? 6.918   -4.371  5.406   1.00 0.00 ? 246 LEU A CD1  1  
ATOM 1015  C CD2  . LEU A 1 68  ? 7.727   -3.733  7.685   1.00 0.00 ? 246 LEU A CD2  1  
ATOM 1016  H H    . LEU A 1 68  ? 8.401   -7.798  7.064   1.00 0.00 ? 246 LEU A H    1  
ATOM 1017  H HA   . LEU A 1 68  ? 7.558   -6.082  9.244   1.00 0.00 ? 246 LEU A HA   1  
ATOM 1018  H HB2  . LEU A 1 68  ? 6.327   -6.638  6.549   1.00 0.00 ? 246 LEU A HB2  1  
ATOM 1019  H HB3  . LEU A 1 68  ? 5.723   -5.455  7.707   1.00 0.00 ? 246 LEU A HB3  1  
ATOM 1020  H HG   . LEU A 1 68  ? 8.475   -5.319  6.489   1.00 0.00 ? 246 LEU A HG   1  
ATOM 1021  H HD11 . LEU A 1 68  ? 7.368   -4.895  4.577   1.00 0.00 ? 246 LEU A HD11 1  
ATOM 1022  H HD12 . LEU A 1 68  ? 7.112   -3.313  5.312   1.00 0.00 ? 246 LEU A HD12 1  
ATOM 1023  H HD13 . LEU A 1 68  ? 5.851   -4.543  5.405   1.00 0.00 ? 246 LEU A HD13 1  
ATOM 1024  H HD21 . LEU A 1 68  ? 7.722   -2.798  7.146   1.00 0.00 ? 246 LEU A HD21 1  
ATOM 1025  H HD22 . LEU A 1 68  ? 8.678   -3.857  8.182   1.00 0.00 ? 246 LEU A HD22 1  
ATOM 1026  H HD23 . LEU A 1 68  ? 6.935   -3.730  8.419   1.00 0.00 ? 246 LEU A HD23 1  
ATOM 1027  N N    . LYS A 1 69  ? 5.021   -7.114  9.446   1.00 0.00 ? 247 LYS A N    1  
ATOM 1028  C CA   . LYS A 1 69  ? 3.930   -7.887  10.028  1.00 0.00 ? 247 LYS A CA   1  
ATOM 1029  C C    . LYS A 1 69  ? 2.652   -7.723  9.213   1.00 0.00 ? 247 LYS A C    1  
ATOM 1030  O O    . LYS A 1 69  ? 2.615   -6.966  8.243   1.00 0.00 ? 247 LYS A O    1  
ATOM 1031  C CB   . LYS A 1 69  ? 3.684   -7.453  11.475  1.00 0.00 ? 247 LYS A CB   1  
ATOM 1032  C CG   . LYS A 1 69  ? 4.753   -7.930  12.443  1.00 0.00 ? 247 LYS A CG   1  
ATOM 1033  C CD   . LYS A 1 69  ? 4.410   -9.291  13.025  1.00 0.00 ? 247 LYS A CD   1  
ATOM 1034  C CE   . LYS A 1 69  ? 3.381   -9.178  14.139  1.00 0.00 ? 247 LYS A CE   1  
ATOM 1035  N NZ   . LYS A 1 69  ? 3.013   -10.510 14.693  1.00 0.00 ? 247 LYS A NZ   1  
ATOM 1036  H H    . LYS A 1 69  ? 4.910   -6.146  9.327   1.00 0.00 ? 247 LYS A H    1  
ATOM 1037  H HA   . LYS A 1 69  ? 4.219   -8.927  10.018  1.00 0.00 ? 247 LYS A HA   1  
ATOM 1038  H HB2  . LYS A 1 69  ? 3.649   -6.374  11.513  1.00 0.00 ? 247 LYS A HB2  1  
ATOM 1039  H HB3  . LYS A 1 69  ? 2.732   -7.847  11.799  1.00 0.00 ? 247 LYS A HB3  1  
ATOM 1040  H HG2  . LYS A 1 69  ? 5.695   -8.001  11.919  1.00 0.00 ? 247 LYS A HG2  1  
ATOM 1041  H HG3  . LYS A 1 69  ? 4.840   -7.215  13.249  1.00 0.00 ? 247 LYS A HG3  1  
ATOM 1042  H HD2  . LYS A 1 69  ? 4.009   -9.917  12.242  1.00 0.00 ? 247 LYS A HD2  1  
ATOM 1043  H HD3  . LYS A 1 69  ? 5.310   -9.740  13.423  1.00 0.00 ? 247 LYS A HD3  1  
ATOM 1044  H HE2  . LYS A 1 69  ? 3.791   -8.569  14.930  1.00 0.00 ? 247 LYS A HE2  1  
ATOM 1045  H HE3  . LYS A 1 69  ? 2.494   -8.704  13.744  1.00 0.00 ? 247 LYS A HE3  1  
ATOM 1046  H HZ1  . LYS A 1 69  ? 2.590   -10.400 15.636  1.00 0.00 ? 247 LYS A HZ1  1  
ATOM 1047  H HZ2  . LYS A 1 69  ? 3.860   -11.109 14.773  1.00 0.00 ? 247 LYS A HZ2  1  
ATOM 1048  H HZ3  . LYS A 1 69  ? 2.327   -10.980 14.069  1.00 0.00 ? 247 LYS A HZ3  1  
ATOM 1049  N N    . VAL A 1 70  ? 1.604   -8.438  9.613   1.00 0.00 ? 248 VAL A N    1  
ATOM 1050  C CA   . VAL A 1 70  ? 0.323   -8.369  8.921   1.00 0.00 ? 248 VAL A CA   1  
ATOM 1051  C C    . VAL A 1 70  ? -0.567  -7.284  9.517   1.00 0.00 ? 248 VAL A C    1  
ATOM 1052  O O    . VAL A 1 70  ? -0.512  -7.011  10.716  1.00 0.00 ? 248 VAL A O    1  
ATOM 1053  C CB   . VAL A 1 70  ? -0.420  -9.717  8.980   1.00 0.00 ? 248 VAL A CB   1  
ATOM 1054  C CG1  . VAL A 1 70  ? -1.770  -9.614  8.286   1.00 0.00 ? 248 VAL A CG1  1  
ATOM 1055  C CG2  . VAL A 1 70  ? 0.426   -10.819 8.359   1.00 0.00 ? 248 VAL A CG2  1  
ATOM 1056  H H    . VAL A 1 70  ? 1.696   -9.024  10.393  1.00 0.00 ? 248 VAL A H    1  
ATOM 1057  H HA   . VAL A 1 70  ? 0.516   -8.133  7.884   1.00 0.00 ? 248 VAL A HA   1  
ATOM 1058  H HB   . VAL A 1 70  ? -0.591  -9.965  10.017  1.00 0.00 ? 248 VAL A HB   1  
ATOM 1059  H HG11 . VAL A 1 70  ? -1.626  -9.285  7.268   1.00 0.00 ? 248 VAL A HG11 1  
ATOM 1060  H HG12 . VAL A 1 70  ? -2.251  -10.581 8.289   1.00 0.00 ? 248 VAL A HG12 1  
ATOM 1061  H HG13 . VAL A 1 70  ? -2.390  -8.902  8.810   1.00 0.00 ? 248 VAL A HG13 1  
ATOM 1062  H HG21 . VAL A 1 70  ? -0.078  -11.766 8.475   1.00 0.00 ? 248 VAL A HG21 1  
ATOM 1063  H HG22 . VAL A 1 70  ? 0.570   -10.613 7.308   1.00 0.00 ? 248 VAL A HG22 1  
ATOM 1064  H HG23 . VAL A 1 70  ? 1.385   -10.858 8.852   1.00 0.00 ? 248 VAL A HG23 1  
ATOM 1065  N N    . GLY A 1 71  ? -1.387  -6.668  8.672   1.00 0.00 ? 249 GLY A N    1  
ATOM 1066  C CA   . GLY A 1 71  ? -2.278  -5.620  9.134   1.00 0.00 ? 249 GLY A CA   1  
ATOM 1067  C C    . GLY A 1 71  ? -1.529  -4.406  9.646   1.00 0.00 ? 249 GLY A C    1  
ATOM 1068  O O    . GLY A 1 71  ? -2.130  -3.484  10.197  1.00 0.00 ? 249 GLY A O    1  
ATOM 1069  H H    . GLY A 1 71  ? -1.388  -6.927  7.727   1.00 0.00 ? 249 GLY A H    1  
ATOM 1070  H HA2  . GLY A 1 71  ? -2.916  -5.318  8.317   1.00 0.00 ? 249 GLY A HA2  1  
ATOM 1071  H HA3  . GLY A 1 71  ? -2.893  -6.011  9.931   1.00 0.00 ? 249 GLY A HA3  1  
ATOM 1072  N N    . GLN A 1 72  ? -0.212  -4.406  9.465   1.00 0.00 ? 250 GLN A N    1  
ATOM 1073  C CA   . GLN A 1 72  ? 0.621   -3.296  9.915   1.00 0.00 ? 250 GLN A CA   1  
ATOM 1074  C C    . GLN A 1 72  ? 0.411   -2.067  9.037   1.00 0.00 ? 250 GLN A C    1  
ATOM 1075  O O    . GLN A 1 72  ? 0.141   -2.185  7.841   1.00 0.00 ? 250 GLN A O    1  
ATOM 1076  C CB   . GLN A 1 72  ? 2.096   -3.701  9.904   1.00 0.00 ? 250 GLN A CB   1  
ATOM 1077  C CG   . GLN A 1 72  ? 2.695   -3.776  8.509   1.00 0.00 ? 250 GLN A CG   1  
ATOM 1078  C CD   . GLN A 1 72  ? 4.191   -3.525  8.503   1.00 0.00 ? 250 GLN A CD   1  
ATOM 1079  O OE1  . GLN A 1 72  ? 4.929   -4.085  9.313   1.00 0.00 ? 250 GLN A OE1  1  
ATOM 1080  N NE2  . GLN A 1 72  ? 4.645   -2.681  7.584   1.00 0.00 ? 250 GLN A NE2  1  
ATOM 1081  H H    . GLN A 1 72  ? 0.209   -5.169  9.019   1.00 0.00 ? 250 GLN A H    1  
ATOM 1082  H HA   . GLN A 1 72  ? 0.331   -3.054  10.927  1.00 0.00 ? 250 GLN A HA   1  
ATOM 1083  H HB2  . GLN A 1 72  ? 2.659   -2.979  10.477  1.00 0.00 ? 250 GLN A HB2  1  
ATOM 1084  H HB3  . GLN A 1 72  ? 2.194   -4.672  10.367  1.00 0.00 ? 250 GLN A HB3  1  
ATOM 1085  H HG2  . GLN A 1 72  ? 2.509   -4.759  8.103   1.00 0.00 ? 250 GLN A HG2  1  
ATOM 1086  H HG3  . GLN A 1 72  ? 2.218   -3.034  7.886   1.00 0.00 ? 250 GLN A HG3  1  
ATOM 1087  H HE21 . GLN A 1 72  ? 3.998   -2.271  6.972   1.00 0.00 ? 250 GLN A HE21 1  
ATOM 1088  H HE22 . GLN A 1 72  ? 5.607   -2.500  7.558   1.00 0.00 ? 250 GLN A HE22 1  
ATOM 1089  N N    . TYR A 1 73  ? 0.537   -0.889  9.637   1.00 0.00 ? 251 TYR A N    1  
ATOM 1090  C CA   . TYR A 1 73  ? 0.359   0.362   8.910   1.00 0.00 ? 251 TYR A CA   1  
ATOM 1091  C C    . TYR A 1 73  ? 1.623   0.728   8.138   1.00 0.00 ? 251 TYR A C    1  
ATOM 1092  O O    . TYR A 1 73  ? 2.716   0.784   8.702   1.00 0.00 ? 251 TYR A O    1  
ATOM 1093  C CB   . TYR A 1 73  ? -0.006  1.490   9.876   1.00 0.00 ? 251 TYR A CB   1  
ATOM 1094  C CG   . TYR A 1 73  ? -1.493  1.624   10.117  1.00 0.00 ? 251 TYR A CG   1  
ATOM 1095  C CD1  . TYR A 1 73  ? -2.341  2.076   9.114   1.00 0.00 ? 251 TYR A CD1  1  
ATOM 1096  C CD2  . TYR A 1 73  ? -2.049  1.297   11.348  1.00 0.00 ? 251 TYR A CD2  1  
ATOM 1097  C CE1  . TYR A 1 73  ? -3.700  2.200   9.330   1.00 0.00 ? 251 TYR A CE1  1  
ATOM 1098  C CE2  . TYR A 1 73  ? -3.407  1.417   11.572  1.00 0.00 ? 251 TYR A CE2  1  
ATOM 1099  C CZ   . TYR A 1 73  ? -4.228  1.869   10.561  1.00 0.00 ? 251 TYR A CZ   1  
ATOM 1100  O OH   . TYR A 1 73  ? -5.581  1.990   10.779  1.00 0.00 ? 251 TYR A OH   1  
ATOM 1101  H H    . TYR A 1 73  ? 0.754   -0.860  10.593  1.00 0.00 ? 251 TYR A H    1  
ATOM 1102  H HA   . TYR A 1 73  ? -0.451  0.226   8.209   1.00 0.00 ? 251 TYR A HA   1  
ATOM 1103  H HB2  . TYR A 1 73  ? 0.468   1.307   10.828  1.00 0.00 ? 251 TYR A HB2  1  
ATOM 1104  H HB3  . TYR A 1 73  ? 0.351   2.428   9.476   1.00 0.00 ? 251 TYR A HB3  1  
ATOM 1105  H HD1  . TYR A 1 73  ? -1.924  2.334   8.151   1.00 0.00 ? 251 TYR A HD1  1  
ATOM 1106  H HD2  . TYR A 1 73  ? -1.403  0.942   12.138  1.00 0.00 ? 251 TYR A HD2  1  
ATOM 1107  H HE1  . TYR A 1 73  ? -4.343  2.554   8.538   1.00 0.00 ? 251 TYR A HE1  1  
ATOM 1108  H HE2  . TYR A 1 73  ? -3.821  1.158   12.536  1.00 0.00 ? 251 TYR A HE2  1  
ATOM 1109  H HH   . TYR A 1 73  ? -6.024  1.186   10.499  1.00 0.00 ? 251 TYR A HH   1  
ATOM 1110  N N    . LEU A 1 74  ? 1.465   0.977   6.842   1.00 0.00 ? 252 LEU A N    1  
ATOM 1111  C CA   . LEU A 1 74  ? 2.592   1.339   5.990   1.00 0.00 ? 252 LEU A CA   1  
ATOM 1112  C C    . LEU A 1 74  ? 2.223   2.489   5.058   1.00 0.00 ? 252 LEU A C    1  
ATOM 1113  O O    . LEU A 1 74  ? 1.146   2.498   4.464   1.00 0.00 ? 252 LEU A O    1  
ATOM 1114  C CB   . LEU A 1 74  ? 3.046   0.130   5.171   1.00 0.00 ? 252 LEU A CB   1  
ATOM 1115  C CG   . LEU A 1 74  ? 4.449   0.216   4.568   1.00 0.00 ? 252 LEU A CG   1  
ATOM 1116  C CD1  . LEU A 1 74  ? 5.502   0.225   5.664   1.00 0.00 ? 252 LEU A CD1  1  
ATOM 1117  C CD2  . LEU A 1 74  ? 4.687   -0.939  3.606   1.00 0.00 ? 252 LEU A CD2  1  
ATOM 1118  H H    . LEU A 1 74  ? 0.570   0.917   6.449   1.00 0.00 ? 252 LEU A H    1  
ATOM 1119  H HA   . LEU A 1 74  ? 3.403   1.656   6.629   1.00 0.00 ? 252 LEU A HA   1  
ATOM 1120  H HB2  . LEU A 1 74  ? 3.017   -0.736  5.815   1.00 0.00 ? 252 LEU A HB2  1  
ATOM 1121  H HB3  . LEU A 1 74  ? 2.344   -0.003  4.360   1.00 0.00 ? 252 LEU A HB3  1  
ATOM 1122  H HG   . LEU A 1 74  ? 4.538   1.139   4.012   1.00 0.00 ? 252 LEU A HG   1  
ATOM 1123  H HD11 . LEU A 1 74  ? 6.281   0.927   5.410   1.00 0.00 ? 252 LEU A HD11 1  
ATOM 1124  H HD12 . LEU A 1 74  ? 5.927   -0.763  5.764   1.00 0.00 ? 252 LEU A HD12 1  
ATOM 1125  H HD13 . LEU A 1 74  ? 5.046   0.516   6.599   1.00 0.00 ? 252 LEU A HD13 1  
ATOM 1126  H HD21 . LEU A 1 74  ? 5.472   -1.572  3.992   1.00 0.00 ? 252 LEU A HD21 1  
ATOM 1127  H HD22 . LEU A 1 74  ? 4.982   -0.549  2.642   1.00 0.00 ? 252 LEU A HD22 1  
ATOM 1128  H HD23 . LEU A 1 74  ? 3.779   -1.513  3.500   1.00 0.00 ? 252 LEU A HD23 1  
ATOM 1129  N N    . ASN A 1 75  ? 3.126   3.456   4.934   1.00 0.00 ? 253 ASN A N    1  
ATOM 1130  C CA   . ASN A 1 75  ? 2.896   4.611   4.073   1.00 0.00 ? 253 ASN A CA   1  
ATOM 1131  C C    . ASN A 1 75  ? 3.081   4.239   2.605   1.00 0.00 ? 253 ASN A C    1  
ATOM 1132  O O    . ASN A 1 75  ? 4.050   3.572   2.240   1.00 0.00 ? 253 ASN A O    1  
ATOM 1133  C CB   . ASN A 1 75  ? 3.847   5.749   4.447   1.00 0.00 ? 253 ASN A CB   1  
ATOM 1134  C CG   . ASN A 1 75  ? 3.808   6.073   5.928   1.00 0.00 ? 253 ASN A CG   1  
ATOM 1135  O OD1  . ASN A 1 75  ? 2.919   5.622   6.650   1.00 0.00 ? 253 ASN A OD1  1  
ATOM 1136  N ND2  . ASN A 1 75  ? 4.776   6.858   6.388   1.00 0.00 ? 253 ASN A ND2  1  
ATOM 1137  H H    . ASN A 1 75  ? 3.967   3.393   5.434   1.00 0.00 ? 253 ASN A H    1  
ATOM 1138  H HA   . ASN A 1 75  ? 1.879   4.939   4.224   1.00 0.00 ? 253 ASN A HA   1  
ATOM 1139  H HB2  . ASN A 1 75  ? 4.857   5.467   4.186   1.00 0.00 ? 253 ASN A HB2  1  
ATOM 1140  H HB3  . ASN A 1 75  ? 3.572   6.636   3.896   1.00 0.00 ? 253 ASN A HB3  1  
ATOM 1141  H HD21 . ASN A 1 75  ? 5.451   7.180   5.754   1.00 0.00 ? 253 ASN A HD21 1  
ATOM 1142  H HD22 . ASN A 1 75  ? 4.775   7.082   7.341   1.00 0.00 ? 253 ASN A HD22 1  
ATOM 1143  N N    . CYS A 1 76  ? 2.148   4.677   1.768   1.00 0.00 ? 254 CYS A N    1  
ATOM 1144  C CA   . CYS A 1 76  ? 2.207   4.391   0.339   1.00 0.00 ? 254 CYS A CA   1  
ATOM 1145  C C    . CYS A 1 76  ? 1.497   5.476   -0.463  1.00 0.00 ? 254 CYS A C    1  
ATOM 1146  O O    . CYS A 1 76  ? 0.491   6.031   -0.020  1.00 0.00 ? 254 CYS A O    1  
ATOM 1147  C CB   . CYS A 1 76  ? 1.579   3.028   0.044   1.00 0.00 ? 254 CYS A CB   1  
ATOM 1148  S SG   . CYS A 1 76  ? 2.365   1.650   0.911   1.00 0.00 ? 254 CYS A SG   1  
ATOM 1149  H H    . CYS A 1 76  ? 1.400   5.204   2.118   1.00 0.00 ? 254 CYS A H    1  
ATOM 1150  H HA   . CYS A 1 76  ? 3.247   4.369   0.049   1.00 0.00 ? 254 CYS A HA   1  
ATOM 1151  H HB2  . CYS A 1 76  ? 0.539   3.049   0.335   1.00 0.00 ? 254 CYS A HB2  1  
ATOM 1152  H HB3  . CYS A 1 76  ? 1.645   2.832   -1.016  1.00 0.00 ? 254 CYS A HB3  1  
ATOM 1153  H HG   . CYS A 1 76  ? 1.465   1.108   1.717   1.00 0.00 ? 254 CYS A HG   1  
ATOM 1154  N N    . ILE A 1 77  ? 2.027   5.775   -1.644  1.00 0.00 ? 255 ILE A N    1  
ATOM 1155  C CA   . ILE A 1 77  ? 1.444   6.795   -2.507  1.00 0.00 ? 255 ILE A CA   1  
ATOM 1156  C C    . ILE A 1 77  ? 1.338   6.302   -3.946  1.00 0.00 ? 255 ILE A C    1  
ATOM 1157  O O    . ILE A 1 77  ? 2.249   5.653   -4.460  1.00 0.00 ? 255 ILE A O    1  
ATOM 1158  C CB   . ILE A 1 77  ? 2.270   8.094   -2.481  1.00 0.00 ? 255 ILE A CB   1  
ATOM 1159  C CG1  . ILE A 1 77  ? 2.434   8.591   -1.043  1.00 0.00 ? 255 ILE A CG1  1  
ATOM 1160  C CG2  . ILE A 1 77  ? 1.609   9.160   -3.343  1.00 0.00 ? 255 ILE A CG2  1  
ATOM 1161  C CD1  . ILE A 1 77  ? 3.369   9.773   -0.915  1.00 0.00 ? 255 ILE A CD1  1  
ATOM 1162  H H    . ILE A 1 77  ? 2.830   5.298   -1.942  1.00 0.00 ? 255 ILE A H    1  
ATOM 1163  H HA   . ILE A 1 77  ? 0.452   7.015   -2.139  1.00 0.00 ? 255 ILE A HA   1  
ATOM 1164  H HB   . ILE A 1 77  ? 3.244   7.884   -2.895  1.00 0.00 ? 255 ILE A HB   1  
ATOM 1165  H HG12 . ILE A 1 77  ? 1.471   8.888   -0.659  1.00 0.00 ? 255 ILE A HG12 1  
ATOM 1166  H HG13 . ILE A 1 77  ? 2.828   7.789   -0.436  1.00 0.00 ? 255 ILE A HG13 1  
ATOM 1167  H HG21 . ILE A 1 77  ? 2.235   9.370   -4.198  1.00 0.00 ? 255 ILE A HG21 1  
ATOM 1168  H HG22 . ILE A 1 77  ? 0.648   8.803   -3.681  1.00 0.00 ? 255 ILE A HG22 1  
ATOM 1169  H HG23 . ILE A 1 77  ? 1.476   10.061  -2.764  1.00 0.00 ? 255 ILE A HG23 1  
ATOM 1170  H HD11 . ILE A 1 77  ? 4.147   9.700   -1.661  1.00 0.00 ? 255 ILE A HD11 1  
ATOM 1171  H HD12 . ILE A 1 77  ? 2.815   10.689  -1.059  1.00 0.00 ? 255 ILE A HD12 1  
ATOM 1172  H HD13 . ILE A 1 77  ? 3.815   9.774   0.069   1.00 0.00 ? 255 ILE A HD13 1  
ATOM 1173  N N    . VAL A 1 78  ? 0.220   6.616   -4.593  1.00 0.00 ? 256 VAL A N    1  
ATOM 1174  C CA   . VAL A 1 78  ? -0.004  6.208   -5.975  1.00 0.00 ? 256 VAL A CA   1  
ATOM 1175  C C    . VAL A 1 78  ? 1.009   6.857   -6.911  1.00 0.00 ? 256 VAL A C    1  
ATOM 1176  O O    . VAL A 1 78  ? 1.079   8.081   -7.013  1.00 0.00 ? 256 VAL A O    1  
ATOM 1177  C CB   . VAL A 1 78  ? -1.426  6.572   -6.443  1.00 0.00 ? 256 VAL A CB   1  
ATOM 1178  C CG1  . VAL A 1 78  ? -1.686  6.020   -7.837  1.00 0.00 ? 256 VAL A CG1  1  
ATOM 1179  C CG2  . VAL A 1 78  ? -2.461  6.057   -5.455  1.00 0.00 ? 256 VAL A CG2  1  
ATOM 1180  H H    . VAL A 1 78  ? -0.470  7.136   -4.130  1.00 0.00 ? 256 VAL A H    1  
ATOM 1181  H HA   . VAL A 1 78  ? 0.106   5.135   -6.028  1.00 0.00 ? 256 VAL A HA   1  
ATOM 1182  H HB   . VAL A 1 78  ? -1.504  7.649   -6.486  1.00 0.00 ? 256 VAL A HB   1  
ATOM 1183  H HG11 . VAL A 1 78  ? -1.954  4.976   -7.766  1.00 0.00 ? 256 VAL A HG11 1  
ATOM 1184  H HG12 . VAL A 1 78  ? -2.495  6.570   -8.297  1.00 0.00 ? 256 VAL A HG12 1  
ATOM 1185  H HG13 . VAL A 1 78  ? -0.794  6.123   -8.437  1.00 0.00 ? 256 VAL A HG13 1  
ATOM 1186  H HG21 . VAL A 1 78  ? -1.960  5.553   -4.641  1.00 0.00 ? 256 VAL A HG21 1  
ATOM 1187  H HG22 . VAL A 1 78  ? -3.033  6.887   -5.066  1.00 0.00 ? 256 VAL A HG22 1  
ATOM 1188  H HG23 . VAL A 1 78  ? -3.123  5.366   -5.954  1.00 0.00 ? 256 VAL A HG23 1  
ATOM 1189  N N    . GLU A 1 79  ? 1.792   6.027   -7.593  1.00 0.00 ? 257 GLU A N    1  
ATOM 1190  C CA   . GLU A 1 79  ? 2.803   6.521   -8.521  1.00 0.00 ? 257 GLU A CA   1  
ATOM 1191  C C    . GLU A 1 79  ? 2.371   6.294   -9.967  1.00 0.00 ? 257 GLU A C    1  
ATOM 1192  O O    . GLU A 1 79  ? 2.727   7.061   -10.861 1.00 0.00 ? 257 GLU A O    1  
ATOM 1193  C CB   . GLU A 1 79  ? 4.144   5.831   -8.264  1.00 0.00 ? 257 GLU A CB   1  
ATOM 1194  C CG   . GLU A 1 79  ? 5.015   6.552   -7.249  1.00 0.00 ? 257 GLU A CG   1  
ATOM 1195  C CD   . GLU A 1 79  ? 6.484   6.200   -7.386  1.00 0.00 ? 257 GLU A CD   1  
ATOM 1196  O OE1  . GLU A 1 79  ? 6.786   5.043   -7.744  1.00 0.00 ? 257 GLU A OE1  1  
ATOM 1197  O OE2  . GLU A 1 79  ? 7.330   7.083   -7.135  1.00 0.00 ? 257 GLU A OE2  1  
ATOM 1198  H H    . GLU A 1 79  ? 1.688   5.061   -7.469  1.00 0.00 ? 257 GLU A H    1  
ATOM 1199  H HA   . GLU A 1 79  ? 2.916   7.581   -8.354  1.00 0.00 ? 257 GLU A HA   1  
ATOM 1200  H HB2  . GLU A 1 79  ? 3.957   4.831   -7.901  1.00 0.00 ? 257 GLU A HB2  1  
ATOM 1201  H HB3  . GLU A 1 79  ? 4.688   5.770   -9.195  1.00 0.00 ? 257 GLU A HB3  1  
ATOM 1202  H HG2  . GLU A 1 79  ? 4.901   7.617   -7.389  1.00 0.00 ? 257 GLU A HG2  1  
ATOM 1203  H HG3  . GLU A 1 79  ? 4.686   6.283   -6.256  1.00 0.00 ? 257 GLU A HG3  1  
ATOM 1204  N N    . LYS A 1 80  ? 1.601   5.234   -10.189 1.00 0.00 ? 258 LYS A N    1  
ATOM 1205  C CA   . LYS A 1 80  ? 1.118   4.904   -11.525 1.00 0.00 ? 258 LYS A CA   1  
ATOM 1206  C C    . LYS A 1 80  ? -0.209  4.156   -11.454 1.00 0.00 ? 258 LYS A C    1  
ATOM 1207  O O    . LYS A 1 80  ? -0.475  3.433   -10.494 1.00 0.00 ? 258 LYS A O    1  
ATOM 1208  C CB   . LYS A 1 80  ? 2.154   4.059   -12.269 1.00 0.00 ? 258 LYS A CB   1  
ATOM 1209  C CG   . LYS A 1 80  ? 3.344   4.858   -12.771 1.00 0.00 ? 258 LYS A CG   1  
ATOM 1210  C CD   . LYS A 1 80  ? 4.195   4.046   -13.733 1.00 0.00 ? 258 LYS A CD   1  
ATOM 1211  C CE   . LYS A 1 80  ? 5.612   4.593   -13.821 1.00 0.00 ? 258 LYS A CE   1  
ATOM 1212  N NZ   . LYS A 1 80  ? 5.638   5.981   -14.359 1.00 0.00 ? 258 LYS A NZ   1  
ATOM 1213  H H    . LYS A 1 80  ? 1.350   4.659   -9.435  1.00 0.00 ? 258 LYS A H    1  
ATOM 1214  H HA   . LYS A 1 80  ? 0.968   5.829   -12.061 1.00 0.00 ? 258 LYS A HA   1  
ATOM 1215  H HB2  . LYS A 1 80  ? 2.518   3.289   -11.604 1.00 0.00 ? 258 LYS A HB2  1  
ATOM 1216  H HB3  . LYS A 1 80  ? 1.676   3.592   -13.119 1.00 0.00 ? 258 LYS A HB3  1  
ATOM 1217  H HG2  . LYS A 1 80  ? 2.985   5.739   -13.282 1.00 0.00 ? 258 LYS A HG2  1  
ATOM 1218  H HG3  . LYS A 1 80  ? 3.951   5.151   -11.926 1.00 0.00 ? 258 LYS A HG3  1  
ATOM 1219  H HD2  . LYS A 1 80  ? 4.237   3.024   -13.388 1.00 0.00 ? 258 LYS A HD2  1  
ATOM 1220  H HD3  . LYS A 1 80  ? 3.744   4.078   -14.715 1.00 0.00 ? 258 LYS A HD3  1  
ATOM 1221  H HE2  . LYS A 1 80  ? 6.047   4.591   -12.833 1.00 0.00 ? 258 LYS A HE2  1  
ATOM 1222  H HE3  . LYS A 1 80  ? 6.191   3.953   -14.470 1.00 0.00 ? 258 LYS A HE3  1  
ATOM 1223  H HZ1  . LYS A 1 80  ? 6.357   6.544   -13.861 1.00 0.00 ? 258 LYS A HZ1  1  
ATOM 1224  H HZ2  . LYS A 1 80  ? 4.710   6.432   -14.229 1.00 0.00 ? 258 LYS A HZ2  1  
ATOM 1225  H HZ3  . LYS A 1 80  ? 5.866   5.967   -15.374 1.00 0.00 ? 258 LYS A HZ3  1  
ATOM 1226  N N    . VAL A 1 81  ? -1.038  4.332   -12.478 1.00 0.00 ? 259 VAL A N    1  
ATOM 1227  C CA   . VAL A 1 81  ? -2.336  3.671   -12.533 1.00 0.00 ? 259 VAL A CA   1  
ATOM 1228  C C    . VAL A 1 81  ? -2.463  2.812   -13.786 1.00 0.00 ? 259 VAL A C    1  
ATOM 1229  O O    . VAL A 1 81  ? -2.140  3.253   -14.890 1.00 0.00 ? 259 VAL A O    1  
ATOM 1230  C CB   . VAL A 1 81  ? -3.488  4.694   -12.507 1.00 0.00 ? 259 VAL A CB   1  
ATOM 1231  C CG1  . VAL A 1 81  ? -4.831  3.988   -12.615 1.00 0.00 ? 259 VAL A CG1  1  
ATOM 1232  C CG2  . VAL A 1 81  ? -3.421  5.539   -11.244 1.00 0.00 ? 259 VAL A CG2  1  
ATOM 1233  H H    . VAL A 1 81  ? -0.770  4.921   -13.214 1.00 0.00 ? 259 VAL A H    1  
ATOM 1234  H HA   . VAL A 1 81  ? -2.426  3.037   -11.663 1.00 0.00 ? 259 VAL A HA   1  
ATOM 1235  H HB   . VAL A 1 81  ? -3.381  5.348   -13.359 1.00 0.00 ? 259 VAL A HB   1  
ATOM 1236  H HG11 . VAL A 1 81  ? -4.681  2.919   -12.568 1.00 0.00 ? 259 VAL A HG11 1  
ATOM 1237  H HG12 . VAL A 1 81  ? -5.468  4.299   -11.799 1.00 0.00 ? 259 VAL A HG12 1  
ATOM 1238  H HG13 . VAL A 1 81  ? -5.298  4.244   -13.554 1.00 0.00 ? 259 VAL A HG13 1  
ATOM 1239  H HG21 . VAL A 1 81  ? -4.395  5.956   -11.038 1.00 0.00 ? 259 VAL A HG21 1  
ATOM 1240  H HG22 . VAL A 1 81  ? -3.111  4.922   -10.413 1.00 0.00 ? 259 VAL A HG22 1  
ATOM 1241  H HG23 . VAL A 1 81  ? -2.709  6.339   -11.383 1.00 0.00 ? 259 VAL A HG23 1  
ATOM 1242  N N    . LYS A 1 82  ? -2.935  1.583   -13.609 1.00 0.00 ? 260 LYS A N    1  
ATOM 1243  C CA   . LYS A 1 82  ? -3.107  0.660   -14.725 1.00 0.00 ? 260 LYS A CA   1  
ATOM 1244  C C    . LYS A 1 82  ? -4.443  0.893   -15.422 1.00 0.00 ? 260 LYS A C    1  
ATOM 1245  O O    . LYS A 1 82  ? -5.411  1.329   -14.801 1.00 0.00 ? 260 LYS A O    1  
ATOM 1246  C CB   . LYS A 1 82  ? -3.020  -0.787  -14.235 1.00 0.00 ? 260 LYS A CB   1  
ATOM 1247  C CG   . LYS A 1 82  ? -2.886  -1.802  -15.357 1.00 0.00 ? 260 LYS A CG   1  
ATOM 1248  C CD   . LYS A 1 82  ? -1.473  -1.833  -15.916 1.00 0.00 ? 260 LYS A CD   1  
ATOM 1249  C CE   . LYS A 1 82  ? -1.418  -2.558  -17.251 1.00 0.00 ? 260 LYS A CE   1  
ATOM 1250  N NZ   . LYS A 1 82  ? -1.693  -1.642  -18.392 1.00 0.00 ? 260 LYS A NZ   1  
ATOM 1251  H H    . LYS A 1 82  ? -3.175  1.289   -12.705 1.00 0.00 ? 260 LYS A H    1  
ATOM 1252  H HA   . LYS A 1 82  ? -2.310  0.841   -15.430 1.00 0.00 ? 260 LYS A HA   1  
ATOM 1253  H HB2  . LYS A 1 82  ? -2.162  -0.884  -13.586 1.00 0.00 ? 260 LYS A HB2  1  
ATOM 1254  H HB3  . LYS A 1 82  ? -3.913  -1.018  -13.673 1.00 0.00 ? 260 LYS A HB3  1  
ATOM 1255  H HG2  . LYS A 1 82  ? -3.132  -2.782  -14.975 1.00 0.00 ? 260 LYS A HG2  1  
ATOM 1256  H HG3  . LYS A 1 82  ? -3.572  -1.540  -16.150 1.00 0.00 ? 260 LYS A HG3  1  
ATOM 1257  H HD2  . LYS A 1 82  ? -1.128  -0.819  -16.055 1.00 0.00 ? 260 LYS A HD2  1  
ATOM 1258  H HD3  . LYS A 1 82  ? -0.829  -2.341  -15.213 1.00 0.00 ? 260 LYS A HD3  1  
ATOM 1259  H HE2  . LYS A 1 82  ? -0.435  -2.986  -17.373 1.00 0.00 ? 260 LYS A HE2  1  
ATOM 1260  H HE3  . LYS A 1 82  ? -2.156  -3.347  -17.248 1.00 0.00 ? 260 LYS A HE3  1  
ATOM 1261  H HZ1  . LYS A 1 82  ? -2.596  -1.148  -18.244 1.00 0.00 ? 260 LYS A HZ1  1  
ATOM 1262  H HZ2  . LYS A 1 82  ? -1.747  -2.182  -19.279 1.00 0.00 ? 260 LYS A HZ2  1  
ATOM 1263  H HZ3  . LYS A 1 82  ? -0.934  -0.936  -18.475 1.00 0.00 ? 260 LYS A HZ3  1  
ATOM 1264  N N    . GLY A 1 83  ? -4.489  0.597   -16.718 1.00 0.00 ? 261 GLY A N    1  
ATOM 1265  C CA   . GLY A 1 83  ? -5.712  0.779   -17.477 1.00 0.00 ? 261 GLY A CA   1  
ATOM 1266  C C    . GLY A 1 83  ? -6.858  -0.055  -16.940 1.00 0.00 ? 261 GLY A C    1  
ATOM 1267  O O    . GLY A 1 83  ? -7.832  0.483   -16.414 1.00 0.00 ? 261 GLY A O    1  
ATOM 1268  H H    . GLY A 1 83  ? -3.686  0.252   -17.161 1.00 0.00 ? 261 GLY A H    1  
ATOM 1269  H HA2  . GLY A 1 83  ? -5.992  1.821   -17.444 1.00 0.00 ? 261 GLY A HA2  1  
ATOM 1270  H HA3  . GLY A 1 83  ? -5.530  0.499   -18.505 1.00 0.00 ? 261 GLY A HA3  1  
ATOM 1271  N N    . ASN A 1 84  ? -6.743  -1.372  -17.073 1.00 0.00 ? 262 ASN A N    1  
ATOM 1272  C CA   . ASN A 1 84  ? -7.780  -2.281  -16.598 1.00 0.00 ? 262 ASN A CA   1  
ATOM 1273  C C    . ASN A 1 84  ? -7.548  -2.656  -15.137 1.00 0.00 ? 262 ASN A C    1  
ATOM 1274  O O    . ASN A 1 84  ? -7.720  -3.809  -14.746 1.00 0.00 ? 262 ASN A O    1  
ATOM 1275  C CB   . ASN A 1 84  ? -7.813  -3.545  -17.460 1.00 0.00 ? 262 ASN A CB   1  
ATOM 1276  C CG   . ASN A 1 84  ? -7.826  -3.232  -18.944 1.00 0.00 ? 262 ASN A CG   1  
ATOM 1277  O OD1  . ASN A 1 84  ? -8.684  -2.492  -19.426 1.00 0.00 ? 262 ASN A OD1  1  
ATOM 1278  N ND2  . ASN A 1 84  ? -6.872  -3.796  -19.676 1.00 0.00 ? 262 ASN A ND2  1  
ATOM 1279  H H    . ASN A 1 84  ? -5.943  -1.741  -17.501 1.00 0.00 ? 262 ASN A H    1  
ATOM 1280  H HA   . ASN A 1 84  ? -8.729  -1.774  -16.681 1.00 0.00 ? 262 ASN A HA   1  
ATOM 1281  H HB2  . ASN A 1 84  ? -6.939  -4.143  -17.246 1.00 0.00 ? 262 ASN A HB2  1  
ATOM 1282  H HB3  . ASN A 1 84  ? -8.700  -4.113  -17.223 1.00 0.00 ? 262 ASN A HB3  1  
ATOM 1283  H HD21 . ASN A 1 84  ? -6.223  -4.375  -19.224 1.00 0.00 ? 262 ASN A HD21 1  
ATOM 1284  H HD22 . ASN A 1 84  ? -6.857  -3.610  -20.638 1.00 0.00 ? 262 ASN A HD22 1  
ATOM 1285  N N    . GLY A 1 85  ? -7.155  -1.671  -14.335 1.00 0.00 ? 263 GLY A N    1  
ATOM 1286  C CA   . GLY A 1 85  ? -6.906  -1.916  -12.926 1.00 0.00 ? 263 GLY A CA   1  
ATOM 1287  C C    . GLY A 1 85  ? -6.118  -3.189  -12.690 1.00 0.00 ? 263 GLY A C    1  
ATOM 1288  O O    . GLY A 1 85  ? -6.428  -3.960  -11.783 1.00 0.00 ? 263 GLY A O    1  
ATOM 1289  H H    . GLY A 1 85  ? -7.033  -0.770  -14.702 1.00 0.00 ? 263 GLY A H    1  
ATOM 1290  H HA2  . GLY A 1 85  ? -6.354  -1.082  -12.519 1.00 0.00 ? 263 GLY A HA2  1  
ATOM 1291  H HA3  . GLY A 1 85  ? -7.853  -1.993  -12.413 1.00 0.00 ? 263 GLY A HA3  1  
ATOM 1292  N N    . GLY A 1 86  ? -5.095  -3.411  -13.510 1.00 0.00 ? 264 GLY A N    1  
ATOM 1293  C CA   . GLY A 1 86  ? -4.277  -4.602  -13.371 1.00 0.00 ? 264 GLY A CA   1  
ATOM 1294  C C    . GLY A 1 86  ? -3.390  -4.555  -12.142 1.00 0.00 ? 264 GLY A C    1  
ATOM 1295  O O    . GLY A 1 86  ? -3.641  -5.253  -11.160 1.00 0.00 ? 264 GLY A O    1  
ATOM 1296  H H    . GLY A 1 86  ? -4.894  -2.761  -14.216 1.00 0.00 ? 264 GLY A H    1  
ATOM 1297  H HA2  . GLY A 1 86  ? -4.924  -5.463  -13.303 1.00 0.00 ? 264 GLY A HA2  1  
ATOM 1298  H HA3  . GLY A 1 86  ? -3.653  -4.700  -14.247 1.00 0.00 ? 264 GLY A HA3  1  
ATOM 1299  N N    . VAL A 1 87  ? -2.348  -3.731  -12.197 1.00 0.00 ? 265 VAL A N    1  
ATOM 1300  C CA   . VAL A 1 87  ? -1.421  -3.597  -11.080 1.00 0.00 ? 265 VAL A CA   1  
ATOM 1301  C C    . VAL A 1 87  ? -1.196  -2.131  -10.726 1.00 0.00 ? 265 VAL A C    1  
ATOM 1302  O O    . VAL A 1 87  ? -1.030  -1.287  -11.607 1.00 0.00 ? 265 VAL A O    1  
ATOM 1303  C CB   . VAL A 1 87  ? -0.063  -4.251  -11.397 1.00 0.00 ? 265 VAL A CB   1  
ATOM 1304  C CG1  . VAL A 1 87  ? 0.897   -4.081  -10.229 1.00 0.00 ? 265 VAL A CG1  1  
ATOM 1305  C CG2  . VAL A 1 87  ? -0.247  -5.723  -11.736 1.00 0.00 ? 265 VAL A CG2  1  
ATOM 1306  H H    . VAL A 1 87  ? -2.201  -3.201  -13.007 1.00 0.00 ? 265 VAL A H    1  
ATOM 1307  H HA   . VAL A 1 87  ? -1.850  -4.102  -10.227 1.00 0.00 ? 265 VAL A HA   1  
ATOM 1308  H HB   . VAL A 1 87  ? 0.361   -3.756  -12.258 1.00 0.00 ? 265 VAL A HB   1  
ATOM 1309  H HG11 . VAL A 1 87  ? 1.850   -4.526  -10.479 1.00 0.00 ? 265 VAL A HG11 1  
ATOM 1310  H HG12 . VAL A 1 87  ? 1.032   -3.029  -10.024 1.00 0.00 ? 265 VAL A HG12 1  
ATOM 1311  H HG13 . VAL A 1 87  ? 0.491   -4.570  -9.356  1.00 0.00 ? 265 VAL A HG13 1  
ATOM 1312  H HG21 . VAL A 1 87  ? 0.304   -5.956  -12.635 1.00 0.00 ? 265 VAL A HG21 1  
ATOM 1313  H HG22 . VAL A 1 87  ? 0.120   -6.330  -10.921 1.00 0.00 ? 265 VAL A HG22 1  
ATOM 1314  H HG23 . VAL A 1 87  ? -1.296  -5.928  -11.893 1.00 0.00 ? 265 VAL A HG23 1  
ATOM 1315  N N    . VAL A 1 88  ? -1.191  -1.835  -9.430  1.00 0.00 ? 266 VAL A N    1  
ATOM 1316  C CA   . VAL A 1 88  ? -0.984  -0.471  -8.959  1.00 0.00 ? 266 VAL A CA   1  
ATOM 1317  C C    . VAL A 1 88  ? 0.424   -0.288  -8.404  1.00 0.00 ? 266 VAL A C    1  
ATOM 1318  O O    . VAL A 1 88  ? 0.949   -1.163  -7.715  1.00 0.00 ? 266 VAL A O    1  
ATOM 1319  C CB   . VAL A 1 88  ? -2.006  -0.093  -7.870  1.00 0.00 ? 266 VAL A CB   1  
ATOM 1320  C CG1  . VAL A 1 88  ? -1.843  1.365   -7.467  1.00 0.00 ? 266 VAL A CG1  1  
ATOM 1321  C CG2  . VAL A 1 88  ? -3.423  -0.367  -8.351  1.00 0.00 ? 266 VAL A CG2  1  
ATOM 1322  H H    . VAL A 1 88  ? -1.328  -2.551  -8.776  1.00 0.00 ? 266 VAL A H    1  
ATOM 1323  H HA   . VAL A 1 88  ? -1.120  0.197   -9.797  1.00 0.00 ? 266 VAL A HA   1  
ATOM 1324  H HB   . VAL A 1 88  ? -1.819  -0.706  -7.000  1.00 0.00 ? 266 VAL A HB   1  
ATOM 1325  H HG11 . VAL A 1 88  ? -0.793  1.620   -7.457  1.00 0.00 ? 266 VAL A HG11 1  
ATOM 1326  H HG12 . VAL A 1 88  ? -2.361  1.994   -8.176  1.00 0.00 ? 266 VAL A HG12 1  
ATOM 1327  H HG13 . VAL A 1 88  ? -2.259  1.515   -6.482  1.00 0.00 ? 266 VAL A HG13 1  
ATOM 1328  H HG21 . VAL A 1 88  ? -4.061  0.460   -8.078  1.00 0.00 ? 266 VAL A HG21 1  
ATOM 1329  H HG22 . VAL A 1 88  ? -3.422  -0.482  -9.425  1.00 0.00 ? 266 VAL A HG22 1  
ATOM 1330  H HG23 . VAL A 1 88  ? -3.790  -1.273  -7.892  1.00 0.00 ? 266 VAL A HG23 1  
ATOM 1331  N N    . SER A 1 89  ? 1.031   0.854   -8.708  1.00 0.00 ? 267 SER A N    1  
ATOM 1332  C CA   . SER A 1 89  ? 2.380   1.151   -8.243  1.00 0.00 ? 267 SER A CA   1  
ATOM 1333  C C    . SER A 1 89  ? 2.345   2.055   -7.014  1.00 0.00 ? 267 SER A C    1  
ATOM 1334  O O    . SER A 1 89  ? 1.926   3.211   -7.091  1.00 0.00 ? 267 SER A O    1  
ATOM 1335  C CB   . SER A 1 89  ? 3.192   1.817   -9.356  1.00 0.00 ? 267 SER A CB   1  
ATOM 1336  O OG   . SER A 1 89  ? 4.570   1.509   -9.236  1.00 0.00 ? 267 SER A OG   1  
ATOM 1337  H H    . SER A 1 89  ? 0.560   1.513   -9.261  1.00 0.00 ? 267 SER A H    1  
ATOM 1338  H HA   . SER A 1 89  ? 2.851   0.217   -7.975  1.00 0.00 ? 267 SER A HA   1  
ATOM 1339  H HB2  . SER A 1 89  ? 2.839   1.466   -10.314 1.00 0.00 ? 267 SER A HB2  1  
ATOM 1340  H HB3  . SER A 1 89  ? 3.067   2.888   -9.297  1.00 0.00 ? 267 SER A HB3  1  
ATOM 1341  H HG   . SER A 1 89  ? 4.698   0.564   -9.344  1.00 0.00 ? 267 SER A HG   1  
ATOM 1342  N N    . LEU A 1 90  ? 2.788   1.520   -5.882  1.00 0.00 ? 268 LEU A N    1  
ATOM 1343  C CA   . LEU A 1 90  ? 2.808   2.277   -4.635  1.00 0.00 ? 268 LEU A CA   1  
ATOM 1344  C C    . LEU A 1 90  ? 4.240   2.566   -4.196  1.00 0.00 ? 268 LEU A C    1  
ATOM 1345  O O    . LEU A 1 90  ? 5.152   1.785   -4.466  1.00 0.00 ? 268 LEU A O    1  
ATOM 1346  C CB   . LEU A 1 90  ? 2.071   1.508   -3.537  1.00 0.00 ? 268 LEU A CB   1  
ATOM 1347  C CG   . LEU A 1 90  ? 0.554   1.699   -3.487  1.00 0.00 ? 268 LEU A CG   1  
ATOM 1348  C CD1  . LEU A 1 90  ? -0.065  0.782   -2.443  1.00 0.00 ? 268 LEU A CD1  1  
ATOM 1349  C CD2  . LEU A 1 90  ? 0.208   3.152   -3.195  1.00 0.00 ? 268 LEU A CD2  1  
ATOM 1350  H H    . LEU A 1 90  ? 3.109   0.595   -5.883  1.00 0.00 ? 268 LEU A H    1  
ATOM 1351  H HA   . LEU A 1 90  ? 2.301   3.215   -4.808  1.00 0.00 ? 268 LEU A HA   1  
ATOM 1352  H HB2  . LEU A 1 90  ? 2.267   0.457   -3.680  1.00 0.00 ? 268 LEU A HB2  1  
ATOM 1353  H HB3  . LEU A 1 90  ? 2.476   1.822   -2.585  1.00 0.00 ? 268 LEU A HB3  1  
ATOM 1354  H HG   . LEU A 1 90  ? 0.133   1.440   -4.448  1.00 0.00 ? 268 LEU A HG   1  
ATOM 1355  H HD11 . LEU A 1 90  ? 0.332   -0.215  -2.559  1.00 0.00 ? 268 LEU A HD11 1  
ATOM 1356  H HD12 . LEU A 1 90  ? -1.137  0.760   -2.573  1.00 0.00 ? 268 LEU A HD12 1  
ATOM 1357  H HD13 . LEU A 1 90  ? 0.171   1.151   -1.455  1.00 0.00 ? 268 LEU A HD13 1  
ATOM 1358  H HD21 . LEU A 1 90  ? -0.534  3.194   -2.412  1.00 0.00 ? 268 LEU A HD21 1  
ATOM 1359  H HD22 . LEU A 1 90  ? -0.184  3.614   -4.089  1.00 0.00 ? 268 LEU A HD22 1  
ATOM 1360  H HD23 . LEU A 1 90  ? 1.097   3.676   -2.878  1.00 0.00 ? 268 LEU A HD23 1  
ATOM 1361  N N    . SER A 1 91  ? 4.429   3.691   -3.515  1.00 0.00 ? 269 SER A N    1  
ATOM 1362  C CA   . SER A 1 91  ? 5.750   4.084   -3.039  1.00 0.00 ? 269 SER A CA   1  
ATOM 1363  C C    . SER A 1 91  ? 5.646   4.885   -1.745  1.00 0.00 ? 269 SER A C    1  
ATOM 1364  O O    . SER A 1 91  ? 4.656   5.578   -1.508  1.00 0.00 ? 269 SER A O    1  
ATOM 1365  C CB   . SER A 1 91  ? 6.476   4.907   -4.105  1.00 0.00 ? 269 SER A CB   1  
ATOM 1366  O OG   . SER A 1 91  ? 7.189   4.069   -4.998  1.00 0.00 ? 269 SER A OG   1  
ATOM 1367  H H    . SER A 1 91  ? 3.662   4.273   -3.330  1.00 0.00 ? 269 SER A H    1  
ATOM 1368  H HA   . SER A 1 91  ? 6.314   3.183   -2.846  1.00 0.00 ? 269 SER A HA   1  
ATOM 1369  H HB2  . SER A 1 91  ? 5.754   5.480   -4.667  1.00 0.00 ? 269 SER A HB2  1  
ATOM 1370  H HB3  . SER A 1 91  ? 7.173   5.578   -3.625  1.00 0.00 ? 269 SER A HB3  1  
ATOM 1371  H HG   . SER A 1 91  ? 7.916   3.650   -4.532  1.00 0.00 ? 269 SER A HG   1  
ATOM 1372  N N    . VAL A 1 92  ? 6.675   4.786   -0.910  1.00 0.00 ? 270 VAL A N    1  
ATOM 1373  C CA   . VAL A 1 92  ? 6.701   5.502   0.360   1.00 0.00 ? 270 VAL A CA   1  
ATOM 1374  C C    . VAL A 1 92  ? 7.082   6.964   0.159   1.00 0.00 ? 270 VAL A C    1  
ATOM 1375  O O    . VAL A 1 92  ? 8.179   7.273   -0.307  1.00 0.00 ? 270 VAL A O    1  
ATOM 1376  C CB   . VAL A 1 92  ? 7.691   4.856   1.348   1.00 0.00 ? 270 VAL A CB   1  
ATOM 1377  C CG1  . VAL A 1 92  ? 7.604   5.531   2.709   1.00 0.00 ? 270 VAL A CG1  1  
ATOM 1378  C CG2  . VAL A 1 92  ? 7.426   3.363   1.467   1.00 0.00 ? 270 VAL A CG2  1  
ATOM 1379  H H    . VAL A 1 92  ? 7.436   4.218   -1.154  1.00 0.00 ? 270 VAL A H    1  
ATOM 1380  H HA   . VAL A 1 92  ? 5.712   5.454   0.791   1.00 0.00 ? 270 VAL A HA   1  
ATOM 1381  H HB   . VAL A 1 92  ? 8.691   4.994   0.966   1.00 0.00 ? 270 VAL A HB   1  
ATOM 1382  H HG11 . VAL A 1 92  ? 6.663   6.055   2.791   1.00 0.00 ? 270 VAL A HG11 1  
ATOM 1383  H HG12 . VAL A 1 92  ? 7.671   4.785   3.486   1.00 0.00 ? 270 VAL A HG12 1  
ATOM 1384  H HG13 . VAL A 1 92  ? 8.417   6.235   2.813   1.00 0.00 ? 270 VAL A HG13 1  
ATOM 1385  H HG21 . VAL A 1 92  ? 6.831   3.036   0.628   1.00 0.00 ? 270 VAL A HG21 1  
ATOM 1386  H HG22 . VAL A 1 92  ? 8.366   2.829   1.472   1.00 0.00 ? 270 VAL A HG22 1  
ATOM 1387  H HG23 . VAL A 1 92  ? 6.894   3.163   2.385   1.00 0.00 ? 270 VAL A HG23 1  
ATOM 1388  N N    . GLY A 1 93  ? 6.169   7.863   0.514   1.00 0.00 ? 271 GLY A N    1  
ATOM 1389  C CA   . GLY A 1 93  ? 6.428   9.283   0.365   1.00 0.00 ? 271 GLY A CA   1  
ATOM 1390  C C    . GLY A 1 93  ? 6.224   10.048  1.658   1.00 0.00 ? 271 GLY A C    1  
ATOM 1391  O O    . GLY A 1 93  ? 7.073   10.846  2.056   1.00 0.00 ? 271 GLY A O    1  
ATOM 1392  H H    . GLY A 1 93  ? 5.312   7.559   0.880   1.00 0.00 ? 271 GLY A H    1  
ATOM 1393  H HA2  . GLY A 1 93  ? 7.447   9.419   0.035   1.00 0.00 ? 271 GLY A HA2  1  
ATOM 1394  H HA3  . GLY A 1 93  ? 5.761   9.682   -0.385  1.00 0.00 ? 271 GLY A HA3  1  
ATOM 1395  N N    . HIS A 1 94  ? 5.094   9.806   2.315   1.00 0.00 ? 272 HIS A N    1  
ATOM 1396  C CA   . HIS A 1 94  ? 4.781   10.479  3.571   1.00 0.00 ? 272 HIS A CA   1  
ATOM 1397  C C    . HIS A 1 94  ? 3.521   9.894   4.201   1.00 0.00 ? 272 HIS A C    1  
ATOM 1398  O O    . HIS A 1 94  ? 2.700   9.282   3.518   1.00 0.00 ? 272 HIS A O    1  
ATOM 1399  C CB   . HIS A 1 94  ? 4.599   11.979  3.337   1.00 0.00 ? 272 HIS A CB   1  
ATOM 1400  C CG   . HIS A 1 94  ? 4.433   12.766  4.601   1.00 0.00 ? 272 HIS A CG   1  
ATOM 1401  N ND1  . HIS A 1 94  ? 3.509   13.780  4.741   1.00 0.00 ? 272 HIS A ND1  1  
ATOM 1402  C CD2  . HIS A 1 94  ? 5.080   12.682  5.787   1.00 0.00 ? 272 HIS A CD2  1  
ATOM 1403  C CE1  . HIS A 1 94  ? 3.595   14.286  5.958   1.00 0.00 ? 272 HIS A CE1  1  
ATOM 1404  N NE2  . HIS A 1 94  ? 4.541   13.638  6.613   1.00 0.00 ? 272 HIS A NE2  1  
ATOM 1405  H H    . HIS A 1 94  ? 4.457   9.159   1.948   1.00 0.00 ? 272 HIS A H    1  
ATOM 1406  H HA   . HIS A 1 94  ? 5.610   10.327  4.245   1.00 0.00 ? 272 HIS A HA   1  
ATOM 1407  H HB2  . HIS A 1 94  ? 5.465   12.364  2.819   1.00 0.00 ? 272 HIS A HB2  1  
ATOM 1408  H HB3  . HIS A 1 94  ? 3.721   12.139  2.729   1.00 0.00 ? 272 HIS A HB3  1  
ATOM 1409  H HD1  . HIS A 1 94  ? 2.884   14.083  4.050   1.00 0.00 ? 272 HIS A HD1  1  
ATOM 1410  H HD2  . HIS A 1 94  ? 5.873   11.992  6.038   1.00 0.00 ? 272 HIS A HD2  1  
ATOM 1411  H HE1  . HIS A 1 94  ? 2.995   15.093  6.351   1.00 0.00 ? 272 HIS A HE1  1  
ATOM 1412  H HE2  . HIS A 1 94  ? 4.868   13.869  7.507   1.00 0.00 ? 272 HIS A HE2  1  
ATOM 1413  N N    . SER A 1 95  ? 3.376   10.086  5.509   1.00 0.00 ? 273 SER A N    1  
ATOM 1414  C CA   . SER A 1 95  ? 2.218   9.573   6.232   1.00 0.00 ? 273 SER A CA   1  
ATOM 1415  C C    . SER A 1 95  ? 1.095   10.605  6.262   1.00 0.00 ? 273 SER A C    1  
ATOM 1416  O O    . SER A 1 95  ? 1.251   11.722  5.769   1.00 0.00 ? 273 SER A O    1  
ATOM 1417  C CB   . SER A 1 95  ? 2.612   9.189   7.660   1.00 0.00 ? 273 SER A CB   1  
ATOM 1418  O OG   . SER A 1 95  ? 2.745   10.338  8.479   1.00 0.00 ? 273 SER A OG   1  
ATOM 1419  H H    . SER A 1 95  ? 4.065   10.582  5.998   1.00 0.00 ? 273 SER A H    1  
ATOM 1420  H HA   . SER A 1 95  ? 1.868   8.692   5.715   1.00 0.00 ? 273 SER A HA   1  
ATOM 1421  H HB2  . SER A 1 95  ? 1.852   8.549   8.080   1.00 0.00 ? 273 SER A HB2  1  
ATOM 1422  H HB3  . SER A 1 95  ? 3.556   8.664   7.641   1.00 0.00 ? 273 SER A HB3  1  
ATOM 1423  H HG   . SER A 1 95  ? 3.598   10.321  8.919   1.00 0.00 ? 273 SER A HG   1  
ATOM 1424  N N    . GLU A 1 96  ? -0.037  10.222  6.845   1.00 0.00 ? 274 GLU A N    1  
ATOM 1425  C CA   . GLU A 1 96  ? -1.187  11.114  6.938   1.00 0.00 ? 274 GLU A CA   1  
ATOM 1426  C C    . GLU A 1 96  ? -2.102  10.702  8.088   1.00 0.00 ? 274 GLU A C    1  
ATOM 1427  O O    . GLU A 1 96  ? -2.286  9.515   8.356   1.00 0.00 ? 274 GLU A O    1  
ATOM 1428  C CB   . GLU A 1 96  ? -1.969  11.113  5.623   1.00 0.00 ? 274 GLU A CB   1  
ATOM 1429  C CG   . GLU A 1 96  ? -3.285  11.870  5.697   1.00 0.00 ? 274 GLU A CG   1  
ATOM 1430  C CD   . GLU A 1 96  ? -3.707  12.438  4.356   1.00 0.00 ? 274 GLU A CD   1  
ATOM 1431  O OE1  . GLU A 1 96  ? -3.500  11.757  3.331   1.00 0.00 ? 274 GLU A OE1  1  
ATOM 1432  O OE2  . GLU A 1 96  ? -4.244  13.565  4.333   1.00 0.00 ? 274 GLU A OE2  1  
ATOM 1433  H H    . GLU A 1 96  ? -0.100  9.319   7.219   1.00 0.00 ? 274 GLU A H    1  
ATOM 1434  H HA   . GLU A 1 96  ? -0.819  12.111  7.126   1.00 0.00 ? 274 GLU A HA   1  
ATOM 1435  H HB2  . GLU A 1 96  ? -1.360  11.565  4.855   1.00 0.00 ? 274 GLU A HB2  1  
ATOM 1436  H HB3  . GLU A 1 96  ? -2.182  10.091  5.346   1.00 0.00 ? 274 GLU A HB3  1  
ATOM 1437  H HG2  . GLU A 1 96  ? -4.054  11.196  6.044   1.00 0.00 ? 274 GLU A HG2  1  
ATOM 1438  H HG3  . GLU A 1 96  ? -3.178  12.684  6.399   1.00 0.00 ? 274 GLU A HG3  1  
ATOM 1439  N N    . VAL A 1 97  ? -2.674  11.693  8.765   1.00 0.00 ? 275 VAL A N    1  
ATOM 1440  C CA   . VAL A 1 97  ? -3.570  11.436  9.886   1.00 0.00 ? 275 VAL A CA   1  
ATOM 1441  C C    . VAL A 1 97  ? -4.669  10.453  9.496   1.00 0.00 ? 275 VAL A C    1  
ATOM 1442  O O    . VAL A 1 97  ? -4.975  9.521   10.239  1.00 0.00 ? 275 VAL A O    1  
ATOM 1443  C CB   . VAL A 1 97  ? -4.218  12.736  10.397  1.00 0.00 ? 275 VAL A CB   1  
ATOM 1444  C CG1  . VAL A 1 97  ? -5.227  12.435  11.494  1.00 0.00 ? 275 VAL A CG1  1  
ATOM 1445  C CG2  . VAL A 1 97  ? -3.152  13.703  10.892  1.00 0.00 ? 275 VAL A CG2  1  
ATOM 1446  H H    . VAL A 1 97  ? -2.489  12.619  8.504   1.00 0.00 ? 275 VAL A H    1  
ATOM 1447  H HA   . VAL A 1 97  ? -2.987  11.009  10.689  1.00 0.00 ? 275 VAL A HA   1  
ATOM 1448  H HB   . VAL A 1 97  ? -4.741  13.201  9.575   1.00 0.00 ? 275 VAL A HB   1  
ATOM 1449  H HG11 . VAL A 1 97  ? -5.021  13.058  12.353  1.00 0.00 ? 275 VAL A HG11 1  
ATOM 1450  H HG12 . VAL A 1 97  ? -6.224  12.637  11.132  1.00 0.00 ? 275 VAL A HG12 1  
ATOM 1451  H HG13 . VAL A 1 97  ? -5.150  11.396  11.778  1.00 0.00 ? 275 VAL A HG13 1  
ATOM 1452  H HG21 . VAL A 1 97  ? -3.112  13.672  11.970  1.00 0.00 ? 275 VAL A HG21 1  
ATOM 1453  H HG22 . VAL A 1 97  ? -2.191  13.417  10.488  1.00 0.00 ? 275 VAL A HG22 1  
ATOM 1454  H HG23 . VAL A 1 97  ? -3.395  14.704  10.568  1.00 0.00 ? 275 VAL A HG23 1  
ATOM 1455  N N    . SER A 1 98  ? -5.260  10.669  8.324   1.00 0.00 ? 276 SER A N    1  
ATOM 1456  C CA   . SER A 1 98  ? -6.327  9.804   7.836   1.00 0.00 ? 276 SER A CA   1  
ATOM 1457  C C    . SER A 1 98  ? -5.876  8.347   7.809   1.00 0.00 ? 276 SER A C    1  
ATOM 1458  O O    . SER A 1 98  ? -5.009  7.967   7.021   1.00 0.00 ? 276 SER A O    1  
ATOM 1459  C CB   . SER A 1 98  ? -6.767  10.240  6.438   1.00 0.00 ? 276 SER A CB   1  
ATOM 1460  O OG   . SER A 1 98  ? -7.713  9.336   5.895   1.00 0.00 ? 276 SER A OG   1  
ATOM 1461  H H    . SER A 1 98  ? -4.971  11.429  7.777   1.00 0.00 ? 276 SER A H    1  
ATOM 1462  H HA   . SER A 1 98  ? -7.164  9.897   8.513   1.00 0.00 ? 276 SER A HA   1  
ATOM 1463  H HB2  . SER A 1 98  ? -7.215  11.221  6.493   1.00 0.00 ? 276 SER A HB2  1  
ATOM 1464  H HB3  . SER A 1 98  ? -5.905  10.275  5.787   1.00 0.00 ? 276 SER A HB3  1  
ATOM 1465  H HG   . SER A 1 98  ? -8.492  9.313   6.455   1.00 0.00 ? 276 SER A HG   1  
ATOM 1466  N N    . THR A 1 99  ? -6.473  7.532   8.674   1.00 0.00 ? 277 THR A N    1  
ATOM 1467  C CA   . THR A 1 99  ? -6.133  6.117   8.751   1.00 0.00 ? 277 THR A CA   1  
ATOM 1468  C C    . THR A 1 99  ? -7.300  5.300   9.293   1.00 0.00 ? 277 THR A C    1  
ATOM 1469  O O    . THR A 1 99  ? -7.935  5.683   10.276  1.00 0.00 ? 277 THR A O    1  
ATOM 1470  C CB   . THR A 1 99  ? -4.899  5.883   9.643   1.00 0.00 ? 277 THR A CB   1  
ATOM 1471  O OG1  . THR A 1 99  ? -5.121  6.443   10.942  1.00 0.00 ? 277 THR A OG1  1  
ATOM 1472  C CG2  . THR A 1 99  ? -3.657  6.505   9.023   1.00 0.00 ? 277 THR A CG2  1  
ATOM 1473  H H    . THR A 1 99  ? -7.157  7.894   9.276   1.00 0.00 ? 277 THR A H    1  
ATOM 1474  H HA   . THR A 1 99  ? -5.899  5.776   7.753   1.00 0.00 ? 277 THR A HA   1  
ATOM 1475  H HB   . THR A 1 99  ? -4.741  4.819   9.740   1.00 0.00 ? 277 THR A HB   1  
ATOM 1476  H HG1  . THR A 1 99  ? -5.702  7.204   10.868  1.00 0.00 ? 277 THR A HG1  1  
ATOM 1477  H HG21 . THR A 1 99  ? -2.777  6.118   9.514   1.00 0.00 ? 277 THR A HG21 1  
ATOM 1478  H HG22 . THR A 1 99  ? -3.693  7.578   9.142   1.00 0.00 ? 277 THR A HG22 1  
ATOM 1479  H HG23 . THR A 1 99  ? -3.619  6.261   7.972   1.00 0.00 ? 277 THR A HG23 1  
ATOM 1480  N N    . ALA A 1 100 ? -7.578  4.173   8.647   1.00 0.00 ? 278 ALA A N    1  
ATOM 1481  C CA   . ALA A 1 100 ? -8.667  3.300   9.066   1.00 0.00 ? 278 ALA A CA   1  
ATOM 1482  C C    . ALA A 1 100 ? -8.191  1.859   9.213   1.00 0.00 ? 278 ALA A C    1  
ATOM 1483  O O    . ALA A 1 100 ? -7.413  1.367   8.395   1.00 0.00 ? 278 ALA A O    1  
ATOM 1484  C CB   . ALA A 1 100 ? -9.819  3.379   8.074   1.00 0.00 ? 278 ALA A CB   1  
ATOM 1485  H H    . ALA A 1 100 ? -7.036  3.921   7.870   1.00 0.00 ? 278 ALA A H    1  
ATOM 1486  H HA   . ALA A 1 100 ? -9.025  3.650   10.024  1.00 0.00 ? 278 ALA A HA   1  
ATOM 1487  H HB1  . ALA A 1 100 ? -9.437  3.658   7.103   1.00 0.00 ? 278 ALA A HB1  1  
ATOM 1488  H HB2  . ALA A 1 100 ? -10.304 2.417   8.008   1.00 0.00 ? 278 ALA A HB2  1  
ATOM 1489  H HB3  . ALA A 1 100 ? -10.530 4.120   8.408   1.00 0.00 ? 278 ALA A HB3  1  
ATOM 1490  N N    . ILE A 1 101 ? -8.663  1.188   10.258  1.00 0.00 ? 279 ILE A N    1  
ATOM 1491  C CA   . ILE A 1 101 ? -8.285  -0.197  10.510  1.00 0.00 ? 279 ILE A CA   1  
ATOM 1492  C C    . ILE A 1 101 ? -9.213  -1.161  9.781   1.00 0.00 ? 279 ILE A C    1  
ATOM 1493  O O    . ILE A 1 101 ? -10.392 -0.871  9.578   1.00 0.00 ? 279 ILE A O    1  
ATOM 1494  C CB   . ILE A 1 101 ? -8.307  -0.521  12.016  1.00 0.00 ? 279 ILE A CB   1  
ATOM 1495  C CG1  . ILE A 1 101 ? -7.419  0.461   12.784  1.00 0.00 ? 279 ILE A CG1  1  
ATOM 1496  C CG2  . ILE A 1 101 ? -7.854  -1.953  12.256  1.00 0.00 ? 279 ILE A CG2  1  
ATOM 1497  C CD1  . ILE A 1 101 ? -7.769  0.570   14.252  1.00 0.00 ? 279 ILE A CD1  1  
ATOM 1498  H H    . ILE A 1 101 ? -9.280  1.635   10.874  1.00 0.00 ? 279 ILE A H    1  
ATOM 1499  H HA   . ILE A 1 101 ? -7.278  -0.339  10.147  1.00 0.00 ? 279 ILE A HA   1  
ATOM 1500  H HB   . ILE A 1 101 ? -9.323  -0.427  12.367  1.00 0.00 ? 279 ILE A HB   1  
ATOM 1501  H HG12 . ILE A 1 101 ? -6.392  0.140   12.711  1.00 0.00 ? 279 ILE A HG12 1  
ATOM 1502  H HG13 . ILE A 1 101 ? -7.518  1.443   12.345  1.00 0.00 ? 279 ILE A HG13 1  
ATOM 1503  H HG21 . ILE A 1 101 ? -6.865  -2.092  11.843  1.00 0.00 ? 279 ILE A HG21 1  
ATOM 1504  H HG22 . ILE A 1 101 ? -7.830  -2.150  13.317  1.00 0.00 ? 279 ILE A HG22 1  
ATOM 1505  H HG23 . ILE A 1 101 ? -8.542  -2.634  11.779  1.00 0.00 ? 279 ILE A HG23 1  
ATOM 1506  H HD11 . ILE A 1 101 ? -7.163  -0.121  14.819  1.00 0.00 ? 279 ILE A HD11 1  
ATOM 1507  H HD12 . ILE A 1 101 ? -7.583  1.577   14.593  1.00 0.00 ? 279 ILE A HD12 1  
ATOM 1508  H HD13 . ILE A 1 101 ? -8.813  0.329   14.392  1.00 0.00 ? 279 ILE A HD13 1  
ATOM 1509  N N    . ALA A 1 102 ? -8.674  -2.312  9.390   1.00 0.00 ? 280 ALA A N    1  
ATOM 1510  C CA   . ALA A 1 102 ? -9.455  -3.321  8.686   1.00 0.00 ? 280 ALA A CA   1  
ATOM 1511  C C    . ALA A 1 102 ? -9.384  -4.667  9.401   1.00 0.00 ? 280 ALA A C    1  
ATOM 1512  O O    . ALA A 1 102 ? -8.570  -5.524  9.055   1.00 0.00 ? 280 ALA A O    1  
ATOM 1513  C CB   . ALA A 1 102 ? -8.969  -3.458  7.251   1.00 0.00 ? 280 ALA A CB   1  
ATOM 1514  H H    . ALA A 1 102 ? -7.729  -2.485  9.581   1.00 0.00 ? 280 ALA A H    1  
ATOM 1515  H HA   . ALA A 1 102 ? -10.483 -2.991  8.662   1.00 0.00 ? 280 ALA A HA   1  
ATOM 1516  H HB1  . ALA A 1 102 ? -9.552  -2.811  6.611   1.00 0.00 ? 280 ALA A HB1  1  
ATOM 1517  H HB2  . ALA A 1 102 ? -7.928  -3.177  7.195   1.00 0.00 ? 280 ALA A HB2  1  
ATOM 1518  H HB3  . ALA A 1 102 ? -9.084  -4.482  6.928   1.00 0.00 ? 280 ALA A HB3  1  
ATOM 1519  N N    . THR A 1 103 ? -10.241 -4.846  10.401  1.00 0.00 ? 281 THR A N    1  
ATOM 1520  C CA   . THR A 1 103 ? -10.275 -6.086  11.166  1.00 0.00 ? 281 THR A CA   1  
ATOM 1521  C C    . THR A 1 103 ? -11.707 -6.487  11.500  1.00 0.00 ? 281 THR A C    1  
ATOM 1522  O O    . THR A 1 103 ? -12.508 -5.660  11.932  1.00 0.00 ? 281 THR A O    1  
ATOM 1523  C CB   . THR A 1 103 ? -9.470  -5.961  12.473  1.00 0.00 ? 281 THR A CB   1  
ATOM 1524  O OG1  . THR A 1 103 ? -8.072  -5.864  12.181  1.00 0.00 ? 281 THR A OG1  1  
ATOM 1525  C CG2  . THR A 1 103 ? -9.721  -7.157  13.379  1.00 0.00 ? 281 THR A CG2  1  
ATOM 1526  H H    . THR A 1 103 ? -10.865 -4.126  10.629  1.00 0.00 ? 281 THR A H    1  
ATOM 1527  H HA   . THR A 1 103 ? -9.825  -6.862  10.563  1.00 0.00 ? 281 THR A HA   1  
ATOM 1528  H HB   . THR A 1 103 ? -9.786  -5.066  12.989  1.00 0.00 ? 281 THR A HB   1  
ATOM 1529  H HG1  . THR A 1 103 ? -7.847  -4.949  11.995  1.00 0.00 ? 281 THR A HG1  1  
ATOM 1530  H HG21 . THR A 1 103 ? -10.732 -7.116  13.759  1.00 0.00 ? 281 THR A HG21 1  
ATOM 1531  H HG22 . THR A 1 103 ? -9.025  -7.136  14.205  1.00 0.00 ? 281 THR A HG22 1  
ATOM 1532  H HG23 . THR A 1 103 ? -9.586  -8.069  12.817  1.00 0.00 ? 281 THR A HG23 1  
ATOM 1533  N N    . GLU A 1 104 ? -12.022 -7.763  11.297  1.00 0.00 ? 282 GLU A N    1  
ATOM 1534  C CA   . GLU A 1 104 ? -13.359 -8.273  11.577  1.00 0.00 ? 282 GLU A CA   1  
ATOM 1535  C C    . GLU A 1 104 ? -13.407 -8.953  12.943  1.00 0.00 ? 282 GLU A C    1  
ATOM 1536  O O    . GLU A 1 104 ? -14.460 -9.023  13.575  1.00 0.00 ? 282 GLU A O    1  
ATOM 1537  C CB   . GLU A 1 104 ? -13.792 -9.258  10.489  1.00 0.00 ? 282 GLU A CB   1  
ATOM 1538  C CG   . GLU A 1 104 ? -15.209 -9.777  10.667  1.00 0.00 ? 282 GLU A CG   1  
ATOM 1539  C CD   . GLU A 1 104 ? -15.826 -10.246 9.364   1.00 0.00 ? 282 GLU A CD   1  
ATOM 1540  O OE1  . GLU A 1 104 ? -15.566 -11.401 8.965   1.00 0.00 ? 282 GLU A OE1  1  
ATOM 1541  O OE2  . GLU A 1 104 ? -16.569 -9.458  8.743   1.00 0.00 ? 282 GLU A OE2  1  
ATOM 1542  H H    . GLU A 1 104 ? -11.339 -8.375  10.950  1.00 0.00 ? 282 GLU A H    1  
ATOM 1543  H HA   . GLU A 1 104 ? -14.039 -7.435  11.582  1.00 0.00 ? 282 GLU A HA   1  
ATOM 1544  H HB2  . GLU A 1 104 ? -13.727 -8.767  9.530   1.00 0.00 ? 282 GLU A HB2  1  
ATOM 1545  H HB3  . GLU A 1 104 ? -13.118 -10.102 10.497  1.00 0.00 ? 282 GLU A HB3  1  
ATOM 1546  H HG2  . GLU A 1 104 ? -15.191 -10.607 11.358  1.00 0.00 ? 282 GLU A HG2  1  
ATOM 1547  H HG3  . GLU A 1 104 ? -15.820 -8.985  11.074  1.00 0.00 ? 282 GLU A HG3  1  
ATOM 1548  N N    . GLN A 1 105 ? -12.259 -9.452  13.389  1.00 0.00 ? 283 GLN A N    1  
ATOM 1549  C CA   . GLN A 1 105 ? -12.170 -10.128 14.678  1.00 0.00 ? 283 GLN A CA   1  
ATOM 1550  C C    . GLN A 1 105 ? -10.785 -9.949  15.292  1.00 0.00 ? 283 GLN A C    1  
ATOM 1551  O O    . GLN A 1 105 ? -9.877  -9.418  14.653  1.00 0.00 ? 283 GLN A O    1  
ATOM 1552  C CB   . GLN A 1 105 ? -12.482 -11.617 14.520  1.00 0.00 ? 283 GLN A CB   1  
ATOM 1553  C CG   . GLN A 1 105 ? -11.475 -12.362 13.659  1.00 0.00 ? 283 GLN A CG   1  
ATOM 1554  C CD   . GLN A 1 105 ? -11.636 -12.062 12.181  1.00 0.00 ? 283 GLN A CD   1  
ATOM 1555  O OE1  . GLN A 1 105 ? -12.687 -12.320 11.594  1.00 0.00 ? 283 GLN A OE1  1  
ATOM 1556  N NE2  . GLN A 1 105 ? -10.592 -11.513 11.572  1.00 0.00 ? 283 GLN A NE2  1  
ATOM 1557  H H    . GLN A 1 105 ? -11.453 -9.365  12.838  1.00 0.00 ? 283 GLN A H    1  
ATOM 1558  H HA   . GLN A 1 105 ? -12.901 -9.684  15.336  1.00 0.00 ? 283 GLN A HA   1  
ATOM 1559  H HB2  . GLN A 1 105 ? -12.497 -12.075 15.497  1.00 0.00 ? 283 GLN A HB2  1  
ATOM 1560  H HB3  . GLN A 1 105 ? -13.457 -11.722 14.067  1.00 0.00 ? 283 GLN A HB3  1  
ATOM 1561  H HG2  . GLN A 1 105 ? -10.479 -12.075 13.962  1.00 0.00 ? 283 GLN A HG2  1  
ATOM 1562  H HG3  . GLN A 1 105 ? -11.605 -13.423 13.812  1.00 0.00 ? 283 GLN A HG3  1  
ATOM 1563  H HE21 . GLN A 1 105 ? -9.786  -11.337 12.103  1.00 0.00 ? 283 GLN A HE21 1  
ATOM 1564  H HE22 . GLN A 1 105 ? -10.667 -11.310 10.617  1.00 0.00 ? 283 GLN A HE22 1  
ATOM 1565  N N    . GLN A 1 106 ? -10.632 -10.396 16.534  1.00 0.00 ? 284 GLN A N    1  
ATOM 1566  C CA   . GLN A 1 106 ? -9.358  -10.284 17.234  1.00 0.00 ? 284 GLN A CA   1  
ATOM 1567  C C    . GLN A 1 106 ? -8.592  -11.602 17.186  1.00 0.00 ? 284 GLN A C    1  
ATOM 1568  O O    . GLN A 1 106 ? -9.000  -12.590 17.797  1.00 0.00 ? 284 GLN A O    1  
ATOM 1569  C CB   . GLN A 1 106 ? -9.585  -9.865  18.687  1.00 0.00 ? 284 GLN A CB   1  
ATOM 1570  C CG   . GLN A 1 106 ? -10.348 -10.894 19.505  1.00 0.00 ? 284 GLN A CG   1  
ATOM 1571  C CD   . GLN A 1 106 ? -10.858 -10.335 20.819  1.00 0.00 ? 284 GLN A CD   1  
ATOM 1572  O OE1  . GLN A 1 106 ? -10.667 -9.156  21.121  1.00 0.00 ? 284 GLN A OE1  1  
ATOM 1573  N NE2  . GLN A 1 106 ? -11.511 -11.179 21.608  1.00 0.00 ? 284 GLN A NE2  1  
ATOM 1574  H H    . GLN A 1 106 ? -11.393 -10.810 16.991  1.00 0.00 ? 284 GLN A H    1  
ATOM 1575  H HA   . GLN A 1 106 ? -8.773  -9.524  16.738  1.00 0.00 ? 284 GLN A HA   1  
ATOM 1576  H HB2  . GLN A 1 106 ? -8.626  -9.702  19.157  1.00 0.00 ? 284 GLN A HB2  1  
ATOM 1577  H HB3  . GLN A 1 106 ? -10.144 -8.941  18.700  1.00 0.00 ? 284 GLN A HB3  1  
ATOM 1578  H HG2  . GLN A 1 106 ? -11.193 -11.240 18.927  1.00 0.00 ? 284 GLN A HG2  1  
ATOM 1579  H HG3  . GLN A 1 106 ? -9.692  -11.726 19.715  1.00 0.00 ? 284 GLN A HG3  1  
ATOM 1580  H HE21 . GLN A 1 106 ? -11.625 -12.104 21.303  1.00 0.00 ? 284 GLN A HE21 1  
ATOM 1581  H HE22 . GLN A 1 106 ? -11.851 -10.845 22.463  1.00 0.00 ? 284 GLN A HE22 1  
ATOM 1582  N N    . SER A 1 107 ? -7.482  -11.610 16.456  1.00 0.00 ? 285 SER A N    1  
ATOM 1583  C CA   . SER A 1 107 ? -6.661  -12.809 16.325  1.00 0.00 ? 285 SER A CA   1  
ATOM 1584  C C    . SER A 1 107 ? -5.287  -12.467 15.757  1.00 0.00 ? 285 SER A C    1  
ATOM 1585  O O    . SER A 1 107 ? -5.178  -11.802 14.727  1.00 0.00 ? 285 SER A O    1  
ATOM 1586  C CB   . SER A 1 107 ? -7.358  -13.833 15.427  1.00 0.00 ? 285 SER A CB   1  
ATOM 1587  O OG   . SER A 1 107 ? -8.647  -14.152 15.921  1.00 0.00 ? 285 SER A OG   1  
ATOM 1588  H H    . SER A 1 107 ? -7.209  -10.791 15.993  1.00 0.00 ? 285 SER A H    1  
ATOM 1589  H HA   . SER A 1 107 ? -6.535  -13.233 17.310  1.00 0.00 ? 285 SER A HA   1  
ATOM 1590  H HB2  . SER A 1 107 ? -7.457  -13.427 14.432  1.00 0.00 ? 285 SER A HB2  1  
ATOM 1591  H HB3  . SER A 1 107 ? -6.766  -14.736 15.390  1.00 0.00 ? 285 SER A HB3  1  
ATOM 1592  H HG   . SER A 1 107 ? -9.309  -13.663 15.427  1.00 0.00 ? 285 SER A HG   1  
ATOM 1593  N N    . TRP A 1 108 ? -4.243  -12.927 16.436  1.00 0.00 ? 286 TRP A N    1  
ATOM 1594  C CA   . TRP A 1 108 ? -2.875  -12.671 15.999  1.00 0.00 ? 286 TRP A CA   1  
ATOM 1595  C C    . TRP A 1 108 ? -1.952  -13.817 16.400  1.00 0.00 ? 286 TRP A C    1  
ATOM 1596  O O    . TRP A 1 108 ? -2.181  -14.487 17.405  1.00 0.00 ? 286 TRP A O    1  
ATOM 1597  C CB   . TRP A 1 108 ? -2.365  -11.357 16.594  1.00 0.00 ? 286 TRP A CB   1  
ATOM 1598  C CG   . TRP A 1 108 ? -2.406  -11.329 18.092  1.00 0.00 ? 286 TRP A CG   1  
ATOM 1599  C CD1  . TRP A 1 108 ? -1.449  -11.796 18.947  1.00 0.00 ? 286 TRP A CD1  1  
ATOM 1600  C CD2  . TRP A 1 108 ? -3.458  -10.807 18.911  1.00 0.00 ? 286 TRP A CD2  1  
ATOM 1601  N NE1  . TRP A 1 108 ? -1.843  -11.596 20.248  1.00 0.00 ? 286 TRP A NE1  1  
ATOM 1602  C CE2  . TRP A 1 108 ? -3.071  -10.990 20.253  1.00 0.00 ? 286 TRP A CE2  1  
ATOM 1603  C CE3  . TRP A 1 108 ? -4.688  -10.201 18.642  1.00 0.00 ? 286 TRP A CE3  1  
ATOM 1604  C CZ2  . TRP A 1 108 ? -3.872  -10.590 21.320  1.00 0.00 ? 286 TRP A CZ2  1  
ATOM 1605  C CZ3  . TRP A 1 108 ? -5.482  -9.805  19.701  1.00 0.00 ? 286 TRP A CZ3  1  
ATOM 1606  C CH2  . TRP A 1 108 ? -5.071  -10.000 21.027  1.00 0.00 ? 286 TRP A CH2  1  
ATOM 1607  H H    . TRP A 1 108 ? -4.394  -13.451 17.250  1.00 0.00 ? 286 TRP A H    1  
ATOM 1608  H HA   . TRP A 1 108 ? -2.882  -12.589 14.922  1.00 0.00 ? 286 TRP A HA   1  
ATOM 1609  H HB2  . TRP A 1 108 ? -1.342  -11.202 16.286  1.00 0.00 ? 286 TRP A HB2  1  
ATOM 1610  H HB3  . TRP A 1 108 ? -2.975  -10.544 16.228  1.00 0.00 ? 286 TRP A HB3  1  
ATOM 1611  H HD1  . TRP A 1 108 ? -0.524  -12.255 18.632  1.00 0.00 ? 286 TRP A HD1  1  
ATOM 1612  H HE1  . TRP A 1 108 ? -1.326  -11.846 21.043  1.00 0.00 ? 286 TRP A HE1  1  
ATOM 1613  H HE3  . TRP A 1 108 ? -5.022  -10.042 17.627  1.00 0.00 ? 286 TRP A HE3  1  
ATOM 1614  H HZ2  . TRP A 1 108 ? -3.569  -10.733 22.347  1.00 0.00 ? 286 TRP A HZ2  1  
ATOM 1615  H HZ3  . TRP A 1 108 ? -6.436  -9.335  19.512  1.00 0.00 ? 286 TRP A HZ3  1  
ATOM 1616  H HH2  . TRP A 1 108 ? -5.723  -9.675  21.823  1.00 0.00 ? 286 TRP A HH2  1  
ATOM 1617  N N    . ASN A 1 109 ? -0.908  -14.035 15.606  1.00 0.00 ? 287 ASN A N    1  
ATOM 1618  C CA   . ASN A 1 109 ? 0.049   -15.101 15.879  1.00 0.00 ? 287 ASN A CA   1  
ATOM 1619  C C    . ASN A 1 109 ? 1.382   -14.527 16.351  1.00 0.00 ? 287 ASN A C    1  
ATOM 1620  O O    . ASN A 1 109 ? 2.090   -13.866 15.591  1.00 0.00 ? 287 ASN A O    1  
ATOM 1621  C CB   . ASN A 1 109 ? 0.263   -15.955 14.627  1.00 0.00 ? 287 ASN A CB   1  
ATOM 1622  C CG   . ASN A 1 109 ? 1.292   -17.048 14.843  1.00 0.00 ? 287 ASN A CG   1  
ATOM 1623  O OD1  . ASN A 1 109 ? 1.988   -17.070 15.858  1.00 0.00 ? 287 ASN A OD1  1  
ATOM 1624  N ND2  . ASN A 1 109 ? 1.394   -17.962 13.885  1.00 0.00 ? 287 ASN A ND2  1  
ATOM 1625  H H    . ASN A 1 109 ? -0.779  -13.467 14.818  1.00 0.00 ? 287 ASN A H    1  
ATOM 1626  H HA   . ASN A 1 109 ? -0.360  -15.721 16.662  1.00 0.00 ? 287 ASN A HA   1  
ATOM 1627  H HB2  . ASN A 1 109 ? -0.672  -16.418 14.351  1.00 0.00 ? 287 ASN A HB2  1  
ATOM 1628  H HB3  . ASN A 1 109 ? 0.600   -15.322 13.820  1.00 0.00 ? 287 ASN A HB3  1  
ATOM 1629  H HD21 . ASN A 1 109 ? 0.807   -17.881 13.104  1.00 0.00 ? 287 ASN A HD21 1  
ATOM 1630  H HD22 . ASN A 1 109 ? 2.050   -18.680 13.998  1.00 0.00 ? 287 ASN A HD22 1  
ATOM 1631  N N    . LEU A 1 110 ? 1.718   -14.785 17.610  1.00 0.00 ? 288 LEU A N    1  
ATOM 1632  C CA   . LEU A 1 110 ? 2.966   -14.296 18.185  1.00 0.00 ? 288 LEU A CA   1  
ATOM 1633  C C    . LEU A 1 110 ? 3.964   -15.434 18.370  1.00 0.00 ? 288 LEU A C    1  
ATOM 1634  O O    . LEU A 1 110 ? 3.745   -16.340 19.173  1.00 0.00 ? 288 LEU A O    1  
ATOM 1635  C CB   . LEU A 1 110 ? 2.699   -13.613 19.527  1.00 0.00 ? 288 LEU A CB   1  
ATOM 1636  C CG   . LEU A 1 110 ? 3.934   -13.233 20.345  1.00 0.00 ? 288 LEU A CG   1  
ATOM 1637  C CD1  . LEU A 1 110 ? 4.686   -12.092 19.677  1.00 0.00 ? 288 LEU A CD1  1  
ATOM 1638  C CD2  . LEU A 1 110 ? 3.539   -12.855 21.765  1.00 0.00 ? 288 LEU A CD2  1  
ATOM 1639  H H    . LEU A 1 110 ? 1.113   -15.318 18.167  1.00 0.00 ? 288 LEU A H    1  
ATOM 1640  H HA   . LEU A 1 110 ? 3.385   -13.574 17.500  1.00 0.00 ? 288 LEU A HA   1  
ATOM 1641  H HB2  . LEU A 1 110 ? 2.140   -12.710 19.334  1.00 0.00 ? 288 LEU A HB2  1  
ATOM 1642  H HB3  . LEU A 1 110 ? 2.099   -14.284 20.125  1.00 0.00 ? 288 LEU A HB3  1  
ATOM 1643  H HG   . LEU A 1 110 ? 4.599   -14.084 20.397  1.00 0.00 ? 288 LEU A HG   1  
ATOM 1644  H HD11 . LEU A 1 110 ? 4.189   -11.823 18.757  1.00 0.00 ? 288 LEU A HD11 1  
ATOM 1645  H HD12 . LEU A 1 110 ? 5.697   -12.404 19.462  1.00 0.00 ? 288 LEU A HD12 1  
ATOM 1646  H HD13 . LEU A 1 110 ? 4.706   -11.238 20.339  1.00 0.00 ? 288 LEU A HD13 1  
ATOM 1647  H HD21 . LEU A 1 110 ? 2.625   -12.280 21.742  1.00 0.00 ? 288 LEU A HD21 1  
ATOM 1648  H HD22 . LEU A 1 110 ? 4.325   -12.265 22.212  1.00 0.00 ? 288 LEU A HD22 1  
ATOM 1649  H HD23 . LEU A 1 110 ? 3.386   -13.752 22.346  1.00 0.00 ? 288 LEU A HD23 1  
ATOM 1650  N N    . ASN A 1 111 ? 5.061   -15.380 17.622  1.00 0.00 ? 289 ASN A N    1  
ATOM 1651  C CA   . ASN A 1 111 ? 6.094   -16.407 17.705  1.00 0.00 ? 289 ASN A CA   1  
ATOM 1652  C C    . ASN A 1 111 ? 7.469   -15.779 17.909  1.00 0.00 ? 289 ASN A C    1  
ATOM 1653  O O    . ASN A 1 111 ? 7.929   -14.987 17.087  1.00 0.00 ? 289 ASN A O    1  
ATOM 1654  C CB   . ASN A 1 111 ? 6.095   -17.263 16.437  1.00 0.00 ? 289 ASN A CB   1  
ATOM 1655  C CG   . ASN A 1 111 ? 4.874   -18.158 16.343  1.00 0.00 ? 289 ASN A CG   1  
ATOM 1656  O OD1  . ASN A 1 111 ? 4.116   -18.093 15.375  1.00 0.00 ? 289 ASN A OD1  1  
ATOM 1657  N ND2  . ASN A 1 111 ? 4.679   -19.000 17.351  1.00 0.00 ? 289 ASN A ND2  1  
ATOM 1658  H H    . ASN A 1 111 ? 5.179   -14.633 16.999  1.00 0.00 ? 289 ASN A H    1  
ATOM 1659  H HA   . ASN A 1 111 ? 5.869   -17.036 18.553  1.00 0.00 ? 289 ASN A HA   1  
ATOM 1660  H HB2  . ASN A 1 111 ? 6.109   -16.614 15.572  1.00 0.00 ? 289 ASN A HB2  1  
ATOM 1661  H HB3  . ASN A 1 111 ? 6.977   -17.885 16.430  1.00 0.00 ? 289 ASN A HB3  1  
ATOM 1662  H HD21 . ASN A 1 111 ? 5.325   -18.996 18.089  1.00 0.00 ? 289 ASN A HD21 1  
ATOM 1663  H HD22 . ASN A 1 111 ? 3.898   -19.590 17.315  1.00 0.00 ? 289 ASN A HD22 1  
ATOM 1664  N N    . ASN A 1 112 ? 8.121   -16.139 19.010  1.00 0.00 ? 290 ASN A N    1  
ATOM 1665  C CA   . ASN A 1 112 ? 9.444   -15.611 19.323  1.00 0.00 ? 290 ASN A CA   1  
ATOM 1666  C C    . ASN A 1 112 ? 10.520  -16.323 18.508  1.00 0.00 ? 290 ASN A C    1  
ATOM 1667  O O    . ASN A 1 112 ? 11.201  -17.219 19.007  1.00 0.00 ? 290 ASN A O    1  
ATOM 1668  C CB   . ASN A 1 112 ? 9.736   -15.762 20.817  1.00 0.00 ? 290 ASN A CB   1  
ATOM 1669  C CG   . ASN A 1 112 ? 9.793   -17.215 21.251  1.00 0.00 ? 290 ASN A CG   1  
ATOM 1670  O OD1  . ASN A 1 112 ? 8.924   -18.013 20.899  1.00 0.00 ? 290 ASN A OD1  1  
ATOM 1671  N ND2  . ASN A 1 112 ? 10.818  -17.563 22.020  1.00 0.00 ? 290 ASN A ND2  1  
ATOM 1672  H H    . ASN A 1 112 ? 7.702   -16.774 19.628  1.00 0.00 ? 290 ASN A H    1  
ATOM 1673  H HA   . ASN A 1 112 ? 9.451   -14.562 19.068  1.00 0.00 ? 290 ASN A HA   1  
ATOM 1674  H HB2  . ASN A 1 112 ? 10.689  -15.304 21.039  1.00 0.00 ? 290 ASN A HB2  1  
ATOM 1675  H HB3  . ASN A 1 112 ? 8.962   -15.266 21.382  1.00 0.00 ? 290 ASN A HB3  1  
ATOM 1676  H HD21 . ASN A 1 112 ? 11.471  -16.873 22.261  1.00 0.00 ? 290 ASN A HD21 1  
ATOM 1677  H HD22 . ASN A 1 112 ? 10.879  -18.495 22.314  1.00 0.00 ? 290 ASN A HD22 1  
ATOM 1678  N N    . LEU A 1 113 ? 10.667  -15.917 17.251  1.00 0.00 ? 291 LEU A N    1  
ATOM 1679  C CA   . LEU A 1 113 ? 11.661  -16.515 16.366  1.00 0.00 ? 291 LEU A CA   1  
ATOM 1680  C C    . LEU A 1 113 ? 12.871  -15.599 16.208  1.00 0.00 ? 291 LEU A C    1  
ATOM 1681  O O    . LEU A 1 113 ? 12.727  -14.387 16.042  1.00 0.00 ? 291 LEU A O    1  
ATOM 1682  C CB   . LEU A 1 113 ? 11.044  -16.805 14.997  1.00 0.00 ? 291 LEU A CB   1  
ATOM 1683  C CG   . LEU A 1 113 ? 12.031  -17.075 13.860  1.00 0.00 ? 291 LEU A CG   1  
ATOM 1684  C CD1  . LEU A 1 113 ? 11.427  -18.035 12.847  1.00 0.00 ? 291 LEU A CD1  1  
ATOM 1685  C CD2  . LEU A 1 113 ? 12.437  -15.772 13.186  1.00 0.00 ? 291 LEU A CD2  1  
ATOM 1686  H H    . LEU A 1 113 ? 10.096  -15.199 16.910  1.00 0.00 ? 291 LEU A H    1  
ATOM 1687  H HA   . LEU A 1 113 ? 11.984  -17.444 16.811  1.00 0.00 ? 291 LEU A HA   1  
ATOM 1688  H HB2  . LEU A 1 113 ? 10.410  -17.672 15.097  1.00 0.00 ? 291 LEU A HB2  1  
ATOM 1689  H HB3  . LEU A 1 113 ? 10.442  -15.951 14.719  1.00 0.00 ? 291 LEU A HB3  1  
ATOM 1690  H HG   . LEU A 1 113 ? 12.921  -17.535 14.266  1.00 0.00 ? 291 LEU A HG   1  
ATOM 1691  H HD11 . LEU A 1 113 ? 11.471  -17.594 11.863  1.00 0.00 ? 291 LEU A HD11 1  
ATOM 1692  H HD12 . LEU A 1 113 ? 10.398  -18.234 13.107  1.00 0.00 ? 291 LEU A HD12 1  
ATOM 1693  H HD13 . LEU A 1 113 ? 11.985  -18.961 12.853  1.00 0.00 ? 291 LEU A HD13 1  
ATOM 1694  H HD21 . LEU A 1 113 ? 12.667  -15.034 13.940  1.00 0.00 ? 291 LEU A HD21 1  
ATOM 1695  H HD22 . LEU A 1 113 ? 11.624  -15.416 12.570  1.00 0.00 ? 291 LEU A HD22 1  
ATOM 1696  H HD23 . LEU A 1 113 ? 13.308  -15.942 12.571  1.00 0.00 ? 291 LEU A HD23 1  
ATOM 1697  N N    . SER A 1 114 ? 14.062  -16.186 16.259  1.00 0.00 ? 292 SER A N    1  
ATOM 1698  C CA   . SER A 1 114 ? 15.297  -15.423 16.122  1.00 0.00 ? 292 SER A CA   1  
ATOM 1699  C C    . SER A 1 114 ? 16.159  -15.981 14.994  1.00 0.00 ? 292 SER A C    1  
ATOM 1700  O O    . SER A 1 114 ? 15.892  -17.061 14.470  1.00 0.00 ? 292 SER A O    1  
ATOM 1701  C CB   . SER A 1 114 ? 16.081  -15.442 17.436  1.00 0.00 ? 292 SER A CB   1  
ATOM 1702  O OG   . SER A 1 114 ? 15.279  -14.992 18.515  1.00 0.00 ? 292 SER A OG   1  
ATOM 1703  H H    . SER A 1 114 ? 14.111  -17.156 16.393  1.00 0.00 ? 292 SER A H    1  
ATOM 1704  H HA   . SER A 1 114 ? 15.032  -14.403 15.886  1.00 0.00 ? 292 SER A HA   1  
ATOM 1705  H HB2  . SER A 1 114 ? 16.408  -16.450 17.642  1.00 0.00 ? 292 SER A HB2  1  
ATOM 1706  H HB3  . SER A 1 114 ? 16.941  -14.795 17.348  1.00 0.00 ? 292 SER A HB3  1  
ATOM 1707  H HG   . SER A 1 114 ? 15.449  -15.535 19.288  1.00 0.00 ? 292 SER A HG   1  
ATOM 1708  N N    . GLY A 1 115 ? 17.196  -15.235 14.626  1.00 0.00 ? 293 GLY A N    1  
ATOM 1709  C CA   . GLY A 1 115 ? 18.082  -15.670 13.562  1.00 0.00 ? 293 GLY A CA   1  
ATOM 1710  C C    . GLY A 1 115 ? 19.292  -14.770 13.411  1.00 0.00 ? 293 GLY A C    1  
ATOM 1711  O O    . GLY A 1 115 ? 19.557  -13.904 14.245  1.00 0.00 ? 293 GLY A O    1  
ATOM 1712  H H    . GLY A 1 115 ? 17.361  -14.382 15.079  1.00 0.00 ? 293 GLY A H    1  
ATOM 1713  H HA2  . GLY A 1 115 ? 18.418  -16.674 13.776  1.00 0.00 ? 293 GLY A HA2  1  
ATOM 1714  H HA3  . GLY A 1 115 ? 17.534  -15.676 12.632  1.00 0.00 ? 293 GLY A HA3  1  
ATOM 1715  N N    . PRO A 1 116 ? 20.053  -14.973 12.325  1.00 0.00 ? 294 PRO A N    1  
ATOM 1716  C CA   . PRO A 1 116 ? 21.255  -14.183 12.042  1.00 0.00 ? 294 PRO A CA   1  
ATOM 1717  C C    . PRO A 1 116 ? 20.927  -12.742 11.664  1.00 0.00 ? 294 PRO A C    1  
ATOM 1718  O O    . PRO A 1 116 ? 19.878  -12.467 11.083  1.00 0.00 ? 294 PRO A O    1  
ATOM 1719  C CB   . PRO A 1 116 ? 21.890  -14.915 10.857  1.00 0.00 ? 294 PRO A CB   1  
ATOM 1720  C CG   . PRO A 1 116 ? 20.755  -15.613 10.191  1.00 0.00 ? 294 PRO A CG   1  
ATOM 1721  C CD   . PRO A 1 116 ? 19.798  -15.988 11.289  1.00 0.00 ? 294 PRO A CD   1  
ATOM 1722  H HA   . PRO A 1 116 ? 21.939  -14.187 12.878  1.00 0.00 ? 294 PRO A HA   1  
ATOM 1723  H HB2  . PRO A 1 116 ? 22.357  -14.198 10.196  1.00 0.00 ? 294 PRO A HB2  1  
ATOM 1724  H HB3  . PRO A 1 116 ? 22.629  -15.615 11.216  1.00 0.00 ? 294 PRO A HB3  1  
ATOM 1725  H HG2  . PRO A 1 116 ? 20.277  -14.949 9.487   1.00 0.00 ? 294 PRO A HG2  1  
ATOM 1726  H HG3  . PRO A 1 116 ? 21.114  -16.500 9.689   1.00 0.00 ? 294 PRO A HG3  1  
ATOM 1727  H HD2  . PRO A 1 116 ? 18.779  -15.931 10.936  1.00 0.00 ? 294 PRO A HD2  1  
ATOM 1728  H HD3  . PRO A 1 116 ? 20.017  -16.978 11.659  1.00 0.00 ? 294 PRO A HD3  1  
ATOM 1729  N N    . SER A 1 117 ? 21.831  -11.827 11.999  1.00 0.00 ? 295 SER A N    1  
ATOM 1730  C CA   . SER A 1 117 ? 21.635  -10.414 11.697  1.00 0.00 ? 295 SER A CA   1  
ATOM 1731  C C    . SER A 1 117 ? 22.884  -9.607  12.040  1.00 0.00 ? 295 SER A C    1  
ATOM 1732  O O    . SER A 1 117 ? 23.553  -9.872  13.039  1.00 0.00 ? 295 SER A O    1  
ATOM 1733  C CB   . SER A 1 117 ? 20.433  -9.867  12.470  1.00 0.00 ? 295 SER A CB   1  
ATOM 1734  O OG   . SER A 1 117 ? 20.106  -8.556  12.043  1.00 0.00 ? 295 SER A OG   1  
ATOM 1735  H H    . SER A 1 117 ? 22.648  -12.109 12.461  1.00 0.00 ? 295 SER A H    1  
ATOM 1736  H HA   . SER A 1 117 ? 21.443  -10.324 10.638  1.00 0.00 ? 295 SER A HA   1  
ATOM 1737  H HB2  . SER A 1 117 ? 19.581  -10.509 12.306  1.00 0.00 ? 295 SER A HB2  1  
ATOM 1738  H HB3  . SER A 1 117 ? 20.668  -9.842  13.524  1.00 0.00 ? 295 SER A HB3  1  
ATOM 1739  H HG   . SER A 1 117 ? 20.892  -8.126  11.699  1.00 0.00 ? 295 SER A HG   1  
ATOM 1740  N N    . SER A 1 118 ? 23.192  -8.621  11.204  1.00 0.00 ? 296 SER A N    1  
ATOM 1741  C CA   . SER A 1 118 ? 24.363  -7.777  11.415  1.00 0.00 ? 296 SER A CA   1  
ATOM 1742  C C    . SER A 1 118 ? 23.951  -6.328  11.655  1.00 0.00 ? 296 SER A C    1  
ATOM 1743  O O    . SER A 1 118 ? 23.019  -5.824  11.030  1.00 0.00 ? 296 SER A O    1  
ATOM 1744  C CB   . SER A 1 118 ? 25.301  -7.860  10.210  1.00 0.00 ? 296 SER A CB   1  
ATOM 1745  O OG   . SER A 1 118 ? 26.047  -9.065  10.225  1.00 0.00 ? 296 SER A OG   1  
ATOM 1746  H H    . SER A 1 118 ? 22.620  -8.459  10.424  1.00 0.00 ? 296 SER A H    1  
ATOM 1747  H HA   . SER A 1 118 ? 24.881  -8.142  12.289  1.00 0.00 ? 296 SER A HA   1  
ATOM 1748  H HB2  . SER A 1 118 ? 24.720  -7.822  9.301   1.00 0.00 ? 296 SER A HB2  1  
ATOM 1749  H HB3  . SER A 1 118 ? 25.987  -7.026  10.233  1.00 0.00 ? 296 SER A HB3  1  
ATOM 1750  H HG   . SER A 1 118 ? 26.962  -8.879  10.001  1.00 0.00 ? 296 SER A HG   1  
ATOM 1751  N N    . GLY A 1 119 ? 24.655  -5.663  12.566  1.00 0.00 ? 297 GLY A N    1  
ATOM 1752  C CA   . GLY A 1 119 ? 24.349  -4.278  12.874  1.00 0.00 ? 297 GLY A CA   1  
ATOM 1753  C C    . GLY A 1 119 ? 25.241  -3.307  12.127  1.00 0.00 ? 297 GLY A C    1  
ATOM 1754  O O    . GLY A 1 119 ? 26.041  -3.712  11.283  1.00 0.00 ? 297 GLY A O    1  
ATOM 1755  H H    . GLY A 1 119 ? 25.388  -6.116  13.033  1.00 0.00 ? 297 GLY A H    1  
ATOM 1756  H HA2  . GLY A 1 119 ? 23.320  -4.081  12.611  1.00 0.00 ? 297 GLY A HA2  1  
ATOM 1757  H HA3  . GLY A 1 119 ? 24.475  -4.121  13.935  1.00 0.00 ? 297 GLY A HA3  1  
ATOM 1758  N N    . GLY A 1 1   ? -17.834 18.816  -33.552 1.00 0.00 ? 179 GLY A N    2  
ATOM 1759  C CA   . GLY A 1 1   ? -18.095 18.088  -32.324 1.00 0.00 ? 179 GLY A CA   2  
ATOM 1760  C C    . GLY A 1 1   ? -18.075 18.985  -31.103 1.00 0.00 ? 179 GLY A C    2  
ATOM 1761  O O    . GLY A 1 1   ? -17.058 19.609  -30.799 1.00 0.00 ? 179 GLY A O    2  
ATOM 1762  H H1   . GLY A 1 1   ? -18.582 19.161  -34.084 1.00 0.00 ? 179 GLY A H1   2  
ATOM 1763  H HA2  . GLY A 1 1   ? -19.065 17.618  -32.397 1.00 0.00 ? 179 GLY A HA2  2  
ATOM 1764  H HA3  . GLY A 1 1   ? -17.343 17.322  -32.207 1.00 0.00 ? 179 GLY A HA3  2  
ATOM 1765  N N    . SER A 1 2   ? -19.201 19.052  -30.400 1.00 0.00 ? 180 SER A N    2  
ATOM 1766  C CA   . SER A 1 2   ? -19.310 19.884  -29.208 1.00 0.00 ? 180 SER A CA   2  
ATOM 1767  C C    . SER A 1 2   ? -20.140 19.187  -28.133 1.00 0.00 ? 180 SER A C    2  
ATOM 1768  O O    . SER A 1 2   ? -21.264 18.754  -28.385 1.00 0.00 ? 180 SER A O    2  
ATOM 1769  C CB   . SER A 1 2   ? -19.939 21.234  -29.558 1.00 0.00 ? 180 SER A CB   2  
ATOM 1770  O OG   . SER A 1 2   ? -18.949 22.178  -29.926 1.00 0.00 ? 180 SER A OG   2  
ATOM 1771  H H    . SER A 1 2   ? -19.978 18.531  -30.693 1.00 0.00 ? 180 SER A H    2  
ATOM 1772  H HA   . SER A 1 2   ? -18.314 20.049  -28.826 1.00 0.00 ? 180 SER A HA   2  
ATOM 1773  H HB2  . SER A 1 2   ? -20.623 21.106  -30.383 1.00 0.00 ? 180 SER A HB2  2  
ATOM 1774  H HB3  . SER A 1 2   ? -20.477 21.610  -28.700 1.00 0.00 ? 180 SER A HB3  2  
ATOM 1775  H HG   . SER A 1 2   ? -19.264 22.700  -30.668 1.00 0.00 ? 180 SER A HG   2  
ATOM 1776  N N    . SER A 1 3   ? -19.575 19.082  -26.934 1.00 0.00 ? 181 SER A N    2  
ATOM 1777  C CA   . SER A 1 3   ? -20.259 18.434  -25.822 1.00 0.00 ? 181 SER A CA   2  
ATOM 1778  C C    . SER A 1 3   ? -20.448 19.406  -24.661 1.00 0.00 ? 181 SER A C    2  
ATOM 1779  O O    . SER A 1 3   ? -19.614 20.279  -24.425 1.00 0.00 ? 181 SER A O    2  
ATOM 1780  C CB   . SER A 1 3   ? -19.471 17.209  -25.353 1.00 0.00 ? 181 SER A CB   2  
ATOM 1781  O OG   . SER A 1 3   ? -19.338 16.259  -26.396 1.00 0.00 ? 181 SER A OG   2  
ATOM 1782  H H    . SER A 1 3   ? -18.676 19.446  -26.796 1.00 0.00 ? 181 SER A H    2  
ATOM 1783  H HA   . SER A 1 3   ? -21.230 18.115  -26.170 1.00 0.00 ? 181 SER A HA   2  
ATOM 1784  H HB2  . SER A 1 3   ? -18.486 17.518  -25.037 1.00 0.00 ? 181 SER A HB2  2  
ATOM 1785  H HB3  . SER A 1 3   ? -19.987 16.747  -24.524 1.00 0.00 ? 181 SER A HB3  2  
ATOM 1786  H HG   . SER A 1 3   ? -18.905 15.471  -26.058 1.00 0.00 ? 181 SER A HG   2  
ATOM 1787  N N    . GLY A 1 4   ? -21.553 19.247  -23.937 1.00 0.00 ? 182 GLY A N    2  
ATOM 1788  C CA   . GLY A 1 4   ? -21.833 20.116  -22.810 1.00 0.00 ? 182 GLY A CA   2  
ATOM 1789  C C    . GLY A 1 4   ? -22.770 19.478  -21.804 1.00 0.00 ? 182 GLY A C    2  
ATOM 1790  O O    . GLY A 1 4   ? -23.682 20.130  -21.295 1.00 0.00 ? 182 GLY A O    2  
ATOM 1791  H H    . GLY A 1 4   ? -22.183 18.533  -24.172 1.00 0.00 ? 182 GLY A H    2  
ATOM 1792  H HA2  . GLY A 1 4   ? -20.903 20.359  -22.317 1.00 0.00 ? 182 GLY A HA2  2  
ATOM 1793  H HA3  . GLY A 1 4   ? -22.282 21.028  -23.176 1.00 0.00 ? 182 GLY A HA3  2  
ATOM 1794  N N    . SER A 1 5   ? -22.547 18.199  -21.518 1.00 0.00 ? 183 SER A N    2  
ATOM 1795  C CA   . SER A 1 5   ? -23.383 17.471  -20.571 1.00 0.00 ? 183 SER A CA   2  
ATOM 1796  C C    . SER A 1 5   ? -23.293 18.090  -19.180 1.00 0.00 ? 183 SER A C    2  
ATOM 1797  O O    . SER A 1 5   ? -22.243 18.050  -18.537 1.00 0.00 ? 183 SER A O    2  
ATOM 1798  C CB   . SER A 1 5   ? -22.965 16.000  -20.516 1.00 0.00 ? 183 SER A CB   2  
ATOM 1799  O OG   . SER A 1 5   ? -23.029 15.403  -21.799 1.00 0.00 ? 183 SER A OG   2  
ATOM 1800  H H    . SER A 1 5   ? -21.804 17.734  -21.957 1.00 0.00 ? 183 SER A H    2  
ATOM 1801  H HA   . SER A 1 5   ? -24.405 17.533  -20.915 1.00 0.00 ? 183 SER A HA   2  
ATOM 1802  H HB2  . SER A 1 5   ? -21.952 15.930  -20.150 1.00 0.00 ? 183 SER A HB2  2  
ATOM 1803  H HB3  . SER A 1 5   ? -23.627 15.466  -19.849 1.00 0.00 ? 183 SER A HB3  2  
ATOM 1804  H HG   . SER A 1 5   ? -22.847 16.065  -22.470 1.00 0.00 ? 183 SER A HG   2  
ATOM 1805  N N    . SER A 1 6   ? -24.402 18.661  -18.720 1.00 0.00 ? 184 SER A N    2  
ATOM 1806  C CA   . SER A 1 6   ? -24.448 19.292  -17.406 1.00 0.00 ? 184 SER A CA   2  
ATOM 1807  C C    . SER A 1 6   ? -25.601 18.735  -16.577 1.00 0.00 ? 184 SER A C    2  
ATOM 1808  O O    . SER A 1 6   ? -26.769 18.993  -16.864 1.00 0.00 ? 184 SER A O    2  
ATOM 1809  C CB   . SER A 1 6   ? -24.595 20.808  -17.550 1.00 0.00 ? 184 SER A CB   2  
ATOM 1810  O OG   . SER A 1 6   ? -23.465 21.371  -18.195 1.00 0.00 ? 184 SER A OG   2  
ATOM 1811  H H    . SER A 1 6   ? -25.207 18.660  -19.279 1.00 0.00 ? 184 SER A H    2  
ATOM 1812  H HA   . SER A 1 6   ? -23.519 19.075  -16.901 1.00 0.00 ? 184 SER A HA   2  
ATOM 1813  H HB2  . SER A 1 6   ? -25.474 21.028  -18.135 1.00 0.00 ? 184 SER A HB2  2  
ATOM 1814  H HB3  . SER A 1 6   ? -24.693 21.252  -16.570 1.00 0.00 ? 184 SER A HB3  2  
ATOM 1815  H HG   . SER A 1 6   ? -23.523 22.328  -18.166 1.00 0.00 ? 184 SER A HG   2  
ATOM 1816  N N    . GLY A 1 7   ? -25.263 17.968  -15.544 1.00 0.00 ? 185 GLY A N    2  
ATOM 1817  C CA   . GLY A 1 7   ? -26.279 17.386  -14.688 1.00 0.00 ? 185 GLY A CA   2  
ATOM 1818  C C    . GLY A 1 7   ? -25.691 16.498  -13.610 1.00 0.00 ? 185 GLY A C    2  
ATOM 1819  O O    . GLY A 1 7   ? -25.577 16.904  -12.453 1.00 0.00 ? 185 GLY A O    2  
ATOM 1820  H H    . GLY A 1 7   ? -24.315 17.797  -15.363 1.00 0.00 ? 185 GLY A H    2  
ATOM 1821  H HA2  . GLY A 1 7   ? -26.838 18.182  -14.219 1.00 0.00 ? 185 GLY A HA2  2  
ATOM 1822  H HA3  . GLY A 1 7   ? -26.951 16.798  -15.296 1.00 0.00 ? 185 GLY A HA3  2  
ATOM 1823  N N    . LYS A 1 8   ? -25.315 15.281  -13.988 1.00 0.00 ? 186 LYS A N    2  
ATOM 1824  C CA   . LYS A 1 8   ? -24.735 14.331  -13.046 1.00 0.00 ? 186 LYS A CA   2  
ATOM 1825  C C    . LYS A 1 8   ? -23.221 14.500  -12.966 1.00 0.00 ? 186 LYS A C    2  
ATOM 1826  O O    . LYS A 1 8   ? -22.595 15.013  -13.892 1.00 0.00 ? 186 LYS A O    2  
ATOM 1827  C CB   . LYS A 1 8   ? -25.078 12.898  -13.459 1.00 0.00 ? 186 LYS A CB   2  
ATOM 1828  C CG   . LYS A 1 8   ? -26.570 12.622  -13.519 1.00 0.00 ? 186 LYS A CG   2  
ATOM 1829  C CD   . LYS A 1 8   ? -26.885 11.458  -14.443 1.00 0.00 ? 186 LYS A CD   2  
ATOM 1830  C CE   . LYS A 1 8   ? -26.917 11.895  -15.900 1.00 0.00 ? 186 LYS A CE   2  
ATOM 1831  N NZ   . LYS A 1 8   ? -27.727 10.969  -16.739 1.00 0.00 ? 186 LYS A NZ   2  
ATOM 1832  H H    . LYS A 1 8   ? -25.431 15.015  -14.925 1.00 0.00 ? 186 LYS A H    2  
ATOM 1833  H HA   . LYS A 1 8   ? -25.160 14.528  -12.073 1.00 0.00 ? 186 LYS A HA   2  
ATOM 1834  H HB2  . LYS A 1 8   ? -24.658 12.707  -14.436 1.00 0.00 ? 186 LYS A HB2  2  
ATOM 1835  H HB3  . LYS A 1 8   ? -24.635 12.216  -12.747 1.00 0.00 ? 186 LYS A HB3  2  
ATOM 1836  H HG2  . LYS A 1 8   ? -26.924 12.386  -12.527 1.00 0.00 ? 186 LYS A HG2  2  
ATOM 1837  H HG3  . LYS A 1 8   ? -27.075 13.506  -13.883 1.00 0.00 ? 186 LYS A HG3  2  
ATOM 1838  H HD2  . LYS A 1 8   ? -26.126 10.699  -14.324 1.00 0.00 ? 186 LYS A HD2  2  
ATOM 1839  H HD3  . LYS A 1 8   ? -27.850 11.050  -14.178 1.00 0.00 ? 186 LYS A HD3  2  
ATOM 1840  H HE2  . LYS A 1 8   ? -27.343 12.885  -15.956 1.00 0.00 ? 186 LYS A HE2  2  
ATOM 1841  H HE3  . LYS A 1 8   ? -25.905 11.917  -16.277 1.00 0.00 ? 186 LYS A HE3  2  
ATOM 1842  H HZ1  . LYS A 1 8   ? -27.411 11.016  -17.729 1.00 0.00 ? 186 LYS A HZ1  2  
ATOM 1843  H HZ2  . LYS A 1 8   ? -28.731 11.234  -16.695 1.00 0.00 ? 186 LYS A HZ2  2  
ATOM 1844  H HZ3  . LYS A 1 8   ? -27.621 9.993   -16.399 1.00 0.00 ? 186 LYS A HZ3  2  
ATOM 1845  N N    . ASN A 1 9   ? -22.640 14.065  -11.852 1.00 0.00 ? 187 ASN A N    2  
ATOM 1846  C CA   . ASN A 1 9   ? -21.199 14.168  -11.652 1.00 0.00 ? 187 ASN A CA   2  
ATOM 1847  C C    . ASN A 1 9   ? -20.450 13.238  -12.602 1.00 0.00 ? 187 ASN A C    2  
ATOM 1848  O O    . ASN A 1 9   ? -20.354 12.035  -12.362 1.00 0.00 ? 187 ASN A O    2  
ATOM 1849  C CB   . ASN A 1 9   ? -20.840 13.833  -10.203 1.00 0.00 ? 187 ASN A CB   2  
ATOM 1850  C CG   . ASN A 1 9   ? -21.135 14.978  -9.254  1.00 0.00 ? 187 ASN A CG   2  
ATOM 1851  O OD1  . ASN A 1 9   ? -20.245 15.468  -8.559  1.00 0.00 ? 187 ASN A OD1  2  
ATOM 1852  N ND2  . ASN A 1 9   ? -22.390 15.411  -9.222  1.00 0.00 ? 187 ASN A ND2  2  
ATOM 1853  H H    . ASN A 1 9   ? -23.193 13.666  -11.149 1.00 0.00 ? 187 ASN A H    2  
ATOM 1854  H HA   . ASN A 1 9   ? -20.908 15.187  -11.860 1.00 0.00 ? 187 ASN A HA   2  
ATOM 1855  H HB2  . ASN A 1 9   ? -21.412 12.973  -9.887  1.00 0.00 ? 187 ASN A HB2  2  
ATOM 1856  H HB3  . ASN A 1 9   ? -19.787 13.602  -10.144 1.00 0.00 ? 187 ASN A HB3  2  
ATOM 1857  H HD21 . ASN A 1 9   ? -23.046 14.973  -9.803  1.00 0.00 ? 187 ASN A HD21 2  
ATOM 1858  H HD22 . ASN A 1 9   ? -22.608 16.151  -8.617  1.00 0.00 ? 187 ASN A HD22 2  
ATOM 1859  N N    . VAL A 1 10  ? -19.921 13.805  -13.681 1.00 0.00 ? 188 VAL A N    2  
ATOM 1860  C CA   . VAL A 1 10  ? -19.179 13.028  -14.667 1.00 0.00 ? 188 VAL A CA   2  
ATOM 1861  C C    . VAL A 1 10  ? -17.751 12.768  -14.200 1.00 0.00 ? 188 VAL A C    2  
ATOM 1862  O O    . VAL A 1 10  ? -17.190 13.543  -13.427 1.00 0.00 ? 188 VAL A O    2  
ATOM 1863  C CB   . VAL A 1 10  ? -19.139 13.743  -16.031 1.00 0.00 ? 188 VAL A CB   2  
ATOM 1864  C CG1  . VAL A 1 10  ? -20.546 13.930  -16.577 1.00 0.00 ? 188 VAL A CG1  2  
ATOM 1865  C CG2  . VAL A 1 10  ? -18.423 15.080  -15.910 1.00 0.00 ? 188 VAL A CG2  2  
ATOM 1866  H H    . VAL A 1 10  ? -20.032 14.769  -13.818 1.00 0.00 ? 188 VAL A H    2  
ATOM 1867  H HA   . VAL A 1 10  ? -19.683 12.082  -14.795 1.00 0.00 ? 188 VAL A HA   2  
ATOM 1868  H HB   . VAL A 1 10  ? -18.587 13.124  -16.723 1.00 0.00 ? 188 VAL A HB   2  
ATOM 1869  H HG11 . VAL A 1 10  ? -20.866 13.021  -17.065 1.00 0.00 ? 188 VAL A HG11 2  
ATOM 1870  H HG12 . VAL A 1 10  ? -21.220 14.161  -15.765 1.00 0.00 ? 188 VAL A HG12 2  
ATOM 1871  H HG13 . VAL A 1 10  ? -20.550 14.741  -17.291 1.00 0.00 ? 188 VAL A HG13 2  
ATOM 1872  H HG21 . VAL A 1 10  ? -19.014 15.751  -15.305 1.00 0.00 ? 188 VAL A HG21 2  
ATOM 1873  H HG22 . VAL A 1 10  ? -17.458 14.932  -15.447 1.00 0.00 ? 188 VAL A HG22 2  
ATOM 1874  H HG23 . VAL A 1 10  ? -18.288 15.506  -16.893 1.00 0.00 ? 188 VAL A HG23 2  
ATOM 1875  N N    . ASN A 1 11  ? -17.169 11.672  -14.676 1.00 0.00 ? 189 ASN A N    2  
ATOM 1876  C CA   . ASN A 1 11  ? -15.805 11.309  -14.307 1.00 0.00 ? 189 ASN A CA   2  
ATOM 1877  C C    . ASN A 1 11  ? -15.572 11.518  -12.813 1.00 0.00 ? 189 ASN A C    2  
ATOM 1878  O O    . ASN A 1 11  ? -14.509 11.980  -12.399 1.00 0.00 ? 189 ASN A O    2  
ATOM 1879  C CB   . ASN A 1 11  ? -14.800 12.136  -15.111 1.00 0.00 ? 189 ASN A CB   2  
ATOM 1880  C CG   . ASN A 1 11  ? -13.479 11.416  -15.299 1.00 0.00 ? 189 ASN A CG   2  
ATOM 1881  O OD1  . ASN A 1 11  ? -13.030 10.679  -14.420 1.00 0.00 ? 189 ASN A OD1  2  
ATOM 1882  N ND2  . ASN A 1 11  ? -12.848 11.626  -16.448 1.00 0.00 ? 189 ASN A ND2  2  
ATOM 1883  H H    . ASN A 1 11  ? -17.668 11.093  -15.289 1.00 0.00 ? 189 ASN A H    2  
ATOM 1884  H HA   . ASN A 1 11  ? -15.667 10.264  -14.539 1.00 0.00 ? 189 ASN A HA   2  
ATOM 1885  H HB2  . ASN A 1 11  ? -15.215 12.346  -16.087 1.00 0.00 ? 189 ASN A HB2  2  
ATOM 1886  H HB3  . ASN A 1 11  ? -14.613 13.066  -14.596 1.00 0.00 ? 189 ASN A HB3  2  
ATOM 1887  H HD21 . ASN A 1 11  ? -13.265 12.226  -17.102 1.00 0.00 ? 189 ASN A HD21 2  
ATOM 1888  H HD22 . ASN A 1 11  ? -11.992 11.173  -16.596 1.00 0.00 ? 189 ASN A HD22 2  
ATOM 1889  N N    . ARG A 1 12  ? -16.573 11.173  -12.010 1.00 0.00 ? 190 ARG A N    2  
ATOM 1890  C CA   . ARG A 1 12  ? -16.478 11.323  -10.563 1.00 0.00 ? 190 ARG A CA   2  
ATOM 1891  C C    . ARG A 1 12  ? -15.316 10.505  -10.007 1.00 0.00 ? 190 ARG A C    2  
ATOM 1892  O O    . ARG A 1 12  ? -15.047 9.395   -10.469 1.00 0.00 ? 190 ARG A O    2  
ATOM 1893  C CB   . ARG A 1 12  ? -17.785 10.889  -9.897  1.00 0.00 ? 190 ARG A CB   2  
ATOM 1894  C CG   . ARG A 1 12  ? -18.054 11.585  -8.572  1.00 0.00 ? 190 ARG A CG   2  
ATOM 1895  C CD   . ARG A 1 12  ? -17.360 10.876  -7.420  1.00 0.00 ? 190 ARG A CD   2  
ATOM 1896  N NE   . ARG A 1 12  ? -18.068 11.064  -6.156  1.00 0.00 ? 190 ARG A NE   2  
ATOM 1897  C CZ   . ARG A 1 12  ? -17.540 10.785  -4.970  1.00 0.00 ? 190 ARG A CZ   2  
ATOM 1898  N NH1  . ARG A 1 12  ? -16.305 10.309  -4.885  1.00 0.00 ? 190 ARG A NH1  2  
ATOM 1899  N NH2  . ARG A 1 12  ? -18.247 10.984  -3.864  1.00 0.00 ? 190 ARG A NH2  2  
ATOM 1900  H H    . ARG A 1 12  ? -17.396 10.810  -12.400 1.00 0.00 ? 190 ARG A H    2  
ATOM 1901  H HA   . ARG A 1 12  ? -16.303 12.366  -10.348 1.00 0.00 ? 190 ARG A HA   2  
ATOM 1902  H HB2  . ARG A 1 12  ? -18.606 11.106  -10.565 1.00 0.00 ? 190 ARG A HB2  2  
ATOM 1903  H HB3  . ARG A 1 12  ? -17.748 9.825   -9.719  1.00 0.00 ? 190 ARG A HB3  2  
ATOM 1904  H HG2  . ARG A 1 12  ? -17.687 12.600  -8.629  1.00 0.00 ? 190 ARG A HG2  2  
ATOM 1905  H HG3  . ARG A 1 12  ? -19.118 11.594  -8.391  1.00 0.00 ? 190 ARG A HG3  2  
ATOM 1906  H HD2  . ARG A 1 12  ? -17.313 9.820   -7.641  1.00 0.00 ? 190 ARG A HD2  2  
ATOM 1907  H HD3  . ARG A 1 12  ? -16.359 11.268  -7.323  1.00 0.00 ? 190 ARG A HD3  2  
ATOM 1908  H HE   . ARG A 1 12  ? -18.981 11.415  -6.196  1.00 0.00 ? 190 ARG A HE   2  
ATOM 1909  H HH11 . ARG A 1 12  ? -15.770 10.159  -5.716  1.00 0.00 ? 190 ARG A HH11 2  
ATOM 1910  H HH12 . ARG A 1 12  ? -15.910 10.101  -3.990  1.00 0.00 ? 190 ARG A HH12 2  
ATOM 1911  H HH21 . ARG A 1 12  ? -19.177 11.343  -3.924  1.00 0.00 ? 190 ARG A HH21 2  
ATOM 1912  H HH22 . ARG A 1 12  ? -17.849 10.773  -2.972  1.00 0.00 ? 190 ARG A HH22 2  
ATOM 1913  N N    . VAL A 1 13  ? -14.629 11.061  -9.014  1.00 0.00 ? 191 VAL A N    2  
ATOM 1914  C CA   . VAL A 1 13  ? -13.496 10.383  -8.395  1.00 0.00 ? 191 VAL A CA   2  
ATOM 1915  C C    . VAL A 1 13  ? -13.964 9.282   -7.449  1.00 0.00 ? 191 VAL A C    2  
ATOM 1916  O O    . VAL A 1 13  ? -13.499 9.186   -6.313  1.00 0.00 ? 191 VAL A O    2  
ATOM 1917  C CB   . VAL A 1 13  ? -12.608 11.371  -7.616  1.00 0.00 ? 191 VAL A CB   2  
ATOM 1918  C CG1  . VAL A 1 13  ? -11.973 12.379  -8.562  1.00 0.00 ? 191 VAL A CG1  2  
ATOM 1919  C CG2  . VAL A 1 13  ? -13.417 12.076  -6.537  1.00 0.00 ? 191 VAL A CG2  2  
ATOM 1920  H H    . VAL A 1 13  ? -14.891 11.947  -8.690  1.00 0.00 ? 191 VAL A H    2  
ATOM 1921  H HA   . VAL A 1 13  ? -12.902 9.940   -9.181  1.00 0.00 ? 191 VAL A HA   2  
ATOM 1922  H HB   . VAL A 1 13  ? -11.818 10.813  -7.137  1.00 0.00 ? 191 VAL A HB   2  
ATOM 1923  H HG11 . VAL A 1 13  ? -12.260 12.149  -9.578  1.00 0.00 ? 191 VAL A HG11 2  
ATOM 1924  H HG12 . VAL A 1 13  ? -12.310 13.374  -8.308  1.00 0.00 ? 191 VAL A HG12 2  
ATOM 1925  H HG13 . VAL A 1 13  ? -10.898 12.328  -8.472  1.00 0.00 ? 191 VAL A HG13 2  
ATOM 1926  H HG21 . VAL A 1 13  ? -13.775 11.349  -5.824  1.00 0.00 ? 191 VAL A HG21 2  
ATOM 1927  H HG22 . VAL A 1 13  ? -12.791 12.798  -6.032  1.00 0.00 ? 191 VAL A HG22 2  
ATOM 1928  H HG23 . VAL A 1 13  ? -14.257 12.582  -6.989  1.00 0.00 ? 191 VAL A HG23 2  
ATOM 1929  N N    . LEU A 1 14  ? -14.886 8.454   -7.926  1.00 0.00 ? 192 LEU A N    2  
ATOM 1930  C CA   . LEU A 1 14  ? -15.418 7.358   -7.123  1.00 0.00 ? 192 LEU A CA   2  
ATOM 1931  C C    . LEU A 1 14  ? -14.657 6.064   -7.396  1.00 0.00 ? 192 LEU A C    2  
ATOM 1932  O O    . LEU A 1 14  ? -14.341 5.312   -6.474  1.00 0.00 ? 192 LEU A O    2  
ATOM 1933  C CB   . LEU A 1 14  ? -16.906 7.160   -7.416  1.00 0.00 ? 192 LEU A CB   2  
ATOM 1934  C CG   . LEU A 1 14  ? -17.493 5.803   -7.025  1.00 0.00 ? 192 LEU A CG   2  
ATOM 1935  C CD1  . LEU A 1 14  ? -18.995 5.911   -6.814  1.00 0.00 ? 192 LEU A CD1  2  
ATOM 1936  C CD2  . LEU A 1 14  ? -17.175 4.759   -8.085  1.00 0.00 ? 192 LEU A CD2  2  
ATOM 1937  H H    . LEU A 1 14  ? -15.219 8.581   -8.838  1.00 0.00 ? 192 LEU A H    2  
ATOM 1938  H HA   . LEU A 1 14  ? -15.296 7.620   -6.082  1.00 0.00 ? 192 LEU A HA   2  
ATOM 1939  H HB2  . LEU A 1 14  ? -17.453 7.922   -6.883  1.00 0.00 ? 192 LEU A HB2  2  
ATOM 1940  H HB3  . LEU A 1 14  ? -17.053 7.291   -8.479  1.00 0.00 ? 192 LEU A HB3  2  
ATOM 1941  H HG   . LEU A 1 14  ? -17.048 5.481   -6.093  1.00 0.00 ? 192 LEU A HG   2  
ATOM 1942  H HD11 . LEU A 1 14  ? -19.285 5.298   -5.974  1.00 0.00 ? 192 LEU A HD11 2  
ATOM 1943  H HD12 . LEU A 1 14  ? -19.508 5.572   -7.702  1.00 0.00 ? 192 LEU A HD12 2  
ATOM 1944  H HD13 . LEU A 1 14  ? -19.257 6.940   -6.618  1.00 0.00 ? 192 LEU A HD13 2  
ATOM 1945  H HD21 . LEU A 1 14  ? -17.927 3.984   -8.063  1.00 0.00 ? 192 LEU A HD21 2  
ATOM 1946  H HD22 . LEU A 1 14  ? -16.206 4.325   -7.884  1.00 0.00 ? 192 LEU A HD22 2  
ATOM 1947  H HD23 . LEU A 1 14  ? -17.167 5.225   -9.059  1.00 0.00 ? 192 LEU A HD23 2  
ATOM 1948  N N    . SER A 1 15  ? -14.365 5.812   -8.668  1.00 0.00 ? 193 SER A N    2  
ATOM 1949  C CA   . SER A 1 15  ? -13.643 4.609   -9.062  1.00 0.00 ? 193 SER A CA   2  
ATOM 1950  C C    . SER A 1 15  ? -12.136 4.815   -8.940  1.00 0.00 ? 193 SER A C    2  
ATOM 1951  O O    . SER A 1 15  ? -11.629 5.914   -9.162  1.00 0.00 ? 193 SER A O    2  
ATOM 1952  C CB   . SER A 1 15  ? -14.001 4.222   -10.498 1.00 0.00 ? 193 SER A CB   2  
ATOM 1953  O OG   . SER A 1 15  ? -13.883 5.332   -11.371 1.00 0.00 ? 193 SER A OG   2  
ATOM 1954  H H    . SER A 1 15  ? -14.645 6.451   -9.357  1.00 0.00 ? 193 SER A H    2  
ATOM 1955  H HA   . SER A 1 15  ? -13.940 3.811   -8.398  1.00 0.00 ? 193 SER A HA   2  
ATOM 1956  H HB2  . SER A 1 15  ? -13.335 3.442   -10.835 1.00 0.00 ? 193 SER A HB2  2  
ATOM 1957  H HB3  . SER A 1 15  ? -15.020 3.862   -10.528 1.00 0.00 ? 193 SER A HB3  2  
ATOM 1958  H HG   . SER A 1 15  ? -13.599 5.030   -12.237 1.00 0.00 ? 193 SER A HG   2  
ATOM 1959  N N    . ALA A 1 16  ? -11.427 3.749   -8.584  1.00 0.00 ? 194 ALA A N    2  
ATOM 1960  C CA   . ALA A 1 16  ? -9.978  3.811   -8.433  1.00 0.00 ? 194 ALA A CA   2  
ATOM 1961  C C    . ALA A 1 16  ? -9.320  4.378   -9.687  1.00 0.00 ? 194 ALA A C    2  
ATOM 1962  O O    . ALA A 1 16  ? -8.278  5.028   -9.611  1.00 0.00 ? 194 ALA A O    2  
ATOM 1963  C CB   . ALA A 1 16  ? -9.421  2.430   -8.120  1.00 0.00 ? 194 ALA A CB   2  
ATOM 1964  H H    . ALA A 1 16  ? -11.888 2.901   -8.420  1.00 0.00 ? 194 ALA A H    2  
ATOM 1965  H HA   . ALA A 1 16  ? -9.757  4.460   -7.598  1.00 0.00 ? 194 ALA A HA   2  
ATOM 1966  H HB1  . ALA A 1 16  ? -8.357  2.504   -7.942  1.00 0.00 ? 194 ALA A HB1  2  
ATOM 1967  H HB2  . ALA A 1 16  ? -9.907  2.037   -7.240  1.00 0.00 ? 194 ALA A HB2  2  
ATOM 1968  H HB3  . ALA A 1 16  ? -9.601  1.771   -8.956  1.00 0.00 ? 194 ALA A HB3  2  
ATOM 1969  N N    . GLU A 1 17  ? -9.934  4.125   -10.838 1.00 0.00 ? 195 GLU A N    2  
ATOM 1970  C CA   . GLU A 1 17  ? -9.405  4.610   -12.108 1.00 0.00 ? 195 GLU A CA   2  
ATOM 1971  C C    . GLU A 1 17  ? -9.437  6.134   -12.164 1.00 0.00 ? 195 GLU A C    2  
ATOM 1972  O O    . GLU A 1 17  ? -8.472  6.771   -12.587 1.00 0.00 ? 195 GLU A O    2  
ATOM 1973  C CB   . GLU A 1 17  ? -10.206 4.028   -13.274 1.00 0.00 ? 195 GLU A CB   2  
ATOM 1974  C CG   . GLU A 1 17  ? -10.301 2.512   -13.252 1.00 0.00 ? 195 GLU A CG   2  
ATOM 1975  C CD   . GLU A 1 17  ? -11.573 1.998   -13.897 1.00 0.00 ? 195 GLU A CD   2  
ATOM 1976  O OE1  . GLU A 1 17  ? -11.951 2.522   -14.966 1.00 0.00 ? 195 GLU A OE1  2  
ATOM 1977  O OE2  . GLU A 1 17  ? -12.191 1.070   -13.334 1.00 0.00 ? 195 GLU A OE2  2  
ATOM 1978  H H    . GLU A 1 17  ? -10.762 3.601   -10.834 1.00 0.00 ? 195 GLU A H    2  
ATOM 1979  H HA   . GLU A 1 17  ? -8.380  4.280   -12.187 1.00 0.00 ? 195 GLU A HA   2  
ATOM 1980  H HB2  . GLU A 1 17  ? -11.207 4.432   -13.245 1.00 0.00 ? 195 GLU A HB2  2  
ATOM 1981  H HB3  . GLU A 1 17  ? -9.736  4.324   -14.201 1.00 0.00 ? 195 GLU A HB3  2  
ATOM 1982  H HG2  . GLU A 1 17  ? -9.455  2.103   -13.783 1.00 0.00 ? 195 GLU A HG2  2  
ATOM 1983  H HG3  . GLU A 1 17  ? -10.276 2.178   -12.225 1.00 0.00 ? 195 GLU A HG3  2  
ATOM 1984  N N    . ALA A 1 18  ? -10.554 6.713   -11.735 1.00 0.00 ? 196 ALA A N    2  
ATOM 1985  C CA   . ALA A 1 18  ? -10.712 8.162   -11.735 1.00 0.00 ? 196 ALA A CA   2  
ATOM 1986  C C    . ALA A 1 18  ? -9.622  8.833   -10.906 1.00 0.00 ? 196 ALA A C    2  
ATOM 1987  O O    . ALA A 1 18  ? -9.035  9.832   -11.326 1.00 0.00 ? 196 ALA A O    2  
ATOM 1988  C CB   . ALA A 1 18  ? -12.088 8.543   -11.208 1.00 0.00 ? 196 ALA A CB   2  
ATOM 1989  H H    . ALA A 1 18  ? -11.288 6.152   -11.409 1.00 0.00 ? 196 ALA A H    2  
ATOM 1990  H HA   . ALA A 1 18  ? -10.637 8.506   -12.756 1.00 0.00 ? 196 ALA A HA   2  
ATOM 1991  H HB1  . ALA A 1 18  ? -12.293 7.986   -10.305 1.00 0.00 ? 196 ALA A HB1  2  
ATOM 1992  H HB2  . ALA A 1 18  ? -12.110 9.600   -10.992 1.00 0.00 ? 196 ALA A HB2  2  
ATOM 1993  H HB3  . ALA A 1 18  ? -12.835 8.311   -11.952 1.00 0.00 ? 196 ALA A HB3  2  
ATOM 1994  N N    . LEU A 1 19  ? -9.356  8.280   -9.729  1.00 0.00 ? 197 LEU A N    2  
ATOM 1995  C CA   . LEU A 1 19  ? -8.335  8.826   -8.840  1.00 0.00 ? 197 LEU A CA   2  
ATOM 1996  C C    . LEU A 1 19  ? -7.111  9.278   -9.629  1.00 0.00 ? 197 LEU A C    2  
ATOM 1997  O O    . LEU A 1 19  ? -6.851  8.786   -10.728 1.00 0.00 ? 197 LEU A O    2  
ATOM 1998  C CB   . LEU A 1 19  ? -7.928  7.783   -7.798  1.00 0.00 ? 197 LEU A CB   2  
ATOM 1999  C CG   . LEU A 1 19  ? -9.069  7.149   -7.000  1.00 0.00 ? 197 LEU A CG   2  
ATOM 2000  C CD1  . LEU A 1 19  ? -8.525  6.146   -5.995  1.00 0.00 ? 197 LEU A CD1  2  
ATOM 2001  C CD2  . LEU A 1 19  ? -9.887  8.222   -6.297  1.00 0.00 ? 197 LEU A CD2  2  
ATOM 2002  H H    . LEU A 1 19  ? -9.856  7.485   -9.449  1.00 0.00 ? 197 LEU A H    2  
ATOM 2003  H HA   . LEU A 1 19  ? -8.759  9.681   -8.335  1.00 0.00 ? 197 LEU A HA   2  
ATOM 2004  H HB2  . LEU A 1 19  ? -7.403  6.991   -8.310  1.00 0.00 ? 197 LEU A HB2  2  
ATOM 2005  H HB3  . LEU A 1 19  ? -7.259  8.261   -7.096  1.00 0.00 ? 197 LEU A HB3  2  
ATOM 2006  H HG   . LEU A 1 19  ? -9.723  6.620   -7.679  1.00 0.00 ? 197 LEU A HG   2  
ATOM 2007  H HD11 . LEU A 1 19  ? -7.830  6.640   -5.334  1.00 0.00 ? 197 LEU A HD11 2  
ATOM 2008  H HD12 . LEU A 1 19  ? -8.018  5.350   -6.520  1.00 0.00 ? 197 LEU A HD12 2  
ATOM 2009  H HD13 . LEU A 1 19  ? -9.341  5.735   -5.419  1.00 0.00 ? 197 LEU A HD13 2  
ATOM 2010  H HD21 . LEU A 1 19  ? -10.260 7.833   -5.361  1.00 0.00 ? 197 LEU A HD21 2  
ATOM 2011  H HD22 . LEU A 1 19  ? -10.719 8.509   -6.924  1.00 0.00 ? 197 LEU A HD22 2  
ATOM 2012  H HD23 . LEU A 1 19  ? -9.265  9.083   -6.106  1.00 0.00 ? 197 LEU A HD23 2  
ATOM 2013  N N    . LYS A 1 20  ? -6.360  10.216  -9.061  1.00 0.00 ? 198 LYS A N    2  
ATOM 2014  C CA   . LYS A 1 20  ? -5.161  10.732  -9.709  1.00 0.00 ? 198 LYS A CA   2  
ATOM 2015  C C    . LYS A 1 20  ? -3.904  10.238  -9.000  1.00 0.00 ? 198 LYS A C    2  
ATOM 2016  O O    . LYS A 1 20  ? -3.886  10.035  -7.786  1.00 0.00 ? 198 LYS A O    2  
ATOM 2017  C CB   . LYS A 1 20  ? -5.183  12.262  -9.724  1.00 0.00 ? 198 LYS A CB   2  
ATOM 2018  C CG   . LYS A 1 20  ? -6.478  12.847  -10.259 1.00 0.00 ? 198 LYS A CG   2  
ATOM 2019  C CD   . LYS A 1 20  ? -7.494  13.062  -9.149  1.00 0.00 ? 198 LYS A CD   2  
ATOM 2020  C CE   . LYS A 1 20  ? -8.683  13.877  -9.633  1.00 0.00 ? 198 LYS A CE   2  
ATOM 2021  N NZ   . LYS A 1 20  ? -9.399  14.537  -8.505  1.00 0.00 ? 198 LYS A NZ   2  
ATOM 2022  H H    . LYS A 1 20  ? -6.620  10.569  -8.184  1.00 0.00 ? 198 LYS A H    2  
ATOM 2023  H HA   . LYS A 1 20  ? -5.151  10.371  -10.726 1.00 0.00 ? 198 LYS A HA   2  
ATOM 2024  H HB2  . LYS A 1 20  ? -5.039  12.622  -8.715  1.00 0.00 ? 198 LYS A HB2  2  
ATOM 2025  H HB3  . LYS A 1 20  ? -4.370  12.616  -10.342 1.00 0.00 ? 198 LYS A HB3  2  
ATOM 2026  H HG2  . LYS A 1 20  ? -6.268  13.797  -10.728 1.00 0.00 ? 198 LYS A HG2  2  
ATOM 2027  H HG3  . LYS A 1 20  ? -6.895  12.167  -10.989 1.00 0.00 ? 198 LYS A HG3  2  
ATOM 2028  H HD2  . LYS A 1 20  ? -7.846  12.102  -8.804  1.00 0.00 ? 198 LYS A HD2  2  
ATOM 2029  H HD3  . LYS A 1 20  ? -7.016  13.587  -8.333  1.00 0.00 ? 198 LYS A HD3  2  
ATOM 2030  H HE2  . LYS A 1 20  ? -8.331  14.634  -10.316 1.00 0.00 ? 198 LYS A HE2  2  
ATOM 2031  H HE3  . LYS A 1 20  ? -9.368  13.219  -10.147 1.00 0.00 ? 198 LYS A HE3  2  
ATOM 2032  H HZ1  . LYS A 1 20  ? -9.820  13.819  -7.881  1.00 0.00 ? 198 LYS A HZ1  2  
ATOM 2033  H HZ2  . LYS A 1 20  ? -10.156 15.148  -8.872  1.00 0.00 ? 198 LYS A HZ2  2  
ATOM 2034  H HZ3  . LYS A 1 20  ? -8.736  15.117  -7.952  1.00 0.00 ? 198 LYS A HZ3  2  
ATOM 2035  N N    . PRO A 1 21  ? -2.826  10.041  -9.774  1.00 0.00 ? 199 PRO A N    2  
ATOM 2036  C CA   . PRO A 1 21  ? -1.544  9.570   -9.240  1.00 0.00 ? 199 PRO A CA   2  
ATOM 2037  C C    . PRO A 1 21  ? -0.854  10.621  -8.377  1.00 0.00 ? 199 PRO A C    2  
ATOM 2038  O O    . PRO A 1 21  ? -0.879  11.810  -8.692  1.00 0.00 ? 199 PRO A O    2  
ATOM 2039  C CB   . PRO A 1 21  ? -0.720  9.285   -10.498 1.00 0.00 ? 199 PRO A CB   2  
ATOM 2040  C CG   . PRO A 1 21  ? -1.308  10.167  -11.544 1.00 0.00 ? 199 PRO A CG   2  
ATOM 2041  C CD   . PRO A 1 21  ? -2.775  10.263  -11.228 1.00 0.00 ? 199 PRO A CD   2  
ATOM 2042  H HA   . PRO A 1 21  ? -1.662  8.660   -8.671  1.00 0.00 ? 199 PRO A HA   2  
ATOM 2043  H HB2  . PRO A 1 21  ? 0.318   9.527   -10.313 1.00 0.00 ? 199 PRO A HB2  2  
ATOM 2044  H HB3  . PRO A 1 21  ? -0.810  8.243   -10.764 1.00 0.00 ? 199 PRO A HB3  2  
ATOM 2045  H HG2  . PRO A 1 21  ? -0.851  11.144  -11.501 1.00 0.00 ? 199 PRO A HG2  2  
ATOM 2046  H HG3  . PRO A 1 21  ? -1.163  9.726   -12.519 1.00 0.00 ? 199 PRO A HG3  2  
ATOM 2047  H HD2  . PRO A 1 21  ? -3.153  11.242  -11.483 1.00 0.00 ? 199 PRO A HD2  2  
ATOM 2048  H HD3  . PRO A 1 21  ? -3.325  9.496   -11.754 1.00 0.00 ? 199 PRO A HD3  2  
ATOM 2049  N N    . GLY A 1 22  ? -0.238  10.174  -7.287  1.00 0.00 ? 200 GLY A N    2  
ATOM 2050  C CA   . GLY A 1 22  ? 0.451   11.090  -6.396  1.00 0.00 ? 200 GLY A CA   2  
ATOM 2051  C C    . GLY A 1 22  ? -0.334  11.366  -5.129  1.00 0.00 ? 200 GLY A C    2  
ATOM 2052  O O    . GLY A 1 22  ? 0.045   12.223  -4.331  1.00 0.00 ? 200 GLY A O    2  
ATOM 2053  H H    . GLY A 1 22  ? -0.251  9.215   -7.087  1.00 0.00 ? 200 GLY A H    2  
ATOM 2054  H HA2  . GLY A 1 22  ? 1.407   10.665  -6.130  1.00 0.00 ? 200 GLY A HA2  2  
ATOM 2055  H HA3  . GLY A 1 22  ? 0.615   12.023  -6.915  1.00 0.00 ? 200 GLY A HA3  2  
ATOM 2056  N N    . MET A 1 23  ? -1.432  10.640  -4.945  1.00 0.00 ? 201 MET A N    2  
ATOM 2057  C CA   . MET A 1 23  ? -2.272  10.812  -3.765  1.00 0.00 ? 201 MET A CA   2  
ATOM 2058  C C    . MET A 1 23  ? -1.687  10.070  -2.568  1.00 0.00 ? 201 MET A C    2  
ATOM 2059  O O    . MET A 1 23  ? -1.192  8.950   -2.700  1.00 0.00 ? 201 MET A O    2  
ATOM 2060  C CB   . MET A 1 23  ? -3.690  10.312  -4.046  1.00 0.00 ? 201 MET A CB   2  
ATOM 2061  C CG   . MET A 1 23  ? -4.457  11.179  -5.032  1.00 0.00 ? 201 MET A CG   2  
ATOM 2062  S SD   . MET A 1 23  ? -6.041  10.460  -5.504  1.00 0.00 ? 201 MET A SD   2  
ATOM 2063  C CE   . MET A 1 23  ? -6.831  11.866  -6.284  1.00 0.00 ? 201 MET A CE   2  
ATOM 2064  H H    . MET A 1 23  ? -1.682  9.972   -5.617  1.00 0.00 ? 201 MET A H    2  
ATOM 2065  H HA   . MET A 1 23  ? -2.310  11.866  -3.537  1.00 0.00 ? 201 MET A HA   2  
ATOM 2066  H HB2  . MET A 1 23  ? -3.634  9.311   -4.449  1.00 0.00 ? 201 MET A HB2  2  
ATOM 2067  H HB3  . MET A 1 23  ? -4.241  10.287  -3.118  1.00 0.00 ? 201 MET A HB3  2  
ATOM 2068  H HG2  . MET A 1 23  ? -4.636  12.143  -4.579  1.00 0.00 ? 201 MET A HG2  2  
ATOM 2069  H HG3  . MET A 1 23  ? -3.856  11.307  -5.920  1.00 0.00 ? 201 MET A HG3  2  
ATOM 2070  H HE1  . MET A 1 23  ? -6.252  12.174  -7.142  1.00 0.00 ? 201 MET A HE1  2  
ATOM 2071  H HE2  . MET A 1 23  ? -7.826  11.589  -6.601  1.00 0.00 ? 201 MET A HE2  2  
ATOM 2072  H HE3  . MET A 1 23  ? -6.892  12.682  -5.578  1.00 0.00 ? 201 MET A HE3  2  
ATOM 2073  N N    . LEU A 1 24  ? -1.746  10.701  -1.400  1.00 0.00 ? 202 LEU A N    2  
ATOM 2074  C CA   . LEU A 1 24  ? -1.221  10.100  -0.179  1.00 0.00 ? 202 LEU A CA   2  
ATOM 2075  C C    . LEU A 1 24  ? -2.288  9.261   0.517   1.00 0.00 ? 202 LEU A C    2  
ATOM 2076  O O    . LEU A 1 24  ? -3.241  9.796   1.085   1.00 0.00 ? 202 LEU A O    2  
ATOM 2077  C CB   . LEU A 1 24  ? -0.712  11.188  0.769   1.00 0.00 ? 202 LEU A CB   2  
ATOM 2078  C CG   . LEU A 1 24  ? 0.502   11.984  0.288   1.00 0.00 ? 202 LEU A CG   2  
ATOM 2079  C CD1  . LEU A 1 24  ? 0.060   13.204  -0.505  1.00 0.00 ? 202 LEU A CD1  2  
ATOM 2080  C CD2  . LEU A 1 24  ? 1.369   12.398  1.468   1.00 0.00 ? 202 LEU A CD2  2  
ATOM 2081  H H    . LEU A 1 24  ? -2.152  11.591  -1.358  1.00 0.00 ? 202 LEU A H    2  
ATOM 2082  H HA   . LEU A 1 24  ? -0.397  9.459   -0.453  1.00 0.00 ? 202 LEU A HA   2  
ATOM 2083  H HB2  . LEU A 1 24  ? -1.519  11.884  0.937   1.00 0.00 ? 202 LEU A HB2  2  
ATOM 2084  H HB3  . LEU A 1 24  ? -0.449  10.713  1.704   1.00 0.00 ? 202 LEU A HB3  2  
ATOM 2085  H HG   . LEU A 1 24  ? 1.098   11.360  -0.364  1.00 0.00 ? 202 LEU A HG   2  
ATOM 2086  H HD11 . LEU A 1 24  ? -0.283  13.969  0.174   1.00 0.00 ? 202 LEU A HD11 2  
ATOM 2087  H HD12 . LEU A 1 24  ? -0.744  12.928  -1.172  1.00 0.00 ? 202 LEU A HD12 2  
ATOM 2088  H HD13 . LEU A 1 24  ? 0.892   13.579  -1.081  1.00 0.00 ? 202 LEU A HD13 2  
ATOM 2089  H HD21 . LEU A 1 24  ? 0.764   12.444  2.361   1.00 0.00 ? 202 LEU A HD21 2  
ATOM 2090  H HD22 . LEU A 1 24  ? 1.800   13.369  1.274   1.00 0.00 ? 202 LEU A HD22 2  
ATOM 2091  H HD23 . LEU A 1 24  ? 2.159   11.674  1.605   1.00 0.00 ? 202 LEU A HD23 2  
ATOM 2092  N N    . LEU A 1 25  ? -2.120  7.944   0.471   1.00 0.00 ? 203 LEU A N    2  
ATOM 2093  C CA   . LEU A 1 25  ? -3.067  7.030   1.099   1.00 0.00 ? 203 LEU A CA   2  
ATOM 2094  C C    . LEU A 1 25  ? -2.360  6.108   2.088   1.00 0.00 ? 203 LEU A C    2  
ATOM 2095  O O    . LEU A 1 25  ? -1.182  5.790   1.925   1.00 0.00 ? 203 LEU A O    2  
ATOM 2096  C CB   . LEU A 1 25  ? -3.787  6.200   0.035   1.00 0.00 ? 203 LEU A CB   2  
ATOM 2097  C CG   . LEU A 1 25  ? -4.671  6.978   -0.939  1.00 0.00 ? 203 LEU A CG   2  
ATOM 2098  C CD1  . LEU A 1 25  ? -3.835  7.949   -1.760  1.00 0.00 ? 203 LEU A CD1  2  
ATOM 2099  C CD2  . LEU A 1 25  ? -5.430  6.025   -1.850  1.00 0.00 ? 203 LEU A CD2  2  
ATOM 2100  H H    . LEU A 1 25  ? -1.341  7.577   0.004   1.00 0.00 ? 203 LEU A H    2  
ATOM 2101  H HA   . LEU A 1 25  ? -3.794  7.622   1.635   1.00 0.00 ? 203 LEU A HA   2  
ATOM 2102  H HB2  . LEU A 1 25  ? -3.037  5.680   -0.541  1.00 0.00 ? 203 LEU A HB2  2  
ATOM 2103  H HB3  . LEU A 1 25  ? -4.410  5.479   0.545   1.00 0.00 ? 203 LEU A HB3  2  
ATOM 2104  H HG   . LEU A 1 25  ? -5.394  7.554   -0.378  1.00 0.00 ? 203 LEU A HG   2  
ATOM 2105  H HD11 . LEU A 1 25  ? -2.794  7.671   -1.694  1.00 0.00 ? 203 LEU A HD11 2  
ATOM 2106  H HD12 . LEU A 1 25  ? -3.965  8.950   -1.376  1.00 0.00 ? 203 LEU A HD12 2  
ATOM 2107  H HD13 . LEU A 1 25  ? -4.153  7.914   -2.791  1.00 0.00 ? 203 LEU A HD13 2  
ATOM 2108  H HD21 . LEU A 1 25  ? -5.697  5.136   -1.297  1.00 0.00 ? 203 LEU A HD21 2  
ATOM 2109  H HD22 . LEU A 1 25  ? -4.805  5.752   -2.688  1.00 0.00 ? 203 LEU A HD22 2  
ATOM 2110  H HD23 . LEU A 1 25  ? -6.326  6.508   -2.210  1.00 0.00 ? 203 LEU A HD23 2  
ATOM 2111  N N    . THR A 1 26  ? -3.089  5.679   3.114   1.00 0.00 ? 204 THR A N    2  
ATOM 2112  C CA   . THR A 1 26  ? -2.532  4.792   4.128   1.00 0.00 ? 204 THR A CA   2  
ATOM 2113  C C    . THR A 1 26  ? -3.261  3.453   4.148   1.00 0.00 ? 204 THR A C    2  
ATOM 2114  O O    . THR A 1 26  ? -4.456  3.390   4.433   1.00 0.00 ? 204 THR A O    2  
ATOM 2115  C CB   . THR A 1 26  ? -2.608  5.425   5.530   1.00 0.00 ? 204 THR A CB   2  
ATOM 2116  O OG1  . THR A 1 26  ? -2.218  6.802   5.468   1.00 0.00 ? 204 THR A OG1  2  
ATOM 2117  C CG2  . THR A 1 26  ? -1.711  4.683   6.509   1.00 0.00 ? 204 THR A CG2  2  
ATOM 2118  H H    . THR A 1 26  ? -4.022  5.966   3.189   1.00 0.00 ? 204 THR A H    2  
ATOM 2119  H HA   . THR A 1 26  ? -1.493  4.622   3.889   1.00 0.00 ? 204 THR A HA   2  
ATOM 2120  H HB   . THR A 1 26  ? -3.628  5.364   5.882   1.00 0.00 ? 204 THR A HB   2  
ATOM 2121  H HG1  . THR A 1 26  ? -2.023  7.120   6.353   1.00 0.00 ? 204 THR A HG1  2  
ATOM 2122  H HG21 . THR A 1 26  ? -2.261  4.474   7.415   1.00 0.00 ? 204 THR A HG21 2  
ATOM 2123  H HG22 . THR A 1 26  ? -0.850  5.292   6.742   1.00 0.00 ? 204 THR A HG22 2  
ATOM 2124  H HG23 . THR A 1 26  ? -1.385  3.755   6.064   1.00 0.00 ? 204 THR A HG23 2  
ATOM 2125  N N    . GLY A 1 27  ? -2.532  2.383   3.844   1.00 0.00 ? 205 GLY A N    2  
ATOM 2126  C CA   . GLY A 1 27  ? -3.127  1.060   3.833   1.00 0.00 ? 205 GLY A CA   2  
ATOM 2127  C C    . GLY A 1 27  ? -2.467  0.120   4.823   1.00 0.00 ? 205 GLY A C    2  
ATOM 2128  O O    . GLY A 1 27  ? -1.628  0.536   5.622   1.00 0.00 ? 205 GLY A O    2  
ATOM 2129  H H    . GLY A 1 27  ? -1.583  2.494   3.625   1.00 0.00 ? 205 GLY A H    2  
ATOM 2130  H HA2  . GLY A 1 27  ? -4.175  1.146   4.078   1.00 0.00 ? 205 GLY A HA2  2  
ATOM 2131  H HA3  . GLY A 1 27  ? -3.032  0.643   2.841   1.00 0.00 ? 205 GLY A HA3  2  
ATOM 2132  N N    . THR A 1 28  ? -2.848  -1.153  4.772   1.00 0.00 ? 206 THR A N    2  
ATOM 2133  C CA   . THR A 1 28  ? -2.291  -2.154  5.673   1.00 0.00 ? 206 THR A CA   2  
ATOM 2134  C C    . THR A 1 28  ? -1.791  -3.370  4.902   1.00 0.00 ? 206 THR A C    2  
ATOM 2135  O O    . THR A 1 28  ? -2.431  -3.820  3.951   1.00 0.00 ? 206 THR A O    2  
ATOM 2136  C CB   . THR A 1 28  ? -3.328  -2.612  6.716   1.00 0.00 ? 206 THR A CB   2  
ATOM 2137  O OG1  . THR A 1 28  ? -4.598  -2.817  6.086   1.00 0.00 ? 206 THR A OG1  2  
ATOM 2138  C CG2  . THR A 1 28  ? -3.468  -1.583  7.827   1.00 0.00 ? 206 THR A CG2  2  
ATOM 2139  H H    . THR A 1 28  ? -3.521  -1.423  4.113   1.00 0.00 ? 206 THR A H    2  
ATOM 2140  H HA   . THR A 1 28  ? -1.459  -1.705  6.196   1.00 0.00 ? 206 THR A HA   2  
ATOM 2141  H HB   . THR A 1 28  ? -2.994  -3.544  7.148   1.00 0.00 ? 206 THR A HB   2  
ATOM 2142  H HG1  . THR A 1 28  ? -5.290  -2.804  6.751   1.00 0.00 ? 206 THR A HG1  2  
ATOM 2143  H HG21 . THR A 1 28  ? -3.398  -2.076  8.786   1.00 0.00 ? 206 THR A HG21 2  
ATOM 2144  H HG22 . THR A 1 28  ? -4.426  -1.091  7.744   1.00 0.00 ? 206 THR A HG22 2  
ATOM 2145  H HG23 . THR A 1 28  ? -2.679  -0.851  7.741   1.00 0.00 ? 206 THR A HG23 2  
ATOM 2146  N N    . VAL A 1 29  ? -0.645  -3.900  5.318   1.00 0.00 ? 207 VAL A N    2  
ATOM 2147  C CA   . VAL A 1 29  ? -0.061  -5.066  4.667   1.00 0.00 ? 207 VAL A CA   2  
ATOM 2148  C C    . VAL A 1 29  ? -0.992  -6.270  4.756   1.00 0.00 ? 207 VAL A C    2  
ATOM 2149  O O    . VAL A 1 29  ? -1.344  -6.715  5.848   1.00 0.00 ? 207 VAL A O    2  
ATOM 2150  C CB   . VAL A 1 29  ? 1.298   -5.435  5.290   1.00 0.00 ? 207 VAL A CB   2  
ATOM 2151  C CG1  . VAL A 1 29  ? 1.878   -6.668  4.615   1.00 0.00 ? 207 VAL A CG1  2  
ATOM 2152  C CG2  . VAL A 1 29  ? 2.263   -4.262  5.197   1.00 0.00 ? 207 VAL A CG2  2  
ATOM 2153  H H    . VAL A 1 29  ? -0.182  -3.496  6.081   1.00 0.00 ? 207 VAL A H    2  
ATOM 2154  H HA   . VAL A 1 29  ? 0.098   -4.823  3.626   1.00 0.00 ? 207 VAL A HA   2  
ATOM 2155  H HB   . VAL A 1 29  ? 1.142   -5.663  6.334   1.00 0.00 ? 207 VAL A HB   2  
ATOM 2156  H HG11 . VAL A 1 29  ? 2.830   -6.419  4.168   1.00 0.00 ? 207 VAL A HG11 2  
ATOM 2157  H HG12 . VAL A 1 29  ? 2.017   -7.449  5.349   1.00 0.00 ? 207 VAL A HG12 2  
ATOM 2158  H HG13 . VAL A 1 29  ? 1.200   -7.011  3.848   1.00 0.00 ? 207 VAL A HG13 2  
ATOM 2159  H HG21 . VAL A 1 29  ? 2.238   -3.703  6.120   1.00 0.00 ? 207 VAL A HG21 2  
ATOM 2160  H HG22 . VAL A 1 29  ? 3.264   -4.632  5.026   1.00 0.00 ? 207 VAL A HG22 2  
ATOM 2161  H HG23 . VAL A 1 29  ? 1.972   -3.621  4.378   1.00 0.00 ? 207 VAL A HG23 2  
ATOM 2162  N N    . SER A 1 30  ? -1.389  -6.792  3.600   1.00 0.00 ? 208 SER A N    2  
ATOM 2163  C CA   . SER A 1 30  ? -2.283  -7.943  3.547   1.00 0.00 ? 208 SER A CA   2  
ATOM 2164  C C    . SER A 1 30  ? -1.494  -9.247  3.625   1.00 0.00 ? 208 SER A C    2  
ATOM 2165  O O    . SER A 1 30  ? -1.921  -10.205 4.268   1.00 0.00 ? 208 SER A O    2  
ATOM 2166  C CB   . SER A 1 30  ? -3.114  -7.911  2.263   1.00 0.00 ? 208 SER A CB   2  
ATOM 2167  O OG   . SER A 1 30  ? -4.052  -8.973  2.237   1.00 0.00 ? 208 SER A OG   2  
ATOM 2168  H H    . SER A 1 30  ? -1.074  -6.391  2.762   1.00 0.00 ? 208 SER A H    2  
ATOM 2169  H HA   . SER A 1 30  ? -2.946  -7.886  4.397   1.00 0.00 ? 208 SER A HA   2  
ATOM 2170  H HB2  . SER A 1 30  ? -3.647  -6.975  2.205   1.00 0.00 ? 208 SER A HB2  2  
ATOM 2171  H HB3  . SER A 1 30  ? -2.457  -8.005  1.410   1.00 0.00 ? 208 SER A HB3  2  
ATOM 2172  H HG   . SER A 1 30  ? -4.351  -9.159  3.130   1.00 0.00 ? 208 SER A HG   2  
ATOM 2173  N N    . SER A 1 31  ? -0.342  -9.274  2.964   1.00 0.00 ? 209 SER A N    2  
ATOM 2174  C CA   . SER A 1 31  ? 0.505   -10.461 2.953   1.00 0.00 ? 209 SER A CA   2  
ATOM 2175  C C    . SER A 1 31  ? 1.953   -10.092 2.642   1.00 0.00 ? 209 SER A C    2  
ATOM 2176  O O    . SER A 1 31  ? 2.224   -9.064  2.022   1.00 0.00 ? 209 SER A O    2  
ATOM 2177  C CB   . SER A 1 31  ? -0.008  -11.471 1.925   1.00 0.00 ? 209 SER A CB   2  
ATOM 2178  O OG   . SER A 1 31  ? -0.138  -10.876 0.646   1.00 0.00 ? 209 SER A OG   2  
ATOM 2179  H H    . SER A 1 31  ? -0.056  -8.478  2.469   1.00 0.00 ? 209 SER A H    2  
ATOM 2180  H HA   . SER A 1 31  ? 0.463   -10.907 3.936   1.00 0.00 ? 209 SER A HA   2  
ATOM 2181  H HB2  . SER A 1 31  ? 0.686   -12.295 1.857   1.00 0.00 ? 209 SER A HB2  2  
ATOM 2182  H HB3  . SER A 1 31  ? -0.974  -11.839 2.238   1.00 0.00 ? 209 SER A HB3  2  
ATOM 2183  H HG   . SER A 1 31  ? -0.976  -10.411 0.593   1.00 0.00 ? 209 SER A HG   2  
ATOM 2184  N N    . LEU A 1 32  ? 2.879   -10.940 3.077   1.00 0.00 ? 210 LEU A N    2  
ATOM 2185  C CA   . LEU A 1 32  ? 4.300   -10.705 2.846   1.00 0.00 ? 210 LEU A CA   2  
ATOM 2186  C C    . LEU A 1 32  ? 4.859   -11.700 1.834   1.00 0.00 ? 210 LEU A C    2  
ATOM 2187  O O    . LEU A 1 32  ? 4.756   -12.912 2.020   1.00 0.00 ? 210 LEU A O    2  
ATOM 2188  C CB   . LEU A 1 32  ? 5.075   -10.808 4.161   1.00 0.00 ? 210 LEU A CB   2  
ATOM 2189  C CG   . LEU A 1 32  ? 5.027   -9.576  5.066   1.00 0.00 ? 210 LEU A CG   2  
ATOM 2190  C CD1  . LEU A 1 32  ? 3.693   -9.498  5.792   1.00 0.00 ? 210 LEU A CD1  2  
ATOM 2191  C CD2  . LEU A 1 32  ? 6.178   -9.602  6.062   1.00 0.00 ? 210 LEU A CD2  2  
ATOM 2192  H H    . LEU A 1 32  ? 2.602   -11.742 3.566   1.00 0.00 ? 210 LEU A H    2  
ATOM 2193  H HA   . LEU A 1 32  ? 4.411   -9.707  2.450   1.00 0.00 ? 210 LEU A HA   2  
ATOM 2194  H HB2  . LEU A 1 32  ? 4.674   -11.642 4.717   1.00 0.00 ? 210 LEU A HB2  2  
ATOM 2195  H HB3  . LEU A 1 32  ? 6.110   -11.003 3.920   1.00 0.00 ? 210 LEU A HB3  2  
ATOM 2196  H HG   . LEU A 1 32  ? 5.129   -8.687  4.459   1.00 0.00 ? 210 LEU A HG   2  
ATOM 2197  H HD11 . LEU A 1 32  ? 3.666   -10.240 6.576   1.00 0.00 ? 210 LEU A HD11 2  
ATOM 2198  H HD12 . LEU A 1 32  ? 2.892   -9.683  5.093   1.00 0.00 ? 210 LEU A HD12 2  
ATOM 2199  H HD13 . LEU A 1 32  ? 3.575   -8.514  6.223   1.00 0.00 ? 210 LEU A HD13 2  
ATOM 2200  H HD21 . LEU A 1 32  ? 6.288   -8.624  6.509   1.00 0.00 ? 210 LEU A HD21 2  
ATOM 2201  H HD22 . LEU A 1 32  ? 7.091   -9.868  5.550   1.00 0.00 ? 210 LEU A HD22 2  
ATOM 2202  H HD23 . LEU A 1 32  ? 5.971   -10.329 6.833   1.00 0.00 ? 210 LEU A HD23 2  
ATOM 2203  N N    . GLU A 1 33  ? 5.453   -11.179 0.765   1.00 0.00 ? 211 GLU A N    2  
ATOM 2204  C CA   . GLU A 1 33  ? 6.029   -12.023 -0.275  1.00 0.00 ? 211 GLU A CA   2  
ATOM 2205  C C    . GLU A 1 33  ? 7.541   -11.834 -0.353  1.00 0.00 ? 211 GLU A C    2  
ATOM 2206  O O    . GLU A 1 33  ? 8.093   -10.908 0.241   1.00 0.00 ? 211 GLU A O    2  
ATOM 2207  C CB   . GLU A 1 33  ? 5.394   -11.706 -1.630  1.00 0.00 ? 211 GLU A CB   2  
ATOM 2208  C CG   . GLU A 1 33  ? 3.874   -11.718 -1.608  1.00 0.00 ? 211 GLU A CG   2  
ATOM 2209  C CD   . GLU A 1 33  ? 3.270   -11.593 -2.993  1.00 0.00 ? 211 GLU A CD   2  
ATOM 2210  O OE1  . GLU A 1 33  ? 3.837   -10.853 -3.824  1.00 0.00 ? 211 GLU A OE1  2  
ATOM 2211  O OE2  . GLU A 1 33  ? 2.229   -12.235 -3.246  1.00 0.00 ? 211 GLU A OE2  2  
ATOM 2212  H H    . GLU A 1 33  ? 5.503   -10.205 0.673   1.00 0.00 ? 211 GLU A H    2  
ATOM 2213  H HA   . GLU A 1 33  ? 5.819   -13.051 -0.022  1.00 0.00 ? 211 GLU A HA   2  
ATOM 2214  H HB2  . GLU A 1 33  ? 5.721   -10.727 -1.948  1.00 0.00 ? 211 GLU A HB2  2  
ATOM 2215  H HB3  . GLU A 1 33  ? 5.728   -12.438 -2.351  1.00 0.00 ? 211 GLU A HB3  2  
ATOM 2216  H HG2  . GLU A 1 33  ? 3.541   -12.646 -1.170  1.00 0.00 ? 211 GLU A HG2  2  
ATOM 2217  H HG3  . GLU A 1 33  ? 3.529   -10.892 -1.005  1.00 0.00 ? 211 GLU A HG3  2  
ATOM 2218  N N    . ASP A 1 34  ? 8.204   -12.718 -1.090  1.00 0.00 ? 212 ASP A N    2  
ATOM 2219  C CA   . ASP A 1 34  ? 9.653   -12.650 -1.247  1.00 0.00 ? 212 ASP A CA   2  
ATOM 2220  C C    . ASP A 1 34  ? 10.032  -11.713 -2.390  1.00 0.00 ? 212 ASP A C    2  
ATOM 2221  O O    . ASP A 1 34  ? 11.137  -11.172 -2.422  1.00 0.00 ? 212 ASP A O    2  
ATOM 2222  C CB   . ASP A 1 34  ? 10.226  -14.045 -1.502  1.00 0.00 ? 212 ASP A CB   2  
ATOM 2223  C CG   . ASP A 1 34  ? 9.542   -14.749 -2.657  1.00 0.00 ? 212 ASP A CG   2  
ATOM 2224  O OD1  . ASP A 1 34  ? 8.348   -15.090 -2.522  1.00 0.00 ? 212 ASP A OD1  2  
ATOM 2225  O OD2  . ASP A 1 34  ? 10.201  -14.959 -3.697  1.00 0.00 ? 212 ASP A OD2  2  
ATOM 2226  H H    . ASP A 1 34  ? 7.708   -13.434 -1.539  1.00 0.00 ? 212 ASP A H    2  
ATOM 2227  H HA   . ASP A 1 34  ? 10.068  -12.263 -0.328  1.00 0.00 ? 212 ASP A HA   2  
ATOM 2228  H HB2  . ASP A 1 34  ? 11.279  -13.958 -1.730  1.00 0.00 ? 212 ASP A HB2  2  
ATOM 2229  H HB3  . ASP A 1 34  ? 10.103  -14.646 -0.613  1.00 0.00 ? 212 ASP A HB3  2  
ATOM 2230  N N    . HIS A 1 35  ? 9.108   -11.528 -3.327  1.00 0.00 ? 213 HIS A N    2  
ATOM 2231  C CA   . HIS A 1 35  ? 9.345   -10.657 -4.473  1.00 0.00 ? 213 HIS A CA   2  
ATOM 2232  C C    . HIS A 1 35  ? 8.866   -9.237  -4.185  1.00 0.00 ? 213 HIS A C    2  
ATOM 2233  O O    . HIS A 1 35  ? 9.208   -8.299  -4.903  1.00 0.00 ? 213 HIS A O    2  
ATOM 2234  C CB   . HIS A 1 35  ? 8.637   -11.205 -5.712  1.00 0.00 ? 213 HIS A CB   2  
ATOM 2235  C CG   . HIS A 1 35  ? 8.874   -12.666 -5.941  1.00 0.00 ? 213 HIS A CG   2  
ATOM 2236  N ND1  . HIS A 1 35  ? 7.853   -13.579 -6.096  1.00 0.00 ? 213 HIS A ND1  2  
ATOM 2237  C CD2  . HIS A 1 35  ? 10.025  -13.371 -6.042  1.00 0.00 ? 213 HIS A CD2  2  
ATOM 2238  C CE1  . HIS A 1 35  ? 8.365   -14.783 -6.281  1.00 0.00 ? 213 HIS A CE1  2  
ATOM 2239  N NE2  . HIS A 1 35  ? 9.682   -14.684 -6.253  1.00 0.00 ? 213 HIS A NE2  2  
ATOM 2240  H H    . HIS A 1 35  ? 8.246   -11.987 -3.246  1.00 0.00 ? 213 HIS A H    2  
ATOM 2241  H HA   . HIS A 1 35  ? 10.408  -10.634 -4.657  1.00 0.00 ? 213 HIS A HA   2  
ATOM 2242  H HB2  . HIS A 1 35  ? 7.573   -11.055 -5.606  1.00 0.00 ? 213 HIS A HB2  2  
ATOM 2243  H HB3  . HIS A 1 35  ? 8.986   -10.671 -6.584  1.00 0.00 ? 213 HIS A HB3  2  
ATOM 2244  H HD1  . HIS A 1 35  ? 6.895   -13.376 -6.072  1.00 0.00 ? 213 HIS A HD1  2  
ATOM 2245  H HD2  . HIS A 1 35  ? 11.029  -12.975 -5.970  1.00 0.00 ? 213 HIS A HD2  2  
ATOM 2246  H HE1  . HIS A 1 35  ? 7.804   -15.693 -6.430  1.00 0.00 ? 213 HIS A HE1  2  
ATOM 2247  H HE2  . HIS A 1 35  ? 10.305  -15.439 -6.279  1.00 0.00 ? 213 HIS A HE2  2  
ATOM 2248  N N    . GLY A 1 36  ? 8.072   -9.089  -3.129  1.00 0.00 ? 214 GLY A N    2  
ATOM 2249  C CA   . GLY A 1 36  ? 7.559   -7.781  -2.765  1.00 0.00 ? 214 GLY A CA   2  
ATOM 2250  C C    . GLY A 1 36  ? 6.595   -7.841  -1.596  1.00 0.00 ? 214 GLY A C    2  
ATOM 2251  O O    . GLY A 1 36  ? 6.497   -8.862  -0.916  1.00 0.00 ? 214 GLY A O    2  
ATOM 2252  H H    . GLY A 1 36  ? 7.833   -9.873  -2.592  1.00 0.00 ? 214 GLY A H    2  
ATOM 2253  H HA2  . GLY A 1 36  ? 8.388   -7.141  -2.503  1.00 0.00 ? 214 GLY A HA2  2  
ATOM 2254  H HA3  . GLY A 1 36  ? 7.046   -7.358  -3.617  1.00 0.00 ? 214 GLY A HA3  2  
ATOM 2255  N N    . TYR A 1 37  ? 5.884   -6.744  -1.361  1.00 0.00 ? 215 TYR A N    2  
ATOM 2256  C CA   . TYR A 1 37  ? 4.926   -6.674  -0.264  1.00 0.00 ? 215 TYR A CA   2  
ATOM 2257  C C    . TYR A 1 37  ? 3.551   -6.246  -0.767  1.00 0.00 ? 215 TYR A C    2  
ATOM 2258  O O    . TYR A 1 37  ? 3.433   -5.335  -1.588  1.00 0.00 ? 215 TYR A O    2  
ATOM 2259  C CB   . TYR A 1 37  ? 5.416   -5.698  0.807   1.00 0.00 ? 215 TYR A CB   2  
ATOM 2260  C CG   . TYR A 1 37  ? 6.585   -6.219  1.613   1.00 0.00 ? 215 TYR A CG   2  
ATOM 2261  C CD1  . TYR A 1 37  ? 6.380   -6.975  2.761   1.00 0.00 ? 215 TYR A CD1  2  
ATOM 2262  C CD2  . TYR A 1 37  ? 7.893   -5.956  1.227   1.00 0.00 ? 215 TYR A CD2  2  
ATOM 2263  C CE1  . TYR A 1 37  ? 7.444   -7.453  3.501   1.00 0.00 ? 215 TYR A CE1  2  
ATOM 2264  C CE2  . TYR A 1 37  ? 8.963   -6.432  1.960   1.00 0.00 ? 215 TYR A CE2  2  
ATOM 2265  C CZ   . TYR A 1 37  ? 8.734   -7.179  3.096   1.00 0.00 ? 215 TYR A CZ   2  
ATOM 2266  O OH   . TYR A 1 37  ? 9.797   -7.653  3.829   1.00 0.00 ? 215 TYR A OH   2  
ATOM 2267  H H    . TYR A 1 37  ? 6.006   -5.961  -1.939  1.00 0.00 ? 215 TYR A H    2  
ATOM 2268  H HA   . TYR A 1 37  ? 4.848   -7.660  0.170   1.00 0.00 ? 215 TYR A HA   2  
ATOM 2269  H HB2  . TYR A 1 37  ? 5.726   -4.779  0.333   1.00 0.00 ? 215 TYR A HB2  2  
ATOM 2270  H HB3  . TYR A 1 37  ? 4.608   -5.489  1.492   1.00 0.00 ? 215 TYR A HB3  2  
ATOM 2271  H HD1  . TYR A 1 37  ? 5.368   -7.188  3.075   1.00 0.00 ? 215 TYR A HD1  2  
ATOM 2272  H HD2  . TYR A 1 37  ? 8.070   -5.370  0.336   1.00 0.00 ? 215 TYR A HD2  2  
ATOM 2273  H HE1  . TYR A 1 37  ? 7.265   -8.039  4.390   1.00 0.00 ? 215 TYR A HE1  2  
ATOM 2274  H HE2  . TYR A 1 37  ? 9.973   -6.217  1.643   1.00 0.00 ? 215 TYR A HE2  2  
ATOM 2275  H HH   . TYR A 1 37  ? 10.617  -7.444  3.376   1.00 0.00 ? 215 TYR A HH   2  
ATOM 2276  N N    . LEU A 1 38  ? 2.514   -6.909  -0.269  1.00 0.00 ? 216 LEU A N    2  
ATOM 2277  C CA   . LEU A 1 38  ? 1.145   -6.598  -0.666  1.00 0.00 ? 216 LEU A CA   2  
ATOM 2278  C C    . LEU A 1 38  ? 0.542   -5.533  0.245   1.00 0.00 ? 216 LEU A C    2  
ATOM 2279  O O    . LEU A 1 38  ? 0.573   -5.658  1.469   1.00 0.00 ? 216 LEU A O    2  
ATOM 2280  C CB   . LEU A 1 38  ? 0.283   -7.862  -0.631  1.00 0.00 ? 216 LEU A CB   2  
ATOM 2281  C CG   . LEU A 1 38  ? 0.277   -8.705  -1.907  1.00 0.00 ? 216 LEU A CG   2  
ATOM 2282  C CD1  . LEU A 1 38  ? -0.590  -8.053  -2.973  1.00 0.00 ? 216 LEU A CD1  2  
ATOM 2283  C CD2  . LEU A 1 38  ? 1.695   -8.906  -2.421  1.00 0.00 ? 216 LEU A CD2  2  
ATOM 2284  H H    . LEU A 1 38  ? 2.671   -7.624  0.382   1.00 0.00 ? 216 LEU A H    2  
ATOM 2285  H HA   . LEU A 1 38  ? 1.171   -6.218  -1.676  1.00 0.00 ? 216 LEU A HA   2  
ATOM 2286  H HB2  . LEU A 1 38  ? 0.642   -8.484  0.174   1.00 0.00 ? 216 LEU A HB2  2  
ATOM 2287  H HB3  . LEU A 1 38  ? -0.734  -7.562  -0.426  1.00 0.00 ? 216 LEU A HB3  2  
ATOM 2288  H HG   . LEU A 1 38  ? -0.142  -9.677  -1.686  1.00 0.00 ? 216 LEU A HG   2  
ATOM 2289  H HD11 . LEU A 1 38  ? -0.774  -8.758  -3.769  1.00 0.00 ? 216 LEU A HD11 2  
ATOM 2290  H HD12 . LEU A 1 38  ? -0.082  -7.186  -3.370  1.00 0.00 ? 216 LEU A HD12 2  
ATOM 2291  H HD13 . LEU A 1 38  ? -1.531  -7.749  -2.536  1.00 0.00 ? 216 LEU A HD13 2  
ATOM 2292  H HD21 . LEU A 1 38  ? 1.661   -9.277  -3.435  1.00 0.00 ? 216 LEU A HD21 2  
ATOM 2293  H HD22 . LEU A 1 38  ? 2.206   -9.622  -1.793  1.00 0.00 ? 216 LEU A HD22 2  
ATOM 2294  H HD23 . LEU A 1 38  ? 2.223   -7.965  -2.398  1.00 0.00 ? 216 LEU A HD23 2  
ATOM 2295  N N    . VAL A 1 39  ? -0.008  -4.486  -0.362  1.00 0.00 ? 217 VAL A N    2  
ATOM 2296  C CA   . VAL A 1 39  ? -0.621  -3.400  0.394   1.00 0.00 ? 217 VAL A CA   2  
ATOM 2297  C C    . VAL A 1 39  ? -2.130  -3.364  0.178   1.00 0.00 ? 217 VAL A C    2  
ATOM 2298  O O    . VAL A 1 39  ? -2.609  -3.489  -0.950  1.00 0.00 ? 217 VAL A O    2  
ATOM 2299  C CB   . VAL A 1 39  ? -0.024  -2.036  0.001   1.00 0.00 ? 217 VAL A CB   2  
ATOM 2300  C CG1  . VAL A 1 39  ? -0.644  -0.922  0.832   1.00 0.00 ? 217 VAL A CG1  2  
ATOM 2301  C CG2  . VAL A 1 39  ? 1.489   -2.051  0.159   1.00 0.00 ? 217 VAL A CG2  2  
ATOM 2302  H H    . VAL A 1 39  ? -0.002  -4.443  -1.341  1.00 0.00 ? 217 VAL A H    2  
ATOM 2303  H HA   . VAL A 1 39  ? -0.421  -3.568  1.442   1.00 0.00 ? 217 VAL A HA   2  
ATOM 2304  H HB   . VAL A 1 39  ? -0.255  -1.850  -1.038  1.00 0.00 ? 217 VAL A HB   2  
ATOM 2305  H HG11 . VAL A 1 39  ? -0.982  -1.324  1.776   1.00 0.00 ? 217 VAL A HG11 2  
ATOM 2306  H HG12 . VAL A 1 39  ? 0.092   -0.152  1.009   1.00 0.00 ? 217 VAL A HG12 2  
ATOM 2307  H HG13 . VAL A 1 39  ? -1.484  -0.502  0.299   1.00 0.00 ? 217 VAL A HG13 2  
ATOM 2308  H HG21 . VAL A 1 39  ? 1.799   -1.187  0.727   1.00 0.00 ? 217 VAL A HG21 2  
ATOM 2309  H HG22 . VAL A 1 39  ? 1.788   -2.950  0.679   1.00 0.00 ? 217 VAL A HG22 2  
ATOM 2310  H HG23 . VAL A 1 39  ? 1.953   -2.028  -0.815  1.00 0.00 ? 217 VAL A HG23 2  
ATOM 2311  N N    . ASP A 1 40  ? -2.874  -3.191  1.264   1.00 0.00 ? 218 ASP A N    2  
ATOM 2312  C CA   . ASP A 1 40  ? -4.329  -3.136  1.194   1.00 0.00 ? 218 ASP A CA   2  
ATOM 2313  C C    . ASP A 1 40  ? -4.806  -1.717  0.901   1.00 0.00 ? 218 ASP A C    2  
ATOM 2314  O O    . ASP A 1 40  ? -4.313  -0.753  1.486   1.00 0.00 ? 218 ASP A O    2  
ATOM 2315  C CB   . ASP A 1 40  ? -4.943  -3.633  2.504   1.00 0.00 ? 218 ASP A CB   2  
ATOM 2316  C CG   . ASP A 1 40  ? -6.324  -4.228  2.307   1.00 0.00 ? 218 ASP A CG   2  
ATOM 2317  O OD1  . ASP A 1 40  ? -6.451  -5.179  1.508   1.00 0.00 ? 218 ASP A OD1  2  
ATOM 2318  O OD2  . ASP A 1 40  ? -7.278  -3.741  2.950   1.00 0.00 ? 218 ASP A OD2  2  
ATOM 2319  H H    . ASP A 1 40  ? -2.433  -3.097  2.135   1.00 0.00 ? 218 ASP A H    2  
ATOM 2320  H HA   . ASP A 1 40  ? -4.647  -3.783  0.390   1.00 0.00 ? 218 ASP A HA   2  
ATOM 2321  H HB2  . ASP A 1 40  ? -4.303  -4.392  2.929   1.00 0.00 ? 218 ASP A HB2  2  
ATOM 2322  H HB3  . ASP A 1 40  ? -5.022  -2.806  3.193   1.00 0.00 ? 218 ASP A HB3  2  
ATOM 2323  N N    . ILE A 1 41  ? -5.766  -1.598  -0.010  1.00 0.00 ? 219 ILE A N    2  
ATOM 2324  C CA   . ILE A 1 41  ? -6.309  -0.297  -0.381  1.00 0.00 ? 219 ILE A CA   2  
ATOM 2325  C C    . ILE A 1 41  ? -7.809  -0.231  -0.115  1.00 0.00 ? 219 ILE A C    2  
ATOM 2326  O O    . ILE A 1 41  ? -8.405  0.845   -0.124  1.00 0.00 ? 219 ILE A O    2  
ATOM 2327  C CB   . ILE A 1 41  ? -6.049  0.019   -1.866  1.00 0.00 ? 219 ILE A CB   2  
ATOM 2328  C CG1  . ILE A 1 41  ? -6.561  -1.120  -2.750  1.00 0.00 ? 219 ILE A CG1  2  
ATOM 2329  C CG2  . ILE A 1 41  ? -4.565  0.256   -2.105  1.00 0.00 ? 219 ILE A CG2  2  
ATOM 2330  C CD1  . ILE A 1 41  ? -6.480  -0.819  -4.230  1.00 0.00 ? 219 ILE A CD1  2  
ATOM 2331  H H    . ILE A 1 41  ? -6.118  -2.403  -0.442  1.00 0.00 ? 219 ILE A H    2  
ATOM 2332  H HA   . ILE A 1 41  ? -5.814  0.454   0.218   1.00 0.00 ? 219 ILE A HA   2  
ATOM 2333  H HB   . ILE A 1 41  ? -6.578  0.926   -2.116  1.00 0.00 ? 219 ILE A HB   2  
ATOM 2334  H HG12 . ILE A 1 41  ? -5.975  -2.006  -2.560  1.00 0.00 ? 219 ILE A HG12 2  
ATOM 2335  H HG13 . ILE A 1 41  ? -7.595  -1.317  -2.506  1.00 0.00 ? 219 ILE A HG13 2  
ATOM 2336  H HG21 . ILE A 1 41  ? -4.146  -0.587  -2.634  1.00 0.00 ? 219 ILE A HG21 2  
ATOM 2337  H HG22 . ILE A 1 41  ? -4.434  1.151   -2.695  1.00 0.00 ? 219 ILE A HG22 2  
ATOM 2338  H HG23 . ILE A 1 41  ? -4.061  0.373   -1.157  1.00 0.00 ? 219 ILE A HG23 2  
ATOM 2339  H HD11 . ILE A 1 41  ? -6.850  -1.665  -4.791  1.00 0.00 ? 219 ILE A HD11 2  
ATOM 2340  H HD12 . ILE A 1 41  ? -7.078  0.052   -4.454  1.00 0.00 ? 219 ILE A HD12 2  
ATOM 2341  H HD13 . ILE A 1 41  ? -5.452  -0.629  -4.504  1.00 0.00 ? 219 ILE A HD13 2  
ATOM 2342  N N    . GLY A 1 42  ? -8.414  -1.390  0.125   1.00 0.00 ? 220 GLY A N    2  
ATOM 2343  C CA   . GLY A 1 42  ? -9.839  -1.442  0.393   1.00 0.00 ? 220 GLY A CA   2  
ATOM 2344  C C    . GLY A 1 42  ? -10.672 -1.149  -0.839  1.00 0.00 ? 220 GLY A C    2  
ATOM 2345  O O    . GLY A 1 42  ? -11.569 -0.307  -0.805  1.00 0.00 ? 220 GLY A O    2  
ATOM 2346  H H    . GLY A 1 42  ? -7.888  -2.217  0.120   1.00 0.00 ? 220 GLY A H    2  
ATOM 2347  H HA2  . GLY A 1 42  ? -10.090 -2.427  0.758   1.00 0.00 ? 220 GLY A HA2  2  
ATOM 2348  H HA3  . GLY A 1 42  ? -10.077 -0.715  1.155   1.00 0.00 ? 220 GLY A HA3  2  
ATOM 2349  N N    . VAL A 1 43  ? -10.373 -1.843  -1.933  1.00 0.00 ? 221 VAL A N    2  
ATOM 2350  C CA   . VAL A 1 43  ? -11.100 -1.652  -3.182  1.00 0.00 ? 221 VAL A CA   2  
ATOM 2351  C C    . VAL A 1 43  ? -11.466 -2.990  -3.815  1.00 0.00 ? 221 VAL A C    2  
ATOM 2352  O O    . VAL A 1 43  ? -10.819 -4.006  -3.561  1.00 0.00 ? 221 VAL A O    2  
ATOM 2353  C CB   . VAL A 1 43  ? -10.278 -0.828  -4.190  1.00 0.00 ? 221 VAL A CB   2  
ATOM 2354  C CG1  . VAL A 1 43  ? -11.102 -0.526  -5.432  1.00 0.00 ? 221 VAL A CG1  2  
ATOM 2355  C CG2  . VAL A 1 43  ? -9.779  0.457   -3.546  1.00 0.00 ? 221 VAL A CG2  2  
ATOM 2356  H H    . VAL A 1 43  ? -9.647  -2.500  -1.898  1.00 0.00 ? 221 VAL A H    2  
ATOM 2357  H HA   . VAL A 1 43  ? -12.008 -1.109  -2.960  1.00 0.00 ? 221 VAL A HA   2  
ATOM 2358  H HB   . VAL A 1 43  ? -9.420  -1.413  -4.488  1.00 0.00 ? 221 VAL A HB   2  
ATOM 2359  H HG11 . VAL A 1 43  ? -10.959 -1.312  -6.159  1.00 0.00 ? 221 VAL A HG11 2  
ATOM 2360  H HG12 . VAL A 1 43  ? -12.147 -0.467  -5.165  1.00 0.00 ? 221 VAL A HG12 2  
ATOM 2361  H HG13 . VAL A 1 43  ? -10.785 0.416   -5.854  1.00 0.00 ? 221 VAL A HG13 2  
ATOM 2362  H HG21 . VAL A 1 43  ? -9.193  1.013   -4.262  1.00 0.00 ? 221 VAL A HG21 2  
ATOM 2363  H HG22 . VAL A 1 43  ? -10.623 1.053   -3.230  1.00 0.00 ? 221 VAL A HG22 2  
ATOM 2364  H HG23 . VAL A 1 43  ? -9.168  0.216   -2.689  1.00 0.00 ? 221 VAL A HG23 2  
ATOM 2365  N N    . ASP A 1 44  ? -12.508 -2.983  -4.640  1.00 0.00 ? 222 ASP A N    2  
ATOM 2366  C CA   . ASP A 1 44  ? -12.960 -4.196  -5.311  1.00 0.00 ? 222 ASP A CA   2  
ATOM 2367  C C    . ASP A 1 44  ? -12.498 -4.217  -6.765  1.00 0.00 ? 222 ASP A C    2  
ATOM 2368  O O    . ASP A 1 44  ? -12.804 -3.310  -7.537  1.00 0.00 ? 222 ASP A O    2  
ATOM 2369  C CB   . ASP A 1 44  ? -14.484 -4.302  -5.246  1.00 0.00 ? 222 ASP A CB   2  
ATOM 2370  C CG   . ASP A 1 44  ? -14.973 -5.725  -5.433  1.00 0.00 ? 222 ASP A CG   2  
ATOM 2371  O OD1  . ASP A 1 44  ? -14.571 -6.600  -4.638  1.00 0.00 ? 222 ASP A OD1  2  
ATOM 2372  O OD2  . ASP A 1 44  ? -15.758 -5.964  -6.375  1.00 0.00 ? 222 ASP A OD2  2  
ATOM 2373  H H    . ASP A 1 44  ? -12.983 -2.141  -4.802  1.00 0.00 ? 222 ASP A H    2  
ATOM 2374  H HA   . ASP A 1 44  ? -12.527 -5.040  -4.797  1.00 0.00 ? 222 ASP A HA   2  
ATOM 2375  H HB2  . ASP A 1 44  ? -14.822 -3.949  -4.282  1.00 0.00 ? 222 ASP A HB2  2  
ATOM 2376  H HB3  . ASP A 1 44  ? -14.915 -3.687  -6.022  1.00 0.00 ? 222 ASP A HB3  2  
ATOM 2377  N N    . GLY A 1 45  ? -11.756 -5.258  -7.130  1.00 0.00 ? 223 GLY A N    2  
ATOM 2378  C CA   . GLY A 1 45  ? -11.263 -5.377  -8.490  1.00 0.00 ? 223 GLY A CA   2  
ATOM 2379  C C    . GLY A 1 45  ? -10.010 -4.558  -8.725  1.00 0.00 ? 223 GLY A C    2  
ATOM 2380  O O    . GLY A 1 45  ? -9.826  -3.983  -9.799  1.00 0.00 ? 223 GLY A O    2  
ATOM 2381  H H    . GLY A 1 45  ? -11.543 -5.952  -6.471  1.00 0.00 ? 223 GLY A H    2  
ATOM 2382  H HA2  . GLY A 1 45  ? -11.045 -6.415  -8.693  1.00 0.00 ? 223 GLY A HA2  2  
ATOM 2383  H HA3  . GLY A 1 45  ? -12.032 -5.041  -9.170  1.00 0.00 ? 223 GLY A HA3  2  
ATOM 2384  N N    . THR A 1 46  ? -9.144  -4.501  -7.718  1.00 0.00 ? 224 THR A N    2  
ATOM 2385  C CA   . THR A 1 46  ? -7.903  -3.743  -7.819  1.00 0.00 ? 224 THR A CA   2  
ATOM 2386  C C    . THR A 1 46  ? -6.819  -4.342  -6.930  1.00 0.00 ? 224 THR A C    2  
ATOM 2387  O O    . THR A 1 46  ? -7.005  -4.488  -5.721  1.00 0.00 ? 224 THR A O    2  
ATOM 2388  C CB   . THR A 1 46  ? -8.112  -2.267  -7.431  1.00 0.00 ? 224 THR A CB   2  
ATOM 2389  O OG1  . THR A 1 46  ? -8.956  -1.623  -8.393  1.00 0.00 ? 224 THR A OG1  2  
ATOM 2390  C CG2  . THR A 1 46  ? -6.781  -1.536  -7.346  1.00 0.00 ? 224 THR A CG2  2  
ATOM 2391  H H    . THR A 1 46  ? -9.346  -4.980  -6.888  1.00 0.00 ? 224 THR A H    2  
ATOM 2392  H HA   . THR A 1 46  ? -7.572  -3.780  -8.847  1.00 0.00 ? 224 THR A HA   2  
ATOM 2393  H HB   . THR A 1 46  ? -8.590  -2.230  -6.463  1.00 0.00 ? 224 THR A HB   2  
ATOM 2394  H HG1  . THR A 1 46  ? -9.842  -1.535  -8.033  1.00 0.00 ? 224 THR A HG1  2  
ATOM 2395  H HG21 . THR A 1 46  ? -6.372  -1.416  -8.339  1.00 0.00 ? 224 THR A HG21 2  
ATOM 2396  H HG22 . THR A 1 46  ? -6.094  -2.108  -6.740  1.00 0.00 ? 224 THR A HG22 2  
ATOM 2397  H HG23 . THR A 1 46  ? -6.933  -0.565  -6.900  1.00 0.00 ? 224 THR A HG23 2  
ATOM 2398  N N    . ARG A 1 47  ? -5.687  -4.686  -7.534  1.00 0.00 ? 225 ARG A N    2  
ATOM 2399  C CA   . ARG A 1 47  ? -4.573  -5.269  -6.796  1.00 0.00 ? 225 ARG A CA   2  
ATOM 2400  C C    . ARG A 1 47  ? -3.370  -4.331  -6.796  1.00 0.00 ? 225 ARG A C    2  
ATOM 2401  O O    . ARG A 1 47  ? -2.970  -3.818  -7.841  1.00 0.00 ? 225 ARG A O    2  
ATOM 2402  C CB   . ARG A 1 47  ? -4.182  -6.617  -7.403  1.00 0.00 ? 225 ARG A CB   2  
ATOM 2403  C CG   . ARG A 1 47  ? -5.105  -7.756  -7.003  1.00 0.00 ? 225 ARG A CG   2  
ATOM 2404  C CD   . ARG A 1 47  ? -6.278  -7.885  -7.963  1.00 0.00 ? 225 ARG A CD   2  
ATOM 2405  N NE   . ARG A 1 47  ? -7.100  -9.056  -7.668  1.00 0.00 ? 225 ARG A NE   2  
ATOM 2406  C CZ   . ARG A 1 47  ? -7.987  -9.101  -6.679  1.00 0.00 ? 225 ARG A CZ   2  
ATOM 2407  N NH1  . ARG A 1 47  ? -8.164  -8.047  -5.895  1.00 0.00 ? 225 ARG A NH1  2  
ATOM 2408  N NH2  . ARG A 1 47  ? -8.697  -10.202 -6.474  1.00 0.00 ? 225 ARG A NH2  2  
ATOM 2409  H H    . ARG A 1 47  ? -5.598  -4.545  -8.500  1.00 0.00 ? 225 ARG A H    2  
ATOM 2410  H HA   . ARG A 1 47  ? -4.895  -5.423  -5.777  1.00 0.00 ? 225 ARG A HA   2  
ATOM 2411  H HB2  . ARG A 1 47  ? -4.196  -6.533  -8.480  1.00 0.00 ? 225 ARG A HB2  2  
ATOM 2412  H HB3  . ARG A 1 47  ? -3.181  -6.865  -7.083  1.00 0.00 ? 225 ARG A HB3  2  
ATOM 2413  H HG2  . ARG A 1 47  ? -4.546  -8.680  -7.010  1.00 0.00 ? 225 ARG A HG2  2  
ATOM 2414  H HG3  . ARG A 1 47  ? -5.483  -7.569  -6.009  1.00 0.00 ? 225 ARG A HG3  2  
ATOM 2415  H HD2  . ARG A 1 47  ? -6.889  -6.999  -7.884  1.00 0.00 ? 225 ARG A HD2  2  
ATOM 2416  H HD3  . ARG A 1 47  ? -5.895  -7.970  -8.969  1.00 0.00 ? 225 ARG A HD3  2  
ATOM 2417  H HE   . ARG A 1 47  ? -6.985  -9.846  -8.235  1.00 0.00 ? 225 ARG A HE   2  
ATOM 2418  H HH11 . ARG A 1 47  ? -7.631  -7.215  -6.048  1.00 0.00 ? 225 ARG A HH11 2  
ATOM 2419  H HH12 . ARG A 1 47  ? -8.833  -8.083  -5.152  1.00 0.00 ? 225 ARG A HH12 2  
ATOM 2420  H HH21 . ARG A 1 47  ? -8.566  -10.999 -7.064  1.00 0.00 ? 225 ARG A HH21 2  
ATOM 2421  H HH22 . ARG A 1 47  ? -9.364  -10.236 -5.730  1.00 0.00 ? 225 ARG A HH22 2  
ATOM 2422  N N    . ALA A 1 48  ? -2.798  -4.110  -5.617  1.00 0.00 ? 226 ALA A N    2  
ATOM 2423  C CA   . ALA A 1 48  ? -1.640  -3.235  -5.481  1.00 0.00 ? 226 ALA A CA   2  
ATOM 2424  C C    . ALA A 1 48  ? -0.424  -4.007  -4.981  1.00 0.00 ? 226 ALA A C    2  
ATOM 2425  O O    . ALA A 1 48  ? -0.524  -4.810  -4.053  1.00 0.00 ? 226 ALA A O    2  
ATOM 2426  C CB   . ALA A 1 48  ? -1.958  -2.082  -4.540  1.00 0.00 ? 226 ALA A CB   2  
ATOM 2427  H H    . ALA A 1 48  ? -3.163  -4.547  -4.819  1.00 0.00 ? 226 ALA A H    2  
ATOM 2428  H HA   . ALA A 1 48  ? -1.418  -2.823  -6.454  1.00 0.00 ? 226 ALA A HA   2  
ATOM 2429  H HB1  . ALA A 1 48  ? -2.704  -1.445  -4.993  1.00 0.00 ? 226 ALA A HB1  2  
ATOM 2430  H HB2  . ALA A 1 48  ? -2.335  -2.472  -3.607  1.00 0.00 ? 226 ALA A HB2  2  
ATOM 2431  H HB3  . ALA A 1 48  ? -1.061  -1.510  -4.356  1.00 0.00 ? 226 ALA A HB3  2  
ATOM 2432  N N    . PHE A 1 49  ? 0.724   -3.760  -5.603  1.00 0.00 ? 227 PHE A N    2  
ATOM 2433  C CA   . PHE A 1 49  ? 1.960   -4.434  -5.223  1.00 0.00 ? 227 PHE A CA   2  
ATOM 2434  C C    . PHE A 1 49  ? 3.086   -3.427  -5.012  1.00 0.00 ? 227 PHE A C    2  
ATOM 2435  O O    . PHE A 1 49  ? 3.188   -2.432  -5.731  1.00 0.00 ? 227 PHE A O    2  
ATOM 2436  C CB   . PHE A 1 49  ? 2.363   -5.449  -6.295  1.00 0.00 ? 227 PHE A CB   2  
ATOM 2437  C CG   . PHE A 1 49  ? 3.767   -5.961  -6.138  1.00 0.00 ? 227 PHE A CG   2  
ATOM 2438  C CD1  . PHE A 1 49  ? 4.844   -5.214  -6.586  1.00 0.00 ? 227 PHE A CD1  2  
ATOM 2439  C CD2  . PHE A 1 49  ? 4.008   -7.188  -5.543  1.00 0.00 ? 227 PHE A CD2  2  
ATOM 2440  C CE1  . PHE A 1 49  ? 6.136   -5.683  -6.444  1.00 0.00 ? 227 PHE A CE1  2  
ATOM 2441  C CE2  . PHE A 1 49  ? 5.299   -7.662  -5.398  1.00 0.00 ? 227 PHE A CE2  2  
ATOM 2442  C CZ   . PHE A 1 49  ? 6.364   -6.908  -5.848  1.00 0.00 ? 227 PHE A CZ   2  
ATOM 2443  H H    . PHE A 1 49  ? 0.740   -3.109  -6.336  1.00 0.00 ? 227 PHE A H    2  
ATOM 2444  H HA   . PHE A 1 49  ? 1.781   -4.955  -4.295  1.00 0.00 ? 227 PHE A HA   2  
ATOM 2445  H HB2  . PHE A 1 49  ? 1.695   -6.296  -6.248  1.00 0.00 ? 227 PHE A HB2  2  
ATOM 2446  H HB3  . PHE A 1 49  ? 2.284   -4.986  -7.267  1.00 0.00 ? 227 PHE A HB3  2  
ATOM 2447  H HD1  . PHE A 1 49  ? 4.668   -4.255  -7.052  1.00 0.00 ? 227 PHE A HD1  2  
ATOM 2448  H HD2  . PHE A 1 49  ? 3.175   -7.779  -5.189  1.00 0.00 ? 227 PHE A HD2  2  
ATOM 2449  H HE1  . PHE A 1 49  ? 6.968   -5.091  -6.797  1.00 0.00 ? 227 PHE A HE1  2  
ATOM 2450  H HE2  . PHE A 1 49  ? 5.473   -8.620  -4.931  1.00 0.00 ? 227 PHE A HE2  2  
ATOM 2451  H HZ   . PHE A 1 49  ? 7.373   -7.276  -5.736  1.00 0.00 ? 227 PHE A HZ   2  
ATOM 2452  N N    . LEU A 1 50  ? 3.930   -3.691  -4.020  1.00 0.00 ? 228 LEU A N    2  
ATOM 2453  C CA   . LEU A 1 50  ? 5.050   -2.808  -3.713  1.00 0.00 ? 228 LEU A CA   2  
ATOM 2454  C C    . LEU A 1 50  ? 6.381   -3.500  -3.986  1.00 0.00 ? 228 LEU A C    2  
ATOM 2455  O O    . LEU A 1 50  ? 6.603   -4.647  -3.598  1.00 0.00 ? 228 LEU A O    2  
ATOM 2456  C CB   . LEU A 1 50  ? 4.985   -2.361  -2.251  1.00 0.00 ? 228 LEU A CB   2  
ATOM 2457  C CG   . LEU A 1 50  ? 6.227   -1.651  -1.711  1.00 0.00 ? 228 LEU A CG   2  
ATOM 2458  C CD1  . LEU A 1 50  ? 6.218   -0.183  -2.107  1.00 0.00 ? 228 LEU A CD1  2  
ATOM 2459  C CD2  . LEU A 1 50  ? 6.309   -1.796  -0.198  1.00 0.00 ? 228 LEU A CD2  2  
ATOM 2460  H H    . LEU A 1 50  ? 3.798   -4.499  -3.482  1.00 0.00 ? 228 LEU A H    2  
ATOM 2461  H HA   . LEU A 1 50  ? 4.972   -1.940  -4.350  1.00 0.00 ? 228 LEU A HA   2  
ATOM 2462  H HB2  . LEU A 1 50  ? 4.149   -1.687  -2.148  1.00 0.00 ? 228 LEU A HB2  2  
ATOM 2463  H HB3  . LEU A 1 50  ? 4.815   -3.239  -1.645  1.00 0.00 ? 228 LEU A HB3  2  
ATOM 2464  H HG   . LEU A 1 50  ? 7.109   -2.106  -2.140  1.00 0.00 ? 228 LEU A HG   2  
ATOM 2465  H HD11 . LEU A 1 50  ? 6.110   0.428   -1.224  1.00 0.00 ? 228 LEU A HD11 2  
ATOM 2466  H HD12 . LEU A 1 50  ? 5.391   0.004   -2.777  1.00 0.00 ? 228 LEU A HD12 2  
ATOM 2467  H HD13 . LEU A 1 50  ? 7.145   0.062   -2.604  1.00 0.00 ? 228 LEU A HD13 2  
ATOM 2468  H HD21 . LEU A 1 50  ? 7.343   -1.901  0.097   1.00 0.00 ? 228 LEU A HD21 2  
ATOM 2469  H HD22 . LEU A 1 50  ? 5.757   -2.672  0.109   1.00 0.00 ? 228 LEU A HD22 2  
ATOM 2470  H HD23 . LEU A 1 50  ? 5.887   -0.920  0.271   1.00 0.00 ? 228 LEU A HD23 2  
ATOM 2471  N N    . PRO A 1 51  ? 7.289   -2.788  -4.669  1.00 0.00 ? 229 PRO A N    2  
ATOM 2472  C CA   . PRO A 1 51  ? 8.615   -3.313  -5.007  1.00 0.00 ? 229 PRO A CA   2  
ATOM 2473  C C    . PRO A 1 51  ? 9.510   -3.463  -3.781  1.00 0.00 ? 229 PRO A C    2  
ATOM 2474  O O    . PRO A 1 51  ? 9.469   -2.640  -2.866  1.00 0.00 ? 229 PRO A O    2  
ATOM 2475  C CB   . PRO A 1 51  ? 9.184   -2.256  -5.958  1.00 0.00 ? 229 PRO A CB   2  
ATOM 2476  C CG   . PRO A 1 51  ? 8.471   -0.999  -5.596  1.00 0.00 ? 229 PRO A CG   2  
ATOM 2477  C CD   . PRO A 1 51  ? 7.092   -1.415  -5.163  1.00 0.00 ? 229 PRO A CD   2  
ATOM 2478  H HA   . PRO A 1 51  ? 8.548   -4.262  -5.520  1.00 0.00 ? 229 PRO A HA   2  
ATOM 2479  H HB2  . PRO A 1 51  ? 10.250  -2.166  -5.804  1.00 0.00 ? 229 PRO A HB2  2  
ATOM 2480  H HB3  . PRO A 1 51  ? 8.985   -2.542  -6.980  1.00 0.00 ? 229 PRO A HB3  2  
ATOM 2481  H HG2  . PRO A 1 51  ? 8.986   -0.505  -4.786  1.00 0.00 ? 229 PRO A HG2  2  
ATOM 2482  H HG3  . PRO A 1 51  ? 8.413   -0.350  -6.457  1.00 0.00 ? 229 PRO A HG3  2  
ATOM 2483  H HD2  . PRO A 1 51  ? 6.734   -0.769  -4.374  1.00 0.00 ? 229 PRO A HD2  2  
ATOM 2484  H HD3  . PRO A 1 51  ? 6.413   -1.401  -6.002  1.00 0.00 ? 229 PRO A HD3  2  
ATOM 2485  N N    . LEU A 1 52  ? 10.318  -4.517  -3.769  1.00 0.00 ? 230 LEU A N    2  
ATOM 2486  C CA   . LEU A 1 52  ? 11.223  -4.775  -2.655  1.00 0.00 ? 230 LEU A CA   2  
ATOM 2487  C C    . LEU A 1 52  ? 12.243  -3.649  -2.511  1.00 0.00 ? 230 LEU A C    2  
ATOM 2488  O O    . LEU A 1 52  ? 12.806  -3.441  -1.435  1.00 0.00 ? 230 LEU A O    2  
ATOM 2489  C CB   . LEU A 1 52  ? 11.945  -6.109  -2.856  1.00 0.00 ? 230 LEU A CB   2  
ATOM 2490  C CG   . LEU A 1 52  ? 11.144  -7.364  -2.506  1.00 0.00 ? 230 LEU A CG   2  
ATOM 2491  C CD1  . LEU A 1 52  ? 11.971  -8.614  -2.764  1.00 0.00 ? 230 LEU A CD1  2  
ATOM 2492  C CD2  . LEU A 1 52  ? 10.685  -7.316  -1.056  1.00 0.00 ? 230 LEU A CD2  2  
ATOM 2493  H H    . LEU A 1 52  ? 10.306  -5.138  -4.527  1.00 0.00 ? 230 LEU A H    2  
ATOM 2494  H HA   . LEU A 1 52  ? 10.632  -4.826  -1.753  1.00 0.00 ? 230 LEU A HA   2  
ATOM 2495  H HB2  . LEU A 1 52  ? 12.229  -6.178  -3.895  1.00 0.00 ? 230 LEU A HB2  2  
ATOM 2496  H HB3  . LEU A 1 52  ? 12.833  -6.099  -2.241  1.00 0.00 ? 230 LEU A HB3  2  
ATOM 2497  H HG   . LEU A 1 52  ? 10.266  -7.410  -3.134  1.00 0.00 ? 230 LEU A HG   2  
ATOM 2498  H HD11 . LEU A 1 52  ? 11.524  -9.182  -3.565  1.00 0.00 ? 230 LEU A HD11 2  
ATOM 2499  H HD12 . LEU A 1 52  ? 12.002  -9.216  -1.868  1.00 0.00 ? 230 LEU A HD12 2  
ATOM 2500  H HD13 . LEU A 1 52  ? 12.976  -8.329  -3.040  1.00 0.00 ? 230 LEU A HD13 2  
ATOM 2501  H HD21 . LEU A 1 52  ? 11.526  -7.080  -0.420  1.00 0.00 ? 230 LEU A HD21 2  
ATOM 2502  H HD22 . LEU A 1 52  ? 10.280  -8.277  -0.775  1.00 0.00 ? 230 LEU A HD22 2  
ATOM 2503  H HD23 . LEU A 1 52  ? 9.925   -6.557  -0.944  1.00 0.00 ? 230 LEU A HD23 2  
ATOM 2504  N N    . LEU A 1 53  ? 12.474  -2.924  -3.600  1.00 0.00 ? 231 LEU A N    2  
ATOM 2505  C CA   . LEU A 1 53  ? 13.424  -1.817  -3.595  1.00 0.00 ? 231 LEU A CA   2  
ATOM 2506  C C    . LEU A 1 53  ? 12.984  -0.727  -2.624  1.00 0.00 ? 231 LEU A C    2  
ATOM 2507  O O    . LEU A 1 53  ? 13.792  -0.195  -1.862  1.00 0.00 ? 231 LEU A O    2  
ATOM 2508  C CB   . LEU A 1 53  ? 13.567  -1.236  -5.002  1.00 0.00 ? 231 LEU A CB   2  
ATOM 2509  C CG   . LEU A 1 53  ? 13.828  -2.244  -6.122  1.00 0.00 ? 231 LEU A CG   2  
ATOM 2510  C CD1  . LEU A 1 53  ? 13.650  -1.589  -7.483  1.00 0.00 ? 231 LEU A CD1  2  
ATOM 2511  C CD2  . LEU A 1 53  ? 15.224  -2.837  -5.991  1.00 0.00 ? 231 LEU A CD2  2  
ATOM 2512  H H    . LEU A 1 53  ? 11.995  -3.138  -4.427  1.00 0.00 ? 231 LEU A H    2  
ATOM 2513  H HA   . LEU A 1 53  ? 14.380  -2.203  -3.275  1.00 0.00 ? 231 LEU A HA   2  
ATOM 2514  H HB2  . LEU A 1 53  ? 12.654  -0.710  -5.237  1.00 0.00 ? 231 LEU A HB2  2  
ATOM 2515  H HB3  . LEU A 1 53  ? 14.390  -0.536  -4.988  1.00 0.00 ? 231 LEU A HB3  2  
ATOM 2516  H HG   . LEU A 1 53  ? 13.112  -3.051  -6.045  1.00 0.00 ? 231 LEU A HG   2  
ATOM 2517  H HD11 . LEU A 1 53  ? 13.196  -2.292  -8.164  1.00 0.00 ? 231 LEU A HD11 2  
ATOM 2518  H HD12 . LEU A 1 53  ? 14.614  -1.288  -7.866  1.00 0.00 ? 231 LEU A HD12 2  
ATOM 2519  H HD13 . LEU A 1 53  ? 13.016  -0.720  -7.384  1.00 0.00 ? 231 LEU A HD13 2  
ATOM 2520  H HD21 . LEU A 1 53  ? 15.712  -2.821  -6.954  1.00 0.00 ? 231 LEU A HD21 2  
ATOM 2521  H HD22 . LEU A 1 53  ? 15.150  -3.856  -5.642  1.00 0.00 ? 231 LEU A HD22 2  
ATOM 2522  H HD23 . LEU A 1 53  ? 15.798  -2.254  -5.287  1.00 0.00 ? 231 LEU A HD23 2  
ATOM 2523  N N    . LYS A 1 54  ? 11.697  -0.398  -2.655  1.00 0.00 ? 232 LYS A N    2  
ATOM 2524  C CA   . LYS A 1 54  ? 11.147  0.627   -1.776  1.00 0.00 ? 232 LYS A CA   2  
ATOM 2525  C C    . LYS A 1 54  ? 10.818  0.047   -0.404  1.00 0.00 ? 232 LYS A C    2  
ATOM 2526  O O    . LYS A 1 54  ? 10.932  0.731   0.613   1.00 0.00 ? 232 LYS A O    2  
ATOM 2527  C CB   . LYS A 1 54  ? 9.890   1.240   -2.397  1.00 0.00 ? 232 LYS A CB   2  
ATOM 2528  C CG   . LYS A 1 54  ? 10.174  2.435   -3.291  1.00 0.00 ? 232 LYS A CG   2  
ATOM 2529  C CD   . LYS A 1 54  ? 10.616  3.643   -2.482  1.00 0.00 ? 232 LYS A CD   2  
ATOM 2530  C CE   . LYS A 1 54  ? 10.887  4.844   -3.376  1.00 0.00 ? 232 LYS A CE   2  
ATOM 2531  N NZ   . LYS A 1 54  ? 11.857  5.789   -2.756  1.00 0.00 ? 232 LYS A NZ   2  
ATOM 2532  H H    . LYS A 1 54  ? 11.102  -0.857  -3.285  1.00 0.00 ? 232 LYS A H    2  
ATOM 2533  H HA   . LYS A 1 54  ? 11.893  1.398   -1.658  1.00 0.00 ? 232 LYS A HA   2  
ATOM 2534  H HB2  . LYS A 1 54  ? 9.390   0.486   -2.988  1.00 0.00 ? 232 LYS A HB2  2  
ATOM 2535  H HB3  . LYS A 1 54  ? 9.230   1.560   -1.604  1.00 0.00 ? 232 LYS A HB3  2  
ATOM 2536  H HG2  . LYS A 1 54  ? 10.958  2.175   -3.986  1.00 0.00 ? 232 LYS A HG2  2  
ATOM 2537  H HG3  . LYS A 1 54  ? 9.276   2.687   -3.836  1.00 0.00 ? 232 LYS A HG3  2  
ATOM 2538  H HD2  . LYS A 1 54  ? 9.837   3.901   -1.780  1.00 0.00 ? 232 LYS A HD2  2  
ATOM 2539  H HD3  . LYS A 1 54  ? 11.520  3.395   -1.944  1.00 0.00 ? 232 LYS A HD3  2  
ATOM 2540  H HE2  . LYS A 1 54  ? 11.289  4.493   -4.315  1.00 0.00 ? 232 LYS A HE2  2  
ATOM 2541  H HE3  . LYS A 1 54  ? 9.956   5.361   -3.554  1.00 0.00 ? 232 LYS A HE3  2  
ATOM 2542  H HZ1  . LYS A 1 54  ? 12.722  5.283   -2.479  1.00 0.00 ? 232 LYS A HZ1  2  
ATOM 2543  H HZ2  . LYS A 1 54  ? 11.439  6.226   -1.911  1.00 0.00 ? 232 LYS A HZ2  2  
ATOM 2544  H HZ3  . LYS A 1 54  ? 12.108  6.538   -3.433  1.00 0.00 ? 232 LYS A HZ3  2  
ATOM 2545  N N    . ALA A 1 55  ? 10.410  -1.217  -0.383  1.00 0.00 ? 233 ALA A N    2  
ATOM 2546  C CA   . ALA A 1 55  ? 10.068  -1.889  0.864   1.00 0.00 ? 233 ALA A CA   2  
ATOM 2547  C C    . ALA A 1 55  ? 11.302  -2.088  1.737   1.00 0.00 ? 233 ALA A C    2  
ATOM 2548  O O    . ALA A 1 55  ? 11.278  -1.805  2.935   1.00 0.00 ? 233 ALA A O    2  
ATOM 2549  C CB   . ALA A 1 55  ? 9.401   -3.226  0.578   1.00 0.00 ? 233 ALA A CB   2  
ATOM 2550  H H    . ALA A 1 55  ? 10.339  -1.710  -1.227  1.00 0.00 ? 233 ALA A H    2  
ATOM 2551  H HA   . ALA A 1 55  ? 9.361   -1.268  1.395   1.00 0.00 ? 233 ALA A HA   2  
ATOM 2552  H HB1  . ALA A 1 55  ? 8.909   -3.184  -0.384  1.00 0.00 ? 233 ALA A HB1  2  
ATOM 2553  H HB2  . ALA A 1 55  ? 10.148  -4.006  0.566   1.00 0.00 ? 233 ALA A HB2  2  
ATOM 2554  H HB3  . ALA A 1 55  ? 8.672   -3.437  1.346   1.00 0.00 ? 233 ALA A HB3  2  
ATOM 2555  N N    . GLN A 1 56  ? 12.379  -2.577  1.129   1.00 0.00 ? 234 GLN A N    2  
ATOM 2556  C CA   . GLN A 1 56  ? 13.622  -2.814  1.853   1.00 0.00 ? 234 GLN A CA   2  
ATOM 2557  C C    . GLN A 1 56  ? 14.196  -1.508  2.392   1.00 0.00 ? 234 GLN A C    2  
ATOM 2558  O O    . GLN A 1 56  ? 14.669  -1.450  3.527   1.00 0.00 ? 234 GLN A O    2  
ATOM 2559  C CB   . GLN A 1 56  ? 14.644  -3.497  0.942   1.00 0.00 ? 234 GLN A CB   2  
ATOM 2560  C CG   . GLN A 1 56  ? 15.869  -4.012  1.681   1.00 0.00 ? 234 GLN A CG   2  
ATOM 2561  C CD   . GLN A 1 56  ? 16.514  -5.195  0.988   1.00 0.00 ? 234 GLN A CD   2  
ATOM 2562  O OE1  . GLN A 1 56  ? 15.972  -6.301  0.987   1.00 0.00 ? 234 GLN A OE1  2  
ATOM 2563  N NE2  . GLN A 1 56  ? 17.680  -4.970  0.392   1.00 0.00 ? 234 GLN A NE2  2  
ATOM 2564  H H    . GLN A 1 56  ? 12.336  -2.782  0.173   1.00 0.00 ? 234 GLN A H    2  
ATOM 2565  H HA   . GLN A 1 56  ? 13.402  -3.467  2.684   1.00 0.00 ? 234 GLN A HA   2  
ATOM 2566  H HB2  . GLN A 1 56  ? 14.169  -4.333  0.451   1.00 0.00 ? 234 GLN A HB2  2  
ATOM 2567  H HB3  . GLN A 1 56  ? 14.973  -2.789  0.196   1.00 0.00 ? 234 GLN A HB3  2  
ATOM 2568  H HG2  . GLN A 1 56  ? 16.595  -3.215  1.748   1.00 0.00 ? 234 GLN A HG2  2  
ATOM 2569  H HG3  . GLN A 1 56  ? 15.574  -4.312  2.676   1.00 0.00 ? 234 GLN A HG3  2  
ATOM 2570  H HE21 . GLN A 1 56  ? 18.053  -4.064  0.434   1.00 0.00 ? 234 GLN A HE21 2  
ATOM 2571  H HE22 . GLN A 1 56  ? 18.119  -5.717  -0.063  1.00 0.00 ? 234 GLN A HE22 2  
ATOM 2572  N N    . GLU A 1 57  ? 14.152  -0.464  1.571   1.00 0.00 ? 235 GLU A N    2  
ATOM 2573  C CA   . GLU A 1 57  ? 14.669  0.841   1.967   1.00 0.00 ? 235 GLU A CA   2  
ATOM 2574  C C    . GLU A 1 57  ? 13.860  1.419   3.124   1.00 0.00 ? 235 GLU A C    2  
ATOM 2575  O O    . GLU A 1 57  ? 14.417  1.993   4.060   1.00 0.00 ? 235 GLU A O    2  
ATOM 2576  C CB   . GLU A 1 57  ? 14.643  1.806   0.780   1.00 0.00 ? 235 GLU A CB   2  
ATOM 2577  C CG   . GLU A 1 57  ? 15.726  2.870   0.836   1.00 0.00 ? 235 GLU A CG   2  
ATOM 2578  C CD   . GLU A 1 57  ? 15.663  3.829   -0.337  1.00 0.00 ? 235 GLU A CD   2  
ATOM 2579  O OE1  . GLU A 1 57  ? 15.457  3.362   -1.476  1.00 0.00 ? 235 GLU A OE1  2  
ATOM 2580  O OE2  . GLU A 1 57  ? 15.820  5.048   -0.114  1.00 0.00 ? 235 GLU A OE2  2  
ATOM 2581  H H    . GLU A 1 57  ? 13.762  -0.574  0.679   1.00 0.00 ? 235 GLU A H    2  
ATOM 2582  H HA   . GLU A 1 57  ? 15.691  0.708   2.289   1.00 0.00 ? 235 GLU A HA   2  
ATOM 2583  H HB2  . GLU A 1 57  ? 14.769  1.240   -0.132  1.00 0.00 ? 235 GLU A HB2  2  
ATOM 2584  H HB3  . GLU A 1 57  ? 13.683  2.300   0.755   1.00 0.00 ? 235 GLU A HB3  2  
ATOM 2585  H HG2  . GLU A 1 57  ? 15.611  3.434   1.749   1.00 0.00 ? 235 GLU A HG2  2  
ATOM 2586  H HG3  . GLU A 1 57  ? 16.691  2.383   0.833   1.00 0.00 ? 235 GLU A HG3  2  
ATOM 2587  N N    . TYR A 1 58  ? 12.543  1.263   3.053   1.00 0.00 ? 236 TYR A N    2  
ATOM 2588  C CA   . TYR A 1 58  ? 11.655  1.771   4.092   1.00 0.00 ? 236 TYR A CA   2  
ATOM 2589  C C    . TYR A 1 58  ? 11.767  0.933   5.362   1.00 0.00 ? 236 TYR A C    2  
ATOM 2590  O O    . TYR A 1 58  ? 11.759  1.464   6.473   1.00 0.00 ? 236 TYR A O    2  
ATOM 2591  C CB   . TYR A 1 58  ? 10.208  1.779   3.598   1.00 0.00 ? 236 TYR A CB   2  
ATOM 2592  C CG   . TYR A 1 58  ? 9.188   1.864   4.711   1.00 0.00 ? 236 TYR A CG   2  
ATOM 2593  C CD1  . TYR A 1 58  ? 8.854   0.742   5.460   1.00 0.00 ? 236 TYR A CD1  2  
ATOM 2594  C CD2  . TYR A 1 58  ? 8.559   3.065   5.014   1.00 0.00 ? 236 TYR A CD2  2  
ATOM 2595  C CE1  . TYR A 1 58  ? 7.922   0.815   6.478   1.00 0.00 ? 236 TYR A CE1  2  
ATOM 2596  C CE2  . TYR A 1 58  ? 7.628   3.147   6.031   1.00 0.00 ? 236 TYR A CE2  2  
ATOM 2597  C CZ   . TYR A 1 58  ? 7.312   2.019   6.760   1.00 0.00 ? 236 TYR A CZ   2  
ATOM 2598  O OH   . TYR A 1 58  ? 6.384   2.097   7.772   1.00 0.00 ? 236 TYR A OH   2  
ATOM 2599  H H    . TYR A 1 58  ? 12.157  0.796   2.282   1.00 0.00 ? 236 TYR A H    2  
ATOM 2600  H HA   . TYR A 1 58  ? 11.954  2.785   4.316   1.00 0.00 ? 236 TYR A HA   2  
ATOM 2601  H HB2  . TYR A 1 58  ? 10.061  2.628   2.949   1.00 0.00 ? 236 TYR A HB2  2  
ATOM 2602  H HB3  . TYR A 1 58  ? 10.019  0.871   3.044   1.00 0.00 ? 236 TYR A HB3  2  
ATOM 2603  H HD1  . TYR A 1 58  ? 9.333   -0.200  5.237   1.00 0.00 ? 236 TYR A HD1  2  
ATOM 2604  H HD2  . TYR A 1 58  ? 8.808   3.946   4.440   1.00 0.00 ? 236 TYR A HD2  2  
ATOM 2605  H HE1  . TYR A 1 58  ? 7.675   -0.068  7.049   1.00 0.00 ? 236 TYR A HE1  2  
ATOM 2606  H HE2  . TYR A 1 58  ? 7.150   4.090   6.251   1.00 0.00 ? 236 TYR A HE2  2  
ATOM 2607  H HH   . TYR A 1 58  ? 5.785   2.828   7.602   1.00 0.00 ? 236 TYR A HH   2  
ATOM 2608  N N    . ILE A 1 59  ? 11.871  -0.380  5.188   1.00 0.00 ? 237 ILE A N    2  
ATOM 2609  C CA   . ILE A 1 59  ? 11.986  -1.293  6.319   1.00 0.00 ? 237 ILE A CA   2  
ATOM 2610  C C    . ILE A 1 59  ? 13.320  -1.116  7.035   1.00 0.00 ? 237 ILE A C    2  
ATOM 2611  O O    . ILE A 1 59  ? 13.379  -1.097  8.265   1.00 0.00 ? 237 ILE A O    2  
ATOM 2612  C CB   . ILE A 1 59  ? 11.846  -2.761  5.874   1.00 0.00 ? 237 ILE A CB   2  
ATOM 2613  C CG1  . ILE A 1 59  ? 10.446  -3.015  5.313   1.00 0.00 ? 237 ILE A CG1  2  
ATOM 2614  C CG2  . ILE A 1 59  ? 12.134  -3.697  7.039   1.00 0.00 ? 237 ILE A CG2  2  
ATOM 2615  C CD1  . ILE A 1 59  ? 10.383  -4.182  4.352   1.00 0.00 ? 237 ILE A CD1  2  
ATOM 2616  H H    . ILE A 1 59  ? 11.871  -0.744  4.279   1.00 0.00 ? 237 ILE A H    2  
ATOM 2617  H HA   . ILE A 1 59  ? 11.186  -1.069  7.010   1.00 0.00 ? 237 ILE A HA   2  
ATOM 2618  H HB   . ILE A 1 59  ? 12.576  -2.951  5.102   1.00 0.00 ? 237 ILE A HB   2  
ATOM 2619  H HG12 . ILE A 1 59  ? 9.770   -3.221  6.128   1.00 0.00 ? 237 ILE A HG12 2  
ATOM 2620  H HG13 . ILE A 1 59  ? 10.111  -2.133  4.787   1.00 0.00 ? 237 ILE A HG13 2  
ATOM 2621  H HG21 . ILE A 1 59  ? 12.942  -4.363  6.773   1.00 0.00 ? 237 ILE A HG21 2  
ATOM 2622  H HG22 . ILE A 1 59  ? 12.416  -3.117  7.904   1.00 0.00 ? 237 ILE A HG22 2  
ATOM 2623  H HG23 . ILE A 1 59  ? 11.250  -4.275  7.264   1.00 0.00 ? 237 ILE A HG23 2  
ATOM 2624  H HD11 . ILE A 1 59  ? 11.384  -4.478  4.078   1.00 0.00 ? 237 ILE A HD11 2  
ATOM 2625  H HD12 . ILE A 1 59  ? 9.877   -5.011  4.824   1.00 0.00 ? 237 ILE A HD12 2  
ATOM 2626  H HD13 . ILE A 1 59  ? 9.840   -3.888  3.465   1.00 0.00 ? 237 ILE A HD13 2  
ATOM 2627  N N    . ARG A 1 60  ? 14.390  -0.983  6.258   1.00 0.00 ? 238 ARG A N    2  
ATOM 2628  C CA   . ARG A 1 60  ? 15.724  -0.806  6.818   1.00 0.00 ? 238 ARG A CA   2  
ATOM 2629  C C    . ARG A 1 60  ? 15.838  0.533   7.540   1.00 0.00 ? 238 ARG A C    2  
ATOM 2630  O O    . ARG A 1 60  ? 16.447  0.625   8.605   1.00 0.00 ? 238 ARG A O    2  
ATOM 2631  C CB   . ARG A 1 60  ? 16.780  -0.894  5.714   1.00 0.00 ? 238 ARG A CB   2  
ATOM 2632  C CG   . ARG A 1 60  ? 16.924  0.386   4.906   1.00 0.00 ? 238 ARG A CG   2  
ATOM 2633  C CD   . ARG A 1 60  ? 18.157  0.347   4.017   1.00 0.00 ? 238 ARG A CD   2  
ATOM 2634  N NE   . ARG A 1 60  ? 19.393  0.422   4.792   1.00 0.00 ? 238 ARG A NE   2  
ATOM 2635  C CZ   . ARG A 1 60  ? 20.551  0.834   4.289   1.00 0.00 ? 238 ARG A CZ   2  
ATOM 2636  N NH1  . ARG A 1 60  ? 20.632  1.205   3.019   1.00 0.00 ? 238 ARG A NH1  2  
ATOM 2637  N NH2  . ARG A 1 60  ? 21.632  0.874   5.057   1.00 0.00 ? 238 ARG A NH2  2  
ATOM 2638  H H    . ARG A 1 60  ? 14.279  -1.006  5.284   1.00 0.00 ? 238 ARG A H    2  
ATOM 2639  H HA   . ARG A 1 60  ? 15.894  -1.600  7.529   1.00 0.00 ? 238 ARG A HA   2  
ATOM 2640  H HB2  . ARG A 1 60  ? 17.736  -1.119  6.163   1.00 0.00 ? 238 ARG A HB2  2  
ATOM 2641  H HB3  . ARG A 1 60  ? 16.511  -1.692  5.038   1.00 0.00 ? 238 ARG A HB3  2  
ATOM 2642  H HG2  . ARG A 1 60  ? 16.049  0.508   4.284   1.00 0.00 ? 238 ARG A HG2  2  
ATOM 2643  H HG3  . ARG A 1 60  ? 17.005  1.221   5.585   1.00 0.00 ? 238 ARG A HG3  2  
ATOM 2644  H HD2  . ARG A 1 60  ? 18.151  -0.575  3.455   1.00 0.00 ? 238 ARG A HD2  2  
ATOM 2645  H HD3  . ARG A 1 60  ? 18.118  1.184   3.336   1.00 0.00 ? 238 ARG A HD3  2  
ATOM 2646  H HE   . ARG A 1 60  ? 19.355  0.152   5.733   1.00 0.00 ? 238 ARG A HE   2  
ATOM 2647  H HH11 . ARG A 1 60  ? 19.819  1.177   2.438   1.00 0.00 ? 238 ARG A HH11 2  
ATOM 2648  H HH12 . ARG A 1 60  ? 21.506  1.516   2.643   1.00 0.00 ? 238 ARG A HH12 2  
ATOM 2649  H HH21 . ARG A 1 60  ? 21.575  0.595   6.015   1.00 0.00 ? 238 ARG A HH21 2  
ATOM 2650  H HH22 . ARG A 1 60  ? 22.504  1.183   4.678   1.00 0.00 ? 238 ARG A HH22 2  
ATOM 2651  N N    . GLN A 1 61  ? 15.247  1.569   6.951   1.00 0.00 ? 239 GLN A N    2  
ATOM 2652  C CA   . GLN A 1 61  ? 15.284  2.903   7.538   1.00 0.00 ? 239 GLN A CA   2  
ATOM 2653  C C    . GLN A 1 61  ? 14.248  3.037   8.649   1.00 0.00 ? 239 GLN A C    2  
ATOM 2654  O O    . GLN A 1 61  ? 14.349  3.918   9.504   1.00 0.00 ? 239 GLN A O    2  
ATOM 2655  C CB   . GLN A 1 61  ? 15.036  3.963   6.463   1.00 0.00 ? 239 GLN A CB   2  
ATOM 2656  C CG   . GLN A 1 61  ? 16.293  4.376   5.715   1.00 0.00 ? 239 GLN A CG   2  
ATOM 2657  C CD   . GLN A 1 61  ? 17.158  5.333   6.510   1.00 0.00 ? 239 GLN A CD   2  
ATOM 2658  O OE1  . GLN A 1 61  ? 16.720  6.424   6.879   1.00 0.00 ? 239 GLN A OE1  2  
ATOM 2659  N NE2  . GLN A 1 61  ? 18.394  4.930   6.780   1.00 0.00 ? 239 GLN A NE2  2  
ATOM 2660  H H    . GLN A 1 61  ? 14.777  1.432   6.103   1.00 0.00 ? 239 GLN A H    2  
ATOM 2661  H HA   . GLN A 1 61  ? 16.266  3.053   7.959   1.00 0.00 ? 239 GLN A HA   2  
ATOM 2662  H HB2  . GLN A 1 61  ? 14.328  3.573   5.747   1.00 0.00 ? 239 GLN A HB2  2  
ATOM 2663  H HB3  . GLN A 1 61  ? 14.617  4.841   6.930   1.00 0.00 ? 239 GLN A HB3  2  
ATOM 2664  H HG2  . GLN A 1 61  ? 16.872  3.491   5.494   1.00 0.00 ? 239 GLN A HG2  2  
ATOM 2665  H HG3  . GLN A 1 61  ? 16.005  4.856   4.791   1.00 0.00 ? 239 GLN A HG3  2  
ATOM 2666  H HE21 . GLN A 1 61  ? 18.675  4.049   6.453   1.00 0.00 ? 239 GLN A HE21 2  
ATOM 2667  H HE22 . GLN A 1 61  ? 18.975  5.529   7.292   1.00 0.00 ? 239 GLN A HE22 2  
ATOM 2668  N N    . LYS A 1 62  ? 13.251  2.159   8.632   1.00 0.00 ? 240 LYS A N    2  
ATOM 2669  C CA   . LYS A 1 62  ? 12.196  2.178   9.638   1.00 0.00 ? 240 LYS A CA   2  
ATOM 2670  C C    . LYS A 1 62  ? 12.430  1.100   10.691  1.00 0.00 ? 240 LYS A C    2  
ATOM 2671  O O    . LYS A 1 62  ? 12.752  1.400   11.840  1.00 0.00 ? 240 LYS A O    2  
ATOM 2672  C CB   . LYS A 1 62  ? 10.830  1.974   8.979   1.00 0.00 ? 240 LYS A CB   2  
ATOM 2673  C CG   . LYS A 1 62  ? 10.442  3.092   8.026   1.00 0.00 ? 240 LYS A CG   2  
ATOM 2674  C CD   . LYS A 1 62  ? 9.927   4.309   8.776   1.00 0.00 ? 240 LYS A CD   2  
ATOM 2675  C CE   . LYS A 1 62  ? 10.100  5.581   7.959   1.00 0.00 ? 240 LYS A CE   2  
ATOM 2676  N NZ   . LYS A 1 62  ? 11.467  6.154   8.108   1.00 0.00 ? 240 LYS A NZ   2  
ATOM 2677  H H    . LYS A 1 62  ? 13.225  1.480   7.924   1.00 0.00 ? 240 LYS A H    2  
ATOM 2678  H HA   . LYS A 1 62  ? 12.214  3.144   10.119  1.00 0.00 ? 240 LYS A HA   2  
ATOM 2679  H HB2  . LYS A 1 62  ? 10.846  1.047   8.425   1.00 0.00 ? 240 LYS A HB2  2  
ATOM 2680  H HB3  . LYS A 1 62  ? 10.077  1.910   9.751   1.00 0.00 ? 240 LYS A HB3  2  
ATOM 2681  H HG2  . LYS A 1 62  ? 11.308  3.378   7.449   1.00 0.00 ? 240 LYS A HG2  2  
ATOM 2682  H HG3  . LYS A 1 62  ? 9.667   2.734   7.363   1.00 0.00 ? 240 LYS A HG3  2  
ATOM 2683  H HD2  . LYS A 1 62  ? 8.877   4.173   8.990   1.00 0.00 ? 240 LYS A HD2  2  
ATOM 2684  H HD3  . LYS A 1 62  ? 10.475  4.409   9.702   1.00 0.00 ? 240 LYS A HD3  2  
ATOM 2685  H HE2  . LYS A 1 62  ? 9.927   5.351   6.919   1.00 0.00 ? 240 LYS A HE2  2  
ATOM 2686  H HE3  . LYS A 1 62  ? 9.375   6.308   8.293   1.00 0.00 ? 240 LYS A HE3  2  
ATOM 2687  H HZ1  . LYS A 1 62  ? 11.834  5.958   9.062   1.00 0.00 ? 240 LYS A HZ1  2  
ATOM 2688  H HZ2  . LYS A 1 62  ? 11.440  7.183   7.964   1.00 0.00 ? 240 LYS A HZ2  2  
ATOM 2689  H HZ3  . LYS A 1 62  ? 12.109  5.733   7.408   1.00 0.00 ? 240 LYS A HZ3  2  
ATOM 2690  N N    . ASN A 1 63  ? 12.267  -0.157  10.291  1.00 0.00 ? 241 ASN A N    2  
ATOM 2691  C CA   . ASN A 1 63  ? 12.461  -1.280  11.201  1.00 0.00 ? 241 ASN A CA   2  
ATOM 2692  C C    . ASN A 1 63  ? 13.934  -1.671  11.277  1.00 0.00 ? 241 ASN A C    2  
ATOM 2693  O O    . ASN A 1 63  ? 14.269  -2.842  11.451  1.00 0.00 ? 241 ASN A O    2  
ATOM 2694  C CB   . ASN A 1 63  ? 11.627  -2.480  10.749  1.00 0.00 ? 241 ASN A CB   2  
ATOM 2695  C CG   . ASN A 1 63  ? 11.212  -3.366  11.908  1.00 0.00 ? 241 ASN A CG   2  
ATOM 2696  O OD1  . ASN A 1 63  ? 11.539  -3.090  13.063  1.00 0.00 ? 241 ASN A OD1  2  
ATOM 2697  N ND2  . ASN A 1 63  ? 10.487  -4.436  11.605  1.00 0.00 ? 241 ASN A ND2  2  
ATOM 2698  H H    . ASN A 1 63  ? 12.009  -0.334  9.362   1.00 0.00 ? 241 ASN A H    2  
ATOM 2699  H HA   . ASN A 1 63  ? 12.131  -0.973  12.182  1.00 0.00 ? 241 ASN A HA   2  
ATOM 2700  H HB2  . ASN A 1 63  ? 10.734  -2.125  10.256  1.00 0.00 ? 241 ASN A HB2  2  
ATOM 2701  H HB3  . ASN A 1 63  ? 12.204  -3.073  10.056  1.00 0.00 ? 241 ASN A HB3  2  
ATOM 2702  H HD21 . ASN A 1 63  ? 10.263  -4.593  10.664  1.00 0.00 ? 241 ASN A HD21 2  
ATOM 2703  H HD22 . ASN A 1 63  ? 10.204  -5.026  12.335  1.00 0.00 ? 241 ASN A HD22 2  
ATOM 2704  N N    . LYS A 1 64  ? 14.810  -0.680  11.146  1.00 0.00 ? 242 LYS A N    2  
ATOM 2705  C CA   . LYS A 1 64  ? 16.248  -0.918  11.202  1.00 0.00 ? 242 LYS A CA   2  
ATOM 2706  C C    . LYS A 1 64  ? 16.608  -2.237  10.526  1.00 0.00 ? 242 LYS A C    2  
ATOM 2707  O O    . LYS A 1 64  ? 17.595  -2.879  10.882  1.00 0.00 ? 242 LYS A O    2  
ATOM 2708  C CB   . LYS A 1 64  ? 16.728  -0.929  12.655  1.00 0.00 ? 242 LYS A CB   2  
ATOM 2709  C CG   . LYS A 1 64  ? 16.498  0.385   13.381  1.00 0.00 ? 242 LYS A CG   2  
ATOM 2710  C CD   . LYS A 1 64  ? 15.117  0.438   14.013  1.00 0.00 ? 242 LYS A CD   2  
ATOM 2711  C CE   . LYS A 1 64  ? 14.982  1.621   14.960  1.00 0.00 ? 242 LYS A CE   2  
ATOM 2712  N NZ   . LYS A 1 64  ? 14.835  2.907   14.223  1.00 0.00 ? 242 LYS A NZ   2  
ATOM 2713  H H    . LYS A 1 64  ? 14.482  0.234   11.010  1.00 0.00 ? 242 LYS A H    2  
ATOM 2714  H HA   . LYS A 1 64  ? 16.738  -0.112  10.676  1.00 0.00 ? 242 LYS A HA   2  
ATOM 2715  H HB2  . LYS A 1 64  ? 16.205  -1.708  13.188  1.00 0.00 ? 242 LYS A HB2  2  
ATOM 2716  H HB3  . LYS A 1 64  ? 17.787  -1.144  12.669  1.00 0.00 ? 242 LYS A HB3  2  
ATOM 2717  H HG2  . LYS A 1 64  ? 17.241  0.491   14.158  1.00 0.00 ? 242 LYS A HG2  2  
ATOM 2718  H HG3  . LYS A 1 64  ? 16.593  1.198   12.675  1.00 0.00 ? 242 LYS A HG3  2  
ATOM 2719  H HD2  . LYS A 1 64  ? 14.377  0.530   13.233  1.00 0.00 ? 242 LYS A HD2  2  
ATOM 2720  H HD3  . LYS A 1 64  ? 14.948  -0.476  14.566  1.00 0.00 ? 242 LYS A HD3  2  
ATOM 2721  H HE2  . LYS A 1 64  ? 14.113  1.471   15.581  1.00 0.00 ? 242 LYS A HE2  2  
ATOM 2722  H HE3  . LYS A 1 64  ? 15.865  1.670   15.581  1.00 0.00 ? 242 LYS A HE3  2  
ATOM 2723  H HZ1  . LYS A 1 64  ? 14.699  2.723   13.208  1.00 0.00 ? 242 LYS A HZ1  2  
ATOM 2724  H HZ2  . LYS A 1 64  ? 15.688  3.489   14.347  1.00 0.00 ? 242 LYS A HZ2  2  
ATOM 2725  H HZ3  . LYS A 1 64  ? 14.014  3.433   14.583  1.00 0.00 ? 242 LYS A HZ3  2  
ATOM 2726  N N    . GLY A 1 65  ? 15.800  -2.635  9.547   1.00 0.00 ? 243 GLY A N    2  
ATOM 2727  C CA   . GLY A 1 65  ? 16.052  -3.875  8.836   1.00 0.00 ? 243 GLY A CA   2  
ATOM 2728  C C    . GLY A 1 65  ? 15.395  -5.068  9.502   1.00 0.00 ? 243 GLY A C    2  
ATOM 2729  O O    . GLY A 1 65  ? 16.077  -5.976  9.977   1.00 0.00 ? 243 GLY A O    2  
ATOM 2730  H H    . GLY A 1 65  ? 15.028  -2.083  9.306   1.00 0.00 ? 243 GLY A H    2  
ATOM 2731  H HA2  . GLY A 1 65  ? 15.673  -3.784  7.830   1.00 0.00 ? 243 GLY A HA2  2  
ATOM 2732  H HA3  . GLY A 1 65  ? 17.118  -4.043  8.795   1.00 0.00 ? 243 GLY A HA3  2  
ATOM 2733  N N    . ALA A 1 66  ? 14.066  -5.067  9.537   1.00 0.00 ? 244 ALA A N    2  
ATOM 2734  C CA   . ALA A 1 66  ? 13.317  -6.158  10.149  1.00 0.00 ? 244 ALA A CA   2  
ATOM 2735  C C    . ALA A 1 66  ? 12.035  -6.444  9.375   1.00 0.00 ? 244 ALA A C    2  
ATOM 2736  O O    . ALA A 1 66  ? 11.268  -5.532  9.064   1.00 0.00 ? 244 ALA A O    2  
ATOM 2737  C CB   . ALA A 1 66  ? 12.999  -5.830  11.600  1.00 0.00 ? 244 ALA A CB   2  
ATOM 2738  H H    . ALA A 1 66  ? 13.579  -4.315  9.141   1.00 0.00 ? 244 ALA A H    2  
ATOM 2739  H HA   . ALA A 1 66  ? 13.940  -7.040  10.133  1.00 0.00 ? 244 ALA A HA   2  
ATOM 2740  H HB1  . ALA A 1 66  ? 13.692  -6.350  12.246  1.00 0.00 ? 244 ALA A HB1  2  
ATOM 2741  H HB2  . ALA A 1 66  ? 13.089  -4.766  11.757  1.00 0.00 ? 244 ALA A HB2  2  
ATOM 2742  H HB3  . ALA A 1 66  ? 11.991  -6.144  11.827  1.00 0.00 ? 244 ALA A HB3  2  
ATOM 2743  N N    . LYS A 1 67  ? 11.807  -7.716  9.067   1.00 0.00 ? 245 LYS A N    2  
ATOM 2744  C CA   . LYS A 1 67  ? 10.617  -8.124  8.330   1.00 0.00 ? 245 LYS A CA   2  
ATOM 2745  C C    . LYS A 1 67  ? 9.367   -7.472  8.911   1.00 0.00 ? 245 LYS A C    2  
ATOM 2746  O O    . LYS A 1 67  ? 9.335   -7.104  10.087  1.00 0.00 ? 245 LYS A O    2  
ATOM 2747  C CB   . LYS A 1 67  ? 10.471  -9.647  8.359   1.00 0.00 ? 245 LYS A CB   2  
ATOM 2748  C CG   . LYS A 1 67  ? 10.038  -10.191 9.709   1.00 0.00 ? 245 LYS A CG   2  
ATOM 2749  C CD   . LYS A 1 67  ? 11.232  -10.487 10.600  1.00 0.00 ? 245 LYS A CD   2  
ATOM 2750  C CE   . LYS A 1 67  ? 10.798  -11.043 11.948  1.00 0.00 ? 245 LYS A CE   2  
ATOM 2751  N NZ   . LYS A 1 67  ? 10.567  -12.513 11.894  1.00 0.00 ? 245 LYS A NZ   2  
ATOM 2752  H H    . LYS A 1 67  ? 12.456  -8.398  9.342   1.00 0.00 ? 245 LYS A H    2  
ATOM 2753  H HA   . LYS A 1 67  ? 10.733  -7.801  7.306   1.00 0.00 ? 245 LYS A HA   2  
ATOM 2754  H HB2  . LYS A 1 67  ? 9.736   -9.940  7.623   1.00 0.00 ? 245 LYS A HB2  2  
ATOM 2755  H HB3  . LYS A 1 67  ? 11.421  -10.093 8.103   1.00 0.00 ? 245 LYS A HB3  2  
ATOM 2756  H HG2  . LYS A 1 67  ? 9.411   -9.460  10.197  1.00 0.00 ? 245 LYS A HG2  2  
ATOM 2757  H HG3  . LYS A 1 67  ? 9.478   -11.103 9.557   1.00 0.00 ? 245 LYS A HG3  2  
ATOM 2758  H HD2  . LYS A 1 67  ? 11.864  -11.214 10.111  1.00 0.00 ? 245 LYS A HD2  2  
ATOM 2759  H HD3  . LYS A 1 67  ? 11.787  -9.573  10.759  1.00 0.00 ? 245 LYS A HD3  2  
ATOM 2760  H HE2  . LYS A 1 67  ? 11.569  -10.835 12.674  1.00 0.00 ? 245 LYS A HE2  2  
ATOM 2761  H HE3  . LYS A 1 67  ? 9.882   -10.553 12.246  1.00 0.00 ? 245 LYS A HE3  2  
ATOM 2762  H HZ1  . LYS A 1 67  ? 10.238  -12.857 12.818  1.00 0.00 ? 245 LYS A HZ1  2  
ATOM 2763  H HZ2  . LYS A 1 67  ? 11.449  -13.004 11.648  1.00 0.00 ? 245 LYS A HZ2  2  
ATOM 2764  H HZ3  . LYS A 1 67  ? 9.847   -12.735 11.177  1.00 0.00 ? 245 LYS A HZ3  2  
ATOM 2765  N N    . LEU A 1 68  ? 8.338   -7.332  8.083   1.00 0.00 ? 246 LEU A N    2  
ATOM 2766  C CA   . LEU A 1 68  ? 7.084   -6.725  8.516   1.00 0.00 ? 246 LEU A CA   2  
ATOM 2767  C C    . LEU A 1 68  ? 6.089   -7.792  8.965   1.00 0.00 ? 246 LEU A C    2  
ATOM 2768  O O    . LEU A 1 68  ? 6.355   -8.989  8.856   1.00 0.00 ? 246 LEU A O    2  
ATOM 2769  C CB   . LEU A 1 68  ? 6.479   -5.893  7.384   1.00 0.00 ? 246 LEU A CB   2  
ATOM 2770  C CG   . LEU A 1 68  ? 7.403   -4.852  6.750   1.00 0.00 ? 246 LEU A CG   2  
ATOM 2771  C CD1  . LEU A 1 68  ? 6.890   -4.450  5.375   1.00 0.00 ? 246 LEU A CD1  2  
ATOM 2772  C CD2  . LEU A 1 68  ? 7.530   -3.632  7.651   1.00 0.00 ? 246 LEU A CD2  2  
ATOM 2773  H H    . LEU A 1 68  ? 8.422   -7.644  7.158   1.00 0.00 ? 246 LEU A H    2  
ATOM 2774  H HA   . LEU A 1 68  ? 7.300   -6.078  9.352   1.00 0.00 ? 246 LEU A HA   2  
ATOM 2775  H HB2  . LEU A 1 68  ? 6.164   -6.571  6.606   1.00 0.00 ? 246 LEU A HB2  2  
ATOM 2776  H HB3  . LEU A 1 68  ? 5.617   -5.375  7.779   1.00 0.00 ? 246 LEU A HB3  2  
ATOM 2777  H HG   . LEU A 1 68  ? 8.388   -5.281  6.626   1.00 0.00 ? 246 LEU A HG   2  
ATOM 2778  H HD11 . LEU A 1 68  ? 7.275   -3.475  5.118   1.00 0.00 ? 246 LEU A HD11 2  
ATOM 2779  H HD12 . LEU A 1 68  ? 5.811   -4.419  5.389   1.00 0.00 ? 246 LEU A HD12 2  
ATOM 2780  H HD13 . LEU A 1 68  ? 7.220   -5.173  4.643   1.00 0.00 ? 246 LEU A HD13 2  
ATOM 2781  H HD21 . LEU A 1 68  ? 6.709   -3.616  8.352   1.00 0.00 ? 246 LEU A HD21 2  
ATOM 2782  H HD22 . LEU A 1 68  ? 7.506   -2.736  7.048   1.00 0.00 ? 246 LEU A HD22 2  
ATOM 2783  H HD23 . LEU A 1 68  ? 8.464   -3.679  8.190   1.00 0.00 ? 246 LEU A HD23 2  
ATOM 2784  N N    . LYS A 1 69  ? 4.942   -7.349  9.468   1.00 0.00 ? 247 LYS A N    2  
ATOM 2785  C CA   . LYS A 1 69  ? 3.905   -8.264  9.930   1.00 0.00 ? 247 LYS A CA   2  
ATOM 2786  C C    . LYS A 1 69  ? 2.553   -7.907  9.320   1.00 0.00 ? 247 LYS A C    2  
ATOM 2787  O O    . LYS A 1 69  ? 2.164   -6.740  9.289   1.00 0.00 ? 247 LYS A O    2  
ATOM 2788  C CB   . LYS A 1 69  ? 3.812   -8.232  11.458  1.00 0.00 ? 247 LYS A CB   2  
ATOM 2789  C CG   . LYS A 1 69  ? 3.676   -6.831  12.029  1.00 0.00 ? 247 LYS A CG   2  
ATOM 2790  C CD   . LYS A 1 69  ? 3.935   -6.812  13.527  1.00 0.00 ? 247 LYS A CD   2  
ATOM 2791  C CE   . LYS A 1 69  ? 2.668   -7.107  14.315  1.00 0.00 ? 247 LYS A CE   2  
ATOM 2792  N NZ   . LYS A 1 69  ? 1.752   -5.934  14.351  1.00 0.00 ? 247 LYS A NZ   2  
ATOM 2793  H H    . LYS A 1 69  ? 4.789   -6.382  9.529   1.00 0.00 ? 247 LYS A H    2  
ATOM 2794  H HA   . LYS A 1 69  ? 4.177   -9.260  9.616   1.00 0.00 ? 247 LYS A HA   2  
ATOM 2795  H HB2  . LYS A 1 69  ? 2.953   -8.809  11.766  1.00 0.00 ? 247 LYS A HB2  2  
ATOM 2796  H HB3  . LYS A 1 69  ? 4.704   -8.681  11.870  1.00 0.00 ? 247 LYS A HB3  2  
ATOM 2797  H HG2  . LYS A 1 69  ? 4.390   -6.183  11.544  1.00 0.00 ? 247 LYS A HG2  2  
ATOM 2798  H HG3  . LYS A 1 69  ? 2.674   -6.472  11.842  1.00 0.00 ? 247 LYS A HG3  2  
ATOM 2799  H HD2  . LYS A 1 69  ? 4.675   -7.561  13.765  1.00 0.00 ? 247 LYS A HD2  2  
ATOM 2800  H HD3  . LYS A 1 69  ? 4.304   -5.836  13.807  1.00 0.00 ? 247 LYS A HD3  2  
ATOM 2801  H HE2  . LYS A 1 69  ? 2.156   -7.937  13.852  1.00 0.00 ? 247 LYS A HE2  2  
ATOM 2802  H HE3  . LYS A 1 69  ? 2.941   -7.371  15.326  1.00 0.00 ? 247 LYS A HE3  2  
ATOM 2803  H HZ1  . LYS A 1 69  ? 2.301   -5.054  14.435  1.00 0.00 ? 247 LYS A HZ1  2  
ATOM 2804  H HZ2  . LYS A 1 69  ? 1.110   -6.006  15.167  1.00 0.00 ? 247 LYS A HZ2  2  
ATOM 2805  H HZ3  . LYS A 1 69  ? 1.185   -5.895  13.480  1.00 0.00 ? 247 LYS A HZ3  2  
ATOM 2806  N N    . VAL A 1 70  ? 1.841   -8.920  8.838   1.00 0.00 ? 248 VAL A N    2  
ATOM 2807  C CA   . VAL A 1 70  ? 0.531   -8.714  8.232   1.00 0.00 ? 248 VAL A CA   2  
ATOM 2808  C C    . VAL A 1 70  ? -0.395  -7.950  9.171   1.00 0.00 ? 248 VAL A C    2  
ATOM 2809  O O    . VAL A 1 70  ? -0.381  -8.163  10.383  1.00 0.00 ? 248 VAL A O    2  
ATOM 2810  C CB   . VAL A 1 70  ? -0.130  -10.053 7.853   1.00 0.00 ? 248 VAL A CB   2  
ATOM 2811  C CG1  . VAL A 1 70  ? -1.499  -9.816  7.234   1.00 0.00 ? 248 VAL A CG1  2  
ATOM 2812  C CG2  . VAL A 1 70  ? 0.765   -10.839 6.906   1.00 0.00 ? 248 VAL A CG2  2  
ATOM 2813  H H    . VAL A 1 70  ? 2.205   -9.829  8.892   1.00 0.00 ? 248 VAL A H    2  
ATOM 2814  H HA   . VAL A 1 70  ? 0.669   -8.136  7.329   1.00 0.00 ? 248 VAL A HA   2  
ATOM 2815  H HB   . VAL A 1 70  ? -0.262  -10.633 8.755   1.00 0.00 ? 248 VAL A HB   2  
ATOM 2816  H HG11 . VAL A 1 70  ? -1.388  -9.247  6.323   1.00 0.00 ? 248 VAL A HG11 2  
ATOM 2817  H HG12 . VAL A 1 70  ? -1.963  -10.766 7.013   1.00 0.00 ? 248 VAL A HG12 2  
ATOM 2818  H HG13 . VAL A 1 70  ? -2.117  -9.266  7.928   1.00 0.00 ? 248 VAL A HG13 2  
ATOM 2819  H HG21 . VAL A 1 70  ? 1.775   -10.842 7.286   1.00 0.00 ? 248 VAL A HG21 2  
ATOM 2820  H HG22 . VAL A 1 70  ? 0.405   -11.855 6.832   1.00 0.00 ? 248 VAL A HG22 2  
ATOM 2821  H HG23 . VAL A 1 70  ? 0.748   -10.379 5.930   1.00 0.00 ? 248 VAL A HG23 2  
ATOM 2822  N N    . GLY A 1 71  ? -1.201  -7.058  8.603   1.00 0.00 ? 249 GLY A N    2  
ATOM 2823  C CA   . GLY A 1 71  ? -2.124  -6.275  9.404   1.00 0.00 ? 249 GLY A CA   2  
ATOM 2824  C C    . GLY A 1 71  ? -1.559  -4.920  9.782   1.00 0.00 ? 249 GLY A C    2  
ATOM 2825  O O    . GLY A 1 71  ? -2.308  -3.970  10.005  1.00 0.00 ? 249 GLY A O    2  
ATOM 2826  H H    . GLY A 1 71  ? -1.169  -6.930  7.632   1.00 0.00 ? 249 GLY A H    2  
ATOM 2827  H HA2  . GLY A 1 71  ? -3.036  -6.130  8.845   1.00 0.00 ? 249 GLY A HA2  2  
ATOM 2828  H HA3  . GLY A 1 71  ? -2.351  -6.822  10.308  1.00 0.00 ? 249 GLY A HA3  2  
ATOM 2829  N N    . GLN A 1 72  ? -0.235  -4.833  9.855   1.00 0.00 ? 250 GLN A N    2  
ATOM 2830  C CA   . GLN A 1 72  ? 0.429   -3.584  10.211  1.00 0.00 ? 250 GLN A CA   2  
ATOM 2831  C C    . GLN A 1 72  ? 0.223   -2.530  9.129   1.00 0.00 ? 250 GLN A C    2  
ATOM 2832  O O    . GLN A 1 72  ? 0.113   -2.854  7.946   1.00 0.00 ? 250 GLN A O    2  
ATOM 2833  C CB   . GLN A 1 72  ? 1.924   -3.822  10.430  1.00 0.00 ? 250 GLN A CB   2  
ATOM 2834  C CG   . GLN A 1 72  ? 2.763   -3.614  9.180   1.00 0.00 ? 250 GLN A CG   2  
ATOM 2835  C CD   . GLN A 1 72  ? 3.268   -2.191  9.045   1.00 0.00 ? 250 GLN A CD   2  
ATOM 2836  O OE1  . GLN A 1 72  ? 3.133   -1.383  9.964   1.00 0.00 ? 250 GLN A OE1  2  
ATOM 2837  N NE2  . GLN A 1 72  ? 3.855   -1.878  7.896   1.00 0.00 ? 250 GLN A NE2  2  
ATOM 2838  H H    . GLN A 1 72  ? 0.308   -5.626  9.666   1.00 0.00 ? 250 GLN A H    2  
ATOM 2839  H HA   . GLN A 1 72  ? -0.008  -3.227  11.132  1.00 0.00 ? 250 GLN A HA   2  
ATOM 2840  H HB2  . GLN A 1 72  ? 2.277   -3.142  11.191  1.00 0.00 ? 250 GLN A HB2  2  
ATOM 2841  H HB3  . GLN A 1 72  ? 2.070   -4.836  10.771  1.00 0.00 ? 250 GLN A HB3  2  
ATOM 2842  H HG2  . GLN A 1 72  ? 3.613   -4.279  9.217   1.00 0.00 ? 250 GLN A HG2  2  
ATOM 2843  H HG3  . GLN A 1 72  ? 2.161   -3.851  8.315   1.00 0.00 ? 250 GLN A HG3  2  
ATOM 2844  H HE21 . GLN A 1 72  ? 3.926   -2.573  7.208   1.00 0.00 ? 250 GLN A HE21 2  
ATOM 2845  H HE22 . GLN A 1 72  ? 4.190   -0.965  7.781   1.00 0.00 ? 250 GLN A HE22 2  
ATOM 2846  N N    . TYR A 1 73  ? 0.171   -1.269  9.541   1.00 0.00 ? 251 TYR A N    2  
ATOM 2847  C CA   . TYR A 1 73  ? -0.026  -0.167  8.606   1.00 0.00 ? 251 TYR A CA   2  
ATOM 2848  C C    . TYR A 1 73  ? 1.291   0.226   7.943   1.00 0.00 ? 251 TYR A C    2  
ATOM 2849  O O    . TYR A 1 73  ? 2.302   0.432   8.616   1.00 0.00 ? 251 TYR A O    2  
ATOM 2850  C CB   . TYR A 1 73  ? -0.626  1.041   9.328   1.00 0.00 ? 251 TYR A CB   2  
ATOM 2851  C CG   . TYR A 1 73  ? -2.138  1.051   9.336   1.00 0.00 ? 251 TYR A CG   2  
ATOM 2852  C CD1  . TYR A 1 73  ? -2.856  1.458   8.218   1.00 0.00 ? 251 TYR A CD1  2  
ATOM 2853  C CD2  . TYR A 1 73  ? -2.849  0.653   10.462  1.00 0.00 ? 251 TYR A CD2  2  
ATOM 2854  C CE1  . TYR A 1 73  ? -4.237  1.470   8.221   1.00 0.00 ? 251 TYR A CE1  2  
ATOM 2855  C CE2  . TYR A 1 73  ? -4.231  0.661   10.473  1.00 0.00 ? 251 TYR A CE2  2  
ATOM 2856  C CZ   . TYR A 1 73  ? -4.920  1.070   9.351   1.00 0.00 ? 251 TYR A CZ   2  
ATOM 2857  O OH   . TYR A 1 73  ? -6.296  1.079   9.358   1.00 0.00 ? 251 TYR A OH   2  
ATOM 2858  H H    . TYR A 1 73  ? 0.264   -1.073  10.497  1.00 0.00 ? 251 TYR A H    2  
ATOM 2859  H HA   . TYR A 1 73  ? -0.715  -0.497  7.844   1.00 0.00 ? 251 TYR A HA   2  
ATOM 2860  H HB2  . TYR A 1 73  ? -0.290  1.043   10.353  1.00 0.00 ? 251 TYR A HB2  2  
ATOM 2861  H HB3  . TYR A 1 73  ? -0.290  1.945   8.842   1.00 0.00 ? 251 TYR A HB3  2  
ATOM 2862  H HD1  . TYR A 1 73  ? -2.318  1.770   7.334   1.00 0.00 ? 251 TYR A HD1  2  
ATOM 2863  H HD2  . TYR A 1 73  ? -2.306  0.333   11.339  1.00 0.00 ? 251 TYR A HD2  2  
ATOM 2864  H HE1  . TYR A 1 73  ? -4.777  1.790   7.342   1.00 0.00 ? 251 TYR A HE1  2  
ATOM 2865  H HE2  . TYR A 1 73  ? -4.766  0.348   11.358  1.00 0.00 ? 251 TYR A HE2  2  
ATOM 2866  H HH   . TYR A 1 73  ? -6.615  1.728   8.727   1.00 0.00 ? 251 TYR A HH   2  
ATOM 2867  N N    . LEU A 1 74  ? 1.271   0.328   6.619   1.00 0.00 ? 252 LEU A N    2  
ATOM 2868  C CA   . LEU A 1 74  ? 2.462   0.697   5.862   1.00 0.00 ? 252 LEU A CA   2  
ATOM 2869  C C    . LEU A 1 74  ? 2.200   1.928   5.000   1.00 0.00 ? 252 LEU A C    2  
ATOM 2870  O O    . LEU A 1 74  ? 1.144   2.051   4.382   1.00 0.00 ? 252 LEU A O    2  
ATOM 2871  C CB   . LEU A 1 74  ? 2.913   -0.470  4.982   1.00 0.00 ? 252 LEU A CB   2  
ATOM 2872  C CG   . LEU A 1 74  ? 4.246   -0.287  4.256   1.00 0.00 ? 252 LEU A CG   2  
ATOM 2873  C CD1  . LEU A 1 74  ? 5.386   -0.163  5.255   1.00 0.00 ? 252 LEU A CD1  2  
ATOM 2874  C CD2  . LEU A 1 74  ? 4.497   -1.445  3.301   1.00 0.00 ? 252 LEU A CD2  2  
ATOM 2875  H H    . LEU A 1 74  ? 0.436   0.152   6.138   1.00 0.00 ? 252 LEU A H    2  
ATOM 2876  H HA   . LEU A 1 74  ? 3.246   0.928   6.569   1.00 0.00 ? 252 LEU A HA   2  
ATOM 2877  H HB2  . LEU A 1 74  ? 2.995   -1.344  5.609   1.00 0.00 ? 252 LEU A HB2  2  
ATOM 2878  H HB3  . LEU A 1 74  ? 2.149   -0.634  4.235   1.00 0.00 ? 252 LEU A HB3  2  
ATOM 2879  H HG   . LEU A 1 74  ? 4.211   0.625   3.675   1.00 0.00 ? 252 LEU A HG   2  
ATOM 2880  H HD11 . LEU A 1 74  ? 4.982   -0.010  6.245   1.00 0.00 ? 252 LEU A HD11 2  
ATOM 2881  H HD12 . LEU A 1 74  ? 6.009   0.677   4.988   1.00 0.00 ? 252 LEU A HD12 2  
ATOM 2882  H HD13 . LEU A 1 74  ? 5.976   -1.067  5.242   1.00 0.00 ? 252 LEU A HD13 2  
ATOM 2883  H HD21 . LEU A 1 74  ? 5.252   -2.096  3.715   1.00 0.00 ? 252 LEU A HD21 2  
ATOM 2884  H HD22 . LEU A 1 74  ? 4.835   -1.060  2.349   1.00 0.00 ? 252 LEU A HD22 2  
ATOM 2885  H HD23 . LEU A 1 74  ? 3.581   -2.000  3.160   1.00 0.00 ? 252 LEU A HD23 2  
ATOM 2886  N N    . ASN A 1 75  ? 3.171   2.835   4.962   1.00 0.00 ? 253 ASN A N    2  
ATOM 2887  C CA   . ASN A 1 75  ? 3.046   4.056   4.174   1.00 0.00 ? 253 ASN A CA   2  
ATOM 2888  C C    . ASN A 1 75  ? 3.372   3.792   2.707   1.00 0.00 ? 253 ASN A C    2  
ATOM 2889  O O    . ASN A 1 75  ? 4.357   3.124   2.390   1.00 0.00 ? 253 ASN A O    2  
ATOM 2890  C CB   . ASN A 1 75  ? 3.971   5.142   4.727   1.00 0.00 ? 253 ASN A CB   2  
ATOM 2891  C CG   . ASN A 1 75  ? 3.600   5.554   6.138   1.00 0.00 ? 253 ASN A CG   2  
ATOM 2892  O OD1  . ASN A 1 75  ? 2.657   5.022   6.725   1.00 0.00 ? 253 ASN A OD1  2  
ATOM 2893  N ND2  . ASN A 1 75  ? 4.341   6.508   6.690   1.00 0.00 ? 253 ASN A ND2  2  
ATOM 2894  H H    . ASN A 1 75  ? 3.991   2.680   5.476   1.00 0.00 ? 253 ASN A H    2  
ATOM 2895  H HA   . ASN A 1 75  ? 2.024   4.395   4.248   1.00 0.00 ? 253 ASN A HA   2  
ATOM 2896  H HB2  . ASN A 1 75  ? 4.986   4.771   4.736   1.00 0.00 ? 253 ASN A HB2  2  
ATOM 2897  H HB3  . ASN A 1 75  ? 3.916   6.012   4.090   1.00 0.00 ? 253 ASN A HB3  2  
ATOM 2898  H HD21 . ASN A 1 75  ? 5.076   6.887   6.163   1.00 0.00 ? 253 ASN A HD21 2  
ATOM 2899  H HD22 . ASN A 1 75  ? 4.123   6.793   7.602   1.00 0.00 ? 253 ASN A HD22 2  
ATOM 2900  N N    . CYS A 1 76  ? 2.540   4.321   1.817   1.00 0.00 ? 254 CYS A N    2  
ATOM 2901  C CA   . CYS A 1 76  ? 2.740   4.144   0.383   1.00 0.00 ? 254 CYS A CA   2  
ATOM 2902  C C    . CYS A 1 76  ? 2.038   5.245   -0.404  1.00 0.00 ? 254 CYS A C    2  
ATOM 2903  O O    . CYS A 1 76  ? 1.022   5.785   0.035   1.00 0.00 ? 254 CYS A O    2  
ATOM 2904  C CB   . CYS A 1 76  ? 2.221   2.774   -0.059  1.00 0.00 ? 254 CYS A CB   2  
ATOM 2905  S SG   . CYS A 1 76  ? 3.284   1.392   0.420   1.00 0.00 ? 254 CYS A SG   2  
ATOM 2906  H H    . CYS A 1 76  ? 1.773   4.844   2.131   1.00 0.00 ? 254 CYS A H    2  
ATOM 2907  H HA   . CYS A 1 76  ? 3.800   4.198   0.188   1.00 0.00 ? 254 CYS A HA   2  
ATOM 2908  H HB2  . CYS A 1 76  ? 1.248   2.607   0.380   1.00 0.00 ? 254 CYS A HB2  2  
ATOM 2909  H HB3  . CYS A 1 76  ? 2.129   2.763   -1.135  1.00 0.00 ? 254 CYS A HB3  2  
ATOM 2910  H HG   . CYS A 1 76  ? 2.597   0.615   1.243   1.00 0.00 ? 254 CYS A HG   2  
ATOM 2911  N N    . ILE A 1 77  ? 2.587   5.575   -1.568  1.00 0.00 ? 255 ILE A N    2  
ATOM 2912  C CA   . ILE A 1 77  ? 2.014   6.613   -2.416  1.00 0.00 ? 255 ILE A CA   2  
ATOM 2913  C C    . ILE A 1 77  ? 1.784   6.100   -3.833  1.00 0.00 ? 255 ILE A C    2  
ATOM 2914  O O    . ILE A 1 77  ? 2.611   5.373   -4.385  1.00 0.00 ? 255 ILE A O    2  
ATOM 2915  C CB   . ILE A 1 77  ? 2.921   7.857   -2.474  1.00 0.00 ? 255 ILE A CB   2  
ATOM 2916  C CG1  . ILE A 1 77  ? 3.100   8.449   -1.074  1.00 0.00 ? 255 ILE A CG1  2  
ATOM 2917  C CG2  . ILE A 1 77  ? 2.338   8.893   -3.423  1.00 0.00 ? 255 ILE A CG2  2  
ATOM 2918  C CD1  . ILE A 1 77  ? 4.221   9.462   -0.986  1.00 0.00 ? 255 ILE A CD1  2  
ATOM 2919  H H    . ILE A 1 77  ? 3.397   5.109   -1.864  1.00 0.00 ? 255 ILE A H    2  
ATOM 2920  H HA   . ILE A 1 77  ? 1.065   6.904   -1.991  1.00 0.00 ? 255 ILE A HA   2  
ATOM 2921  H HB   . ILE A 1 77  ? 3.884   7.555   -2.855  1.00 0.00 ? 255 ILE A HB   2  
ATOM 2922  H HG12 . ILE A 1 77  ? 2.187   8.940   -0.778  1.00 0.00 ? 255 ILE A HG12 2  
ATOM 2923  H HG13 . ILE A 1 77  ? 3.317   7.651   -0.379  1.00 0.00 ? 255 ILE A HG13 2  
ATOM 2924  H HG21 . ILE A 1 77  ? 1.275   8.731   -3.524  1.00 0.00 ? 255 ILE A HG21 2  
ATOM 2925  H HG22 . ILE A 1 77  ? 2.514   9.882   -3.028  1.00 0.00 ? 255 ILE A HG22 2  
ATOM 2926  H HG23 . ILE A 1 77  ? 2.810   8.802   -4.390  1.00 0.00 ? 255 ILE A HG23 2  
ATOM 2927  H HD11 . ILE A 1 77  ? 4.299   9.824   0.028   1.00 0.00 ? 255 ILE A HD11 2  
ATOM 2928  H HD12 . ILE A 1 77  ? 5.150   8.997   -1.276  1.00 0.00 ? 255 ILE A HD12 2  
ATOM 2929  H HD13 . ILE A 1 77  ? 4.010   10.290  -1.648  1.00 0.00 ? 255 ILE A HD13 2  
ATOM 2930  N N    . VAL A 1 78  ? 0.654   6.484   -4.419  1.00 0.00 ? 256 VAL A N    2  
ATOM 2931  C CA   . VAL A 1 78  ? 0.315   6.065   -5.774  1.00 0.00 ? 256 VAL A CA   2  
ATOM 2932  C C    . VAL A 1 78  ? 1.286   6.655   -6.791  1.00 0.00 ? 256 VAL A C    2  
ATOM 2933  O O    . VAL A 1 78  ? 1.450   7.872   -6.873  1.00 0.00 ? 256 VAL A O    2  
ATOM 2934  C CB   . VAL A 1 78  ? -1.120  6.483   -6.148  1.00 0.00 ? 256 VAL A CB   2  
ATOM 2935  C CG1  . VAL A 1 78  ? -1.451  6.044   -7.566  1.00 0.00 ? 256 VAL A CG1  2  
ATOM 2936  C CG2  . VAL A 1 78  ? -2.118  5.906   -5.156  1.00 0.00 ? 256 VAL A CG2  2  
ATOM 2937  H H    . VAL A 1 78  ? 0.034   7.063   -3.929  1.00 0.00 ? 256 VAL A H    2  
ATOM 2938  H HA   . VAL A 1 78  ? 0.376   4.987   -5.816  1.00 0.00 ? 256 VAL A HA   2  
ATOM 2939  H HB   . VAL A 1 78  ? -1.182  7.560   -6.105  1.00 0.00 ? 256 VAL A HB   2  
ATOM 2940  H HG11 . VAL A 1 78  ? -1.019  6.741   -8.269  1.00 0.00 ? 256 VAL A HG11 2  
ATOM 2941  H HG12 . VAL A 1 78  ? -1.048  5.057   -7.742  1.00 0.00 ? 256 VAL A HG12 2  
ATOM 2942  H HG13 . VAL A 1 78  ? -2.523  6.022   -7.695  1.00 0.00 ? 256 VAL A HG13 2  
ATOM 2943  H HG21 . VAL A 1 78  ? -2.905  5.399   -5.692  1.00 0.00 ? 256 VAL A HG21 2  
ATOM 2944  H HG22 . VAL A 1 78  ? -1.615  5.205   -4.505  1.00 0.00 ? 256 VAL A HG22 2  
ATOM 2945  H HG23 . VAL A 1 78  ? -2.541  6.705   -4.565  1.00 0.00 ? 256 VAL A HG23 2  
ATOM 2946  N N    . GLU A 1 79  ? 1.927   5.784   -7.563  1.00 0.00 ? 257 GLU A N    2  
ATOM 2947  C CA   . GLU A 1 79  ? 2.883   6.220   -8.575  1.00 0.00 ? 257 GLU A CA   2  
ATOM 2948  C C    . GLU A 1 79  ? 2.220   6.308   -9.947  1.00 0.00 ? 257 GLU A C    2  
ATOM 2949  O O    . GLU A 1 79  ? 2.394   7.288   -10.671 1.00 0.00 ? 257 GLU A O    2  
ATOM 2950  C CB   . GLU A 1 79  ? 4.073   5.260   -8.632  1.00 0.00 ? 257 GLU A CB   2  
ATOM 2951  C CG   . GLU A 1 79  ? 5.198   5.629   -7.680  1.00 0.00 ? 257 GLU A CG   2  
ATOM 2952  C CD   . GLU A 1 79  ? 6.554   5.159   -8.171  1.00 0.00 ? 257 GLU A CD   2  
ATOM 2953  O OE1  . GLU A 1 79  ? 6.645   4.013   -8.657  1.00 0.00 ? 257 GLU A OE1  2  
ATOM 2954  O OE2  . GLU A 1 79  ? 7.524   5.939   -8.068  1.00 0.00 ? 257 GLU A OE2  2  
ATOM 2955  H H    . GLU A 1 79  ? 1.754   4.826   -7.450  1.00 0.00 ? 257 GLU A H    2  
ATOM 2956  H HA   . GLU A 1 79  ? 3.237   7.201   -8.296  1.00 0.00 ? 257 GLU A HA   2  
ATOM 2957  H HB2  . GLU A 1 79  ? 3.730   4.266   -8.384  1.00 0.00 ? 257 GLU A HB2  2  
ATOM 2958  H HB3  . GLU A 1 79  ? 4.467   5.254   -9.637  1.00 0.00 ? 257 GLU A HB3  2  
ATOM 2959  H HG2  . GLU A 1 79  ? 5.224   6.703   -7.573  1.00 0.00 ? 257 GLU A HG2  2  
ATOM 2960  H HG3  . GLU A 1 79  ? 5.003   5.176   -6.719  1.00 0.00 ? 257 GLU A HG3  2  
ATOM 2961  N N    . LYS A 1 80  ? 1.460   5.276   -10.298 1.00 0.00 ? 258 LYS A N    2  
ATOM 2962  C CA   . LYS A 1 80  ? 0.771   5.235   -11.582 1.00 0.00 ? 258 LYS A CA   2  
ATOM 2963  C C    . LYS A 1 80  ? -0.583  4.544   -11.450 1.00 0.00 ? 258 LYS A C    2  
ATOM 2964  O O    . LYS A 1 80  ? -0.773  3.688   -10.585 1.00 0.00 ? 258 LYS A O    2  
ATOM 2965  C CB   . LYS A 1 80  ? 1.627   4.508   -12.621 1.00 0.00 ? 258 LYS A CB   2  
ATOM 2966  C CG   . LYS A 1 80  ? 2.910   5.242   -12.973 1.00 0.00 ? 258 LYS A CG   2  
ATOM 2967  C CD   . LYS A 1 80  ? 3.638   4.570   -14.125 1.00 0.00 ? 258 LYS A CD   2  
ATOM 2968  C CE   . LYS A 1 80  ? 4.688   5.489   -14.732 1.00 0.00 ? 258 LYS A CE   2  
ATOM 2969  N NZ   . LYS A 1 80  ? 5.941   5.508   -13.927 1.00 0.00 ? 258 LYS A NZ   2  
ATOM 2970  H H    . LYS A 1 80  ? 1.361   4.523   -9.677  1.00 0.00 ? 258 LYS A H    2  
ATOM 2971  H HA   . LYS A 1 80  ? 0.612   6.252   -11.906 1.00 0.00 ? 258 LYS A HA   2  
ATOM 2972  H HB2  . LYS A 1 80  ? 1.888   3.533   -12.237 1.00 0.00 ? 258 LYS A HB2  2  
ATOM 2973  H HB3  . LYS A 1 80  ? 1.048   4.386   -13.525 1.00 0.00 ? 258 LYS A HB3  2  
ATOM 2974  H HG2  . LYS A 1 80  ? 2.668   6.255   -13.256 1.00 0.00 ? 258 LYS A HG2  2  
ATOM 2975  H HG3  . LYS A 1 80  ? 3.556   5.253   -12.107 1.00 0.00 ? 258 LYS A HG3  2  
ATOM 2976  H HD2  . LYS A 1 80  ? 4.125   3.678   -13.760 1.00 0.00 ? 258 LYS A HD2  2  
ATOM 2977  H HD3  . LYS A 1 80  ? 2.920   4.304   -14.888 1.00 0.00 ? 258 LYS A HD3  2  
ATOM 2978  H HE2  . LYS A 1 80  ? 4.915   5.145   -15.729 1.00 0.00 ? 258 LYS A HE2  2  
ATOM 2979  H HE3  . LYS A 1 80  ? 4.286   6.490   -14.780 1.00 0.00 ? 258 LYS A HE3  2  
ATOM 2980  H HZ1  . LYS A 1 80  ? 6.351   4.553   -13.883 1.00 0.00 ? 258 LYS A HZ1  2  
ATOM 2981  H HZ2  . LYS A 1 80  ? 5.739   5.831   -12.960 1.00 0.00 ? 258 LYS A HZ2  2  
ATOM 2982  H HZ3  . LYS A 1 80  ? 6.634   6.151   -14.360 1.00 0.00 ? 258 LYS A HZ3  2  
ATOM 2983  N N    . VAL A 1 81  ? -1.521  4.919   -12.314 1.00 0.00 ? 259 VAL A N    2  
ATOM 2984  C CA   . VAL A 1 81  ? -2.856  4.334   -12.296 1.00 0.00 ? 259 VAL A CA   2  
ATOM 2985  C C    . VAL A 1 81  ? -3.201  3.711   -13.644 1.00 0.00 ? 259 VAL A C    2  
ATOM 2986  O O    . VAL A 1 81  ? -3.190  4.386   -14.674 1.00 0.00 ? 259 VAL A O    2  
ATOM 2987  C CB   . VAL A 1 81  ? -3.924  5.384   -11.939 1.00 0.00 ? 259 VAL A CB   2  
ATOM 2988  C CG1  . VAL A 1 81  ? -5.309  4.754   -11.925 1.00 0.00 ? 259 VAL A CG1  2  
ATOM 2989  C CG2  . VAL A 1 81  ? -3.609  6.030   -10.599 1.00 0.00 ? 259 VAL A CG2  2  
ATOM 2990  H H    . VAL A 1 81  ? -1.309  5.606   -12.981 1.00 0.00 ? 259 VAL A H    2  
ATOM 2991  H HA   . VAL A 1 81  ? -2.872  3.563   -11.539 1.00 0.00 ? 259 VAL A HA   2  
ATOM 2992  H HB   . VAL A 1 81  ? -3.911  6.153   -12.698 1.00 0.00 ? 259 VAL A HB   2  
ATOM 2993  H HG11 . VAL A 1 81  ? -5.215  3.679   -11.983 1.00 0.00 ? 259 VAL A HG11 2  
ATOM 2994  H HG12 . VAL A 1 81  ? -5.817  5.023   -11.010 1.00 0.00 ? 259 VAL A HG12 2  
ATOM 2995  H HG13 . VAL A 1 81  ? -5.876  5.112   -12.771 1.00 0.00 ? 259 VAL A HG13 2  
ATOM 2996  H HG21 . VAL A 1 81  ? -2.541  6.155   -10.503 1.00 0.00 ? 259 VAL A HG21 2  
ATOM 2997  H HG22 . VAL A 1 81  ? -4.091  6.995   -10.541 1.00 0.00 ? 259 VAL A HG22 2  
ATOM 2998  H HG23 . VAL A 1 81  ? -3.972  5.399   -9.801  1.00 0.00 ? 259 VAL A HG23 2  
ATOM 2999  N N    . LYS A 1 82  ? -3.509  2.418   -13.631 1.00 0.00 ? 260 LYS A N    2  
ATOM 3000  C CA   . LYS A 1 82  ? -3.860  1.702   -14.851 1.00 0.00 ? 260 LYS A CA   2  
ATOM 3001  C C    . LYS A 1 82  ? -5.306  1.980   -15.248 1.00 0.00 ? 260 LYS A C    2  
ATOM 3002  O O    . LYS A 1 82  ? -6.211  1.919   -14.416 1.00 0.00 ? 260 LYS A O    2  
ATOM 3003  C CB   . LYS A 1 82  ? -3.651  0.198   -14.663 1.00 0.00 ? 260 LYS A CB   2  
ATOM 3004  C CG   . LYS A 1 82  ? -2.198  -0.232  -14.764 1.00 0.00 ? 260 LYS A CG   2  
ATOM 3005  C CD   . LYS A 1 82  ? -2.073  -1.658  -15.275 1.00 0.00 ? 260 LYS A CD   2  
ATOM 3006  C CE   . LYS A 1 82  ? -0.623  -2.024  -15.554 1.00 0.00 ? 260 LYS A CE   2  
ATOM 3007  N NZ   . LYS A 1 82  ? -0.492  -3.414  -16.073 1.00 0.00 ? 260 LYS A NZ   2  
ATOM 3008  H H    . LYS A 1 82  ? -3.500  1.934   -12.778 1.00 0.00 ? 260 LYS A H    2  
ATOM 3009  H HA   . LYS A 1 82  ? -3.210  2.051   -15.639 1.00 0.00 ? 260 LYS A HA   2  
ATOM 3010  H HB2  . LYS A 1 82  ? -4.022  -0.085  -13.688 1.00 0.00 ? 260 LYS A HB2  2  
ATOM 3011  H HB3  . LYS A 1 82  ? -4.214  -0.329  -15.419 1.00 0.00 ? 260 LYS A HB3  2  
ATOM 3012  H HG2  . LYS A 1 82  ? -1.683  0.429   -15.445 1.00 0.00 ? 260 LYS A HG2  2  
ATOM 3013  H HG3  . LYS A 1 82  ? -1.744  -0.169  -13.785 1.00 0.00 ? 260 LYS A HG3  2  
ATOM 3014  H HD2  . LYS A 1 82  ? -2.466  -2.334  -14.531 1.00 0.00 ? 260 LYS A HD2  2  
ATOM 3015  H HD3  . LYS A 1 82  ? -2.642  -1.754  -16.189 1.00 0.00 ? 260 LYS A HD3  2  
ATOM 3016  H HE2  . LYS A 1 82  ? -0.226  -1.337  -16.286 1.00 0.00 ? 260 LYS A HE2  2  
ATOM 3017  H HE3  . LYS A 1 82  ? -0.060  -1.937  -14.637 1.00 0.00 ? 260 LYS A HE3  2  
ATOM 3018  H HZ1  . LYS A 1 82  ? -0.335  -3.397  -17.102 1.00 0.00 ? 260 LYS A HZ1  2  
ATOM 3019  H HZ2  . LYS A 1 82  ? -1.360  -3.952  -15.876 1.00 0.00 ? 260 LYS A HZ2  2  
ATOM 3020  H HZ3  . LYS A 1 82  ? 0.311   -3.891  -15.618 1.00 0.00 ? 260 LYS A HZ3  2  
ATOM 3021  N N    . GLY A 1 83  ? -5.517  2.283   -16.525 1.00 0.00 ? 261 GLY A N    2  
ATOM 3022  C CA   . GLY A 1 83  ? -6.856  2.563   -17.010 1.00 0.00 ? 261 GLY A CA   2  
ATOM 3023  C C    . GLY A 1 83  ? -7.907  1.699   -16.342 1.00 0.00 ? 261 GLY A C    2  
ATOM 3024  O O    . GLY A 1 83  ? -8.957  2.192   -15.933 1.00 0.00 ? 261 GLY A O    2  
ATOM 3025  H H    . GLY A 1 83  ? -4.758  2.316   -17.144 1.00 0.00 ? 261 GLY A H    2  
ATOM 3026  H HA2  . GLY A 1 83  ? -7.086  3.602   -16.820 1.00 0.00 ? 261 GLY A HA2  2  
ATOM 3027  H HA3  . GLY A 1 83  ? -6.886  2.387   -18.075 1.00 0.00 ? 261 GLY A HA3  2  
ATOM 3028  N N    . ASN A 1 84  ? -7.625  0.405   -16.234 1.00 0.00 ? 262 ASN A N    2  
ATOM 3029  C CA   . ASN A 1 84  ? -8.556  -0.531  -15.613 1.00 0.00 ? 262 ASN A CA   2  
ATOM 3030  C C    . ASN A 1 84  ? -8.031  -1.004  -14.261 1.00 0.00 ? 262 ASN A C    2  
ATOM 3031  O O    . ASN A 1 84  ? -6.911  -0.678  -13.869 1.00 0.00 ? 262 ASN A O    2  
ATOM 3032  C CB   . ASN A 1 84  ? -8.791  -1.733  -16.530 1.00 0.00 ? 262 ASN A CB   2  
ATOM 3033  C CG   . ASN A 1 84  ? -10.093 -2.448  -16.225 1.00 0.00 ? 262 ASN A CG   2  
ATOM 3034  O OD1  . ASN A 1 84  ? -10.152 -3.302  -15.340 1.00 0.00 ? 262 ASN A OD1  2  
ATOM 3035  N ND2  . ASN A 1 84  ? -11.144 -2.101  -16.957 1.00 0.00 ? 262 ASN A ND2  2  
ATOM 3036  H H    . ASN A 1 84  ? -6.771  0.071   -16.579 1.00 0.00 ? 262 ASN A H    2  
ATOM 3037  H HA   . ASN A 1 84  ? -9.493  -0.016  -15.462 1.00 0.00 ? 262 ASN A HA   2  
ATOM 3038  H HB2  . ASN A 1 84  ? -8.821  -1.395  -17.556 1.00 0.00 ? 262 ASN A HB2  2  
ATOM 3039  H HB3  . ASN A 1 84  ? -7.979  -2.434  -16.411 1.00 0.00 ? 262 ASN A HB3  2  
ATOM 3040  H HD21 . ASN A 1 84  ? -11.023 -1.413  -17.645 1.00 0.00 ? 262 ASN A HD21 2  
ATOM 3041  H HD22 . ASN A 1 84  ? -11.999 -2.547  -16.780 1.00 0.00 ? 262 ASN A HD22 2  
ATOM 3042  N N    . GLY A 1 85  ? -8.849  -1.776  -13.552 1.00 0.00 ? 263 GLY A N    2  
ATOM 3043  C CA   . GLY A 1 85  ? -8.450  -2.282  -12.251 1.00 0.00 ? 263 GLY A CA   2  
ATOM 3044  C C    . GLY A 1 85  ? -7.508  -3.465  -12.354 1.00 0.00 ? 263 GLY A C    2  
ATOM 3045  O O    . GLY A 1 85  ? -7.825  -4.562  -11.896 1.00 0.00 ? 263 GLY A O    2  
ATOM 3046  H H    . GLY A 1 85  ? -9.731  -2.004  -13.914 1.00 0.00 ? 263 GLY A H    2  
ATOM 3047  H HA2  . GLY A 1 85  ? -7.959  -1.491  -11.704 1.00 0.00 ? 263 GLY A HA2  2  
ATOM 3048  H HA3  . GLY A 1 85  ? -9.333  -2.587  -11.710 1.00 0.00 ? 263 GLY A HA3  2  
ATOM 3049  N N    . GLY A 1 86  ? -6.344  -3.243  -12.959 1.00 0.00 ? 264 GLY A N    2  
ATOM 3050  C CA   . GLY A 1 86  ? -5.372  -4.309  -13.111 1.00 0.00 ? 264 GLY A CA   2  
ATOM 3051  C C    . GLY A 1 86  ? -4.352  -4.328  -11.990 1.00 0.00 ? 264 GLY A C    2  
ATOM 3052  O O    . GLY A 1 86  ? -4.472  -5.106  -11.044 1.00 0.00 ? 264 GLY A O    2  
ATOM 3053  H H    . GLY A 1 86  ? -6.145  -2.348  -13.305 1.00 0.00 ? 264 GLY A H    2  
ATOM 3054  H HA2  . GLY A 1 86  ? -5.891  -5.256  -13.127 1.00 0.00 ? 264 GLY A HA2  2  
ATOM 3055  H HA3  . GLY A 1 86  ? -4.855  -4.178  -14.050 1.00 0.00 ? 264 GLY A HA3  2  
ATOM 3056  N N    . VAL A 1 87  ? -3.343  -3.469  -12.096 1.00 0.00 ? 265 VAL A N    2  
ATOM 3057  C CA   . VAL A 1 87  ? -2.297  -3.389  -11.084 1.00 0.00 ? 265 VAL A CA   2  
ATOM 3058  C C    . VAL A 1 87  ? -2.032  -1.944  -10.678 1.00 0.00 ? 265 VAL A C    2  
ATOM 3059  O O    . VAL A 1 87  ? -2.085  -1.035  -11.508 1.00 0.00 ? 265 VAL A O    2  
ATOM 3060  C CB   . VAL A 1 87  ? -0.983  -4.019  -11.583 1.00 0.00 ? 265 VAL A CB   2  
ATOM 3061  C CG1  . VAL A 1 87  ? 0.115   -3.862  -10.542 1.00 0.00 ? 265 VAL A CG1  2  
ATOM 3062  C CG2  . VAL A 1 87  ? -1.194  -5.485  -11.931 1.00 0.00 ? 265 VAL A CG2  2  
ATOM 3063  H H    . VAL A 1 87  ? -3.301  -2.873  -12.873 1.00 0.00 ? 265 VAL A H    2  
ATOM 3064  H HA   . VAL A 1 87  ? -2.629  -3.941  -10.216 1.00 0.00 ? 265 VAL A HA   2  
ATOM 3065  H HB   . VAL A 1 87  ? -0.676  -3.499  -12.479 1.00 0.00 ? 265 VAL A HB   2  
ATOM 3066  H HG11 . VAL A 1 87  ? 0.084   -2.862  -10.135 1.00 0.00 ? 265 VAL A HG11 2  
ATOM 3067  H HG12 . VAL A 1 87  ? -0.036  -4.580  -9.749  1.00 0.00 ? 265 VAL A HG12 2  
ATOM 3068  H HG13 . VAL A 1 87  ? 1.076   -4.032  -11.005 1.00 0.00 ? 265 VAL A HG13 2  
ATOM 3069  H HG21 . VAL A 1 87  ? -0.241  -5.993  -11.941 1.00 0.00 ? 265 VAL A HG21 2  
ATOM 3070  H HG22 . VAL A 1 87  ? -1.837  -5.942  -11.193 1.00 0.00 ? 265 VAL A HG22 2  
ATOM 3071  H HG23 . VAL A 1 87  ? -1.653  -5.562  -12.905 1.00 0.00 ? 265 VAL A HG23 2  
ATOM 3072  N N    . VAL A 1 88  ? -1.747  -1.737  -9.396  1.00 0.00 ? 266 VAL A N    2  
ATOM 3073  C CA   . VAL A 1 88  ? -1.473  -0.401  -8.880  1.00 0.00 ? 266 VAL A CA   2  
ATOM 3074  C C    . VAL A 1 88  ? -0.021  -0.272  -8.434  1.00 0.00 ? 266 VAL A C    2  
ATOM 3075  O O    . VAL A 1 88  ? 0.541   -1.192  -7.841  1.00 0.00 ? 266 VAL A O    2  
ATOM 3076  C CB   . VAL A 1 88  ? -2.395  -0.057  -7.695  1.00 0.00 ? 266 VAL A CB   2  
ATOM 3077  C CG1  . VAL A 1 88  ? -2.193  1.387   -7.264  1.00 0.00 ? 266 VAL A CG1  2  
ATOM 3078  C CG2  . VAL A 1 88  ? -3.849  -0.315  -8.060  1.00 0.00 ? 266 VAL A CG2  2  
ATOM 3079  H H    . VAL A 1 88  ? -1.720  -2.501  -8.784  1.00 0.00 ? 266 VAL A H    2  
ATOM 3080  H HA   . VAL A 1 88  ? -1.660  0.308   -9.673  1.00 0.00 ? 266 VAL A HA   2  
ATOM 3081  H HB   . VAL A 1 88  ? -2.135  -0.697  -6.865  1.00 0.00 ? 266 VAL A HB   2  
ATOM 3082  H HG11 . VAL A 1 88  ? -2.936  2.012   -7.738  1.00 0.00 ? 266 VAL A HG11 2  
ATOM 3083  H HG12 . VAL A 1 88  ? -2.292  1.460   -6.190  1.00 0.00 ? 266 VAL A HG12 2  
ATOM 3084  H HG13 . VAL A 1 88  ? -1.207  1.717   -7.558  1.00 0.00 ? 266 VAL A HG13 2  
ATOM 3085  H HG21 . VAL A 1 88  ? -4.291  0.594   -8.440  1.00 0.00 ? 266 VAL A HG21 2  
ATOM 3086  H HG22 . VAL A 1 88  ? -3.900  -1.084  -8.817  1.00 0.00 ? 266 VAL A HG22 2  
ATOM 3087  H HG23 . VAL A 1 88  ? -4.389  -0.638  -7.182  1.00 0.00 ? 266 VAL A HG23 2  
ATOM 3088  N N    . SER A 1 89  ? 0.582   0.877   -8.724  1.00 0.00 ? 267 SER A N    2  
ATOM 3089  C CA   . SER A 1 89  ? 1.970   1.126   -8.356  1.00 0.00 ? 267 SER A CA   2  
ATOM 3090  C C    . SER A 1 89  ? 2.053   1.969   -7.087  1.00 0.00 ? 267 SER A C    2  
ATOM 3091  O O    . SER A 1 89  ? 1.389   3.000   -6.969  1.00 0.00 ? 267 SER A O    2  
ATOM 3092  C CB   . SER A 1 89  ? 2.705   1.829   -9.499  1.00 0.00 ? 267 SER A CB   2  
ATOM 3093  O OG   . SER A 1 89  ? 4.098   1.891   -9.248  1.00 0.00 ? 267 SER A OG   2  
ATOM 3094  H H    . SER A 1 89  ? 0.080   1.572   -9.199  1.00 0.00 ? 267 SER A H    2  
ATOM 3095  H HA   . SER A 1 89  ? 2.441   0.172   -8.171  1.00 0.00 ? 267 SER A HA   2  
ATOM 3096  H HB2  . SER A 1 89  ? 2.540   1.287   -10.417 1.00 0.00 ? 267 SER A HB2  2  
ATOM 3097  H HB3  . SER A 1 89  ? 2.325   2.836   -9.602  1.00 0.00 ? 267 SER A HB3  2  
ATOM 3098  H HG   . SER A 1 89  ? 4.249   2.050   -8.314  1.00 0.00 ? 267 SER A HG   2  
ATOM 3099  N N    . LEU A 1 90  ? 2.873   1.525   -6.142  1.00 0.00 ? 268 LEU A N    2  
ATOM 3100  C CA   . LEU A 1 90  ? 3.044   2.238   -4.880  1.00 0.00 ? 268 LEU A CA   2  
ATOM 3101  C C    . LEU A 1 90  ? 4.519   2.518   -4.609  1.00 0.00 ? 268 LEU A C    2  
ATOM 3102  O O    . LEU A 1 90  ? 5.398   1.838   -5.139  1.00 0.00 ? 268 LEU A O    2  
ATOM 3103  C CB   . LEU A 1 90  ? 2.447   1.428   -3.729  1.00 0.00 ? 268 LEU A CB   2  
ATOM 3104  C CG   . LEU A 1 90  ? 0.935   1.553   -3.534  1.00 0.00 ? 268 LEU A CG   2  
ATOM 3105  C CD1  . LEU A 1 90  ? 0.467   0.652   -2.402  1.00 0.00 ? 268 LEU A CD1  2  
ATOM 3106  C CD2  . LEU A 1 90  ? 0.550   2.999   -3.262  1.00 0.00 ? 268 LEU A CD2  2  
ATOM 3107  H H    . LEU A 1 90  ? 3.376   0.698   -6.294  1.00 0.00 ? 268 LEU A H    2  
ATOM 3108  H HA   . LEU A 1 90  ? 2.520   3.179   -4.958  1.00 0.00 ? 268 LEU A HA   2  
ATOM 3109  H HB2  . LEU A 1 90  ? 2.672   0.387   -3.904  1.00 0.00 ? 268 LEU A HB2  2  
ATOM 3110  H HB3  . LEU A 1 90  ? 2.927   1.750   -2.815  1.00 0.00 ? 268 LEU A HB3  2  
ATOM 3111  H HG   . LEU A 1 90  ? 0.435   1.237   -4.439  1.00 0.00 ? 268 LEU A HG   2  
ATOM 3112  H HD11 . LEU A 1 90  ? -0.191  -0.108  -2.795  1.00 0.00 ? 268 LEU A HD11 2  
ATOM 3113  H HD12 . LEU A 1 90  ? -0.063  1.242   -1.668  1.00 0.00 ? 268 LEU A HD12 2  
ATOM 3114  H HD13 . LEU A 1 90  ? 1.322   0.184   -1.937  1.00 0.00 ? 268 LEU A HD13 2  
ATOM 3115  H HD21 . LEU A 1 90  ? 0.243   3.469   -4.184  1.00 0.00 ? 268 LEU A HD21 2  
ATOM 3116  H HD22 . LEU A 1 90  ? 1.400   3.528   -2.855  1.00 0.00 ? 268 LEU A HD22 2  
ATOM 3117  H HD23 . LEU A 1 90  ? -0.265  3.028   -2.554  1.00 0.00 ? 268 LEU A HD23 2  
ATOM 3118  N N    . SER A 1 91  ? 4.783   3.521   -3.778  1.00 0.00 ? 269 SER A N    2  
ATOM 3119  C CA   . SER A 1 91  ? 6.151   3.892   -3.437  1.00 0.00 ? 269 SER A CA   2  
ATOM 3120  C C    . SER A 1 91  ? 6.197   4.636   -2.106  1.00 0.00 ? 269 SER A C    2  
ATOM 3121  O O    . SER A 1 91  ? 5.299   5.416   -1.786  1.00 0.00 ? 269 SER A O    2  
ATOM 3122  C CB   . SER A 1 91  ? 6.757   4.760   -4.541  1.00 0.00 ? 269 SER A CB   2  
ATOM 3123  O OG   . SER A 1 91  ? 6.100   6.013   -4.622  1.00 0.00 ? 269 SER A OG   2  
ATOM 3124  H H    . SER A 1 91  ? 4.039   4.026   -3.387  1.00 0.00 ? 269 SER A H    2  
ATOM 3125  H HA   . SER A 1 91  ? 6.728   2.983   -3.348  1.00 0.00 ? 269 SER A HA   2  
ATOM 3126  H HB2  . SER A 1 91  ? 7.802   4.928   -4.330  1.00 0.00 ? 269 SER A HB2  2  
ATOM 3127  H HB3  . SER A 1 91  ? 6.658   4.253   -5.489  1.00 0.00 ? 269 SER A HB3  2  
ATOM 3128  H HG   . SER A 1 91  ? 5.200   5.924   -4.302  1.00 0.00 ? 269 SER A HG   2  
ATOM 3129  N N    . VAL A 1 92  ? 7.249   4.389   -1.332  1.00 0.00 ? 270 VAL A N    2  
ATOM 3130  C CA   . VAL A 1 92  ? 7.414   5.035   -0.036  1.00 0.00 ? 270 VAL A CA   2  
ATOM 3131  C C    . VAL A 1 92  ? 7.747   6.514   -0.198  1.00 0.00 ? 270 VAL A C    2  
ATOM 3132  O O    . VAL A 1 92  ? 8.631   6.881   -0.970  1.00 0.00 ? 270 VAL A O    2  
ATOM 3133  C CB   . VAL A 1 92  ? 8.522   4.359   0.792   1.00 0.00 ? 270 VAL A CB   2  
ATOM 3134  C CG1  . VAL A 1 92  ? 8.589   4.960   2.187   1.00 0.00 ? 270 VAL A CG1  2  
ATOM 3135  C CG2  . VAL A 1 92  ? 8.293   2.856   0.861   1.00 0.00 ? 270 VAL A CG2  2  
ATOM 3136  H H    . VAL A 1 92  ? 7.931   3.757   -1.641  1.00 0.00 ? 270 VAL A H    2  
ATOM 3137  H HA   . VAL A 1 92  ? 6.482   4.943   0.504   1.00 0.00 ? 270 VAL A HA   2  
ATOM 3138  H HB   . VAL A 1 92  ? 9.468   4.535   0.302   1.00 0.00 ? 270 VAL A HB   2  
ATOM 3139  H HG11 . VAL A 1 92  ? 9.513   4.663   2.663   1.00 0.00 ? 270 VAL A HG11 2  
ATOM 3140  H HG12 . VAL A 1 92  ? 8.549   6.038   2.118   1.00 0.00 ? 270 VAL A HG12 2  
ATOM 3141  H HG13 . VAL A 1 92  ? 7.754   4.606   2.773   1.00 0.00 ? 270 VAL A HG13 2  
ATOM 3142  H HG21 . VAL A 1 92  ? 7.713   2.621   1.741   1.00 0.00 ? 270 VAL A HG21 2  
ATOM 3143  H HG22 . VAL A 1 92  ? 7.758   2.532   -0.020  1.00 0.00 ? 270 VAL A HG22 2  
ATOM 3144  H HG23 . VAL A 1 92  ? 9.245   2.348   0.911   1.00 0.00 ? 270 VAL A HG23 2  
ATOM 3145  N N    . GLY A 1 93  ? 7.032   7.360   0.538   1.00 0.00 ? 271 GLY A N    2  
ATOM 3146  C CA   . GLY A 1 93  ? 7.266   8.791   0.462   1.00 0.00 ? 271 GLY A CA   2  
ATOM 3147  C C    . GLY A 1 93  ? 8.465   9.226   1.281   1.00 0.00 ? 271 GLY A C    2  
ATOM 3148  O O    . GLY A 1 93  ? 8.317   9.885   2.310   1.00 0.00 ? 271 GLY A O    2  
ATOM 3149  H H    . GLY A 1 93  ? 6.339   7.011   1.137   1.00 0.00 ? 271 GLY A H    2  
ATOM 3150  H HA2  . GLY A 1 93  ? 7.430   9.063   -0.570  1.00 0.00 ? 271 GLY A HA2  2  
ATOM 3151  H HA3  . GLY A 1 93  ? 6.390   9.307   0.825   1.00 0.00 ? 271 GLY A HA3  2  
ATOM 3152  N N    . HIS A 1 94  ? 9.657   8.855   0.825   1.00 0.00 ? 272 HIS A N    2  
ATOM 3153  C CA   . HIS A 1 94  ? 10.888  9.211   1.524   1.00 0.00 ? 272 HIS A CA   2  
ATOM 3154  C C    . HIS A 1 94  ? 11.043  10.726  1.612   1.00 0.00 ? 272 HIS A C    2  
ATOM 3155  O O    . HIS A 1 94  ? 11.323  11.270  2.681   1.00 0.00 ? 272 HIS A O    2  
ATOM 3156  C CB   . HIS A 1 94  ? 12.097  8.603   0.813   1.00 0.00 ? 272 HIS A CB   2  
ATOM 3157  C CG   . HIS A 1 94  ? 13.318  8.516   1.676   1.00 0.00 ? 272 HIS A CG   2  
ATOM 3158  N ND1  . HIS A 1 94  ? 14.600  8.513   1.169   1.00 0.00 ? 272 HIS A ND1  2  
ATOM 3159  C CD2  . HIS A 1 94  ? 13.447  8.429   3.021   1.00 0.00 ? 272 HIS A CD2  2  
ATOM 3160  C CE1  . HIS A 1 94  ? 15.465  8.427   2.164   1.00 0.00 ? 272 HIS A CE1  2  
ATOM 3161  N NE2  . HIS A 1 94  ? 14.790  8.375   3.298   1.00 0.00 ? 272 HIS A NE2  2  
ATOM 3162  H H    . HIS A 1 94  ? 9.711   8.331   -0.001  1.00 0.00 ? 272 HIS A H    2  
ATOM 3163  H HA   . HIS A 1 94  ? 10.829  8.809   2.523   1.00 0.00 ? 272 HIS A HA   2  
ATOM 3164  H HB2  . HIS A 1 94  ? 11.850  7.604   0.487   1.00 0.00 ? 272 HIS A HB2  2  
ATOM 3165  H HB3  . HIS A 1 94  ? 12.341  9.207   -0.049  1.00 0.00 ? 272 HIS A HB3  2  
ATOM 3166  H HD1  . HIS A 1 94  ? 14.840  8.564   0.220   1.00 0.00 ? 272 HIS A HD1  2  
ATOM 3167  H HD2  . HIS A 1 94  ? 12.642  8.407   3.743   1.00 0.00 ? 272 HIS A HD2  2  
ATOM 3168  H HE1  . HIS A 1 94  ? 16.540  8.403   2.067   1.00 0.00 ? 272 HIS A HE1  2  
ATOM 3169  H HE2  . HIS A 1 94  ? 15.185  8.223   4.182   1.00 0.00 ? 272 HIS A HE2  2  
ATOM 3170  N N    . SER A 1 95  ? 10.861  11.402  0.482   1.00 0.00 ? 273 SER A N    2  
ATOM 3171  C CA   . SER A 1 95  ? 10.986  12.854  0.431   1.00 0.00 ? 273 SER A CA   2  
ATOM 3172  C C    . SER A 1 95  ? 10.319  13.499  1.642   1.00 0.00 ? 273 SER A C    2  
ATOM 3173  O O    . SER A 1 95  ? 9.096   13.482  1.773   1.00 0.00 ? 273 SER A O    2  
ATOM 3174  C CB   . SER A 1 95  ? 10.364  13.396  -0.857  1.00 0.00 ? 273 SER A CB   2  
ATOM 3175  O OG   . SER A 1 95  ? 10.600  14.787  -0.991  1.00 0.00 ? 273 SER A OG   2  
ATOM 3176  H H    . SER A 1 95  ? 10.640  10.912  -0.337  1.00 0.00 ? 273 SER A H    2  
ATOM 3177  H HA   . SER A 1 95  ? 12.038  13.097  0.443   1.00 0.00 ? 273 SER A HA   2  
ATOM 3178  H HB2  . SER A 1 95  ? 10.795  12.886  -1.704  1.00 0.00 ? 273 SER A HB2  2  
ATOM 3179  H HB3  . SER A 1 95  ? 9.297   13.224  -0.838  1.00 0.00 ? 273 SER A HB3  2  
ATOM 3180  H HG   . SER A 1 95  ? 9.761   15.251  -1.038  1.00 0.00 ? 273 SER A HG   2  
ATOM 3181  N N    . GLU A 1 96  ? 11.134  14.068  2.526   1.00 0.00 ? 274 GLU A N    2  
ATOM 3182  C CA   . GLU A 1 96  ? 10.623  14.718  3.727   1.00 0.00 ? 274 GLU A CA   2  
ATOM 3183  C C    . GLU A 1 96  ? 10.398  16.208  3.485   1.00 0.00 ? 274 GLU A C    2  
ATOM 3184  O O    . GLU A 1 96  ? 11.262  17.034  3.781   1.00 0.00 ? 274 GLU A O    2  
ATOM 3185  C CB   . GLU A 1 96  ? 11.594  14.520  4.893   1.00 0.00 ? 274 GLU A CB   2  
ATOM 3186  C CG   . GLU A 1 96  ? 13.051  14.444  4.466   1.00 0.00 ? 274 GLU A CG   2  
ATOM 3187  C CD   . GLU A 1 96  ? 13.468  13.043  4.063   1.00 0.00 ? 274 GLU A CD   2  
ATOM 3188  O OE1  . GLU A 1 96  ? 13.228  12.104  4.850   1.00 0.00 ? 274 GLU A OE1  2  
ATOM 3189  O OE2  . GLU A 1 96  ? 14.034  12.886  2.961   1.00 0.00 ? 274 GLU A OE2  2  
ATOM 3190  H H    . GLU A 1 96  ? 12.101  14.049  2.366   1.00 0.00 ? 274 GLU A H    2  
ATOM 3191  H HA   . GLU A 1 96  ? 9.678   14.260  3.976   1.00 0.00 ? 274 GLU A HA   2  
ATOM 3192  H HB2  . GLU A 1 96  ? 11.484  15.346  5.581   1.00 0.00 ? 274 GLU A HB2  2  
ATOM 3193  H HB3  . GLU A 1 96  ? 11.342  13.602  5.403   1.00 0.00 ? 274 GLU A HB3  2  
ATOM 3194  H HG2  . GLU A 1 96  ? 13.201  15.104  3.624   1.00 0.00 ? 274 GLU A HG2  2  
ATOM 3195  H HG3  . GLU A 1 96  ? 13.671  14.766  5.289   1.00 0.00 ? 274 GLU A HG3  2  
ATOM 3196  N N    . VAL A 1 97  ? 9.231   16.544  2.945   1.00 0.00 ? 275 VAL A N    2  
ATOM 3197  C CA   . VAL A 1 97  ? 8.891   17.934  2.663   1.00 0.00 ? 275 VAL A CA   2  
ATOM 3198  C C    . VAL A 1 97  ? 8.471   18.665  3.933   1.00 0.00 ? 275 VAL A C    2  
ATOM 3199  O O    . VAL A 1 97  ? 8.883   19.799  4.175   1.00 0.00 ? 275 VAL A O    2  
ATOM 3200  C CB   . VAL A 1 97  ? 7.757   18.035  1.627   1.00 0.00 ? 275 VAL A CB   2  
ATOM 3201  C CG1  . VAL A 1 97  ? 8.149   17.333  0.335   1.00 0.00 ? 275 VAL A CG1  2  
ATOM 3202  C CG2  . VAL A 1 97  ? 6.468   17.454  2.189   1.00 0.00 ? 275 VAL A CG2  2  
ATOM 3203  H H    . VAL A 1 97  ? 8.583   15.841  2.731   1.00 0.00 ? 275 VAL A H    2  
ATOM 3204  H HA   . VAL A 1 97  ? 9.767   18.416  2.255   1.00 0.00 ? 275 VAL A HA   2  
ATOM 3205  H HB   . VAL A 1 97  ? 7.590   19.079  1.406   1.00 0.00 ? 275 VAL A HB   2  
ATOM 3206  H HG11 . VAL A 1 97  ? 8.114   18.038  -0.482  1.00 0.00 ? 275 VAL A HG11 2  
ATOM 3207  H HG12 . VAL A 1 97  ? 9.150   16.938  0.430   1.00 0.00 ? 275 VAL A HG12 2  
ATOM 3208  H HG13 . VAL A 1 97  ? 7.459   16.524  0.142   1.00 0.00 ? 275 VAL A HG13 2  
ATOM 3209  H HG21 . VAL A 1 97  ? 5.743   17.353  1.395   1.00 0.00 ? 275 VAL A HG21 2  
ATOM 3210  H HG22 . VAL A 1 97  ? 6.668   16.483  2.619   1.00 0.00 ? 275 VAL A HG22 2  
ATOM 3211  H HG23 . VAL A 1 97  ? 6.079   18.111  2.952   1.00 0.00 ? 275 VAL A HG23 2  
ATOM 3212  N N    . SER A 1 98  ? 7.647   18.007  4.743   1.00 0.00 ? 276 SER A N    2  
ATOM 3213  C CA   . SER A 1 98  ? 7.168   18.596  5.988   1.00 0.00 ? 276 SER A CA   2  
ATOM 3214  C C    . SER A 1 98  ? 7.724   17.844  7.194   1.00 0.00 ? 276 SER A C    2  
ATOM 3215  O O    . SER A 1 98  ? 6.995   17.532  8.137   1.00 0.00 ? 276 SER A O    2  
ATOM 3216  C CB   . SER A 1 98  ? 5.638   18.584  6.027   1.00 0.00 ? 276 SER A CB   2  
ATOM 3217  O OG   . SER A 1 98  ? 5.096   19.339  4.957   1.00 0.00 ? 276 SER A OG   2  
ATOM 3218  H H    . SER A 1 98  ? 7.353   17.105  4.496   1.00 0.00 ? 276 SER A H    2  
ATOM 3219  H HA   . SER A 1 98  ? 7.513   19.618  6.026   1.00 0.00 ? 276 SER A HA   2  
ATOM 3220  H HB2  . SER A 1 98  ? 5.287   17.567  5.948   1.00 0.00 ? 276 SER A HB2  2  
ATOM 3221  H HB3  . SER A 1 98  ? 5.301   19.011  6.961   1.00 0.00 ? 276 SER A HB3  2  
ATOM 3222  H HG   . SER A 1 98  ? 4.622   20.096  5.308   1.00 0.00 ? 276 SER A HG   2  
ATOM 3223  N N    . THR A 1 99  ? 9.021   17.556  7.157   1.00 0.00 ? 277 THR A N    2  
ATOM 3224  C CA   . THR A 1 99  ? 9.676   16.840  8.245   1.00 0.00 ? 277 THR A CA   2  
ATOM 3225  C C    . THR A 1 99  ? 11.176  17.114  8.258   1.00 0.00 ? 277 THR A C    2  
ATOM 3226  O O    . THR A 1 99  ? 11.846  17.000  7.233   1.00 0.00 ? 277 THR A O    2  
ATOM 3227  C CB   . THR A 1 99  ? 9.444   15.321  8.138   1.00 0.00 ? 277 THR A CB   2  
ATOM 3228  O OG1  . THR A 1 99  ? 8.054   15.052  7.921   1.00 0.00 ? 277 THR A OG1  2  
ATOM 3229  C CG2  . THR A 1 99  ? 9.912   14.612  9.400   1.00 0.00 ? 277 THR A CG2  2  
ATOM 3230  H H    . THR A 1 99  ? 9.549   17.831  6.379   1.00 0.00 ? 277 THR A H    2  
ATOM 3231  H HA   . THR A 1 99  ? 9.249   17.184  9.176   1.00 0.00 ? 277 THR A HA   2  
ATOM 3232  H HB   . THR A 1 99  ? 10.011  14.944  7.299   1.00 0.00 ? 277 THR A HB   2  
ATOM 3233  H HG1  . THR A 1 99  ? 7.883   14.997  6.978   1.00 0.00 ? 277 THR A HG1  2  
ATOM 3234  H HG21 . THR A 1 99  ? 10.172  13.591  9.163   1.00 0.00 ? 277 THR A HG21 2  
ATOM 3235  H HG22 . THR A 1 99  ? 9.120   14.622  10.133  1.00 0.00 ? 277 THR A HG22 2  
ATOM 3236  H HG23 . THR A 1 99  ? 10.777  15.121  9.798   1.00 0.00 ? 277 THR A HG23 2  
ATOM 3237  N N    . ALA A 1 100 ? 11.696  17.475  9.427   1.00 0.00 ? 278 ALA A N    2  
ATOM 3238  C CA   . ALA A 1 100 ? 13.118  17.762  9.574   1.00 0.00 ? 278 ALA A CA   2  
ATOM 3239  C C    . ALA A 1 100 ? 13.964  16.758  8.798   1.00 0.00 ? 278 ALA A C    2  
ATOM 3240  O O    . ALA A 1 100 ? 13.583  15.597  8.648   1.00 0.00 ? 278 ALA A O    2  
ATOM 3241  C CB   . ALA A 1 100 ? 13.507  17.759  11.045  1.00 0.00 ? 278 ALA A CB   2  
ATOM 3242  H H    . ALA A 1 100 ? 11.110  17.548  10.209  1.00 0.00 ? 278 ALA A H    2  
ATOM 3243  H HA   . ALA A 1 100 ? 13.301  18.752  9.181   1.00 0.00 ? 278 ALA A HA   2  
ATOM 3244  H HB1  . ALA A 1 100 ? 13.538  18.775  11.410  1.00 0.00 ? 278 ALA A HB1  2  
ATOM 3245  H HB2  . ALA A 1 100 ? 12.779  17.194  11.608  1.00 0.00 ? 278 ALA A HB2  2  
ATOM 3246  H HB3  . ALA A 1 100 ? 14.481  17.306  11.158  1.00 0.00 ? 278 ALA A HB3  2  
ATOM 3247  N N    . ILE A 1 101 ? 15.111  17.213  8.307   1.00 0.00 ? 279 ILE A N    2  
ATOM 3248  C CA   . ILE A 1 101 ? 16.011  16.354  7.547   1.00 0.00 ? 279 ILE A CA   2  
ATOM 3249  C C    . ILE A 1 101 ? 16.264  15.040  8.278   1.00 0.00 ? 279 ILE A C    2  
ATOM 3250  O O    . ILE A 1 101 ? 16.434  15.018  9.497   1.00 0.00 ? 279 ILE A O    2  
ATOM 3251  C CB   . ILE A 1 101 ? 17.360  17.047  7.280   1.00 0.00 ? 279 ILE A CB   2  
ATOM 3252  C CG1  . ILE A 1 101 ? 17.136  18.407  6.616   1.00 0.00 ? 279 ILE A CG1  2  
ATOM 3253  C CG2  . ILE A 1 101 ? 18.245  16.167  6.410   1.00 0.00 ? 279 ILE A CG2  2  
ATOM 3254  C CD1  . ILE A 1 101 ? 16.367  18.326  5.316   1.00 0.00 ? 279 ILE A CD1  2  
ATOM 3255  H H    . ILE A 1 101 ? 15.360  18.148  8.460   1.00 0.00 ? 279 ILE A H    2  
ATOM 3256  H HA   . ILE A 1 101 ? 15.543  16.141  6.597   1.00 0.00 ? 279 ILE A HA   2  
ATOM 3257  H HB   . ILE A 1 101 ? 17.858  17.194  8.226   1.00 0.00 ? 279 ILE A HB   2  
ATOM 3258  H HG12 . ILE A 1 101 ? 16.582  19.043  7.289   1.00 0.00 ? 279 ILE A HG12 2  
ATOM 3259  H HG13 . ILE A 1 101 ? 18.095  18.860  6.407   1.00 0.00 ? 279 ILE A HG13 2  
ATOM 3260  H HG21 . ILE A 1 101 ? 18.615  16.742  5.575   1.00 0.00 ? 279 ILE A HG21 2  
ATOM 3261  H HG22 . ILE A 1 101 ? 19.077  15.805  6.995   1.00 0.00 ? 279 ILE A HG22 2  
ATOM 3262  H HG23 . ILE A 1 101 ? 17.670  15.329  6.044   1.00 0.00 ? 279 ILE A HG23 2  
ATOM 3263  H HD11 . ILE A 1 101 ? 15.418  17.840  5.488   1.00 0.00 ? 279 ILE A HD11 2  
ATOM 3264  H HD12 . ILE A 1 101 ? 16.199  19.321  4.933   1.00 0.00 ? 279 ILE A HD12 2  
ATOM 3265  H HD13 . ILE A 1 101 ? 16.937  17.755  4.596   1.00 0.00 ? 279 ILE A HD13 2  
ATOM 3266  N N    . ALA A 1 102 ? 16.289  13.945  7.525   1.00 0.00 ? 280 ALA A N    2  
ATOM 3267  C CA   . ALA A 1 102 ? 16.525  12.627  8.100   1.00 0.00 ? 280 ALA A CA   2  
ATOM 3268  C C    . ALA A 1 102 ? 17.829  12.028  7.583   1.00 0.00 ? 280 ALA A C    2  
ATOM 3269  O O    . ALA A 1 102 ? 17.915  11.604  6.430   1.00 0.00 ? 280 ALA A O    2  
ATOM 3270  C CB   . ALA A 1 102 ? 15.358  11.700  7.794   1.00 0.00 ? 280 ALA A CB   2  
ATOM 3271  H H    . ALA A 1 102 ? 16.147  14.027  6.559   1.00 0.00 ? 280 ALA A H    2  
ATOM 3272  H HA   . ALA A 1 102 ? 16.593  12.738  9.173   1.00 0.00 ? 280 ALA A HA   2  
ATOM 3273  H HB1  . ALA A 1 102 ? 14.671  11.702  8.628   1.00 0.00 ? 280 ALA A HB1  2  
ATOM 3274  H HB2  . ALA A 1 102 ? 14.849  12.045  6.906   1.00 0.00 ? 280 ALA A HB2  2  
ATOM 3275  H HB3  . ALA A 1 102 ? 15.727  10.699  7.633   1.00 0.00 ? 280 ALA A HB3  2  
ATOM 3276  N N    . THR A 1 103 ? 18.843  11.996  8.442   1.00 0.00 ? 281 THR A N    2  
ATOM 3277  C CA   . THR A 1 103 ? 20.142  11.450  8.071   1.00 0.00 ? 281 THR A CA   2  
ATOM 3278  C C    . THR A 1 103 ? 20.918  10.993  9.301   1.00 0.00 ? 281 THR A C    2  
ATOM 3279  O O    . THR A 1 103 ? 20.639  11.426  10.418  1.00 0.00 ? 281 THR A O    2  
ATOM 3280  C CB   . THR A 1 103 ? 20.986  12.484  7.301   1.00 0.00 ? 281 THR A CB   2  
ATOM 3281  O OG1  . THR A 1 103 ? 22.190  11.874  6.823   1.00 0.00 ? 281 THR A OG1  2  
ATOM 3282  C CG2  . THR A 1 103 ? 21.330  13.670  8.189   1.00 0.00 ? 281 THR A CG2  2  
ATOM 3283  H H    . THR A 1 103 ? 18.712  12.349  9.347   1.00 0.00 ? 281 THR A H    2  
ATOM 3284  H HA   . THR A 1 103 ? 19.975  10.600  7.426   1.00 0.00 ? 281 THR A HA   2  
ATOM 3285  H HB   . THR A 1 103 ? 20.411  12.839  6.458   1.00 0.00 ? 281 THR A HB   2  
ATOM 3286  H HG1  . THR A 1 103 ? 22.773  11.693  7.564   1.00 0.00 ? 281 THR A HG1  2  
ATOM 3287  H HG21 . THR A 1 103 ? 21.415  13.341  9.214   1.00 0.00 ? 281 THR A HG21 2  
ATOM 3288  H HG22 . THR A 1 103 ? 20.552  14.415  8.112   1.00 0.00 ? 281 THR A HG22 2  
ATOM 3289  H HG23 . THR A 1 103 ? 22.269  14.097  7.870   1.00 0.00 ? 281 THR A HG23 2  
ATOM 3290  N N    . GLU A 1 104 ? 21.892  10.114  9.087   1.00 0.00 ? 282 GLU A N    2  
ATOM 3291  C CA   . GLU A 1 104 ? 22.708  9.598   10.181  1.00 0.00 ? 282 GLU A CA   2  
ATOM 3292  C C    . GLU A 1 104 ? 24.166  10.016  10.016  1.00 0.00 ? 282 GLU A C    2  
ATOM 3293  O O    . GLU A 1 104 ? 24.577  10.460  8.944   1.00 0.00 ? 282 GLU A O    2  
ATOM 3294  C CB   . GLU A 1 104 ? 22.607  8.073   10.245  1.00 0.00 ? 282 GLU A CB   2  
ATOM 3295  C CG   . GLU A 1 104 ? 21.419  7.574   11.051  1.00 0.00 ? 282 GLU A CG   2  
ATOM 3296  C CD   . GLU A 1 104 ? 21.116  6.110   10.798  1.00 0.00 ? 282 GLU A CD   2  
ATOM 3297  O OE1  . GLU A 1 104 ? 21.694  5.254   11.500  1.00 0.00 ? 282 GLU A OE1  2  
ATOM 3298  O OE2  . GLU A 1 104 ? 20.299  5.821   9.899   1.00 0.00 ? 282 GLU A OE2  2  
ATOM 3299  H H    . GLU A 1 104 ? 22.066  9.806   8.174   1.00 0.00 ? 282 GLU A H    2  
ATOM 3300  H HA   . GLU A 1 104 ? 22.329  10.014  11.102  1.00 0.00 ? 282 GLU A HA   2  
ATOM 3301  H HB2  . GLU A 1 104 ? 22.522  7.686   9.240   1.00 0.00 ? 282 GLU A HB2  2  
ATOM 3302  H HB3  . GLU A 1 104 ? 23.509  7.684   10.695  1.00 0.00 ? 282 GLU A HB3  2  
ATOM 3303  H HG2  . GLU A 1 104 ? 21.633  7.706   12.101  1.00 0.00 ? 282 GLU A HG2  2  
ATOM 3304  H HG3  . GLU A 1 104 ? 20.550  8.158   10.785  1.00 0.00 ? 282 GLU A HG3  2  
ATOM 3305  N N    . GLN A 1 105 ? 24.941  9.872   11.085  1.00 0.00 ? 283 GLN A N    2  
ATOM 3306  C CA   . GLN A 1 105 ? 26.353  10.236  11.060  1.00 0.00 ? 283 GLN A CA   2  
ATOM 3307  C C    . GLN A 1 105 ? 27.048  9.634   9.843   1.00 0.00 ? 283 GLN A C    2  
ATOM 3308  O O    . GLN A 1 105 ? 27.451  8.471   9.859   1.00 0.00 ? 283 GLN A O    2  
ATOM 3309  C CB   . GLN A 1 105 ? 27.046  9.767   12.341  1.00 0.00 ? 283 GLN A CB   2  
ATOM 3310  C CG   . GLN A 1 105 ? 26.902  8.276   12.600  1.00 0.00 ? 283 GLN A CG   2  
ATOM 3311  C CD   . GLN A 1 105 ? 27.236  7.897   14.029  1.00 0.00 ? 283 GLN A CD   2  
ATOM 3312  O OE1  . GLN A 1 105 ? 28.368  7.521   14.335  1.00 0.00 ? 283 GLN A OE1  2  
ATOM 3313  N NE2  . GLN A 1 105 ? 26.250  7.993   14.913  1.00 0.00 ? 283 GLN A NE2  2  
ATOM 3314  H H    . GLN A 1 105 ? 24.555  9.513   11.911  1.00 0.00 ? 283 GLN A H    2  
ATOM 3315  H HA   . GLN A 1 105 ? 26.417  11.311  11.000  1.00 0.00 ? 283 GLN A HA   2  
ATOM 3316  H HB2  . GLN A 1 105 ? 28.098  9.999   12.273  1.00 0.00 ? 283 GLN A HB2  2  
ATOM 3317  H HB3  . GLN A 1 105 ? 26.622  10.298  13.180  1.00 0.00 ? 283 GLN A HB3  2  
ATOM 3318  H HG2  . GLN A 1 105 ? 25.882  7.985   12.396  1.00 0.00 ? 283 GLN A HG2  2  
ATOM 3319  H HG3  . GLN A 1 105 ? 27.567  7.743   11.936  1.00 0.00 ? 283 GLN A HG3  2  
ATOM 3320  H HE21 . GLN A 1 105 ? 25.374  8.299   14.597  1.00 0.00 ? 283 GLN A HE21 2  
ATOM 3321  H HE22 . GLN A 1 105 ? 26.438  7.754   15.844  1.00 0.00 ? 283 GLN A HE22 2  
ATOM 3322  N N    . GLN A 1 106 ? 27.185  10.434  8.790   1.00 0.00 ? 284 GLN A N    2  
ATOM 3323  C CA   . GLN A 1 106 ? 27.831  9.979   7.565   1.00 0.00 ? 284 GLN A CA   2  
ATOM 3324  C C    . GLN A 1 106 ? 27.998  11.130  6.578   1.00 0.00 ? 284 GLN A C    2  
ATOM 3325  O O    . GLN A 1 106 ? 27.059  11.883  6.322   1.00 0.00 ? 284 GLN A O    2  
ATOM 3326  C CB   . GLN A 1 106 ? 27.017  8.855   6.921   1.00 0.00 ? 284 GLN A CB   2  
ATOM 3327  C CG   . GLN A 1 106 ? 27.621  8.330   5.629   1.00 0.00 ? 284 GLN A CG   2  
ATOM 3328  C CD   . GLN A 1 106 ? 26.612  7.591   4.772   1.00 0.00 ? 284 GLN A CD   2  
ATOM 3329  O OE1  . GLN A 1 106 ? 25.660  7.001   5.283   1.00 0.00 ? 284 GLN A OE1  2  
ATOM 3330  N NE2  . GLN A 1 106 ? 26.817  7.618   3.460   1.00 0.00 ? 284 GLN A NE2  2  
ATOM 3331  H H    . GLN A 1 106 ? 26.844  11.351  8.839   1.00 0.00 ? 284 GLN A H    2  
ATOM 3332  H HA   . GLN A 1 106 ? 28.807  9.600   7.826   1.00 0.00 ? 284 GLN A HA   2  
ATOM 3333  H HB2  . GLN A 1 106 ? 26.944  8.035   7.619   1.00 0.00 ? 284 GLN A HB2  2  
ATOM 3334  H HB3  . GLN A 1 106 ? 26.025  9.223   6.706   1.00 0.00 ? 284 GLN A HB3  2  
ATOM 3335  H HG2  . GLN A 1 106 ? 28.009  9.163   5.063   1.00 0.00 ? 284 GLN A HG2  2  
ATOM 3336  H HG3  . GLN A 1 106 ? 28.428  7.655   5.873   1.00 0.00 ? 284 GLN A HG3  2  
ATOM 3337  H HE21 . GLN A 1 106 ? 27.598  8.107   3.124   1.00 0.00 ? 284 GLN A HE21 2  
ATOM 3338  H HE22 . GLN A 1 106 ? 26.181  7.149   2.882   1.00 0.00 ? 284 GLN A HE22 2  
ATOM 3339  N N    . SER A 1 107 ? 29.201  11.261  6.028   1.00 0.00 ? 285 SER A N    2  
ATOM 3340  C CA   . SER A 1 107 ? 29.493  12.324  5.073   1.00 0.00 ? 285 SER A CA   2  
ATOM 3341  C C    . SER A 1 107 ? 28.538  12.263  3.885   1.00 0.00 ? 285 SER A C    2  
ATOM 3342  O O    . SER A 1 107 ? 27.912  11.235  3.630   1.00 0.00 ? 285 SER A O    2  
ATOM 3343  C CB   . SER A 1 107 ? 30.940  12.217  4.585   1.00 0.00 ? 285 SER A CB   2  
ATOM 3344  O OG   . SER A 1 107 ? 31.222  13.201  3.606   1.00 0.00 ? 285 SER A OG   2  
ATOM 3345  H H    . SER A 1 107 ? 29.910  10.630  6.273   1.00 0.00 ? 285 SER A H    2  
ATOM 3346  H HA   . SER A 1 107 ? 29.362  13.269  5.578   1.00 0.00 ? 285 SER A HA   2  
ATOM 3347  H HB2  . SER A 1 107 ? 31.609  12.354  5.420   1.00 0.00 ? 285 SER A HB2  2  
ATOM 3348  H HB3  . SER A 1 107 ? 31.099  11.239  4.153   1.00 0.00 ? 285 SER A HB3  2  
ATOM 3349  H HG   . SER A 1 107 ? 31.332  12.780  2.750   1.00 0.00 ? 285 SER A HG   2  
ATOM 3350  N N    . TRP A 1 108 ? 28.433  13.372  3.162   1.00 0.00 ? 286 TRP A N    2  
ATOM 3351  C CA   . TRP A 1 108 ? 27.555  13.447  2.000   1.00 0.00 ? 286 TRP A CA   2  
ATOM 3352  C C    . TRP A 1 108 ? 28.353  13.726  0.731   1.00 0.00 ? 286 TRP A C    2  
ATOM 3353  O O    . TRP A 1 108 ? 28.019  13.232  -0.345  1.00 0.00 ? 286 TRP A O    2  
ATOM 3354  C CB   . TRP A 1 108 ? 26.498  14.534  2.202   1.00 0.00 ? 286 TRP A CB   2  
ATOM 3355  C CG   . TRP A 1 108 ? 25.740  14.865  0.953   1.00 0.00 ? 286 TRP A CG   2  
ATOM 3356  C CD1  . TRP A 1 108 ? 26.170  15.641  -0.085  1.00 0.00 ? 286 TRP A CD1  2  
ATOM 3357  C CD2  . TRP A 1 108 ? 24.418  14.433  0.612   1.00 0.00 ? 286 TRP A CD2  2  
ATOM 3358  N NE1  . TRP A 1 108 ? 25.196  15.717  -1.051  1.00 0.00 ? 286 TRP A NE1  2  
ATOM 3359  C CE2  . TRP A 1 108 ? 24.112  14.983  -0.648  1.00 0.00 ? 286 TRP A CE2  2  
ATOM 3360  C CE3  . TRP A 1 108 ? 23.465  13.633  1.247   1.00 0.00 ? 286 TRP A CE3  2  
ATOM 3361  C CZ2  . TRP A 1 108 ? 22.892  14.759  -1.281  1.00 0.00 ? 286 TRP A CZ2  2  
ATOM 3362  C CZ3  . TRP A 1 108 ? 22.255  13.411  0.618   1.00 0.00 ? 286 TRP A CZ3  2  
ATOM 3363  C CH2  . TRP A 1 108 ? 21.977  13.972  -0.636  1.00 0.00 ? 286 TRP A CH2  2  
ATOM 3364  H H    . TRP A 1 108 ? 28.959  14.160  3.415   1.00 0.00 ? 286 TRP A H    2  
ATOM 3365  H HA   . TRP A 1 108 ? 27.061  12.492  1.897   1.00 0.00 ? 286 TRP A HA   2  
ATOM 3366  H HB2  . TRP A 1 108 ? 25.788  14.203  2.945   1.00 0.00 ? 286 TRP A HB2  2  
ATOM 3367  H HB3  . TRP A 1 108 ? 26.982  15.435  2.549   1.00 0.00 ? 286 TRP A HB3  2  
ATOM 3368  H HD1  . TRP A 1 108 ? 27.137  16.120  -0.127  1.00 0.00 ? 286 TRP A HD1  2  
ATOM 3369  H HE1  . TRP A 1 108 ? 25.267  16.214  -1.893  1.00 0.00 ? 286 TRP A HE1  2  
ATOM 3370  H HE3  . TRP A 1 108 ? 23.660  13.191  2.214   1.00 0.00 ? 286 TRP A HE3  2  
ATOM 3371  H HZ2  . TRP A 1 108 ? 22.663  15.184  -2.247  1.00 0.00 ? 286 TRP A HZ2  2  
ATOM 3372  H HZ3  . TRP A 1 108 ? 21.506  12.796  1.094   1.00 0.00 ? 286 TRP A HZ3  2  
ATOM 3373  H HH2  . TRP A 1 108 ? 21.019  13.772  -1.090  1.00 0.00 ? 286 TRP A HH2  2  
ATOM 3374  N N    . ASN A 1 109 ? 29.409  14.523  0.864   1.00 0.00 ? 287 ASN A N    2  
ATOM 3375  C CA   . ASN A 1 109 ? 30.254  14.868  -0.273  1.00 0.00 ? 287 ASN A CA   2  
ATOM 3376  C C    . ASN A 1 109 ? 30.916  13.624  -0.856  1.00 0.00 ? 287 ASN A C    2  
ATOM 3377  O O    . ASN A 1 109 ? 31.413  12.769  -0.121  1.00 0.00 ? 287 ASN A O    2  
ATOM 3378  C CB   . ASN A 1 109 ? 31.323  15.879  0.148   1.00 0.00 ? 287 ASN A CB   2  
ATOM 3379  C CG   . ASN A 1 109 ? 30.857  17.313  -0.011  1.00 0.00 ? 287 ASN A CG   2  
ATOM 3380  O OD1  . ASN A 1 109 ? 29.868  17.727  0.595   1.00 0.00 ? 287 ASN A OD1  2  
ATOM 3381  N ND2  . ASN A 1 109 ? 31.569  18.079  -0.829  1.00 0.00 ? 287 ASN A ND2  2  
ATOM 3382  H H    . ASN A 1 109 ? 29.624  14.887  1.748   1.00 0.00 ? 287 ASN A H    2  
ATOM 3383  H HA   . ASN A 1 109 ? 29.626  15.316  -1.028  1.00 0.00 ? 287 ASN A HA   2  
ATOM 3384  H HB2  . ASN A 1 109 ? 31.575  15.716  1.186   1.00 0.00 ? 287 ASN A HB2  2  
ATOM 3385  H HB3  . ASN A 1 109 ? 32.204  15.736  -0.459  1.00 0.00 ? 287 ASN A HB3  2  
ATOM 3386  H HD21 . ASN A 1 109 ? 32.344  17.681  -1.279  1.00 0.00 ? 287 ASN A HD21 2  
ATOM 3387  H HD22 . ASN A 1 109 ? 31.291  19.011  -0.950  1.00 0.00 ? 287 ASN A HD22 2  
ATOM 3388  N N    . LEU A 1 110 ? 30.921  13.529  -2.181  1.00 0.00 ? 288 LEU A N    2  
ATOM 3389  C CA   . LEU A 1 110 ? 31.523  12.389  -2.864  1.00 0.00 ? 288 LEU A CA   2  
ATOM 3390  C C    . LEU A 1 110 ? 32.383  12.850  -4.037  1.00 0.00 ? 288 LEU A C    2  
ATOM 3391  O O    . LEU A 1 110 ? 33.540  12.452  -4.164  1.00 0.00 ? 288 LEU A O    2  
ATOM 3392  C CB   . LEU A 1 110 ? 30.436  11.434  -3.360  1.00 0.00 ? 288 LEU A CB   2  
ATOM 3393  C CG   . LEU A 1 110 ? 30.923  10.195  -4.112  1.00 0.00 ? 288 LEU A CG   2  
ATOM 3394  C CD1  . LEU A 1 110 ? 31.613  9.230   -3.161  1.00 0.00 ? 288 LEU A CD1  2  
ATOM 3395  C CD2  . LEU A 1 110 ? 29.763  9.511   -4.820  1.00 0.00 ? 288 LEU A CD2  2  
ATOM 3396  H H    . LEU A 1 110 ? 30.510  14.241  -2.713  1.00 0.00 ? 288 LEU A H    2  
ATOM 3397  H HA   . LEU A 1 110 ? 32.150  11.871  -2.155  1.00 0.00 ? 288 LEU A HA   2  
ATOM 3398  H HB2  . LEU A 1 110 ? 29.874  11.099  -2.501  1.00 0.00 ? 288 LEU A HB2  2  
ATOM 3399  H HB3  . LEU A 1 110 ? 29.785  11.989  -4.020  1.00 0.00 ? 288 LEU A HB3  2  
ATOM 3400  H HG   . LEU A 1 110 ? 31.642  10.496  -4.861  1.00 0.00 ? 288 LEU A HG   2  
ATOM 3401  H HD11 . LEU A 1 110 ? 31.385  8.215   -3.450  1.00 0.00 ? 288 LEU A HD11 2  
ATOM 3402  H HD12 . LEU A 1 110 ? 31.263  9.404   -2.154  1.00 0.00 ? 288 LEU A HD12 2  
ATOM 3403  H HD13 . LEU A 1 110 ? 32.681  9.386   -3.202  1.00 0.00 ? 288 LEU A HD13 2  
ATOM 3404  H HD21 . LEU A 1 110 ? 29.922  9.547   -5.888  1.00 0.00 ? 288 LEU A HD21 2  
ATOM 3405  H HD22 . LEU A 1 110 ? 28.841  10.020  -4.577  1.00 0.00 ? 288 LEU A HD22 2  
ATOM 3406  H HD23 . LEU A 1 110 ? 29.702  8.482   -4.499  1.00 0.00 ? 288 LEU A HD23 2  
ATOM 3407  N N    . ASN A 1 111 ? 31.810  13.693  -4.890  1.00 0.00 ? 289 ASN A N    2  
ATOM 3408  C CA   . ASN A 1 111 ? 32.526  14.209  -6.051  1.00 0.00 ? 289 ASN A CA   2  
ATOM 3409  C C    . ASN A 1 111 ? 31.919  15.528  -6.521  1.00 0.00 ? 289 ASN A C    2  
ATOM 3410  O O    . ASN A 1 111 ? 30.703  15.709  -6.492  1.00 0.00 ? 289 ASN A O    2  
ATOM 3411  C CB   . ASN A 1 111 ? 32.498  13.187  -7.189  1.00 0.00 ? 289 ASN A CB   2  
ATOM 3412  C CG   . ASN A 1 111 ? 33.482  13.524  -8.293  1.00 0.00 ? 289 ASN A CG   2  
ATOM 3413  O OD1  . ASN A 1 111 ? 33.297  14.493  -9.030  1.00 0.00 ? 289 ASN A OD1  2  
ATOM 3414  N ND2  . ASN A 1 111 ? 34.534  12.723  -8.411  1.00 0.00 ? 289 ASN A ND2  2  
ATOM 3415  H H    . ASN A 1 111 ? 30.884  13.974  -4.735  1.00 0.00 ? 289 ASN A H    2  
ATOM 3416  H HA   . ASN A 1 111 ? 33.551  14.381  -5.759  1.00 0.00 ? 289 ASN A HA   2  
ATOM 3417  H HB2  . ASN A 1 111 ? 32.747  12.212  -6.796  1.00 0.00 ? 289 ASN A HB2  2  
ATOM 3418  H HB3  . ASN A 1 111 ? 31.505  13.156  -7.613  1.00 0.00 ? 289 ASN A HB3  2  
ATOM 3419  H HD21 . ASN A 1 111 ? 34.616  11.970  -7.789  1.00 0.00 ? 289 ASN A HD21 2  
ATOM 3420  H HD22 . ASN A 1 111 ? 35.187  12.918  -9.116  1.00 0.00 ? 289 ASN A HD22 2  
ATOM 3421  N N    . ASN A 1 112 ? 32.777  16.446  -6.955  1.00 0.00 ? 290 ASN A N    2  
ATOM 3422  C CA   . ASN A 1 112 ? 32.326  17.748  -7.432  1.00 0.00 ? 290 ASN A CA   2  
ATOM 3423  C C    . ASN A 1 112 ? 31.419  17.597  -8.650  1.00 0.00 ? 290 ASN A C    2  
ATOM 3424  O O    . ASN A 1 112 ? 31.777  16.936  -9.626  1.00 0.00 ? 290 ASN A O    2  
ATOM 3425  C CB   . ASN A 1 112 ? 33.526  18.630  -7.782  1.00 0.00 ? 290 ASN A CB   2  
ATOM 3426  C CG   . ASN A 1 112 ? 33.148  20.091  -7.926  1.00 0.00 ? 290 ASN A CG   2  
ATOM 3427  O OD1  . ASN A 1 112 ? 32.437  20.645  -7.087  1.00 0.00 ? 290 ASN A OD1  2  
ATOM 3428  N ND2  . ASN A 1 112 ? 33.623  20.723  -8.993  1.00 0.00 ? 290 ASN A ND2  2  
ATOM 3429  H H    . ASN A 1 112 ? 33.736  16.243  -6.955  1.00 0.00 ? 290 ASN A H    2  
ATOM 3430  H HA   . ASN A 1 112 ? 31.766  18.217  -6.637  1.00 0.00 ? 290 ASN A HA   2  
ATOM 3431  H HB2  . ASN A 1 112 ? 34.268  18.545  -7.001  1.00 0.00 ? 290 ASN A HB2  2  
ATOM 3432  H HB3  . ASN A 1 112 ? 33.953  18.294  -8.715  1.00 0.00 ? 290 ASN A HB3  2  
ATOM 3433  H HD21 . ASN A 1 112 ? 34.184  20.219  -9.619  1.00 0.00 ? 290 ASN A HD21 2  
ATOM 3434  H HD22 . ASN A 1 112 ? 33.395  21.669  -9.110  1.00 0.00 ? 290 ASN A HD22 2  
ATOM 3435  N N    . LEU A 1 113 ? 30.245  18.215  -8.586  1.00 0.00 ? 291 LEU A N    2  
ATOM 3436  C CA   . LEU A 1 113 ? 29.286  18.151  -9.684  1.00 0.00 ? 291 LEU A CA   2  
ATOM 3437  C C    . LEU A 1 113 ? 29.789  18.934  -10.892 1.00 0.00 ? 291 LEU A C    2  
ATOM 3438  O O    . LEU A 1 113 ? 30.490  19.935  -10.748 1.00 0.00 ? 291 LEU A O    2  
ATOM 3439  C CB   . LEU A 1 113 ? 27.930  18.699  -9.235  1.00 0.00 ? 291 LEU A CB   2  
ATOM 3440  C CG   . LEU A 1 113 ? 27.947  20.081  -8.581  1.00 0.00 ? 291 LEU A CG   2  
ATOM 3441  C CD1  . LEU A 1 113 ? 27.770  21.169  -9.629  1.00 0.00 ? 291 LEU A CD1  2  
ATOM 3442  C CD2  . LEU A 1 113 ? 26.865  20.181  -7.517  1.00 0.00 ? 291 LEU A CD2  2  
ATOM 3443  H H    . LEU A 1 113 ? 30.016  18.727  -7.783  1.00 0.00 ? 291 LEU A H    2  
ATOM 3444  H HA   . LEU A 1 113 ? 29.172  17.114  -9.963  1.00 0.00 ? 291 LEU A HA   2  
ATOM 3445  H HB2  . LEU A 1 113 ? 27.291  18.752  -10.103 1.00 0.00 ? 291 LEU A HB2  2  
ATOM 3446  H HB3  . LEU A 1 113 ? 27.511  18.001  -8.524  1.00 0.00 ? 291 LEU A HB3  2  
ATOM 3447  H HG   . LEU A 1 113 ? 28.904  20.233  -8.101  1.00 0.00 ? 291 LEU A HG   2  
ATOM 3448  H HD11 . LEU A 1 113 ? 28.222  22.084  -9.277  1.00 0.00 ? 291 LEU A HD11 2  
ATOM 3449  H HD12 . LEU A 1 113 ? 26.717  21.331  -9.805  1.00 0.00 ? 291 LEU A HD12 2  
ATOM 3450  H HD13 . LEU A 1 113 ? 28.245  20.863  -10.550 1.00 0.00 ? 291 LEU A HD13 2  
ATOM 3451  H HD21 . LEU A 1 113 ? 26.488  19.194  -7.293  1.00 0.00 ? 291 LEU A HD21 2  
ATOM 3452  H HD22 . LEU A 1 113 ? 26.058  20.800  -7.882  1.00 0.00 ? 291 LEU A HD22 2  
ATOM 3453  H HD23 . LEU A 1 113 ? 27.279  20.620  -6.622  1.00 0.00 ? 291 LEU A HD23 2  
ATOM 3454  N N    . SER A 1 114 ? 29.424  18.472  -12.084 1.00 0.00 ? 292 SER A N    2  
ATOM 3455  C CA   . SER A 1 114 ? 29.839  19.128  -13.318 1.00 0.00 ? 292 SER A CA   2  
ATOM 3456  C C    . SER A 1 114 ? 28.648  19.341  -14.247 1.00 0.00 ? 292 SER A C    2  
ATOM 3457  O O    . SER A 1 114 ? 27.813  18.454  -14.418 1.00 0.00 ? 292 SER A O    2  
ATOM 3458  C CB   . SER A 1 114 ? 30.910  18.297  -14.027 1.00 0.00 ? 292 SER A CB   2  
ATOM 3459  O OG   . SER A 1 114 ? 30.473  16.964  -14.226 1.00 0.00 ? 292 SER A OG   2  
ATOM 3460  H H    . SER A 1 114 ? 28.864  17.669  -12.134 1.00 0.00 ? 292 SER A H    2  
ATOM 3461  H HA   . SER A 1 114 ? 30.255  20.090  -13.059 1.00 0.00 ? 292 SER A HA   2  
ATOM 3462  H HB2  . SER A 1 114 ? 31.128  18.738  -14.987 1.00 0.00 ? 292 SER A HB2  2  
ATOM 3463  H HB3  . SER A 1 114 ? 31.808  18.283  -13.425 1.00 0.00 ? 292 SER A HB3  2  
ATOM 3464  H HG   . SER A 1 114 ? 29.514  16.937  -14.218 1.00 0.00 ? 292 SER A HG   2  
ATOM 3465  N N    . GLY A 1 115 ? 28.577  20.526  -14.846 1.00 0.00 ? 293 GLY A N    2  
ATOM 3466  C CA   . GLY A 1 115 ? 27.485  20.836  -15.751 1.00 0.00 ? 293 GLY A CA   2  
ATOM 3467  C C    . GLY A 1 115 ? 27.916  21.733  -16.894 1.00 0.00 ? 293 GLY A C    2  
ATOM 3468  O O    . GLY A 1 115 ? 27.722  22.948  -16.865 1.00 0.00 ? 293 GLY A O    2  
ATOM 3469  H H    . GLY A 1 115 ? 29.271  21.195  -14.672 1.00 0.00 ? 293 GLY A H    2  
ATOM 3470  H HA2  . GLY A 1 115 ? 27.095  19.914  -16.157 1.00 0.00 ? 293 GLY A HA2  2  
ATOM 3471  H HA3  . GLY A 1 115 ? 26.702  21.332  -15.195 1.00 0.00 ? 293 GLY A HA3  2  
ATOM 3472  N N    . PRO A 1 116 ? 28.517  21.130  -17.930 1.00 0.00 ? 294 PRO A N    2  
ATOM 3473  C CA   . PRO A 1 116 ? 28.991  21.864  -19.107 1.00 0.00 ? 294 PRO A CA   2  
ATOM 3474  C C    . PRO A 1 116 ? 27.843  22.398  -19.958 1.00 0.00 ? 294 PRO A C    2  
ATOM 3475  O O    . PRO A 1 116 ? 26.865  21.694  -20.210 1.00 0.00 ? 294 PRO A O    2  
ATOM 3476  C CB   . PRO A 1 116 ? 29.787  20.812  -19.884 1.00 0.00 ? 294 PRO A CB   2  
ATOM 3477  C CG   . PRO A 1 116 ? 29.203  19.508  -19.465 1.00 0.00 ? 294 PRO A CG   2  
ATOM 3478  C CD   . PRO A 1 116 ? 28.781  19.685  -18.032 1.00 0.00 ? 294 PRO A CD   2  
ATOM 3479  H HA   . PRO A 1 116 ? 29.642  22.680  -18.831 1.00 0.00 ? 294 PRO A HA   2  
ATOM 3480  H HB2  . PRO A 1 116 ? 29.667  20.978  -20.945 1.00 0.00 ? 294 PRO A HB2  2  
ATOM 3481  H HB3  . PRO A 1 116 ? 30.832  20.880  -19.620 1.00 0.00 ? 294 PRO A HB3  2  
ATOM 3482  H HG2  . PRO A 1 116 ? 28.348  19.273  -20.081 1.00 0.00 ? 294 PRO A HG2  2  
ATOM 3483  H HG3  . PRO A 1 116 ? 29.948  18.730  -19.542 1.00 0.00 ? 294 PRO A HG3  2  
ATOM 3484  H HD2  . PRO A 1 116 ? 27.886  19.114  -17.830 1.00 0.00 ? 294 PRO A HD2  2  
ATOM 3485  H HD3  . PRO A 1 116 ? 29.577  19.390  -17.365 1.00 0.00 ? 294 PRO A HD3  2  
ATOM 3486  N N    . SER A 1 117 ? 27.969  23.646  -20.398 1.00 0.00 ? 295 SER A N    2  
ATOM 3487  C CA   . SER A 1 117 ? 26.941  24.275  -21.217 1.00 0.00 ? 295 SER A CA   2  
ATOM 3488  C C    . SER A 1 117 ? 27.546  25.340  -22.126 1.00 0.00 ? 295 SER A C    2  
ATOM 3489  O O    . SER A 1 117 ? 28.443  26.080  -21.722 1.00 0.00 ? 295 SER A O    2  
ATOM 3490  C CB   . SER A 1 117 ? 25.862  24.899  -20.330 1.00 0.00 ? 295 SER A CB   2  
ATOM 3491  O OG   . SER A 1 117 ? 25.245  23.919  -19.512 1.00 0.00 ? 295 SER A OG   2  
ATOM 3492  H H    . SER A 1 117 ? 28.773  24.156  -20.163 1.00 0.00 ? 295 SER A H    2  
ATOM 3493  H HA   . SER A 1 117 ? 26.491  23.508  -21.831 1.00 0.00 ? 295 SER A HA   2  
ATOM 3494  H HB2  . SER A 1 117 ? 26.310  25.649  -19.696 1.00 0.00 ? 295 SER A HB2  2  
ATOM 3495  H HB3  . SER A 1 117 ? 25.108  25.358  -20.953 1.00 0.00 ? 295 SER A HB3  2  
ATOM 3496  H HG   . SER A 1 117 ? 25.242  24.219  -18.600 1.00 0.00 ? 295 SER A HG   2  
ATOM 3497  N N    . SER A 1 118 ? 27.049  25.412  -23.357 1.00 0.00 ? 296 SER A N    2  
ATOM 3498  C CA   . SER A 1 118 ? 27.543  26.384  -24.325 1.00 0.00 ? 296 SER A CA   2  
ATOM 3499  C C    . SER A 1 118 ? 27.702  27.758  -23.683 1.00 0.00 ? 296 SER A C    2  
ATOM 3500  O O    . SER A 1 118 ? 27.116  28.040  -22.638 1.00 0.00 ? 296 SER A O    2  
ATOM 3501  C CB   . SER A 1 118 ? 26.591  26.474  -25.520 1.00 0.00 ? 296 SER A CB   2  
ATOM 3502  O OG   . SER A 1 118 ? 26.849  25.442  -26.457 1.00 0.00 ? 296 SER A OG   2  
ATOM 3503  H H    . SER A 1 118 ? 26.334  24.795  -23.620 1.00 0.00 ? 296 SER A H    2  
ATOM 3504  H HA   . SER A 1 118 ? 28.509  26.046  -24.670 1.00 0.00 ? 296 SER A HA   2  
ATOM 3505  H HB2  . SER A 1 118 ? 25.573  26.382  -25.173 1.00 0.00 ? 296 SER A HB2  2  
ATOM 3506  H HB3  . SER A 1 118 ? 26.721  27.429  -26.008 1.00 0.00 ? 296 SER A HB3  2  
ATOM 3507  H HG   . SER A 1 118 ? 26.502  25.695  -27.315 1.00 0.00 ? 296 SER A HG   2  
ATOM 3508  N N    . GLY A 1 119 ? 28.501  28.612  -24.316 1.00 0.00 ? 297 GLY A N    2  
ATOM 3509  C CA   . GLY A 1 119 ? 28.724  29.947  -23.793 1.00 0.00 ? 297 GLY A CA   2  
ATOM 3510  C C    . GLY A 1 119 ? 30.027  30.550  -24.281 1.00 0.00 ? 297 GLY A C    2  
ATOM 3511  O O    . GLY A 1 119 ? 30.273  31.742  -24.097 1.00 0.00 ? 297 GLY A O    2  
ATOM 3512  H H    . GLY A 1 119 ? 28.942  28.333  -25.146 1.00 0.00 ? 297 GLY A H    2  
ATOM 3513  H HA2  . GLY A 1 119 ? 27.907  30.583  -24.100 1.00 0.00 ? 297 GLY A HA2  2  
ATOM 3514  H HA3  . GLY A 1 119 ? 28.745  29.899  -22.714 1.00 0.00 ? 297 GLY A HA3  2  
ATOM 3515  N N    . GLY A 1 1   ? -15.535 8.331   -19.249 1.00 0.00 ? 179 GLY A N    3  
ATOM 3516  C CA   . GLY A 1 1   ? -14.344 7.927   -18.525 1.00 0.00 ? 179 GLY A CA   3  
ATOM 3517  C C    . GLY A 1 1   ? -14.646 6.931   -17.423 1.00 0.00 ? 179 GLY A C    3  
ATOM 3518  O O    . GLY A 1 1   ? -13.929 5.944   -17.256 1.00 0.00 ? 179 GLY A O    3  
ATOM 3519  H H1   . GLY A 1 1   ? -16.421 8.096   -18.901 1.00 0.00 ? 179 GLY A H1   3  
ATOM 3520  H HA2  . GLY A 1 1   ? -13.648 7.481   -19.219 1.00 0.00 ? 179 GLY A HA2  3  
ATOM 3521  H HA3  . GLY A 1 1   ? -13.888 8.804   -18.087 1.00 0.00 ? 179 GLY A HA3  3  
ATOM 3522  N N    . SER A 1 2   ? -15.708 7.190   -16.667 1.00 0.00 ? 180 SER A N    3  
ATOM 3523  C CA   . SER A 1 2   ? -16.099 6.311   -15.571 1.00 0.00 ? 180 SER A CA   3  
ATOM 3524  C C    . SER A 1 2   ? -17.605 6.065   -15.584 1.00 0.00 ? 180 SER A C    3  
ATOM 3525  O O    . SER A 1 2   ? -18.350 6.743   -16.291 1.00 0.00 ? 180 SER A O    3  
ATOM 3526  C CB   . SER A 1 2   ? -15.681 6.916   -14.230 1.00 0.00 ? 180 SER A CB   3  
ATOM 3527  O OG   . SER A 1 2   ? -15.678 5.935   -13.207 1.00 0.00 ? 180 SER A OG   3  
ATOM 3528  H H    . SER A 1 2   ? -16.239 7.993   -16.850 1.00 0.00 ? 180 SER A H    3  
ATOM 3529  H HA   . SER A 1 2   ? -15.591 5.368   -15.705 1.00 0.00 ? 180 SER A HA   3  
ATOM 3530  H HB2  . SER A 1 2   ? -14.688 7.330   -14.318 1.00 0.00 ? 180 SER A HB2  3  
ATOM 3531  H HB3  . SER A 1 2   ? -16.375 7.699   -13.959 1.00 0.00 ? 180 SER A HB3  3  
ATOM 3532  H HG   . SER A 1 2   ? -16.514 5.960   -12.737 1.00 0.00 ? 180 SER A HG   3  
ATOM 3533  N N    . SER A 1 3   ? -18.045 5.089   -14.796 1.00 0.00 ? 181 SER A N    3  
ATOM 3534  C CA   . SER A 1 3   ? -19.461 4.749   -14.719 1.00 0.00 ? 181 SER A CA   3  
ATOM 3535  C C    . SER A 1 3   ? -20.308 5.998   -14.493 1.00 0.00 ? 181 SER A C    3  
ATOM 3536  O O    . SER A 1 3   ? -19.848 6.976   -13.905 1.00 0.00 ? 181 SER A O    3  
ATOM 3537  C CB   . SER A 1 3   ? -19.705 3.743   -13.592 1.00 0.00 ? 181 SER A CB   3  
ATOM 3538  O OG   . SER A 1 3   ? -19.673 4.378   -12.325 1.00 0.00 ? 181 SER A OG   3  
ATOM 3539  H H    . SER A 1 3   ? -17.401 4.584   -14.256 1.00 0.00 ? 181 SER A H    3  
ATOM 3540  H HA   . SER A 1 3   ? -19.746 4.300   -15.658 1.00 0.00 ? 181 SER A HA   3  
ATOM 3541  H HB2  . SER A 1 3   ? -20.672 3.283   -13.726 1.00 0.00 ? 181 SER A HB2  3  
ATOM 3542  H HB3  . SER A 1 3   ? -18.937 2.983   -13.620 1.00 0.00 ? 181 SER A HB3  3  
ATOM 3543  H HG   . SER A 1 3   ? -19.148 5.180   -12.382 1.00 0.00 ? 181 SER A HG   3  
ATOM 3544  N N    . GLY A 1 4   ? -21.550 5.956   -14.965 1.00 0.00 ? 182 GLY A N    3  
ATOM 3545  C CA   . GLY A 1 4   ? -22.442 7.090   -14.806 1.00 0.00 ? 182 GLY A CA   3  
ATOM 3546  C C    . GLY A 1 4   ? -23.691 6.738   -14.022 1.00 0.00 ? 182 GLY A C    3  
ATOM 3547  O O    . GLY A 1 4   ? -24.783 6.654   -14.585 1.00 0.00 ? 182 GLY A O    3  
ATOM 3548  H H    . GLY A 1 4   ? -21.863 5.150   -15.426 1.00 0.00 ? 182 GLY A H    3  
ATOM 3549  H HA2  . GLY A 1 4   ? -21.916 7.879   -14.290 1.00 0.00 ? 182 GLY A HA2  3  
ATOM 3550  H HA3  . GLY A 1 4   ? -22.733 7.444   -15.784 1.00 0.00 ? 182 GLY A HA3  3  
ATOM 3551  N N    . SER A 1 5   ? -23.532 6.531   -12.719 1.00 0.00 ? 183 SER A N    3  
ATOM 3552  C CA   . SER A 1 5   ? -24.655 6.182   -11.857 1.00 0.00 ? 183 SER A CA   3  
ATOM 3553  C C    . SER A 1 5   ? -25.808 7.164   -12.042 1.00 0.00 ? 183 SER A C    3  
ATOM 3554  O O    . SER A 1 5   ? -25.621 8.378   -11.965 1.00 0.00 ? 183 SER A O    3  
ATOM 3555  C CB   . SER A 1 5   ? -24.214 6.164   -10.392 1.00 0.00 ? 183 SER A CB   3  
ATOM 3556  O OG   . SER A 1 5   ? -23.721 4.888   -10.023 1.00 0.00 ? 183 SER A OG   3  
ATOM 3557  H H    . SER A 1 5   ? -22.636 6.614   -12.328 1.00 0.00 ? 183 SER A H    3  
ATOM 3558  H HA   . SER A 1 5   ? -24.991 5.194   -12.135 1.00 0.00 ? 183 SER A HA   3  
ATOM 3559  H HB2  . SER A 1 5   ? -23.434 6.895   -10.244 1.00 0.00 ? 183 SER A HB2  3  
ATOM 3560  H HB3  . SER A 1 5   ? -25.059 6.407   -9.763  1.00 0.00 ? 183 SER A HB3  3  
ATOM 3561  H HG   . SER A 1 5   ? -22.762 4.894   -10.056 1.00 0.00 ? 183 SER A HG   3  
ATOM 3562  N N    . SER A 1 6   ? -26.999 6.628   -12.286 1.00 0.00 ? 184 SER A N    3  
ATOM 3563  C CA   . SER A 1 6   ? -28.183 7.456   -12.486 1.00 0.00 ? 184 SER A CA   3  
ATOM 3564  C C    . SER A 1 6   ? -28.741 7.937   -11.150 1.00 0.00 ? 184 SER A C    3  
ATOM 3565  O O    . SER A 1 6   ? -29.087 7.135   -10.284 1.00 0.00 ? 184 SER A O    3  
ATOM 3566  C CB   . SER A 1 6   ? -29.255 6.675   -13.248 1.00 0.00 ? 184 SER A CB   3  
ATOM 3567  O OG   . SER A 1 6   ? -28.964 6.629   -14.634 1.00 0.00 ? 184 SER A OG   3  
ATOM 3568  H H    . SER A 1 6   ? -27.084 5.653   -12.336 1.00 0.00 ? 184 SER A H    3  
ATOM 3569  H HA   . SER A 1 6   ? -27.891 8.316   -13.071 1.00 0.00 ? 184 SER A HA   3  
ATOM 3570  H HB2  . SER A 1 6   ? -29.300 5.666   -12.868 1.00 0.00 ? 184 SER A HB2  3  
ATOM 3571  H HB3  . SER A 1 6   ? -30.213 7.155   -13.109 1.00 0.00 ? 184 SER A HB3  3  
ATOM 3572  H HG   . SER A 1 6   ? -29.427 7.340   -15.083 1.00 0.00 ? 184 SER A HG   3  
ATOM 3573  N N    . GLY A 1 7   ? -28.826 9.255   -10.991 1.00 0.00 ? 185 GLY A N    3  
ATOM 3574  C CA   . GLY A 1 7   ? -29.343 9.822   -9.759  1.00 0.00 ? 185 GLY A CA   3  
ATOM 3575  C C    . GLY A 1 7   ? -28.240 10.237  -8.805  1.00 0.00 ? 185 GLY A C    3  
ATOM 3576  O O    . GLY A 1 7   ? -28.134 11.407  -8.438  1.00 0.00 ? 185 GLY A O    3  
ATOM 3577  H H    . GLY A 1 7   ? -28.536 9.847   -11.716 1.00 0.00 ? 185 GLY A H    3  
ATOM 3578  H HA2  . GLY A 1 7   ? -29.943 10.687  -9.997  1.00 0.00 ? 185 GLY A HA2  3  
ATOM 3579  H HA3  . GLY A 1 7   ? -29.966 9.086   -9.272  1.00 0.00 ? 185 GLY A HA3  3  
ATOM 3580  N N    . LYS A 1 8   ? -27.417 9.275   -8.400  1.00 0.00 ? 186 LYS A N    3  
ATOM 3581  C CA   . LYS A 1 8   ? -26.317 9.546   -7.482  1.00 0.00 ? 186 LYS A CA   3  
ATOM 3582  C C    . LYS A 1 8   ? -25.271 10.444  -8.136  1.00 0.00 ? 186 LYS A C    3  
ATOM 3583  O O    . LYS A 1 8   ? -25.365 10.760  -9.321  1.00 0.00 ? 186 LYS A O    3  
ATOM 3584  C CB   . LYS A 1 8   ? -25.669 8.235   -7.030  1.00 0.00 ? 186 LYS A CB   3  
ATOM 3585  C CG   . LYS A 1 8   ? -26.593 7.350   -6.212  1.00 0.00 ? 186 LYS A CG   3  
ATOM 3586  C CD   . LYS A 1 8   ? -25.811 6.392   -5.330  1.00 0.00 ? 186 LYS A CD   3  
ATOM 3587  C CE   . LYS A 1 8   ? -25.292 5.202   -6.123  1.00 0.00 ? 186 LYS A CE   3  
ATOM 3588  N NZ   . LYS A 1 8   ? -24.334 4.383   -5.330  1.00 0.00 ? 186 LYS A NZ   3  
ATOM 3589  H H    . LYS A 1 8   ? -27.553 8.361   -8.727  1.00 0.00 ? 186 LYS A H    3  
ATOM 3590  H HA   . LYS A 1 8   ? -26.722 10.054  -6.620  1.00 0.00 ? 186 LYS A HA   3  
ATOM 3591  H HB2  . LYS A 1 8   ? -25.356 7.683   -7.903  1.00 0.00 ? 186 LYS A HB2  3  
ATOM 3592  H HB3  . LYS A 1 8   ? -24.801 8.466   -6.430  1.00 0.00 ? 186 LYS A HB3  3  
ATOM 3593  H HG2  . LYS A 1 8   ? -27.213 7.974   -5.585  1.00 0.00 ? 186 LYS A HG2  3  
ATOM 3594  H HG3  . LYS A 1 8   ? -27.218 6.779   -6.884  1.00 0.00 ? 186 LYS A HG3  3  
ATOM 3595  H HD2  . LYS A 1 8   ? -24.971 6.917   -4.899  1.00 0.00 ? 186 LYS A HD2  3  
ATOM 3596  H HD3  . LYS A 1 8   ? -26.457 6.033   -4.541  1.00 0.00 ? 186 LYS A HD3  3  
ATOM 3597  H HE2  . LYS A 1 8   ? -26.129 4.585   -6.410  1.00 0.00 ? 186 LYS A HE2  3  
ATOM 3598  H HE3  . LYS A 1 8   ? -24.793 5.567   -7.009  1.00 0.00 ? 186 LYS A HE3  3  
ATOM 3599  H HZ1  . LYS A 1 8   ? -24.080 3.522   -5.856  1.00 0.00 ? 186 LYS A HZ1  3  
ATOM 3600  H HZ2  . LYS A 1 8   ? -24.764 4.107   -4.425  1.00 0.00 ? 186 LYS A HZ2  3  
ATOM 3601  H HZ3  . LYS A 1 8   ? -23.469 4.928   -5.139  1.00 0.00 ? 186 LYS A HZ3  3  
ATOM 3602  N N    . ASN A 1 9   ? -24.275 10.849  -7.355  1.00 0.00 ? 187 ASN A N    3  
ATOM 3603  C CA   . ASN A 1 9   ? -23.211 11.710  -7.859  1.00 0.00 ? 187 ASN A CA   3  
ATOM 3604  C C    . ASN A 1 9   ? -22.550 11.094  -9.088  1.00 0.00 ? 187 ASN A C    3  
ATOM 3605  O O    . ASN A 1 9   ? -22.227 9.906   -9.103  1.00 0.00 ? 187 ASN A O    3  
ATOM 3606  C CB   . ASN A 1 9   ? -22.164 11.952  -6.770  1.00 0.00 ? 187 ASN A CB   3  
ATOM 3607  C CG   . ASN A 1 9   ? -22.503 13.145  -5.897  1.00 0.00 ? 187 ASN A CG   3  
ATOM 3608  O OD1  . ASN A 1 9   ? -21.852 14.187  -5.970  1.00 0.00 ? 187 ASN A OD1  3  
ATOM 3609  N ND2  . ASN A 1 9   ? -23.527 12.996  -5.065  1.00 0.00 ? 187 ASN A ND2  3  
ATOM 3610  H H    . ASN A 1 9   ? -24.255 10.564  -6.418  1.00 0.00 ? 187 ASN A H    3  
ATOM 3611  H HA   . ASN A 1 9   ? -23.653 12.655  -8.138  1.00 0.00 ? 187 ASN A HA   3  
ATOM 3612  H HB2  . ASN A 1 9   ? -22.099 11.077  -6.141  1.00 0.00 ? 187 ASN A HB2  3  
ATOM 3613  H HB3  . ASN A 1 9   ? -21.205 12.129  -7.234  1.00 0.00 ? 187 ASN A HB3  3  
ATOM 3614  H HD21 . ASN A 1 9   ? -24.000 12.137  -5.060  1.00 0.00 ? 187 ASN A HD21 3  
ATOM 3615  H HD22 . ASN A 1 9   ? -23.768 13.752  -4.489  1.00 0.00 ? 187 ASN A HD22 3  
ATOM 3616  N N    . VAL A 1 10  ? -22.350 11.910  -10.118 1.00 0.00 ? 188 VAL A N    3  
ATOM 3617  C CA   . VAL A 1 10  ? -21.726 11.447  -11.352 1.00 0.00 ? 188 VAL A CA   3  
ATOM 3618  C C    . VAL A 1 10  ? -20.420 10.714  -11.065 1.00 0.00 ? 188 VAL A C    3  
ATOM 3619  O O    . VAL A 1 10  ? -20.139 9.672   -11.655 1.00 0.00 ? 188 VAL A O    3  
ATOM 3620  C CB   . VAL A 1 10  ? -21.445 12.618  -12.312 1.00 0.00 ? 188 VAL A CB   3  
ATOM 3621  C CG1  . VAL A 1 10  ? -20.514 13.630  -11.663 1.00 0.00 ? 188 VAL A CG1  3  
ATOM 3622  C CG2  . VAL A 1 10  ? -20.859 12.105  -13.619 1.00 0.00 ? 188 VAL A CG2  3  
ATOM 3623  H H    . VAL A 1 10  ? -22.629 12.847  -10.046 1.00 0.00 ? 188 VAL A H    3  
ATOM 3624  H HA   . VAL A 1 10  ? -22.410 10.767  -11.837 1.00 0.00 ? 188 VAL A HA   3  
ATOM 3625  H HB   . VAL A 1 10  ? -22.381 13.111  -12.530 1.00 0.00 ? 188 VAL A HB   3  
ATOM 3626  H HG11 . VAL A 1 10  ? -20.555 14.560  -12.211 1.00 0.00 ? 188 VAL A HG11 3  
ATOM 3627  H HG12 . VAL A 1 10  ? -20.821 13.799  -10.641 1.00 0.00 ? 188 VAL A HG12 3  
ATOM 3628  H HG13 . VAL A 1 10  ? -19.503 13.250  -11.676 1.00 0.00 ? 188 VAL A HG13 3  
ATOM 3629  H HG21 . VAL A 1 10  ? -19.781 12.142  -13.569 1.00 0.00 ? 188 VAL A HG21 3  
ATOM 3630  H HG22 . VAL A 1 10  ? -21.177 11.085  -13.781 1.00 0.00 ? 188 VAL A HG22 3  
ATOM 3631  H HG23 . VAL A 1 10  ? -21.204 12.722  -14.435 1.00 0.00 ? 188 VAL A HG23 3  
ATOM 3632  N N    . ASN A 1 11  ? -19.625 11.267  -10.154 1.00 0.00 ? 189 ASN A N    3  
ATOM 3633  C CA   . ASN A 1 11  ? -18.348 10.666  -9.789  1.00 0.00 ? 189 ASN A CA   3  
ATOM 3634  C C    . ASN A 1 11  ? -17.936 11.079  -8.379  1.00 0.00 ? 189 ASN A C    3  
ATOM 3635  O O    . ASN A 1 11  ? -17.725 12.261  -8.104  1.00 0.00 ? 189 ASN A O    3  
ATOM 3636  C CB   . ASN A 1 11  ? -17.264 11.073  -10.789 1.00 0.00 ? 189 ASN A CB   3  
ATOM 3637  C CG   . ASN A 1 11  ? -16.003 10.243  -10.645 1.00 0.00 ? 189 ASN A CG   3  
ATOM 3638  O OD1  . ASN A 1 11  ? -16.027 9.152   -10.076 1.00 0.00 ? 189 ASN A OD1  3  
ATOM 3639  N ND2  . ASN A 1 11  ? -14.894 10.758  -11.162 1.00 0.00 ? 189 ASN A ND2  3  
ATOM 3640  H H    . ASN A 1 11  ? -19.904 12.100  -9.718  1.00 0.00 ? 189 ASN A H    3  
ATOM 3641  H HA   . ASN A 1 11  ? -18.466 9.593   -9.817  1.00 0.00 ? 189 ASN A HA   3  
ATOM 3642  H HB2  . ASN A 1 11  ? -17.643 10.946  -11.793 1.00 0.00 ? 189 ASN A HB2  3  
ATOM 3643  H HB3  . ASN A 1 11  ? -17.010 12.111  -10.633 1.00 0.00 ? 189 ASN A HB3  3  
ATOM 3644  H HD21 . ASN A 1 11  ? -14.950 11.632  -11.602 1.00 0.00 ? 189 ASN A HD21 3  
ATOM 3645  H HD22 . ASN A 1 11  ? -14.064 10.242  -11.084 1.00 0.00 ? 189 ASN A HD22 3  
ATOM 3646  N N    . ARG A 1 12  ? -17.822 10.098  -7.490  1.00 0.00 ? 190 ARG A N    3  
ATOM 3647  C CA   . ARG A 1 12  ? -17.436 10.359  -6.109  1.00 0.00 ? 190 ARG A CA   3  
ATOM 3648  C C    . ARG A 1 12  ? -16.038 9.818   -5.824  1.00 0.00 ? 190 ARG A C    3  
ATOM 3649  O O    . ARG A 1 12  ? -15.813 9.149   -4.815  1.00 0.00 ? 190 ARG A O    3  
ATOM 3650  C CB   . ARG A 1 12  ? -18.444 9.728   -5.147  1.00 0.00 ? 190 ARG A CB   3  
ATOM 3651  C CG   . ARG A 1 12  ? -18.480 10.392  -3.780  1.00 0.00 ? 190 ARG A CG   3  
ATOM 3652  C CD   . ARG A 1 12  ? -17.494 9.743   -2.820  1.00 0.00 ? 190 ARG A CD   3  
ATOM 3653  N NE   . ARG A 1 12  ? -17.879 9.938   -1.425  1.00 0.00 ? 190 ARG A NE   3  
ATOM 3654  C CZ   . ARG A 1 12  ? -17.627 11.049  -0.742  1.00 0.00 ? 190 ARG A CZ   3  
ATOM 3655  N NH1  . ARG A 1 12  ? -16.993 12.059  -1.322  1.00 0.00 ? 190 ARG A NH1  3  
ATOM 3656  N NH2  . ARG A 1 12  ? -18.009 11.151  0.525   1.00 0.00 ? 190 ARG A NH2  3  
ATOM 3657  H H    . ARG A 1 12  ? -18.003 9.176   -7.770  1.00 0.00 ? 190 ARG A H    3  
ATOM 3658  H HA   . ARG A 1 12  ? -17.432 11.429  -5.962  1.00 0.00 ? 190 ARG A HA   3  
ATOM 3659  H HB2  . ARG A 1 12  ? -19.431 9.797   -5.582  1.00 0.00 ? 190 ARG A HB2  3  
ATOM 3660  H HB3  . ARG A 1 12  ? -18.192 8.687   -5.012  1.00 0.00 ? 190 ARG A HB3  3  
ATOM 3661  H HG2  . ARG A 1 12  ? -18.224 11.435  -3.890  1.00 0.00 ? 190 ARG A HG2  3  
ATOM 3662  H HG3  . ARG A 1 12  ? -19.476 10.304  -3.373  1.00 0.00 ? 190 ARG A HG3  3  
ATOM 3663  H HD2  . ARG A 1 12  ? -17.454 8.684   -3.028  1.00 0.00 ? 190 ARG A HD2  3  
ATOM 3664  H HD3  . ARG A 1 12  ? -16.519 10.178  -2.979  1.00 0.00 ? 190 ARG A HD3  3  
ATOM 3665  H HE   . ARG A 1 12  ? -18.349 9.205   -0.977  1.00 0.00 ? 190 ARG A HE   3  
ATOM 3666  H HH11 . ARG A 1 12  ? -16.705 11.985  -2.276  1.00 0.00 ? 190 ARG A HH11 3  
ATOM 3667  H HH12 . ARG A 1 12  ? -16.805 12.894  -0.805  1.00 0.00 ? 190 ARG A HH12 3  
ATOM 3668  H HH21 . ARG A 1 12  ? -18.488 10.392  0.965   1.00 0.00 ? 190 ARG A HH21 3  
ATOM 3669  H HH22 . ARG A 1 12  ? -17.819 11.987  1.038   1.00 0.00 ? 190 ARG A HH22 3  
ATOM 3670  N N    . VAL A 1 13  ? -15.101 10.113  -6.720  1.00 0.00 ? 191 VAL A N    3  
ATOM 3671  C CA   . VAL A 1 13  ? -13.725 9.657   -6.565  1.00 0.00 ? 191 VAL A CA   3  
ATOM 3672  C C    . VAL A 1 13  ? -13.671 8.287   -5.899  1.00 0.00 ? 191 VAL A C    3  
ATOM 3673  O O    . VAL A 1 13  ? -12.984 8.098   -4.895  1.00 0.00 ? 191 VAL A O    3  
ATOM 3674  C CB   . VAL A 1 13  ? -12.894 10.652  -5.732  1.00 0.00 ? 191 VAL A CB   3  
ATOM 3675  C CG1  . VAL A 1 13  ? -11.408 10.366  -5.884  1.00 0.00 ? 191 VAL A CG1  3  
ATOM 3676  C CG2  . VAL A 1 13  ? -13.214 12.083  -6.138  1.00 0.00 ? 191 VAL A CG2  3  
ATOM 3677  H H    . VAL A 1 13  ? -15.341 10.650  -7.503  1.00 0.00 ? 191 VAL A H    3  
ATOM 3678  H HA   . VAL A 1 13  ? -13.283 9.587   -7.548  1.00 0.00 ? 191 VAL A HA   3  
ATOM 3679  H HB   . VAL A 1 13  ? -13.158 10.528  -4.692  1.00 0.00 ? 191 VAL A HB   3  
ATOM 3680  H HG11 . VAL A 1 13  ? -10.997 11.000  -6.655  1.00 0.00 ? 191 VAL A HG11 3  
ATOM 3681  H HG12 . VAL A 1 13  ? -10.906 10.563  -4.948  1.00 0.00 ? 191 VAL A HG12 3  
ATOM 3682  H HG13 . VAL A 1 13  ? -11.268 9.330   -6.157  1.00 0.00 ? 191 VAL A HG13 3  
ATOM 3683  H HG21 . VAL A 1 13  ? -12.338 12.536  -6.579  1.00 0.00 ? 191 VAL A HG21 3  
ATOM 3684  H HG22 . VAL A 1 13  ? -14.019 12.082  -6.859  1.00 0.00 ? 191 VAL A HG22 3  
ATOM 3685  H HG23 . VAL A 1 13  ? -13.513 12.647  -5.267  1.00 0.00 ? 191 VAL A HG23 3  
ATOM 3686  N N    . LEU A 1 14  ? -14.400 7.331   -6.466  1.00 0.00 ? 192 LEU A N    3  
ATOM 3687  C CA   . LEU A 1 14  ? -14.436 5.976   -5.928  1.00 0.00 ? 192 LEU A CA   3  
ATOM 3688  C C    . LEU A 1 14  ? -13.701 5.006   -6.847  1.00 0.00 ? 192 LEU A C    3  
ATOM 3689  O O    . LEU A 1 14  ? -12.969 4.131   -6.385  1.00 0.00 ? 192 LEU A O    3  
ATOM 3690  C CB   . LEU A 1 14  ? -15.884 5.519   -5.739  1.00 0.00 ? 192 LEU A CB   3  
ATOM 3691  C CG   . LEU A 1 14  ? -16.091 4.021   -5.511  1.00 0.00 ? 192 LEU A CG   3  
ATOM 3692  C CD1  . LEU A 1 14  ? -17.316 3.778   -4.643  1.00 0.00 ? 192 LEU A CD1  3  
ATOM 3693  C CD2  . LEU A 1 14  ? -16.223 3.293   -6.840  1.00 0.00 ? 192 LEU A CD2  3  
ATOM 3694  H H    . LEU A 1 14  ? -14.927 7.542   -7.264  1.00 0.00 ? 192 LEU A H    3  
ATOM 3695  H HA   . LEU A 1 14  ? -13.943 5.987   -4.968  1.00 0.00 ? 192 LEU A HA   3  
ATOM 3696  H HB2  . LEU A 1 14  ? -16.287 6.042   -4.886  1.00 0.00 ? 192 LEU A HB2  3  
ATOM 3697  H HB3  . LEU A 1 14  ? -16.437 5.799   -6.625  1.00 0.00 ? 192 LEU A HB3  3  
ATOM 3698  H HG   . LEU A 1 14  ? -15.231 3.620   -4.993  1.00 0.00 ? 192 LEU A HG   3  
ATOM 3699  H HD11 . LEU A 1 14  ? -17.479 4.631   -4.003  1.00 0.00 ? 192 LEU A HD11 3  
ATOM 3700  H HD12 . LEU A 1 14  ? -17.158 2.898   -4.037  1.00 0.00 ? 192 LEU A HD12 3  
ATOM 3701  H HD13 . LEU A 1 14  ? -18.180 3.630   -5.274  1.00 0.00 ? 192 LEU A HD13 3  
ATOM 3702  H HD21 . LEU A 1 14  ? -15.302 3.387   -7.395  1.00 0.00 ? 192 LEU A HD21 3  
ATOM 3703  H HD22 . LEU A 1 14  ? -17.032 3.727   -7.410  1.00 0.00 ? 192 LEU A HD22 3  
ATOM 3704  H HD23 . LEU A 1 14  ? -16.430 2.249   -6.659  1.00 0.00 ? 192 LEU A HD23 3  
ATOM 3705  N N    . SER A 1 15  ? -13.899 5.169   -8.152  1.00 0.00 ? 193 SER A N    3  
ATOM 3706  C CA   . SER A 1 15  ? -13.256 4.307   -9.136  1.00 0.00 ? 193 SER A CA   3  
ATOM 3707  C C    . SER A 1 15  ? -11.745 4.518   -9.139  1.00 0.00 ? 193 SER A C    3  
ATOM 3708  O O    . SER A 1 15  ? -11.243 5.492   -8.579  1.00 0.00 ? 193 SER A O    3  
ATOM 3709  C CB   . SER A 1 15  ? -13.823 4.579   -10.531 1.00 0.00 ? 193 SER A CB   3  
ATOM 3710  O OG   . SER A 1 15  ? -15.212 4.301   -10.580 1.00 0.00 ? 193 SER A OG   3  
ATOM 3711  H H    . SER A 1 15  ? -14.495 5.885   -8.458  1.00 0.00 ? 193 SER A H    3  
ATOM 3712  H HA   . SER A 1 15  ? -13.464 3.282   -8.866  1.00 0.00 ? 193 SER A HA   3  
ATOM 3713  H HB2  . SER A 1 15  ? -13.666 5.616   -10.785 1.00 0.00 ? 193 SER A HB2  3  
ATOM 3714  H HB3  . SER A 1 15  ? -13.317 3.951   -11.251 1.00 0.00 ? 193 SER A HB3  3  
ATOM 3715  H HG   . SER A 1 15  ? -15.595 4.717   -11.356 1.00 0.00 ? 193 SER A HG   3  
ATOM 3716  N N    . ALA A 1 16  ? -11.027 3.598   -9.774  1.00 0.00 ? 194 ALA A N    3  
ATOM 3717  C CA   . ALA A 1 16  ? -9.574  3.683   -9.852  1.00 0.00 ? 194 ALA A CA   3  
ATOM 3718  C C    . ALA A 1 16  ? -9.138  4.587   -11.000 1.00 0.00 ? 194 ALA A C    3  
ATOM 3719  O O    . ALA A 1 16  ? -8.278  5.451   -10.828 1.00 0.00 ? 194 ALA A O    3  
ATOM 3720  C CB   . ALA A 1 16  ? -8.972  2.295   -10.014 1.00 0.00 ? 194 ALA A CB   3  
ATOM 3721  H H    . ALA A 1 16  ? -11.485 2.844   -10.201 1.00 0.00 ? 194 ALA A H    3  
ATOM 3722  H HA   . ALA A 1 16  ? -9.213  4.099   -8.922  1.00 0.00 ? 194 ALA A HA   3  
ATOM 3723  H HB1  . ALA A 1 16  ? -8.263  2.304   -10.829 1.00 0.00 ? 194 ALA A HB1  3  
ATOM 3724  H HB2  . ALA A 1 16  ? -8.468  2.013   -9.101  1.00 0.00 ? 194 ALA A HB2  3  
ATOM 3725  H HB3  . ALA A 1 16  ? -9.757  1.585   -10.227 1.00 0.00 ? 194 ALA A HB3  3  
ATOM 3726  N N    . GLU A 1 17  ? -9.737  4.383   -12.169 1.00 0.00 ? 195 GLU A N    3  
ATOM 3727  C CA   . GLU A 1 17  ? -9.408  5.180   -13.344 1.00 0.00 ? 195 GLU A CA   3  
ATOM 3728  C C    . GLU A 1 17  ? -9.371  6.666   -13.001 1.00 0.00 ? 195 GLU A C    3  
ATOM 3729  O O    . GLU A 1 17  ? -8.500  7.401   -13.467 1.00 0.00 ? 195 GLU A O    3  
ATOM 3730  C CB   . GLU A 1 17  ? -10.425 4.928   -14.460 1.00 0.00 ? 195 GLU A CB   3  
ATOM 3731  C CG   . GLU A 1 17  ? -10.218 3.610   -15.186 1.00 0.00 ? 195 GLU A CG   3  
ATOM 3732  C CD   . GLU A 1 17  ? -9.148  3.695   -16.257 1.00 0.00 ? 195 GLU A CD   3  
ATOM 3733  O OE1  . GLU A 1 17  ? -8.108  4.341   -16.008 1.00 0.00 ? 195 GLU A OE1  3  
ATOM 3734  O OE2  . GLU A 1 17  ? -9.350  3.116   -17.345 1.00 0.00 ? 195 GLU A OE2  3  
ATOM 3735  H H    . GLU A 1 17  ? -10.415 3.679   -12.242 1.00 0.00 ? 195 GLU A H    3  
ATOM 3736  H HA   . GLU A 1 17  ? -8.430  4.878   -13.687 1.00 0.00 ? 195 GLU A HA   3  
ATOM 3737  H HB2  . GLU A 1 17  ? -11.417 4.929   -14.033 1.00 0.00 ? 195 GLU A HB2  3  
ATOM 3738  H HB3  . GLU A 1 17  ? -10.353 5.728   -15.182 1.00 0.00 ? 195 GLU A HB3  3  
ATOM 3739  H HG2  . GLU A 1 17  ? -9.926  2.859   -14.467 1.00 0.00 ? 195 GLU A HG2  3  
ATOM 3740  H HG3  . GLU A 1 17  ? -11.148 3.319   -15.650 1.00 0.00 ? 195 GLU A HG3  3  
ATOM 3741  N N    . ALA A 1 18  ? -10.323 7.102   -12.183 1.00 0.00 ? 196 ALA A N    3  
ATOM 3742  C CA   . ALA A 1 18  ? -10.400 8.500   -11.776 1.00 0.00 ? 196 ALA A CA   3  
ATOM 3743  C C    . ALA A 1 18  ? -9.167  8.907   -10.975 1.00 0.00 ? 196 ALA A C    3  
ATOM 3744  O O    . ALA A 1 18  ? -8.585  9.967   -11.208 1.00 0.00 ? 196 ALA A O    3  
ATOM 3745  C CB   . ALA A 1 18  ? -11.663 8.745   -10.964 1.00 0.00 ? 196 ALA A CB   3  
ATOM 3746  H H    . ALA A 1 18  ? -10.989 6.469   -11.844 1.00 0.00 ? 196 ALA A H    3  
ATOM 3747  H HA   . ALA A 1 18  ? -10.453 9.106   -12.669 1.00 0.00 ? 196 ALA A HA   3  
ATOM 3748  H HB1  . ALA A 1 18  ? -12.080 7.797   -10.653 1.00 0.00 ? 196 ALA A HB1  3  
ATOM 3749  H HB2  . ALA A 1 18  ? -11.422 9.335   -10.092 1.00 0.00 ? 196 ALA A HB2  3  
ATOM 3750  H HB3  . ALA A 1 18  ? -12.383 9.273   -11.570 1.00 0.00 ? 196 ALA A HB3  3  
ATOM 3751  N N    . LEU A 1 19  ? -8.774  8.058   -10.031 1.00 0.00 ? 197 LEU A N    3  
ATOM 3752  C CA   . LEU A 1 19  ? -7.610  8.330   -9.195  1.00 0.00 ? 197 LEU A CA   3  
ATOM 3753  C C    . LEU A 1 19  ? -6.462  8.893   -10.027 1.00 0.00 ? 197 LEU A C    3  
ATOM 3754  O O    . LEU A 1 19  ? -6.431  8.739   -11.248 1.00 0.00 ? 197 LEU A O    3  
ATOM 3755  C CB   . LEU A 1 19  ? -7.160  7.053   -8.482  1.00 0.00 ? 197 LEU A CB   3  
ATOM 3756  C CG   . LEU A 1 19  ? -8.251  6.279   -7.740  1.00 0.00 ? 197 LEU A CG   3  
ATOM 3757  C CD1  . LEU A 1 19  ? -7.696  4.978   -7.182  1.00 0.00 ? 197 LEU A CD1  3  
ATOM 3758  C CD2  . LEU A 1 19  ? -8.845  7.130   -6.627  1.00 0.00 ? 197 LEU A CD2  3  
ATOM 3759  H H    . LEU A 1 19  ? -9.278  7.230   -9.893  1.00 0.00 ? 197 LEU A H    3  
ATOM 3760  H HA   . LEU A 1 19  ? -7.897  9.063   -8.456  1.00 0.00 ? 197 LEU A HA   3  
ATOM 3761  H HB2  . LEU A 1 19  ? -6.733  6.394   -9.223  1.00 0.00 ? 197 LEU A HB2  3  
ATOM 3762  H HB3  . LEU A 1 19  ? -6.400  7.327   -7.764  1.00 0.00 ? 197 LEU A HB3  3  
ATOM 3763  H HG   . LEU A 1 19  ? -9.044  6.033   -8.434  1.00 0.00 ? 197 LEU A HG   3  
ATOM 3764  H HD11 . LEU A 1 19  ? -8.470  4.463   -6.633  1.00 0.00 ? 197 LEU A HD11 3  
ATOM 3765  H HD12 . LEU A 1 19  ? -6.869  5.194   -6.522  1.00 0.00 ? 197 LEU A HD12 3  
ATOM 3766  H HD13 . LEU A 1 19  ? -7.354  4.355   -7.995  1.00 0.00 ? 197 LEU A HD13 3  
ATOM 3767  H HD21 . LEU A 1 19  ? -9.773  7.567   -6.965  1.00 0.00 ? 197 LEU A HD21 3  
ATOM 3768  H HD22 . LEU A 1 19  ? -8.151  7.916   -6.365  1.00 0.00 ? 197 LEU A HD22 3  
ATOM 3769  H HD23 . LEU A 1 19  ? -9.032  6.511   -5.762  1.00 0.00 ? 197 LEU A HD23 3  
ATOM 3770  N N    . LYS A 1 20  ? -5.517  9.544   -9.357  1.00 0.00 ? 198 LYS A N    3  
ATOM 3771  C CA   . LYS A 1 20  ? -4.364  10.128  -10.032 1.00 0.00 ? 198 LYS A CA   3  
ATOM 3772  C C    . LYS A 1 20  ? -3.065  9.702   -9.356  1.00 0.00 ? 198 LYS A C    3  
ATOM 3773  O O    . LYS A 1 20  ? -3.029  9.391   -8.165  1.00 0.00 ? 198 LYS A O    3  
ATOM 3774  C CB   . LYS A 1 20  ? -4.470  11.654  -10.040 1.00 0.00 ? 198 LYS A CB   3  
ATOM 3775  C CG   . LYS A 1 20  ? -5.569  12.182  -10.946 1.00 0.00 ? 198 LYS A CG   3  
ATOM 3776  C CD   . LYS A 1 20  ? -5.469  13.688  -11.125 1.00 0.00 ? 198 LYS A CD   3  
ATOM 3777  C CE   . LYS A 1 20  ? -6.105  14.137  -12.432 1.00 0.00 ? 198 LYS A CE   3  
ATOM 3778  N NZ   . LYS A 1 20  ? -6.360  15.604  -12.449 1.00 0.00 ? 198 LYS A NZ   3  
ATOM 3779  H H    . LYS A 1 20  ? -5.597  9.634   -8.384  1.00 0.00 ? 198 LYS A H    3  
ATOM 3780  H HA   . LYS A 1 20  ? -4.360  9.770   -11.051 1.00 0.00 ? 198 LYS A HA   3  
ATOM 3781  H HB2  . LYS A 1 20  ? -4.666  11.995  -9.034  1.00 0.00 ? 198 LYS A HB2  3  
ATOM 3782  H HB3  . LYS A 1 20  ? -3.529  12.067  -10.374 1.00 0.00 ? 198 LYS A HB3  3  
ATOM 3783  H HG2  . LYS A 1 20  ? -5.485  11.709  -11.913 1.00 0.00 ? 198 LYS A HG2  3  
ATOM 3784  H HG3  . LYS A 1 20  ? -6.529  11.944  -10.509 1.00 0.00 ? 198 LYS A HG3  3  
ATOM 3785  H HD2  . LYS A 1 20  ? -5.977  14.174  -10.305 1.00 0.00 ? 198 LYS A HD2  3  
ATOM 3786  H HD3  . LYS A 1 20  ? -4.426  13.973  -11.125 1.00 0.00 ? 198 LYS A HD3  3  
ATOM 3787  H HE2  . LYS A 1 20  ? -5.440  13.887  -13.245 1.00 0.00 ? 198 LYS A HE2  3  
ATOM 3788  H HE3  . LYS A 1 20  ? -7.042  13.615  -12.559 1.00 0.00 ? 198 LYS A HE3  3  
ATOM 3789  H HZ1  . LYS A 1 20  ? -6.004  16.039  -11.573 1.00 0.00 ? 198 LYS A HZ1  3  
ATOM 3790  H HZ2  . LYS A 1 20  ? -7.381  15.788  -12.522 1.00 0.00 ? 198 LYS A HZ2  3  
ATOM 3791  H HZ3  . LYS A 1 20  ? -5.881  16.042  -13.261 1.00 0.00 ? 198 LYS A HZ3  3  
ATOM 3792  N N    . PRO A 1 21  ? -1.970  9.688   -10.131 1.00 0.00 ? 199 PRO A N    3  
ATOM 3793  C CA   . PRO A 1 21  ? -0.648  9.304   -9.627  1.00 0.00 ? 199 PRO A CA   3  
ATOM 3794  C C    . PRO A 1 21  ? -0.073  10.337  -8.663  1.00 0.00 ? 199 PRO A C    3  
ATOM 3795  O O    . PRO A 1 21  ? 0.307   11.435  -9.069  1.00 0.00 ? 199 PRO A O    3  
ATOM 3796  C CB   . PRO A 1 21  ? 0.205   9.223   -10.895 1.00 0.00 ? 199 PRO A CB   3  
ATOM 3797  C CG   . PRO A 1 21  ? -0.468  10.132  -11.864 1.00 0.00 ? 199 PRO A CG   3  
ATOM 3798  C CD   . PRO A 1 21  ? -1.938  10.047  -11.559 1.00 0.00 ? 199 PRO A CD   3  
ATOM 3799  H HA   . PRO A 1 21  ? -0.672  8.338   -9.145  1.00 0.00 ? 199 PRO A HA   3  
ATOM 3800  H HB2  . PRO A 1 21  ? 1.211   9.552   -10.677 1.00 0.00 ? 199 PRO A HB2  3  
ATOM 3801  H HB3  . PRO A 1 21  ? 0.223   8.205   -11.256 1.00 0.00 ? 199 PRO A HB3  3  
ATOM 3802  H HG2  . PRO A 1 21  ? -0.115  11.142  -11.726 1.00 0.00 ? 199 PRO A HG2  3  
ATOM 3803  H HG3  . PRO A 1 21  ? -0.276  9.800   -12.873 1.00 0.00 ? 199 PRO A HG3  3  
ATOM 3804  H HD2  . PRO A 1 21  ? -2.415  11.001  -11.727 1.00 0.00 ? 199 PRO A HD2  3  
ATOM 3805  H HD3  . PRO A 1 21  ? -2.405  9.279   -12.159 1.00 0.00 ? 199 PRO A HD3  3  
ATOM 3806  N N    . GLY A 1 22  ? -0.010  9.977   -7.385  1.00 0.00 ? 200 GLY A N    3  
ATOM 3807  C CA   . GLY A 1 22  ? 0.521   10.883  -6.384  1.00 0.00 ? 200 GLY A CA   3  
ATOM 3808  C C    . GLY A 1 22  ? -0.442  11.106  -5.235  1.00 0.00 ? 200 GLY A C    3  
ATOM 3809  O O    . GLY A 1 22  ? -0.437  12.166  -4.609  1.00 0.00 ? 200 GLY A O    3  
ATOM 3810  H H    . GLY A 1 22  ? -0.328  9.088   -7.119  1.00 0.00 ? 200 GLY A H    3  
ATOM 3811  H HA2  . GLY A 1 22  ? 1.441   10.474  -5.995  1.00 0.00 ? 200 GLY A HA2  3  
ATOM 3812  H HA3  . GLY A 1 22  ? 0.730   11.834  -6.851  1.00 0.00 ? 200 GLY A HA3  3  
ATOM 3813  N N    . MET A 1 23  ? -1.272  10.105  -4.957  1.00 0.00 ? 201 MET A N    3  
ATOM 3814  C CA   . MET A 1 23  ? -2.245  10.198  -3.875  1.00 0.00 ? 201 MET A CA   3  
ATOM 3815  C C    . MET A 1 23  ? -1.708  9.548   -2.604  1.00 0.00 ? 201 MET A C    3  
ATOM 3816  O O    . MET A 1 23  ? -1.118  8.468   -2.648  1.00 0.00 ? 201 MET A O    3  
ATOM 3817  C CB   . MET A 1 23  ? -3.560  9.532   -4.285  1.00 0.00 ? 201 MET A CB   3  
ATOM 3818  C CG   . MET A 1 23  ? -4.341  10.319  -5.325  1.00 0.00 ? 201 MET A CG   3  
ATOM 3819  S SD   . MET A 1 23  ? -5.812  9.447   -5.896  1.00 0.00 ? 201 MET A SD   3  
ATOM 3820  C CE   . MET A 1 23  ? -6.862  10.821  -6.360  1.00 0.00 ? 201 MET A CE   3  
ATOM 3821  H H    . MET A 1 23  ? -1.228  9.285   -5.492  1.00 0.00 ? 201 MET A H    3  
ATOM 3822  H HA   . MET A 1 23  ? -2.427  11.244  -3.682  1.00 0.00 ? 201 MET A HA   3  
ATOM 3823  H HB2  . MET A 1 23  ? -3.344  8.556   -4.692  1.00 0.00 ? 201 MET A HB2  3  
ATOM 3824  H HB3  . MET A 1 23  ? -4.182  9.419   -3.409  1.00 0.00 ? 201 MET A HB3  3  
ATOM 3825  H HG2  . MET A 1 23  ? -4.645  11.261  -4.891  1.00 0.00 ? 201 MET A HG2  3  
ATOM 3826  H HG3  . MET A 1 23  ? -3.698  10.507  -6.172  1.00 0.00 ? 201 MET A HG3  3  
ATOM 3827  H HE1  . MET A 1 23  ? -6.994  10.828  -7.432  1.00 0.00 ? 201 MET A HE1  3  
ATOM 3828  H HE2  . MET A 1 23  ? -7.824  10.716  -5.881  1.00 0.00 ? 201 MET A HE2  3  
ATOM 3829  H HE3  . MET A 1 23  ? -6.402  11.747  -6.048  1.00 0.00 ? 201 MET A HE3  3  
ATOM 3830  N N    . LEU A 1 24  ? -1.915  10.213  -1.472  1.00 0.00 ? 202 LEU A N    3  
ATOM 3831  C CA   . LEU A 1 24  ? -1.451  9.700   -0.188  1.00 0.00 ? 202 LEU A CA   3  
ATOM 3832  C C    . LEU A 1 24  ? -2.572  8.968   0.543   1.00 0.00 ? 202 LEU A C    3  
ATOM 3833  O O    . LEU A 1 24  ? -3.548  9.580   0.978   1.00 0.00 ? 202 LEU A O    3  
ATOM 3834  C CB   . LEU A 1 24  ? -0.924  10.844  0.680   1.00 0.00 ? 202 LEU A CB   3  
ATOM 3835  C CG   . LEU A 1 24  ? 0.180   11.702  0.061   1.00 0.00 ? 202 LEU A CG   3  
ATOM 3836  C CD1  . LEU A 1 24  ? -0.405  12.678  -0.949  1.00 0.00 ? 202 LEU A CD1  3  
ATOM 3837  C CD2  . LEU A 1 24  ? 0.947   12.448  1.143   1.00 0.00 ? 202 LEU A CD2  3  
ATOM 3838  H H    . LEU A 1 24  ? -2.391  11.069  -1.500  1.00 0.00 ? 202 LEU A H    3  
ATOM 3839  H HA   . LEU A 1 24  ? -0.648  9.005   -0.380  1.00 0.00 ? 202 LEU A HA   3  
ATOM 3840  H HB2  . LEU A 1 24  ? -1.754  11.492  0.913   1.00 0.00 ? 202 LEU A HB2  3  
ATOM 3841  H HB3  . LEU A 1 24  ? -0.537  10.415  1.593   1.00 0.00 ? 202 LEU A HB3  3  
ATOM 3842  H HG   . LEU A 1 24  ? 0.877   11.060  -0.461  1.00 0.00 ? 202 LEU A HG   3  
ATOM 3843  H HD11 . LEU A 1 24  ? -1.354  13.044  -0.588  1.00 0.00 ? 202 LEU A HD11 3  
ATOM 3844  H HD12 . LEU A 1 24  ? -0.548  12.175  -1.894  1.00 0.00 ? 202 LEU A HD12 3  
ATOM 3845  H HD13 . LEU A 1 24  ? 0.274   13.507  -1.083  1.00 0.00 ? 202 LEU A HD13 3  
ATOM 3846  H HD21 . LEU A 1 24  ? 0.541   13.443  1.250   1.00 0.00 ? 202 LEU A HD21 3  
ATOM 3847  H HD22 . LEU A 1 24  ? 1.989   12.512  0.867   1.00 0.00 ? 202 LEU A HD22 3  
ATOM 3848  H HD23 . LEU A 1 24  ? 0.854   11.918  2.080   1.00 0.00 ? 202 LEU A HD23 3  
ATOM 3849  N N    . LEU A 1 25  ? -2.424  7.654   0.676   1.00 0.00 ? 203 LEU A N    3  
ATOM 3850  C CA   . LEU A 1 25  ? -3.423  6.837   1.357   1.00 0.00 ? 203 LEU A CA   3  
ATOM 3851  C C    . LEU A 1 25  ? -2.768  5.920   2.384   1.00 0.00 ? 203 LEU A C    3  
ATOM 3852  O O    . LEU A 1 25  ? -1.627  5.490   2.211   1.00 0.00 ? 203 LEU A O    3  
ATOM 3853  C CB   . LEU A 1 25  ? -4.209  6.006   0.341   1.00 0.00 ? 203 LEU A CB   3  
ATOM 3854  C CG   . LEU A 1 25  ? -5.196  6.776   -0.536  1.00 0.00 ? 203 LEU A CG   3  
ATOM 3855  C CD1  . LEU A 1 25  ? -4.472  7.837   -1.350  1.00 0.00 ? 203 LEU A CD1  3  
ATOM 3856  C CD2  . LEU A 1 25  ? -5.952  5.824   -1.452  1.00 0.00 ? 203 LEU A CD2  3  
ATOM 3857  H H    . LEU A 1 25  ? -1.626  7.223   0.309   1.00 0.00 ? 203 LEU A H    3  
ATOM 3858  H HA   . LEU A 1 25  ? -4.103  7.503   1.868   1.00 0.00 ? 203 LEU A HA   3  
ATOM 3859  H HB2  . LEU A 1 25  ? -3.498  5.520   -0.309  1.00 0.00 ? 203 LEU A HB2  3  
ATOM 3860  H HB3  . LEU A 1 25  ? -4.765  5.257   0.888   1.00 0.00 ? 203 LEU A HB3  3  
ATOM 3861  H HG   . LEU A 1 25  ? -5.917  7.276   0.096   1.00 0.00 ? 203 LEU A HG   3  
ATOM 3862  H HD11 . LEU A 1 25  ? -4.937  7.928   -2.320  1.00 0.00 ? 203 LEU A HD11 3  
ATOM 3863  H HD12 . LEU A 1 25  ? -3.437  7.553   -1.472  1.00 0.00 ? 203 LEU A HD12 3  
ATOM 3864  H HD13 . LEU A 1 25  ? -4.525  8.785   -0.834  1.00 0.00 ? 203 LEU A HD13 3  
ATOM 3865  H HD21 . LEU A 1 25  ? -5.318  5.542   -2.280  1.00 0.00 ? 203 LEU A HD21 3  
ATOM 3866  H HD22 . LEU A 1 25  ? -6.839  6.313   -1.827  1.00 0.00 ? 203 LEU A HD22 3  
ATOM 3867  H HD23 . LEU A 1 25  ? -6.234  4.941   -0.898  1.00 0.00 ? 203 LEU A HD23 3  
ATOM 3868  N N    . THR A 1 26  ? -3.498  5.622   3.455   1.00 0.00 ? 204 THR A N    3  
ATOM 3869  C CA   . THR A 1 26  ? -2.989  4.754   4.509   1.00 0.00 ? 204 THR A CA   3  
ATOM 3870  C C    . THR A 1 26  ? -3.571  3.350   4.395   1.00 0.00 ? 204 THR A C    3  
ATOM 3871  O O    . THR A 1 26  ? -4.785  3.164   4.458   1.00 0.00 ? 204 THR A O    3  
ATOM 3872  C CB   . THR A 1 26  ? -3.311  5.319   5.906   1.00 0.00 ? 204 THR A CB   3  
ATOM 3873  O OG1  . THR A 1 26  ? -2.960  6.706   5.966   1.00 0.00 ? 204 THR A OG1  3  
ATOM 3874  C CG2  . THR A 1 26  ? -2.562  4.553   6.986   1.00 0.00 ? 204 THR A CG2  3  
ATOM 3875  H H    . THR A 1 26  ? -4.400  5.995   3.536   1.00 0.00 ? 204 THR A H    3  
ATOM 3876  H HA   . THR A 1 26  ? -1.915  4.698   4.406   1.00 0.00 ? 204 THR A HA   3  
ATOM 3877  H HB   . THR A 1 26  ? -4.372  5.217   6.083   1.00 0.00 ? 204 THR A HB   3  
ATOM 3878  H HG1  . THR A 1 26  ? -2.293  6.897   5.302   1.00 0.00 ? 204 THR A HG1  3  
ATOM 3879  H HG21 . THR A 1 26  ? -2.997  3.571   7.098   1.00 0.00 ? 204 THR A HG21 3  
ATOM 3880  H HG22 . THR A 1 26  ? -2.633  5.088   7.921   1.00 0.00 ? 204 THR A HG22 3  
ATOM 3881  H HG23 . THR A 1 26  ? -1.524  4.457   6.703   1.00 0.00 ? 204 THR A HG23 3  
ATOM 3882  N N    . GLY A 1 27  ? -2.695  2.363   4.227   1.00 0.00 ? 205 GLY A N    3  
ATOM 3883  C CA   . GLY A 1 27  ? -3.142  0.988   4.107   1.00 0.00 ? 205 GLY A CA   3  
ATOM 3884  C C    . GLY A 1 27  ? -2.446  0.065   5.088   1.00 0.00 ? 205 GLY A C    3  
ATOM 3885  O O    . GLY A 1 27  ? -1.574  0.493   5.845   1.00 0.00 ? 205 GLY A O    3  
ATOM 3886  H H    . GLY A 1 27  ? -1.738  2.571   4.184   1.00 0.00 ? 205 GLY A H    3  
ATOM 3887  H HA2  . GLY A 1 27  ? -4.206  0.949   4.286   1.00 0.00 ? 205 GLY A HA2  3  
ATOM 3888  H HA3  . GLY A 1 27  ? -2.943  0.643   3.103   1.00 0.00 ? 205 GLY A HA3  3  
ATOM 3889  N N    . THR A 1 28  ? -2.832  -1.207  5.077   1.00 0.00 ? 206 THR A N    3  
ATOM 3890  C CA   . THR A 1 28  ? -2.241  -2.193  5.974   1.00 0.00 ? 206 THR A CA   3  
ATOM 3891  C C    . THR A 1 28  ? -1.724  -3.400  5.200   1.00 0.00 ? 206 THR A C    3  
ATOM 3892  O O    . THR A 1 28  ? -2.388  -3.899  4.291   1.00 0.00 ? 206 THR A O    3  
ATOM 3893  C CB   . THR A 1 28  ? -3.256  -2.671  7.030   1.00 0.00 ? 206 THR A CB   3  
ATOM 3894  O OG1  . THR A 1 28  ? -4.544  -2.841  6.429   1.00 0.00 ? 206 THR A OG1  3  
ATOM 3895  C CG2  . THR A 1 28  ? -3.353  -1.676  8.176   1.00 0.00 ? 206 THR A CG2  3  
ATOM 3896  H H    . THR A 1 28  ? -3.531  -1.488  4.451   1.00 0.00 ? 206 THR A H    3  
ATOM 3897  H HA   . THR A 1 28  ? -1.414  -1.724  6.487   1.00 0.00 ? 206 THR A HA   3  
ATOM 3898  H HB   . THR A 1 28  ? -2.922  -3.620  7.424   1.00 0.00 ? 206 THR A HB   3  
ATOM 3899  H HG1  . THR A 1 28  ? -4.775  -2.050  5.936   1.00 0.00 ? 206 THR A HG1  3  
ATOM 3900  H HG21 . THR A 1 28  ? -3.839  -0.775  7.831   1.00 0.00 ? 206 THR A HG21 3  
ATOM 3901  H HG22 . THR A 1 28  ? -2.361  -1.437  8.531   1.00 0.00 ? 206 THR A HG22 3  
ATOM 3902  H HG23 . THR A 1 28  ? -3.928  -2.109  8.981   1.00 0.00 ? 206 THR A HG23 3  
ATOM 3903  N N    . VAL A 1 29  ? -0.534  -3.866  5.567   1.00 0.00 ? 207 VAL A N    3  
ATOM 3904  C CA   . VAL A 1 29  ? 0.072   -5.017  4.908   1.00 0.00 ? 207 VAL A CA   3  
ATOM 3905  C C    . VAL A 1 29  ? -0.797  -6.260  5.062   1.00 0.00 ? 207 VAL A C    3  
ATOM 3906  O O    . VAL A 1 29  ? -1.110  -6.676  6.178   1.00 0.00 ? 207 VAL A O    3  
ATOM 3907  C CB   . VAL A 1 29  ? 1.475   -5.312  5.471   1.00 0.00 ? 207 VAL A CB   3  
ATOM 3908  C CG1  . VAL A 1 29  ? 2.071   -6.542  4.803   1.00 0.00 ? 207 VAL A CG1  3  
ATOM 3909  C CG2  . VAL A 1 29  ? 2.384   -4.105  5.293   1.00 0.00 ? 207 VAL A CG2  3  
ATOM 3910  H H    . VAL A 1 29  ? -0.053  -3.426  6.298   1.00 0.00 ? 207 VAL A H    3  
ATOM 3911  H HA   . VAL A 1 29  ? 0.170   -4.787  3.857   1.00 0.00 ? 207 VAL A HA   3  
ATOM 3912  H HB   . VAL A 1 29  ? 1.382   -5.513  6.528   1.00 0.00 ? 207 VAL A HB   3  
ATOM 3913  H HG11 . VAL A 1 29  ? 2.059   -6.411  3.731   1.00 0.00 ? 207 VAL A HG11 3  
ATOM 3914  H HG12 . VAL A 1 29  ? 3.088   -6.677  5.140   1.00 0.00 ? 207 VAL A HG12 3  
ATOM 3915  H HG13 . VAL A 1 29  ? 1.486   -7.412  5.065   1.00 0.00 ? 207 VAL A HG13 3  
ATOM 3916  H HG21 . VAL A 1 29  ? 2.872   -3.881  6.230   1.00 0.00 ? 207 VAL A HG21 3  
ATOM 3917  H HG22 . VAL A 1 29  ? 3.130   -4.324  4.542   1.00 0.00 ? 207 VAL A HG22 3  
ATOM 3918  H HG23 . VAL A 1 29  ? 1.798   -3.255  4.979   1.00 0.00 ? 207 VAL A HG23 3  
ATOM 3919  N N    . SER A 1 30  ? -1.184  -6.849  3.935   1.00 0.00 ? 208 SER A N    3  
ATOM 3920  C CA   . SER A 1 30  ? -2.021  -8.043  3.945   1.00 0.00 ? 208 SER A CA   3  
ATOM 3921  C C    . SER A 1 30  ? -1.169  -9.302  4.073   1.00 0.00 ? 208 SER A C    3  
ATOM 3922  O O    . SER A 1 30  ? -1.474  -10.193 4.865   1.00 0.00 ? 208 SER A O    3  
ATOM 3923  C CB   . SER A 1 30  ? -2.864  -8.111  2.671   1.00 0.00 ? 208 SER A CB   3  
ATOM 3924  O OG   . SER A 1 30  ? -3.697  -9.258  2.671   1.00 0.00 ? 208 SER A OG   3  
ATOM 3925  H H    . SER A 1 30  ? -0.903  -6.469  3.077   1.00 0.00 ? 208 SER A H    3  
ATOM 3926  H HA   . SER A 1 30  ? -2.679  -7.980  4.799   1.00 0.00 ? 208 SER A HA   3  
ATOM 3927  H HB2  . SER A 1 30  ? -3.484  -7.231  2.605   1.00 0.00 ? 208 SER A HB2  3  
ATOM 3928  H HB3  . SER A 1 30  ? -2.210  -8.156  1.812   1.00 0.00 ? 208 SER A HB3  3  
ATOM 3929  H HG   . SER A 1 30  ? -4.396  -9.145  3.319   1.00 0.00 ? 208 SER A HG   3  
ATOM 3930  N N    . SER A 1 31  ? -0.099  -9.367  3.287   1.00 0.00 ? 209 SER A N    3  
ATOM 3931  C CA   . SER A 1 31  ? 0.796   -10.518 3.309   1.00 0.00 ? 209 SER A CA   3  
ATOM 3932  C C    . SER A 1 31  ? 2.180   -10.140 2.788   1.00 0.00 ? 209 SER A C    3  
ATOM 3933  O O    . SER A 1 31  ? 2.331   -9.178  2.033   1.00 0.00 ? 209 SER A O    3  
ATOM 3934  C CB   . SER A 1 31  ? 0.217   -11.657 2.468   1.00 0.00 ? 209 SER A CB   3  
ATOM 3935  O OG   . SER A 1 31  ? 0.440   -11.436 1.086   1.00 0.00 ? 209 SER A OG   3  
ATOM 3936  H H    . SER A 1 31  ? 0.091   -8.624  2.676   1.00 0.00 ? 209 SER A H    3  
ATOM 3937  H HA   . SER A 1 31  ? 0.888   -10.848 4.333   1.00 0.00 ? 209 SER A HA   3  
ATOM 3938  H HB2  . SER A 1 31  ? 0.688   -12.586 2.752   1.00 0.00 ? 209 SER A HB2  3  
ATOM 3939  H HB3  . SER A 1 31  ? -0.847  -11.725 2.643   1.00 0.00 ? 209 SER A HB3  3  
ATOM 3940  H HG   . SER A 1 31  ? 0.357   -10.499 0.894   1.00 0.00 ? 209 SER A HG   3  
ATOM 3941  N N    . LEU A 1 32  ? 3.188   -10.902 3.197   1.00 0.00 ? 210 LEU A N    3  
ATOM 3942  C CA   . LEU A 1 32  ? 4.560   -10.649 2.773   1.00 0.00 ? 210 LEU A CA   3  
ATOM 3943  C C    . LEU A 1 32  ? 4.964   -11.591 1.644   1.00 0.00 ? 210 LEU A C    3  
ATOM 3944  O O    . LEU A 1 32  ? 4.821   -12.808 1.758   1.00 0.00 ? 210 LEU A O    3  
ATOM 3945  C CB   . LEU A 1 32  ? 5.518   -10.810 3.955   1.00 0.00 ? 210 LEU A CB   3  
ATOM 3946  C CG   . LEU A 1 32  ? 5.519   -9.674  4.979   1.00 0.00 ? 210 LEU A CG   3  
ATOM 3947  C CD1  . LEU A 1 32  ? 4.312   -9.783  5.898   1.00 0.00 ? 210 LEU A CD1  3  
ATOM 3948  C CD2  . LEU A 1 32  ? 6.809   -9.685  5.786   1.00 0.00 ? 210 LEU A CD2  3  
ATOM 3949  H H    . LEU A 1 32  ? 3.005   -11.654 3.798   1.00 0.00 ? 210 LEU A H    3  
ATOM 3950  H HA   . LEU A 1 32  ? 4.613   -9.632  2.414   1.00 0.00 ? 210 LEU A HA   3  
ATOM 3951  H HB2  . LEU A 1 32  ? 5.255   -11.721 4.472   1.00 0.00 ? 210 LEU A HB2  3  
ATOM 3952  H HB3  . LEU A 1 32  ? 6.519   -10.901 3.559   1.00 0.00 ? 210 LEU A HB3  3  
ATOM 3953  H HG   . LEU A 1 32  ? 5.457   -8.729  4.458   1.00 0.00 ? 210 LEU A HG   3  
ATOM 3954  H HD11 . LEU A 1 32  ? 3.513   -10.294 5.383   1.00 0.00 ? 210 LEU A HD11 3  
ATOM 3955  H HD12 . LEU A 1 32  ? 3.984   -8.793  6.179   1.00 0.00 ? 210 LEU A HD12 3  
ATOM 3956  H HD13 . LEU A 1 32  ? 4.583   -10.337 6.784   1.00 0.00 ? 210 LEU A HD13 3  
ATOM 3957  H HD21 . LEU A 1 32  ? 6.875   -8.779  6.370   1.00 0.00 ? 210 LEU A HD21 3  
ATOM 3958  H HD22 . LEU A 1 32  ? 7.653   -9.743  5.115   1.00 0.00 ? 210 LEU A HD22 3  
ATOM 3959  H HD23 . LEU A 1 32  ? 6.813   -10.540 6.446   1.00 0.00 ? 210 LEU A HD23 3  
ATOM 3960  N N    . GLU A 1 33  ? 5.471   -11.020 0.556   1.00 0.00 ? 211 GLU A N    3  
ATOM 3961  C CA   . GLU A 1 33  ? 5.897   -11.810 -0.593  1.00 0.00 ? 211 GLU A CA   3  
ATOM 3962  C C    . GLU A 1 33  ? 7.410   -11.727 -0.780  1.00 0.00 ? 211 GLU A C    3  
ATOM 3963  O O    . GLU A 1 33  ? 8.021   -10.688 -0.528  1.00 0.00 ? 211 GLU A O    3  
ATOM 3964  C CB   . GLU A 1 33  ? 5.189   -11.330 -1.861  1.00 0.00 ? 211 GLU A CB   3  
ATOM 3965  C CG   . GLU A 1 33  ? 3.873   -12.040 -2.129  1.00 0.00 ? 211 GLU A CG   3  
ATOM 3966  C CD   . GLU A 1 33  ? 3.467   -11.985 -3.589  1.00 0.00 ? 211 GLU A CD   3  
ATOM 3967  O OE1  . GLU A 1 33  ? 4.359   -11.816 -4.446  1.00 0.00 ? 211 GLU A OE1  3  
ATOM 3968  O OE2  . GLU A 1 33  ? 2.258   -12.111 -3.875  1.00 0.00 ? 211 GLU A OE2  3  
ATOM 3969  H H    . GLU A 1 33  ? 5.560   -10.044 0.525   1.00 0.00 ? 211 GLU A H    3  
ATOM 3970  H HA   . GLU A 1 33  ? 5.626   -12.838 -0.407  1.00 0.00 ? 211 GLU A HA   3  
ATOM 3971  H HB2  . GLU A 1 33  ? 4.992   -10.272 -1.770  1.00 0.00 ? 211 GLU A HB2  3  
ATOM 3972  H HB3  . GLU A 1 33  ? 5.841   -11.493 -2.707  1.00 0.00 ? 211 GLU A HB3  3  
ATOM 3973  H HG2  . GLU A 1 33  ? 3.971   -13.075 -1.838  1.00 0.00 ? 211 GLU A HG2  3  
ATOM 3974  H HG3  . GLU A 1 33  ? 3.099   -11.573 -1.538  1.00 0.00 ? 211 GLU A HG3  3  
ATOM 3975  N N    . ASP A 1 34  ? 8.006   -12.829 -1.221  1.00 0.00 ? 212 ASP A N    3  
ATOM 3976  C CA   . ASP A 1 34  ? 9.447   -12.882 -1.442  1.00 0.00 ? 212 ASP A CA   3  
ATOM 3977  C C    . ASP A 1 34  ? 9.861   -11.926 -2.557  1.00 0.00 ? 212 ASP A C    3  
ATOM 3978  O O    . ASP A 1 34  ? 11.012  -11.493 -2.621  1.00 0.00 ? 212 ASP A O    3  
ATOM 3979  C CB   . ASP A 1 34  ? 9.879   -14.307 -1.788  1.00 0.00 ? 212 ASP A CB   3  
ATOM 3980  C CG   . ASP A 1 34  ? 11.112  -14.340 -2.669  1.00 0.00 ? 212 ASP A CG   3  
ATOM 3981  O OD1  . ASP A 1 34  ? 10.970  -14.162 -3.897  1.00 0.00 ? 212 ASP A OD1  3  
ATOM 3982  O OD2  . ASP A 1 34  ? 12.220  -14.544 -2.131  1.00 0.00 ? 212 ASP A OD2  3  
ATOM 3983  H H    . ASP A 1 34  ? 7.465   -13.625 -1.403  1.00 0.00 ? 212 ASP A H    3  
ATOM 3984  H HA   . ASP A 1 34  ? 9.934   -12.580 -0.527  1.00 0.00 ? 212 ASP A HA   3  
ATOM 3985  H HB2  . ASP A 1 34  ? 10.097  -14.842 -0.875  1.00 0.00 ? 212 ASP A HB2  3  
ATOM 3986  H HB3  . ASP A 1 34  ? 9.073   -14.804 -2.308  1.00 0.00 ? 212 ASP A HB3  3  
ATOM 3987  N N    . HIS A 1 35  ? 8.916   -11.603 -3.434  1.00 0.00 ? 213 HIS A N    3  
ATOM 3988  C CA   . HIS A 1 35  ? 9.183   -10.699 -4.547  1.00 0.00 ? 213 HIS A CA   3  
ATOM 3989  C C    . HIS A 1 35  ? 8.794   -9.267  -4.189  1.00 0.00 ? 213 HIS A C    3  
ATOM 3990  O O    . HIS A 1 35  ? 9.491   -8.317  -4.545  1.00 0.00 ? 213 HIS A O    3  
ATOM 3991  C CB   . HIS A 1 35  ? 8.420   -11.151 -5.792  1.00 0.00 ? 213 HIS A CB   3  
ATOM 3992  C CG   . HIS A 1 35  ? 9.164   -12.154 -6.619  1.00 0.00 ? 213 HIS A CG   3  
ATOM 3993  N ND1  . HIS A 1 35  ? 10.068  -11.800 -7.598  1.00 0.00 ? 213 HIS A ND1  3  
ATOM 3994  C CD2  . HIS A 1 35  ? 9.135   -13.507 -6.607  1.00 0.00 ? 213 HIS A CD2  3  
ATOM 3995  C CE1  . HIS A 1 35  ? 10.562  -12.892 -8.154  1.00 0.00 ? 213 HIS A CE1  3  
ATOM 3996  N NE2  . HIS A 1 35  ? 10.012  -13.942 -7.570  1.00 0.00 ? 213 HIS A NE2  3  
ATOM 3997  H H    . HIS A 1 35  ? 8.018   -11.980 -3.329  1.00 0.00 ? 213 HIS A H    3  
ATOM 3998  H HA   . HIS A 1 35  ? 10.242  -10.730 -4.753  1.00 0.00 ? 213 HIS A HA   3  
ATOM 3999  H HB2  . HIS A 1 35  ? 7.485   -11.598 -5.491  1.00 0.00 ? 213 HIS A HB2  3  
ATOM 4000  H HB3  . HIS A 1 35  ? 8.218   -10.291 -6.415  1.00 0.00 ? 213 HIS A HB3  3  
ATOM 4001  H HD1  . HIS A 1 35  ? 10.311  -10.885 -7.849  1.00 0.00 ? 213 HIS A HD1  3  
ATOM 4002  H HD2  . HIS A 1 35  ? 8.533   -14.130 -5.960  1.00 0.00 ? 213 HIS A HD2  3  
ATOM 4003  H HE1  . HIS A 1 35  ? 11.291  -12.923 -8.949  1.00 0.00 ? 213 HIS A HE1  3  
ATOM 4004  H HE2  . HIS A 1 35  ? 10.137  -14.873 -7.848  1.00 0.00 ? 213 HIS A HE2  3  
ATOM 4005  N N    . GLY A 1 36  ? 7.676   -9.121  -3.484  1.00 0.00 ? 214 GLY A N    3  
ATOM 4006  C CA   . GLY A 1 36  ? 7.214   -7.802  -3.092  1.00 0.00 ? 214 GLY A CA   3  
ATOM 4007  C C    . GLY A 1 36  ? 6.370   -7.835  -1.833  1.00 0.00 ? 214 GLY A C    3  
ATOM 4008  O O    . GLY A 1 36  ? 6.441   -8.786  -1.054  1.00 0.00 ? 214 GLY A O    3  
ATOM 4009  H H    . GLY A 1 36  ? 7.161   -9.915  -3.229  1.00 0.00 ? 214 GLY A H    3  
ATOM 4010  H HA2  . GLY A 1 36  ? 8.072   -7.168  -2.922  1.00 0.00 ? 214 GLY A HA2  3  
ATOM 4011  H HA3  . GLY A 1 36  ? 6.625   -7.386  -3.895  1.00 0.00 ? 214 GLY A HA3  3  
ATOM 4012  N N    . TYR A 1 37  ? 5.571   -6.793  -1.632  1.00 0.00 ? 215 TYR A N    3  
ATOM 4013  C CA   . TYR A 1 37  ? 4.713   -6.704  -0.456  1.00 0.00 ? 215 TYR A CA   3  
ATOM 4014  C C    . TYR A 1 37  ? 3.300   -6.281  -0.844  1.00 0.00 ? 215 TYR A C    3  
ATOM 4015  O O    . TYR A 1 37  ? 3.110   -5.331  -1.606  1.00 0.00 ? 215 TYR A O    3  
ATOM 4016  C CB   . TYR A 1 37  ? 5.295   -5.712  0.552   1.00 0.00 ? 215 TYR A CB   3  
ATOM 4017  C CG   . TYR A 1 37  ? 6.532   -6.221  1.258   1.00 0.00 ? 215 TYR A CG   3  
ATOM 4018  C CD1  . TYR A 1 37  ? 6.456   -7.275  2.160   1.00 0.00 ? 215 TYR A CD1  3  
ATOM 4019  C CD2  . TYR A 1 37  ? 7.776   -5.649  1.023   1.00 0.00 ? 215 TYR A CD2  3  
ATOM 4020  C CE1  . TYR A 1 37  ? 7.583   -7.744  2.808   1.00 0.00 ? 215 TYR A CE1  3  
ATOM 4021  C CE2  . TYR A 1 37  ? 8.908   -6.111  1.665   1.00 0.00 ? 215 TYR A CE2  3  
ATOM 4022  C CZ   . TYR A 1 37  ? 8.806   -7.159  2.556   1.00 0.00 ? 215 TYR A CZ   3  
ATOM 4023  O OH   . TYR A 1 37  ? 9.932   -7.622  3.199   1.00 0.00 ? 215 TYR A OH   3  
ATOM 4024  H H    . TYR A 1 37  ? 5.559   -6.065  -2.288  1.00 0.00 ? 215 TYR A H    3  
ATOM 4025  H HA   . TYR A 1 37  ? 4.672   -7.682  -0.001  1.00 0.00 ? 215 TYR A HA   3  
ATOM 4026  H HB2  . TYR A 1 37  ? 5.559   -4.800  0.039   1.00 0.00 ? 215 TYR A HB2  3  
ATOM 4027  H HB3  . TYR A 1 37  ? 4.551   -5.494  1.304   1.00 0.00 ? 215 TYR A HB3  3  
ATOM 4028  H HD1  . TYR A 1 37  ? 5.496   -7.731  2.355   1.00 0.00 ? 215 TYR A HD1  3  
ATOM 4029  H HD2  . TYR A 1 37  ? 7.852   -4.828  0.325   1.00 0.00 ? 215 TYR A HD2  3  
ATOM 4030  H HE1  . TYR A 1 37  ? 7.504   -8.564  3.506   1.00 0.00 ? 215 TYR A HE1  3  
ATOM 4031  H HE2  . TYR A 1 37  ? 9.866   -5.653  1.469   1.00 0.00 ? 215 TYR A HE2  3  
ATOM 4032  H HH   . TYR A 1 37  ? 9.696   -8.362  3.764   1.00 0.00 ? 215 TYR A HH   3  
ATOM 4033  N N    . LEU A 1 38  ? 2.310   -6.992  -0.315  1.00 0.00 ? 216 LEU A N    3  
ATOM 4034  C CA   . LEU A 1 38  ? 0.912   -6.691  -0.604  1.00 0.00 ? 216 LEU A CA   3  
ATOM 4035  C C    . LEU A 1 38  ? 0.379   -5.619  0.341   1.00 0.00 ? 216 LEU A C    3  
ATOM 4036  O O    . LEU A 1 38  ? 0.454   -5.760  1.562   1.00 0.00 ? 216 LEU A O    3  
ATOM 4037  C CB   . LEU A 1 38  ? 0.063   -7.958  -0.488  1.00 0.00 ? 216 LEU A CB   3  
ATOM 4038  C CG   . LEU A 1 38  ? -0.048  -8.810  -1.752  1.00 0.00 ? 216 LEU A CG   3  
ATOM 4039  C CD1  . LEU A 1 38  ? -0.988  -8.158  -2.754  1.00 0.00 ? 216 LEU A CD1  3  
ATOM 4040  C CD2  . LEU A 1 38  ? 1.325   -9.029  -2.371  1.00 0.00 ? 216 LEU A CD2  3  
ATOM 4041  H H    . LEU A 1 38  ? 2.524   -7.737  0.285   1.00 0.00 ? 216 LEU A H    3  
ATOM 4042  H HA   . LEU A 1 38  ? 0.856   -6.322  -1.617  1.00 0.00 ? 216 LEU A HA   3  
ATOM 4043  H HB2  . LEU A 1 38  ? 0.492   -8.573  0.289   1.00 0.00 ? 216 LEU A HB2  3  
ATOM 4044  H HB3  . LEU A 1 38  ? -0.935  -7.661  -0.199  1.00 0.00 ? 216 LEU A HB3  3  
ATOM 4045  H HG   . LEU A 1 38  ? -0.457  -9.777  -1.493  1.00 0.00 ? 216 LEU A HG   3  
ATOM 4046  H HD11 . LEU A 1 38  ? -0.585  -7.204  -3.057  1.00 0.00 ? 216 LEU A HD11 3  
ATOM 4047  H HD12 . LEU A 1 38  ? -1.956  -8.012  -2.297  1.00 0.00 ? 216 LEU A HD12 3  
ATOM 4048  H HD13 . LEU A 1 38  ? -1.092  -8.797  -3.619  1.00 0.00 ? 216 LEU A HD13 3  
ATOM 4049  H HD21 . LEU A 1 38  ? 1.213   -9.491  -3.340  1.00 0.00 ? 216 LEU A HD21 3  
ATOM 4050  H HD22 . LEU A 1 38  ? 1.910   -9.673  -1.730  1.00 0.00 ? 216 LEU A HD22 3  
ATOM 4051  H HD23 . LEU A 1 38  ? 1.826   -8.078  -2.480  1.00 0.00 ? 216 LEU A HD23 3  
ATOM 4052  N N    . VAL A 1 39  ? -0.162  -4.549  -0.232  1.00 0.00 ? 217 VAL A N    3  
ATOM 4053  C CA   . VAL A 1 39  ? -0.711  -3.454  0.559   1.00 0.00 ? 217 VAL A CA   3  
ATOM 4054  C C    . VAL A 1 39  ? -2.226  -3.375  0.411   1.00 0.00 ? 217 VAL A C    3  
ATOM 4055  O O    . VAL A 1 39  ? -2.755  -3.428  -0.700  1.00 0.00 ? 217 VAL A O    3  
ATOM 4056  C CB   . VAL A 1 39  ? -0.095  -2.102  0.151   1.00 0.00 ? 217 VAL A CB   3  
ATOM 4057  C CG1  . VAL A 1 39  ? -0.598  -0.991  1.060   1.00 0.00 ? 217 VAL A CG1  3  
ATOM 4058  C CG2  . VAL A 1 39  ? 1.424   -2.180  0.179   1.00 0.00 ? 217 VAL A CG2  3  
ATOM 4059  H H    . VAL A 1 39  ? -0.193  -4.494  -1.210  1.00 0.00 ? 217 VAL A H    3  
ATOM 4060  H HA   . VAL A 1 39  ? -0.470  -3.637  1.596   1.00 0.00 ? 217 VAL A HA   3  
ATOM 4061  H HB   . VAL A 1 39  ? -0.405  -1.879  -0.859  1.00 0.00 ? 217 VAL A HB   3  
ATOM 4062  H HG11 . VAL A 1 39  ? -0.523  -1.307  2.090   1.00 0.00 ? 217 VAL A HG11 3  
ATOM 4063  H HG12 . VAL A 1 39  ? 0.002   -0.104  0.910   1.00 0.00 ? 217 VAL A HG12 3  
ATOM 4064  H HG13 . VAL A 1 39  ? -1.629  -0.772  0.824   1.00 0.00 ? 217 VAL A HG13 3  
ATOM 4065  H HG21 . VAL A 1 39  ? 1.819   -1.304  0.671   1.00 0.00 ? 217 VAL A HG21 3  
ATOM 4066  H HG22 . VAL A 1 39  ? 1.730   -3.064  0.719   1.00 0.00 ? 217 VAL A HG22 3  
ATOM 4067  H HG23 . VAL A 1 39  ? 1.801   -2.226  -0.832  1.00 0.00 ? 217 VAL A HG23 3  
ATOM 4068  N N    . ASP A 1 40  ? -2.920  -3.248  1.536   1.00 0.00 ? 218 ASP A N    3  
ATOM 4069  C CA   . ASP A 1 40  ? -4.376  -3.160  1.532   1.00 0.00 ? 218 ASP A CA   3  
ATOM 4070  C C    . ASP A 1 40  ? -4.833  -1.731  1.253   1.00 0.00 ? 218 ASP A C    3  
ATOM 4071  O O    . ASP A 1 40  ? -4.276  -0.775  1.792   1.00 0.00 ? 218 ASP A O    3  
ATOM 4072  C CB   . ASP A 1 40  ? -4.940  -3.637  2.871   1.00 0.00 ? 218 ASP A CB   3  
ATOM 4073  C CG   . ASP A 1 40  ? -6.325  -4.239  2.734   1.00 0.00 ? 218 ASP A CG   3  
ATOM 4074  O OD1  . ASP A 1 40  ? -7.294  -3.468  2.572   1.00 0.00 ? 218 ASP A OD1  3  
ATOM 4075  O OD2  . ASP A 1 40  ? -6.439  -5.481  2.787   1.00 0.00 ? 218 ASP A OD2  3  
ATOM 4076  H H    . ASP A 1 40  ? -2.441  -3.211  2.391   1.00 0.00 ? 218 ASP A H    3  
ATOM 4077  H HA   . ASP A 1 40  ? -4.744  -3.802  0.747   1.00 0.00 ? 218 ASP A HA   3  
ATOM 4078  H HB2  . ASP A 1 40  ? -4.282  -4.386  3.286   1.00 0.00 ? 218 ASP A HB2  3  
ATOM 4079  H HB3  . ASP A 1 40  ? -4.998  -2.798  3.549   1.00 0.00 ? 218 ASP A HB3  3  
ATOM 4080  N N    . ILE A 1 41  ? -5.848  -1.595  0.407   1.00 0.00 ? 219 ILE A N    3  
ATOM 4081  C CA   . ILE A 1 41  ? -6.380  -0.284  0.056   1.00 0.00 ? 219 ILE A CA   3  
ATOM 4082  C C    . ILE A 1 41  ? -7.883  -0.217  0.301   1.00 0.00 ? 219 ILE A C    3  
ATOM 4083  O O    . ILE A 1 41  ? -8.426  0.844   0.606   1.00 0.00 ? 219 ILE A O    3  
ATOM 4084  C CB   . ILE A 1 41  ? -6.094  0.063   -1.417  1.00 0.00 ? 219 ILE A CB   3  
ATOM 4085  C CG1  . ILE A 1 41  ? -6.611  -1.046  -2.334  1.00 0.00 ? 219 ILE A CG1  3  
ATOM 4086  C CG2  . ILE A 1 41  ? -4.604  0.284   -1.630  1.00 0.00 ? 219 ILE A CG2  3  
ATOM 4087  C CD1  . ILE A 1 41  ? -6.456  -0.734  -3.806  1.00 0.00 ? 219 ILE A CD1  3  
ATOM 4088  H H    . ILE A 1 41  ? -6.250  -2.396  0.010   1.00 0.00 ? 219 ILE A H    3  
ATOM 4089  H HA   . ILE A 1 41  ? -5.891  0.451   0.680   1.00 0.00 ? 219 ILE A HA   3  
ATOM 4090  H HB   . ILE A 1 41  ? -6.607  0.984   -1.652  1.00 0.00 ? 219 ILE A HB   3  
ATOM 4091  H HG12 . ILE A 1 41  ? -6.069  -1.956  -2.130  1.00 0.00 ? 219 ILE A HG12 3  
ATOM 4092  H HG13 . ILE A 1 41  ? -7.662  -1.206  -2.137  1.00 0.00 ? 219 ILE A HG13 3  
ATOM 4093  H HG21 . ILE A 1 41  ? -4.122  -0.666  -1.808  1.00 0.00 ? 219 ILE A HG21 3  
ATOM 4094  H HG22 . ILE A 1 41  ? -4.454  0.927   -2.484  1.00 0.00 ? 219 ILE A HG22 3  
ATOM 4095  H HG23 . ILE A 1 41  ? -4.179  0.745   -0.751  1.00 0.00 ? 219 ILE A HG23 3  
ATOM 4096  H HD11 . ILE A 1 41  ? -5.413  -0.567  -4.031  1.00 0.00 ? 219 ILE A HD11 3  
ATOM 4097  H HD12 . ILE A 1 41  ? -6.823  -1.564  -4.392  1.00 0.00 ? 219 ILE A HD12 3  
ATOM 4098  H HD13 . ILE A 1 41  ? -7.022  0.154   -4.047  1.00 0.00 ? 219 ILE A HD13 3  
ATOM 4099  N N    . GLY A 1 42  ? -8.551  -1.359  0.166   1.00 0.00 ? 220 GLY A N    3  
ATOM 4100  C CA   . GLY A 1 42  ? -9.986  -1.409  0.378   1.00 0.00 ? 220 GLY A CA   3  
ATOM 4101  C C    . GLY A 1 42  ? -10.768 -1.015  -0.860  1.00 0.00 ? 220 GLY A C    3  
ATOM 4102  O O    . GLY A 1 42  ? -11.695 -0.208  -0.786  1.00 0.00 ? 220 GLY A O    3  
ATOM 4103  H H    . GLY A 1 42  ? -8.065  -2.174  -0.079  1.00 0.00 ? 220 GLY A H    3  
ATOM 4104  H HA2  . GLY A 1 42  ? -10.262 -2.413  0.662   1.00 0.00 ? 220 GLY A HA2  3  
ATOM 4105  H HA3  . GLY A 1 42  ? -10.243 -0.734  1.181   1.00 0.00 ? 220 GLY A HA3  3  
ATOM 4106  N N    . VAL A 1 43  ? -10.394 -1.585  -2.001  1.00 0.00 ? 221 VAL A N    3  
ATOM 4107  C CA   . VAL A 1 43  ? -11.067 -1.289  -3.260  1.00 0.00 ? 221 VAL A CA   3  
ATOM 4108  C C    . VAL A 1 43  ? -11.374 -2.567  -4.033  1.00 0.00 ? 221 VAL A C    3  
ATOM 4109  O O    . VAL A 1 43  ? -10.549 -3.479  -4.097  1.00 0.00 ? 221 VAL A O    3  
ATOM 4110  C CB   . VAL A 1 43  ? -10.218 -0.358  -4.145  1.00 0.00 ? 221 VAL A CB   3  
ATOM 4111  C CG1  . VAL A 1 43  ? -10.988 0.041   -5.394  1.00 0.00 ? 221 VAL A CG1  3  
ATOM 4112  C CG2  . VAL A 1 43  ? -9.784  0.871   -3.360  1.00 0.00 ? 221 VAL A CG2  3  
ATOM 4113  H H    . VAL A 1 43  ? -9.649  -2.221  -1.995  1.00 0.00 ? 221 VAL A H    3  
ATOM 4114  H HA   . VAL A 1 43  ? -11.996 -0.786  -3.032  1.00 0.00 ? 221 VAL A HA   3  
ATOM 4115  H HB   . VAL A 1 43  ? -9.332  -0.895  -4.451  1.00 0.00 ? 221 VAL A HB   3  
ATOM 4116  H HG11 . VAL A 1 43  ? -10.298 0.178   -6.214  1.00 0.00 ? 221 VAL A HG11 3  
ATOM 4117  H HG12 . VAL A 1 43  ? -11.697 -0.734  -5.643  1.00 0.00 ? 221 VAL A HG12 3  
ATOM 4118  H HG13 . VAL A 1 43  ? -11.516 0.966   -5.211  1.00 0.00 ? 221 VAL A HG13 3  
ATOM 4119  H HG21 . VAL A 1 43  ? -10.468 1.683   -3.558  1.00 0.00 ? 221 VAL A HG21 3  
ATOM 4120  H HG22 . VAL A 1 43  ? -9.789  0.645   -2.304  1.00 0.00 ? 221 VAL A HG22 3  
ATOM 4121  H HG23 . VAL A 1 43  ? -8.787  1.158   -3.662  1.00 0.00 ? 221 VAL A HG23 3  
ATOM 4122  N N    . ASP A 1 44  ? -12.564 -2.626  -4.619  1.00 0.00 ? 222 ASP A N    3  
ATOM 4123  C CA   . ASP A 1 44  ? -12.980 -3.792  -5.391  1.00 0.00 ? 222 ASP A CA   3  
ATOM 4124  C C    . ASP A 1 44  ? -12.565 -3.652  -6.852  1.00 0.00 ? 222 ASP A C    3  
ATOM 4125  O O    . ASP A 1 44  ? -13.115 -2.834  -7.589  1.00 0.00 ? 222 ASP A O    3  
ATOM 4126  C CB   . ASP A 1 44  ? -14.494 -3.981  -5.293  1.00 0.00 ? 222 ASP A CB   3  
ATOM 4127  C CG   . ASP A 1 44  ? -14.906 -5.434  -5.427  1.00 0.00 ? 222 ASP A CG   3  
ATOM 4128  O OD1  . ASP A 1 44  ? -14.264 -6.293  -4.788  1.00 0.00 ? 222 ASP A OD1  3  
ATOM 4129  O OD2  . ASP A 1 44  ? -15.869 -5.711  -6.172  1.00 0.00 ? 222 ASP A OD2  3  
ATOM 4130  H H    . ASP A 1 44  ? -13.178 -1.866  -4.532  1.00 0.00 ? 222 ASP A H    3  
ATOM 4131  H HA   . ASP A 1 44  ? -12.490 -4.658  -4.972  1.00 0.00 ? 222 ASP A HA   3  
ATOM 4132  H HB2  . ASP A 1 44  ? -14.835 -3.617  -4.335  1.00 0.00 ? 222 ASP A HB2  3  
ATOM 4133  H HB3  . ASP A 1 44  ? -14.972 -3.415  -6.079  1.00 0.00 ? 222 ASP A HB3  3  
ATOM 4134  N N    . GLY A 1 45  ? -11.590 -4.456  -7.265  1.00 0.00 ? 223 GLY A N    3  
ATOM 4135  C CA   . GLY A 1 45  ? -11.117 -4.406  -8.636  1.00 0.00 ? 223 GLY A CA   3  
ATOM 4136  C C    . GLY A 1 45  ? -9.822  -3.630  -8.775  1.00 0.00 ? 223 GLY A C    3  
ATOM 4137  O O    . GLY A 1 45  ? -9.617  -2.921  -9.761  1.00 0.00 ? 223 GLY A O    3  
ATOM 4138  H H    . GLY A 1 45  ? -11.188 -5.089  -6.633  1.00 0.00 ? 223 GLY A H    3  
ATOM 4139  H HA2  . GLY A 1 45  ? -10.960 -5.414  -8.989  1.00 0.00 ? 223 GLY A HA2  3  
ATOM 4140  H HA3  . GLY A 1 45  ? -11.873 -3.935  -9.248  1.00 0.00 ? 223 GLY A HA3  3  
ATOM 4141  N N    . THR A 1 46  ? -8.946  -3.763  -7.784  1.00 0.00 ? 224 THR A N    3  
ATOM 4142  C CA   . THR A 1 46  ? -7.665  -3.067  -7.799  1.00 0.00 ? 224 THR A CA   3  
ATOM 4143  C C    . THR A 1 46  ? -6.599  -3.862  -7.054  1.00 0.00 ? 224 THR A C    3  
ATOM 4144  O O    . THR A 1 46  ? -6.804  -4.274  -5.912  1.00 0.00 ? 224 THR A O    3  
ATOM 4145  C CB   . THR A 1 46  ? -7.780  -1.666  -7.167  1.00 0.00 ? 224 THR A CB   3  
ATOM 4146  O OG1  . THR A 1 46  ? -8.787  -0.905  -7.844  1.00 0.00 ? 224 THR A OG1  3  
ATOM 4147  C CG2  . THR A 1 46  ? -6.450  -0.931  -7.235  1.00 0.00 ? 224 THR A CG2  3  
ATOM 4148  H H    . THR A 1 46  ? -9.167  -4.343  -7.026  1.00 0.00 ? 224 THR A H    3  
ATOM 4149  H HA   . THR A 1 46  ? -7.360  -2.950  -8.829  1.00 0.00 ? 224 THR A HA   3  
ATOM 4150  H HB   . THR A 1 46  ? -8.061  -1.778  -6.130  1.00 0.00 ? 224 THR A HB   3  
ATOM 4151  H HG1  . THR A 1 46  ? -8.437  -0.581  -8.677  1.00 0.00 ? 224 THR A HG1  3  
ATOM 4152  H HG21 . THR A 1 46  ? -6.347  -0.292  -6.371  1.00 0.00 ? 224 THR A HG21 3  
ATOM 4153  H HG22 . THR A 1 46  ? -6.416  -0.332  -8.133  1.00 0.00 ? 224 THR A HG22 3  
ATOM 4154  H HG23 . THR A 1 46  ? -5.644  -1.649  -7.250  1.00 0.00 ? 224 THR A HG23 3  
ATOM 4155  N N    . ARG A 1 47  ? -5.461  -4.072  -7.707  1.00 0.00 ? 225 ARG A N    3  
ATOM 4156  C CA   . ARG A 1 47  ? -4.362  -4.819  -7.106  1.00 0.00 ? 225 ARG A CA   3  
ATOM 4157  C C    . ARG A 1 47  ? -3.148  -3.920  -6.890  1.00 0.00 ? 225 ARG A C    3  
ATOM 4158  O O    . ARG A 1 47  ? -2.675  -3.265  -7.818  1.00 0.00 ? 225 ARG A O    3  
ATOM 4159  C CB   . ARG A 1 47  ? -3.980  -6.006  -7.991  1.00 0.00 ? 225 ARG A CB   3  
ATOM 4160  C CG   . ARG A 1 47  ? -2.824  -6.827  -7.443  1.00 0.00 ? 225 ARG A CG   3  
ATOM 4161  C CD   . ARG A 1 47  ? -2.639  -8.120  -8.222  1.00 0.00 ? 225 ARG A CD   3  
ATOM 4162  N NE   . ARG A 1 47  ? -3.488  -9.193  -7.712  1.00 0.00 ? 225 ARG A NE   3  
ATOM 4163  C CZ   . ARG A 1 47  ? -3.302  -9.779  -6.534  1.00 0.00 ? 225 ARG A CZ   3  
ATOM 4164  N NH1  . ARG A 1 47  ? -2.303  -9.398  -5.750  1.00 0.00 ? 225 ARG A NH1  3  
ATOM 4165  N NH2  . ARG A 1 47  ? -4.116  -10.749 -6.139  1.00 0.00 ? 225 ARG A NH2  3  
ATOM 4166  H H    . ARG A 1 47  ? -5.358  -3.718  -8.615  1.00 0.00 ? 225 ARG A H    3  
ATOM 4167  H HA   . ARG A 1 47  ? -4.697  -5.188  -6.148  1.00 0.00 ? 225 ARG A HA   3  
ATOM 4168  H HB2  . ARG A 1 47  ? -4.837  -6.656  -8.092  1.00 0.00 ? 225 ARG A HB2  3  
ATOM 4169  H HB3  . ARG A 1 47  ? -3.700  -5.637  -8.966  1.00 0.00 ? 225 ARG A HB3  3  
ATOM 4170  H HG2  . ARG A 1 47  ? -1.917  -6.245  -7.512  1.00 0.00 ? 225 ARG A HG2  3  
ATOM 4171  H HG3  . ARG A 1 47  ? -3.023  -7.066  -6.408  1.00 0.00 ? 225 ARG A HG3  3  
ATOM 4172  H HD2  . ARG A 1 47  ? -2.889  -7.939  -9.257  1.00 0.00 ? 225 ARG A HD2  3  
ATOM 4173  H HD3  . ARG A 1 47  ? -1.606  -8.424  -8.149  1.00 0.00 ? 225 ARG A HD3  3  
ATOM 4174  H HE   . ARG A 1 47  ? -4.231  -9.491  -8.275  1.00 0.00 ? 225 ARG A HE   3  
ATOM 4175  H HH11 . ARG A 1 47  ? -1.689  -8.666  -6.045  1.00 0.00 ? 225 ARG A HH11 3  
ATOM 4176  H HH12 . ARG A 1 47  ? -2.166  -9.840  -4.863  1.00 0.00 ? 225 ARG A HH12 3  
ATOM 4177  H HH21 . ARG A 1 47  ? -4.870  -11.040 -6.727  1.00 0.00 ? 225 ARG A HH21 3  
ATOM 4178  H HH22 . ARG A 1 47  ? -3.976  -11.190 -5.253  1.00 0.00 ? 225 ARG A HH22 3  
ATOM 4179  N N    . ALA A 1 48  ? -2.650  -3.893  -5.658  1.00 0.00 ? 226 ALA A N    3  
ATOM 4180  C CA   . ALA A 1 48  ? -1.491  -3.076  -5.321  1.00 0.00 ? 226 ALA A CA   3  
ATOM 4181  C C    . ALA A 1 48  ? -0.303  -3.946  -4.923  1.00 0.00 ? 226 ALA A C    3  
ATOM 4182  O O    . ALA A 1 48  ? -0.418  -4.813  -4.056  1.00 0.00 ? 226 ALA A O    3  
ATOM 4183  C CB   . ALA A 1 48  ? -1.836  -2.107  -4.200  1.00 0.00 ? 226 ALA A CB   3  
ATOM 4184  H H    . ALA A 1 48  ? -3.071  -4.437  -4.960  1.00 0.00 ? 226 ALA A H    3  
ATOM 4185  H HA   . ALA A 1 48  ? -1.224  -2.498  -6.194  1.00 0.00 ? 226 ALA A HA   3  
ATOM 4186  H HB1  . ALA A 1 48  ? -1.285  -2.376  -3.310  1.00 0.00 ? 226 ALA A HB1  3  
ATOM 4187  H HB2  . ALA A 1 48  ? -1.573  -1.104  -4.498  1.00 0.00 ? 226 ALA A HB2  3  
ATOM 4188  H HB3  . ALA A 1 48  ? -2.895  -2.157  -3.995  1.00 0.00 ? 226 ALA A HB3  3  
ATOM 4189  N N    . PHE A 1 49  ? 0.838   -3.711  -5.563  1.00 0.00 ? 227 PHE A N    3  
ATOM 4190  C CA   . PHE A 1 49  ? 2.047   -4.474  -5.277  1.00 0.00 ? 227 PHE A CA   3  
ATOM 4191  C C    . PHE A 1 49  ? 3.244   -3.547  -5.090  1.00 0.00 ? 227 PHE A C    3  
ATOM 4192  O O    . PHE A 1 49  ? 3.538   -2.713  -5.948  1.00 0.00 ? 227 PHE A O    3  
ATOM 4193  C CB   . PHE A 1 49  ? 2.327   -5.467  -6.407  1.00 0.00 ? 227 PHE A CB   3  
ATOM 4194  C CG   . PHE A 1 49  ? 3.700   -6.074  -6.344  1.00 0.00 ? 227 PHE A CG   3  
ATOM 4195  C CD1  . PHE A 1 49  ? 4.788   -5.418  -6.897  1.00 0.00 ? 227 PHE A CD1  3  
ATOM 4196  C CD2  . PHE A 1 49  ? 3.902   -7.300  -5.731  1.00 0.00 ? 227 PHE A CD2  3  
ATOM 4197  C CE1  . PHE A 1 49  ? 6.051   -5.975  -6.842  1.00 0.00 ? 227 PHE A CE1  3  
ATOM 4198  C CE2  . PHE A 1 49  ? 5.164   -7.862  -5.672  1.00 0.00 ? 227 PHE A CE2  3  
ATOM 4199  C CZ   . PHE A 1 49  ? 6.240   -7.198  -6.227  1.00 0.00 ? 227 PHE A CZ   3  
ATOM 4200  H H    . PHE A 1 49  ? 0.867   -3.006  -6.244  1.00 0.00 ? 227 PHE A H    3  
ATOM 4201  H HA   . PHE A 1 49  ? 1.884   -5.021  -4.361  1.00 0.00 ? 227 PHE A HA   3  
ATOM 4202  H HB2  . PHE A 1 49  ? 1.608   -6.270  -6.357  1.00 0.00 ? 227 PHE A HB2  3  
ATOM 4203  H HB3  . PHE A 1 49  ? 2.230   -4.960  -7.354  1.00 0.00 ? 227 PHE A HB3  3  
ATOM 4204  H HD1  . PHE A 1 49  ? 4.642   -4.462  -7.377  1.00 0.00 ? 227 PHE A HD1  3  
ATOM 4205  H HD2  . PHE A 1 49  ? 3.061   -7.821  -5.296  1.00 0.00 ? 227 PHE A HD2  3  
ATOM 4206  H HE1  . PHE A 1 49  ? 6.891   -5.454  -7.277  1.00 0.00 ? 227 PHE A HE1  3  
ATOM 4207  H HE2  . PHE A 1 49  ? 5.308   -8.818  -5.191  1.00 0.00 ? 227 PHE A HE2  3  
ATOM 4208  H HZ   . PHE A 1 49  ? 7.226   -7.635  -6.183  1.00 0.00 ? 227 PHE A HZ   3  
ATOM 4209  N N    . LEU A 1 50  ? 3.932   -3.698  -3.964  1.00 0.00 ? 228 LEU A N    3  
ATOM 4210  C CA   . LEU A 1 50  ? 5.098   -2.875  -3.662  1.00 0.00 ? 228 LEU A CA   3  
ATOM 4211  C C    . LEU A 1 50  ? 6.387   -3.667  -3.850  1.00 0.00 ? 228 LEU A C    3  
ATOM 4212  O O    . LEU A 1 50  ? 6.540   -4.780  -3.346  1.00 0.00 ? 228 LEU A O    3  
ATOM 4213  C CB   . LEU A 1 50  ? 5.016   -2.344  -2.230  1.00 0.00 ? 228 LEU A CB   3  
ATOM 4214  C CG   . LEU A 1 50  ? 5.961   -1.193  -1.886  1.00 0.00 ? 228 LEU A CG   3  
ATOM 4215  C CD1  . LEU A 1 50  ? 5.552   0.073   -2.622  1.00 0.00 ? 228 LEU A CD1  3  
ATOM 4216  C CD2  . LEU A 1 50  ? 5.985   -0.954  -0.383  1.00 0.00 ? 228 LEU A CD2  3  
ATOM 4217  H H    . LEU A 1 50  ? 3.650   -4.379  -3.319  1.00 0.00 ? 228 LEU A H    3  
ATOM 4218  H HA   . LEU A 1 50  ? 5.100   -2.040  -4.348  1.00 0.00 ? 228 LEU A HA   3  
ATOM 4219  H HB2  . LEU A 1 50  ? 4.006   -2.004  -2.061  1.00 0.00 ? 228 LEU A HB2  3  
ATOM 4220  H HB3  . LEU A 1 50  ? 5.234   -3.165  -1.561  1.00 0.00 ? 228 LEU A HB3  3  
ATOM 4221  H HG   . LEU A 1 50  ? 6.963   -1.452  -2.200  1.00 0.00 ? 228 LEU A HG   3  
ATOM 4222  H HD11 . LEU A 1 50  ? 5.008   0.720   -1.950  1.00 0.00 ? 228 LEU A HD11 3  
ATOM 4223  H HD12 . LEU A 1 50  ? 4.922   -0.186  -3.461  1.00 0.00 ? 228 LEU A HD12 3  
ATOM 4224  H HD13 . LEU A 1 50  ? 6.435   0.583   -2.979  1.00 0.00 ? 228 LEU A HD13 3  
ATOM 4225  H HD21 . LEU A 1 50  ? 6.989   -0.698  -0.076  1.00 0.00 ? 228 LEU A HD21 3  
ATOM 4226  H HD22 . LEU A 1 50  ? 5.671   -1.852  0.129   1.00 0.00 ? 228 LEU A HD22 3  
ATOM 4227  H HD23 . LEU A 1 50  ? 5.315   -0.144  -0.136  1.00 0.00 ? 228 LEU A HD23 3  
ATOM 4228  N N    . PRO A 1 51  ? 7.340   -3.082  -4.591  1.00 0.00 ? 229 PRO A N    3  
ATOM 4229  C CA   . PRO A 1 51  ? 8.634   -3.715  -4.860  1.00 0.00 ? 229 PRO A CA   3  
ATOM 4230  C C    . PRO A 1 51  ? 9.512   -3.791  -3.616  1.00 0.00 ? 229 PRO A C    3  
ATOM 4231  O O    . PRO A 1 51  ? 9.515   -2.877  -2.789  1.00 0.00 ? 229 PRO A O    3  
ATOM 4232  C CB   . PRO A 1 51  ? 9.268   -2.795  -5.907  1.00 0.00 ? 229 PRO A CB   3  
ATOM 4233  C CG   . PRO A 1 51  ? 8.629   -1.468  -5.682  1.00 0.00 ? 229 PRO A CG   3  
ATOM 4234  C CD   . PRO A 1 51  ? 7.226   -1.757  -5.224  1.00 0.00 ? 229 PRO A CD   3  
ATOM 4235  H HA   . PRO A 1 51  ? 8.513   -4.705  -5.275  1.00 0.00 ? 229 PRO A HA   3  
ATOM 4236  H HB2  . PRO A 1 51  ? 10.337  -2.751  -5.750  1.00 0.00 ? 229 PRO A HB2  3  
ATOM 4237  H HB3  . PRO A 1 51  ? 9.059   -3.171  -6.896  1.00 0.00 ? 229 PRO A HB3  3  
ATOM 4238  H HG2  . PRO A 1 51  ? 9.168   -0.925  -4.920  1.00 0.00 ? 229 PRO A HG2  3  
ATOM 4239  H HG3  . PRO A 1 51  ? 8.613   -0.907  -6.605  1.00 0.00 ? 229 PRO A HG3  3  
ATOM 4240  H HD2  . PRO A 1 51  ? 6.902   -1.015  -4.509  1.00 0.00 ? 229 PRO A HD2  3  
ATOM 4241  H HD3  . PRO A 1 51  ? 6.553   -1.790  -6.067  1.00 0.00 ? 229 PRO A HD3  3  
ATOM 4242  N N    . LEU A 1 52  ? 10.256  -4.884  -3.488  1.00 0.00 ? 230 LEU A N    3  
ATOM 4243  C CA   . LEU A 1 52  ? 11.140  -5.078  -2.343  1.00 0.00 ? 230 LEU A CA   3  
ATOM 4244  C C    . LEU A 1 52  ? 12.233  -4.015  -2.312  1.00 0.00 ? 230 LEU A C    3  
ATOM 4245  O O    . LEU A 1 52  ? 12.725  -3.646  -1.245  1.00 0.00 ? 230 LEU A O    3  
ATOM 4246  C CB   . LEU A 1 52  ? 11.769  -6.472  -2.391  1.00 0.00 ? 230 LEU A CB   3  
ATOM 4247  C CG   . LEU A 1 52  ? 10.892  -7.621  -1.894  1.00 0.00 ? 230 LEU A CG   3  
ATOM 4248  C CD1  . LEU A 1 52  ? 11.561  -8.960  -2.167  1.00 0.00 ? 230 LEU A CD1  3  
ATOM 4249  C CD2  . LEU A 1 52  ? 10.598  -7.464  -0.409  1.00 0.00 ? 230 LEU A CD2  3  
ATOM 4250  H H    . LEU A 1 52  ? 10.211  -5.576  -4.179  1.00 0.00 ? 230 LEU A H    3  
ATOM 4251  H HA   . LEU A 1 52  ? 10.544  -4.991  -1.447  1.00 0.00 ? 230 LEU A HA   3  
ATOM 4252  H HB2  . LEU A 1 52  ? 12.035  -6.679  -3.416  1.00 0.00 ? 230 LEU A HB2  3  
ATOM 4253  H HB3  . LEU A 1 52  ? 12.664  -6.450  -1.785  1.00 0.00 ? 230 LEU A HB3  3  
ATOM 4254  H HG   . LEU A 1 52  ? 9.951   -7.604  -2.426  1.00 0.00 ? 230 LEU A HG   3  
ATOM 4255  H HD11 . LEU A 1 52  ? 12.630  -8.824  -2.217  1.00 0.00 ? 230 LEU A HD11 3  
ATOM 4256  H HD12 . LEU A 1 52  ? 11.204  -9.355  -3.107  1.00 0.00 ? 230 LEU A HD12 3  
ATOM 4257  H HD13 . LEU A 1 52  ? 11.321  -9.651  -1.373  1.00 0.00 ? 230 LEU A HD13 3  
ATOM 4258  H HD21 . LEU A 1 52  ? 11.218  -8.146  0.154   1.00 0.00 ? 230 LEU A HD21 3  
ATOM 4259  H HD22 . LEU A 1 52  ? 9.557   -7.686  -0.223  1.00 0.00 ? 230 LEU A HD22 3  
ATOM 4260  H HD23 . LEU A 1 52  ? 10.810  -6.450  -0.106  1.00 0.00 ? 230 LEU A HD23 3  
ATOM 4261  N N    . LEU A 1 53  ? 12.607  -3.524  -3.488  1.00 0.00 ? 231 LEU A N    3  
ATOM 4262  C CA   . LEU A 1 53  ? 13.641  -2.500  -3.597  1.00 0.00 ? 231 LEU A CA   3  
ATOM 4263  C C    . LEU A 1 53  ? 13.213  -1.218  -2.890  1.00 0.00 ? 231 LEU A C    3  
ATOM 4264  O O    . LEU A 1 53  ? 13.991  -0.614  -2.151  1.00 0.00 ? 231 LEU A O    3  
ATOM 4265  C CB   . LEU A 1 53  ? 13.945  -2.209  -5.067  1.00 0.00 ? 231 LEU A CB   3  
ATOM 4266  C CG   . LEU A 1 53  ? 14.097  -3.429  -5.976  1.00 0.00 ? 231 LEU A CG   3  
ATOM 4267  C CD1  . LEU A 1 53  ? 14.209  -3.000  -7.431  1.00 0.00 ? 231 LEU A CD1  3  
ATOM 4268  C CD2  . LEU A 1 53  ? 15.310  -4.251  -5.566  1.00 0.00 ? 231 LEU A CD2  3  
ATOM 4269  H H    . LEU A 1 53  ? 12.178  -3.857  -4.304  1.00 0.00 ? 231 LEU A H    3  
ATOM 4270  H HA   . LEU A 1 53  ? 14.533  -2.879  -3.121  1.00 0.00 ? 231 LEU A HA   3  
ATOM 4271  H HB2  . LEU A 1 53  ? 13.142  -1.604  -5.457  1.00 0.00 ? 231 LEU A HB2  3  
ATOM 4272  H HB3  . LEU A 1 53  ? 14.868  -1.648  -5.107  1.00 0.00 ? 231 LEU A HB3  3  
ATOM 4273  H HG   . LEU A 1 53  ? 13.220  -4.053  -5.879  1.00 0.00 ? 231 LEU A HG   3  
ATOM 4274  H HD11 . LEU A 1 53  ? 13.806  -3.775  -8.066  1.00 0.00 ? 231 LEU A HD11 3  
ATOM 4275  H HD12 . LEU A 1 53  ? 15.246  -2.834  -7.679  1.00 0.00 ? 231 LEU A HD12 3  
ATOM 4276  H HD13 . LEU A 1 53  ? 13.652  -2.086  -7.580  1.00 0.00 ? 231 LEU A HD13 3  
ATOM 4277  H HD21 . LEU A 1 53  ? 15.929  -4.434  -6.432  1.00 0.00 ? 231 LEU A HD21 3  
ATOM 4278  H HD22 . LEU A 1 53  ? 14.982  -5.194  -5.152  1.00 0.00 ? 231 LEU A HD22 3  
ATOM 4279  H HD23 . LEU A 1 53  ? 15.878  -3.710  -4.824  1.00 0.00 ? 231 LEU A HD23 3  
ATOM 4280  N N    . LYS A 1 54  ? 11.970  -0.808  -3.120  1.00 0.00 ? 232 LYS A N    3  
ATOM 4281  C CA   . LYS A 1 54  ? 11.436  0.401   -2.503  1.00 0.00 ? 232 LYS A CA   3  
ATOM 4282  C C    . LYS A 1 54  ? 10.995  0.130   -1.068  1.00 0.00 ? 232 LYS A C    3  
ATOM 4283  O O    . LYS A 1 54  ? 11.241  0.935   -0.171  1.00 0.00 ? 232 LYS A O    3  
ATOM 4284  C CB   . LYS A 1 54  ? 10.257  0.936   -3.318  1.00 0.00 ? 232 LYS A CB   3  
ATOM 4285  C CG   . LYS A 1 54  ? 10.128  2.449   -3.281  1.00 0.00 ? 232 LYS A CG   3  
ATOM 4286  C CD   . LYS A 1 54  ? 9.886   2.952   -1.867  1.00 0.00 ? 232 LYS A CD   3  
ATOM 4287  C CE   . LYS A 1 54  ? 9.562   4.438   -1.853  1.00 0.00 ? 232 LYS A CE   3  
ATOM 4288  N NZ   . LYS A 1 54  ? 10.790  5.275   -1.940  1.00 0.00 ? 232 LYS A NZ   3  
ATOM 4289  H H    . LYS A 1 54  ? 11.397  -1.332  -3.719  1.00 0.00 ? 232 LYS A H    3  
ATOM 4290  H HA   . LYS A 1 54  ? 12.221  1.142   -2.492  1.00 0.00 ? 232 LYS A HA   3  
ATOM 4291  H HB2  . LYS A 1 54  ? 10.379  0.631   -4.347  1.00 0.00 ? 232 LYS A HB2  3  
ATOM 4292  H HB3  . LYS A 1 54  ? 9.344   0.508   -2.931  1.00 0.00 ? 232 LYS A HB3  3  
ATOM 4293  H HG2  . LYS A 1 54  ? 11.040  2.888   -3.657  1.00 0.00 ? 232 LYS A HG2  3  
ATOM 4294  H HG3  . LYS A 1 54  ? 9.298   2.746   -3.906  1.00 0.00 ? 232 LYS A HG3  3  
ATOM 4295  H HD2  . LYS A 1 54  ? 9.057   2.410   -1.438  1.00 0.00 ? 232 LYS A HD2  3  
ATOM 4296  H HD3  . LYS A 1 54  ? 10.775  2.781   -1.277  1.00 0.00 ? 232 LYS A HD3  3  
ATOM 4297  H HE2  . LYS A 1 54  ? 8.924   4.662   -2.695  1.00 0.00 ? 232 LYS A HE2  3  
ATOM 4298  H HE3  . LYS A 1 54  ? 9.042   4.671   -0.936  1.00 0.00 ? 232 LYS A HE3  3  
ATOM 4299  H HZ1  . LYS A 1 54  ? 10.554  6.274   -1.774  1.00 0.00 ? 232 LYS A HZ1  3  
ATOM 4300  H HZ2  . LYS A 1 54  ? 11.218  5.185   -2.884  1.00 0.00 ? 232 LYS A HZ2  3  
ATOM 4301  H HZ3  . LYS A 1 54  ? 11.482  4.970   -1.227  1.00 0.00 ? 232 LYS A HZ3  3  
ATOM 4302  N N    . ALA A 1 55  ? 10.343  -1.009  -0.859  1.00 0.00 ? 233 ALA A N    3  
ATOM 4303  C CA   . ALA A 1 55  ? 9.871   -1.387  0.467   1.00 0.00 ? 233 ALA A CA   3  
ATOM 4304  C C    . ALA A 1 55  ? 11.038  -1.588  1.428   1.00 0.00 ? 233 ALA A C    3  
ATOM 4305  O O    . ALA A 1 55  ? 10.974  -1.184  2.589   1.00 0.00 ? 233 ALA A O    3  
ATOM 4306  C CB   . ALA A 1 55  ? 9.027   -2.651  0.386   1.00 0.00 ? 233 ALA A CB   3  
ATOM 4307  H H    . ALA A 1 55  ? 10.178  -1.611  -1.615  1.00 0.00 ? 233 ALA A H    3  
ATOM 4308  H HA   . ALA A 1 55  ? 9.245   -0.589  0.838   1.00 0.00 ? 233 ALA A HA   3  
ATOM 4309  H HB1  . ALA A 1 55  ? 8.913   -2.941  -0.648  1.00 0.00 ? 233 ALA A HB1  3  
ATOM 4310  H HB2  . ALA A 1 55  ? 9.515   -3.445  0.932   1.00 0.00 ? 233 ALA A HB2  3  
ATOM 4311  H HB3  . ALA A 1 55  ? 8.056   -2.462  0.817   1.00 0.00 ? 233 ALA A HB3  3  
ATOM 4312  N N    . GLN A 1 56  ? 12.102  -2.216  0.937   1.00 0.00 ? 234 GLN A N    3  
ATOM 4313  C CA   . GLN A 1 56  ? 13.282  -2.471  1.754   1.00 0.00 ? 234 GLN A CA   3  
ATOM 4314  C C    . GLN A 1 56  ? 13.869  -1.167  2.286   1.00 0.00 ? 234 GLN A C    3  
ATOM 4315  O O    . GLN A 1 56  ? 14.459  -1.137  3.365   1.00 0.00 ? 234 GLN A O    3  
ATOM 4316  C CB   . GLN A 1 56  ? 14.337  -3.225  0.943   1.00 0.00 ? 234 GLN A CB   3  
ATOM 4317  C CG   . GLN A 1 56  ? 15.573  -3.596  1.747   1.00 0.00 ? 234 GLN A CG   3  
ATOM 4318  C CD   . GLN A 1 56  ? 16.682  -4.162  0.883   1.00 0.00 ? 234 GLN A CD   3  
ATOM 4319  O OE1  . GLN A 1 56  ? 16.442  -5.004  0.017   1.00 0.00 ? 234 GLN A OE1  3  
ATOM 4320  N NE2  . GLN A 1 56  ? 17.907  -3.703  1.115   1.00 0.00 ? 234 GLN A NE2  3  
ATOM 4321  H H    . GLN A 1 56  ? 12.093  -2.514  0.004   1.00 0.00 ? 234 GLN A H    3  
ATOM 4322  H HA   . GLN A 1 56  ? 12.980  -3.083  2.591   1.00 0.00 ? 234 GLN A HA   3  
ATOM 4323  H HB2  . GLN A 1 56  ? 13.897  -4.134  0.560   1.00 0.00 ? 234 GLN A HB2  3  
ATOM 4324  H HB3  . GLN A 1 56  ? 14.646  -2.607  0.113   1.00 0.00 ? 234 GLN A HB3  3  
ATOM 4325  H HG2  . GLN A 1 56  ? 15.942  -2.711  2.244   1.00 0.00 ? 234 GLN A HG2  3  
ATOM 4326  H HG3  . GLN A 1 56  ? 15.298  -4.334  2.485   1.00 0.00 ? 234 GLN A HG3  3  
ATOM 4327  H HE21 . GLN A 1 56  ? 18.023  -3.034  1.822   1.00 0.00 ? 234 GLN A HE21 3  
ATOM 4328  H HE22 . GLN A 1 56  ? 18.643  -4.052  0.572   1.00 0.00 ? 234 GLN A HE22 3  
ATOM 4329  N N    . GLU A 1 57  ? 13.703  -0.094  1.520   1.00 0.00 ? 235 GLU A N    3  
ATOM 4330  C CA   . GLU A 1 57  ? 14.218  1.212   1.914   1.00 0.00 ? 235 GLU A CA   3  
ATOM 4331  C C    . GLU A 1 57  ? 13.491  1.733   3.151   1.00 0.00 ? 235 GLU A C    3  
ATOM 4332  O O    . GLU A 1 57  ? 14.114  2.253   4.077   1.00 0.00 ? 235 GLU A O    3  
ATOM 4333  C CB   . GLU A 1 57  ? 14.071  2.212   0.765   1.00 0.00 ? 235 GLU A CB   3  
ATOM 4334  C CG   . GLU A 1 57  ? 14.980  3.423   0.892   1.00 0.00 ? 235 GLU A CG   3  
ATOM 4335  C CD   . GLU A 1 57  ? 16.358  3.181   0.308   1.00 0.00 ? 235 GLU A CD   3  
ATOM 4336  O OE1  . GLU A 1 57  ? 16.463  2.403   -0.663  1.00 0.00 ? 235 GLU A OE1  3  
ATOM 4337  O OE2  . GLU A 1 57  ? 17.332  3.768   0.823   1.00 0.00 ? 235 GLU A OE2  3  
ATOM 4338  H H    . GLU A 1 57  ? 13.224  -0.182  0.670   1.00 0.00 ? 235 GLU A H    3  
ATOM 4339  H HA   . GLU A 1 57  ? 15.265  1.099   2.148   1.00 0.00 ? 235 GLU A HA   3  
ATOM 4340  H HB2  . GLU A 1 57  ? 14.300  1.710   -0.164  1.00 0.00 ? 235 GLU A HB2  3  
ATOM 4341  H HB3  . GLU A 1 57  ? 13.048  2.557   0.734   1.00 0.00 ? 235 GLU A HB3  3  
ATOM 4342  H HG2  . GLU A 1 57  ? 14.526  4.253   0.371   1.00 0.00 ? 235 GLU A HG2  3  
ATOM 4343  H HG3  . GLU A 1 57  ? 15.085  3.670   1.938   1.00 0.00 ? 235 GLU A HG3  3  
ATOM 4344  N N    . TYR A 1 58  ? 12.171  1.588   3.159   1.00 0.00 ? 236 TYR A N    3  
ATOM 4345  C CA   . TYR A 1 58  ? 11.358  2.046   4.279   1.00 0.00 ? 236 TYR A CA   3  
ATOM 4346  C C    . TYR A 1 58  ? 11.530  1.129   5.487   1.00 0.00 ? 236 TYR A C    3  
ATOM 4347  O O    . TYR A 1 58  ? 11.559  1.588   6.629   1.00 0.00 ? 236 TYR A O    3  
ATOM 4348  C CB   . TYR A 1 58  ? 9.884   2.106   3.876   1.00 0.00 ? 236 TYR A CB   3  
ATOM 4349  C CG   . TYR A 1 58  ? 8.932   2.059   5.051   1.00 0.00 ? 236 TYR A CG   3  
ATOM 4350  C CD1  . TYR A 1 58  ? 8.707   0.874   5.741   1.00 0.00 ? 236 TYR A CD1  3  
ATOM 4351  C CD2  . TYR A 1 58  ? 8.258   3.200   5.470   1.00 0.00 ? 236 TYR A CD2  3  
ATOM 4352  C CE1  . TYR A 1 58  ? 7.839   0.827   6.814   1.00 0.00 ? 236 TYR A CE1  3  
ATOM 4353  C CE2  . TYR A 1 58  ? 7.389   3.161   6.543   1.00 0.00 ? 236 TYR A CE2  3  
ATOM 4354  C CZ   . TYR A 1 58  ? 7.182   1.973   7.212   1.00 0.00 ? 236 TYR A CZ   3  
ATOM 4355  O OH   . TYR A 1 58  ? 6.316   1.930   8.280   1.00 0.00 ? 236 TYR A OH   3  
ATOM 4356  H H    . TYR A 1 58  ? 11.731  1.165   2.392   1.00 0.00 ? 236 TYR A H    3  
ATOM 4357  H HA   . TYR A 1 58  ? 11.689  3.039   4.546   1.00 0.00 ? 236 TYR A HA   3  
ATOM 4358  H HB2  . TYR A 1 58  ? 9.702   3.024   3.339   1.00 0.00 ? 236 TYR A HB2  3  
ATOM 4359  H HB3  . TYR A 1 58  ? 9.659   1.268   3.233   1.00 0.00 ? 236 TYR A HB3  3  
ATOM 4360  H HD1  . TYR A 1 58  ? 9.223   -0.022  5.427   1.00 0.00 ? 236 TYR A HD1  3  
ATOM 4361  H HD2  . TYR A 1 58  ? 8.422   4.129   4.944   1.00 0.00 ? 236 TYR A HD2  3  
ATOM 4362  H HE1  . TYR A 1 58  ? 7.677   -0.104  7.338   1.00 0.00 ? 236 TYR A HE1  3  
ATOM 4363  H HE2  . TYR A 1 58  ? 6.874   4.059   6.854   1.00 0.00 ? 236 TYR A HE2  3  
ATOM 4364  H HH   . TYR A 1 58  ? 6.103   2.825   8.555   1.00 0.00 ? 236 TYR A HH   3  
ATOM 4365  N N    . ILE A 1 59  ? 11.643  -0.168  5.225   1.00 0.00 ? 237 ILE A N    3  
ATOM 4366  C CA   . ILE A 1 59  ? 11.813  -1.150  6.289   1.00 0.00 ? 237 ILE A CA   3  
ATOM 4367  C C    . ILE A 1 59  ? 13.174  -1.002  6.961   1.00 0.00 ? 237 ILE A C    3  
ATOM 4368  O O    . ILE A 1 59  ? 13.267  -0.918  8.185   1.00 0.00 ? 237 ILE A O    3  
ATOM 4369  C CB   . ILE A 1 59  ? 11.670  -2.588  5.756   1.00 0.00 ? 237 ILE A CB   3  
ATOM 4370  C CG1  . ILE A 1 59  ? 10.301  -2.778  5.100   1.00 0.00 ? 237 ILE A CG1  3  
ATOM 4371  C CG2  . ILE A 1 59  ? 11.868  -3.592  6.882   1.00 0.00 ? 237 ILE A CG2  3  
ATOM 4372  C CD1  . ILE A 1 59  ? 10.304  -3.794  3.980   1.00 0.00 ? 237 ILE A CD1  3  
ATOM 4373  H H    . ILE A 1 59  ? 11.611  -0.473  4.294   1.00 0.00 ? 237 ILE A H    3  
ATOM 4374  H HA   . ILE A 1 59  ? 11.040  -0.981  7.025   1.00 0.00 ? 237 ILE A HA   3  
ATOM 4375  H HB   . ILE A 1 59  ? 12.441  -2.754  5.019   1.00 0.00 ? 237 ILE A HB   3  
ATOM 4376  H HG12 . ILE A 1 59  ? 9.594   -3.108  5.845   1.00 0.00 ? 237 ILE A HG12 3  
ATOM 4377  H HG13 . ILE A 1 59  ? 9.972   -1.833  4.691   1.00 0.00 ? 237 ILE A HG13 3  
ATOM 4378  H HG21 . ILE A 1 59  ? 11.379  -4.520  6.626   1.00 0.00 ? 237 ILE A HG21 3  
ATOM 4379  H HG22 . ILE A 1 59  ? 12.923  -3.769  7.025   1.00 0.00 ? 237 ILE A HG22 3  
ATOM 4380  H HG23 . ILE A 1 59  ? 11.441  -3.200  7.793   1.00 0.00 ? 237 ILE A HG23 3  
ATOM 4381  H HD11 . ILE A 1 59  ? 11.109  -3.573  3.294   1.00 0.00 ? 237 ILE A HD11 3  
ATOM 4382  H HD12 . ILE A 1 59  ? 10.441  -4.783  4.390   1.00 0.00 ? 237 ILE A HD12 3  
ATOM 4383  H HD13 . ILE A 1 59  ? 9.362   -3.751  3.452   1.00 0.00 ? 237 ILE A HD13 3  
ATOM 4384  N N    . ARG A 1 60  ? 14.227  -0.969  6.150   1.00 0.00 ? 238 ARG A N    3  
ATOM 4385  C CA   . ARG A 1 60  ? 15.584  -0.830  6.666   1.00 0.00 ? 238 ARG A CA   3  
ATOM 4386  C C    . ARG A 1 60  ? 15.718  0.435   7.509   1.00 0.00 ? 238 ARG A C    3  
ATOM 4387  O O    . ARG A 1 60  ? 16.377  0.432   8.549   1.00 0.00 ? 238 ARG A O    3  
ATOM 4388  C CB   . ARG A 1 60  ? 16.589  -0.796  5.514   1.00 0.00 ? 238 ARG A CB   3  
ATOM 4389  C CG   . ARG A 1 60  ? 16.755  0.580   4.890   1.00 0.00 ? 238 ARG A CG   3  
ATOM 4390  C CD   . ARG A 1 60  ? 17.785  0.564   3.771   1.00 0.00 ? 238 ARG A CD   3  
ATOM 4391  N NE   . ARG A 1 60  ? 18.211  1.910   3.400   1.00 0.00 ? 238 ARG A NE   3  
ATOM 4392  C CZ   . ARG A 1 60  ? 18.969  2.680   4.172   1.00 0.00 ? 238 ARG A CZ   3  
ATOM 4393  N NH1  . ARG A 1 60  ? 19.382  2.239   5.352   1.00 0.00 ? 238 ARG A NH1  3  
ATOM 4394  N NH2  . ARG A 1 60  ? 19.315  3.895   3.764   1.00 0.00 ? 238 ARG A NH2  3  
ATOM 4395  H H    . ARG A 1 60  ? 14.089  -1.040  5.183   1.00 0.00 ? 238 ARG A H    3  
ATOM 4396  H HA   . ARG A 1 60  ? 15.792  -1.687  7.289   1.00 0.00 ? 238 ARG A HA   3  
ATOM 4397  H HB2  . ARG A 1 60  ? 17.552  -1.119  5.882   1.00 0.00 ? 238 ARG A HB2  3  
ATOM 4398  H HB3  . ARG A 1 60  ? 16.260  -1.479  4.745   1.00 0.00 ? 238 ARG A HB3  3  
ATOM 4399  H HG2  . ARG A 1 60  ? 15.806  0.898   4.486   1.00 0.00 ? 238 ARG A HG2  3  
ATOM 4400  H HG3  . ARG A 1 60  ? 17.076  1.274   5.653   1.00 0.00 ? 238 ARG A HG3  3  
ATOM 4401  H HD2  . ARG A 1 60  ? 18.646  0.002   4.100   1.00 0.00 ? 238 ARG A HD2  3  
ATOM 4402  H HD3  . ARG A 1 60  ? 17.350  0.082   2.908   1.00 0.00 ? 238 ARG A HD3  3  
ATOM 4403  H HE   . ARG A 1 60  ? 17.917  2.256   2.532   1.00 0.00 ? 238 ARG A HE   3  
ATOM 4404  H HH11 . ARG A 1 60  ? 19.124  1.324   5.661   1.00 0.00 ? 238 ARG A HH11 3  
ATOM 4405  H HH12 . ARG A 1 60  ? 19.954  2.821   5.931   1.00 0.00 ? 238 ARG A HH12 3  
ATOM 4406  H HH21 . ARG A 1 60  ? 19.005  4.231   2.876   1.00 0.00 ? 238 ARG A HH21 3  
ATOM 4407  H HH22 . ARG A 1 60  ? 19.885  4.474   4.346   1.00 0.00 ? 238 ARG A HH22 3  
ATOM 4408  N N    . GLN A 1 61  ? 15.089  1.514   7.053   1.00 0.00 ? 239 GLN A N    3  
ATOM 4409  C CA   . GLN A 1 61  ? 15.140  2.785   7.765   1.00 0.00 ? 239 GLN A CA   3  
ATOM 4410  C C    . GLN A 1 61  ? 14.156  2.796   8.930   1.00 0.00 ? 239 GLN A C    3  
ATOM 4411  O O    . GLN A 1 61  ? 14.396  3.438   9.954   1.00 0.00 ? 239 GLN A O    3  
ATOM 4412  C CB   . GLN A 1 61  ? 14.832  3.941   6.811   1.00 0.00 ? 239 GLN A CB   3  
ATOM 4413  C CG   . GLN A 1 61  ? 16.025  4.372   5.973   1.00 0.00 ? 239 GLN A CG   3  
ATOM 4414  C CD   . GLN A 1 61  ? 17.092  5.071   6.792   1.00 0.00 ? 239 GLN A CD   3  
ATOM 4415  O OE1  . GLN A 1 61  ? 16.959  6.247   7.132   1.00 0.00 ? 239 GLN A OE1  3  
ATOM 4416  N NE2  . GLN A 1 61  ? 18.159  4.349   7.114   1.00 0.00 ? 239 GLN A NE2  3  
ATOM 4417  H H    . GLN A 1 61  ? 14.580  1.453   6.219   1.00 0.00 ? 239 GLN A H    3  
ATOM 4418  H HA   . GLN A 1 61  ? 16.140  2.908   8.153   1.00 0.00 ? 239 GLN A HA   3  
ATOM 4419  H HB2  . GLN A 1 61  ? 14.040  3.639   6.143   1.00 0.00 ? 239 GLN A HB2  3  
ATOM 4420  H HB3  . GLN A 1 61  ? 14.500  4.790   7.389   1.00 0.00 ? 239 GLN A HB3  3  
ATOM 4421  H HG2  . GLN A 1 61  ? 16.461  3.497   5.514   1.00 0.00 ? 239 GLN A HG2  3  
ATOM 4422  H HG3  . GLN A 1 61  ? 15.682  5.048   5.203   1.00 0.00 ? 239 GLN A HG3  3  
ATOM 4423  H HE21 . GLN A 1 61  ? 18.197  3.418   6.808   1.00 0.00 ? 239 GLN A HE21 3  
ATOM 4424  H HE22 . GLN A 1 61  ? 18.864  4.775   7.643   1.00 0.00 ? 239 GLN A HE22 3  
ATOM 4425  N N    . LYS A 1 62  ? 13.047  2.082   8.769   1.00 0.00 ? 240 LYS A N    3  
ATOM 4426  C CA   . LYS A 1 62  ? 12.026  2.008   9.807   1.00 0.00 ? 240 LYS A CA   3  
ATOM 4427  C C    . LYS A 1 62  ? 12.320  0.869   10.778  1.00 0.00 ? 240 LYS A C    3  
ATOM 4428  O O    . LYS A 1 62  ? 12.671  1.103   11.934  1.00 0.00 ? 240 LYS A O    3  
ATOM 4429  C CB   . LYS A 1 62  ? 10.644  1.813   9.179   1.00 0.00 ? 240 LYS A CB   3  
ATOM 4430  C CG   . LYS A 1 62  ? 10.185  2.994   8.342   1.00 0.00 ? 240 LYS A CG   3  
ATOM 4431  C CD   . LYS A 1 62  ? 9.505   4.052   9.195   1.00 0.00 ? 240 LYS A CD   3  
ATOM 4432  C CE   . LYS A 1 62  ? 9.533   5.415   8.520   1.00 0.00 ? 240 LYS A CE   3  
ATOM 4433  N NZ   . LYS A 1 62  ? 8.408   6.280   8.972   1.00 0.00 ? 240 LYS A NZ   3  
ATOM 4434  H H    . LYS A 1 62  ? 12.913  1.592   7.930   1.00 0.00 ? 240 LYS A H    3  
ATOM 4435  H HA   . LYS A 1 62  ? 12.037  2.941   10.350  1.00 0.00 ? 240 LYS A HA   3  
ATOM 4436  H HB2  . LYS A 1 62  ? 10.670  0.938   8.546   1.00 0.00 ? 240 LYS A HB2  3  
ATOM 4437  H HB3  . LYS A 1 62  ? 9.923   1.656   9.968   1.00 0.00 ? 240 LYS A HB3  3  
ATOM 4438  H HG2  . LYS A 1 62  ? 11.043  3.436   7.856   1.00 0.00 ? 240 LYS A HG2  3  
ATOM 4439  H HG3  . LYS A 1 62  ? 9.487   2.644   7.594   1.00 0.00 ? 240 LYS A HG3  3  
ATOM 4440  H HD2  . LYS A 1 62  ? 8.477   3.765   9.358   1.00 0.00 ? 240 LYS A HD2  3  
ATOM 4441  H HD3  . LYS A 1 62  ? 10.017  4.120   10.145  1.00 0.00 ? 240 LYS A HD3  3  
ATOM 4442  H HE2  . LYS A 1 62  ? 10.467  5.900   8.757   1.00 0.00 ? 240 LYS A HE2  3  
ATOM 4443  H HE3  . LYS A 1 62  ? 9.460   5.274   7.452   1.00 0.00 ? 240 LYS A HE3  3  
ATOM 4444  H HZ1  . LYS A 1 62  ? 8.605   6.654   9.923   1.00 0.00 ? 240 LYS A HZ1  3  
ATOM 4445  H HZ2  . LYS A 1 62  ? 7.526   5.732   9.005   1.00 0.00 ? 240 LYS A HZ2  3  
ATOM 4446  H HZ3  . LYS A 1 62  ? 8.285   7.078   8.316   1.00 0.00 ? 240 LYS A HZ3  3  
ATOM 4447  N N    . ASN A 1 63  ? 12.174  -0.362  10.301  1.00 0.00 ? 241 ASN A N    3  
ATOM 4448  C CA   . ASN A 1 63  ? 12.425  -1.537  11.128  1.00 0.00 ? 241 ASN A CA   3  
ATOM 4449  C C    . ASN A 1 63  ? 13.911  -1.882  11.147  1.00 0.00 ? 241 ASN A C    3  
ATOM 4450  O O    . ASN A 1 63  ? 14.288  -3.053  11.188  1.00 0.00 ? 241 ASN A O    3  
ATOM 4451  C CB   . ASN A 1 63  ? 11.620  -2.731  10.611  1.00 0.00 ? 241 ASN A CB   3  
ATOM 4452  C CG   . ASN A 1 63  ? 11.316  -3.740  11.703  1.00 0.00 ? 241 ASN A CG   3  
ATOM 4453  O OD1  . ASN A 1 63  ? 11.848  -3.652  12.810  1.00 0.00 ? 241 ASN A OD1  3  
ATOM 4454  N ND2  . ASN A 1 63  ? 10.458  -4.705  11.394  1.00 0.00 ? 241 ASN A ND2  3  
ATOM 4455  H H    . ASN A 1 63  ? 11.891  -0.484  9.371   1.00 0.00 ? 241 ASN A H    3  
ATOM 4456  H HA   . ASN A 1 63  ? 12.107  -1.308  12.134  1.00 0.00 ? 241 ASN A HA   3  
ATOM 4457  H HB2  . ASN A 1 63  ? 10.683  -2.377  10.205  1.00 0.00 ? 241 ASN A HB2  3  
ATOM 4458  H HB3  . ASN A 1 63  ? 12.181  -3.227  9.834   1.00 0.00 ? 241 ASN A HB3  3  
ATOM 4459  H HD21 . ASN A 1 63  ? 10.074  -4.712  10.493  1.00 0.00 ? 241 ASN A HD21 3  
ATOM 4460  H HD22 . ASN A 1 63  ? 10.244  -5.370  12.081  1.00 0.00 ? 241 ASN A HD22 3  
ATOM 4461  N N    . LYS A 1 64  ? 14.751  -0.853  11.119  1.00 0.00 ? 242 LYS A N    3  
ATOM 4462  C CA   . LYS A 1 64  ? 16.197  -1.045  11.136  1.00 0.00 ? 242 LYS A CA   3  
ATOM 4463  C C    . LYS A 1 64  ? 16.586  -2.311  10.379  1.00 0.00 ? 242 LYS A C    3  
ATOM 4464  O O    . LYS A 1 64  ? 17.554  -2.983  10.732  1.00 0.00 ? 242 LYS A O    3  
ATOM 4465  C CB   . LYS A 1 64  ? 16.705  -1.122  12.577  1.00 0.00 ? 242 LYS A CB   3  
ATOM 4466  C CG   . LYS A 1 64  ? 16.482  0.154   13.370  1.00 0.00 ? 242 LYS A CG   3  
ATOM 4467  C CD   . LYS A 1 64  ? 16.826  -0.035  14.838  1.00 0.00 ? 242 LYS A CD   3  
ATOM 4468  C CE   . LYS A 1 64  ? 16.631  1.252   15.626  1.00 0.00 ? 242 LYS A CE   3  
ATOM 4469  N NZ   . LYS A 1 64  ? 15.202  1.669   15.663  1.00 0.00 ? 242 LYS A NZ   3  
ATOM 4470  H H    . LYS A 1 64  ? 14.390  0.058   11.088  1.00 0.00 ? 242 LYS A H    3  
ATOM 4471  H HA   . LYS A 1 64  ? 16.650  -0.195  10.648  1.00 0.00 ? 242 LYS A HA   3  
ATOM 4472  H HB2  . LYS A 1 64  ? 16.197  -1.929  13.083  1.00 0.00 ? 242 LYS A HB2  3  
ATOM 4473  H HB3  . LYS A 1 64  ? 17.766  -1.330  12.561  1.00 0.00 ? 242 LYS A HB3  3  
ATOM 4474  H HG2  . LYS A 1 64  ? 17.107  0.935   12.963  1.00 0.00 ? 242 LYS A HG2  3  
ATOM 4475  H HG3  . LYS A 1 64  ? 15.443  0.441   13.287  1.00 0.00 ? 242 LYS A HG3  3  
ATOM 4476  H HD2  . LYS A 1 64  ? 16.185  -0.798  15.254  1.00 0.00 ? 242 LYS A HD2  3  
ATOM 4477  H HD3  . LYS A 1 64  ? 17.858  -0.345  14.920  1.00 0.00 ? 242 LYS A HD3  3  
ATOM 4478  H HE2  . LYS A 1 64  ? 16.979  1.096   16.635  1.00 0.00 ? 242 LYS A HE2  3  
ATOM 4479  H HE3  . LYS A 1 64  ? 17.214  2.034   15.161  1.00 0.00 ? 242 LYS A HE3  3  
ATOM 4480  H HZ1  . LYS A 1 64  ? 15.107  2.647   15.322  1.00 0.00 ? 242 LYS A HZ1  3  
ATOM 4481  H HZ2  . LYS A 1 64  ? 14.840  1.617   16.636  1.00 0.00 ? 242 LYS A HZ2  3  
ATOM 4482  H HZ3  . LYS A 1 64  ? 14.632  1.045   15.058  1.00 0.00 ? 242 LYS A HZ3  3  
ATOM 4483  N N    . GLY A 1 65  ? 15.826  -2.630  9.336   1.00 0.00 ? 243 GLY A N    3  
ATOM 4484  C CA   . GLY A 1 65  ? 16.109  -3.813  8.546   1.00 0.00 ? 243 GLY A CA   3  
ATOM 4485  C C    . GLY A 1 65  ? 15.588  -5.081  9.194   1.00 0.00 ? 243 GLY A C    3  
ATOM 4486  O O    . GLY A 1 65  ? 16.353  -6.003  9.474   1.00 0.00 ? 243 GLY A O    3  
ATOM 4487  H H    . GLY A 1 65  ? 15.066  -2.056  9.101   1.00 0.00 ? 243 GLY A H    3  
ATOM 4488  H HA2  . GLY A 1 65  ? 15.650  -3.703  7.575   1.00 0.00 ? 243 GLY A HA2  3  
ATOM 4489  H HA3  . GLY A 1 65  ? 17.178  -3.901  8.420   1.00 0.00 ? 243 GLY A HA3  3  
ATOM 4490  N N    . ALA A 1 66  ? 14.281  -5.127  9.434   1.00 0.00 ? 244 ALA A N    3  
ATOM 4491  C CA   . ALA A 1 66  ? 13.659  -6.291  10.052  1.00 0.00 ? 244 ALA A CA   3  
ATOM 4492  C C    . ALA A 1 66  ? 12.355  -6.655  9.350   1.00 0.00 ? 244 ALA A C    3  
ATOM 4493  O O    . ALA A 1 66  ? 11.480  -5.808  9.166   1.00 0.00 ? 244 ALA A O    3  
ATOM 4494  C CB   . ALA A 1 66  ? 13.410  -6.033  11.531  1.00 0.00 ? 244 ALA A CB   3  
ATOM 4495  H H    . ALA A 1 66  ? 13.723  -4.361  9.187   1.00 0.00 ? 244 ALA A H    3  
ATOM 4496  H HA   . ALA A 1 66  ? 14.346  -7.121  9.967   1.00 0.00 ? 244 ALA A HA   3  
ATOM 4497  H HB1  . ALA A 1 66  ? 13.742  -6.886  12.105  1.00 0.00 ? 244 ALA A HB1  3  
ATOM 4498  H HB2  . ALA A 1 66  ? 13.958  -5.156  11.840  1.00 0.00 ? 244 ALA A HB2  3  
ATOM 4499  H HB3  . ALA A 1 66  ? 12.355  -5.876  11.696  1.00 0.00 ? 244 ALA A HB3  3  
ATOM 4500  N N    . LYS A 1 67  ? 12.232  -7.918  8.959   1.00 0.00 ? 245 LYS A N    3  
ATOM 4501  C CA   . LYS A 1 67  ? 11.035  -8.395  8.277   1.00 0.00 ? 245 LYS A CA   3  
ATOM 4502  C C    . LYS A 1 67  ? 9.778   -7.793  8.898   1.00 0.00 ? 245 LYS A C    3  
ATOM 4503  O O    . LYS A 1 67  ? 9.602   -7.817  10.117  1.00 0.00 ? 245 LYS A O    3  
ATOM 4504  C CB   . LYS A 1 67  ? 10.963  -9.923  8.336   1.00 0.00 ? 245 LYS A CB   3  
ATOM 4505  C CG   . LYS A 1 67  ? 10.790  -10.469 9.743   1.00 0.00 ? 245 LYS A CG   3  
ATOM 4506  C CD   . LYS A 1 67  ? 11.353  -11.875 9.868   1.00 0.00 ? 245 LYS A CD   3  
ATOM 4507  C CE   . LYS A 1 67  ? 10.398  -12.911 9.294   1.00 0.00 ? 245 LYS A CE   3  
ATOM 4508  N NZ   . LYS A 1 67  ? 10.896  -14.299 9.500   1.00 0.00 ? 245 LYS A NZ   3  
ATOM 4509  H H    . LYS A 1 67  ? 12.964  -8.547  9.134   1.00 0.00 ? 245 LYS A H    3  
ATOM 4510  H HA   . LYS A 1 67  ? 11.095  -8.086  7.245   1.00 0.00 ? 245 LYS A HA   3  
ATOM 4511  H HB2  . LYS A 1 67  ? 10.128  -10.256 7.738   1.00 0.00 ? 245 LYS A HB2  3  
ATOM 4512  H HB3  . LYS A 1 67  ? 11.875  -10.330 7.924   1.00 0.00 ? 245 LYS A HB3  3  
ATOM 4513  H HG2  . LYS A 1 67  ? 11.308  -9.823  10.437  1.00 0.00 ? 245 LYS A HG2  3  
ATOM 4514  H HG3  . LYS A 1 67  ? 9.737   -10.490 9.985   1.00 0.00 ? 245 LYS A HG3  3  
ATOM 4515  H HD2  . LYS A 1 67  ? 12.288  -11.929 9.331   1.00 0.00 ? 245 LYS A HD2  3  
ATOM 4516  H HD3  . LYS A 1 67  ? 11.522  -12.095 10.913  1.00 0.00 ? 245 LYS A HD3  3  
ATOM 4517  H HE2  . LYS A 1 67  ? 9.440   -12.806 9.779   1.00 0.00 ? 245 LYS A HE2  3  
ATOM 4518  H HE3  . LYS A 1 67  ? 10.287  -12.731 8.235   1.00 0.00 ? 245 LYS A HE3  3  
ATOM 4519  H HZ1  . LYS A 1 67  ? 11.912  -14.349 9.286   1.00 0.00 ? 245 LYS A HZ1  3  
ATOM 4520  H HZ2  . LYS A 1 67  ? 10.389  -14.957 8.875   1.00 0.00 ? 245 LYS A HZ2  3  
ATOM 4521  H HZ3  . LYS A 1 67  ? 10.745  -14.590 10.487  1.00 0.00 ? 245 LYS A HZ3  3  
ATOM 4522  N N    . LEU A 1 68  ? 8.907   -7.253  8.053   1.00 0.00 ? 246 LEU A N    3  
ATOM 4523  C CA   . LEU A 1 68  ? 7.665   -6.645  8.518   1.00 0.00 ? 246 LEU A CA   3  
ATOM 4524  C C    . LEU A 1 68  ? 6.700   -7.707  9.036   1.00 0.00 ? 246 LEU A C    3  
ATOM 4525  O O    . LEU A 1 68  ? 7.037   -8.889  9.103   1.00 0.00 ? 246 LEU A O    3  
ATOM 4526  C CB   . LEU A 1 68  ? 7.009   -5.849  7.389   1.00 0.00 ? 246 LEU A CB   3  
ATOM 4527  C CG   . LEU A 1 68  ? 7.880   -4.783  6.725   1.00 0.00 ? 246 LEU A CG   3  
ATOM 4528  C CD1  . LEU A 1 68  ? 7.286   -4.363  5.389   1.00 0.00 ? 246 LEU A CD1  3  
ATOM 4529  C CD2  . LEU A 1 68  ? 8.040   -3.578  7.641   1.00 0.00 ? 246 LEU A CD2  3  
ATOM 4530  H H    . LEU A 1 68  ? 9.102   -7.263  7.093   1.00 0.00 ? 246 LEU A H    3  
ATOM 4531  H HA   . LEU A 1 68  ? 7.909   -5.972  9.327   1.00 0.00 ? 246 LEU A HA   3  
ATOM 4532  H HB2  . LEU A 1 68  ? 6.704   -6.549  6.626   1.00 0.00 ? 246 LEU A HB2  3  
ATOM 4533  H HB3  . LEU A 1 68  ? 6.135   -5.359  7.795   1.00 0.00 ? 246 LEU A HB3  3  
ATOM 4534  H HG   . LEU A 1 68  ? 8.862   -5.194  6.538   1.00 0.00 ? 246 LEU A HG   3  
ATOM 4535  H HD11 . LEU A 1 68  ? 7.547   -5.090  4.635   1.00 0.00 ? 246 LEU A HD11 3  
ATOM 4536  H HD12 . LEU A 1 68  ? 7.677   -3.397  5.109   1.00 0.00 ? 246 LEU A HD12 3  
ATOM 4537  H HD13 . LEU A 1 68  ? 6.211   -4.304  5.477   1.00 0.00 ? 246 LEU A HD13 3  
ATOM 4538  H HD21 . LEU A 1 68  ? 8.028   -2.674  7.051   1.00 0.00 ? 246 LEU A HD21 3  
ATOM 4539  H HD22 . LEU A 1 68  ? 8.979   -3.651  8.170   1.00 0.00 ? 246 LEU A HD22 3  
ATOM 4540  H HD23 . LEU A 1 68  ? 7.227   -3.556  8.351   1.00 0.00 ? 246 LEU A HD23 3  
ATOM 4541  N N    . LYS A 1 69  ? 5.496   -7.277  9.398   1.00 0.00 ? 247 LYS A N    3  
ATOM 4542  C CA   . LYS A 1 69  ? 4.479   -8.190  9.906   1.00 0.00 ? 247 LYS A CA   3  
ATOM 4543  C C    . LYS A 1 69  ? 3.171   -8.029  9.138   1.00 0.00 ? 247 LYS A C    3  
ATOM 4544  O O    . LYS A 1 69  ? 3.064   -7.193  8.242   1.00 0.00 ? 247 LYS A O    3  
ATOM 4545  C CB   . LYS A 1 69  ? 4.240   -7.942  11.398  1.00 0.00 ? 247 LYS A CB   3  
ATOM 4546  C CG   . LYS A 1 69  ? 5.392   -8.391  12.281  1.00 0.00 ? 247 LYS A CG   3  
ATOM 4547  C CD   . LYS A 1 69  ? 5.295   -9.871  12.613  1.00 0.00 ? 247 LYS A CD   3  
ATOM 4548  C CE   . LYS A 1 69  ? 4.192   -10.144 13.624  1.00 0.00 ? 247 LYS A CE   3  
ATOM 4549  N NZ   . LYS A 1 69  ? 4.120   -11.586 13.989  1.00 0.00 ? 247 LYS A NZ   3  
ATOM 4550  H H    . LYS A 1 69  ? 5.286   -6.323  9.321   1.00 0.00 ? 247 LYS A H    3  
ATOM 4551  H HA   . LYS A 1 69  ? 4.840   -9.198  9.771   1.00 0.00 ? 247 LYS A HA   3  
ATOM 4552  H HB2  . LYS A 1 69  ? 4.085   -6.885  11.554  1.00 0.00 ? 247 LYS A HB2  3  
ATOM 4553  H HB3  . LYS A 1 69  ? 3.352   -8.476  11.702  1.00 0.00 ? 247 LYS A HB3  3  
ATOM 4554  H HG2  . LYS A 1 69  ? 6.322   -8.209  11.764  1.00 0.00 ? 247 LYS A HG2  3  
ATOM 4555  H HG3  . LYS A 1 69  ? 5.371   -7.823  13.200  1.00 0.00 ? 247 LYS A HG3  3  
ATOM 4556  H HD2  . LYS A 1 69  ? 5.083   -10.421 11.708  1.00 0.00 ? 247 LYS A HD2  3  
ATOM 4557  H HD3  . LYS A 1 69  ? 6.239   -10.201 13.025  1.00 0.00 ? 247 LYS A HD3  3  
ATOM 4558  H HE2  . LYS A 1 69  ? 4.385   -9.565  14.514  1.00 0.00 ? 247 LYS A HE2  3  
ATOM 4559  H HE3  . LYS A 1 69  ? 3.247   -9.842  13.196  1.00 0.00 ? 247 LYS A HE3  3  
ATOM 4560  H HZ1  . LYS A 1 69  ? 4.557   -11.740 14.920  1.00 0.00 ? 247 LYS A HZ1  3  
ATOM 4561  H HZ2  . LYS A 1 69  ? 4.623   -12.159 13.283  1.00 0.00 ? 247 LYS A HZ2  3  
ATOM 4562  H HZ3  . LYS A 1 69  ? 3.128   -11.896 14.029  1.00 0.00 ? 247 LYS A HZ3  3  
ATOM 4563  N N    . VAL A 1 70  ? 2.176   -8.836  9.496   1.00 0.00 ? 248 VAL A N    3  
ATOM 4564  C CA   . VAL A 1 70  ? 0.874   -8.781  8.842   1.00 0.00 ? 248 VAL A CA   3  
ATOM 4565  C C    . VAL A 1 70  ? -0.071  -7.837  9.578   1.00 0.00 ? 248 VAL A C    3  
ATOM 4566  O O    . VAL A 1 70  ? 0.066   -7.617  10.780  1.00 0.00 ? 248 VAL A O    3  
ATOM 4567  C CB   . VAL A 1 70  ? 0.228   -10.177 8.761   1.00 0.00 ? 248 VAL A CB   3  
ATOM 4568  C CG1  . VAL A 1 70  ? -1.125  -10.099 8.069   1.00 0.00 ? 248 VAL A CG1  3  
ATOM 4569  C CG2  . VAL A 1 70  ? 1.149   -11.149 8.041   1.00 0.00 ? 248 VAL A CG2  3  
ATOM 4570  H H    . VAL A 1 70  ? 2.322   -9.482  10.218  1.00 0.00 ? 248 VAL A H    3  
ATOM 4571  H HA   . VAL A 1 70  ? 1.021   -8.416  7.836   1.00 0.00 ? 248 VAL A HA   3  
ATOM 4572  H HB   . VAL A 1 70  ? 0.072   -10.538 9.767   1.00 0.00 ? 248 VAL A HB   3  
ATOM 4573  H HG11 . VAL A 1 70  ? -1.566  -11.084 8.032   1.00 0.00 ? 248 VAL A HG11 3  
ATOM 4574  H HG12 . VAL A 1 70  ? -1.773  -9.433  8.619   1.00 0.00 ? 248 VAL A HG12 3  
ATOM 4575  H HG13 . VAL A 1 70  ? -0.994  -9.726  7.064   1.00 0.00 ? 248 VAL A HG13 3  
ATOM 4576  H HG21 . VAL A 1 70  ? 2.078   -10.653 7.801   1.00 0.00 ? 248 VAL A HG21 3  
ATOM 4577  H HG22 . VAL A 1 70  ? 1.349   -11.997 8.681   1.00 0.00 ? 248 VAL A HG22 3  
ATOM 4578  H HG23 . VAL A 1 70  ? 0.676   -11.488 7.132   1.00 0.00 ? 248 VAL A HG23 3  
ATOM 4579  N N    . GLY A 1 71  ? -1.031  -7.281  8.845   1.00 0.00 ? 249 GLY A N    3  
ATOM 4580  C CA   . GLY A 1 71  ? -1.986  -6.367  9.445   1.00 0.00 ? 249 GLY A CA   3  
ATOM 4581  C C    . GLY A 1 71  ? -1.328  -5.111  9.982   1.00 0.00 ? 249 GLY A C    3  
ATOM 4582  O O    . GLY A 1 71  ? -1.947  -4.347  10.721  1.00 0.00 ? 249 GLY A O    3  
ATOM 4583  H H    . GLY A 1 71  ? -1.092  -7.493  7.890   1.00 0.00 ? 249 GLY A H    3  
ATOM 4584  H HA2  . GLY A 1 71  ? -2.716  -6.088  8.700   1.00 0.00 ? 249 GLY A HA2  3  
ATOM 4585  H HA3  . GLY A 1 71  ? -2.489  -6.871  10.257  1.00 0.00 ? 249 GLY A HA3  3  
ATOM 4586  N N    . GLN A 1 72  ? -0.069  -4.900  9.612   1.00 0.00 ? 250 GLN A N    3  
ATOM 4587  C CA   . GLN A 1 72  ? 0.674   -3.730  10.064  1.00 0.00 ? 250 GLN A CA   3  
ATOM 4588  C C    . GLN A 1 72  ? 0.349   -2.513  9.204   1.00 0.00 ? 250 GLN A C    3  
ATOM 4589  O O    . GLN A 1 72  ? 0.072   -2.640  8.011   1.00 0.00 ? 250 GLN A O    3  
ATOM 4590  C CB   . GLN A 1 72  ? 2.177   -4.008  10.027  1.00 0.00 ? 250 GLN A CB   3  
ATOM 4591  C CG   . GLN A 1 72  ? 2.762   -4.009  8.624   1.00 0.00 ? 250 GLN A CG   3  
ATOM 4592  C CD   . GLN A 1 72  ? 4.238   -3.666  8.606   1.00 0.00 ? 250 GLN A CD   3  
ATOM 4593  O OE1  . GLN A 1 72  ? 5.018   -4.187  9.404   1.00 0.00 ? 250 GLN A OE1  3  
ATOM 4594  N NE2  . GLN A 1 72  ? 4.630   -2.785  7.694   1.00 0.00 ? 250 GLN A NE2  3  
ATOM 4595  H H    . GLN A 1 72  ? 0.371   -5.546  9.021   1.00 0.00 ? 250 GLN A H    3  
ATOM 4596  H HA   . GLN A 1 72  ? 0.380   -3.524  11.082  1.00 0.00 ? 250 GLN A HA   3  
ATOM 4597  H HB2  . GLN A 1 72  ? 2.686   -3.251  10.605  1.00 0.00 ? 250 GLN A HB2  3  
ATOM 4598  H HB3  . GLN A 1 72  ? 2.363   -4.974  10.472  1.00 0.00 ? 250 GLN A HB3  3  
ATOM 4599  H HG2  . GLN A 1 72  ? 2.632   -4.992  8.194   1.00 0.00 ? 250 GLN A HG2  3  
ATOM 4600  H HG3  . GLN A 1 72  ? 2.231   -3.283  8.026   1.00 0.00 ? 250 GLN A HG3  3  
ATOM 4601  H HE21 . GLN A 1 72  ? 3.953   -2.409  7.092   1.00 0.00 ? 250 GLN A HE21 3  
ATOM 4602  H HE22 . GLN A 1 72  ? 5.579   -2.544  7.660   1.00 0.00 ? 250 GLN A HE22 3  
ATOM 4603  N N    . TYR A 1 73  ? 0.384   -1.335  9.817   1.00 0.00 ? 251 TYR A N    3  
ATOM 4604  C CA   . TYR A 1 73  ? 0.090   -0.095  9.108   1.00 0.00 ? 251 TYR A CA   3  
ATOM 4605  C C    . TYR A 1 73  ? 1.307   0.384   8.322   1.00 0.00 ? 251 TYR A C    3  
ATOM 4606  O O    . TYR A 1 73  ? 2.399   0.530   8.873   1.00 0.00 ? 251 TYR A O    3  
ATOM 4607  C CB   . TYR A 1 73  ? -0.354  0.987   10.093  1.00 0.00 ? 251 TYR A CB   3  
ATOM 4608  C CG   . TYR A 1 73  ? -1.834  0.956   10.401  1.00 0.00 ? 251 TYR A CG   3  
ATOM 4609  C CD1  . TYR A 1 73  ? -2.348  0.074   11.344  1.00 0.00 ? 251 TYR A CD1  3  
ATOM 4610  C CD2  . TYR A 1 73  ? -2.718  1.806   9.749   1.00 0.00 ? 251 TYR A CD2  3  
ATOM 4611  C CE1  . TYR A 1 73  ? -3.700  0.041   11.628  1.00 0.00 ? 251 TYR A CE1  3  
ATOM 4612  C CE2  . TYR A 1 73  ? -4.071  1.781   10.028  1.00 0.00 ? 251 TYR A CE2  3  
ATOM 4613  C CZ   . TYR A 1 73  ? -4.557  0.897   10.968  1.00 0.00 ? 251 TYR A CZ   3  
ATOM 4614  O OH   . TYR A 1 73  ? -5.904  0.867   11.247  1.00 0.00 ? 251 TYR A OH   3  
ATOM 4615  H H    . TYR A 1 73  ? 0.611   -1.298  10.769  1.00 0.00 ? 251 TYR A H    3  
ATOM 4616  H HA   . TYR A 1 73  ? -0.716  -0.292  8.416   1.00 0.00 ? 251 TYR A HA   3  
ATOM 4617  H HB2  . TYR A 1 73  ? 0.180   0.860   11.022  1.00 0.00 ? 251 TYR A HB2  3  
ATOM 4618  H HB3  . TYR A 1 73  ? -0.122  1.958   9.679   1.00 0.00 ? 251 TYR A HB3  3  
ATOM 4619  H HD1  . TYR A 1 73  ? -1.675  -0.595  11.859  1.00 0.00 ? 251 TYR A HD1  3  
ATOM 4620  H HD2  . TYR A 1 73  ? -2.334  2.498   9.013   1.00 0.00 ? 251 TYR A HD2  3  
ATOM 4621  H HE1  . TYR A 1 73  ? -4.081  -0.651  12.364  1.00 0.00 ? 251 TYR A HE1  3  
ATOM 4622  H HE2  . TYR A 1 73  ? -4.742  2.451   9.510   1.00 0.00 ? 251 TYR A HE2  3  
ATOM 4623  H HH   . TYR A 1 73  ? -6.154  1.677   11.699  1.00 0.00 ? 251 TYR A HH   3  
ATOM 4624  N N    . LEU A 1 74  ? 1.110   0.630   7.031   1.00 0.00 ? 252 LEU A N    3  
ATOM 4625  C CA   . LEU A 1 74  ? 2.190   1.094   6.168   1.00 0.00 ? 252 LEU A CA   3  
ATOM 4626  C C    . LEU A 1 74  ? 1.722   2.243   5.281   1.00 0.00 ? 252 LEU A C    3  
ATOM 4627  O O    . LEU A 1 74  ? 0.588   2.250   4.803   1.00 0.00 ? 252 LEU A O    3  
ATOM 4628  C CB   . LEU A 1 74  ? 2.707   -0.056  5.301   1.00 0.00 ? 252 LEU A CB   3  
ATOM 4629  C CG   . LEU A 1 74  ? 4.087   0.144   4.675   1.00 0.00 ? 252 LEU A CG   3  
ATOM 4630  C CD1  . LEU A 1 74  ? 5.110   0.504   5.742   1.00 0.00 ? 252 LEU A CD1  3  
ATOM 4631  C CD2  . LEU A 1 74  ? 4.518   -1.107  3.922   1.00 0.00 ? 252 LEU A CD2  3  
ATOM 4632  H H    . LEU A 1 74  ? 0.218   0.496   6.649   1.00 0.00 ? 252 LEU A H    3  
ATOM 4633  H HA   . LEU A 1 74  ? 2.991   1.446   6.800   1.00 0.00 ? 252 LEU A HA   3  
ATOM 4634  H HB2  . LEU A 1 74  ? 2.748   -0.941  5.917   1.00 0.00 ? 252 LEU A HB2  3  
ATOM 4635  H HB3  . LEU A 1 74  ? 1.998   -0.209  4.500   1.00 0.00 ? 252 LEU A HB3  3  
ATOM 4636  H HG   . LEU A 1 74  ? 4.041   0.961   3.969   1.00 0.00 ? 252 LEU A HG   3  
ATOM 4637  H HD11 . LEU A 1 74  ? 5.239   1.576   5.769   1.00 0.00 ? 252 LEU A HD11 3  
ATOM 4638  H HD12 . LEU A 1 74  ? 6.054   0.034   5.509   1.00 0.00 ? 252 LEU A HD12 3  
ATOM 4639  H HD13 . LEU A 1 74  ? 4.763   0.158   6.704   1.00 0.00 ? 252 LEU A HD13 3  
ATOM 4640  H HD21 . LEU A 1 74  ? 4.749   -0.849  2.900   1.00 0.00 ? 252 LEU A HD21 3  
ATOM 4641  H HD22 . LEU A 1 74  ? 3.715   -1.830  3.938   1.00 0.00 ? 252 LEU A HD22 3  
ATOM 4642  H HD23 . LEU A 1 74  ? 5.392   -1.529  4.395   1.00 0.00 ? 252 LEU A HD23 3  
ATOM 4643  N N    . ASN A 1 75  ? 2.604   3.214   5.064   1.00 0.00 ? 253 ASN A N    3  
ATOM 4644  C CA   . ASN A 1 75  ? 2.281   4.368   4.233   1.00 0.00 ? 253 ASN A CA   3  
ATOM 4645  C C    . ASN A 1 75  ? 2.785   4.169   2.806   1.00 0.00 ? 253 ASN A C    3  
ATOM 4646  O O    . ASN A 1 75  ? 3.929   3.766   2.592   1.00 0.00 ? 253 ASN A O    3  
ATOM 4647  C CB   . ASN A 1 75  ? 2.892   5.638   4.828   1.00 0.00 ? 253 ASN A CB   3  
ATOM 4648  C CG   . ASN A 1 75  ? 4.401   5.550   4.955   1.00 0.00 ? 253 ASN A CG   3  
ATOM 4649  O OD1  . ASN A 1 75  ? 5.006   4.536   4.607   1.00 0.00 ? 253 ASN A OD1  3  
ATOM 4650  N ND2  . ASN A 1 75  ? 5.015   6.615   5.456   1.00 0.00 ? 253 ASN A ND2  3  
ATOM 4651  H H    . ASN A 1 75  ? 3.492   3.153   5.472   1.00 0.00 ? 253 ASN A H    3  
ATOM 4652  H HA   . ASN A 1 75  ? 1.207   4.471   4.212   1.00 0.00 ? 253 ASN A HA   3  
ATOM 4653  H HB2  . ASN A 1 75  ? 2.652   6.478   4.192   1.00 0.00 ? 253 ASN A HB2  3  
ATOM 4654  H HB3  . ASN A 1 75  ? 2.475   5.805   5.810   1.00 0.00 ? 253 ASN A HB3  3  
ATOM 4655  H HD21 . ASN A 1 75  ? 4.469   7.387   5.713   1.00 0.00 ? 253 ASN A HD21 3  
ATOM 4656  H HD22 . ASN A 1 75  ? 5.990   6.585   5.549   1.00 0.00 ? 253 ASN A HD22 3  
ATOM 4657  N N    . CYS A 1 76  ? 1.924   4.454   1.836   1.00 0.00 ? 254 CYS A N    3  
ATOM 4658  C CA   . CYS A 1 76  ? 2.281   4.306   0.429   1.00 0.00 ? 254 CYS A CA   3  
ATOM 4659  C C    . CYS A 1 76  ? 1.585   5.363   -0.422  1.00 0.00 ? 254 CYS A C    3  
ATOM 4660  O O    . CYS A 1 76  ? 0.580   5.944   -0.009  1.00 0.00 ? 254 CYS A O    3  
ATOM 4661  C CB   . CYS A 1 76  ? 1.911   2.908   -0.068  1.00 0.00 ? 254 CYS A CB   3  
ATOM 4662  S SG   . CYS A 1 76  ? 2.871   1.577   0.690   1.00 0.00 ? 254 CYS A SG   3  
ATOM 4663  H H    . CYS A 1 76  ? 1.026   4.771   2.070   1.00 0.00 ? 254 CYS A H    3  
ATOM 4664  H HA   . CYS A 1 76  ? 3.349   4.439   0.344   1.00 0.00 ? 254 CYS A HA   3  
ATOM 4665  H HB2  . CYS A 1 76  ? 0.868   2.723   0.145   1.00 0.00 ? 254 CYS A HB2  3  
ATOM 4666  H HB3  . CYS A 1 76  ? 2.067   2.861   -1.136  1.00 0.00 ? 254 CYS A HB3  3  
ATOM 4667  H HG   . CYS A 1 76  ? 2.023   0.651   1.111   1.00 0.00 ? 254 CYS A HG   3  
ATOM 4668  N N    . ILE A 1 77  ? 2.126   5.608   -1.611  1.00 0.00 ? 255 ILE A N    3  
ATOM 4669  C CA   . ILE A 1 77  ? 1.557   6.595   -2.520  1.00 0.00 ? 255 ILE A CA   3  
ATOM 4670  C C    . ILE A 1 77  ? 1.524   6.071   -3.951  1.00 0.00 ? 255 ILE A C    3  
ATOM 4671  O O    . ILE A 1 77  ? 2.479   5.449   -4.417  1.00 0.00 ? 255 ILE A O    3  
ATOM 4672  C CB   . ILE A 1 77  ? 2.351   7.915   -2.486  1.00 0.00 ? 255 ILE A CB   3  
ATOM 4673  C CG1  . ILE A 1 77  ? 2.310   8.525   -1.084  1.00 0.00 ? 255 ILE A CG1  3  
ATOM 4674  C CG2  . ILE A 1 77  ? 1.796   8.892   -3.511  1.00 0.00 ? 255 ILE A CG2  3  
ATOM 4675  C CD1  . ILE A 1 77  ? 3.310   9.641   -0.881  1.00 0.00 ? 255 ILE A CD1  3  
ATOM 4676  H H    . ILE A 1 77  ? 2.926   5.113   -1.883  1.00 0.00 ? 255 ILE A H    3  
ATOM 4677  H HA   . ILE A 1 77  ? 0.545   6.799   -2.199  1.00 0.00 ? 255 ILE A HA   3  
ATOM 4678  H HB   . ILE A 1 77  ? 3.375   7.699   -2.748  1.00 0.00 ? 255 ILE A HB   3  
ATOM 4679  H HG12 . ILE A 1 77  ? 1.325   8.925   -0.900  1.00 0.00 ? 255 ILE A HG12 3  
ATOM 4680  H HG13 . ILE A 1 77  ? 2.521   7.753   -0.358  1.00 0.00 ? 255 ILE A HG13 3  
ATOM 4681  H HG21 . ILE A 1 77  ? 0.814   8.569   -3.822  1.00 0.00 ? 255 ILE A HG21 3  
ATOM 4682  H HG22 . ILE A 1 77  ? 1.727   9.875   -3.070  1.00 0.00 ? 255 ILE A HG22 3  
ATOM 4683  H HG23 . ILE A 1 77  ? 2.452   8.927   -4.368  1.00 0.00 ? 255 ILE A HG23 3  
ATOM 4684  H HD11 . ILE A 1 77  ? 4.069   9.323   -0.181  1.00 0.00 ? 255 ILE A HD11 3  
ATOM 4685  H HD12 . ILE A 1 77  ? 3.770   9.889   -1.825  1.00 0.00 ? 255 ILE A HD12 3  
ATOM 4686  H HD13 . ILE A 1 77  ? 2.803   10.512  -0.489  1.00 0.00 ? 255 ILE A HD13 3  
ATOM 4687  N N    . VAL A 1 78  ? 0.419   6.327   -4.644  1.00 0.00 ? 256 VAL A N    3  
ATOM 4688  C CA   . VAL A 1 78  ? 0.263   5.883   -6.024  1.00 0.00 ? 256 VAL A CA   3  
ATOM 4689  C C    . VAL A 1 78  ? 1.297   6.538   -6.933  1.00 0.00 ? 256 VAL A C    3  
ATOM 4690  O O    . VAL A 1 78  ? 1.487   7.753   -6.898  1.00 0.00 ? 256 VAL A O    3  
ATOM 4691  C CB   . VAL A 1 78  ? -1.147  6.199   -6.559  1.00 0.00 ? 256 VAL A CB   3  
ATOM 4692  C CG1  . VAL A 1 78  ? -1.283  5.748   -8.005  1.00 0.00 ? 256 VAL A CG1  3  
ATOM 4693  C CG2  . VAL A 1 78  ? -2.206  5.544   -5.686  1.00 0.00 ? 256 VAL A CG2  3  
ATOM 4694  H H    . VAL A 1 78  ? -0.307  6.827   -4.218  1.00 0.00 ? 256 VAL A H    3  
ATOM 4695  H HA   . VAL A 1 78  ? 0.403   4.812   -6.049  1.00 0.00 ? 256 VAL A HA   3  
ATOM 4696  H HB   . VAL A 1 78  ? -1.292  7.269   -6.524  1.00 0.00 ? 256 VAL A HB   3  
ATOM 4697  H HG11 . VAL A 1 78  ? -1.040  4.698   -8.079  1.00 0.00 ? 256 VAL A HG11 3  
ATOM 4698  H HG12 . VAL A 1 78  ? -2.298  5.908   -8.339  1.00 0.00 ? 256 VAL A HG12 3  
ATOM 4699  H HG13 . VAL A 1 78  ? -0.606  6.317   -8.625  1.00 0.00 ? 256 VAL A HG13 3  
ATOM 4700  H HG21 . VAL A 1 78  ? -1.864  5.520   -4.662  1.00 0.00 ? 256 VAL A HG21 3  
ATOM 4701  H HG22 . VAL A 1 78  ? -3.124  6.112   -5.745  1.00 0.00 ? 256 VAL A HG22 3  
ATOM 4702  H HG23 . VAL A 1 78  ? -2.384  4.536   -6.030  1.00 0.00 ? 256 VAL A HG23 3  
ATOM 4703  N N    . GLU A 1 79  ? 1.964   5.723   -7.745  1.00 0.00 ? 257 GLU A N    3  
ATOM 4704  C CA   . GLU A 1 79  ? 2.980   6.224   -8.663  1.00 0.00 ? 257 GLU A CA   3  
ATOM 4705  C C    . GLU A 1 79  ? 2.450   6.263   -10.094 1.00 0.00 ? 257 GLU A C    3  
ATOM 4706  O O    . GLU A 1 79  ? 2.695   7.215   -10.834 1.00 0.00 ? 257 GLU A O    3  
ATOM 4707  C CB   . GLU A 1 79  ? 4.235   5.351   -8.596  1.00 0.00 ? 257 GLU A CB   3  
ATOM 4708  C CG   . GLU A 1 79  ? 5.162   5.705   -7.446  1.00 0.00 ? 257 GLU A CG   3  
ATOM 4709  C CD   . GLU A 1 79  ? 6.443   4.893   -7.458  1.00 0.00 ? 257 GLU A CD   3  
ATOM 4710  O OE1  . GLU A 1 79  ? 6.356   3.648   -7.456  1.00 0.00 ? 257 GLU A OE1  3  
ATOM 4711  O OE2  . GLU A 1 79  ? 7.532   5.505   -7.469  1.00 0.00 ? 257 GLU A OE2  3  
ATOM 4712  H H    . GLU A 1 79  ? 1.768   4.763   -7.726  1.00 0.00 ? 257 GLU A H    3  
ATOM 4713  H HA   . GLU A 1 79  ? 3.235   7.228   -8.360  1.00 0.00 ? 257 GLU A HA   3  
ATOM 4714  H HB2  . GLU A 1 79  ? 3.935   4.319   -8.486  1.00 0.00 ? 257 GLU A HB2  3  
ATOM 4715  H HB3  . GLU A 1 79  ? 4.783   5.460   -9.520  1.00 0.00 ? 257 GLU A HB3  3  
ATOM 4716  H HG2  . GLU A 1 79  ? 5.417   6.752   -7.515  1.00 0.00 ? 257 GLU A HG2  3  
ATOM 4717  H HG3  . GLU A 1 79  ? 4.646   5.523   -6.515  1.00 0.00 ? 257 GLU A HG3  3  
ATOM 4718  N N    . LYS A 1 80  ? 1.721   5.219   -10.476 1.00 0.00 ? 258 LYS A N    3  
ATOM 4719  C CA   . LYS A 1 80  ? 1.154   5.132   -11.817 1.00 0.00 ? 258 LYS A CA   3  
ATOM 4720  C C    . LYS A 1 80  ? -0.138  4.321   -11.810 1.00 0.00 ? 258 LYS A C    3  
ATOM 4721  O O    . LYS A 1 80  ? -0.333  3.454   -10.958 1.00 0.00 ? 258 LYS A O    3  
ATOM 4722  C CB   . LYS A 1 80  ? 2.162   4.497   -12.778 1.00 0.00 ? 258 LYS A CB   3  
ATOM 4723  C CG   . LYS A 1 80  ? 3.483   5.243   -12.855 1.00 0.00 ? 258 LYS A CG   3  
ATOM 4724  C CD   . LYS A 1 80  ? 4.413   4.625   -13.884 1.00 0.00 ? 258 LYS A CD   3  
ATOM 4725  C CE   . LYS A 1 80  ? 5.189   3.453   -13.302 1.00 0.00 ? 258 LYS A CE   3  
ATOM 4726  N NZ   . LYS A 1 80  ? 5.926   2.699   -14.353 1.00 0.00 ? 258 LYS A NZ   3  
ATOM 4727  H H    . LYS A 1 80  ? 1.559   4.490   -9.841  1.00 0.00 ? 258 LYS A H    3  
ATOM 4728  H HA   . LYS A 1 80  ? 0.934   6.135   -12.150 1.00 0.00 ? 258 LYS A HA   3  
ATOM 4729  H HB2  . LYS A 1 80  ? 2.361   3.486   -12.456 1.00 0.00 ? 258 LYS A HB2  3  
ATOM 4730  H HB3  . LYS A 1 80  ? 1.729   4.471   -13.768 1.00 0.00 ? 258 LYS A HB3  3  
ATOM 4731  H HG2  . LYS A 1 80  ? 3.291   6.270   -13.130 1.00 0.00 ? 258 LYS A HG2  3  
ATOM 4732  H HG3  . LYS A 1 80  ? 3.960   5.211   -11.886 1.00 0.00 ? 258 LYS A HG3  3  
ATOM 4733  H HD2  . LYS A 1 80  ? 3.828   4.274   -14.721 1.00 0.00 ? 258 LYS A HD2  3  
ATOM 4734  H HD3  . LYS A 1 80  ? 5.113   5.377   -14.222 1.00 0.00 ? 258 LYS A HD3  3  
ATOM 4735  H HE2  . LYS A 1 80  ? 5.896   3.830   -12.579 1.00 0.00 ? 258 LYS A HE2  3  
ATOM 4736  H HE3  . LYS A 1 80  ? 4.495   2.787   -12.812 1.00 0.00 ? 258 LYS A HE3  3  
ATOM 4737  H HZ1  . LYS A 1 80  ? 5.883   1.678   -14.156 1.00 0.00 ? 258 LYS A HZ1  3  
ATOM 4738  H HZ2  . LYS A 1 80  ? 6.923   2.995   -14.373 1.00 0.00 ? 258 LYS A HZ2  3  
ATOM 4739  H HZ3  . LYS A 1 80  ? 5.503   2.879   -15.286 1.00 0.00 ? 258 LYS A HZ3  3  
ATOM 4740  N N    . VAL A 1 81  ? -1.017  4.608   -12.765 1.00 0.00 ? 259 VAL A N    3  
ATOM 4741  C CA   . VAL A 1 81  ? -2.289  3.904   -12.870 1.00 0.00 ? 259 VAL A CA   3  
ATOM 4742  C C    . VAL A 1 81  ? -2.454  3.270   -14.246 1.00 0.00 ? 259 VAL A C    3  
ATOM 4743  O O    . VAL A 1 81  ? -2.426  3.958   -15.267 1.00 0.00 ? 259 VAL A O    3  
ATOM 4744  C CB   . VAL A 1 81  ? -3.477  4.848   -12.605 1.00 0.00 ? 259 VAL A CB   3  
ATOM 4745  C CG1  . VAL A 1 81  ? -4.794  4.096   -12.724 1.00 0.00 ? 259 VAL A CG1  3  
ATOM 4746  C CG2  . VAL A 1 81  ? -3.346  5.498   -11.236 1.00 0.00 ? 259 VAL A CG2  3  
ATOM 4747  H H    . VAL A 1 81  ? -0.804  5.310   -13.415 1.00 0.00 ? 259 VAL A H    3  
ATOM 4748  H HA   . VAL A 1 81  ? -2.302  3.125   -12.121 1.00 0.00 ? 259 VAL A HA   3  
ATOM 4749  H HB   . VAL A 1 81  ? -3.464  5.627   -13.353 1.00 0.00 ? 259 VAL A HB   3  
ATOM 4750  H HG11 . VAL A 1 81  ? -4.596  3.062   -12.966 1.00 0.00 ? 259 VAL A HG11 3  
ATOM 4751  H HG12 . VAL A 1 81  ? -5.326  4.152   -11.786 1.00 0.00 ? 259 VAL A HG12 3  
ATOM 4752  H HG13 . VAL A 1 81  ? -5.392  4.540   -13.505 1.00 0.00 ? 259 VAL A HG13 3  
ATOM 4753  H HG21 . VAL A 1 81  ? -2.933  6.489   -11.347 1.00 0.00 ? 259 VAL A HG21 3  
ATOM 4754  H HG22 . VAL A 1 81  ? -4.320  5.564   -10.774 1.00 0.00 ? 259 VAL A HG22 3  
ATOM 4755  H HG23 . VAL A 1 81  ? -2.693  4.903   -10.616 1.00 0.00 ? 259 VAL A HG23 3  
ATOM 4756  N N    . LYS A 1 82  ? -2.627  1.953   -14.268 1.00 0.00 ? 260 LYS A N    3  
ATOM 4757  C CA   . LYS A 1 82  ? -2.799  1.224   -15.519 1.00 0.00 ? 260 LYS A CA   3  
ATOM 4758  C C    . LYS A 1 82  ? -4.051  0.353   -15.473 1.00 0.00 ? 260 LYS A C    3  
ATOM 4759  O O    . LYS A 1 82  ? -4.384  -0.218  -14.436 1.00 0.00 ? 260 LYS A O    3  
ATOM 4760  C CB   . LYS A 1 82  ? -1.571  0.355   -15.800 1.00 0.00 ? 260 LYS A CB   3  
ATOM 4761  C CG   . LYS A 1 82  ? -1.708  -0.508  -17.043 1.00 0.00 ? 260 LYS A CG   3  
ATOM 4762  C CD   . LYS A 1 82  ? -1.223  0.222   -18.284 1.00 0.00 ? 260 LYS A CD   3  
ATOM 4763  C CE   . LYS A 1 82  ? -1.270  -0.676  -19.512 1.00 0.00 ? 260 LYS A CE   3  
ATOM 4764  N NZ   . LYS A 1 82  ? -0.326  -0.219  -20.569 1.00 0.00 ? 260 LYS A NZ   3  
ATOM 4765  H H    . LYS A 1 82  ? -2.641  1.458   -13.421 1.00 0.00 ? 260 LYS A H    3  
ATOM 4766  H HA   . LYS A 1 82  ? -2.908  1.947   -16.312 1.00 0.00 ? 260 LYS A HA   3  
ATOM 4767  H HB2  . LYS A 1 82  ? -0.712  0.998   -15.926 1.00 0.00 ? 260 LYS A HB2  3  
ATOM 4768  H HB3  . LYS A 1 82  ? -1.403  -0.294  -14.953 1.00 0.00 ? 260 LYS A HB3  3  
ATOM 4769  H HG2  . LYS A 1 82  ? -1.121  -1.405  -16.913 1.00 0.00 ? 260 LYS A HG2  3  
ATOM 4770  H HG3  . LYS A 1 82  ? -2.748  -0.772  -17.174 1.00 0.00 ? 260 LYS A HG3  3  
ATOM 4771  H HD2  . LYS A 1 82  ? -1.855  1.080   -18.457 1.00 0.00 ? 260 LYS A HD2  3  
ATOM 4772  H HD3  . LYS A 1 82  ? -0.205  0.547   -18.126 1.00 0.00 ? 260 LYS A HD3  3  
ATOM 4773  H HE2  . LYS A 1 82  ? -1.008  -1.680  -19.217 1.00 0.00 ? 260 LYS A HE2  3  
ATOM 4774  H HE3  . LYS A 1 82  ? -2.274  -0.668  -19.909 1.00 0.00 ? 260 LYS A HE3  3  
ATOM 4775  H HZ1  . LYS A 1 82  ? 0.655   -0.314  -20.237 1.00 0.00 ? 260 LYS A HZ1  3  
ATOM 4776  H HZ2  . LYS A 1 82  ? -0.506  0.778   -20.802 1.00 0.00 ? 260 LYS A HZ2  3  
ATOM 4777  H HZ3  . LYS A 1 82  ? -0.447  -0.792  -21.428 1.00 0.00 ? 260 LYS A HZ3  3  
ATOM 4778  N N    . GLY A 1 83  ? -4.740  0.255   -16.606 1.00 0.00 ? 261 GLY A N    3  
ATOM 4779  C CA   . GLY A 1 83  ? -5.946  -0.550  -16.674 1.00 0.00 ? 261 GLY A CA   3  
ATOM 4780  C C    . GLY A 1 83  ? -6.964  -0.158  -15.621 1.00 0.00 ? 261 GLY A C    3  
ATOM 4781  O O    . GLY A 1 83  ? -6.642  0.558   -14.674 1.00 0.00 ? 261 GLY A O    3  
ATOM 4782  H H    . GLY A 1 83  ? -4.427  0.733   -17.403 1.00 0.00 ? 261 GLY A H    3  
ATOM 4783  H HA2  . GLY A 1 83  ? -6.391  -0.431  -17.651 1.00 0.00 ? 261 GLY A HA2  3  
ATOM 4784  H HA3  . GLY A 1 83  ? -5.681  -1.587  -16.533 1.00 0.00 ? 261 GLY A HA3  3  
ATOM 4785  N N    . ASN A 1 84  ? -8.196  -0.628  -15.788 1.00 0.00 ? 262 ASN A N    3  
ATOM 4786  C CA   . ASN A 1 84  ? -9.265  -0.320  -14.844 1.00 0.00 ? 262 ASN A CA   3  
ATOM 4787  C C    . ASN A 1 84  ? -9.415  -1.433  -13.811 1.00 0.00 ? 262 ASN A C    3  
ATOM 4788  O O    . ASN A 1 84  ? -10.528 -1.800  -13.436 1.00 0.00 ? 262 ASN A O    3  
ATOM 4789  C CB   . ASN A 1 84  ? -10.587 -0.118  -15.588 1.00 0.00 ? 262 ASN A CB   3  
ATOM 4790  C CG   . ASN A 1 84  ? -11.162 -1.420  -16.111 1.00 0.00 ? 262 ASN A CG   3  
ATOM 4791  O OD1  . ASN A 1 84  ? -10.641 -2.499  -15.829 1.00 0.00 ? 262 ASN A OD1  3  
ATOM 4792  N ND2  . ASN A 1 84  ? -12.241 -1.324  -16.878 1.00 0.00 ? 262 ASN A ND2  3  
ATOM 4793  H H    . ASN A 1 84  ? -8.391  -1.194  -16.563 1.00 0.00 ? 262 ASN A H    3  
ATOM 4794  H HA   . ASN A 1 84  ? -9.005  0.595   -14.335 1.00 0.00 ? 262 ASN A HA   3  
ATOM 4795  H HB2  . ASN A 1 84  ? -11.306 0.327   -14.916 1.00 0.00 ? 262 ASN A HB2  3  
ATOM 4796  H HB3  . ASN A 1 84  ? -10.425 0.545   -16.425 1.00 0.00 ? 262 ASN A HB3  3  
ATOM 4797  H HD21 . ASN A 1 84  ? -12.602 -0.431  -17.061 1.00 0.00 ? 262 ASN A HD21 3  
ATOM 4798  H HD22 . ASN A 1 84  ? -12.634 -2.150  -17.229 1.00 0.00 ? 262 ASN A HD22 3  
ATOM 4799  N N    . GLY A 1 85  ? -8.286  -1.966  -13.354 1.00 0.00 ? 263 GLY A N    3  
ATOM 4800  C CA   . GLY A 1 85  ? -8.314  -3.030  -12.368 1.00 0.00 ? 263 GLY A CA   3  
ATOM 4801  C C    . GLY A 1 85  ? -7.240  -4.073  -12.611 1.00 0.00 ? 263 GLY A C    3  
ATOM 4802  O O    . GLY A 1 85  ? -7.481  -5.269  -12.456 1.00 0.00 ? 263 GLY A O    3  
ATOM 4803  H H    . GLY A 1 85  ? -7.427  -1.633  -13.689 1.00 0.00 ? 263 GLY A H    3  
ATOM 4804  H HA2  . GLY A 1 85  ? -8.170  -2.602  -11.388 1.00 0.00 ? 263 GLY A HA2  3  
ATOM 4805  H HA3  . GLY A 1 85  ? -9.280  -3.511  -12.402 1.00 0.00 ? 263 GLY A HA3  3  
ATOM 4806  N N    . GLY A 1 86  ? -6.051  -3.618  -12.994 1.00 0.00 ? 264 GLY A N    3  
ATOM 4807  C CA   . GLY A 1 86  ? -4.955  -4.533  -13.254 1.00 0.00 ? 264 GLY A CA   3  
ATOM 4808  C C    . GLY A 1 86  ? -3.882  -4.471  -12.186 1.00 0.00 ? 264 GLY A C    3  
ATOM 4809  O O    . GLY A 1 86  ? -3.984  -5.135  -11.154 1.00 0.00 ? 264 GLY A O    3  
ATOM 4810  H H    . GLY A 1 86  ? -5.917  -2.653  -13.101 1.00 0.00 ? 264 GLY A H    3  
ATOM 4811  H HA2  . GLY A 1 86  ? -5.345  -5.539  -13.301 1.00 0.00 ? 264 GLY A HA2  3  
ATOM 4812  H HA3  . GLY A 1 86  ? -4.513  -4.285  -14.207 1.00 0.00 ? 264 GLY A HA3  3  
ATOM 4813  N N    . VAL A 1 87  ? -2.848  -3.673  -12.433 1.00 0.00 ? 265 VAL A N    3  
ATOM 4814  C CA   . VAL A 1 87  ? -1.751  -3.527  -11.484 1.00 0.00 ? 265 VAL A CA   3  
ATOM 4815  C C    . VAL A 1 87  ? -1.600  -2.077  -11.037 1.00 0.00 ? 265 VAL A C    3  
ATOM 4816  O O    . VAL A 1 87  ? -1.685  -1.154  -11.847 1.00 0.00 ? 265 VAL A O    3  
ATOM 4817  C CB   . VAL A 1 87  ? -0.418  -4.007  -12.089 1.00 0.00 ? 265 VAL A CB   3  
ATOM 4818  C CG1  . VAL A 1 87  ? 0.724   -3.782  -11.111 1.00 0.00 ? 265 VAL A CG1  3  
ATOM 4819  C CG2  . VAL A 1 87  ? -0.511  -5.473  -12.486 1.00 0.00 ? 265 VAL A CG2  3  
ATOM 4820  H H    . VAL A 1 87  ? -2.824  -3.169  -13.273 1.00 0.00 ? 265 VAL A H    3  
ATOM 4821  H HA   . VAL A 1 87  ? -1.972  -4.139  -10.622 1.00 0.00 ? 265 VAL A HA   3  
ATOM 4822  H HB   . VAL A 1 87  ? -0.221  -3.427  -12.979 1.00 0.00 ? 265 VAL A HB   3  
ATOM 4823  H HG11 . VAL A 1 87  ? 0.564   -4.382  -10.227 1.00 0.00 ? 265 VAL A HG11 3  
ATOM 4824  H HG12 . VAL A 1 87  ? 1.658   -4.065  -11.576 1.00 0.00 ? 265 VAL A HG12 3  
ATOM 4825  H HG13 . VAL A 1 87  ? 0.761   -2.738  -10.835 1.00 0.00 ? 265 VAL A HG13 3  
ATOM 4826  H HG21 . VAL A 1 87  ? 0.164   -5.666  -13.306 1.00 0.00 ? 265 VAL A HG21 3  
ATOM 4827  H HG22 . VAL A 1 87  ? -0.240  -6.092  -11.643 1.00 0.00 ? 265 VAL A HG22 3  
ATOM 4828  H HG23 . VAL A 1 87  ? -1.522  -5.701  -12.789 1.00 0.00 ? 265 VAL A HG23 3  
ATOM 4829  N N    . VAL A 1 88  ? -1.377  -1.884  -9.741  1.00 0.00 ? 266 VAL A N    3  
ATOM 4830  C CA   . VAL A 1 88  ? -1.212  -0.546  -9.184  1.00 0.00 ? 266 VAL A CA   3  
ATOM 4831  C C    . VAL A 1 88  ? 0.199   -0.345  -8.644  1.00 0.00 ? 266 VAL A C    3  
ATOM 4832  O O    . VAL A 1 88  ? 0.774   -1.245  -8.030  1.00 0.00 ? 266 VAL A O    3  
ATOM 4833  C CB   . VAL A 1 88  ? -2.226  -0.280  -8.055  1.00 0.00 ? 266 VAL A CB   3  
ATOM 4834  C CG1  . VAL A 1 88  ? -2.024  1.112   -7.475  1.00 0.00 ? 266 VAL A CG1  3  
ATOM 4835  C CG2  . VAL A 1 88  ? -3.648  -0.453  -8.565  1.00 0.00 ? 266 VAL A CG2  3  
ATOM 4836  H H    . VAL A 1 88  ? -1.320  -2.660  -9.145  1.00 0.00 ? 266 VAL A H    3  
ATOM 4837  H HA   . VAL A 1 88  ? -1.390  0.168   -9.975  1.00 0.00 ? 266 VAL A HA   3  
ATOM 4838  H HB   . VAL A 1 88  ? -2.057  -1.001  -7.270  1.00 0.00 ? 266 VAL A HB   3  
ATOM 4839  H HG11 . VAL A 1 88  ? -0.984  1.246   -7.214  1.00 0.00 ? 266 VAL A HG11 3  
ATOM 4840  H HG12 . VAL A 1 88  ? -2.312  1.853   -8.206  1.00 0.00 ? 266 VAL A HG12 3  
ATOM 4841  H HG13 . VAL A 1 88  ? -2.633  1.223   -6.589  1.00 0.00 ? 266 VAL A HG13 3  
ATOM 4842  H HG21 . VAL A 1 88  ? -3.939  -1.489  -8.475  1.00 0.00 ? 266 VAL A HG21 3  
ATOM 4843  H HG22 . VAL A 1 88  ? -4.318  0.161   -7.980  1.00 0.00 ? 266 VAL A HG22 3  
ATOM 4844  H HG23 . VAL A 1 88  ? -3.699  -0.153  -9.601  1.00 0.00 ? 266 VAL A HG23 3  
ATOM 4845  N N    . SER A 1 89  ? 0.752   0.841   -8.875  1.00 0.00 ? 267 SER A N    3  
ATOM 4846  C CA   . SER A 1 89  ? 2.098   1.160   -8.414  1.00 0.00 ? 267 SER A CA   3  
ATOM 4847  C C    . SER A 1 89  ? 2.052   1.968   -7.121  1.00 0.00 ? 267 SER A C    3  
ATOM 4848  O O    . SER A 1 89  ? 1.408   3.015   -7.052  1.00 0.00 ? 267 SER A O    3  
ATOM 4849  C CB   . SER A 1 89  ? 2.857   1.939   -9.490  1.00 0.00 ? 267 SER A CB   3  
ATOM 4850  O OG   . SER A 1 89  ? 4.255   1.738   -9.375  1.00 0.00 ? 267 SER A OG   3  
ATOM 4851  H H    . SER A 1 89  ? 0.243   1.517   -9.370  1.00 0.00 ? 267 SER A H    3  
ATOM 4852  H HA   . SER A 1 89  ? 2.613   0.229   -8.226  1.00 0.00 ? 267 SER A HA   3  
ATOM 4853  H HB2  . SER A 1 89  ? 2.537   1.607   -10.465 1.00 0.00 ? 267 SER A HB2  3  
ATOM 4854  H HB3  . SER A 1 89  ? 2.647   2.994   -9.382  1.00 0.00 ? 267 SER A HB3  3  
ATOM 4855  H HG   . SER A 1 89  ? 4.546   2.001   -8.498  1.00 0.00 ? 267 SER A HG   3  
ATOM 4856  N N    . LEU A 1 90  ? 2.740   1.474   -6.098  1.00 0.00 ? 268 LEU A N    3  
ATOM 4857  C CA   . LEU A 1 90  ? 2.780   2.149   -4.805  1.00 0.00 ? 268 LEU A CA   3  
ATOM 4858  C C    . LEU A 1 90  ? 4.212   2.499   -4.417  1.00 0.00 ? 268 LEU A C    3  
ATOM 4859  O O    . LEU A 1 90  ? 5.159   1.825   -4.823  1.00 0.00 ? 268 LEU A O    3  
ATOM 4860  C CB   . LEU A 1 90  ? 2.149   1.266   -3.727  1.00 0.00 ? 268 LEU A CB   3  
ATOM 4861  C CG   . LEU A 1 90  ? 0.620   1.232   -3.697  1.00 0.00 ? 268 LEU A CG   3  
ATOM 4862  C CD1  . LEU A 1 90  ? 0.129   0.167   -2.728  1.00 0.00 ? 268 LEU A CD1  3  
ATOM 4863  C CD2  . LEU A 1 90  ? 0.064   2.597   -3.318  1.00 0.00 ? 268 LEU A CD2  3  
ATOM 4864  H H    . LEU A 1 90  ? 3.234   0.636   -6.213  1.00 0.00 ? 268 LEU A H    3  
ATOM 4865  H HA   . LEU A 1 90  ? 2.209   3.062   -4.891  1.00 0.00 ? 268 LEU A HA   3  
ATOM 4866  H HB2  . LEU A 1 90  ? 2.498   0.256   -3.880  1.00 0.00 ? 268 LEU A HB2  3  
ATOM 4867  H HB3  . LEU A 1 90  ? 2.492   1.622   -2.766  1.00 0.00 ? 268 LEU A HB3  3  
ATOM 4868  H HG   . LEU A 1 90  ? 0.252   0.982   -4.682  1.00 0.00 ? 268 LEU A HG   3  
ATOM 4869  H HD11 . LEU A 1 90  ? 0.060   -0.780  -3.241  1.00 0.00 ? 268 LEU A HD11 3  
ATOM 4870  H HD12 . LEU A 1 90  ? -0.844  0.445   -2.352  1.00 0.00 ? 268 LEU A HD12 3  
ATOM 4871  H HD13 . LEU A 1 90  ? 0.823   0.082   -1.905  1.00 0.00 ? 268 LEU A HD13 3  
ATOM 4872  H HD21 . LEU A 1 90  ? -1.005  2.526   -3.187  1.00 0.00 ? 268 LEU A HD21 3  
ATOM 4873  H HD22 . LEU A 1 90  ? 0.285   3.306   -4.103  1.00 0.00 ? 268 LEU A HD22 3  
ATOM 4874  H HD23 . LEU A 1 90  ? 0.519   2.928   -2.396  1.00 0.00 ? 268 LEU A HD23 3  
ATOM 4875  N N    . SER A 1 91  ? 4.364   3.557   -3.626  1.00 0.00 ? 269 SER A N    3  
ATOM 4876  C CA   . SER A 1 91  ? 5.682   3.998   -3.184  1.00 0.00 ? 269 SER A CA   3  
ATOM 4877  C C    . SER A 1 91  ? 5.572   4.872   -1.938  1.00 0.00 ? 269 SER A C    3  
ATOM 4878  O O    . SER A 1 91  ? 4.636   5.659   -1.798  1.00 0.00 ? 269 SER A O    3  
ATOM 4879  C CB   . SER A 1 91  ? 6.386   4.770   -4.302  1.00 0.00 ? 269 SER A CB   3  
ATOM 4880  O OG   . SER A 1 91  ? 5.725   5.993   -4.572  1.00 0.00 ? 269 SER A OG   3  
ATOM 4881  H H    . SER A 1 91  ? 3.571   4.054   -3.336  1.00 0.00 ? 269 SER A H    3  
ATOM 4882  H HA   . SER A 1 91  ? 6.262   3.120   -2.944  1.00 0.00 ? 269 SER A HA   3  
ATOM 4883  H HB2  . SER A 1 91  ? 7.402   4.982   -4.005  1.00 0.00 ? 269 SER A HB2  3  
ATOM 4884  H HB3  . SER A 1 91  ? 6.392   4.171   -5.201  1.00 0.00 ? 269 SER A HB3  3  
ATOM 4885  H HG   . SER A 1 91  ? 6.277   6.538   -5.137  1.00 0.00 ? 269 SER A HG   3  
ATOM 4886  N N    . VAL A 1 92  ? 6.537   4.727   -1.035  1.00 0.00 ? 270 VAL A N    3  
ATOM 4887  C CA   . VAL A 1 92  ? 6.551   5.503   0.199   1.00 0.00 ? 270 VAL A CA   3  
ATOM 4888  C C    . VAL A 1 92  ? 7.114   6.900   -0.036  1.00 0.00 ? 270 VAL A C    3  
ATOM 4889  O O    . VAL A 1 92  ? 8.243   7.055   -0.500  1.00 0.00 ? 270 VAL A O    3  
ATOM 4890  C CB   . VAL A 1 92  ? 7.381   4.804   1.292   1.00 0.00 ? 270 VAL A CB   3  
ATOM 4891  C CG1  . VAL A 1 92  ? 7.345   5.605   2.585   1.00 0.00 ? 270 VAL A CG1  3  
ATOM 4892  C CG2  . VAL A 1 92  ? 6.877   3.387   1.519   1.00 0.00 ? 270 VAL A CG2  3  
ATOM 4893  H H    . VAL A 1 92  ? 7.256   4.084   -1.203  1.00 0.00 ? 270 VAL A H    3  
ATOM 4894  H HA   . VAL A 1 92  ? 5.533   5.590   0.551   1.00 0.00 ? 270 VAL A HA   3  
ATOM 4895  H HB   . VAL A 1 92  ? 8.406   4.749   0.957   1.00 0.00 ? 270 VAL A HB   3  
ATOM 4896  H HG11 . VAL A 1 92  ? 6.715   5.100   3.303   1.00 0.00 ? 270 VAL A HG11 3  
ATOM 4897  H HG12 . VAL A 1 92  ? 8.345   5.695   2.981   1.00 0.00 ? 270 VAL A HG12 3  
ATOM 4898  H HG13 . VAL A 1 92  ? 6.946   6.589   2.387   1.00 0.00 ? 270 VAL A HG13 3  
ATOM 4899  H HG21 . VAL A 1 92  ? 6.528   2.975   0.583   1.00 0.00 ? 270 VAL A HG21 3  
ATOM 4900  H HG22 . VAL A 1 92  ? 7.680   2.775   1.904   1.00 0.00 ? 270 VAL A HG22 3  
ATOM 4901  H HG23 . VAL A 1 92  ? 6.065   3.403   2.231   1.00 0.00 ? 270 VAL A HG23 3  
ATOM 4902  N N    . GLY A 1 93  ? 6.319   7.915   0.289   1.00 0.00 ? 271 GLY A N    3  
ATOM 4903  C CA   . GLY A 1 93  ? 6.756   9.287   0.106   1.00 0.00 ? 271 GLY A CA   3  
ATOM 4904  C C    . GLY A 1 93  ? 6.967   10.009  1.422   1.00 0.00 ? 271 GLY A C    3  
ATOM 4905  O O    . GLY A 1 93  ? 6.012   10.480  2.040   1.00 0.00 ? 271 GLY A O    3  
ATOM 4906  H H    . GLY A 1 93  ? 5.429   7.731   0.655   1.00 0.00 ? 271 GLY A H    3  
ATOM 4907  H HA2  . GLY A 1 93  ? 7.685   9.287   -0.446  1.00 0.00 ? 271 GLY A HA2  3  
ATOM 4908  H HA3  . GLY A 1 93  ? 6.009   9.817   -0.466  1.00 0.00 ? 271 GLY A HA3  3  
ATOM 4909  N N    . HIS A 1 94  ? 8.221   10.095  1.854   1.00 0.00 ? 272 HIS A N    3  
ATOM 4910  C CA   . HIS A 1 94  ? 8.554   10.764  3.106   1.00 0.00 ? 272 HIS A CA   3  
ATOM 4911  C C    . HIS A 1 94  ? 8.706   12.267  2.896   1.00 0.00 ? 272 HIS A C    3  
ATOM 4912  O O    . HIS A 1 94  ? 9.811   12.765  2.679   1.00 0.00 ? 272 HIS A O    3  
ATOM 4913  C CB   . HIS A 1 94  ? 9.844   10.186  3.690   1.00 0.00 ? 272 HIS A CB   3  
ATOM 4914  C CG   . HIS A 1 94  ? 9.632   8.938   4.491   1.00 0.00 ? 272 HIS A CG   3  
ATOM 4915  N ND1  . HIS A 1 94  ? 10.560  8.453   5.388   1.00 0.00 ? 272 HIS A ND1  3  
ATOM 4916  C CD2  . HIS A 1 94  ? 8.589   8.076   4.528   1.00 0.00 ? 272 HIS A CD2  3  
ATOM 4917  C CE1  . HIS A 1 94  ? 10.098  7.345   5.940   1.00 0.00 ? 272 HIS A CE1  3  
ATOM 4918  N NE2  . HIS A 1 94  ? 8.904   7.095   5.436   1.00 0.00 ? 272 HIS A NE2  3  
ATOM 4919  H H    . HIS A 1 94  ? 8.940   9.700   1.317   1.00 0.00 ? 272 HIS A H    3  
ATOM 4920  H HA   . HIS A 1 94  ? 7.746   10.590  3.800   1.00 0.00 ? 272 HIS A HA   3  
ATOM 4921  H HB2  . HIS A 1 94  ? 10.522  9.951   2.884   1.00 0.00 ? 272 HIS A HB2  3  
ATOM 4922  H HB3  . HIS A 1 94  ? 10.301  10.922  4.336   1.00 0.00 ? 272 HIS A HB3  3  
ATOM 4923  H HD1  . HIS A 1 94  ? 11.429  8.859   5.588   1.00 0.00 ? 272 HIS A HD1  3  
ATOM 4924  H HD2  . HIS A 1 94  ? 7.678   8.146   3.950   1.00 0.00 ? 272 HIS A HD2  3  
ATOM 4925  H HE1  . HIS A 1 94  ? 10.609  6.746   6.679   1.00 0.00 ? 272 HIS A HE1  3  
ATOM 4926  H HE2  . HIS A 1 94  ? 8.376   6.288   5.609   1.00 0.00 ? 272 HIS A HE2  3  
ATOM 4927  N N    . SER A 1 95  ? 7.589   12.985  2.961   1.00 0.00 ? 273 SER A N    3  
ATOM 4928  C CA   . SER A 1 95  ? 7.598   14.431  2.773   1.00 0.00 ? 273 SER A CA   3  
ATOM 4929  C C    . SER A 1 95  ? 6.435   15.082  3.515   1.00 0.00 ? 273 SER A C    3  
ATOM 4930  O O    . SER A 1 95  ? 5.610   14.398  4.120   1.00 0.00 ? 273 SER A O    3  
ATOM 4931  C CB   . SER A 1 95  ? 7.523   14.773  1.283   1.00 0.00 ? 273 SER A CB   3  
ATOM 4932  O OG   . SER A 1 95  ? 8.798   14.679  0.673   1.00 0.00 ? 273 SER A OG   3  
ATOM 4933  H H    . SER A 1 95  ? 6.739   12.530  3.137   1.00 0.00 ? 273 SER A H    3  
ATOM 4934  H HA   . SER A 1 95  ? 8.525   14.812  3.174   1.00 0.00 ? 273 SER A HA   3  
ATOM 4935  H HB2  . SER A 1 95  ? 6.851   14.086  0.792   1.00 0.00 ? 273 SER A HB2  3  
ATOM 4936  H HB3  . SER A 1 95  ? 7.154   15.783  1.167   1.00 0.00 ? 273 SER A HB3  3  
ATOM 4937  H HG   . SER A 1 95  ? 8.693   14.602  -0.278  1.00 0.00 ? 273 SER A HG   3  
ATOM 4938  N N    . GLU A 1 96  ? 6.378   16.410  3.464   1.00 0.00 ? 274 GLU A N    3  
ATOM 4939  C CA   . GLU A 1 96  ? 5.317   17.154  4.133   1.00 0.00 ? 274 GLU A CA   3  
ATOM 4940  C C    . GLU A 1 96  ? 3.954   16.809  3.540   1.00 0.00 ? 274 GLU A C    3  
ATOM 4941  O O    . GLU A 1 96  ? 3.632   17.210  2.421   1.00 0.00 ? 274 GLU A O    3  
ATOM 4942  C CB   . GLU A 1 96  ? 5.570   18.659  4.019   1.00 0.00 ? 274 GLU A CB   3  
ATOM 4943  C CG   . GLU A 1 96  ? 4.877   19.475  5.098   1.00 0.00 ? 274 GLU A CG   3  
ATOM 4944  C CD   . GLU A 1 96  ? 5.436   19.207  6.481   1.00 0.00 ? 274 GLU A CD   3  
ATOM 4945  O OE1  . GLU A 1 96  ? 6.597   18.756  6.576   1.00 0.00 ? 274 GLU A OE1  3  
ATOM 4946  O OE2  . GLU A 1 96  ? 4.712   19.449  7.470   1.00 0.00 ? 274 GLU A OE2  3  
ATOM 4947  H H    . GLU A 1 96  ? 7.065   16.899  2.966   1.00 0.00 ? 274 GLU A H    3  
ATOM 4948  H HA   . GLU A 1 96  ? 5.323   16.875  5.176   1.00 0.00 ? 274 GLU A HA   3  
ATOM 4949  H HB2  . GLU A 1 96  ? 6.632   18.839  4.086   1.00 0.00 ? 274 GLU A HB2  3  
ATOM 4950  H HB3  . GLU A 1 96  ? 5.216   18.999  3.057   1.00 0.00 ? 274 GLU A HB3  3  
ATOM 4951  H HG2  . GLU A 1 96  ? 5.002   20.524  4.873   1.00 0.00 ? 274 GLU A HG2  3  
ATOM 4952  H HG3  . GLU A 1 96  ? 3.825   19.231  5.097   1.00 0.00 ? 274 GLU A HG3  3  
ATOM 4953  N N    . VAL A 1 97  ? 3.157   16.063  4.298   1.00 0.00 ? 275 VAL A N    3  
ATOM 4954  C CA   . VAL A 1 97  ? 1.828   15.664  3.849   1.00 0.00 ? 275 VAL A CA   3  
ATOM 4955  C C    . VAL A 1 97  ? 1.050   16.858  3.308   1.00 0.00 ? 275 VAL A C    3  
ATOM 4956  O O    . VAL A 1 97  ? 0.372   16.759  2.285   1.00 0.00 ? 275 VAL A O    3  
ATOM 4957  C CB   . VAL A 1 97  ? 1.022   15.014  4.988   1.00 0.00 ? 275 VAL A CB   3  
ATOM 4958  C CG1  . VAL A 1 97  ? 1.686   13.723  5.443   1.00 0.00 ? 275 VAL A CG1  3  
ATOM 4959  C CG2  . VAL A 1 97  ? 0.868   15.982  6.152   1.00 0.00 ? 275 VAL A CG2  3  
ATOM 4960  H H    . VAL A 1 97  ? 3.469   15.774  5.180   1.00 0.00 ? 275 VAL A H    3  
ATOM 4961  H HA   . VAL A 1 97  ? 1.947   14.937  3.059   1.00 0.00 ? 275 VAL A HA   3  
ATOM 4962  H HB   . VAL A 1 97  ? 0.038   14.774  4.614   1.00 0.00 ? 275 VAL A HB   3  
ATOM 4963  H HG11 . VAL A 1 97  ? 2.581   13.555  4.861   1.00 0.00 ? 275 VAL A HG11 3  
ATOM 4964  H HG12 . VAL A 1 97  ? 1.944   13.799  6.489   1.00 0.00 ? 275 VAL A HG12 3  
ATOM 4965  H HG13 . VAL A 1 97  ? 1.004   12.897  5.299   1.00 0.00 ? 275 VAL A HG13 3  
ATOM 4966  H HG21 . VAL A 1 97  ? 0.415   15.470  6.987   1.00 0.00 ? 275 VAL A HG21 3  
ATOM 4967  H HG22 . VAL A 1 97  ? 1.840   16.354  6.442   1.00 0.00 ? 275 VAL A HG22 3  
ATOM 4968  H HG23 . VAL A 1 97  ? 0.241   16.808  5.852   1.00 0.00 ? 275 VAL A HG23 3  
ATOM 4969  N N    . SER A 1 98  ? 1.152   17.988  4.001   1.00 0.00 ? 276 SER A N    3  
ATOM 4970  C CA   . SER A 1 98  ? 0.454   19.201  3.593   1.00 0.00 ? 276 SER A CA   3  
ATOM 4971  C C    . SER A 1 98  ? 1.399   20.151  2.861   1.00 0.00 ? 276 SER A C    3  
ATOM 4972  O O    . SER A 1 98  ? 2.620   20.014  2.941   1.00 0.00 ? 276 SER A O    3  
ATOM 4973  C CB   . SER A 1 98  ? -0.149  19.903  4.811   1.00 0.00 ? 276 SER A CB   3  
ATOM 4974  O OG   . SER A 1 98  ? 0.861   20.477  5.622   1.00 0.00 ? 276 SER A OG   3  
ATOM 4975  H H    . SER A 1 98  ? 1.707   18.004  4.809   1.00 0.00 ? 276 SER A H    3  
ATOM 4976  H HA   . SER A 1 98  ? -0.342  18.916  2.921   1.00 0.00 ? 276 SER A HA   3  
ATOM 4977  H HB2  . SER A 1 98  ? -0.816  20.685  4.480   1.00 0.00 ? 276 SER A HB2  3  
ATOM 4978  H HB3  . SER A 1 98  ? -0.701  19.184  5.400   1.00 0.00 ? 276 SER A HB3  3  
ATOM 4979  H HG   . SER A 1 98  ? 1.205   21.265  5.194   1.00 0.00 ? 276 SER A HG   3  
ATOM 4980  N N    . THR A 1 99  ? 0.824   21.114  2.148   1.00 0.00 ? 277 THR A N    3  
ATOM 4981  C CA   . THR A 1 99  ? 1.612   22.086  1.401   1.00 0.00 ? 277 THR A CA   3  
ATOM 4982  C C    . THR A 1 99  ? 0.909   23.437  1.344   1.00 0.00 ? 277 THR A C    3  
ATOM 4983  O O    . THR A 1 99  ? -0.251  23.560  1.734   1.00 0.00 ? 277 THR A O    3  
ATOM 4984  C CB   . THR A 1 99  ? 1.886   21.602  -0.036  1.00 0.00 ? 277 THR A CB   3  
ATOM 4985  O OG1  . THR A 1 99  ? 0.649   21.390  -0.725  1.00 0.00 ? 277 THR A OG1  3  
ATOM 4986  C CG2  . THR A 1 99  ? 2.695   20.314  -0.028  1.00 0.00 ? 277 THR A CG2  3  
ATOM 4987  H H    . THR A 1 99  ? -0.154  21.170  2.123   1.00 0.00 ? 277 THR A H    3  
ATOM 4988  H HA   . THR A 1 99  ? 2.560   22.204  1.905   1.00 0.00 ? 277 THR A HA   3  
ATOM 4989  H HB   . THR A 1 99  ? 2.453   22.362  -0.554  1.00 0.00 ? 277 THR A HB   3  
ATOM 4990  H HG1  . THR A 1 99  ? 0.825   20.999  -1.585  1.00 0.00 ? 277 THR A HG1  3  
ATOM 4991  H HG21 . THR A 1 99  ? 2.184   19.571  0.567   1.00 0.00 ? 277 THR A HG21 3  
ATOM 4992  H HG22 . THR A 1 99  ? 3.671   20.504  0.394   1.00 0.00 ? 277 THR A HG22 3  
ATOM 4993  H HG23 . THR A 1 99  ? 2.804   19.952  -1.039  1.00 0.00 ? 277 THR A HG23 3  
ATOM 4994  N N    . ALA A 1 100 ? 1.620   24.448  0.856   1.00 0.00 ? 278 ALA A N    3  
ATOM 4995  C CA   . ALA A 1 100 ? 1.063   25.791  0.746   1.00 0.00 ? 278 ALA A CA   3  
ATOM 4996  C C    . ALA A 1 100 ? 0.024   25.864  -0.368  1.00 0.00 ? 278 ALA A C    3  
ATOM 4997  O O    . ALA A 1 100 ? 0.192   25.258  -1.427  1.00 0.00 ? 278 ALA A O    3  
ATOM 4998  C CB   . ALA A 1 100 ? 2.171   26.804  0.505   1.00 0.00 ? 278 ALA A CB   3  
ATOM 4999  H H    . ALA A 1 100 ? 2.540   24.287  0.561   1.00 0.00 ? 278 ALA A H    3  
ATOM 5000  H HA   . ALA A 1 100 ? 0.586   26.032  1.685   1.00 0.00 ? 278 ALA A HA   3  
ATOM 5001  H HB1  . ALA A 1 100 ? 2.451   27.261  1.443   1.00 0.00 ? 278 ALA A HB1  3  
ATOM 5002  H HB2  . ALA A 1 100 ? 3.028   26.305  0.077   1.00 0.00 ? 278 ALA A HB2  3  
ATOM 5003  H HB3  . ALA A 1 100 ? 1.821   27.566  -0.176  1.00 0.00 ? 278 ALA A HB3  3  
ATOM 5004  N N    . ILE A 1 101 ? -1.048  26.610  -0.123  1.00 0.00 ? 279 ILE A N    3  
ATOM 5005  C CA   . ILE A 1 101 ? -2.113  26.762  -1.106  1.00 0.00 ? 279 ILE A CA   3  
ATOM 5006  C C    . ILE A 1 101 ? -1.579  27.351  -2.408  1.00 0.00 ? 279 ILE A C    3  
ATOM 5007  O O    . ILE A 1 101 ? -0.709  28.221  -2.397  1.00 0.00 ? 279 ILE A O    3  
ATOM 5008  C CB   . ILE A 1 101 ? -3.245  27.662  -0.575  1.00 0.00 ? 279 ILE A CB   3  
ATOM 5009  C CG1  . ILE A 1 101 ? -3.856  27.056  0.690   1.00 0.00 ? 279 ILE A CG1  3  
ATOM 5010  C CG2  . ILE A 1 101 ? -4.310  27.859  -1.643  1.00 0.00 ? 279 ILE A CG2  3  
ATOM 5011  C CD1  . ILE A 1 101 ? -3.102  27.406  1.953   1.00 0.00 ? 279 ILE A CD1  3  
ATOM 5012  H H    . ILE A 1 101 ? -1.124  27.069  0.739   1.00 0.00 ? 279 ILE A H    3  
ATOM 5013  H HA   . ILE A 1 101 ? -2.523  25.783  -1.308  1.00 0.00 ? 279 ILE A HA   3  
ATOM 5014  H HB   . ILE A 1 101 ? -2.826  28.627  -0.337  1.00 0.00 ? 279 ILE A HB   3  
ATOM 5015  H HG12 . ILE A 1 101 ? -4.868  27.413  0.799   1.00 0.00 ? 279 ILE A HG12 3  
ATOM 5016  H HG13 . ILE A 1 101 ? -3.867  25.980  0.596   1.00 0.00 ? 279 ILE A HG13 3  
ATOM 5017  H HG21 . ILE A 1 101 ? -4.308  28.888  -1.969  1.00 0.00 ? 279 ILE A HG21 3  
ATOM 5018  H HG22 . ILE A 1 101 ? -4.099  27.216  -2.485  1.00 0.00 ? 279 ILE A HG22 3  
ATOM 5019  H HG23 . ILE A 1 101 ? -5.279  27.612  -1.236  1.00 0.00 ? 279 ILE A HG23 3  
ATOM 5020  H HD11 . ILE A 1 101 ? -2.526  26.552  2.278   1.00 0.00 ? 279 ILE A HD11 3  
ATOM 5021  H HD12 . ILE A 1 101 ? -2.439  28.236  1.759   1.00 0.00 ? 279 ILE A HD12 3  
ATOM 5022  H HD13 . ILE A 1 101 ? -3.804  27.681  2.727   1.00 0.00 ? 279 ILE A HD13 3  
ATOM 5023  N N    . ALA A 1 102 ? -2.108  26.871  -3.529  1.00 0.00 ? 280 ALA A N    3  
ATOM 5024  C CA   . ALA A 1 102 ? -1.688  27.352  -4.839  1.00 0.00 ? 280 ALA A CA   3  
ATOM 5025  C C    . ALA A 1 102 ? -2.112  28.801  -5.053  1.00 0.00 ? 280 ALA A C    3  
ATOM 5026  O O    . ALA A 1 102 ? -1.486  29.535  -5.819  1.00 0.00 ? 280 ALA A O    3  
ATOM 5027  C CB   . ALA A 1 102 ? -2.260  26.465  -5.935  1.00 0.00 ? 280 ALA A CB   3  
ATOM 5028  H H    . ALA A 1 102 ? -2.799  26.178  -3.473  1.00 0.00 ? 280 ALA A H    3  
ATOM 5029  H HA   . ALA A 1 102 ? -0.611  27.291  -4.887  1.00 0.00 ? 280 ALA A HA   3  
ATOM 5030  H HB1  . ALA A 1 102 ? -2.917  27.049  -6.563  1.00 0.00 ? 280 ALA A HB1  3  
ATOM 5031  H HB2  . ALA A 1 102 ? -1.454  26.064  -6.530  1.00 0.00 ? 280 ALA A HB2  3  
ATOM 5032  H HB3  . ALA A 1 102 ? -2.817  25.654  -5.488  1.00 0.00 ? 280 ALA A HB3  3  
ATOM 5033  N N    . THR A 1 103 ? -3.179  29.208  -4.373  1.00 0.00 ? 281 THR A N    3  
ATOM 5034  C CA   . THR A 1 103 ? -3.688  30.568  -4.491  1.00 0.00 ? 281 THR A CA   3  
ATOM 5035  C C    . THR A 1 103 ? -3.179  31.446  -3.353  1.00 0.00 ? 281 THR A C    3  
ATOM 5036  O O    . THR A 1 103 ? -2.853  30.951  -2.275  1.00 0.00 ? 281 THR A O    3  
ATOM 5037  C CB   . THR A 1 103 ? -5.228  30.594  -4.495  1.00 0.00 ? 281 THR A CB   3  
ATOM 5038  O OG1  . THR A 1 103 ? -5.731  30.041  -3.274  1.00 0.00 ? 281 THR A OG1  3  
ATOM 5039  C CG2  . THR A 1 103 ? -5.779  29.811  -5.677  1.00 0.00 ? 281 THR A CG2  3  
ATOM 5040  H H    . THR A 1 103 ? -3.636  28.576  -3.779  1.00 0.00 ? 281 THR A H    3  
ATOM 5041  H HA   . THR A 1 103 ? -3.339  30.975  -5.429  1.00 0.00 ? 281 THR A HA   3  
ATOM 5042  H HB   . THR A 1 103 ? -5.555  31.621  -4.579  1.00 0.00 ? 281 THR A HB   3  
ATOM 5043  H HG1  . THR A 1 103 ? -5.835  29.092  -3.371  1.00 0.00 ? 281 THR A HG1  3  
ATOM 5044  H HG21 . THR A 1 103 ? -4.961  29.385  -6.240  1.00 0.00 ? 281 THR A HG21 3  
ATOM 5045  H HG22 . THR A 1 103 ? -6.348  30.472  -6.313  1.00 0.00 ? 281 THR A HG22 3  
ATOM 5046  H HG23 . THR A 1 103 ? -6.418  29.019  -5.317  1.00 0.00 ? 281 THR A HG23 3  
ATOM 5047  N N    . GLU A 1 104 ? -3.116  32.750  -3.600  1.00 0.00 ? 282 GLU A N    3  
ATOM 5048  C CA   . GLU A 1 104 ? -2.647  33.696  -2.594  1.00 0.00 ? 282 GLU A CA   3  
ATOM 5049  C C    . GLU A 1 104 ? -3.746  34.003  -1.582  1.00 0.00 ? 282 GLU A C    3  
ATOM 5050  O O    . GLU A 1 104 ? -4.931  33.824  -1.864  1.00 0.00 ? 282 GLU A O    3  
ATOM 5051  C CB   . GLU A 1 104 ? -2.175  34.990  -3.260  1.00 0.00 ? 282 GLU A CB   3  
ATOM 5052  C CG   . GLU A 1 104 ? -0.903  34.827  -4.075  1.00 0.00 ? 282 GLU A CG   3  
ATOM 5053  C CD   . GLU A 1 104 ? -0.162  36.136  -4.269  1.00 0.00 ? 282 GLU A CD   3  
ATOM 5054  O OE1  . GLU A 1 104 ? 0.623   36.512  -3.373  1.00 0.00 ? 282 GLU A OE1  3  
ATOM 5055  O OE2  . GLU A 1 104 ? -0.367  36.783  -5.317  1.00 0.00 ? 282 GLU A OE2  3  
ATOM 5056  H H    . GLU A 1 104 ? -3.390  33.084  -4.480  1.00 0.00 ? 282 GLU A H    3  
ATOM 5057  H HA   . GLU A 1 104 ? -1.814  33.244  -2.077  1.00 0.00 ? 282 GLU A HA   3  
ATOM 5058  H HB2  . GLU A 1 104 ? -2.955  35.349  -3.915  1.00 0.00 ? 282 GLU A HB2  3  
ATOM 5059  H HB3  . GLU A 1 104 ? -1.993  35.729  -2.493  1.00 0.00 ? 282 GLU A HB3  3  
ATOM 5060  H HG2  . GLU A 1 104 ? -0.251  34.134  -3.566  1.00 0.00 ? 282 GLU A HG2  3  
ATOM 5061  H HG3  . GLU A 1 104 ? -1.161  34.429  -5.046  1.00 0.00 ? 282 GLU A HG3  3  
ATOM 5062  N N    . GLN A 1 105 ? -3.344  34.466  -0.403  1.00 0.00 ? 283 GLN A N    3  
ATOM 5063  C CA   . GLN A 1 105 ? -4.294  34.797  0.652   1.00 0.00 ? 283 GLN A CA   3  
ATOM 5064  C C    . GLN A 1 105 ? -4.439  36.308  0.801   1.00 0.00 ? 283 GLN A C    3  
ATOM 5065  O O    . GLN A 1 105 ? -4.630  36.816  1.905   1.00 0.00 ? 283 GLN A O    3  
ATOM 5066  C CB   . GLN A 1 105 ? -3.849  34.182  1.980   1.00 0.00 ? 283 GLN A CB   3  
ATOM 5067  C CG   . GLN A 1 105 ? -2.533  34.740  2.498   1.00 0.00 ? 283 GLN A CG   3  
ATOM 5068  C CD   . GLN A 1 105 ? -1.329  34.008  1.937   1.00 0.00 ? 283 GLN A CD   3  
ATOM 5069  O OE1  . GLN A 1 105 ? -1.370  32.797  1.720   1.00 0.00 ? 283 GLN A OE1  3  
ATOM 5070  N NE2  . GLN A 1 105 ? -0.248  34.742  1.700   1.00 0.00 ? 283 GLN A NE2  3  
ATOM 5071  H H    . GLN A 1 105 ? -2.386  34.587  -0.238  1.00 0.00 ? 283 GLN A H    3  
ATOM 5072  H HA   . GLN A 1 105 ? -5.252  34.382  0.377   1.00 0.00 ? 283 GLN A HA   3  
ATOM 5073  H HB2  . GLN A 1 105 ? -4.611  34.368  2.723   1.00 0.00 ? 283 GLN A HB2  3  
ATOM 5074  H HB3  . GLN A 1 105 ? -3.737  33.116  1.850   1.00 0.00 ? 283 GLN A HB3  3  
ATOM 5075  H HG2  . GLN A 1 105 ? -2.463  35.781  2.220   1.00 0.00 ? 283 GLN A HG2  3  
ATOM 5076  H HG3  . GLN A 1 105 ? -2.519  34.654  3.574   1.00 0.00 ? 283 GLN A HG3  3  
ATOM 5077  H HE21 . GLN A 1 105 ? -0.288  35.702  1.898   1.00 0.00 ? 283 GLN A HE21 3  
ATOM 5078  H HE22 . GLN A 1 105 ? 0.544   34.295  1.338   1.00 0.00 ? 283 GLN A HE22 3  
ATOM 5079  N N    . GLN A 1 106 ? -4.345  37.019  -0.318  1.00 0.00 ? 284 GLN A N    3  
ATOM 5080  C CA   . GLN A 1 106 ? -4.465  38.472  -0.311  1.00 0.00 ? 284 GLN A CA   3  
ATOM 5081  C C    . GLN A 1 106 ? -5.812  38.911  -0.875  1.00 0.00 ? 284 GLN A C    3  
ATOM 5082  O O    . GLN A 1 106 ? -6.484  38.148  -1.569  1.00 0.00 ? 284 GLN A O    3  
ATOM 5083  C CB   . GLN A 1 106 ? -3.330  39.102  -1.122  1.00 0.00 ? 284 GLN A CB   3  
ATOM 5084  C CG   . GLN A 1 106 ? -3.314  38.674  -2.580  1.00 0.00 ? 284 GLN A CG   3  
ATOM 5085  C CD   . GLN A 1 106 ? -2.049  39.100  -3.299  1.00 0.00 ? 284 GLN A CD   3  
ATOM 5086  O OE1  . GLN A 1 106 ? -2.076  39.987  -4.153  1.00 0.00 ? 284 GLN A OE1  3  
ATOM 5087  N NE2  . GLN A 1 106 ? -0.932  38.468  -2.958  1.00 0.00 ? 284 GLN A NE2  3  
ATOM 5088  H H    . GLN A 1 106 ? -4.193  36.556  -1.167  1.00 0.00 ? 284 GLN A H    3  
ATOM 5089  H HA   . GLN A 1 106 ? -4.391  38.806  0.713   1.00 0.00 ? 284 GLN A HA   3  
ATOM 5090  H HB2  . GLN A 1 106 ? -3.431  40.176  -1.085  1.00 0.00 ? 284 GLN A HB2  3  
ATOM 5091  H HB3  . GLN A 1 106 ? -2.387  38.822  -0.676  1.00 0.00 ? 284 GLN A HB3  3  
ATOM 5092  H HG2  . GLN A 1 106 ? -3.391  37.597  -2.627  1.00 0.00 ? 284 GLN A HG2  3  
ATOM 5093  H HG3  . GLN A 1 106 ? -4.162  39.116  -3.081  1.00 0.00 ? 284 GLN A HG3  3  
ATOM 5094  H HE21 . GLN A 1 106 ? -0.987  37.771  -2.270  1.00 0.00 ? 284 GLN A HE21 3  
ATOM 5095  H HE22 . GLN A 1 106 ? -0.101  38.723  -3.407  1.00 0.00 ? 284 GLN A HE22 3  
ATOM 5096  N N    . SER A 1 107 ? -6.202  40.145  -0.571  1.00 0.00 ? 285 SER A N    3  
ATOM 5097  C CA   . SER A 1 107 ? -7.472  40.683  -1.044  1.00 0.00 ? 285 SER A CA   3  
ATOM 5098  C C    . SER A 1 107 ? -7.289  42.088  -1.611  1.00 0.00 ? 285 SER A C    3  
ATOM 5099  O O    . SER A 1 107 ? -6.559  42.905  -1.050  1.00 0.00 ? 285 SER A O    3  
ATOM 5100  C CB   . SER A 1 107 ? -8.494  40.710  0.094   1.00 0.00 ? 285 SER A CB   3  
ATOM 5101  O OG   . SER A 1 107 ? -8.017  41.470  1.190   1.00 0.00 ? 285 SER A OG   3  
ATOM 5102  H H    . SER A 1 107 ? -5.622  40.705  -0.013  1.00 0.00 ? 285 SER A H    3  
ATOM 5103  H HA   . SER A 1 107 ? -7.835  40.036  -1.828  1.00 0.00 ? 285 SER A HA   3  
ATOM 5104  H HB2  . SER A 1 107 ? -9.413  41.150  -0.262  1.00 0.00 ? 285 SER A HB2  3  
ATOM 5105  H HB3  . SER A 1 107 ? -8.684  39.700  0.427   1.00 0.00 ? 285 SER A HB3  3  
ATOM 5106  H HG   . SER A 1 107 ? -7.058  41.494  1.170   1.00 0.00 ? 285 SER A HG   3  
ATOM 5107  N N    . TRP A 1 108 ? -7.956  42.360  -2.727  1.00 0.00 ? 286 TRP A N    3  
ATOM 5108  C CA   . TRP A 1 108 ? -7.867  43.666  -3.371  1.00 0.00 ? 286 TRP A CA   3  
ATOM 5109  C C    . TRP A 1 108 ? -9.126  43.960  -4.179  1.00 0.00 ? 286 TRP A C    3  
ATOM 5110  O O    . TRP A 1 108 ? -9.881  43.052  -4.521  1.00 0.00 ? 286 TRP A O    3  
ATOM 5111  C CB   . TRP A 1 108 ? -6.637  43.727  -4.278  1.00 0.00 ? 286 TRP A CB   3  
ATOM 5112  C CG   . TRP A 1 108 ? -5.342  43.685  -3.526  1.00 0.00 ? 286 TRP A CG   3  
ATOM 5113  C CD1  . TRP A 1 108 ? -4.544  42.594  -3.327  1.00 0.00 ? 286 TRP A CD1  3  
ATOM 5114  C CD2  . TRP A 1 108 ? -4.695  44.782  -2.872  1.00 0.00 ? 286 TRP A CD2  3  
ATOM 5115  N NE1  . TRP A 1 108 ? -3.441  42.947  -2.588  1.00 0.00 ? 286 TRP A NE1  3  
ATOM 5116  C CE2  . TRP A 1 108 ? -3.509  44.284  -2.297  1.00 0.00 ? 286 TRP A CE2  3  
ATOM 5117  C CE3  . TRP A 1 108 ? -5.001  46.137  -2.717  1.00 0.00 ? 286 TRP A CE3  3  
ATOM 5118  C CZ2  . TRP A 1 108 ? -2.633  45.094  -1.580  1.00 0.00 ? 286 TRP A CZ2  3  
ATOM 5119  C CZ3  . TRP A 1 108 ? -4.130  46.939  -2.005  1.00 0.00 ? 286 TRP A CZ3  3  
ATOM 5120  C CH2  . TRP A 1 108 ? -2.957  46.416  -1.444  1.00 0.00 ? 286 TRP A CH2  3  
ATOM 5121  H H    . TRP A 1 108 ? -8.521  41.667  -3.127  1.00 0.00 ? 286 TRP A H    3  
ATOM 5122  H HA   . TRP A 1 108 ? -7.769  44.411  -2.595  1.00 0.00 ? 286 TRP A HA   3  
ATOM 5123  H HB2  . TRP A 1 108 ? -6.656  42.887  -4.957  1.00 0.00 ? 286 TRP A HB2  3  
ATOM 5124  H HB3  . TRP A 1 108 ? -6.664  44.645  -4.847  1.00 0.00 ? 286 TRP A HB3  3  
ATOM 5125  H HD1  . TRP A 1 108 ? -4.763  41.606  -3.700  1.00 0.00 ? 286 TRP A HD1  3  
ATOM 5126  H HE1  . TRP A 1 108 ? -2.721  42.340  -2.316  1.00 0.00 ? 286 TRP A HE1  3  
ATOM 5127  H HE3  . TRP A 1 108 ? -5.900  46.559  -3.142  1.00 0.00 ? 286 TRP A HE3  3  
ATOM 5128  H HZ2  . TRP A 1 108 ? -1.724  44.706  -1.142  1.00 0.00 ? 286 TRP A HZ2  3  
ATOM 5129  H HZ3  . TRP A 1 108 ? -4.350  47.989  -1.874  1.00 0.00 ? 286 TRP A HZ3  3  
ATOM 5130  H HH2  . TRP A 1 108 ? -2.306  47.080  -0.895  1.00 0.00 ? 286 TRP A HH2  3  
ATOM 5131  N N    . ASN A 1 109 ? -9.345  45.236  -4.481  1.00 0.00 ? 287 ASN A N    3  
ATOM 5132  C CA   . ASN A 1 109 ? -10.513 45.650  -5.250  1.00 0.00 ? 287 ASN A CA   3  
ATOM 5133  C C    . ASN A 1 109 ? -10.183 45.738  -6.737  1.00 0.00 ? 287 ASN A C    3  
ATOM 5134  O O    . ASN A 1 109 ? -9.416  46.602  -7.163  1.00 0.00 ? 287 ASN A O    3  
ATOM 5135  C CB   . ASN A 1 109 ? -11.027 47.001  -4.749  1.00 0.00 ? 287 ASN A CB   3  
ATOM 5136  C CG   . ASN A 1 109 ? -12.352 47.385  -5.378  1.00 0.00 ? 287 ASN A CG   3  
ATOM 5137  O OD1  . ASN A 1 109 ? -12.438 48.362  -6.122  1.00 0.00 ? 287 ASN A OD1  3  
ATOM 5138  N ND2  . ASN A 1 109 ? -13.393 46.617  -5.080  1.00 0.00 ? 287 ASN A ND2  3  
ATOM 5139  H H    . ASN A 1 109 ? -8.706  45.915  -4.180  1.00 0.00 ? 287 ASN A H    3  
ATOM 5140  H HA   . ASN A 1 109 ? -11.283 44.907  -5.108  1.00 0.00 ? 287 ASN A HA   3  
ATOM 5141  H HB2  . ASN A 1 109 ? -11.159 46.954  -3.677  1.00 0.00 ? 287 ASN A HB2  3  
ATOM 5142  H HB3  . ASN A 1 109 ? -10.302 47.765  -4.985  1.00 0.00 ? 287 ASN A HB3  3  
ATOM 5143  H HD21 . ASN A 1 109 ? -13.250 45.855  -4.479  1.00 0.00 ? 287 ASN A HD21 3  
ATOM 5144  H HD22 . ASN A 1 109 ? -14.262 46.842  -5.473  1.00 0.00 ? 287 ASN A HD22 3  
ATOM 5145  N N    . LEU A 1 110 ? -10.768 44.840  -7.521  1.00 0.00 ? 288 LEU A N    3  
ATOM 5146  C CA   . LEU A 1 110 ? -10.537 44.816  -8.962  1.00 0.00 ? 288 LEU A CA   3  
ATOM 5147  C C    . LEU A 1 110 ? -11.816 45.145  -9.724  1.00 0.00 ? 288 LEU A C    3  
ATOM 5148  O O    . LEU A 1 110 ? -12.857 45.408  -9.124  1.00 0.00 ? 288 LEU A O    3  
ATOM 5149  C CB   . LEU A 1 110 ? -10.012 43.445  -9.391  1.00 0.00 ? 288 LEU A CB   3  
ATOM 5150  C CG   . LEU A 1 110 ? -8.497  43.251  -9.313  1.00 0.00 ? 288 LEU A CG   3  
ATOM 5151  C CD1  . LEU A 1 110 ? -7.793  44.136  -10.330 1.00 0.00 ? 288 LEU A CD1  3  
ATOM 5152  C CD2  . LEU A 1 110 ? -7.994  43.545  -7.908  1.00 0.00 ? 288 LEU A CD2  3  
ATOM 5153  H H    . LEU A 1 110 ? -11.369 44.176  -7.124  1.00 0.00 ? 288 LEU A H    3  
ATOM 5154  H HA   . LEU A 1 110 ? -9.793  45.565  -9.190  1.00 0.00 ? 288 LEU A HA   3  
ATOM 5155  H HB2  . LEU A 1 110 ? -10.473 42.701  -8.759  1.00 0.00 ? 288 LEU A HB2  3  
ATOM 5156  H HB3  . LEU A 1 110 ? -10.315 43.282  -10.416 1.00 0.00 ? 288 LEU A HB3  3  
ATOM 5157  H HG   . LEU A 1 110 ? -8.260  42.222  -9.546  1.00 0.00 ? 288 LEU A HG   3  
ATOM 5158  H HD11 . LEU A 1 110 ? -7.077  44.765  -9.824  1.00 0.00 ? 288 LEU A HD11 3  
ATOM 5159  H HD12 . LEU A 1 110 ? -8.521  44.753  -10.836 1.00 0.00 ? 288 LEU A HD12 3  
ATOM 5160  H HD13 . LEU A 1 110 ? -7.282  43.517  -11.053 1.00 0.00 ? 288 LEU A HD13 3  
ATOM 5161  H HD21 . LEU A 1 110 ? -8.704  43.171  -7.186  1.00 0.00 ? 288 LEU A HD21 3  
ATOM 5162  H HD22 . LEU A 1 110 ? -7.881  44.612  -7.782  1.00 0.00 ? 288 LEU A HD22 3  
ATOM 5163  H HD23 . LEU A 1 110 ? -7.040  43.061  -7.759  1.00 0.00 ? 288 LEU A HD23 3  
ATOM 5164  N N    . ASN A 1 111 ? -11.730 45.127  -11.050 1.00 0.00 ? 289 ASN A N    3  
ATOM 5165  C CA   . ASN A 1 111 ? -12.882 45.422  -11.895 1.00 0.00 ? 289 ASN A CA   3  
ATOM 5166  C C    . ASN A 1 111 ? -12.789 44.675  -13.222 1.00 0.00 ? 289 ASN A C    3  
ATOM 5167  O O    . ASN A 1 111 ? -11.760 44.711  -13.895 1.00 0.00 ? 289 ASN A O    3  
ATOM 5168  C CB   . ASN A 1 111 ? -12.981 46.927  -12.150 1.00 0.00 ? 289 ASN A CB   3  
ATOM 5169  C CG   . ASN A 1 111 ? -13.691 47.248  -13.451 1.00 0.00 ? 289 ASN A CG   3  
ATOM 5170  O OD1  . ASN A 1 111 ? -14.902 47.063  -13.572 1.00 0.00 ? 289 ASN A OD1  3  
ATOM 5171  N ND2  . ASN A 1 111 ? -12.937 47.730  -14.432 1.00 0.00 ? 289 ASN A ND2  3  
ATOM 5172  H H    . ASN A 1 111 ? -10.872 44.910  -11.471 1.00 0.00 ? 289 ASN A H    3  
ATOM 5173  H HA   . ASN A 1 111 ? -13.768 45.095  -11.372 1.00 0.00 ? 289 ASN A HA   3  
ATOM 5174  H HB2  . ASN A 1 111 ? -13.529 47.388  -11.340 1.00 0.00 ? 289 ASN A HB2  3  
ATOM 5175  H HB3  . ASN A 1 111 ? -11.987 47.346  -12.190 1.00 0.00 ? 289 ASN A HB3  3  
ATOM 5176  H HD21 . ASN A 1 111 ? -11.979 47.851  -14.264 1.00 0.00 ? 289 ASN A HD21 3  
ATOM 5177  H HD22 . ASN A 1 111 ? -13.371 47.947  -15.284 1.00 0.00 ? 289 ASN A HD22 3  
ATOM 5178  N N    . ASN A 1 112 ? -13.872 44.000  -13.591 1.00 0.00 ? 290 ASN A N    3  
ATOM 5179  C CA   . ASN A 1 112 ? -13.913 43.244  -14.838 1.00 0.00 ? 290 ASN A CA   3  
ATOM 5180  C C    . ASN A 1 112 ? -15.160 43.592  -15.645 1.00 0.00 ? 290 ASN A C    3  
ATOM 5181  O O    . ASN A 1 112 ? -16.146 44.091  -15.100 1.00 0.00 ? 290 ASN A O    3  
ATOM 5182  C CB   . ASN A 1 112 ? -13.882 41.742  -14.550 1.00 0.00 ? 290 ASN A CB   3  
ATOM 5183  C CG   . ASN A 1 112 ? -12.489 41.247  -14.210 1.00 0.00 ? 290 ASN A CG   3  
ATOM 5184  O OD1  . ASN A 1 112 ? -11.517 41.580  -14.889 1.00 0.00 ? 290 ASN A OD1  3  
ATOM 5185  N ND2  . ASN A 1 112 ? -12.386 40.447  -13.155 1.00 0.00 ? 290 ASN A ND2  3  
ATOM 5186  H H    . ASN A 1 112 ? -14.663 44.009  -13.012 1.00 0.00 ? 290 ASN A H    3  
ATOM 5187  H HA   . ASN A 1 112 ? -13.040 43.509  -15.415 1.00 0.00 ? 290 ASN A HA   3  
ATOM 5188  H HB2  . ASN A 1 112 ? -14.532 41.528  -13.714 1.00 0.00 ? 290 ASN A HB2  3  
ATOM 5189  H HB3  . ASN A 1 112 ? -14.233 41.206  -15.419 1.00 0.00 ? 290 ASN A HB3  3  
ATOM 5190  H HD21 . ASN A 1 112 ? -13.203 40.223  -12.662 1.00 0.00 ? 290 ASN A HD21 3  
ATOM 5191  H HD22 . ASN A 1 112 ? -11.497 40.113  -12.913 1.00 0.00 ? 290 ASN A HD22 3  
ATOM 5192  N N    . LEU A 1 113 ? -15.110 43.326  -16.945 1.00 0.00 ? 291 LEU A N    3  
ATOM 5193  C CA   . LEU A 1 113 ? -16.236 43.610  -17.828 1.00 0.00 ? 291 LEU A CA   3  
ATOM 5194  C C    . LEU A 1 113 ? -17.450 42.766  -17.453 1.00 0.00 ? 291 LEU A C    3  
ATOM 5195  O O    . LEU A 1 113 ? -17.311 41.645  -16.963 1.00 0.00 ? 291 LEU A O    3  
ATOM 5196  C CB   . LEU A 1 113 ? -15.848 43.346  -19.284 1.00 0.00 ? 291 LEU A CB   3  
ATOM 5197  C CG   . LEU A 1 113 ? -16.145 41.943  -19.814 1.00 0.00 ? 291 LEU A CG   3  
ATOM 5198  C CD1  . LEU A 1 113 ? -15.572 40.888  -18.882 1.00 0.00 ? 291 LEU A CD1  3  
ATOM 5199  C CD2  . LEU A 1 113 ? -17.644 41.746  -19.990 1.00 0.00 ? 291 LEU A CD2  3  
ATOM 5200  H H    . LEU A 1 113 ? -14.298 42.928  -17.322 1.00 0.00 ? 291 LEU A H    3  
ATOM 5201  H HA   . LEU A 1 113 ? -16.491 44.654  -17.715 1.00 0.00 ? 291 LEU A HA   3  
ATOM 5202  H HB2  . LEU A 1 113 ? -16.381 44.053  -19.902 1.00 0.00 ? 291 LEU A HB2  3  
ATOM 5203  H HB3  . LEU A 1 113 ? -14.785 43.519  -19.378 1.00 0.00 ? 291 LEU A HB3  3  
ATOM 5204  H HG   . LEU A 1 113 ? -15.676 41.824  -20.781 1.00 0.00 ? 291 LEU A HG   3  
ATOM 5205  H HD11 . LEU A 1 113 ? -16.290 40.091  -18.756 1.00 0.00 ? 291 LEU A HD11 3  
ATOM 5206  H HD12 . LEU A 1 113 ? -15.358 41.334  -17.922 1.00 0.00 ? 291 LEU A HD12 3  
ATOM 5207  H HD13 . LEU A 1 113 ? -14.661 40.490  -19.305 1.00 0.00 ? 291 LEU A HD13 3  
ATOM 5208  H HD21 . LEU A 1 113 ? -18.126 42.709  -20.067 1.00 0.00 ? 291 LEU A HD21 3  
ATOM 5209  H HD22 . LEU A 1 113 ? -18.039 41.213  -19.137 1.00 0.00 ? 291 LEU A HD22 3  
ATOM 5210  H HD23 . LEU A 1 113 ? -17.829 41.177  -20.889 1.00 0.00 ? 291 LEU A HD23 3  
ATOM 5211  N N    . SER A 1 114 ? -18.639 43.310  -17.688 1.00 0.00 ? 292 SER A N    3  
ATOM 5212  C CA   . SER A 1 114 ? -19.877 42.607  -17.373 1.00 0.00 ? 292 SER A CA   3  
ATOM 5213  C C    . SER A 1 114 ? -21.061 43.240  -18.099 1.00 0.00 ? 292 SER A C    3  
ATOM 5214  O O    . SER A 1 114 ? -21.495 44.340  -17.759 1.00 0.00 ? 292 SER A O    3  
ATOM 5215  C CB   . SER A 1 114 ? -20.125 42.618  -15.864 1.00 0.00 ? 292 SER A CB   3  
ATOM 5216  O OG   . SER A 1 114 ? -21.072 41.629  -15.495 1.00 0.00 ? 292 SER A OG   3  
ATOM 5217  H H    . SER A 1 114 ? -18.685 44.207  -18.081 1.00 0.00 ? 292 SER A H    3  
ATOM 5218  H HA   . SER A 1 114 ? -19.772 41.585  -17.705 1.00 0.00 ? 292 SER A HA   3  
ATOM 5219  H HB2  . SER A 1 114 ? -19.198 42.420  -15.348 1.00 0.00 ? 292 SER A HB2  3  
ATOM 5220  H HB3  . SER A 1 114 ? -20.501 43.587  -15.570 1.00 0.00 ? 292 SER A HB3  3  
ATOM 5221  H HG   . SER A 1 114 ? -21.058 40.917  -16.139 1.00 0.00 ? 292 SER A HG   3  
ATOM 5222  N N    . GLY A 1 115 ? -21.578 42.536  -19.101 1.00 0.00 ? 293 GLY A N    3  
ATOM 5223  C CA   . GLY A 1 115 ? -22.707 43.044  -19.859 1.00 0.00 ? 293 GLY A CA   3  
ATOM 5224  C C    . GLY A 1 115 ? -22.954 42.254  -21.130 1.00 0.00 ? 293 GLY A C    3  
ATOM 5225  O O    . GLY A 1 115 ? -22.026 41.758  -21.768 1.00 0.00 ? 293 GLY A O    3  
ATOM 5226  H H    . GLY A 1 115 ? -21.191 41.665  -19.327 1.00 0.00 ? 293 GLY A H    3  
ATOM 5227  H HA2  . GLY A 1 115 ? -23.591 42.999  -19.242 1.00 0.00 ? 293 GLY A HA2  3  
ATOM 5228  H HA3  . GLY A 1 115 ? -22.515 44.074  -20.122 1.00 0.00 ? 293 GLY A HA3  3  
ATOM 5229  N N    . PRO A 1 116 ? -24.233 42.129  -21.513 1.00 0.00 ? 294 PRO A N    3  
ATOM 5230  C CA   . PRO A 1 116 ? -24.630 41.394  -22.718 1.00 0.00 ? 294 PRO A CA   3  
ATOM 5231  C C    . PRO A 1 116 ? -24.214 42.111  -23.998 1.00 0.00 ? 294 PRO A C    3  
ATOM 5232  O O    . PRO A 1 116 ? -24.386 43.323  -24.125 1.00 0.00 ? 294 PRO A O    3  
ATOM 5233  C CB   . PRO A 1 116 ? -26.155 41.333  -22.610 1.00 0.00 ? 294 PRO A CB   3  
ATOM 5234  C CG   . PRO A 1 116 ? -26.523 42.508  -21.772 1.00 0.00 ? 294 PRO A CG   3  
ATOM 5235  C CD   . PRO A 1 116 ? -25.391 42.695  -20.801 1.00 0.00 ? 294 PRO A CD   3  
ATOM 5236  H HA   . PRO A 1 116 ? -24.227 40.391  -22.721 1.00 0.00 ? 294 PRO A HA   3  
ATOM 5237  H HB2  . PRO A 1 116 ? -26.591 41.398  -23.597 1.00 0.00 ? 294 PRO A HB2  3  
ATOM 5238  H HB3  . PRO A 1 116 ? -26.450 40.406  -22.141 1.00 0.00 ? 294 PRO A HB3  3  
ATOM 5239  H HG2  . PRO A 1 116 ? -26.631 43.384  -22.394 1.00 0.00 ? 294 PRO A HG2  3  
ATOM 5240  H HG3  . PRO A 1 116 ? -27.442 42.308  -21.242 1.00 0.00 ? 294 PRO A HG3  3  
ATOM 5241  H HD2  . PRO A 1 116 ? -25.241 43.744  -20.593 1.00 0.00 ? 294 PRO A HD2  3  
ATOM 5242  H HD3  . PRO A 1 116 ? -25.584 42.151  -19.887 1.00 0.00 ? 294 PRO A HD3  3  
ATOM 5243  N N    . SER A 1 117 ? -23.667 41.354  -24.944 1.00 0.00 ? 295 SER A N    3  
ATOM 5244  C CA   . SER A 1 117 ? -23.224 41.919  -26.213 1.00 0.00 ? 295 SER A CA   3  
ATOM 5245  C C    . SER A 1 117 ? -24.369 41.954  -27.221 1.00 0.00 ? 295 SER A C    3  
ATOM 5246  O O    . SER A 1 117 ? -25.238 41.082  -27.220 1.00 0.00 ? 295 SER A O    3  
ATOM 5247  C CB   . SER A 1 117 ? -22.057 41.106  -26.777 1.00 0.00 ? 295 SER A CB   3  
ATOM 5248  O OG   . SER A 1 117 ? -20.835 41.475  -26.163 1.00 0.00 ? 295 SER A OG   3  
ATOM 5249  H H    . SER A 1 117 ? -23.557 40.393  -24.783 1.00 0.00 ? 295 SER A H    3  
ATOM 5250  H HA   . SER A 1 117 ? -22.892 42.929  -26.028 1.00 0.00 ? 295 SER A HA   3  
ATOM 5251  H HB2  . SER A 1 117 ? -22.234 40.056  -26.599 1.00 0.00 ? 295 SER A HB2  3  
ATOM 5252  H HB3  . SER A 1 117 ? -21.980 41.283  -27.840 1.00 0.00 ? 295 SER A HB3  3  
ATOM 5253  H HG   . SER A 1 117 ? -20.898 42.376  -25.839 1.00 0.00 ? 295 SER A HG   3  
ATOM 5254  N N    . SER A 1 118 ? -24.362 42.968  -28.080 1.00 0.00 ? 296 SER A N    3  
ATOM 5255  C CA   . SER A 1 118 ? -25.401 43.120  -29.092 1.00 0.00 ? 296 SER A CA   3  
ATOM 5256  C C    . SER A 1 118 ? -24.884 42.709  -30.467 1.00 0.00 ? 296 SER A C    3  
ATOM 5257  O O    . SER A 1 118 ? -25.496 41.892  -31.154 1.00 0.00 ? 296 SER A O    3  
ATOM 5258  C CB   . SER A 1 118 ? -25.895 44.568  -29.132 1.00 0.00 ? 296 SER A CB   3  
ATOM 5259  O OG   . SER A 1 118 ? -26.951 44.720  -30.065 1.00 0.00 ? 296 SER A OG   3  
ATOM 5260  H H    . SER A 1 118 ? -23.641 43.631  -28.030 1.00 0.00 ? 296 SER A H    3  
ATOM 5261  H HA   . SER A 1 118 ? -26.223 42.475  -28.822 1.00 0.00 ? 296 SER A HA   3  
ATOM 5262  H HB2  . SER A 1 118 ? -26.251 44.851  -28.153 1.00 0.00 ? 296 SER A HB2  3  
ATOM 5263  H HB3  . SER A 1 118 ? -25.080 45.215  -29.420 1.00 0.00 ? 296 SER A HB3  3  
ATOM 5264  H HG   . SER A 1 118 ? -26.765 45.467  -30.639 1.00 0.00 ? 296 SER A HG   3  
ATOM 5265  N N    . GLY A 1 119 ? -23.752 43.283  -30.863 1.00 0.00 ? 297 GLY A N    3  
ATOM 5266  C CA   . GLY A 1 119 ? -23.171 42.964  -32.154 1.00 0.00 ? 297 GLY A CA   3  
ATOM 5267  C C    . GLY A 1 119 ? -22.377 44.119  -32.734 1.00 0.00 ? 297 GLY A C    3  
ATOM 5268  O O    . GLY A 1 119 ? -21.152 44.157  -32.621 1.00 0.00 ? 297 GLY A O    3  
ATOM 5269  H H    . GLY A 1 119 ? -23.307 43.927  -30.274 1.00 0.00 ? 297 GLY A H    3  
ATOM 5270  H HA2  . GLY A 1 119 ? -22.517 42.112  -32.043 1.00 0.00 ? 297 GLY A HA2  3  
ATOM 5271  H HA3  . GLY A 1 119 ? -23.965 42.709  -32.840 1.00 0.00 ? 297 GLY A HA3  3  
ATOM 5272  N N    . GLY A 1 1   ? -25.459 21.916  17.096  1.00 0.00 ? 179 GLY A N    4  
ATOM 5273  C CA   . GLY A 1 1   ? -26.471 22.634  16.343  1.00 0.00 ? 179 GLY A CA   4  
ATOM 5274  C C    . GLY A 1 1   ? -27.856 22.047  16.528  1.00 0.00 ? 179 GLY A C    4  
ATOM 5275  O O    . GLY A 1 1   ? -28.272 21.761  17.651  1.00 0.00 ? 179 GLY A O    4  
ATOM 5276  H H1   . GLY A 1 1   ? -25.575 21.776  18.059  1.00 0.00 ? 179 GLY A H1   4  
ATOM 5277  H HA2  . GLY A 1 1   ? -26.482 23.664  16.666  1.00 0.00 ? 179 GLY A HA2  4  
ATOM 5278  H HA3  . GLY A 1 1   ? -26.215 22.599  15.294  1.00 0.00 ? 179 GLY A HA3  4  
ATOM 5279  N N    . SER A 1 2   ? -28.574 21.868  15.423  1.00 0.00 ? 180 SER A N    4  
ATOM 5280  C CA   . SER A 1 2   ? -29.923 21.316  15.469  1.00 0.00 ? 180 SER A CA   4  
ATOM 5281  C C    . SER A 1 2   ? -29.893 19.796  15.345  1.00 0.00 ? 180 SER A C    4  
ATOM 5282  O O    . SER A 1 2   ? -29.374 19.252  14.371  1.00 0.00 ? 180 SER A O    4  
ATOM 5283  C CB   . SER A 1 2   ? -30.779 21.913  14.350  1.00 0.00 ? 180 SER A CB   4  
ATOM 5284  O OG   . SER A 1 2   ? -30.984 23.301  14.550  1.00 0.00 ? 180 SER A OG   4  
ATOM 5285  H H    . SER A 1 2   ? -28.187 22.115  14.557  1.00 0.00 ? 180 SER A H    4  
ATOM 5286  H HA   . SER A 1 2   ? -30.357 21.580  16.422  1.00 0.00 ? 180 SER A HA   4  
ATOM 5287  H HB2  . SER A 1 2   ? -30.282 21.768  13.403  1.00 0.00 ? 180 SER A HB2  4  
ATOM 5288  H HB3  . SER A 1 2   ? -31.739 21.419  14.333  1.00 0.00 ? 180 SER A HB3  4  
ATOM 5289  H HG   . SER A 1 2   ? -31.025 23.487  15.491  1.00 0.00 ? 180 SER A HG   4  
ATOM 5290  N N    . SER A 1 3   ? -30.453 19.116  16.341  1.00 0.00 ? 181 SER A N    4  
ATOM 5291  C CA   . SER A 1 3   ? -30.488 17.659  16.346  1.00 0.00 ? 181 SER A CA   4  
ATOM 5292  C C    . SER A 1 3   ? -30.949 17.121  14.995  1.00 0.00 ? 181 SER A C    4  
ATOM 5293  O O    . SER A 1 3   ? -31.661 17.798  14.255  1.00 0.00 ? 181 SER A O    4  
ATOM 5294  C CB   . SER A 1 3   ? -31.416 17.154  17.453  1.00 0.00 ? 181 SER A CB   4  
ATOM 5295  O OG   . SER A 1 3   ? -31.491 15.739  17.450  1.00 0.00 ? 181 SER A OG   4  
ATOM 5296  H H    . SER A 1 3   ? -30.851 19.608  17.090  1.00 0.00 ? 181 SER A H    4  
ATOM 5297  H HA   . SER A 1 3   ? -29.486 17.304  16.539  1.00 0.00 ? 181 SER A HA   4  
ATOM 5298  H HB2  . SER A 1 3   ? -31.041 17.480  18.411  1.00 0.00 ? 181 SER A HB2  4  
ATOM 5299  H HB3  . SER A 1 3   ? -32.407 17.556  17.299  1.00 0.00 ? 181 SER A HB3  4  
ATOM 5300  H HG   . SER A 1 3   ? -32.404 15.467  17.326  1.00 0.00 ? 181 SER A HG   4  
ATOM 5301  N N    . GLY A 1 4   ? -30.537 15.896  14.681  1.00 0.00 ? 182 GLY A N    4  
ATOM 5302  C CA   . GLY A 1 4   ? -30.917 15.287  13.420  1.00 0.00 ? 182 GLY A CA   4  
ATOM 5303  C C    . GLY A 1 4   ? -30.033 14.110  13.055  1.00 0.00 ? 182 GLY A C    4  
ATOM 5304  O O    . GLY A 1 4   ? -29.576 13.374  13.929  1.00 0.00 ? 182 GLY A O    4  
ATOM 5305  H H    . GLY A 1 4   ? -29.970 15.403  15.310  1.00 0.00 ? 182 GLY A H    4  
ATOM 5306  H HA2  . GLY A 1 4   ? -31.939 14.948  13.490  1.00 0.00 ? 182 GLY A HA2  4  
ATOM 5307  H HA3  . GLY A 1 4   ? -30.847 16.030  12.639  1.00 0.00 ? 182 GLY A HA3  4  
ATOM 5308  N N    . SER A 1 5   ? -29.793 13.932  11.760  1.00 0.00 ? 183 SER A N    4  
ATOM 5309  C CA   . SER A 1 5   ? -28.963 12.833  11.281  1.00 0.00 ? 183 SER A CA   4  
ATOM 5310  C C    . SER A 1 5   ? -27.890 13.340  10.322  1.00 0.00 ? 183 SER A C    4  
ATOM 5311  O O    . SER A 1 5   ? -28.190 13.770  9.208   1.00 0.00 ? 183 SER A O    4  
ATOM 5312  C CB   . SER A 1 5   ? -29.826 11.779  10.586  1.00 0.00 ? 183 SER A CB   4  
ATOM 5313  O OG   . SER A 1 5   ? -29.134 10.547  10.471  1.00 0.00 ? 183 SER A OG   4  
ATOM 5314  H H    . SER A 1 5   ? -30.186 14.553  11.111  1.00 0.00 ? 183 SER A H    4  
ATOM 5315  H HA   . SER A 1 5   ? -28.481 12.384  12.137  1.00 0.00 ? 183 SER A HA   4  
ATOM 5316  H HB2  . SER A 1 5   ? -30.727 11.619  11.160  1.00 0.00 ? 183 SER A HB2  4  
ATOM 5317  H HB3  . SER A 1 5   ? -30.086 12.126  9.596   1.00 0.00 ? 183 SER A HB3  4  
ATOM 5318  H HG   . SER A 1 5   ? -29.728 9.825   10.688  1.00 0.00 ? 183 SER A HG   4  
ATOM 5319  N N    . SER A 1 6   ? -26.637 13.288  10.764  1.00 0.00 ? 184 SER A N    4  
ATOM 5320  C CA   . SER A 1 6   ? -25.519 13.745  9.947   1.00 0.00 ? 184 SER A CA   4  
ATOM 5321  C C    . SER A 1 6   ? -24.813 12.567  9.283   1.00 0.00 ? 184 SER A C    4  
ATOM 5322  O O    . SER A 1 6   ? -23.831 12.042  9.806   1.00 0.00 ? 184 SER A O    4  
ATOM 5323  C CB   . SER A 1 6   ? -24.525 14.534  10.802  1.00 0.00 ? 184 SER A CB   4  
ATOM 5324  O OG   . SER A 1 6   ? -23.935 13.707  11.791  1.00 0.00 ? 184 SER A OG   4  
ATOM 5325  H H    . SER A 1 6   ? -26.462 12.935  11.661  1.00 0.00 ? 184 SER A H    4  
ATOM 5326  H HA   . SER A 1 6   ? -25.913 14.393  9.179   1.00 0.00 ? 184 SER A HA   4  
ATOM 5327  H HB2  . SER A 1 6   ? -23.745 14.930  10.170  1.00 0.00 ? 184 SER A HB2  4  
ATOM 5328  H HB3  . SER A 1 6   ? -25.041 15.347  11.291  1.00 0.00 ? 184 SER A HB3  4  
ATOM 5329  H HG   . SER A 1 6   ? -24.605 13.437  12.424  1.00 0.00 ? 184 SER A HG   4  
ATOM 5330  N N    . GLY A 1 7   ? -25.323 12.155  8.126   1.00 0.00 ? 185 GLY A N    4  
ATOM 5331  C CA   . GLY A 1 7   ? -24.730 11.042  7.409   1.00 0.00 ? 185 GLY A CA   4  
ATOM 5332  C C    . GLY A 1 7   ? -24.510 11.350  5.941   1.00 0.00 ? 185 GLY A C    4  
ATOM 5333  O O    . GLY A 1 7   ? -25.061 10.678  5.068   1.00 0.00 ? 185 GLY A O    4  
ATOM 5334  H H    . GLY A 1 7   ? -26.108 12.611  7.757   1.00 0.00 ? 185 GLY A H    4  
ATOM 5335  H HA2  . GLY A 1 7   ? -23.781 10.800  7.862   1.00 0.00 ? 185 GLY A HA2  4  
ATOM 5336  H HA3  . GLY A 1 7   ? -25.385 10.187  7.490   1.00 0.00 ? 185 GLY A HA3  4  
ATOM 5337  N N    . LYS A 1 8   ? -23.703 12.369  5.666   1.00 0.00 ? 186 LYS A N    4  
ATOM 5338  C CA   . LYS A 1 8   ? -23.411 12.766  4.294   1.00 0.00 ? 186 LYS A CA   4  
ATOM 5339  C C    . LYS A 1 8   ? -21.913 12.691  4.014   1.00 0.00 ? 186 LYS A C    4  
ATOM 5340  O O    . LYS A 1 8   ? -21.106 13.257  4.749   1.00 0.00 ? 186 LYS A O    4  
ATOM 5341  C CB   . LYS A 1 8   ? -23.919 14.186  4.033   1.00 0.00 ? 186 LYS A CB   4  
ATOM 5342  C CG   . LYS A 1 8   ? -25.413 14.258  3.767   1.00 0.00 ? 186 LYS A CG   4  
ATOM 5343  C CD   . LYS A 1 8   ? -25.996 15.587  4.215   1.00 0.00 ? 186 LYS A CD   4  
ATOM 5344  C CE   . LYS A 1 8   ? -25.880 16.642  3.126   1.00 0.00 ? 186 LYS A CE   4  
ATOM 5345  N NZ   . LYS A 1 8   ? -24.529 17.267  3.099   1.00 0.00 ? 186 LYS A NZ   4  
ATOM 5346  H H    . LYS A 1 8   ? -23.293 12.867  6.406   1.00 0.00 ? 186 LYS A H    4  
ATOM 5347  H HA   . LYS A 1 8   ? -23.923 12.082  3.635   1.00 0.00 ? 186 LYS A HA   4  
ATOM 5348  H HB2  . LYS A 1 8   ? -23.698 14.799  4.894   1.00 0.00 ? 186 LYS A HB2  4  
ATOM 5349  H HB3  . LYS A 1 8   ? -23.402 14.588  3.174   1.00 0.00 ? 186 LYS A HB3  4  
ATOM 5350  H HG2  . LYS A 1 8   ? -25.586 14.140  2.707   1.00 0.00 ? 186 LYS A HG2  4  
ATOM 5351  H HG3  . LYS A 1 8   ? -25.904 13.459  4.305   1.00 0.00 ? 186 LYS A HG3  4  
ATOM 5352  H HD2  . LYS A 1 8   ? -27.039 15.450  4.458   1.00 0.00 ? 186 LYS A HD2  4  
ATOM 5353  H HD3  . LYS A 1 8   ? -25.462 15.927  5.091   1.00 0.00 ? 186 LYS A HD3  4  
ATOM 5354  H HE2  . LYS A 1 8   ? -26.071 16.177  2.171   1.00 0.00 ? 186 LYS A HE2  4  
ATOM 5355  H HE3  . LYS A 1 8   ? -26.619 17.409  3.306   1.00 0.00 ? 186 LYS A HE3  4  
ATOM 5356  H HZ1  . LYS A 1 8   ? -24.483 18.048  3.784   1.00 0.00 ? 186 LYS A HZ1  4  
ATOM 5357  H HZ2  . LYS A 1 8   ? -24.326 17.641  2.150   1.00 0.00 ? 186 LYS A HZ2  4  
ATOM 5358  H HZ3  . LYS A 1 8   ? -23.804 16.562  3.344   1.00 0.00 ? 186 LYS A HZ3  4  
ATOM 5359  N N    . ASN A 1 9   ? -21.550 11.991  2.944   1.00 0.00 ? 187 ASN A N    4  
ATOM 5360  C CA   . ASN A 1 9   ? -20.149 11.843  2.566   1.00 0.00 ? 187 ASN A CA   4  
ATOM 5361  C C    . ASN A 1 9   ? -19.983 11.923  1.052   1.00 0.00 ? 187 ASN A C    4  
ATOM 5362  O O    . ASN A 1 9   ? -20.584 11.146  0.309   1.00 0.00 ? 187 ASN A O    4  
ATOM 5363  C CB   . ASN A 1 9   ? -19.598 10.512  3.082   1.00 0.00 ? 187 ASN A CB   4  
ATOM 5364  C CG   . ASN A 1 9   ? -19.140 10.597  4.525   1.00 0.00 ? 187 ASN A CG   4  
ATOM 5365  O OD1  . ASN A 1 9   ? -19.594 9.832   5.377   1.00 0.00 ? 187 ASN A OD1  4  
ATOM 5366  N ND2  . ASN A 1 9   ? -18.238 11.529  4.806   1.00 0.00 ? 187 ASN A ND2  4  
ATOM 5367  H H    . ASN A 1 9   ? -22.241 11.562  2.396   1.00 0.00 ? 187 ASN A H    4  
ATOM 5368  H HA   . ASN A 1 9   ? -19.597 12.652  3.020   1.00 0.00 ? 187 ASN A HA   4  
ATOM 5369  H HB2  . ASN A 1 9   ? -20.369 9.759   3.012   1.00 0.00 ? 187 ASN A HB2  4  
ATOM 5370  H HB3  . ASN A 1 9   ? -18.757 10.218  2.473   1.00 0.00 ? 187 ASN A HB3  4  
ATOM 5371  H HD21 . ASN A 1 9   ? -17.922 12.103  4.077   1.00 0.00 ? 187 ASN A HD21 4  
ATOM 5372  H HD22 . ASN A 1 9   ? -17.924 11.605  5.731   1.00 0.00 ? 187 ASN A HD22 4  
ATOM 5373  N N    . VAL A 1 10  ? -19.164 12.867  0.600   1.00 0.00 ? 188 VAL A N    4  
ATOM 5374  C CA   . VAL A 1 10  ? -18.917 13.048  -0.825  1.00 0.00 ? 188 VAL A CA   4  
ATOM 5375  C C    . VAL A 1 10  ? -18.772 11.705  -1.532  1.00 0.00 ? 188 VAL A C    4  
ATOM 5376  O O    . VAL A 1 10  ? -18.141 10.784  -1.015  1.00 0.00 ? 188 VAL A O    4  
ATOM 5377  C CB   . VAL A 1 10  ? -17.648 13.885  -1.073  1.00 0.00 ? 188 VAL A CB   4  
ATOM 5378  C CG1  . VAL A 1 10  ? -16.437 13.221  -0.435  1.00 0.00 ? 188 VAL A CG1  4  
ATOM 5379  C CG2  . VAL A 1 10  ? -17.429 14.091  -2.564  1.00 0.00 ? 188 VAL A CG2  4  
ATOM 5380  H H    . VAL A 1 10  ? -18.714 13.456  1.242   1.00 0.00 ? 188 VAL A H    4  
ATOM 5381  H HA   . VAL A 1 10  ? -19.759 13.577  -1.246  1.00 0.00 ? 188 VAL A HA   4  
ATOM 5382  H HB   . VAL A 1 10  ? -17.784 14.853  -0.614  1.00 0.00 ? 188 VAL A HB   4  
ATOM 5383  H HG11 . VAL A 1 10  ? -16.740 12.713  0.469   1.00 0.00 ? 188 VAL A HG11 4  
ATOM 5384  H HG12 . VAL A 1 10  ? -16.010 12.509  -1.125  1.00 0.00 ? 188 VAL A HG12 4  
ATOM 5385  H HG13 . VAL A 1 10  ? -15.700 13.974  -0.193  1.00 0.00 ? 188 VAL A HG13 4  
ATOM 5386  H HG21 . VAL A 1 10  ? -18.352 13.905  -3.092  1.00 0.00 ? 188 VAL A HG21 4  
ATOM 5387  H HG22 . VAL A 1 10  ? -17.109 15.107  -2.745  1.00 0.00 ? 188 VAL A HG22 4  
ATOM 5388  H HG23 . VAL A 1 10  ? -16.669 13.408  -2.915  1.00 0.00 ? 188 VAL A HG23 4  
ATOM 5389  N N    . ASN A 1 11  ? -19.362 11.601  -2.719  1.00 0.00 ? 189 ASN A N    4  
ATOM 5390  C CA   . ASN A 1 11  ? -19.300 10.370  -3.498  1.00 0.00 ? 189 ASN A CA   4  
ATOM 5391  C C    . ASN A 1 11  ? -17.853 9.940   -3.721  1.00 0.00 ? 189 ASN A C    4  
ATOM 5392  O O    . ASN A 1 11  ? -17.223 10.329  -4.704  1.00 0.00 ? 189 ASN A O    4  
ATOM 5393  C CB   . ASN A 1 11  ? -20.001 10.558  -4.845  1.00 0.00 ? 189 ASN A CB   4  
ATOM 5394  C CG   . ASN A 1 11  ? -21.510 10.461  -4.730  1.00 0.00 ? 189 ASN A CG   4  
ATOM 5395  O OD1  . ASN A 1 11  ? -22.033 9.757   -3.867  1.00 0.00 ? 189 ASN A OD1  4  
ATOM 5396  N ND2  . ASN A 1 11  ? -22.216 11.169  -5.604  1.00 0.00 ? 189 ASN A ND2  4  
ATOM 5397  H H    . ASN A 1 11  ? -19.851 12.370  -3.079  1.00 0.00 ? 189 ASN A H    4  
ATOM 5398  H HA   . ASN A 1 11  ? -19.811 9.599   -2.941  1.00 0.00 ? 189 ASN A HA   4  
ATOM 5399  H HB2  . ASN A 1 11  ? -19.752 11.532  -5.241  1.00 0.00 ? 189 ASN A HB2  4  
ATOM 5400  H HB3  . ASN A 1 11  ? -19.660 9.798   -5.531  1.00 0.00 ? 189 ASN A HB3  4  
ATOM 5401  H HD21 . ASN A 1 11  ? -21.731 11.708  -6.264  1.00 0.00 ? 189 ASN A HD21 4  
ATOM 5402  H HD22 . ASN A 1 11  ? -23.194 11.125  -5.551  1.00 0.00 ? 189 ASN A HD22 4  
ATOM 5403  N N    . ARG A 1 12  ? -17.333 9.134   -2.801  1.00 0.00 ? 190 ARG A N    4  
ATOM 5404  C CA   . ARG A 1 12  ? -15.960 8.651   -2.896  1.00 0.00 ? 190 ARG A CA   4  
ATOM 5405  C C    . ARG A 1 12  ? -15.891 7.368   -3.718  1.00 0.00 ? 190 ARG A C    4  
ATOM 5406  O O    . ARG A 1 12  ? -16.496 6.356   -3.361  1.00 0.00 ? 190 ARG A O    4  
ATOM 5407  C CB   . ARG A 1 12  ? -15.385 8.407   -1.500  1.00 0.00 ? 190 ARG A CB   4  
ATOM 5408  C CG   . ARG A 1 12  ? -14.691 9.622   -0.906  1.00 0.00 ? 190 ARG A CG   4  
ATOM 5409  C CD   . ARG A 1 12  ? -13.220 9.666   -1.289  1.00 0.00 ? 190 ARG A CD   4  
ATOM 5410  N NE   . ARG A 1 12  ? -12.383 8.948   -0.332  1.00 0.00 ? 190 ARG A NE   4  
ATOM 5411  C CZ   . ARG A 1 12  ? -11.061 8.869   -0.426  1.00 0.00 ? 190 ARG A CZ   4  
ATOM 5412  N NH1  . ARG A 1 12  ? -10.428 9.462   -1.429  1.00 0.00 ? 190 ARG A NH1  4  
ATOM 5413  N NH2  . ARG A 1 12  ? -10.368 8.197   0.485   1.00 0.00 ? 190 ARG A NH2  4  
ATOM 5414  H H    . ARG A 1 12  ? -17.885 8.858   -2.040  1.00 0.00 ? 190 ARG A H    4  
ATOM 5415  H HA   . ARG A 1 12  ? -15.374 9.412   -3.389  1.00 0.00 ? 190 ARG A HA   4  
ATOM 5416  H HB2  . ARG A 1 12  ? -16.188 8.119   -0.838  1.00 0.00 ? 190 ARG A HB2  4  
ATOM 5417  H HB3  . ARG A 1 12  ? -14.669 7.601   -1.555  1.00 0.00 ? 190 ARG A HB3  4  
ATOM 5418  H HG2  . ARG A 1 12  ? -15.174 10.516  -1.272  1.00 0.00 ? 190 ARG A HG2  4  
ATOM 5419  H HG3  . ARG A 1 12  ? -14.773 9.581   0.170   1.00 0.00 ? 190 ARG A HG3  4  
ATOM 5420  H HD2  . ARG A 1 12  ? -13.102 9.217   -2.264  1.00 0.00 ? 190 ARG A HD2  4  
ATOM 5421  H HD3  . ARG A 1 12  ? -12.903 10.697  -1.328  1.00 0.00 ? 190 ARG A HD3  4  
ATOM 5422  H HE   . ARG A 1 12  ? -12.831 8.502   0.417   1.00 0.00 ? 190 ARG A HE   4  
ATOM 5423  H HH11 . ARG A 1 12  ? -10.947 9.970   -2.116  1.00 0.00 ? 190 ARG A HH11 4  
ATOM 5424  H HH12 . ARG A 1 12  ? -9.432  9.403   -1.497  1.00 0.00 ? 190 ARG A HH12 4  
ATOM 5425  H HH21 . ARG A 1 12  ? -10.842 7.749   1.242   1.00 0.00 ? 190 ARG A HH21 4  
ATOM 5426  H HH22 . ARG A 1 12  ? -9.373  8.139   0.413   1.00 0.00 ? 190 ARG A HH22 4  
ATOM 5427  N N    . VAL A 1 13  ? -15.151 7.416   -4.821  1.00 0.00 ? 191 VAL A N    4  
ATOM 5428  C CA   . VAL A 1 13  ? -15.003 6.258   -5.694  1.00 0.00 ? 191 VAL A CA   4  
ATOM 5429  C C    . VAL A 1 13  ? -13.749 5.463   -5.344  1.00 0.00 ? 191 VAL A C    4  
ATOM 5430  O O    . VAL A 1 13  ? -13.732 4.236   -5.442  1.00 0.00 ? 191 VAL A O    4  
ATOM 5431  C CB   . VAL A 1 13  ? -14.935 6.676   -7.175  1.00 0.00 ? 191 VAL A CB   4  
ATOM 5432  C CG1  . VAL A 1 13  ? -14.936 5.450   -8.076  1.00 0.00 ? 191 VAL A CG1  4  
ATOM 5433  C CG2  . VAL A 1 13  ? -16.092 7.602   -7.520  1.00 0.00 ? 191 VAL A CG2  4  
ATOM 5434  H H    . VAL A 1 13  ? -14.693 8.251   -5.053  1.00 0.00 ? 191 VAL A H    4  
ATOM 5435  H HA   . VAL A 1 13  ? -15.868 5.625   -5.559  1.00 0.00 ? 191 VAL A HA   4  
ATOM 5436  H HB   . VAL A 1 13  ? -14.012 7.212   -7.335  1.00 0.00 ? 191 VAL A HB   4  
ATOM 5437  H HG11 . VAL A 1 13  ? -15.903 5.353   -8.549  1.00 0.00 ? 191 VAL A HG11 4  
ATOM 5438  H HG12 . VAL A 1 13  ? -14.173 5.559   -8.833  1.00 0.00 ? 191 VAL A HG12 4  
ATOM 5439  H HG13 . VAL A 1 13  ? -14.735 4.569   -7.486  1.00 0.00 ? 191 VAL A HG13 4  
ATOM 5440  H HG21 . VAL A 1 13  ? -15.876 8.117   -8.444  1.00 0.00 ? 191 VAL A HG21 4  
ATOM 5441  H HG22 . VAL A 1 13  ? -16.997 7.023   -7.633  1.00 0.00 ? 191 VAL A HG22 4  
ATOM 5442  H HG23 . VAL A 1 13  ? -16.223 8.324   -6.728  1.00 0.00 ? 191 VAL A HG23 4  
ATOM 5443  N N    . LEU A 1 14  ? -12.702 6.171   -4.936  1.00 0.00 ? 192 LEU A N    4  
ATOM 5444  C CA   . LEU A 1 14  ? -11.442 5.532   -4.570  1.00 0.00 ? 192 LEU A CA   4  
ATOM 5445  C C    . LEU A 1 14  ? -11.180 4.307   -5.441  1.00 0.00 ? 192 LEU A C    4  
ATOM 5446  O O    . LEU A 1 14  ? -10.795 3.250   -4.942  1.00 0.00 ? 192 LEU A O    4  
ATOM 5447  C CB   . LEU A 1 14  ? -11.462 5.129   -3.095  1.00 0.00 ? 192 LEU A CB   4  
ATOM 5448  C CG   . LEU A 1 14  ? -12.429 4.005   -2.719  1.00 0.00 ? 192 LEU A CG   4  
ATOM 5449  C CD1  . LEU A 1 14  ? -11.893 3.213   -1.536  1.00 0.00 ? 192 LEU A CD1  4  
ATOM 5450  C CD2  . LEU A 1 14  ? -13.807 4.569   -2.406  1.00 0.00 ? 192 LEU A CD2  4  
ATOM 5451  H H    . LEU A 1 14  ? -12.776 7.146   -4.879  1.00 0.00 ? 192 LEU A H    4  
ATOM 5452  H HA   . LEU A 1 14  ? -10.650 6.248   -4.729  1.00 0.00 ? 192 LEU A HA   4  
ATOM 5453  H HB2  . LEU A 1 14  ? -10.466 4.812   -2.825  1.00 0.00 ? 192 LEU A HB2  4  
ATOM 5454  H HB3  . LEU A 1 14  ? -11.729 6.003   -2.517  1.00 0.00 ? 192 LEU A HB3  4  
ATOM 5455  H HG   . LEU A 1 14  ? -12.526 3.328   -3.557  1.00 0.00 ? 192 LEU A HG   4  
ATOM 5456  H HD11 . LEU A 1 14  ? -10.970 2.728   -1.816  1.00 0.00 ? 192 LEU A HD11 4  
ATOM 5457  H HD12 . LEU A 1 14  ? -12.618 2.467   -1.245  1.00 0.00 ? 192 LEU A HD12 4  
ATOM 5458  H HD13 . LEU A 1 14  ? -11.713 3.882   -0.708  1.00 0.00 ? 192 LEU A HD13 4  
ATOM 5459  H HD21 . LEU A 1 14  ? -14.480 4.349   -3.221  1.00 0.00 ? 192 LEU A HD21 4  
ATOM 5460  H HD22 . LEU A 1 14  ? -13.736 5.640   -2.276  1.00 0.00 ? 192 LEU A HD22 4  
ATOM 5461  H HD23 . LEU A 1 14  ? -14.182 4.120   -1.498  1.00 0.00 ? 192 LEU A HD23 4  
ATOM 5462  N N    . SER A 1 15  ? -11.389 4.459   -6.745  1.00 0.00 ? 193 SER A N    4  
ATOM 5463  C CA   . SER A 1 15  ? -11.177 3.365   -7.685  1.00 0.00 ? 193 SER A CA   4  
ATOM 5464  C C    . SER A 1 15  ? -10.147 3.750   -8.743  1.00 0.00 ? 193 SER A C    4  
ATOM 5465  O O    . SER A 1 15  ? -10.100 4.895   -9.191  1.00 0.00 ? 193 SER A O    4  
ATOM 5466  C CB   . SER A 1 15  ? -12.496 2.979   -8.357  1.00 0.00 ? 193 SER A CB   4  
ATOM 5467  O OG   . SER A 1 15  ? -13.445 2.537   -7.402  1.00 0.00 ? 193 SER A OG   4  
ATOM 5468  H H    . SER A 1 15  ? -11.696 5.327   -7.082  1.00 0.00 ? 193 SER A H    4  
ATOM 5469  H HA   . SER A 1 15  ? -10.805 2.517   -7.129  1.00 0.00 ? 193 SER A HA   4  
ATOM 5470  H HB2  . SER A 1 15  ? -12.897 3.836   -8.876  1.00 0.00 ? 193 SER A HB2  4  
ATOM 5471  H HB3  . SER A 1 15  ? -12.316 2.182   -9.064  1.00 0.00 ? 193 SER A HB3  4  
ATOM 5472  H HG   . SER A 1 15  ? -12.990 2.120   -6.667  1.00 0.00 ? 193 SER A HG   4  
ATOM 5473  N N    . ALA A 1 16  ? -9.323  2.784   -9.137  1.00 0.00 ? 194 ALA A N    4  
ATOM 5474  C CA   . ALA A 1 16  ? -8.295  3.020   -10.143 1.00 0.00 ? 194 ALA A CA   4  
ATOM 5475  C C    . ALA A 1 16  ? -8.847  3.828   -11.312 1.00 0.00 ? 194 ALA A C    4  
ATOM 5476  O O    . ALA A 1 16  ? -8.096  4.483   -12.034 1.00 0.00 ? 194 ALA A O    4  
ATOM 5477  C CB   . ALA A 1 16  ? -7.725  1.698   -10.635 1.00 0.00 ? 194 ALA A CB   4  
ATOM 5478  H H    . ALA A 1 16  ? -9.410  1.892   -8.742  1.00 0.00 ? 194 ALA A H    4  
ATOM 5479  H HA   . ALA A 1 16  ? -7.495  3.578   -9.678  1.00 0.00 ? 194 ALA A HA   4  
ATOM 5480  H HB1  . ALA A 1 16  ? -8.449  0.912   -10.473 1.00 0.00 ? 194 ALA A HB1  4  
ATOM 5481  H HB2  . ALA A 1 16  ? -7.504  1.772   -11.689 1.00 0.00 ? 194 ALA A HB2  4  
ATOM 5482  H HB3  . ALA A 1 16  ? -6.820  1.472   -10.091 1.00 0.00 ? 194 ALA A HB3  4  
ATOM 5483  N N    . GLU A 1 17  ? -10.163 3.777   -11.493 1.00 0.00 ? 195 GLU A N    4  
ATOM 5484  C CA   . GLU A 1 17  ? -10.814 4.504   -12.576 1.00 0.00 ? 195 GLU A CA   4  
ATOM 5485  C C    . GLU A 1 17  ? -10.885 5.996   -12.265 1.00 0.00 ? 195 GLU A C    4  
ATOM 5486  O O    . GLU A 1 17  ? -10.704 6.834   -13.147 1.00 0.00 ? 195 GLU A O    4  
ATOM 5487  C CB   . GLU A 1 17  ? -12.222 3.954   -12.816 1.00 0.00 ? 195 GLU A CB   4  
ATOM 5488  C CG   . GLU A 1 17  ? -12.271 2.441   -12.943 1.00 0.00 ? 195 GLU A CG   4  
ATOM 5489  C CD   . GLU A 1 17  ? -12.376 1.746   -11.600 1.00 0.00 ? 195 GLU A CD   4  
ATOM 5490  O OE1  . GLU A 1 17  ? -13.499 1.661   -11.061 1.00 0.00 ? 195 GLU A OE1  4  
ATOM 5491  O OE2  . GLU A 1 17  ? -11.334 1.286   -11.087 1.00 0.00 ? 195 GLU A OE2  4  
ATOM 5492  H H    . GLU A 1 17  ? -10.709 3.237   -10.884 1.00 0.00 ? 195 GLU A H    4  
ATOM 5493  H HA   . GLU A 1 17  ? -10.226 4.363   -13.470 1.00 0.00 ? 195 GLU A HA   4  
ATOM 5494  H HB2  . GLU A 1 17  ? -12.855 4.247   -11.991 1.00 0.00 ? 195 GLU A HB2  4  
ATOM 5495  H HB3  . GLU A 1 17  ? -12.612 4.383   -13.727 1.00 0.00 ? 195 GLU A HB3  4  
ATOM 5496  H HG2  . GLU A 1 17  ? -13.129 2.170   -13.539 1.00 0.00 ? 195 GLU A HG2  4  
ATOM 5497  H HG3  . GLU A 1 17  ? -11.371 2.104   -13.436 1.00 0.00 ? 195 GLU A HG3  4  
ATOM 5498  N N    . ALA A 1 18  ? -11.150 6.319   -11.003 1.00 0.00 ? 196 ALA A N    4  
ATOM 5499  C CA   . ALA A 1 18  ? -11.244 7.709   -10.574 1.00 0.00 ? 196 ALA A CA   4  
ATOM 5500  C C    . ALA A 1 18  ? -10.058 8.093   -9.696  1.00 0.00 ? 196 ALA A C    4  
ATOM 5501  O O    . ALA A 1 18  ? -10.105 9.090   -8.973  1.00 0.00 ? 196 ALA A O    4  
ATOM 5502  C CB   . ALA A 1 18  ? -12.551 7.945   -9.832  1.00 0.00 ? 196 ALA A CB   4  
ATOM 5503  H H    . ALA A 1 18  ? -11.285 5.605   -10.345 1.00 0.00 ? 196 ALA A H    4  
ATOM 5504  H HA   . ALA A 1 18  ? -11.242 8.332   -11.457 1.00 0.00 ? 196 ALA A HA   4  
ATOM 5505  H HB1  . ALA A 1 18  ? -13.226 8.506   -10.462 1.00 0.00 ? 196 ALA A HB1  4  
ATOM 5506  H HB2  . ALA A 1 18  ? -12.999 6.995   -9.581  1.00 0.00 ? 196 ALA A HB2  4  
ATOM 5507  H HB3  . ALA A 1 18  ? -12.356 8.502   -8.928  1.00 0.00 ? 196 ALA A HB3  4  
ATOM 5508  N N    . LEU A 1 19  ? -8.996  7.298   -9.762  1.00 0.00 ? 197 LEU A N    4  
ATOM 5509  C CA   . LEU A 1 19  ? -7.797  7.555   -8.972  1.00 0.00 ? 197 LEU A CA   4  
ATOM 5510  C C    . LEU A 1 19  ? -6.675  8.103   -9.848  1.00 0.00 ? 197 LEU A C    4  
ATOM 5511  O O    . LEU A 1 19  ? -6.523  7.704   -11.003 1.00 0.00 ? 197 LEU A O    4  
ATOM 5512  C CB   . LEU A 1 19  ? -7.337  6.273   -8.276  1.00 0.00 ? 197 LEU A CB   4  
ATOM 5513  C CG   . LEU A 1 19  ? -8.140  5.851   -7.045  1.00 0.00 ? 197 LEU A CG   4  
ATOM 5514  C CD1  . LEU A 1 19  ? -7.587  4.560   -6.464  1.00 0.00 ? 197 LEU A CD1  4  
ATOM 5515  C CD2  . LEU A 1 19  ? -8.131  6.956   -5.999  1.00 0.00 ? 197 LEU A CD2  4  
ATOM 5516  H H    . LEU A 1 19  ? -9.018  6.519   -10.356 1.00 0.00 ? 197 LEU A H    4  
ATOM 5517  H HA   . LEU A 1 19  ? -8.046  8.292   -8.223  1.00 0.00 ? 197 LEU A HA   4  
ATOM 5518  H HB2  . LEU A 1 19  ? -7.388  5.470   -8.995  1.00 0.00 ? 197 LEU A HB2  4  
ATOM 5519  H HB3  . LEU A 1 19  ? -6.310  6.414   -7.970  1.00 0.00 ? 197 LEU A HB3  4  
ATOM 5520  H HG   . LEU A 1 19  ? -9.166  5.673   -7.336  1.00 0.00 ? 197 LEU A HG   4  
ATOM 5521  H HD11 . LEU A 1 19  ? -8.020  4.389   -5.490  1.00 0.00 ? 197 LEU A HD11 4  
ATOM 5522  H HD12 . LEU A 1 19  ? -6.514  4.636   -6.372  1.00 0.00 ? 197 LEU A HD12 4  
ATOM 5523  H HD13 . LEU A 1 19  ? -7.834  3.736   -7.117  1.00 0.00 ? 197 LEU A HD13 4  
ATOM 5524  H HD21 . LEU A 1 19  ? -8.395  6.542   -5.037  1.00 0.00 ? 197 LEU A HD21 4  
ATOM 5525  H HD22 . LEU A 1 19  ? -8.848  7.717   -6.273  1.00 0.00 ? 197 LEU A HD22 4  
ATOM 5526  H HD23 . LEU A 1 19  ? -7.145  7.393   -5.945  1.00 0.00 ? 197 LEU A HD23 4  
ATOM 5527  N N    . LYS A 1 20  ? -5.890  9.018   -9.291  1.00 0.00 ? 198 LYS A N    4  
ATOM 5528  C CA   . LYS A 1 20  ? -4.779  9.620   -10.018 1.00 0.00 ? 198 LYS A CA   4  
ATOM 5529  C C    . LYS A 1 20  ? -3.468  9.432   -9.261  1.00 0.00 ? 198 LYS A C    4  
ATOM 5530  O O    . LYS A 1 20  ? -3.438  9.349   -8.033  1.00 0.00 ? 198 LYS A O    4  
ATOM 5531  C CB   . LYS A 1 20  ? -5.039  11.110  -10.247 1.00 0.00 ? 198 LYS A CB   4  
ATOM 5532  C CG   . LYS A 1 20  ? -6.308  11.393  -11.033 1.00 0.00 ? 198 LYS A CG   4  
ATOM 5533  C CD   . LYS A 1 20  ? -6.057  11.352  -12.531 1.00 0.00 ? 198 LYS A CD   4  
ATOM 5534  C CE   . LYS A 1 20  ? -5.456  12.657  -13.030 1.00 0.00 ? 198 LYS A CE   4  
ATOM 5535  N NZ   . LYS A 1 20  ? -4.810  12.496  -14.363 1.00 0.00 ? 198 LYS A NZ   4  
ATOM 5536  H H    . LYS A 1 20  ? -6.062  9.296   -8.366  1.00 0.00 ? 198 LYS A H    4  
ATOM 5537  H HA   . LYS A 1 20  ? -4.702  9.125   -10.975 1.00 0.00 ? 198 LYS A HA   4  
ATOM 5538  H HB2  . LYS A 1 20  ? -5.117  11.601  -9.288  1.00 0.00 ? 198 LYS A HB2  4  
ATOM 5539  H HB3  . LYS A 1 20  ? -4.204  11.530  -10.789 1.00 0.00 ? 198 LYS A HB3  4  
ATOM 5540  H HG2  . LYS A 1 20  ? -7.049  10.648  -10.783 1.00 0.00 ? 198 LYS A HG2  4  
ATOM 5541  H HG3  . LYS A 1 20  ? -6.676  12.373  -10.765 1.00 0.00 ? 198 LYS A HG3  4  
ATOM 5542  H HD2  . LYS A 1 20  ? -5.372  10.547  -12.751 1.00 0.00 ? 198 LYS A HD2  4  
ATOM 5543  H HD3  . LYS A 1 20  ? -6.995  11.180  -13.039 1.00 0.00 ? 198 LYS A HD3  4  
ATOM 5544  H HE2  . LYS A 1 20  ? -6.241  13.394  -13.107 1.00 0.00 ? 198 LYS A HE2  4  
ATOM 5545  H HE3  . LYS A 1 20  ? -4.716  12.993  -12.319 1.00 0.00 ? 198 LYS A HE3  4  
ATOM 5546  H HZ1  . LYS A 1 20  ? -5.425  12.885  -15.106 1.00 0.00 ? 198 LYS A HZ1  4  
ATOM 5547  H HZ2  . LYS A 1 20  ? -4.643  11.489  -14.559 1.00 0.00 ? 198 LYS A HZ2  4  
ATOM 5548  H HZ3  . LYS A 1 20  ? -3.900  12.999  -14.382 1.00 0.00 ? 198 LYS A HZ3  4  
ATOM 5549  N N    . PRO A 1 21  ? -2.356  9.365   -10.009 1.00 0.00 ? 199 PRO A N    4  
ATOM 5550  C CA   . PRO A 1 21  ? -1.021  9.189   -9.429  1.00 0.00 ? 199 PRO A CA   4  
ATOM 5551  C C    . PRO A 1 21  ? -0.552  10.424  -8.668  1.00 0.00 ? 199 PRO A C    4  
ATOM 5552  O O    . PRO A 1 21  ? -0.418  11.504  -9.241  1.00 0.00 ? 199 PRO A O    4  
ATOM 5553  C CB   . PRO A 1 21  ? -0.133  8.945   -10.652 1.00 0.00 ? 199 PRO A CB   4  
ATOM 5554  C CG   . PRO A 1 21  ? -0.851  9.603   -11.779 1.00 0.00 ? 199 PRO A CG   4  
ATOM 5555  C CD   . PRO A 1 21  ? -2.317  9.457   -11.478 1.00 0.00 ? 199 PRO A CD   4  
ATOM 5556  H HA   . PRO A 1 21  ? -0.983  8.329   -8.777  1.00 0.00 ? 199 PRO A HA   4  
ATOM 5557  H HB2  . PRO A 1 21  ? 0.839   9.389   -10.488 1.00 0.00 ? 199 PRO A HB2  4  
ATOM 5558  H HB3  . PRO A 1 21  ? -0.027  7.883   -10.818 1.00 0.00 ? 199 PRO A HB3  4  
ATOM 5559  H HG2  . PRO A 1 21  ? -0.580  10.647  -11.827 1.00 0.00 ? 199 PRO A HG2  4  
ATOM 5560  H HG3  . PRO A 1 21  ? -0.608  9.108   -12.707 1.00 0.00 ? 199 PRO A HG3  4  
ATOM 5561  H HD2  . PRO A 1 21  ? -2.861  10.322  -11.826 1.00 0.00 ? 199 PRO A HD2  4  
ATOM 5562  H HD3  . PRO A 1 21  ? -2.707  8.557   -11.931 1.00 0.00 ? 199 PRO A HD3  4  
ATOM 5563  N N    . GLY A 1 22  ? -0.305  10.256  -7.372  1.00 0.00 ? 200 GLY A N    4  
ATOM 5564  C CA   . GLY A 1 22  ? 0.147   11.366  -6.554  1.00 0.00 ? 200 GLY A CA   4  
ATOM 5565  C C    . GLY A 1 22  ? -0.717  11.570  -5.325  1.00 0.00 ? 200 GLY A C    4  
ATOM 5566  O O    . GLY A 1 22  ? -0.610  12.590  -4.646  1.00 0.00 ? 200 GLY A O    4  
ATOM 5567  H H    . GLY A 1 22  ? -0.430  9.371   -6.969  1.00 0.00 ? 200 GLY A H    4  
ATOM 5568  H HA2  . GLY A 1 22  ? 1.163   11.177  -6.239  1.00 0.00 ? 200 GLY A HA2  4  
ATOM 5569  H HA3  . GLY A 1 22  ? 0.127   12.268  -7.148  1.00 0.00 ? 200 GLY A HA3  4  
ATOM 5570  N N    . MET A 1 23  ? -1.578  10.598  -5.041  1.00 0.00 ? 201 MET A N    4  
ATOM 5571  C CA   . MET A 1 23  ? -2.465  10.677  -3.886  1.00 0.00 ? 201 MET A CA   4  
ATOM 5572  C C    . MET A 1 23  ? -1.907  9.872   -2.717  1.00 0.00 ? 201 MET A C    4  
ATOM 5573  O O    . MET A 1 23  ? -1.521  8.713   -2.875  1.00 0.00 ? 201 MET A O    4  
ATOM 5574  C CB   . MET A 1 23  ? -3.860  10.166  -4.252  1.00 0.00 ? 201 MET A CB   4  
ATOM 5575  C CG   . MET A 1 23  ? -4.705  11.188  -4.996  1.00 0.00 ? 201 MET A CG   4  
ATOM 5576  S SD   . MET A 1 23  ? -6.462  10.781  -4.978  1.00 0.00 ? 201 MET A SD   4  
ATOM 5577  C CE   . MET A 1 23  ? -6.949  11.313  -6.617  1.00 0.00 ? 201 MET A CE   4  
ATOM 5578  H H    . MET A 1 23  ? -1.618  9.809   -5.621  1.00 0.00 ? 201 MET A H    4  
ATOM 5579  H HA   . MET A 1 23  ? -2.536  11.714  -3.594  1.00 0.00 ? 201 MET A HA   4  
ATOM 5580  H HB2  . MET A 1 23  ? -3.758  9.292   -4.878  1.00 0.00 ? 201 MET A HB2  4  
ATOM 5581  H HB3  . MET A 1 23  ? -4.380  9.893   -3.346  1.00 0.00 ? 201 MET A HB3  4  
ATOM 5582  H HG2  . MET A 1 23  ? -4.570  12.154  -4.532  1.00 0.00 ? 201 MET A HG2  4  
ATOM 5583  H HG3  . MET A 1 23  ? -4.370  11.234  -6.021  1.00 0.00 ? 201 MET A HG3  4  
ATOM 5584  H HE1  . MET A 1 23  ? -6.108  11.226  -7.289  1.00 0.00 ? 201 MET A HE1  4  
ATOM 5585  H HE2  . MET A 1 23  ? -7.759  10.692  -6.971  1.00 0.00 ? 201 MET A HE2  4  
ATOM 5586  H HE3  . MET A 1 23  ? -7.274  12.343  -6.579  1.00 0.00 ? 201 MET A HE3  4  
ATOM 5587  N N    . LEU A 1 24  ? -1.867  10.493  -1.543  1.00 0.00 ? 202 LEU A N    4  
ATOM 5588  C CA   . LEU A 1 24  ? -1.355  9.835   -0.346  1.00 0.00 ? 202 LEU A CA   4  
ATOM 5589  C C    . LEU A 1 24  ? -2.455  9.039   0.350   1.00 0.00 ? 202 LEU A C    4  
ATOM 5590  O O    . LEU A 1 24  ? -3.361  9.612   0.956   1.00 0.00 ? 202 LEU A O    4  
ATOM 5591  C CB   . LEU A 1 24  ? -0.770  10.868  0.618   1.00 0.00 ? 202 LEU A CB   4  
ATOM 5592  C CG   . LEU A 1 24  ? 0.466   11.622  0.125   1.00 0.00 ? 202 LEU A CG   4  
ATOM 5593  C CD1  . LEU A 1 24  ? 0.058   12.870  -0.644  1.00 0.00 ? 202 LEU A CD1  4  
ATOM 5594  C CD2  . LEU A 1 24  ? 1.371   11.985  1.293   1.00 0.00 ? 202 LEU A CD2  4  
ATOM 5595  H H    . LEU A 1 24  ? -2.188  11.417  -1.479  1.00 0.00 ? 202 LEU A H    4  
ATOM 5596  H HA   . LEU A 1 24  ? -0.573  9.155   -0.650  1.00 0.00 ? 202 LEU A HA   4  
ATOM 5597  H HB2  . LEU A 1 24  ? -1.538  11.596  0.829   1.00 0.00 ? 202 LEU A HB2  4  
ATOM 5598  H HB3  . LEU A 1 24  ? -0.503  10.354  1.530   1.00 0.00 ? 202 LEU A HB3  4  
ATOM 5599  H HG   . LEU A 1 24  ? 1.024   10.985  -0.547  1.00 0.00 ? 202 LEU A HG   4  
ATOM 5600  H HD11 . LEU A 1 24  ? -0.513  13.520  0.001   1.00 0.00 ? 202 LEU A HD11 4  
ATOM 5601  H HD12 . LEU A 1 24  ? -0.544  12.587  -1.495  1.00 0.00 ? 202 LEU A HD12 4  
ATOM 5602  H HD13 . LEU A 1 24  ? 0.943   13.387  -0.986  1.00 0.00 ? 202 LEU A HD13 4  
ATOM 5603  H HD21 . LEU A 1 24  ? 1.176   11.317  2.119   1.00 0.00 ? 202 LEU A HD21 4  
ATOM 5604  H HD22 . LEU A 1 24  ? 1.173   13.003  1.598   1.00 0.00 ? 202 LEU A HD22 4  
ATOM 5605  H HD23 . LEU A 1 24  ? 2.403   11.893  0.990   1.00 0.00 ? 202 LEU A HD23 4  
ATOM 5606  N N    . LEU A 1 25  ? -2.369  7.717   0.259   1.00 0.00 ? 203 LEU A N    4  
ATOM 5607  C CA   . LEU A 1 25  ? -3.355  6.841   0.882   1.00 0.00 ? 203 LEU A CA   4  
ATOM 5608  C C    . LEU A 1 25  ? -2.693  5.896   1.879   1.00 0.00 ? 203 LEU A C    4  
ATOM 5609  O O    . LEU A 1 25  ? -1.695  5.245   1.566   1.00 0.00 ? 203 LEU A O    4  
ATOM 5610  C CB   . LEU A 1 25  ? -4.098  6.036   -0.185  1.00 0.00 ? 203 LEU A CB   4  
ATOM 5611  C CG   . LEU A 1 25  ? -5.201  6.779   -0.941  1.00 0.00 ? 203 LEU A CG   4  
ATOM 5612  C CD1  . LEU A 1 25  ? -6.453  6.888   -0.085  1.00 0.00 ? 203 LEU A CD1  4  
ATOM 5613  C CD2  . LEU A 1 25  ? -4.720  8.159   -1.365  1.00 0.00 ? 203 LEU A CD2  4  
ATOM 5614  H H    . LEU A 1 25  ? -1.624  7.319   -0.237  1.00 0.00 ? 203 LEU A H    4  
ATOM 5615  H HA   . LEU A 1 25  ? -4.063  7.463   1.410   1.00 0.00 ? 203 LEU A HA   4  
ATOM 5616  H HB2  . LEU A 1 25  ? -3.372  5.698   -0.909  1.00 0.00 ? 203 LEU A HB2  4  
ATOM 5617  H HB3  . LEU A 1 25  ? -4.546  5.180   0.299   1.00 0.00 ? 203 LEU A HB3  4  
ATOM 5618  H HG   . LEU A 1 25  ? -5.454  6.223   -1.833  1.00 0.00 ? 203 LEU A HG   4  
ATOM 5619  H HD11 . LEU A 1 25  ? -6.748  5.905   0.248   1.00 0.00 ? 203 LEU A HD11 4  
ATOM 5620  H HD12 . LEU A 1 25  ? -7.250  7.325   -0.668  1.00 0.00 ? 203 LEU A HD12 4  
ATOM 5621  H HD13 . LEU A 1 25  ? -6.250  7.514   0.772   1.00 0.00 ? 203 LEU A HD13 4  
ATOM 5622  H HD21 . LEU A 1 25  ? -4.794  8.838   -0.528  1.00 0.00 ? 203 LEU A HD21 4  
ATOM 5623  H HD22 . LEU A 1 25  ? -5.335  8.520   -2.177  1.00 0.00 ? 203 LEU A HD22 4  
ATOM 5624  H HD23 . LEU A 1 25  ? -3.692  8.098   -1.690  1.00 0.00 ? 203 LEU A HD23 4  
ATOM 5625  N N    . THR A 1 26  ? -3.255  5.824   3.082   1.00 0.00 ? 204 THR A N    4  
ATOM 5626  C CA   . THR A 1 26  ? -2.719  4.957   4.125   1.00 0.00 ? 204 THR A CA   4  
ATOM 5627  C C    . THR A 1 26  ? -3.412  3.600   4.121   1.00 0.00 ? 204 THR A C    4  
ATOM 5628  O O    . THR A 1 26  ? -4.640  3.518   4.128   1.00 0.00 ? 204 THR A O    4  
ATOM 5629  C CB   . THR A 1 26  ? -2.873  5.595   5.518   1.00 0.00 ? 204 THR A CB   4  
ATOM 5630  O OG1  . THR A 1 26  ? -2.394  6.945   5.494   1.00 0.00 ? 204 THR A OG1  4  
ATOM 5631  C CG2  . THR A 1 26  ? -2.108  4.799   6.565   1.00 0.00 ? 204 THR A CG2  4  
ATOM 5632  H H    . THR A 1 26  ? -4.048  6.367   3.271   1.00 0.00 ? 204 THR A H    4  
ATOM 5633  H HA   . THR A 1 26  ? -1.666  4.814   3.931   1.00 0.00 ? 204 THR A HA   4  
ATOM 5634  H HB   . THR A 1 26  ? -3.920  5.597   5.783   1.00 0.00 ? 204 THR A HB   4  
ATOM 5635  H HG1  . THR A 1 26  ? -2.787  7.436   6.220   1.00 0.00 ? 204 THR A HG1  4  
ATOM 5636  H HG21 . THR A 1 26  ? -1.260  5.374   6.906   1.00 0.00 ? 204 THR A HG21 4  
ATOM 5637  H HG22 . THR A 1 26  ? -1.763  3.872   6.131   1.00 0.00 ? 204 THR A HG22 4  
ATOM 5638  H HG23 . THR A 1 26  ? -2.757  4.587   7.400   1.00 0.00 ? 204 THR A HG23 4  
ATOM 5639  N N    . GLY A 1 27  ? -2.617  2.534   4.110   1.00 0.00 ? 205 GLY A N    4  
ATOM 5640  C CA   . GLY A 1 27  ? -3.173  1.194   4.107   1.00 0.00 ? 205 GLY A CA   4  
ATOM 5641  C C    . GLY A 1 27  ? -2.458  0.267   5.070   1.00 0.00 ? 205 GLY A C    4  
ATOM 5642  O O    . GLY A 1 27  ? -1.604  0.701   5.844   1.00 0.00 ? 205 GLY A O    4  
ATOM 5643  H H    . GLY A 1 27  ? -1.645  2.660   4.105   1.00 0.00 ? 205 GLY A H    4  
ATOM 5644  H HA2  . GLY A 1 27  ? -4.216  1.247   4.381   1.00 0.00 ? 205 GLY A HA2  4  
ATOM 5645  H HA3  . GLY A 1 27  ? -3.094  0.786   3.109   1.00 0.00 ? 205 GLY A HA3  4  
ATOM 5646  N N    . THR A 1 28  ? -2.809  -1.015  5.027   1.00 0.00 ? 206 THR A N    4  
ATOM 5647  C CA   . THR A 1 28  ? -2.197  -2.005  5.905   1.00 0.00 ? 206 THR A CA   4  
ATOM 5648  C C    . THR A 1 28  ? -1.735  -3.226  5.118   1.00 0.00 ? 206 THR A C    4  
ATOM 5649  O O    . THR A 1 28  ? -2.421  -3.683  4.203   1.00 0.00 ? 206 THR A O    4  
ATOM 5650  C CB   . THR A 1 28  ? -3.173  -2.457  7.007   1.00 0.00 ? 206 THR A CB   4  
ATOM 5651  O OG1  . THR A 1 28  ? -4.482  -2.645  6.456   1.00 0.00 ? 206 THR A OG1  4  
ATOM 5652  C CG2  . THR A 1 28  ? -3.233  -1.433  8.130   1.00 0.00 ? 206 THR A CG2  4  
ATOM 5653  H H    . THR A 1 28  ? -3.496  -1.300  4.389   1.00 0.00 ? 206 THR A H    4  
ATOM 5654  H HA   . THR A 1 28  ? -1.340  -1.547  6.377   1.00 0.00 ? 206 THR A HA   4  
ATOM 5655  H HB   . THR A 1 28  ? -2.824  -3.395  7.413   1.00 0.00 ? 206 THR A HB   4  
ATOM 5656  H HG1  . THR A 1 28  ? -4.408  -3.048  5.587   1.00 0.00 ? 206 THR A HG1  4  
ATOM 5657  H HG21 . THR A 1 28  ? -4.236  -1.039  8.206   1.00 0.00 ? 206 THR A HG21 4  
ATOM 5658  H HG22 . THR A 1 28  ? -2.545  -0.628  7.920   1.00 0.00 ? 206 THR A HG22 4  
ATOM 5659  H HG23 . THR A 1 28  ? -2.962  -1.905  9.062   1.00 0.00 ? 206 THR A HG23 4  
ATOM 5660  N N    . VAL A 1 29  ? -0.569  -3.751  5.481   1.00 0.00 ? 207 VAL A N    4  
ATOM 5661  C CA   . VAL A 1 29  ? -0.017  -4.922  4.810   1.00 0.00 ? 207 VAL A CA   4  
ATOM 5662  C C    . VAL A 1 29  ? -0.931  -6.131  4.971   1.00 0.00 ? 207 VAL A C    4  
ATOM 5663  O O    . VAL A 1 29  ? -1.204  -6.571  6.088   1.00 0.00 ? 207 VAL A O    4  
ATOM 5664  C CB   . VAL A 1 29  ? 1.381   -5.273  5.354   1.00 0.00 ? 207 VAL A CB   4  
ATOM 5665  C CG1  . VAL A 1 29  ? 1.918   -6.525  4.678   1.00 0.00 ? 207 VAL A CG1  4  
ATOM 5666  C CG2  . VAL A 1 29  ? 2.336   -4.103  5.163   1.00 0.00 ? 207 VAL A CG2  4  
ATOM 5667  H H    . VAL A 1 29  ? -0.069  -3.342  6.217   1.00 0.00 ? 207 VAL A H    4  
ATOM 5668  H HA   . VAL A 1 29  ? 0.077   -4.691  3.758   1.00 0.00 ? 207 VAL A HA   4  
ATOM 5669  H HB   . VAL A 1 29  ? 1.294   -5.470  6.412   1.00 0.00 ? 207 VAL A HB   4  
ATOM 5670  H HG11 . VAL A 1 29  ? 2.163   -7.262  5.430   1.00 0.00 ? 207 VAL A HG11 4  
ATOM 5671  H HG12 . VAL A 1 29  ? 1.168   -6.925  4.012   1.00 0.00 ? 207 VAL A HG12 4  
ATOM 5672  H HG13 . VAL A 1 29  ? 2.806   -6.278  4.115   1.00 0.00 ? 207 VAL A HG13 4  
ATOM 5673  H HG21 . VAL A 1 29  ? 2.346   -3.499  6.058   1.00 0.00 ? 207 VAL A HG21 4  
ATOM 5674  H HG22 . VAL A 1 29  ? 3.330   -4.478  4.971   1.00 0.00 ? 207 VAL A HG22 4  
ATOM 5675  H HG23 . VAL A 1 29  ? 2.009   -3.504  4.327   1.00 0.00 ? 207 VAL A HG23 4  
ATOM 5676  N N    . SER A 1 30  ? -1.401  -6.664  3.848   1.00 0.00 ? 208 SER A N    4  
ATOM 5677  C CA   . SER A 1 30  ? -2.289  -7.821  3.865   1.00 0.00 ? 208 SER A CA   4  
ATOM 5678  C C    . SER A 1 30  ? -1.488  -9.119  3.901   1.00 0.00 ? 208 SER A C    4  
ATOM 5679  O O    . SER A 1 30  ? -1.854  -10.068 4.594   1.00 0.00 ? 208 SER A O    4  
ATOM 5680  C CB   . SER A 1 30  ? -3.203  -7.807  2.638   1.00 0.00 ? 208 SER A CB   4  
ATOM 5681  O OG   . SER A 1 30  ? -4.141  -8.868  2.689   1.00 0.00 ? 208 SER A OG   4  
ATOM 5682  H H    . SER A 1 30  ? -1.147  -6.268  2.988   1.00 0.00 ? 208 SER A H    4  
ATOM 5683  H HA   . SER A 1 30  ? -2.895  -7.761  4.756   1.00 0.00 ? 208 SER A HA   4  
ATOM 5684  H HB2  . SER A 1 30  ? -3.738  -6.871  2.602   1.00 0.00 ? 208 SER A HB2  4  
ATOM 5685  H HB3  . SER A 1 30  ? -2.604  -7.914  1.745   1.00 0.00 ? 208 SER A HB3  4  
ATOM 5686  H HG   . SER A 1 30  ? -3.691  -9.683  2.920   1.00 0.00 ? 208 SER A HG   4  
ATOM 5687  N N    . SER A 1 31  ? -0.392  -9.153  3.149   1.00 0.00 ? 209 SER A N    4  
ATOM 5688  C CA   . SER A 1 31  ? 0.460   -10.335 3.091   1.00 0.00 ? 209 SER A CA   4  
ATOM 5689  C C    . SER A 1 31  ? 1.874   -9.964  2.657   1.00 0.00 ? 209 SER A C    4  
ATOM 5690  O O    . SER A 1 31  ? 2.088   -8.943  2.003   1.00 0.00 ? 209 SER A O    4  
ATOM 5691  C CB   . SER A 1 31  ? -0.128  -11.366 2.126   1.00 0.00 ? 209 SER A CB   4  
ATOM 5692  O OG   . SER A 1 31  ? -1.464  -11.688 2.475   1.00 0.00 ? 209 SER A OG   4  
ATOM 5693  H H    . SER A 1 31  ? -0.153  -8.364  2.618   1.00 0.00 ? 209 SER A H    4  
ATOM 5694  H HA   . SER A 1 31  ? 0.500   -10.763 4.082   1.00 0.00 ? 209 SER A HA   4  
ATOM 5695  H HB2  . SER A 1 31  ? -0.118  -10.965 1.124   1.00 0.00 ? 209 SER A HB2  4  
ATOM 5696  H HB3  . SER A 1 31  ? 0.467   -12.267 2.160   1.00 0.00 ? 209 SER A HB3  4  
ATOM 5697  H HG   . SER A 1 31  ? -1.468  -12.462 3.044   1.00 0.00 ? 209 SER A HG   4  
ATOM 5698  N N    . LEU A 1 32  ? 2.838   -10.801 3.026   1.00 0.00 ? 210 LEU A N    4  
ATOM 5699  C CA   . LEU A 1 32  ? 4.234   -10.563 2.676   1.00 0.00 ? 210 LEU A CA   4  
ATOM 5700  C C    . LEU A 1 32  ? 4.693   -11.525 1.584   1.00 0.00 ? 210 LEU A C    4  
ATOM 5701  O O    . LEU A 1 32  ? 4.575   -12.741 1.727   1.00 0.00 ? 210 LEU A O    4  
ATOM 5702  C CB   . LEU A 1 32  ? 5.123   -10.714 3.911   1.00 0.00 ? 210 LEU A CB   4  
ATOM 5703  C CG   . LEU A 1 32  ? 5.141   -9.525  4.874   1.00 0.00 ? 210 LEU A CG   4  
ATOM 5704  C CD1  . LEU A 1 32  ? 3.845   -9.461  5.666   1.00 0.00 ? 210 LEU A CD1  4  
ATOM 5705  C CD2  . LEU A 1 32  ? 6.337   -9.616  5.810   1.00 0.00 ? 210 LEU A CD2  4  
ATOM 5706  H H    . LEU A 1 32  ? 2.606   -11.598 3.546   1.00 0.00 ? 210 LEU A H    4  
ATOM 5707  H HA   . LEU A 1 32  ? 4.314   -9.552  2.305   1.00 0.00 ? 210 LEU A HA   4  
ATOM 5708  H HB2  . LEU A 1 32  ? 4.783   -11.578 4.460   1.00 0.00 ? 210 LEU A HB2  4  
ATOM 5709  H HB3  . LEU A 1 32  ? 6.135   -10.881 3.571   1.00 0.00 ? 210 LEU A HB3  4  
ATOM 5710  H HG   . LEU A 1 32  ? 5.230   -8.610  4.304   1.00 0.00 ? 210 LEU A HG   4  
ATOM 5711  H HD11 . LEU A 1 32  ? 3.006   -9.510  4.989   1.00 0.00 ? 210 LEU A HD11 4  
ATOM 5712  H HD12 . LEU A 1 32  ? 3.807   -8.533  6.219   1.00 0.00 ? 210 LEU A HD12 4  
ATOM 5713  H HD13 . LEU A 1 32  ? 3.802   -10.292 6.355   1.00 0.00 ? 210 LEU A HD13 4  
ATOM 5714  H HD21 . LEU A 1 32  ? 7.246   -9.670  5.229   1.00 0.00 ? 210 LEU A HD21 4  
ATOM 5715  H HD22 . LEU A 1 32  ? 6.249   -10.502 6.422   1.00 0.00 ? 210 LEU A HD22 4  
ATOM 5716  H HD23 . LEU A 1 32  ? 6.366   -8.742  6.443   1.00 0.00 ? 210 LEU A HD23 4  
ATOM 5717  N N    . GLU A 1 33  ? 5.219   -10.970 0.497   1.00 0.00 ? 211 GLU A N    4  
ATOM 5718  C CA   . GLU A 1 33  ? 5.697   -11.780 -0.618  1.00 0.00 ? 211 GLU A CA   4  
ATOM 5719  C C    . GLU A 1 33  ? 7.197   -11.591 -0.823  1.00 0.00 ? 211 GLU A C    4  
ATOM 5720  O O    . GLU A 1 33  ? 7.728   -10.496 -0.632  1.00 0.00 ? 211 GLU A O    4  
ATOM 5721  C CB   . GLU A 1 33  ? 4.945   -11.417 -1.900  1.00 0.00 ? 211 GLU A CB   4  
ATOM 5722  C CG   . GLU A 1 33  ? 3.554   -12.023 -1.982  1.00 0.00 ? 211 GLU A CG   4  
ATOM 5723  C CD   . GLU A 1 33  ? 3.580   -13.500 -2.324  1.00 0.00 ? 211 GLU A CD   4  
ATOM 5724  O OE1  . GLU A 1 33  ? 4.015   -14.299 -1.469  1.00 0.00 ? 211 GLU A OE1  4  
ATOM 5725  O OE2  . GLU A 1 33  ? 3.165   -13.857 -3.446  1.00 0.00 ? 211 GLU A OE2  4  
ATOM 5726  H H    . GLU A 1 33  ? 5.286   -9.994  0.442   1.00 0.00 ? 211 GLU A H    4  
ATOM 5727  H HA   . GLU A 1 33  ? 5.507   -12.816 -0.381  1.00 0.00 ? 211 GLU A HA   4  
ATOM 5728  H HB2  . GLU A 1 33  ? 4.853   -10.343 -1.957  1.00 0.00 ? 211 GLU A HB2  4  
ATOM 5729  H HB3  . GLU A 1 33  ? 5.517   -11.766 -2.748  1.00 0.00 ? 211 GLU A HB3  4  
ATOM 5730  H HG2  . GLU A 1 33  ? 3.065   -11.899 -1.028  1.00 0.00 ? 211 GLU A HG2  4  
ATOM 5731  H HG3  . GLU A 1 33  ? 2.993   -11.501 -2.744  1.00 0.00 ? 211 GLU A HG3  4  
ATOM 5732  N N    . ASP A 1 34  ? 7.875   -12.665 -1.214  1.00 0.00 ? 212 ASP A N    4  
ATOM 5733  C CA   . ASP A 1 34  ? 9.314   -12.618 -1.447  1.00 0.00 ? 212 ASP A CA   4  
ATOM 5734  C C    . ASP A 1 34  ? 9.643   -11.727 -2.640  1.00 0.00 ? 212 ASP A C    4  
ATOM 5735  O O    . ASP A 1 34  ? 10.783  -11.294 -2.809  1.00 0.00 ? 212 ASP A O    4  
ATOM 5736  C CB   . ASP A 1 34  ? 9.860   -14.027 -1.681  1.00 0.00 ? 212 ASP A CB   4  
ATOM 5737  C CG   . ASP A 1 34  ? 9.480   -14.987 -0.571  1.00 0.00 ? 212 ASP A CG   4  
ATOM 5738  O OD1  . ASP A 1 34  ? 8.284   -15.332 -0.469  1.00 0.00 ? 212 ASP A OD1  4  
ATOM 5739  O OD2  . ASP A 1 34  ? 10.378  -15.394 0.196   1.00 0.00 ? 212 ASP A OD2  4  
ATOM 5740  H H    . ASP A 1 34  ? 7.396   -13.509 -1.350  1.00 0.00 ? 212 ASP A H    4  
ATOM 5741  H HA   . ASP A 1 34  ? 9.779   -12.203 -0.565  1.00 0.00 ? 212 ASP A HA   4  
ATOM 5742  H HB2  . ASP A 1 34  ? 9.467   -14.409 -2.612  1.00 0.00 ? 212 ASP A HB2  4  
ATOM 5743  H HB3  . ASP A 1 34  ? 10.938  -13.983 -1.741  1.00 0.00 ? 212 ASP A HB3  4  
ATOM 5744  N N    . HIS A 1 35  ? 8.637   -11.457 -3.466  1.00 0.00 ? 213 HIS A N    4  
ATOM 5745  C CA   . HIS A 1 35  ? 8.819   -10.618 -4.645  1.00 0.00 ? 213 HIS A CA   4  
ATOM 5746  C C    . HIS A 1 35  ? 8.439   -9.171  -4.346  1.00 0.00 ? 213 HIS A C    4  
ATOM 5747  O O    . HIS A 1 35  ? 8.953   -8.242  -4.967  1.00 0.00 ? 213 HIS A O    4  
ATOM 5748  C CB   . HIS A 1 35  ? 7.981   -11.147 -5.809  1.00 0.00 ? 213 HIS A CB   4  
ATOM 5749  C CG   . HIS A 1 35  ? 8.074   -12.631 -5.988  1.00 0.00 ? 213 HIS A CG   4  
ATOM 5750  N ND1  . HIS A 1 35  ? 8.867   -13.225 -6.947  1.00 0.00 ? 213 HIS A ND1  4  
ATOM 5751  C CD2  . HIS A 1 35  ? 7.470   -13.643 -5.322  1.00 0.00 ? 213 HIS A CD2  4  
ATOM 5752  C CE1  . HIS A 1 35  ? 8.745   -14.538 -6.866  1.00 0.00 ? 213 HIS A CE1  4  
ATOM 5753  N NE2  . HIS A 1 35  ? 7.904   -14.818 -5.887  1.00 0.00 ? 213 HIS A NE2  4  
ATOM 5754  H H    . HIS A 1 35  ? 7.751   -11.831 -3.278  1.00 0.00 ? 213 HIS A H    4  
ATOM 5755  H HA   . HIS A 1 35  ? 9.863   -10.653 -4.919  1.00 0.00 ? 213 HIS A HA   4  
ATOM 5756  H HB2  . HIS A 1 35  ? 6.943   -10.899 -5.639  1.00 0.00 ? 213 HIS A HB2  4  
ATOM 5757  H HB3  . HIS A 1 35  ? 8.312   -10.680 -6.725  1.00 0.00 ? 213 HIS A HB3  4  
ATOM 5758  H HD1  . HIS A 1 35  ? 9.433   -12.754 -7.594  1.00 0.00 ? 213 HIS A HD1  4  
ATOM 5759  H HD2  . HIS A 1 35  ? 6.776   -13.546 -4.500  1.00 0.00 ? 213 HIS A HD2  4  
ATOM 5760  H HE1  . HIS A 1 35  ? 9.248   -15.260 -7.491  1.00 0.00 ? 213 HIS A HE1  4  
ATOM 5761  H HE2  . HIS A 1 35  ? 7.570   -15.712 -5.669  1.00 0.00 ? 213 HIS A HE2  4  
ATOM 5762  N N    . GLY A 1 36  ? 7.534   -8.987  -3.389  1.00 0.00 ? 214 GLY A N    4  
ATOM 5763  C CA   . GLY A 1 36  ? 7.100   -7.651  -3.025  1.00 0.00 ? 214 GLY A CA   4  
ATOM 5764  C C    . GLY A 1 36  ? 6.257   -7.639  -1.765  1.00 0.00 ? 214 GLY A C    4  
ATOM 5765  O O    . GLY A 1 36  ? 6.315   -8.570  -0.962  1.00 0.00 ? 214 GLY A O    4  
ATOM 5766  H H    . GLY A 1 36  ? 7.158   -9.765  -2.927  1.00 0.00 ? 214 GLY A H    4  
ATOM 5767  H HA2  . GLY A 1 36  ? 7.970   -7.031  -2.869  1.00 0.00 ? 214 GLY A HA2  4  
ATOM 5768  H HA3  . GLY A 1 36  ? 6.518   -7.240  -3.837  1.00 0.00 ? 214 GLY A HA3  4  
ATOM 5769  N N    . TYR A 1 37  ? 5.473   -6.580  -1.590  1.00 0.00 ? 215 TYR A N    4  
ATOM 5770  C CA   . TYR A 1 37  ? 4.618   -6.448  -0.416  1.00 0.00 ? 215 TYR A CA   4  
ATOM 5771  C C    . TYR A 1 37  ? 3.208   -6.022  -0.815  1.00 0.00 ? 215 TYR A C    4  
ATOM 5772  O O    . TYR A 1 37  ? 3.025   -5.055  -1.555  1.00 0.00 ? 215 TYR A O    4  
ATOM 5773  C CB   . TYR A 1 37  ? 5.212   -5.433  0.562   1.00 0.00 ? 215 TYR A CB   4  
ATOM 5774  C CG   . TYR A 1 37  ? 6.446   -5.934  1.279   1.00 0.00 ? 215 TYR A CG   4  
ATOM 5775  C CD1  . TYR A 1 37  ? 6.350   -6.899  2.275   1.00 0.00 ? 215 TYR A CD1  4  
ATOM 5776  C CD2  . TYR A 1 37  ? 7.706   -5.442  0.963   1.00 0.00 ? 215 TYR A CD2  4  
ATOM 5777  C CE1  . TYR A 1 37  ? 7.474   -7.359  2.934   1.00 0.00 ? 215 TYR A CE1  4  
ATOM 5778  C CE2  . TYR A 1 37  ? 8.835   -5.898  1.615   1.00 0.00 ? 215 TYR A CE2  4  
ATOM 5779  C CZ   . TYR A 1 37  ? 8.714   -6.856  2.600   1.00 0.00 ? 215 TYR A CZ   4  
ATOM 5780  O OH   . TYR A 1 37  ? 9.836   -7.311  3.253   1.00 0.00 ? 215 TYR A OH   4  
ATOM 5781  H H    . TYR A 1 37  ? 5.471   -5.870  -2.265  1.00 0.00 ? 215 TYR A H    4  
ATOM 5782  H HA   . TYR A 1 37  ? 4.568   -7.413  0.067   1.00 0.00 ? 215 TYR A HA   4  
ATOM 5783  H HB2  . TYR A 1 37  ? 5.484   -4.539  0.022   1.00 0.00 ? 215 TYR A HB2  4  
ATOM 5784  H HB3  . TYR A 1 37  ? 4.471   -5.187  1.308   1.00 0.00 ? 215 TYR A HB3  4  
ATOM 5785  H HD1  . TYR A 1 37  ? 5.378   -7.292  2.534   1.00 0.00 ? 215 TYR A HD1  4  
ATOM 5786  H HD2  . TYR A 1 37  ? 7.797   -4.691  0.191   1.00 0.00 ? 215 TYR A HD2  4  
ATOM 5787  H HE1  . TYR A 1 37  ? 7.380   -8.110  3.705   1.00 0.00 ? 215 TYR A HE1  4  
ATOM 5788  H HE2  . TYR A 1 37  ? 9.806   -5.503  1.354   1.00 0.00 ? 215 TYR A HE2  4  
ATOM 5789  H HH   . TYR A 1 37  ? 9.708   -7.233  4.201   1.00 0.00 ? 215 TYR A HH   4  
ATOM 5790  N N    . LEU A 1 38  ? 2.215   -6.751  -0.318  1.00 0.00 ? 216 LEU A N    4  
ATOM 5791  C CA   . LEU A 1 38  ? 0.820   -6.450  -0.620  1.00 0.00 ? 216 LEU A CA   4  
ATOM 5792  C C    . LEU A 1 38  ? 0.267   -5.404  0.344   1.00 0.00 ? 216 LEU A C    4  
ATOM 5793  O O    . LEU A 1 38  ? 0.341   -5.568  1.562   1.00 0.00 ? 216 LEU A O    4  
ATOM 5794  C CB   . LEU A 1 38  ? -0.024  -7.723  -0.548  1.00 0.00 ? 216 LEU A CB   4  
ATOM 5795  C CG   . LEU A 1 38  ? -0.101  -8.551  -1.831  1.00 0.00 ? 216 LEU A CG   4  
ATOM 5796  C CD1  . LEU A 1 38  ? -1.069  -7.917  -2.818  1.00 0.00 ? 216 LEU A CD1  4  
ATOM 5797  C CD2  . LEU A 1 38  ? 1.279   -8.697  -2.455  1.00 0.00 ? 216 LEU A CD2  4  
ATOM 5798  H H    . LEU A 1 38  ? 2.423   -7.509  0.267   1.00 0.00 ? 216 LEU A H    4  
ATOM 5799  H HA   . LEU A 1 38  ? 0.776   -6.055  -1.624  1.00 0.00 ? 216 LEU A HA   4  
ATOM 5800  H HB2  . LEU A 1 38  ? 0.390   -8.351  0.226   1.00 0.00 ? 216 LEU A HB2  4  
ATOM 5801  H HB3  . LEU A 1 38  ? -1.031  -7.437  -0.277  1.00 0.00 ? 216 LEU A HB3  4  
ATOM 5802  H HG   . LEU A 1 38  ? -0.468  -9.540  -1.593  1.00 0.00 ? 216 LEU A HG   4  
ATOM 5803  H HD11 . LEU A 1 38  ? -0.672  -6.973  -3.156  1.00 0.00 ? 216 LEU A HD11 4  
ATOM 5804  H HD12 . LEU A 1 38  ? -2.021  -7.755  -2.334  1.00 0.00 ? 216 LEU A HD12 4  
ATOM 5805  H HD13 . LEU A 1 38  ? -1.203  -8.576  -3.664  1.00 0.00 ? 216 LEU A HD13 4  
ATOM 5806  H HD21 . LEU A 1 38  ? 1.995   -8.952  -1.688  1.00 0.00 ? 216 LEU A HD21 4  
ATOM 5807  H HD22 . LEU A 1 38  ? 1.566   -7.763  -2.918  1.00 0.00 ? 216 LEU A HD22 4  
ATOM 5808  H HD23 . LEU A 1 38  ? 1.257   -9.477  -3.201  1.00 0.00 ? 216 LEU A HD23 4  
ATOM 5809  N N    . VAL A 1 39  ? -0.288  -4.331  -0.210  1.00 0.00 ? 217 VAL A N    4  
ATOM 5810  C CA   . VAL A 1 39  ? -0.856  -3.260  0.600   1.00 0.00 ? 217 VAL A CA   4  
ATOM 5811  C C    . VAL A 1 39  ? -2.372  -3.204  0.451   1.00 0.00 ? 217 VAL A C    4  
ATOM 5812  O O    . VAL A 1 39  ? -2.901  -3.291  -0.657  1.00 0.00 ? 217 VAL A O    4  
ATOM 5813  C CB   . VAL A 1 39  ? -0.263  -1.892  0.218   1.00 0.00 ? 217 VAL A CB   4  
ATOM 5814  C CG1  . VAL A 1 39  ? -0.770  -0.808  1.158   1.00 0.00 ? 217 VAL A CG1  4  
ATOM 5815  C CG2  . VAL A 1 39  ? 1.257   -1.949  0.228   1.00 0.00 ? 217 VAL A CG2  4  
ATOM 5816  H H    . VAL A 1 39  ? -0.316  -4.258  -1.187  1.00 0.00 ? 217 VAL A H    4  
ATOM 5817  H HA   . VAL A 1 39  ? -0.613  -3.459  1.634   1.00 0.00 ? 217 VAL A HA   4  
ATOM 5818  H HB   . VAL A 1 39  ? -0.586  -1.649  -0.783  1.00 0.00 ? 217 VAL A HB   4  
ATOM 5819  H HG11 . VAL A 1 39  ? -0.989  -1.243  2.122   1.00 0.00 ? 217 VAL A HG11 4  
ATOM 5820  H HG12 . VAL A 1 39  ? -0.014  -0.045  1.269   1.00 0.00 ? 217 VAL A HG12 4  
ATOM 5821  H HG13 . VAL A 1 39  ? -1.668  -0.369  0.749   1.00 0.00 ? 217 VAL A HG13 4  
ATOM 5822  H HG21 . VAL A 1 39  ? 1.622   -1.985  -0.788  1.00 0.00 ? 217 VAL A HG21 4  
ATOM 5823  H HG22 . VAL A 1 39  ? 1.648   -1.069  0.719   1.00 0.00 ? 217 VAL A HG22 4  
ATOM 5824  H HG23 . VAL A 1 39  ? 1.581   -2.831  0.759   1.00 0.00 ? 217 VAL A HG23 4  
ATOM 5825  N N    . ASP A 1 40  ? -3.067  -3.058  1.574   1.00 0.00 ? 218 ASP A N    4  
ATOM 5826  C CA   . ASP A 1 40  ? -4.523  -2.988  1.569   1.00 0.00 ? 218 ASP A CA   4  
ATOM 5827  C C    . ASP A 1 40  ? -4.999  -1.580  1.224   1.00 0.00 ? 218 ASP A C    4  
ATOM 5828  O O    . ASP A 1 40  ? -4.495  -0.595  1.763   1.00 0.00 ? 218 ASP A O    4  
ATOM 5829  C CB   . ASP A 1 40  ? -5.080  -3.408  2.930   1.00 0.00 ? 218 ASP A CB   4  
ATOM 5830  C CG   . ASP A 1 40  ? -6.459  -4.029  2.825   1.00 0.00 ? 218 ASP A CG   4  
ATOM 5831  O OD1  . ASP A 1 40  ? -6.692  -4.797  1.868   1.00 0.00 ? 218 ASP A OD1  4  
ATOM 5832  O OD2  . ASP A 1 40  ? -7.306  -3.747  3.699   1.00 0.00 ? 218 ASP A OD2  4  
ATOM 5833  H H    . ASP A 1 40  ? -2.588  -2.994  2.427   1.00 0.00 ? 218 ASP A H    4  
ATOM 5834  H HA   . ASP A 1 40  ? -4.885  -3.671  0.816   1.00 0.00 ? 218 ASP A HA   4  
ATOM 5835  H HB2  . ASP A 1 40  ? -4.414  -4.132  3.377   1.00 0.00 ? 218 ASP A HB2  4  
ATOM 5836  H HB3  . ASP A 1 40  ? -5.144  -2.540  3.569   1.00 0.00 ? 218 ASP A HB3  4  
ATOM 5837  N N    . ILE A 1 41  ? -5.971  -1.494  0.322   1.00 0.00 ? 219 ILE A N    4  
ATOM 5838  C CA   . ILE A 1 41  ? -6.514  -0.207  -0.095  1.00 0.00 ? 219 ILE A CA   4  
ATOM 5839  C C    . ILE A 1 41  ? -8.020  -0.145  0.135   1.00 0.00 ? 219 ILE A C    4  
ATOM 5840  O O    . ILE A 1 41  ? -8.597  0.935   0.252   1.00 0.00 ? 219 ILE A O    4  
ATOM 5841  C CB   . ILE A 1 41  ? -6.221  0.073   -1.581  1.00 0.00 ? 219 ILE A CB   4  
ATOM 5842  C CG1  . ILE A 1 41  ? -6.452  -1.189  -2.415  1.00 0.00 ? 219 ILE A CG1  4  
ATOM 5843  C CG2  . ILE A 1 41  ? -4.795  0.575   -1.754  1.00 0.00 ? 219 ILE A CG2  4  
ATOM 5844  C CD1  . ILE A 1 41  ? -6.042  -1.039  -3.864  1.00 0.00 ? 219 ILE A CD1  4  
ATOM 5845  H H    . ILE A 1 41  ? -6.332  -2.315  -0.072  1.00 0.00 ? 219 ILE A H    4  
ATOM 5846  H HA   . ILE A 1 41  ? -6.038  0.562   0.496   1.00 0.00 ? 219 ILE A HA   4  
ATOM 5847  H HB   . ILE A 1 41  ? -6.893  0.847   -1.918  1.00 0.00 ? 219 ILE A HB   4  
ATOM 5848  H HG12 . ILE A 1 41  ? -5.884  -2.002  -1.993  1.00 0.00 ? 219 ILE A HG12 4  
ATOM 5849  H HG13 . ILE A 1 41  ? -7.503  -1.439  -2.392  1.00 0.00 ? 219 ILE A HG13 4  
ATOM 5850  H HG21 . ILE A 1 41  ? -4.777  1.357   -2.499  1.00 0.00 ? 219 ILE A HG21 4  
ATOM 5851  H HG22 . ILE A 1 41  ? -4.435  0.965   -0.815  1.00 0.00 ? 219 ILE A HG22 4  
ATOM 5852  H HG23 . ILE A 1 41  ? -4.162  -0.240  -2.073  1.00 0.00 ? 219 ILE A HG23 4  
ATOM 5853  H HD11 . ILE A 1 41  ? -6.482  -0.141  -4.272  1.00 0.00 ? 219 ILE A HD11 4  
ATOM 5854  H HD12 . ILE A 1 41  ? -4.966  -0.976  -3.929  1.00 0.00 ? 219 ILE A HD12 4  
ATOM 5855  H HD13 . ILE A 1 41  ? -6.386  -1.896  -4.426  1.00 0.00 ? 219 ILE A HD13 4  
ATOM 5856  N N    . GLY A 1 42  ? -8.652  -1.314  0.201   1.00 0.00 ? 220 GLY A N    4  
ATOM 5857  C CA   . GLY A 1 42  ? -10.085 -1.371  0.419   1.00 0.00 ? 220 GLY A CA   4  
ATOM 5858  C C    . GLY A 1 42  ? -10.873 -1.237  -0.869  1.00 0.00 ? 220 GLY A C    4  
ATOM 5859  O O    . GLY A 1 42  ? -11.797 -0.429  -0.959  1.00 0.00 ? 220 GLY A O    4  
ATOM 5860  H H    . GLY A 1 42  ? -8.140  -2.144  0.101   1.00 0.00 ? 220 GLY A H    4  
ATOM 5861  H HA2  . GLY A 1 42  ? -10.331 -2.314  0.883   1.00 0.00 ? 220 GLY A HA2  4  
ATOM 5862  H HA3  . GLY A 1 42  ? -10.368 -0.569  1.085   1.00 0.00 ? 220 GLY A HA3  4  
ATOM 5863  N N    . VAL A 1 43  ? -10.506 -2.031  -1.870  1.00 0.00 ? 221 VAL A N    4  
ATOM 5864  C CA   . VAL A 1 43  ? -11.185 -1.998  -3.160  1.00 0.00 ? 221 VAL A CA   4  
ATOM 5865  C C    . VAL A 1 43  ? -11.284 -3.394  -3.765  1.00 0.00 ? 221 VAL A C    4  
ATOM 5866  O O    . VAL A 1 43  ? -10.406 -4.233  -3.563  1.00 0.00 ? 221 VAL A O    4  
ATOM 5867  C CB   . VAL A 1 43  ? -10.459 -1.071  -4.153  1.00 0.00 ? 221 VAL A CB   4  
ATOM 5868  C CG1  . VAL A 1 43  ? -11.140 -1.106  -5.512  1.00 0.00 ? 221 VAL A CG1  4  
ATOM 5869  C CG2  . VAL A 1 43  ? -10.404 0.350   -3.611  1.00 0.00 ? 221 VAL A CG2  4  
ATOM 5870  H H    . VAL A 1 43  ? -9.762  -2.655  -1.738  1.00 0.00 ? 221 VAL A H    4  
ATOM 5871  H HA   . VAL A 1 43  ? -12.182 -1.613  -3.003  1.00 0.00 ? 221 VAL A HA   4  
ATOM 5872  H HB   . VAL A 1 43  ? -9.447  -1.428  -4.273  1.00 0.00 ? 221 VAL A HB   4  
ATOM 5873  H HG11 . VAL A 1 43  ? -10.782 -1.957  -6.073  1.00 0.00 ? 221 VAL A HG11 4  
ATOM 5874  H HG12 . VAL A 1 43  ? -12.209 -1.185  -5.378  1.00 0.00 ? 221 VAL A HG12 4  
ATOM 5875  H HG13 . VAL A 1 43  ? -10.912 -0.198  -6.053  1.00 0.00 ? 221 VAL A HG13 4  
ATOM 5876  H HG21 . VAL A 1 43  ? -9.729  0.938   -4.215  1.00 0.00 ? 221 VAL A HG21 4  
ATOM 5877  H HG22 . VAL A 1 43  ? -11.391 0.787   -3.644  1.00 0.00 ? 221 VAL A HG22 4  
ATOM 5878  H HG23 . VAL A 1 43  ? -10.052 0.333   -2.591  1.00 0.00 ? 221 VAL A HG23 4  
ATOM 5879  N N    . ASP A 1 44  ? -12.358 -3.636  -4.508  1.00 0.00 ? 222 ASP A N    4  
ATOM 5880  C CA   . ASP A 1 44  ? -12.572 -4.930  -5.145  1.00 0.00 ? 222 ASP A CA   4  
ATOM 5881  C C    . ASP A 1 44  ? -11.984 -4.947  -6.553  1.00 0.00 ? 222 ASP A C    4  
ATOM 5882  O O    . ASP A 1 44  ? -12.320 -4.107  -7.387  1.00 0.00 ? 222 ASP A O    4  
ATOM 5883  C CB   . ASP A 1 44  ? -14.065 -5.256  -5.198  1.00 0.00 ? 222 ASP A CB   4  
ATOM 5884  C CG   . ASP A 1 44  ? -14.330 -6.746  -5.294  1.00 0.00 ? 222 ASP A CG   4  
ATOM 5885  O OD1  . ASP A 1 44  ? -14.010 -7.468  -4.328  1.00 0.00 ? 222 ASP A OD1  4  
ATOM 5886  O OD2  . ASP A 1 44  ? -14.856 -7.189  -6.337  1.00 0.00 ? 222 ASP A OD2  4  
ATOM 5887  H H    . ASP A 1 44  ? -13.023 -2.926  -4.632  1.00 0.00 ? 222 ASP A H    4  
ATOM 5888  H HA   . ASP A 1 44  ? -12.071 -5.679  -4.550  1.00 0.00 ? 222 ASP A HA   4  
ATOM 5889  H HB2  . ASP A 1 44  ? -14.541 -4.882  -4.303  1.00 0.00 ? 222 ASP A HB2  4  
ATOM 5890  H HB3  . ASP A 1 44  ? -14.501 -4.774  -6.061  1.00 0.00 ? 222 ASP A HB3  4  
ATOM 5891  N N    . GLY A 1 45  ? -11.104 -5.910  -6.810  1.00 0.00 ? 223 GLY A N    4  
ATOM 5892  C CA   . GLY A 1 45  ? -10.482 -6.017  -8.117  1.00 0.00 ? 223 GLY A CA   4  
ATOM 5893  C C    . GLY A 1 45  ? -9.131  -5.333  -8.175  1.00 0.00 ? 223 GLY A C    4  
ATOM 5894  O O    . GLY A 1 45  ? -8.141  -5.931  -8.596  1.00 0.00 ? 223 GLY A O    4  
ATOM 5895  H H    . GLY A 1 45  ? -10.874 -6.552  -6.106  1.00 0.00 ? 223 GLY A H    4  
ATOM 5896  H HA2  . GLY A 1 45  ? -10.356 -7.062  -8.358  1.00 0.00 ? 223 GLY A HA2  4  
ATOM 5897  H HA3  . GLY A 1 45  ? -11.134 -5.565  -8.850  1.00 0.00 ? 223 GLY A HA3  4  
ATOM 5898  N N    . THR A 1 46  ? -9.089  -4.073  -7.752  1.00 0.00 ? 224 THR A N    4  
ATOM 5899  C CA   . THR A 1 46  ? -7.851  -3.305  -7.760  1.00 0.00 ? 224 THR A CA   4  
ATOM 5900  C C    . THR A 1 46  ? -6.787  -3.968  -6.892  1.00 0.00 ? 224 THR A C    4  
ATOM 5901  O O    . THR A 1 46  ? -7.013  -4.232  -5.711  1.00 0.00 ? 224 THR A O    4  
ATOM 5902  C CB   . THR A 1 46  ? -8.079  -1.865  -7.263  1.00 0.00 ? 224 THR A CB   4  
ATOM 5903  O OG1  . THR A 1 46  ? -8.999  -1.188  -8.126  1.00 0.00 ? 224 THR A OG1  4  
ATOM 5904  C CG2  . THR A 1 46  ? -6.767  -1.097  -7.209  1.00 0.00 ? 224 THR A CG2  4  
ATOM 5905  H H    . THR A 1 46  ? -9.912  -3.651  -7.428  1.00 0.00 ? 224 THR A H    4  
ATOM 5906  H HA   . THR A 1 46  ? -7.493  -3.259  -8.779  1.00 0.00 ? 224 THR A HA   4  
ATOM 5907  H HB   . THR A 1 46  ? -8.496  -1.906  -6.266  1.00 0.00 ? 224 THR A HB   4  
ATOM 5908  H HG1  . THR A 1 46  ? -9.565  -0.614  -7.604  1.00 0.00 ? 224 THR A HG1  4  
ATOM 5909  H HG21 . THR A 1 46  ? -6.193  -1.423  -6.355  1.00 0.00 ? 224 THR A HG21 4  
ATOM 5910  H HG22 . THR A 1 46  ? -6.972  -0.040  -7.123  1.00 0.00 ? 224 THR A HG22 4  
ATOM 5911  H HG23 . THR A 1 46  ? -6.205  -1.282  -8.112  1.00 0.00 ? 224 THR A HG23 4  
ATOM 5912  N N    . ARG A 1 47  ? -5.628  -4.233  -7.485  1.00 0.00 ? 225 ARG A N    4  
ATOM 5913  C CA   . ARG A 1 47  ? -4.529  -4.866  -6.765  1.00 0.00 ? 225 ARG A CA   4  
ATOM 5914  C C    . ARG A 1 47  ? -3.331  -3.926  -6.666  1.00 0.00 ? 225 ARG A C    4  
ATOM 5915  O O    . ARG A 1 47  ? -2.916  -3.328  -7.657  1.00 0.00 ? 225 ARG A O    4  
ATOM 5916  C CB   . ARG A 1 47  ? -4.116  -6.165  -7.460  1.00 0.00 ? 225 ARG A CB   4  
ATOM 5917  C CG   . ARG A 1 47  ? -3.256  -7.072  -6.596  1.00 0.00 ? 225 ARG A CG   4  
ATOM 5918  C CD   . ARG A 1 47  ? -2.518  -8.104  -7.433  1.00 0.00 ? 225 ARG A CD   4  
ATOM 5919  N NE   . ARG A 1 47  ? -1.939  -9.163  -6.611  1.00 0.00 ? 225 ARG A NE   4  
ATOM 5920  C CZ   . ARG A 1 47  ? -2.632  -10.198 -6.149  1.00 0.00 ? 225 ARG A CZ   4  
ATOM 5921  N NH1  . ARG A 1 47  ? -3.924  -10.312 -6.427  1.00 0.00 ? 225 ARG A NH1  4  
ATOM 5922  N NH2  . ARG A 1 47  ? -2.034  -11.121 -5.407  1.00 0.00 ? 225 ARG A NH2  4  
ATOM 5923  H H    . ARG A 1 47  ? -5.508  -3.999  -8.429  1.00 0.00 ? 225 ARG A H    4  
ATOM 5924  H HA   . ARG A 1 47  ? -4.874  -5.096  -5.768  1.00 0.00 ? 225 ARG A HA   4  
ATOM 5925  H HB2  . ARG A 1 47  ? -5.006  -6.709  -7.739  1.00 0.00 ? 225 ARG A HB2  4  
ATOM 5926  H HB3  . ARG A 1 47  ? -3.559  -5.920  -8.352  1.00 0.00 ? 225 ARG A HB3  4  
ATOM 5927  H HG2  . ARG A 1 47  ? -2.532  -6.469  -6.067  1.00 0.00 ? 225 ARG A HG2  4  
ATOM 5928  H HG3  . ARG A 1 47  ? -3.889  -7.582  -5.885  1.00 0.00 ? 225 ARG A HG3  4  
ATOM 5929  H HD2  . ARG A 1 47  ? -3.214  -8.545  -8.132  1.00 0.00 ? 225 ARG A HD2  4  
ATOM 5930  H HD3  . ARG A 1 47  ? -1.728  -7.609  -7.977  1.00 0.00 ? 225 ARG A HD3  4  
ATOM 5931  H HE   . ARG A 1 47  ? -0.986  -9.099  -6.394  1.00 0.00 ? 225 ARG A HE   4  
ATOM 5932  H HH11 . ARG A 1 47  ? -4.377  -9.618  -6.987  1.00 0.00 ? 225 ARG A HH11 4  
ATOM 5933  H HH12 . ARG A 1 47  ? -4.443  -11.092 -6.079  1.00 0.00 ? 225 ARG A HH12 4  
ATOM 5934  H HH21 . ARG A 1 47  ? -1.060  -11.038 -5.196  1.00 0.00 ? 225 ARG A HH21 4  
ATOM 5935  H HH22 . ARG A 1 47  ? -2.556  -11.899 -5.060  1.00 0.00 ? 225 ARG A HH22 4  
ATOM 5936  N N    . ALA A 1 48  ? -2.781  -3.802  -5.462  1.00 0.00 ? 226 ALA A N    4  
ATOM 5937  C CA   . ALA A 1 48  ? -1.630  -2.937  -5.234  1.00 0.00 ? 226 ALA A CA   4  
ATOM 5938  C C    . ALA A 1 48  ? -0.407  -3.748  -4.821  1.00 0.00 ? 226 ALA A C    4  
ATOM 5939  O O    . ALA A 1 48  ? -0.457  -4.523  -3.866  1.00 0.00 ? 226 ALA A O    4  
ATOM 5940  C CB   . ALA A 1 48  ? -1.956  -1.893  -4.176  1.00 0.00 ? 226 ALA A CB   4  
ATOM 5941  H H    . ALA A 1 48  ? -3.157  -4.305  -4.711  1.00 0.00 ? 226 ALA A H    4  
ATOM 5942  H HA   . ALA A 1 48  ? -1.413  -2.420  -6.158  1.00 0.00 ? 226 ALA A HA   4  
ATOM 5943  H HB1  . ALA A 1 48  ? -1.393  -2.105  -3.278  1.00 0.00 ? 226 ALA A HB1  4  
ATOM 5944  H HB2  . ALA A 1 48  ? -1.693  -0.913  -4.544  1.00 0.00 ? 226 ALA A HB2  4  
ATOM 5945  H HB3  . ALA A 1 48  ? -3.012  -1.924  -3.954  1.00 0.00 ? 226 ALA A HB3  4  
ATOM 5946  N N    . PHE A 1 49  ? 0.691   -3.564  -5.547  1.00 0.00 ? 227 PHE A N    4  
ATOM 5947  C CA   . PHE A 1 49  ? 1.928   -4.281  -5.257  1.00 0.00 ? 227 PHE A CA   4  
ATOM 5948  C C    . PHE A 1 49  ? 3.077   -3.306  -5.015  1.00 0.00 ? 227 PHE A C    4  
ATOM 5949  O O    . PHE A 1 49  ? 3.230   -2.318  -5.735  1.00 0.00 ? 227 PHE A O    4  
ATOM 5950  C CB   . PHE A 1 49  ? 2.278   -5.224  -6.409  1.00 0.00 ? 227 PHE A CB   4  
ATOM 5951  C CG   . PHE A 1 49  ? 3.663   -5.798  -6.315  1.00 0.00 ? 227 PHE A CG   4  
ATOM 5952  C CD1  . PHE A 1 49  ? 4.760   -5.069  -6.744  1.00 0.00 ? 227 PHE A CD1  4  
ATOM 5953  C CD2  . PHE A 1 49  ? 3.867   -7.066  -5.796  1.00 0.00 ? 227 PHE A CD2  4  
ATOM 5954  C CE1  . PHE A 1 49  ? 6.035   -5.595  -6.658  1.00 0.00 ? 227 PHE A CE1  4  
ATOM 5955  C CE2  . PHE A 1 49  ? 5.140   -7.598  -5.708  1.00 0.00 ? 227 PHE A CE2  4  
ATOM 5956  C CZ   . PHE A 1 49  ? 6.226   -6.861  -6.138  1.00 0.00 ? 227 PHE A CZ   4  
ATOM 5957  H H    . PHE A 1 49  ? 0.669   -2.932  -6.296  1.00 0.00 ? 227 PHE A H    4  
ATOM 5958  H HA   . PHE A 1 49  ? 1.771   -4.862  -4.362  1.00 0.00 ? 227 PHE A HA   4  
ATOM 5959  H HB2  . PHE A 1 49  ? 1.579   -6.046  -6.417  1.00 0.00 ? 227 PHE A HB2  4  
ATOM 5960  H HB3  . PHE A 1 49  ? 2.204   -4.685  -7.342  1.00 0.00 ? 227 PHE A HB3  4  
ATOM 5961  H HD1  . PHE A 1 49  ? 4.613   -4.079  -7.150  1.00 0.00 ? 227 PHE A HD1  4  
ATOM 5962  H HD2  . PHE A 1 49  ? 3.018   -7.644  -5.458  1.00 0.00 ? 227 PHE A HD2  4  
ATOM 5963  H HE1  . PHE A 1 49  ? 6.882   -5.017  -6.996  1.00 0.00 ? 227 PHE A HE1  4  
ATOM 5964  H HE2  . PHE A 1 49  ? 5.285   -8.588  -5.301  1.00 0.00 ? 227 PHE A HE2  4  
ATOM 5965  H HZ   . PHE A 1 49  ? 7.221   -7.274  -6.071  1.00 0.00 ? 227 PHE A HZ   4  
ATOM 5966  N N    . LEU A 1 50  ? 3.882   -3.591  -3.998  1.00 0.00 ? 228 LEU A N    4  
ATOM 5967  C CA   . LEU A 1 50  ? 5.018   -2.741  -3.659  1.00 0.00 ? 228 LEU A CA   4  
ATOM 5968  C C    . LEU A 1 50  ? 6.336   -3.464  -3.918  1.00 0.00 ? 228 LEU A C    4  
ATOM 5969  O O    . LEU A 1 50  ? 6.529   -4.614  -3.523  1.00 0.00 ? 228 LEU A O    4  
ATOM 5970  C CB   . LEU A 1 50  ? 4.939   -2.309  -2.194  1.00 0.00 ? 228 LEU A CB   4  
ATOM 5971  C CG   . LEU A 1 50  ? 5.758   -1.076  -1.812  1.00 0.00 ? 228 LEU A CG   4  
ATOM 5972  C CD1  . LEU A 1 50  ? 5.132   0.182   -2.392  1.00 0.00 ? 228 LEU A CD1  4  
ATOM 5973  C CD2  . LEU A 1 50  ? 5.880   -0.965  -0.299  1.00 0.00 ? 228 LEU A CD2  4  
ATOM 5974  H H    . LEU A 1 50  ? 3.710   -4.392  -3.461  1.00 0.00 ? 228 LEU A H    4  
ATOM 5975  H HA   . LEU A 1 50  ? 4.973   -1.863  -4.287  1.00 0.00 ? 228 LEU A HA   4  
ATOM 5976  H HB2  . LEU A 1 50  ? 3.904   -2.102  -1.966  1.00 0.00 ? 228 LEU A HB2  4  
ATOM 5977  H HB3  . LEU A 1 50  ? 5.281   -3.136  -1.588  1.00 0.00 ? 228 LEU A HB3  4  
ATOM 5978  H HG   . LEU A 1 50  ? 6.754   -1.172  -2.222  1.00 0.00 ? 228 LEU A HG   4  
ATOM 5979  H HD11 . LEU A 1 50  ? 5.178   0.143   -3.470  1.00 0.00 ? 228 LEU A HD11 4  
ATOM 5980  H HD12 . LEU A 1 50  ? 5.671   1.048   -2.039  1.00 0.00 ? 228 LEU A HD12 4  
ATOM 5981  H HD13 . LEU A 1 50  ? 4.100   0.248   -2.078  1.00 0.00 ? 228 LEU A HD13 4  
ATOM 5982  H HD21 . LEU A 1 50  ? 6.849   -0.560  -0.046  1.00 0.00 ? 228 LEU A HD21 4  
ATOM 5983  H HD22 . LEU A 1 50  ? 5.772   -1.944  0.144   1.00 0.00 ? 228 LEU A HD22 4  
ATOM 5984  H HD23 . LEU A 1 50  ? 5.107   -0.311  0.077   1.00 0.00 ? 228 LEU A HD23 4  
ATOM 5985  N N    . PRO A 1 51  ? 7.266   -2.775  -4.595  1.00 0.00 ? 229 PRO A N    4  
ATOM 5986  C CA   . PRO A 1 51  ? 8.583   -3.331  -4.919  1.00 0.00 ? 229 PRO A CA   4  
ATOM 5987  C C    . PRO A 1 51  ? 9.463   -3.495  -3.684  1.00 0.00 ? 229 PRO A C    4  
ATOM 5988  O O    . PRO A 1 51  ? 9.467   -2.643  -2.795  1.00 0.00 ? 229 PRO A O    4  
ATOM 5989  C CB   . PRO A 1 51  ? 9.183   -2.292  -5.869  1.00 0.00 ? 229 PRO A CB   4  
ATOM 5990  C CG   . PRO A 1 51  ? 8.496   -1.017  -5.519  1.00 0.00 ? 229 PRO A CG   4  
ATOM 5991  C CD   . PRO A 1 51  ? 7.104   -1.400  -5.097  1.00 0.00 ? 229 PRO A CD   4  
ATOM 5992  H HA   . PRO A 1 51  ? 8.499   -4.280  -5.428  1.00 0.00 ? 229 PRO A HA   4  
ATOM 5993  H HB2  . PRO A 1 51  ? 10.250  -2.224  -5.705  1.00 0.00 ? 229 PRO A HB2  4  
ATOM 5994  H HB3  . PRO A 1 51  ? 8.988   -2.578  -6.891  1.00 0.00 ? 229 PRO A HB3  4  
ATOM 5995  H HG2  . PRO A 1 51  ? 9.014   -0.531  -4.707  1.00 0.00 ? 229 PRO A HG2  4  
ATOM 5996  H HG3  . PRO A 1 51  ? 8.460   -0.371  -6.384  1.00 0.00 ? 229 PRO A HG3  4  
ATOM 5997  H HD2  . PRO A 1 51  ? 6.753   -0.743  -4.315  1.00 0.00 ? 229 PRO A HD2  4  
ATOM 5998  H HD3  . PRO A 1 51  ? 6.433   -1.376  -5.942  1.00 0.00 ? 229 PRO A HD3  4  
ATOM 5999  N N    . LEU A 1 52  ? 10.207  -4.594  -3.635  1.00 0.00 ? 230 LEU A N    4  
ATOM 6000  C CA   . LEU A 1 52  ? 11.092  -4.870  -2.509  1.00 0.00 ? 230 LEU A CA   4  
ATOM 6001  C C    . LEU A 1 52  ? 12.182  -3.809  -2.401  1.00 0.00 ? 230 LEU A C    4  
ATOM 6002  O O    . LEU A 1 52  ? 12.795  -3.638  -1.346  1.00 0.00 ? 230 LEU A O    4  
ATOM 6003  C CB   . LEU A 1 52  ? 11.725  -6.254  -2.659  1.00 0.00 ? 230 LEU A CB   4  
ATOM 6004  C CG   . LEU A 1 52  ? 10.850  -7.440  -2.250  1.00 0.00 ? 230 LEU A CG   4  
ATOM 6005  C CD1  . LEU A 1 52  ? 11.552  -8.753  -2.560  1.00 0.00 ? 230 LEU A CD1  4  
ATOM 6006  C CD2  . LEU A 1 52  ? 10.497  -7.358  -0.772  1.00 0.00 ? 230 LEU A CD2  4  
ATOM 6007  H H    . LEU A 1 52  ? 10.161  -5.237  -4.374  1.00 0.00 ? 230 LEU A H    4  
ATOM 6008  H HA   . LEU A 1 52  ? 10.497  -4.850  -1.608  1.00 0.00 ? 230 LEU A HA   4  
ATOM 6009  H HB2  . LEU A 1 52  ? 11.995  -6.384  -3.695  1.00 0.00 ? 230 LEU A HB2  4  
ATOM 6010  H HB3  . LEU A 1 52  ? 12.618  -6.276  -2.051  1.00 0.00 ? 230 LEU A HB3  4  
ATOM 6011  H HG   . LEU A 1 52  ? 9.930   -7.412  -2.817  1.00 0.00 ? 230 LEU A HG   4  
ATOM 6012  H HD11 . LEU A 1 52  ? 11.455  -9.420  -1.718  1.00 0.00 ? 230 LEU A HD11 4  
ATOM 6013  H HD12 . LEU A 1 52  ? 12.598  -8.565  -2.753  1.00 0.00 ? 230 LEU A HD12 4  
ATOM 6014  H HD13 . LEU A 1 52  ? 11.101  -9.205  -3.432  1.00 0.00 ? 230 LEU A HD13 4  
ATOM 6015  H HD21 . LEU A 1 52  ? 11.005  -8.146  -0.237  1.00 0.00 ? 230 LEU A HD21 4  
ATOM 6016  H HD22 . LEU A 1 52  ? 9.429   -7.471  -0.651  1.00 0.00 ? 230 LEU A HD22 4  
ATOM 6017  H HD23 . LEU A 1 52  ? 10.805  -6.400  -0.381  1.00 0.00 ? 230 LEU A HD23 4  
ATOM 6018  N N    . LEU A 1 53  ? 12.418  -3.097  -3.497  1.00 0.00 ? 231 LEU A N    4  
ATOM 6019  C CA   . LEU A 1 53  ? 13.434  -2.049  -3.526  1.00 0.00 ? 231 LEU A CA   4  
ATOM 6020  C C    . LEU A 1 53  ? 12.996  -0.844  -2.699  1.00 0.00 ? 231 LEU A C    4  
ATOM 6021  O O    . LEU A 1 53  ? 13.780  -0.290  -1.928  1.00 0.00 ? 231 LEU A O    4  
ATOM 6022  C CB   . LEU A 1 53  ? 13.711  -1.619  -4.968  1.00 0.00 ? 231 LEU A CB   4  
ATOM 6023  C CG   . LEU A 1 53  ? 13.885  -2.749  -5.983  1.00 0.00 ? 231 LEU A CG   4  
ATOM 6024  C CD1  . LEU A 1 53  ? 13.866  -2.200  -7.401  1.00 0.00 ? 231 LEU A CD1  4  
ATOM 6025  C CD2  . LEU A 1 53  ? 15.178  -3.507  -5.720  1.00 0.00 ? 231 LEU A CD2  4  
ATOM 6026  H H    . LEU A 1 53  ? 11.898  -3.278  -4.307  1.00 0.00 ? 231 LEU A H    4  
ATOM 6027  H HA   . LEU A 1 53  ? 14.339  -2.454  -3.099  1.00 0.00 ? 231 LEU A HA   4  
ATOM 6028  H HB2  . LEU A 1 53  ? 12.885  -1.006  -5.294  1.00 0.00 ? 231 LEU A HB2  4  
ATOM 6029  H HB3  . LEU A 1 53  ? 14.616  -1.030  -4.968  1.00 0.00 ? 231 LEU A HB3  4  
ATOM 6030  H HG   . LEU A 1 53  ? 13.063  -3.444  -5.884  1.00 0.00 ? 231 LEU A HG   4  
ATOM 6031  H HD11 . LEU A 1 53  ? 14.465  -2.831  -8.040  1.00 0.00 ? 231 LEU A HD11 4  
ATOM 6032  H HD12 . LEU A 1 53  ? 14.269  -1.198  -7.405  1.00 0.00 ? 231 LEU A HD12 4  
ATOM 6033  H HD13 . LEU A 1 53  ? 12.849  -2.180  -7.765  1.00 0.00 ? 231 LEU A HD13 4  
ATOM 6034  H HD21 . LEU A 1 53  ? 15.130  -3.973  -4.747  1.00 0.00 ? 231 LEU A HD21 4  
ATOM 6035  H HD22 . LEU A 1 53  ? 16.011  -2.819  -5.749  1.00 0.00 ? 231 LEU A HD22 4  
ATOM 6036  H HD23 . LEU A 1 53  ? 15.311  -4.266  -6.477  1.00 0.00 ? 231 LEU A HD23 4  
ATOM 6037  N N    . LYS A 1 54  ? 11.740  -0.445  -2.863  1.00 0.00 ? 232 LYS A N    4  
ATOM 6038  C CA   . LYS A 1 54  ? 11.196  0.691   -2.130  1.00 0.00 ? 232 LYS A CA   4  
ATOM 6039  C C    . LYS A 1 54  ? 10.811  0.289   -0.710  1.00 0.00 ? 232 LYS A C    4  
ATOM 6040  O O    . LYS A 1 54  ? 10.956  1.072   0.228   1.00 0.00 ? 232 LYS A O    4  
ATOM 6041  C CB   . LYS A 1 54  ? 9.975   1.258   -2.859  1.00 0.00 ? 232 LYS A CB   4  
ATOM 6042  C CG   . LYS A 1 54  ? 9.301   2.400   -2.119  1.00 0.00 ? 232 LYS A CG   4  
ATOM 6043  C CD   . LYS A 1 54  ? 10.309  3.441   -1.662  1.00 0.00 ? 232 LYS A CD   4  
ATOM 6044  C CE   . LYS A 1 54  ? 10.942  4.160   -2.843  1.00 0.00 ? 232 LYS A CE   4  
ATOM 6045  N NZ   . LYS A 1 54  ? 10.127  5.325   -3.285  1.00 0.00 ? 232 LYS A NZ   4  
ATOM 6046  H H    . LYS A 1 54  ? 11.163  -0.928  -3.492  1.00 0.00 ? 232 LYS A H    4  
ATOM 6047  H HA   . LYS A 1 54  ? 11.960  1.452   -2.081  1.00 0.00 ? 232 LYS A HA   4  
ATOM 6048  H HB2  . LYS A 1 54  ? 10.286  1.618   -3.829  1.00 0.00 ? 232 LYS A HB2  4  
ATOM 6049  H HB3  . LYS A 1 54  ? 9.252   0.467   -2.993  1.00 0.00 ? 232 LYS A HB3  4  
ATOM 6050  H HG2  . LYS A 1 54  ? 8.587   2.872   -2.778  1.00 0.00 ? 232 LYS A HG2  4  
ATOM 6051  H HG3  . LYS A 1 54  ? 8.789   2.004   -1.254  1.00 0.00 ? 232 LYS A HG3  4  
ATOM 6052  H HD2  . LYS A 1 54  ? 9.807   4.167   -1.040  1.00 0.00 ? 232 LYS A HD2  4  
ATOM 6053  H HD3  . LYS A 1 54  ? 11.085  2.951   -1.091  1.00 0.00 ? 232 LYS A HD3  4  
ATOM 6054  H HE2  . LYS A 1 54  ? 11.922  4.507   -2.553  1.00 0.00 ? 232 LYS A HE2  4  
ATOM 6055  H HE3  . LYS A 1 54  ? 11.036  3.464   -3.663  1.00 0.00 ? 232 LYS A HE3  4  
ATOM 6056  H HZ1  . LYS A 1 54  ? 10.742  6.055   -3.699  1.00 0.00 ? 232 LYS A HZ1  4  
ATOM 6057  H HZ2  . LYS A 1 54  ? 9.619   5.734   -2.475  1.00 0.00 ? 232 LYS A HZ2  4  
ATOM 6058  H HZ3  . LYS A 1 54  ? 9.433   5.025   -4.000  1.00 0.00 ? 232 LYS A HZ3  4  
ATOM 6059  N N    . ALA A 1 55  ? 10.320  -0.937  -0.559  1.00 0.00 ? 233 ALA A N    4  
ATOM 6060  C CA   . ALA A 1 55  ? 9.918   -1.444  0.747   1.00 0.00 ? 233 ALA A CA   4  
ATOM 6061  C C    . ALA A 1 55  ? 11.134  -1.740  1.619   1.00 0.00 ? 233 ALA A C    4  
ATOM 6062  O O    . ALA A 1 55  ? 11.149  -1.419  2.807   1.00 0.00 ? 233 ALA A O    4  
ATOM 6063  C CB   . ALA A 1 55  ? 9.063   -2.692  0.588   1.00 0.00 ? 233 ALA A CB   4  
ATOM 6064  H H    . ALA A 1 55  ? 10.228  -1.515  -1.345  1.00 0.00 ? 233 ALA A H    4  
ATOM 6065  H HA   . ALA A 1 55  ? 9.318   -0.685  1.229   1.00 0.00 ? 233 ALA A HA   4  
ATOM 6066  H HB1  . ALA A 1 55  ? 9.406   -3.256  -0.267  1.00 0.00 ? 233 ALA A HB1  4  
ATOM 6067  H HB2  . ALA A 1 55  ? 9.146   -3.300  1.477   1.00 0.00 ? 233 ALA A HB2  4  
ATOM 6068  H HB3  . ALA A 1 55  ? 8.033   -2.406  0.441   1.00 0.00 ? 233 ALA A HB3  4  
ATOM 6069  N N    . GLN A 1 56  ? 12.149  -2.355  1.021   1.00 0.00 ? 234 GLN A N    4  
ATOM 6070  C CA   . GLN A 1 56  ? 13.369  -2.695  1.745   1.00 0.00 ? 234 GLN A CA   4  
ATOM 6071  C C    . GLN A 1 56  ? 14.016  -1.448  2.338   1.00 0.00 ? 234 GLN A C    4  
ATOM 6072  O O    . GLN A 1 56  ? 14.566  -1.487  3.438   1.00 0.00 ? 234 GLN A O    4  
ATOM 6073  C CB   . GLN A 1 56  ? 14.356  -3.405  0.817   1.00 0.00 ? 234 GLN A CB   4  
ATOM 6074  C CG   . GLN A 1 56  ? 15.728  -3.618  1.438   1.00 0.00 ? 234 GLN A CG   4  
ATOM 6075  C CD   . GLN A 1 56  ? 16.756  -4.094  0.431   1.00 0.00 ? 234 GLN A CD   4  
ATOM 6076  O OE1  . GLN A 1 56  ? 17.773  -3.436  0.206   1.00 0.00 ? 234 GLN A OE1  4  
ATOM 6077  N NE2  . GLN A 1 56  ? 16.498  -5.243  -0.182  1.00 0.00 ? 234 GLN A NE2  4  
ATOM 6078  H H    . GLN A 1 56  ? 12.077  -2.585  0.072   1.00 0.00 ? 234 GLN A H    4  
ATOM 6079  H HA   . GLN A 1 56  ? 13.100  -3.364  2.549   1.00 0.00 ? 234 GLN A HA   4  
ATOM 6080  H HB2  . GLN A 1 56  ? 13.952  -4.369  0.550   1.00 0.00 ? 234 GLN A HB2  4  
ATOM 6081  H HB3  . GLN A 1 56  ? 14.479  -2.813  -0.078  1.00 0.00 ? 234 GLN A HB3  4  
ATOM 6082  H HG2  . GLN A 1 56  ? 16.067  -2.684  1.861   1.00 0.00 ? 234 GLN A HG2  4  
ATOM 6083  H HG3  . GLN A 1 56  ? 15.643  -4.358  2.221   1.00 0.00 ? 234 GLN A HG3  4  
ATOM 6084  H HE21 . GLN A 1 56  ? 15.667  -5.712  0.046   1.00 0.00 ? 234 GLN A HE21 4  
ATOM 6085  H HE22 . GLN A 1 56  ? 17.145  -5.573  -0.839  1.00 0.00 ? 234 GLN A HE22 4  
ATOM 6086  N N    . GLU A 1 57  ? 13.945  -0.343  1.602   1.00 0.00 ? 235 GLU A N    4  
ATOM 6087  C CA   . GLU A 1 57  ? 14.526  0.915   2.056   1.00 0.00 ? 235 GLU A CA   4  
ATOM 6088  C C    . GLU A 1 57  ? 13.799  1.434   3.293   1.00 0.00 ? 235 GLU A C    4  
ATOM 6089  O O    . GLU A 1 57  ? 14.426  1.897   4.246   1.00 0.00 ? 235 GLU A O    4  
ATOM 6090  C CB   . GLU A 1 57  ? 14.468  1.960   0.941   1.00 0.00 ? 235 GLU A CB   4  
ATOM 6091  C CG   . GLU A 1 57  ? 15.096  3.291   1.321   1.00 0.00 ? 235 GLU A CG   4  
ATOM 6092  C CD   . GLU A 1 57  ? 14.253  4.071   2.311   1.00 0.00 ? 235 GLU A CD   4  
ATOM 6093  O OE1  . GLU A 1 57  ? 13.088  4.381   1.986   1.00 0.00 ? 235 GLU A OE1  4  
ATOM 6094  O OE2  . GLU A 1 57  ? 14.760  4.372   3.413   1.00 0.00 ? 235 GLU A OE2  4  
ATOM 6095  H H    . GLU A 1 57  ? 13.493  -0.376  0.733   1.00 0.00 ? 235 GLU A H    4  
ATOM 6096  H HA   . GLU A 1 57  ? 15.558  0.731   2.311   1.00 0.00 ? 235 GLU A HA   4  
ATOM 6097  H HB2  . GLU A 1 57  ? 14.987  1.575   0.075   1.00 0.00 ? 235 GLU A HB2  4  
ATOM 6098  H HB3  . GLU A 1 57  ? 13.435  2.135   0.681   1.00 0.00 ? 235 GLU A HB3  4  
ATOM 6099  H HG2  . GLU A 1 57  ? 16.063  3.105   1.763   1.00 0.00 ? 235 GLU A HG2  4  
ATOM 6100  H HG3  . GLU A 1 57  ? 15.218  3.885   0.427   1.00 0.00 ? 235 GLU A HG3  4  
ATOM 6101  N N    . TYR A 1 58  ? 12.473  1.355   3.270   1.00 0.00 ? 236 TYR A N    4  
ATOM 6102  C CA   . TYR A 1 58  ? 11.660  1.819   4.387   1.00 0.00 ? 236 TYR A CA   4  
ATOM 6103  C C    . TYR A 1 58  ? 11.782  0.876   5.580   1.00 0.00 ? 236 TYR A C    4  
ATOM 6104  O O    . TYR A 1 58  ? 11.824  1.313   6.730   1.00 0.00 ? 236 TYR A O    4  
ATOM 6105  C CB   . TYR A 1 58  ? 10.194  1.937   3.964   1.00 0.00 ? 236 TYR A CB   4  
ATOM 6106  C CG   . TYR A 1 58  ? 9.223   1.865   5.120   1.00 0.00 ? 236 TYR A CG   4  
ATOM 6107  C CD1  . TYR A 1 58  ? 9.045   0.684   5.831   1.00 0.00 ? 236 TYR A CD1  4  
ATOM 6108  C CD2  . TYR A 1 58  ? 8.482   2.977   5.502   1.00 0.00 ? 236 TYR A CD2  4  
ATOM 6109  C CE1  . TYR A 1 58  ? 8.158   0.613   6.888   1.00 0.00 ? 236 TYR A CE1  4  
ATOM 6110  C CE2  . TYR A 1 58  ? 7.594   2.915   6.558   1.00 0.00 ? 236 TYR A CE2  4  
ATOM 6111  C CZ   . TYR A 1 58  ? 7.435   1.731   7.247   1.00 0.00 ? 236 TYR A CZ   4  
ATOM 6112  O OH   . TYR A 1 58  ? 6.550   1.666   8.299   1.00 0.00 ? 236 TYR A OH   4  
ATOM 6113  H H    . TYR A 1 58  ? 12.030  0.976   2.482   1.00 0.00 ? 236 TYR A H    4  
ATOM 6114  H HA   . TYR A 1 58  ? 12.020  2.796   4.676   1.00 0.00 ? 236 TYR A HA   4  
ATOM 6115  H HB2  . TYR A 1 58  ? 10.046  2.883   3.465   1.00 0.00 ? 236 TYR A HB2  4  
ATOM 6116  H HB3  . TYR A 1 58  ? 9.958   1.134   3.281   1.00 0.00 ? 236 TYR A HB3  4  
ATOM 6117  H HD1  . TYR A 1 58  ? 9.613   -0.190  5.547   1.00 0.00 ? 236 TYR A HD1  4  
ATOM 6118  H HD2  . TYR A 1 58  ? 8.608   3.903   4.959   1.00 0.00 ? 236 TYR A HD2  4  
ATOM 6119  H HE1  . TYR A 1 58  ? 8.033   -0.314  7.428   1.00 0.00 ? 236 TYR A HE1  4  
ATOM 6120  H HE2  . TYR A 1 58  ? 7.027   3.791   6.839   1.00 0.00 ? 236 TYR A HE2  4  
ATOM 6121  H HH   . TYR A 1 58  ? 7.034   1.713   9.127   1.00 0.00 ? 236 TYR A HH   4  
ATOM 6122  N N    . ILE A 1 59  ? 11.840  -0.421  5.296   1.00 0.00 ? 237 ILE A N    4  
ATOM 6123  C CA   . ILE A 1 59  ? 11.959  -1.427  6.344   1.00 0.00 ? 237 ILE A CA   4  
ATOM 6124  C C    . ILE A 1 59  ? 13.301  -1.319  7.059   1.00 0.00 ? 237 ILE A C    4  
ATOM 6125  O O    . ILE A 1 59  ? 13.381  -1.478  8.277   1.00 0.00 ? 237 ILE A O    4  
ATOM 6126  C CB   . ILE A 1 59  ? 11.806  -2.851  5.777   1.00 0.00 ? 237 ILE A CB   4  
ATOM 6127  C CG1  . ILE A 1 59  ? 10.447  -3.007  5.091   1.00 0.00 ? 237 ILE A CG1  4  
ATOM 6128  C CG2  . ILE A 1 59  ? 11.968  -3.882  6.884   1.00 0.00 ? 237 ILE A CG2  4  
ATOM 6129  C CD1  . ILE A 1 59  ? 10.444  -4.036  3.982   1.00 0.00 ? 237 ILE A CD1  4  
ATOM 6130  H H    . ILE A 1 59  ? 11.802  -0.708  4.360   1.00 0.00 ? 237 ILE A H    4  
ATOM 6131  H HA   . ILE A 1 59  ? 11.167  -1.259  7.059   1.00 0.00 ? 237 ILE A HA   4  
ATOM 6132  H HB   . ILE A 1 59  ? 12.588  -3.012  5.051   1.00 0.00 ? 237 ILE A HB   4  
ATOM 6133  H HG12 . ILE A 1 59  ? 9.714   -3.307  5.823   1.00 0.00 ? 237 ILE A HG12 4  
ATOM 6134  H HG13 . ILE A 1 59  ? 10.157  -2.058  4.664   1.00 0.00 ? 237 ILE A HG13 4  
ATOM 6135  H HG21 . ILE A 1 59  ? 12.660  -3.509  7.625   1.00 0.00 ? 237 ILE A HG21 4  
ATOM 6136  H HG22 . ILE A 1 59  ? 11.010  -4.065  7.347   1.00 0.00 ? 237 ILE A HG22 4  
ATOM 6137  H HG23 . ILE A 1 59  ? 12.348  -4.802  6.467   1.00 0.00 ? 237 ILE A HG23 4  
ATOM 6138  H HD11 . ILE A 1 59  ? 10.426  -5.027  4.411   1.00 0.00 ? 237 ILE A HD11 4  
ATOM 6139  H HD12 . ILE A 1 59  ? 9.573   -3.895  3.361   1.00 0.00 ? 237 ILE A HD12 4  
ATOM 6140  H HD13 . ILE A 1 59  ? 11.336  -3.921  3.382   1.00 0.00 ? 237 ILE A HD13 4  
ATOM 6141  N N    . ARG A 1 60  ? 14.353  -1.045  6.295   1.00 0.00 ? 238 ARG A N    4  
ATOM 6142  C CA   . ARG A 1 60  ? 15.692  -0.914  6.856   1.00 0.00 ? 238 ARG A CA   4  
ATOM 6143  C C    . ARG A 1 60  ? 15.802  0.344   7.713   1.00 0.00 ? 238 ARG A C    4  
ATOM 6144  O O    . ARG A 1 60  ? 16.397  0.321   8.790   1.00 0.00 ? 238 ARG A O    4  
ATOM 6145  C CB   . ARG A 1 60  ? 16.735  -0.875  5.737   1.00 0.00 ? 238 ARG A CB   4  
ATOM 6146  C CG   . ARG A 1 60  ? 17.949  -0.021  6.067   1.00 0.00 ? 238 ARG A CG   4  
ATOM 6147  C CD   . ARG A 1 60  ? 19.199  -0.538  5.371   1.00 0.00 ? 238 ARG A CD   4  
ATOM 6148  N NE   . ARG A 1 60  ? 20.418  -0.134  6.065   1.00 0.00 ? 238 ARG A NE   4  
ATOM 6149  C CZ   . ARG A 1 60  ? 20.862  -0.718  7.173   1.00 0.00 ? 238 ARG A CZ   4  
ATOM 6150  N NH1  . ARG A 1 60  ? 20.189  -1.727  7.709   1.00 0.00 ? 238 ARG A NH1  4  
ATOM 6151  N NH2  . ARG A 1 60  ? 21.980  -0.293  7.746   1.00 0.00 ? 238 ARG A NH2  4  
ATOM 6152  H H    . ARG A 1 60  ? 14.226  -0.929  5.330   1.00 0.00 ? 238 ARG A H    4  
ATOM 6153  H HA   . ARG A 1 60  ? 15.877  -1.777  7.478   1.00 0.00 ? 238 ARG A HA   4  
ATOM 6154  H HB2  . ARG A 1 60  ? 17.074  -1.881  5.541   1.00 0.00 ? 238 ARG A HB2  4  
ATOM 6155  H HB3  . ARG A 1 60  ? 16.274  -0.478  4.846   1.00 0.00 ? 238 ARG A HB3  4  
ATOM 6156  H HG2  . ARG A 1 60  ? 17.764  0.992   5.742   1.00 0.00 ? 238 ARG A HG2  4  
ATOM 6157  H HG3  . ARG A 1 60  ? 18.109  -0.036  7.134   1.00 0.00 ? 238 ARG A HG3  4  
ATOM 6158  H HD2  . ARG A 1 60  ? 19.156  -1.617  5.338   1.00 0.00 ? 238 ARG A HD2  4  
ATOM 6159  H HD3  . ARG A 1 60  ? 19.222  -0.148  4.365   1.00 0.00 ? 238 ARG A HD3  4  
ATOM 6160  H HE   . ARG A 1 60  ? 20.931  0.610   5.686   1.00 0.00 ? 238 ARG A HE   4  
ATOM 6161  H HH11 . ARG A 1 60  ? 19.347  -2.050  7.278   1.00 0.00 ? 238 ARG A HH11 4  
ATOM 6162  H HH12 . ARG A 1 60  ? 20.526  -2.166  8.542   1.00 0.00 ? 238 ARG A HH12 4  
ATOM 6163  H HH21 . ARG A 1 60  ? 22.490  0.467   7.345   1.00 0.00 ? 238 ARG A HH21 4  
ATOM 6164  H HH22 . ARG A 1 60  ? 22.313  -0.733  8.580   1.00 0.00 ? 238 ARG A HH22 4  
ATOM 6165  N N    . GLN A 1 61  ? 15.225  1.437   7.226   1.00 0.00 ? 239 GLN A N    4  
ATOM 6166  C CA   . GLN A 1 61  ? 15.259  2.704   7.948   1.00 0.00 ? 239 GLN A CA   4  
ATOM 6167  C C    . GLN A 1 61  ? 14.210  2.729   9.054   1.00 0.00 ? 239 GLN A C    4  
ATOM 6168  O O    . GLN A 1 61  ? 14.318  3.498   10.010  1.00 0.00 ? 239 GLN A O    4  
ATOM 6169  C CB   . GLN A 1 61  ? 15.030  3.870   6.984   1.00 0.00 ? 239 GLN A CB   4  
ATOM 6170  C CG   . GLN A 1 61  ? 16.260  4.237   6.170   1.00 0.00 ? 239 GLN A CG   4  
ATOM 6171  C CD   . GLN A 1 61  ? 17.401  4.741   7.031   1.00 0.00 ? 239 GLN A CD   4  
ATOM 6172  O OE1  . GLN A 1 61  ? 18.425  4.073   7.179   1.00 0.00 ? 239 GLN A OE1  4  
ATOM 6173  N NE2  . GLN A 1 61  ? 17.231  5.927   7.604   1.00 0.00 ? 239 GLN A NE2  4  
ATOM 6174  H H    . GLN A 1 61  ? 14.766  1.392   6.362   1.00 0.00 ? 239 GLN A H    4  
ATOM 6175  H HA   . GLN A 1 61  ? 16.237  2.805   8.394   1.00 0.00 ? 239 GLN A HA   4  
ATOM 6176  H HB2  . GLN A 1 61  ? 14.237  3.606   6.301   1.00 0.00 ? 239 GLN A HB2  4  
ATOM 6177  H HB3  . GLN A 1 61  ? 14.730  4.738   7.553   1.00 0.00 ? 239 GLN A HB3  4  
ATOM 6178  H HG2  . GLN A 1 61  ? 16.594  3.362   5.632   1.00 0.00 ? 239 GLN A HG2  4  
ATOM 6179  H HG3  . GLN A 1 61  ? 15.991  5.010   5.465   1.00 0.00 ? 239 GLN A HG3  4  
ATOM 6180  H HE21 . GLN A 1 61  ? 16.389  6.403   7.443   1.00 0.00 ? 239 GLN A HE21 4  
ATOM 6181  H HE22 . GLN A 1 61  ? 17.952  6.277   8.167   1.00 0.00 ? 239 GLN A HE22 4  
ATOM 6182  N N    . LYS A 1 62  ? 13.194  1.884   8.919   1.00 0.00 ? 240 LYS A N    4  
ATOM 6183  C CA   . LYS A 1 62  ? 12.125  1.808   9.907   1.00 0.00 ? 240 LYS A CA   4  
ATOM 6184  C C    . LYS A 1 62  ? 12.333  0.622   10.844  1.00 0.00 ? 240 LYS A C    4  
ATOM 6185  O O    . LYS A 1 62  ? 12.596  0.798   12.033  1.00 0.00 ? 240 LYS A O    4  
ATOM 6186  C CB   . LYS A 1 62  ? 10.767  1.688   9.211   1.00 0.00 ? 240 LYS A CB   4  
ATOM 6187  C CG   . LYS A 1 62  ? 10.430  2.877   8.328   1.00 0.00 ? 240 LYS A CG   4  
ATOM 6188  C CD   . LYS A 1 62  ? 9.881   4.038   9.140   1.00 0.00 ? 240 LYS A CD   4  
ATOM 6189  C CE   . LYS A 1 62  ? 10.165  5.372   8.469   1.00 0.00 ? 240 LYS A CE   4  
ATOM 6190  N NZ   . LYS A 1 62  ? 9.175   6.413   8.862   1.00 0.00 ? 240 LYS A NZ   4  
ATOM 6191  H H    . LYS A 1 62  ? 13.163  1.296   8.135   1.00 0.00 ? 240 LYS A H    4  
ATOM 6192  H HA   . LYS A 1 62  ? 12.144  2.718   10.487  1.00 0.00 ? 240 LYS A HA   4  
ATOM 6193  H HB2  . LYS A 1 62  ? 10.767  0.799   8.598   1.00 0.00 ? 240 LYS A HB2  4  
ATOM 6194  H HB3  . LYS A 1 62  ? 9.997   1.596   9.964   1.00 0.00 ? 240 LYS A HB3  4  
ATOM 6195  H HG2  . LYS A 1 62  ? 11.325  3.201   7.818   1.00 0.00 ? 240 LYS A HG2  4  
ATOM 6196  H HG3  . LYS A 1 62  ? 9.688   2.575   7.601   1.00 0.00 ? 240 LYS A HG3  4  
ATOM 6197  H HD2  . LYS A 1 62  ? 8.812   3.920   9.244   1.00 0.00 ? 240 LYS A HD2  4  
ATOM 6198  H HD3  . LYS A 1 62  ? 10.341  4.031   10.118  1.00 0.00 ? 240 LYS A HD3  4  
ATOM 6199  H HE2  . LYS A 1 62  ? 11.153  5.701   8.754   1.00 0.00 ? 240 LYS A HE2  4  
ATOM 6200  H HE3  . LYS A 1 62  ? 10.126  5.237   7.398   1.00 0.00 ? 240 LYS A HE3  4  
ATOM 6201  H HZ1  . LYS A 1 62  ? 8.661   6.113   9.715   1.00 0.00 ? 240 LYS A HZ1  4  
ATOM 6202  H HZ2  . LYS A 1 62  ? 8.491   6.564   8.094   1.00 0.00 ? 240 LYS A HZ2  4  
ATOM 6203  H HZ3  . LYS A 1 62  ? 9.661   7.311   9.061   1.00 0.00 ? 240 LYS A HZ3  4  
ATOM 6204  N N    . ASN A 1 63  ? 12.215  -0.584  10.300  1.00 0.00 ? 241 ASN A N    4  
ATOM 6205  C CA   . ASN A 1 63  ? 12.392  -1.799  11.087  1.00 0.00 ? 241 ASN A CA   4  
ATOM 6206  C C    . ASN A 1 63  ? 13.868  -2.171  11.189  1.00 0.00 ? 241 ASN A C    4  
ATOM 6207  O O    . ASN A 1 63  ? 14.221  -3.350  11.246  1.00 0.00 ? 241 ASN A O    4  
ATOM 6208  C CB   . ASN A 1 63  ? 11.605  -2.954  10.466  1.00 0.00 ? 241 ASN A CB   4  
ATOM 6209  C CG   . ASN A 1 63  ? 11.293  -4.047  11.470  1.00 0.00 ? 241 ASN A CG   4  
ATOM 6210  O OD1  . ASN A 1 63  ? 11.734  -3.995  12.618  1.00 0.00 ? 241 ASN A OD1  4  
ATOM 6211  N ND2  . ASN A 1 63  ? 10.530  -5.045  11.039  1.00 0.00 ? 241 ASN A ND2  4  
ATOM 6212  H H    . ASN A 1 63  ? 12.004  -0.660  9.346   1.00 0.00 ? 241 ASN A H    4  
ATOM 6213  H HA   . ASN A 1 63  ? 12.012  -1.608  12.080  1.00 0.00 ? 241 ASN A HA   4  
ATOM 6214  H HB2  . ASN A 1 63  ? 10.672  -2.576  10.074  1.00 0.00 ? 241 ASN A HB2  4  
ATOM 6215  H HB3  . ASN A 1 63  ? 12.182  -3.383  9.661   1.00 0.00 ? 241 ASN A HB3  4  
ATOM 6216  H HD21 . ASN A 1 63  ? 10.216  -5.021  10.112  1.00 0.00 ? 241 ASN A HD21 4  
ATOM 6217  H HD22 . ASN A 1 63  ? 10.313  -5.765  11.668  1.00 0.00 ? 241 ASN A HD22 4  
ATOM 6218  N N    . LYS A 1 64  ? 14.728  -1.159  11.212  1.00 0.00 ? 242 LYS A N    4  
ATOM 6219  C CA   . LYS A 1 64  ? 16.167  -1.377  11.309  1.00 0.00 ? 242 LYS A CA   4  
ATOM 6220  C C    . LYS A 1 64  ? 16.587  -2.596  10.494  1.00 0.00 ? 242 LYS A C    4  
ATOM 6221  O O    . LYS A 1 64  ? 17.580  -3.252  10.807  1.00 0.00 ? 242 LYS A O    4  
ATOM 6222  C CB   . LYS A 1 64  ? 16.578  -1.562  12.771  1.00 0.00 ? 242 LYS A CB   4  
ATOM 6223  C CG   . LYS A 1 64  ? 16.846  -0.255  13.497  1.00 0.00 ? 242 LYS A CG   4  
ATOM 6224  C CD   . LYS A 1 64  ? 17.116  -0.483  14.975  1.00 0.00 ? 242 LYS A CD   4  
ATOM 6225  C CE   . LYS A 1 64  ? 17.384  0.826   15.701  1.00 0.00 ? 242 LYS A CE   4  
ATOM 6226  N NZ   . LYS A 1 64  ? 17.288  0.670   17.179  1.00 0.00 ? 242 LYS A NZ   4  
ATOM 6227  H H    . LYS A 1 64  ? 14.387  -0.241  11.164  1.00 0.00 ? 242 LYS A H    4  
ATOM 6228  H HA   . LYS A 1 64  ? 16.662  -0.505  10.911  1.00 0.00 ? 242 LYS A HA   4  
ATOM 6229  H HB2  . LYS A 1 64  ? 15.788  -2.084  13.292  1.00 0.00 ? 242 LYS A HB2  4  
ATOM 6230  H HB3  . LYS A 1 64  ? 17.477  -2.160  12.807  1.00 0.00 ? 242 LYS A HB3  4  
ATOM 6231  H HG2  . LYS A 1 64  ? 17.708  0.222   13.054  1.00 0.00 ? 242 LYS A HG2  4  
ATOM 6232  H HG3  . LYS A 1 64  ? 15.983  0.387   13.393  1.00 0.00 ? 242 LYS A HG3  4  
ATOM 6233  H HD2  . LYS A 1 64  ? 16.255  -0.959  15.420  1.00 0.00 ? 242 LYS A HD2  4  
ATOM 6234  H HD3  . LYS A 1 64  ? 17.979  -1.126  15.079  1.00 0.00 ? 242 LYS A HD3  4  
ATOM 6235  H HE2  . LYS A 1 64  ? 18.377  1.166   15.448  1.00 0.00 ? 242 LYS A HE2  4  
ATOM 6236  H HE3  . LYS A 1 64  ? 16.659  1.558   15.376  1.00 0.00 ? 242 LYS A HE3  4  
ATOM 6237  H HZ1  . LYS A 1 64  ? 16.487  0.053   17.421  1.00 0.00 ? 242 LYS A HZ1  4  
ATOM 6238  H HZ2  . LYS A 1 64  ? 17.144  1.597   17.627  1.00 0.00 ? 242 LYS A HZ2  4  
ATOM 6239  H HZ3  . LYS A 1 64  ? 18.162  0.249   17.552  1.00 0.00 ? 242 LYS A HZ3  4  
ATOM 6240  N N    . GLY A 1 65  ? 15.826  -2.893  9.444   1.00 0.00 ? 243 GLY A N    4  
ATOM 6241  C CA   . GLY A 1 65  ? 16.138  -4.031  8.600   1.00 0.00 ? 243 GLY A CA   4  
ATOM 6242  C C    . GLY A 1 65  ? 15.546  -5.323  9.127   1.00 0.00 ? 243 GLY A C    4  
ATOM 6243  O O    . GLY A 1 65  ? 16.275  -6.261  9.451   1.00 0.00 ? 243 GLY A O    4  
ATOM 6244  H H    . GLY A 1 65  ? 15.047  -2.334  9.242   1.00 0.00 ? 243 GLY A H    4  
ATOM 6245  H HA2  . GLY A 1 65  ? 15.750  -3.847  7.609   1.00 0.00 ? 243 GLY A HA2  4  
ATOM 6246  H HA3  . GLY A 1 65  ? 17.211  -4.138  8.541   1.00 0.00 ? 243 GLY A HA3  4  
ATOM 6247  N N    . ALA A 1 66  ? 14.221  -5.373  9.216   1.00 0.00 ? 244 ALA A N    4  
ATOM 6248  C CA   . ALA A 1 66  ? 13.532  -6.559  9.707   1.00 0.00 ? 244 ALA A CA   4  
ATOM 6249  C C    . ALA A 1 66  ? 12.235  -6.798  8.942   1.00 0.00 ? 244 ALA A C    4  
ATOM 6250  O O    . ALA A 1 66  ? 11.454  -5.872  8.718   1.00 0.00 ? 244 ALA A O    4  
ATOM 6251  C CB   . ALA A 1 66  ? 13.251  -6.428  11.197  1.00 0.00 ? 244 ALA A CB   4  
ATOM 6252  H H    . ALA A 1 66  ? 13.694  -4.593  8.943   1.00 0.00 ? 244 ALA A H    4  
ATOM 6253  H HA   . ALA A 1 66  ? 14.185  -7.408  9.563   1.00 0.00 ? 244 ALA A HA   4  
ATOM 6254  H HB1  . ALA A 1 66  ? 13.520  -5.434  11.526  1.00 0.00 ? 244 ALA A HB1  4  
ATOM 6255  H HB2  . ALA A 1 66  ? 12.201  -6.597  11.381  1.00 0.00 ? 244 ALA A HB2  4  
ATOM 6256  H HB3  . ALA A 1 66  ? 13.834  -7.157  11.739  1.00 0.00 ? 244 ALA A HB3  4  
ATOM 6257  N N    . LYS A 1 67  ? 12.011  -8.045  8.541   1.00 0.00 ? 245 LYS A N    4  
ATOM 6258  C CA   . LYS A 1 67  ? 10.808  -8.406  7.800   1.00 0.00 ? 245 LYS A CA   4  
ATOM 6259  C C    . LYS A 1 67  ? 9.584   -7.696  8.370   1.00 0.00 ? 245 LYS A C    4  
ATOM 6260  O O    . LYS A 1 67  ? 9.510   -7.432  9.571   1.00 0.00 ? 245 LYS A O    4  
ATOM 6261  C CB   . LYS A 1 67  ? 10.596  -9.921  7.840   1.00 0.00 ? 245 LYS A CB   4  
ATOM 6262  C CG   . LYS A 1 67  ? 10.840  -10.535 9.208   1.00 0.00 ? 245 LYS A CG   4  
ATOM 6263  C CD   . LYS A 1 67  ? 9.567   -10.573 10.036  1.00 0.00 ? 245 LYS A CD   4  
ATOM 6264  C CE   . LYS A 1 67  ? 8.738   -11.810 9.727   1.00 0.00 ? 245 LYS A CE   4  
ATOM 6265  N NZ   . LYS A 1 67  ? 7.282   -11.564 9.920   1.00 0.00 ? 245 LYS A NZ   4  
ATOM 6266  H H    . LYS A 1 67  ? 12.670  -8.740  8.750   1.00 0.00 ? 245 LYS A H    4  
ATOM 6267  H HA   . LYS A 1 67  ? 10.944  -8.097  6.775   1.00 0.00 ? 245 LYS A HA   4  
ATOM 6268  H HB2  . LYS A 1 67  ? 9.579   -10.138 7.547   1.00 0.00 ? 245 LYS A HB2  4  
ATOM 6269  H HB3  . LYS A 1 67  ? 11.271  -10.385 7.135   1.00 0.00 ? 245 LYS A HB3  4  
ATOM 6270  H HG2  . LYS A 1 67  ? 11.204  -11.543 9.080   1.00 0.00 ? 245 LYS A HG2  4  
ATOM 6271  H HG3  . LYS A 1 67  ? 11.581  -9.945  9.729   1.00 0.00 ? 245 LYS A HG3  4  
ATOM 6272  H HD2  . LYS A 1 67  ? 9.829   -10.582 11.084  1.00 0.00 ? 245 LYS A HD2  4  
ATOM 6273  H HD3  . LYS A 1 67  ? 8.979   -9.693  9.818   1.00 0.00 ? 245 LYS A HD3  4  
ATOM 6274  H HE2  . LYS A 1 67  ? 8.913   -12.098 8.702   1.00 0.00 ? 245 LYS A HE2  4  
ATOM 6275  H HE3  . LYS A 1 67  ? 9.049   -12.609 10.384  1.00 0.00 ? 245 LYS A HE3  4  
ATOM 6276  H HZ1  . LYS A 1 67  ? 7.112   -11.135 10.852  1.00 0.00 ? 245 LYS A HZ1  4  
ATOM 6277  H HZ2  . LYS A 1 67  ? 6.758   -12.461 9.864   1.00 0.00 ? 245 LYS A HZ2  4  
ATOM 6278  H HZ3  . LYS A 1 67  ? 6.927   -10.921 9.184   1.00 0.00 ? 245 LYS A HZ3  4  
ATOM 6279  N N    . LEU A 1 68  ? 8.625   -7.392  7.503   1.00 0.00 ? 246 LEU A N    4  
ATOM 6280  C CA   . LEU A 1 68  ? 7.403   -6.714  7.921   1.00 0.00 ? 246 LEU A CA   4  
ATOM 6281  C C    . LEU A 1 68  ? 6.435   -7.692  8.579   1.00 0.00 ? 246 LEU A C    4  
ATOM 6282  O O    . LEU A 1 68  ? 6.742   -8.874  8.738   1.00 0.00 ? 246 LEU A O    4  
ATOM 6283  C CB   . LEU A 1 68  ? 6.731   -6.045  6.720   1.00 0.00 ? 246 LEU A CB   4  
ATOM 6284  C CG   . LEU A 1 68  ? 7.515   -4.911  6.058   1.00 0.00 ? 246 LEU A CG   4  
ATOM 6285  C CD1  . LEU A 1 68  ? 6.832   -4.469  4.773   1.00 0.00 ? 246 LEU A CD1  4  
ATOM 6286  C CD2  . LEU A 1 68  ? 7.666   -3.738  7.015   1.00 0.00 ? 246 LEU A CD2  4  
ATOM 6287  H H    . LEU A 1 68  ? 8.740   -7.628  6.559   1.00 0.00 ? 246 LEU A H    4  
ATOM 6288  H HA   . LEU A 1 68  ? 7.674   -5.955  8.640   1.00 0.00 ? 246 LEU A HA   4  
ATOM 6289  H HB2  . LEU A 1 68  ? 6.556   -6.805  5.974   1.00 0.00 ? 246 LEU A HB2  4  
ATOM 6290  H HB3  . LEU A 1 68  ? 5.784   -5.644  7.052   1.00 0.00 ? 246 LEU A HB3  4  
ATOM 6291  H HG   . LEU A 1 68  ? 8.504   -5.266  5.804   1.00 0.00 ? 246 LEU A HG   4  
ATOM 6292  H HD11 . LEU A 1 68  ? 7.578   -4.167  4.054   1.00 0.00 ? 246 LEU A HD11 4  
ATOM 6293  H HD12 . LEU A 1 68  ? 6.177   -3.636  4.983   1.00 0.00 ? 246 LEU A HD12 4  
ATOM 6294  H HD13 . LEU A 1 68  ? 6.255   -5.289  4.372   1.00 0.00 ? 246 LEU A HD13 4  
ATOM 6295  H HD21 . LEU A 1 68  ? 7.868   -2.838  6.453   1.00 0.00 ? 246 LEU A HD21 4  
ATOM 6296  H HD22 . LEU A 1 68  ? 8.486   -3.929  7.693   1.00 0.00 ? 246 LEU A HD22 4  
ATOM 6297  H HD23 . LEU A 1 68  ? 6.754   -3.614  7.579   1.00 0.00 ? 246 LEU A HD23 4  
ATOM 6298  N N    . LYS A 1 69  ? 5.263   -7.193  8.958   1.00 0.00 ? 247 LYS A N    4  
ATOM 6299  C CA   . LYS A 1 69  ? 4.248   -8.022  9.596   1.00 0.00 ? 247 LYS A CA   4  
ATOM 6300  C C    . LYS A 1 69  ? 2.873   -7.762  8.989   1.00 0.00 ? 247 LYS A C    4  
ATOM 6301  O O    . LYS A 1 69  ? 2.559   -6.638  8.596   1.00 0.00 ? 247 LYS A O    4  
ATOM 6302  C CB   . LYS A 1 69  ? 4.212   -7.752  11.102  1.00 0.00 ? 247 LYS A CB   4  
ATOM 6303  C CG   . LYS A 1 69  ? 5.552   -7.952  11.788  1.00 0.00 ? 247 LYS A CG   4  
ATOM 6304  C CD   . LYS A 1 69  ? 5.504   -7.515  13.242  1.00 0.00 ? 247 LYS A CD   4  
ATOM 6305  C CE   . LYS A 1 69  ? 4.738   -8.512  14.099  1.00 0.00 ? 247 LYS A CE   4  
ATOM 6306  N NZ   . LYS A 1 69  ? 4.634   -8.062  15.514  1.00 0.00 ? 247 LYS A NZ   4  
ATOM 6307  H H    . LYS A 1 69  ? 5.077   -6.242  8.804   1.00 0.00 ? 247 LYS A H    4  
ATOM 6308  H HA   . LYS A 1 69  ? 4.512   -9.056  9.430   1.00 0.00 ? 247 LYS A HA   4  
ATOM 6309  H HB2  . LYS A 1 69  ? 3.896   -6.732  11.265  1.00 0.00 ? 247 LYS A HB2  4  
ATOM 6310  H HB3  . LYS A 1 69  ? 3.495   -8.419  11.558  1.00 0.00 ? 247 LYS A HB3  4  
ATOM 6311  H HG2  . LYS A 1 69  ? 5.815   -8.998  11.746  1.00 0.00 ? 247 LYS A HG2  4  
ATOM 6312  H HG3  . LYS A 1 69  ? 6.301   -7.369  11.271  1.00 0.00 ? 247 LYS A HG3  4  
ATOM 6313  H HD2  . LYS A 1 69  ? 6.513   -7.436  13.619  1.00 0.00 ? 247 LYS A HD2  4  
ATOM 6314  H HD3  . LYS A 1 69  ? 5.018   -6.552  13.304  1.00 0.00 ? 247 LYS A HD3  4  
ATOM 6315  H HE2  . LYS A 1 69  ? 3.745   -8.626  13.693  1.00 0.00 ? 247 LYS A HE2  4  
ATOM 6316  H HE3  . LYS A 1 69  ? 5.251   -9.462  14.068  1.00 0.00 ? 247 LYS A HE3  4  
ATOM 6317  H HZ1  . LYS A 1 69  ? 5.509   -8.293  16.028  1.00 0.00 ? 247 LYS A HZ1  4  
ATOM 6318  H HZ2  . LYS A 1 69  ? 3.836   -8.536  15.982  1.00 0.00 ? 247 LYS A HZ2  4  
ATOM 6319  H HZ3  . LYS A 1 69  ? 4.484   -7.033  15.553  1.00 0.00 ? 247 LYS A HZ3  4  
ATOM 6320  N N    . VAL A 1 70  ? 2.056   -8.808  8.916   1.00 0.00 ? 248 VAL A N    4  
ATOM 6321  C CA   . VAL A 1 70  ? 0.713   -8.691  8.360   1.00 0.00 ? 248 VAL A CA   4  
ATOM 6322  C C    . VAL A 1 70  ? -0.210  -7.932  9.306   1.00 0.00 ? 248 VAL A C    4  
ATOM 6323  O O    . VAL A 1 70  ? -0.310  -8.258  10.488  1.00 0.00 ? 248 VAL A O    4  
ATOM 6324  C CB   . VAL A 1 70  ? 0.105   -10.076 8.068   1.00 0.00 ? 248 VAL A CB   4  
ATOM 6325  C CG1  . VAL A 1 70  ? -1.355  -9.943  7.661   1.00 0.00 ? 248 VAL A CG1  4  
ATOM 6326  C CG2  . VAL A 1 70  ? 0.904   -10.792 6.989   1.00 0.00 ? 248 VAL A CG2  4  
ATOM 6327  H H    . VAL A 1 70  ? 2.363   -9.678  9.246   1.00 0.00 ? 248 VAL A H    4  
ATOM 6328  H HA   . VAL A 1 70  ? 0.784   -8.149  7.428   1.00 0.00 ? 248 VAL A HA   4  
ATOM 6329  H HB   . VAL A 1 70  ? 0.151   -10.665 8.972   1.00 0.00 ? 248 VAL A HB   4  
ATOM 6330  H HG11 . VAL A 1 70  ? -1.416  -9.493  6.681   1.00 0.00 ? 248 VAL A HG11 4  
ATOM 6331  H HG12 . VAL A 1 70  ? -1.813  -10.921 7.639   1.00 0.00 ? 248 VAL A HG12 4  
ATOM 6332  H HG13 . VAL A 1 70  ? -1.872  -9.319  8.376   1.00 0.00 ? 248 VAL A HG13 4  
ATOM 6333  H HG21 . VAL A 1 70  ? 1.115   -11.801 7.309   1.00 0.00 ? 248 VAL A HG21 4  
ATOM 6334  H HG22 . VAL A 1 70  ? 0.331   -10.817 6.073   1.00 0.00 ? 248 VAL A HG22 4  
ATOM 6335  H HG23 . VAL A 1 70  ? 1.831   -10.265 6.818   1.00 0.00 ? 248 VAL A HG23 4  
ATOM 6336  N N    . GLY A 1 71  ? -0.885  -6.916  8.777   1.00 0.00 ? 249 GLY A N    4  
ATOM 6337  C CA   . GLY A 1 71  ? -1.792  -6.125  9.588   1.00 0.00 ? 249 GLY A CA   4  
ATOM 6338  C C    . GLY A 1 71  ? -1.216  -4.770  9.949   1.00 0.00 ? 249 GLY A C    4  
ATOM 6339  O O    . GLY A 1 71  ? -1.958  -3.815  10.177  1.00 0.00 ? 249 GLY A O    4  
ATOM 6340  H H    . GLY A 1 71  ? -0.766  -6.701  7.828   1.00 0.00 ? 249 GLY A H    4  
ATOM 6341  H HA2  . GLY A 1 71  ? -2.712  -5.980  9.042   1.00 0.00 ? 249 GLY A HA2  4  
ATOM 6342  H HA3  . GLY A 1 71  ? -2.007  -6.666  10.498  1.00 0.00 ? 249 GLY A HA3  4  
ATOM 6343  N N    . GLN A 1 72  ? 0.109   -4.688  10.003  1.00 0.00 ? 250 GLN A N    4  
ATOM 6344  C CA   . GLN A 1 72  ? 0.783   -3.440  10.342  1.00 0.00 ? 250 GLN A CA   4  
ATOM 6345  C C    . GLN A 1 72  ? 0.490   -2.364  9.302   1.00 0.00 ? 250 GLN A C    4  
ATOM 6346  O O    . GLN A 1 72  ? 0.309   -2.660  8.121   1.00 0.00 ? 250 GLN A O    4  
ATOM 6347  C CB   . GLN A 1 72  ? 2.292   -3.664  10.450  1.00 0.00 ? 250 GLN A CB   4  
ATOM 6348  C CG   . GLN A 1 72  ? 3.033   -3.465  9.137   1.00 0.00 ? 250 GLN A CG   4  
ATOM 6349  C CD   . GLN A 1 72  ? 4.539   -3.522  9.303   1.00 0.00 ? 250 GLN A CD   4  
ATOM 6350  O OE1  . GLN A 1 72  ? 5.111   -4.591  9.517   1.00 0.00 ? 250 GLN A OE1  4  
ATOM 6351  N NE2  . GLN A 1 72  ? 5.190   -2.369  9.203   1.00 0.00 ? 250 GLN A NE2  4  
ATOM 6352  H H    . GLN A 1 72  ? 0.646   -5.484  9.810   1.00 0.00 ? 250 GLN A H    4  
ATOM 6353  H HA   . GLN A 1 72  ? 0.408   -3.110  11.298  1.00 0.00 ? 250 GLN A HA   4  
ATOM 6354  H HB2  . GLN A 1 72  ? 2.696   -2.974  11.175  1.00 0.00 ? 250 GLN A HB2  4  
ATOM 6355  H HB3  . GLN A 1 72  ? 2.471   -4.674  10.789  1.00 0.00 ? 250 GLN A HB3  4  
ATOM 6356  H HG2  . GLN A 1 72  ? 2.733   -4.240  8.448   1.00 0.00 ? 250 GLN A HG2  4  
ATOM 6357  H HG3  . GLN A 1 72  ? 2.766   -2.500  8.732   1.00 0.00 ? 250 GLN A HG3  4  
ATOM 6358  H HE21 . GLN A 1 72  ? 4.668   -1.556  9.032   1.00 0.00 ? 250 GLN A HE21 4  
ATOM 6359  H HE22 . GLN A 1 72  ? 6.163   -2.376  9.306   1.00 0.00 ? 250 GLN A HE22 4  
ATOM 6360  N N    . TYR A 1 73  ? 0.445   -1.113  9.748   1.00 0.00 ? 251 TYR A N    4  
ATOM 6361  C CA   . TYR A 1 73  ? 0.172   0.008   8.857   1.00 0.00 ? 251 TYR A CA   4  
ATOM 6362  C C    . TYR A 1 73  ? 1.431   0.424   8.103   1.00 0.00 ? 251 TYR A C    4  
ATOM 6363  O O    . TYR A 1 73  ? 2.498   0.591   8.697   1.00 0.00 ? 251 TYR A O    4  
ATOM 6364  C CB   . TYR A 1 73  ? -0.378  1.195   9.650   1.00 0.00 ? 251 TYR A CB   4  
ATOM 6365  C CG   . TYR A 1 73  ? -1.883  1.184   9.791   1.00 0.00 ? 251 TYR A CG   4  
ATOM 6366  C CD1  . TYR A 1 73  ? -2.701  1.595   8.746   1.00 0.00 ? 251 TYR A CD1  4  
ATOM 6367  C CD2  . TYR A 1 73  ? -2.487  0.762   10.969  1.00 0.00 ? 251 TYR A CD2  4  
ATOM 6368  C CE1  . TYR A 1 73  ? -4.077  1.587   8.871   1.00 0.00 ? 251 TYR A CE1  4  
ATOM 6369  C CE2  . TYR A 1 73  ? -3.862  0.749   11.102  1.00 0.00 ? 251 TYR A CE2  4  
ATOM 6370  C CZ   . TYR A 1 73  ? -4.653  1.164   10.051  1.00 0.00 ? 251 TYR A CZ   4  
ATOM 6371  O OH   . TYR A 1 73  ? -6.023  1.153   10.179  1.00 0.00 ? 251 TYR A OH   4  
ATOM 6372  H H    . TYR A 1 73  ? 0.598   -0.940  10.701  1.00 0.00 ? 251 TYR A H    4  
ATOM 6373  H HA   . TYR A 1 73  ? -0.573  -0.311  8.142   1.00 0.00 ? 251 TYR A HA   4  
ATOM 6374  H HB2  . TYR A 1 73  ? 0.048   1.184   10.641  1.00 0.00 ? 251 TYR A HB2  4  
ATOM 6375  H HB3  . TYR A 1 73  ? -0.097  2.112   9.152   1.00 0.00 ? 251 TYR A HB3  4  
ATOM 6376  H HD1  . TYR A 1 73  ? -2.247  1.925   7.823   1.00 0.00 ? 251 TYR A HD1  4  
ATOM 6377  H HD2  . TYR A 1 73  ? -1.865  0.438   11.791  1.00 0.00 ? 251 TYR A HD2  4  
ATOM 6378  H HE1  . TYR A 1 73  ? -4.697  1.911   8.048   1.00 0.00 ? 251 TYR A HE1  4  
ATOM 6379  H HE2  . TYR A 1 73  ? -4.313  0.418   12.026  1.00 0.00 ? 251 TYR A HE2  4  
ATOM 6380  H HH   . TYR A 1 73  ? -6.271  0.580   10.908  1.00 0.00 ? 251 TYR A HH   4  
ATOM 6381  N N    . LEU A 1 74  ? 1.300   0.591   6.792   1.00 0.00 ? 252 LEU A N    4  
ATOM 6382  C CA   . LEU A 1 74  ? 2.426   0.989   5.955   1.00 0.00 ? 252 LEU A CA   4  
ATOM 6383  C C    . LEU A 1 74  ? 2.069   2.204   5.104   1.00 0.00 ? 252 LEU A C    4  
ATOM 6384  O O    . LEU A 1 74  ? 0.951   2.317   4.604   1.00 0.00 ? 252 LEU A O    4  
ATOM 6385  C CB   . LEU A 1 74  ? 2.852   -0.171  5.054   1.00 0.00 ? 252 LEU A CB   4  
ATOM 6386  C CG   . LEU A 1 74  ? 4.254   -0.072  4.450   1.00 0.00 ? 252 LEU A CG   4  
ATOM 6387  C CD1  . LEU A 1 74  ? 5.312   -0.161  5.539   1.00 0.00 ? 252 LEU A CD1  4  
ATOM 6388  C CD2  . LEU A 1 74  ? 4.464   -1.162  3.409   1.00 0.00 ? 252 LEU A CD2  4  
ATOM 6389  H H    . LEU A 1 74  ? 0.425   0.444   6.376   1.00 0.00 ? 252 LEU A H    4  
ATOM 6390  H HA   . LEU A 1 74  ? 3.247   1.249   6.606   1.00 0.00 ? 252 LEU A HA   4  
ATOM 6391  H HB2  . LEU A 1 74  ? 2.808   -1.077  5.638   1.00 0.00 ? 252 LEU A HB2  4  
ATOM 6392  H HB3  . LEU A 1 74  ? 2.144   -0.234  4.240   1.00 0.00 ? 252 LEU A HB3  4  
ATOM 6393  H HG   . LEU A 1 74  ? 4.360   0.886   3.959   1.00 0.00 ? 252 LEU A HG   4  
ATOM 6394  H HD11 . LEU A 1 74  ? 5.720   -1.160  5.563   1.00 0.00 ? 252 LEU A HD11 4  
ATOM 6395  H HD12 . LEU A 1 74  ? 4.865   0.068   6.494   1.00 0.00 ? 252 LEU A HD12 4  
ATOM 6396  H HD13 . LEU A 1 74  ? 6.101   0.547   5.332   1.00 0.00 ? 252 LEU A HD13 4  
ATOM 6397  H HD21 . LEU A 1 74  ? 3.633   -1.851  3.437   1.00 0.00 ? 252 LEU A HD21 4  
ATOM 6398  H HD22 . LEU A 1 74  ? 5.379   -1.694  3.625   1.00 0.00 ? 252 LEU A HD22 4  
ATOM 6399  H HD23 . LEU A 1 74  ? 4.529   -0.715  2.428   1.00 0.00 ? 252 LEU A HD23 4  
ATOM 6400  N N    . ASN A 1 75  ? 3.029   3.109   4.943   1.00 0.00 ? 253 ASN A N    4  
ATOM 6401  C CA   . ASN A 1 75  ? 2.817   4.316   4.151   1.00 0.00 ? 253 ASN A CA   4  
ATOM 6402  C C    . ASN A 1 75  ? 3.136   4.064   2.680   1.00 0.00 ? 253 ASN A C    4  
ATOM 6403  O O    . ASN A 1 75  ? 4.165   3.473   2.351   1.00 0.00 ? 253 ASN A O    4  
ATOM 6404  C CB   . ASN A 1 75  ? 3.681   5.460   4.684   1.00 0.00 ? 253 ASN A CB   4  
ATOM 6405  C CG   . ASN A 1 75  ? 3.702   6.653   3.749   1.00 0.00 ? 253 ASN A CG   4  
ATOM 6406  O OD1  . ASN A 1 75  ? 4.746   7.011   3.204   1.00 0.00 ? 253 ASN A OD1  4  
ATOM 6407  N ND2  . ASN A 1 75  ? 2.544   7.276   3.559   1.00 0.00 ? 253 ASN A ND2  4  
ATOM 6408  H H    . ASN A 1 75  ? 3.901   2.964   5.367   1.00 0.00 ? 253 ASN A H    4  
ATOM 6409  H HA   . ASN A 1 75  ? 1.777   4.591   4.239   1.00 0.00 ? 253 ASN A HA   4  
ATOM 6410  H HB2  . ASN A 1 75  ? 3.292   5.782   5.639   1.00 0.00 ? 253 ASN A HB2  4  
ATOM 6411  H HB3  . ASN A 1 75  ? 4.694   5.108   4.812   1.00 0.00 ? 253 ASN A HB3  4  
ATOM 6412  H HD21 . ASN A 1 75  ? 1.753   6.935   4.026   1.00 0.00 ? 253 ASN A HD21 4  
ATOM 6413  H HD22 . ASN A 1 75  ? 2.529   8.050   2.959   1.00 0.00 ? 253 ASN A HD22 4  
ATOM 6414  N N    . CYS A 1 76  ? 2.249   4.517   1.802   1.00 0.00 ? 254 CYS A N    4  
ATOM 6415  C CA   . CYS A 1 76  ? 2.436   4.342   0.366   1.00 0.00 ? 254 CYS A CA   4  
ATOM 6416  C C    . CYS A 1 76  ? 1.679   5.410   -0.416  1.00 0.00 ? 254 CYS A C    4  
ATOM 6417  O O    . CYS A 1 76  ? 0.654   5.917   0.040   1.00 0.00 ? 254 CYS A O    4  
ATOM 6418  C CB   . CYS A 1 76  ? 1.968   2.951   -0.064  1.00 0.00 ? 254 CYS A CB   4  
ATOM 6419  S SG   . CYS A 1 76  ? 2.988   1.599   0.572   1.00 0.00 ? 254 CYS A SG   4  
ATOM 6420  H H    . CYS A 1 76  ? 1.449   4.981   2.126   1.00 0.00 ? 254 CYS A H    4  
ATOM 6421  H HA   . CYS A 1 76  ? 3.490   4.438   0.156   1.00 0.00 ? 254 CYS A HA   4  
ATOM 6422  H HB2  . CYS A 1 76  ? 0.959   2.793   0.289   1.00 0.00 ? 254 CYS A HB2  4  
ATOM 6423  H HB3  . CYS A 1 76  ? 1.978   2.893   -1.142  1.00 0.00 ? 254 CYS A HB3  4  
ATOM 6424  H HG   . CYS A 1 76  ? 2.630   0.488   -0.053  1.00 0.00 ? 254 CYS A HG   4  
ATOM 6425  N N    . ILE A 1 77  ? 2.192   5.749   -1.594  1.00 0.00 ? 255 ILE A N    4  
ATOM 6426  C CA   . ILE A 1 77  ? 1.565   6.758   -2.438  1.00 0.00 ? 255 ILE A CA   4  
ATOM 6427  C C    . ILE A 1 77  ? 1.434   6.267   -3.876  1.00 0.00 ? 255 ILE A C    4  
ATOM 6428  O O    . ILE A 1 77  ? 2.279   5.518   -4.367  1.00 0.00 ? 255 ILE A O    4  
ATOM 6429  C CB   . ILE A 1 77  ? 2.362   8.075   -2.427  1.00 0.00 ? 255 ILE A CB   4  
ATOM 6430  C CG1  . ILE A 1 77  ? 2.481   8.613   -1.000  1.00 0.00 ? 255 ILE A CG1  4  
ATOM 6431  C CG2  . ILE A 1 77  ? 1.698   9.103   -3.332  1.00 0.00 ? 255 ILE A CG2  4  
ATOM 6432  C CD1  . ILE A 1 77  ? 3.513   9.709   -0.851  1.00 0.00 ? 255 ILE A CD1  4  
ATOM 6433  H H    . ILE A 1 77  ? 3.011   5.309   -1.903  1.00 0.00 ? 255 ILE A H    4  
ATOM 6434  H HA   . ILE A 1 77  ? 0.578   6.954   -2.045  1.00 0.00 ? 255 ILE A HA   4  
ATOM 6435  H HB   . ILE A 1 77  ? 3.350   7.876   -2.813  1.00 0.00 ? 255 ILE A HB   4  
ATOM 6436  H HG12 . ILE A 1 77  ? 1.527   9.012   -0.691  1.00 0.00 ? 255 ILE A HG12 4  
ATOM 6437  H HG13 . ILE A 1 77  ? 2.757   7.803   -0.340  1.00 0.00 ? 255 ILE A HG13 4  
ATOM 6438  H HG21 . ILE A 1 77  ? 2.002   10.095  -3.034  1.00 0.00 ? 255 ILE A HG21 4  
ATOM 6439  H HG22 . ILE A 1 77  ? 1.998   8.928   -4.355  1.00 0.00 ? 255 ILE A HG22 4  
ATOM 6440  H HG23 . ILE A 1 77  ? 0.625   9.015   -3.251  1.00 0.00 ? 255 ILE A HG23 4  
ATOM 6441  H HD11 . ILE A 1 77  ? 3.103   10.641  -1.209  1.00 0.00 ? 255 ILE A HD11 4  
ATOM 6442  H HD12 . ILE A 1 77  ? 3.785   9.809   0.189   1.00 0.00 ? 255 ILE A HD12 4  
ATOM 6443  H HD13 . ILE A 1 77  ? 4.391   9.457   -1.429  1.00 0.00 ? 255 ILE A HD13 4  
ATOM 6444  N N    . VAL A 1 78  ? 0.371   6.697   -4.548  1.00 0.00 ? 256 VAL A N    4  
ATOM 6445  C CA   . VAL A 1 78  ? 0.131   6.304   -5.931  1.00 0.00 ? 256 VAL A CA   4  
ATOM 6446  C C    . VAL A 1 78  ? 1.102   7.003   -6.877  1.00 0.00 ? 256 VAL A C    4  
ATOM 6447  O O    . VAL A 1 78  ? 1.138   8.230   -6.949  1.00 0.00 ? 256 VAL A O    4  
ATOM 6448  C CB   . VAL A 1 78  ? -1.312  6.627   -6.364  1.00 0.00 ? 256 VAL A CB   4  
ATOM 6449  C CG1  . VAL A 1 78  ? -1.690  5.826   -7.601  1.00 0.00 ? 256 VAL A CG1  4  
ATOM 6450  C CG2  . VAL A 1 78  ? -2.283  6.355   -5.225  1.00 0.00 ? 256 VAL A CG2  4  
ATOM 6451  H H    . VAL A 1 78  ? -0.267  7.293   -4.103  1.00 0.00 ? 256 VAL A H    4  
ATOM 6452  H HA   . VAL A 1 78  ? 0.276   5.236   -6.006  1.00 0.00 ? 256 VAL A HA   4  
ATOM 6453  H HB   . VAL A 1 78  ? -1.366  7.677   -6.612  1.00 0.00 ? 256 VAL A HB   4  
ATOM 6454  H HG11 . VAL A 1 78  ? -0.802  5.386   -8.030  1.00 0.00 ? 256 VAL A HG11 4  
ATOM 6455  H HG12 . VAL A 1 78  ? -2.384  5.045   -7.326  1.00 0.00 ? 256 VAL A HG12 4  
ATOM 6456  H HG13 . VAL A 1 78  ? -2.152  6.481   -8.326  1.00 0.00 ? 256 VAL A HG13 4  
ATOM 6457  H HG21 . VAL A 1 78  ? -2.681  7.290   -4.862  1.00 0.00 ? 256 VAL A HG21 4  
ATOM 6458  H HG22 . VAL A 1 78  ? -3.091  5.733   -5.582  1.00 0.00 ? 256 VAL A HG22 4  
ATOM 6459  H HG23 . VAL A 1 78  ? -1.766  5.847   -4.424  1.00 0.00 ? 256 VAL A HG23 4  
ATOM 6460  N N    . GLU A 1 79  ? 1.886   6.211   -7.602  1.00 0.00 ? 257 GLU A N    4  
ATOM 6461  C CA   . GLU A 1 79  ? 2.858   6.754   -8.543  1.00 0.00 ? 257 GLU A CA   4  
ATOM 6462  C C    . GLU A 1 79  ? 2.399   6.541   -9.983  1.00 0.00 ? 257 GLU A C    4  
ATOM 6463  O O    . GLU A 1 79  ? 2.415   7.465   -10.796 1.00 0.00 ? 257 GLU A O    4  
ATOM 6464  C CB   . GLU A 1 79  ? 4.226   6.103   -8.331  1.00 0.00 ? 257 GLU A CB   4  
ATOM 6465  C CG   . GLU A 1 79  ? 5.077   6.802   -7.284  1.00 0.00 ? 257 GLU A CG   4  
ATOM 6466  C CD   . GLU A 1 79  ? 6.562   6.585   -7.499  1.00 0.00 ? 257 GLU A CD   4  
ATOM 6467  O OE1  . GLU A 1 79  ? 6.932   5.547   -8.087  1.00 0.00 ? 257 GLU A OE1  4  
ATOM 6468  O OE2  . GLU A 1 79  ? 7.355   7.454   -7.079  1.00 0.00 ? 257 GLU A OE2  4  
ATOM 6469  H H    . GLU A 1 79  ? 1.810   5.239   -7.500  1.00 0.00 ? 257 GLU A H    4  
ATOM 6470  H HA   . GLU A 1 79  ? 2.942   7.814   -8.359  1.00 0.00 ? 257 GLU A HA   4  
ATOM 6471  H HB2  . GLU A 1 79  ? 4.080   5.078   -8.022  1.00 0.00 ? 257 GLU A HB2  4  
ATOM 6472  H HB3  . GLU A 1 79  ? 4.765   6.113   -9.267  1.00 0.00 ? 257 GLU A HB3  4  
ATOM 6473  H HG2  . GLU A 1 79  ? 4.875   7.861   -7.322  1.00 0.00 ? 257 GLU A HG2  4  
ATOM 6474  H HG3  . GLU A 1 79  ? 4.810   6.421   -6.309  1.00 0.00 ? 257 GLU A HG3  4  
ATOM 6475  N N    . LYS A 1 80  ? 1.990   5.315   -10.291 1.00 0.00 ? 258 LYS A N    4  
ATOM 6476  C CA   . LYS A 1 80  ? 1.526   4.977   -11.632 1.00 0.00 ? 258 LYS A CA   4  
ATOM 6477  C C    . LYS A 1 80  ? 0.284   4.093   -11.571 1.00 0.00 ? 258 LYS A C    4  
ATOM 6478  O O    . LYS A 1 80  ? 0.224   3.143   -10.791 1.00 0.00 ? 258 LYS A O    4  
ATOM 6479  C CB   . LYS A 1 80  ? 2.633   4.266   -12.414 1.00 0.00 ? 258 LYS A CB   4  
ATOM 6480  C CG   . LYS A 1 80  ? 3.840   5.145   -12.694 1.00 0.00 ? 258 LYS A CG   4  
ATOM 6481  C CD   . LYS A 1 80  ? 4.634   4.638   -13.886 1.00 0.00 ? 258 LYS A CD   4  
ATOM 6482  C CE   . LYS A 1 80  ? 5.533   3.473   -13.501 1.00 0.00 ? 258 LYS A CE   4  
ATOM 6483  N NZ   . LYS A 1 80  ? 6.590   3.228   -14.522 1.00 0.00 ? 258 LYS A NZ   4  
ATOM 6484  H H    . LYS A 1 80  ? 2.001   4.619   -9.600  1.00 0.00 ? 258 LYS A H    4  
ATOM 6485  H HA   . LYS A 1 80  ? 1.273   5.897   -12.137 1.00 0.00 ? 258 LYS A HA   4  
ATOM 6486  H HB2  . LYS A 1 80  ? 2.962   3.407   -11.848 1.00 0.00 ? 258 LYS A HB2  4  
ATOM 6487  H HB3  . LYS A 1 80  ? 2.231   3.932   -13.359 1.00 0.00 ? 258 LYS A HB3  4  
ATOM 6488  H HG2  . LYS A 1 80  ? 3.502   6.150   -12.901 1.00 0.00 ? 258 LYS A HG2  4  
ATOM 6489  H HG3  . LYS A 1 80  ? 4.479   5.150   -11.822 1.00 0.00 ? 258 LYS A HG3  4  
ATOM 6490  H HD2  . LYS A 1 80  ? 3.947   4.310   -14.652 1.00 0.00 ? 258 LYS A HD2  4  
ATOM 6491  H HD3  . LYS A 1 80  ? 5.246   5.443   -14.268 1.00 0.00 ? 258 LYS A HD3  4  
ATOM 6492  H HE2  . LYS A 1 80  ? 6.003   3.695   -12.555 1.00 0.00 ? 258 LYS A HE2  4  
ATOM 6493  H HE3  . LYS A 1 80  ? 4.927   2.585   -13.403 1.00 0.00 ? 258 LYS A HE3  4  
ATOM 6494  H HZ1  . LYS A 1 80  ? 6.450   3.857   -15.338 1.00 0.00 ? 258 LYS A HZ1  4  
ATOM 6495  H HZ2  . LYS A 1 80  ? 6.550   2.241   -14.848 1.00 0.00 ? 258 LYS A HZ2  4  
ATOM 6496  H HZ3  . LYS A 1 80  ? 7.529   3.409   -14.114 1.00 0.00 ? 258 LYS A HZ3  4  
ATOM 6497  N N    . VAL A 1 81  ? -0.705  4.412   -12.399 1.00 0.00 ? 259 VAL A N    4  
ATOM 6498  C CA   . VAL A 1 81  ? -1.945  3.645   -12.441 1.00 0.00 ? 259 VAL A CA   4  
ATOM 6499  C C    . VAL A 1 81  ? -2.207  3.100   -13.840 1.00 0.00 ? 259 VAL A C    4  
ATOM 6500  O O    . VAL A 1 81  ? -2.292  3.857   -14.808 1.00 0.00 ? 259 VAL A O    4  
ATOM 6501  C CB   . VAL A 1 81  ? -3.148  4.500   -12.001 1.00 0.00 ? 259 VAL A CB   4  
ATOM 6502  C CG1  . VAL A 1 81  ? -4.423  3.669   -12.005 1.00 0.00 ? 259 VAL A CG1  4  
ATOM 6503  C CG2  . VAL A 1 81  ? -2.899  5.102   -10.626 1.00 0.00 ? 259 VAL A CG2  4  
ATOM 6504  H H    . VAL A 1 81  ? -0.599  5.181   -12.997 1.00 0.00 ? 259 VAL A H    4  
ATOM 6505  H HA   . VAL A 1 81  ? -1.848  2.817   -11.755 1.00 0.00 ? 259 VAL A HA   4  
ATOM 6506  H HB   . VAL A 1 81  ? -3.269  5.307   -12.708 1.00 0.00 ? 259 VAL A HB   4  
ATOM 6507  H HG11 . VAL A 1 81  ? -4.855  3.669   -11.015 1.00 0.00 ? 259 VAL A HG11 4  
ATOM 6508  H HG12 . VAL A 1 81  ? -5.127  4.093   -12.706 1.00 0.00 ? 259 VAL A HG12 4  
ATOM 6509  H HG13 . VAL A 1 81  ? -4.190  2.655   -12.296 1.00 0.00 ? 259 VAL A HG13 4  
ATOM 6510  H HG21 . VAL A 1 81  ? -2.069  5.790   -10.681 1.00 0.00 ? 259 VAL A HG21 4  
ATOM 6511  H HG22 . VAL A 1 81  ? -3.783  5.630   -10.298 1.00 0.00 ? 259 VAL A HG22 4  
ATOM 6512  H HG23 . VAL A 1 81  ? -2.670  4.315   -9.924  1.00 0.00 ? 259 VAL A HG23 4  
ATOM 6513  N N    . LYS A 1 82  ? -2.335  1.782   -13.942 1.00 0.00 ? 260 LYS A N    4  
ATOM 6514  C CA   . LYS A 1 82  ? -2.589  1.133   -15.223 1.00 0.00 ? 260 LYS A CA   4  
ATOM 6515  C C    . LYS A 1 82  ? -3.823  0.240   -15.144 1.00 0.00 ? 260 LYS A C    4  
ATOM 6516  O O    . LYS A 1 82  ? -3.987  -0.526  -14.196 1.00 0.00 ? 260 LYS A O    4  
ATOM 6517  C CB   . LYS A 1 82  ? -1.374  0.307   -15.650 1.00 0.00 ? 260 LYS A CB   4  
ATOM 6518  C CG   . LYS A 1 82  ? -0.837  -0.596  -14.553 1.00 0.00 ? 260 LYS A CG   4  
ATOM 6519  C CD   . LYS A 1 82  ? -0.102  -1.795  -15.128 1.00 0.00 ? 260 LYS A CD   4  
ATOM 6520  C CE   . LYS A 1 82  ? 1.380   -1.504  -15.314 1.00 0.00 ? 260 LYS A CE   4  
ATOM 6521  N NZ   . LYS A 1 82  ? 2.133   -1.623  -14.034 1.00 0.00 ? 260 LYS A NZ   4  
ATOM 6522  H H    . LYS A 1 82  ? -2.257  1.231   -13.134 1.00 0.00 ? 260 LYS A H    4  
ATOM 6523  H HA   . LYS A 1 82  ? -2.765  1.905   -15.956 1.00 0.00 ? 260 LYS A HA   4  
ATOM 6524  H HB2  . LYS A 1 82  ? -1.651  -0.310  -16.492 1.00 0.00 ? 260 LYS A HB2  4  
ATOM 6525  H HB3  . LYS A 1 82  ? -0.584  0.980   -15.952 1.00 0.00 ? 260 LYS A HB3  4  
ATOM 6526  H HG2  . LYS A 1 82  ? -0.155  -0.031  -13.936 1.00 0.00 ? 260 LYS A HG2  4  
ATOM 6527  H HG3  . LYS A 1 82  ? -1.663  -0.947  -13.951 1.00 0.00 ? 260 LYS A HG3  4  
ATOM 6528  H HD2  . LYS A 1 82  ? -0.211  -2.631  -14.454 1.00 0.00 ? 260 LYS A HD2  4  
ATOM 6529  H HD3  . LYS A 1 82  ? -0.533  -2.045  -16.087 1.00 0.00 ? 260 LYS A HD3  4  
ATOM 6530  H HE2  . LYS A 1 82  ? 1.785   -2.206  -16.026 1.00 0.00 ? 260 LYS A HE2  4  
ATOM 6531  H HE3  . LYS A 1 82  ? 1.491   -0.499  -15.695 1.00 0.00 ? 260 LYS A HE3  4  
ATOM 6532  H HZ1  . LYS A 1 82  ? 1.865   -0.852  -13.390 1.00 0.00 ? 260 LYS A HZ1  4  
ATOM 6533  H HZ2  . LYS A 1 82  ? 3.155   -1.568  -14.215 1.00 0.00 ? 260 LYS A HZ2  4  
ATOM 6534  H HZ3  . LYS A 1 82  ? 1.920   -2.532  -13.577 1.00 0.00 ? 260 LYS A HZ3  4  
ATOM 6535  N N    . GLY A 1 83  ? -4.687  0.342   -16.149 1.00 0.00 ? 261 GLY A N    4  
ATOM 6536  C CA   . GLY A 1 83  ? -5.894  -0.464  -16.175 1.00 0.00 ? 261 GLY A CA   4  
ATOM 6537  C C    . GLY A 1 83  ? -6.851  -0.110  -15.054 1.00 0.00 ? 261 GLY A C    4  
ATOM 6538  O O    . GLY A 1 83  ? -6.799  0.992   -14.509 1.00 0.00 ? 261 GLY A O    4  
ATOM 6539  H H    . GLY A 1 83  ? -4.504  0.970   -16.879 1.00 0.00 ? 261 GLY A H    4  
ATOM 6540  H HA2  . GLY A 1 83  ? -6.393  -0.315  -17.121 1.00 0.00 ? 261 GLY A HA2  4  
ATOM 6541  H HA3  . GLY A 1 83  ? -5.620  -1.504  -16.083 1.00 0.00 ? 261 GLY A HA3  4  
ATOM 6542  N N    . ASN A 1 84  ? -7.730  -1.046  -14.710 1.00 0.00 ? 262 ASN A N    4  
ATOM 6543  C CA   . ASN A 1 84  ? -8.705  -0.827  -13.649 1.00 0.00 ? 262 ASN A CA   4  
ATOM 6544  C C    . ASN A 1 84  ? -8.498  -1.816  -12.506 1.00 0.00 ? 262 ASN A C    4  
ATOM 6545  O O    . ASN A 1 84  ? -8.563  -1.450  -11.334 1.00 0.00 ? 262 ASN A O    4  
ATOM 6546  C CB   . ASN A 1 84  ? -10.127 -0.956  -14.199 1.00 0.00 ? 262 ASN A CB   4  
ATOM 6547  C CG   . ASN A 1 84  ? -10.278 -0.319  -15.567 1.00 0.00 ? 262 ASN A CG   4  
ATOM 6548  O OD1  . ASN A 1 84  ? -10.468 0.891   -15.683 1.00 0.00 ? 262 ASN A OD1  4  
ATOM 6549  N ND2  . ASN A 1 84  ? -10.193 -1.135  -16.612 1.00 0.00 ? 262 ASN A ND2  4  
ATOM 6550  H H    . ASN A 1 84  ? -7.722  -1.905  -15.182 1.00 0.00 ? 262 ASN A H    4  
ATOM 6551  H HA   . ASN A 1 84  ? -8.564  0.175   -13.272 1.00 0.00 ? 262 ASN A HA   4  
ATOM 6552  H HB2  . ASN A 1 84  ? -10.381 -2.003  -14.281 1.00 0.00 ? 262 ASN A HB2  4  
ATOM 6553  H HB3  . ASN A 1 84  ? -10.815 -0.475  -13.520 1.00 0.00 ? 262 ASN A HB3  4  
ATOM 6554  H HD21 . ASN A 1 84  ? -10.041 -2.089  -16.444 1.00 0.00 ? 262 ASN A HD21 4  
ATOM 6555  H HD22 . ASN A 1 84  ? -10.287 -0.750  -17.508 1.00 0.00 ? 262 ASN A HD22 4  
ATOM 6556  N N    . GLY A 1 85  ? -8.247  -3.074  -12.858 1.00 0.00 ? 263 GLY A N    4  
ATOM 6557  C CA   . GLY A 1 85  ? -8.034  -4.097  -11.852 1.00 0.00 ? 263 GLY A CA   4  
ATOM 6558  C C    . GLY A 1 85  ? -6.787  -4.919  -12.115 1.00 0.00 ? 263 GLY A C    4  
ATOM 6559  O O    . GLY A 1 85  ? -6.739  -6.106  -11.795 1.00 0.00 ? 263 GLY A O    4  
ATOM 6560  H H    . GLY A 1 85  ? -8.207  -3.309  -13.809 1.00 0.00 ? 263 GLY A H    4  
ATOM 6561  H HA2  . GLY A 1 85  ? -7.942  -3.623  -10.886 1.00 0.00 ? 263 GLY A HA2  4  
ATOM 6562  H HA3  . GLY A 1 85  ? -8.889  -4.757  -11.838 1.00 0.00 ? 263 GLY A HA3  4  
ATOM 6563  N N    . GLY A 1 86  ? -5.776  -4.286  -12.703 1.00 0.00 ? 264 GLY A N    4  
ATOM 6564  C CA   . GLY A 1 86  ? -4.538  -4.982  -13.001 1.00 0.00 ? 264 GLY A CA   4  
ATOM 6565  C C    . GLY A 1 86  ? -3.534  -4.889  -11.870 1.00 0.00 ? 264 GLY A C    4  
ATOM 6566  O O    . GLY A 1 86  ? -3.639  -5.607  -10.875 1.00 0.00 ? 264 GLY A O    4  
ATOM 6567  H H    . GLY A 1 86  ? -5.872  -3.339  -12.935 1.00 0.00 ? 264 GLY A H    4  
ATOM 6568  H HA2  . GLY A 1 86  ? -4.759  -6.022  -13.188 1.00 0.00 ? 264 GLY A HA2  4  
ATOM 6569  H HA3  . GLY A 1 86  ? -4.102  -4.551  -13.891 1.00 0.00 ? 264 GLY A HA3  4  
ATOM 6570  N N    . VAL A 1 87  ? -2.554  -4.004  -12.022 1.00 0.00 ? 265 VAL A N    4  
ATOM 6571  C CA   . VAL A 1 87  ? -1.525  -3.820  -11.005 1.00 0.00 ? 265 VAL A CA   4  
ATOM 6572  C C    . VAL A 1 87  ? -1.274  -2.340  -10.739 1.00 0.00 ? 265 VAL A C    4  
ATOM 6573  O O    . VAL A 1 87  ? -1.158  -1.542  -11.669 1.00 0.00 ? 265 VAL A O    4  
ATOM 6574  C CB   . VAL A 1 87  ? -0.201  -4.488  -11.420 1.00 0.00 ? 265 VAL A CB   4  
ATOM 6575  C CG1  . VAL A 1 87  ? 0.868   -4.255  -10.363 1.00 0.00 ? 265 VAL A CG1  4  
ATOM 6576  C CG2  . VAL A 1 87  ? -0.408  -5.975  -11.663 1.00 0.00 ? 265 VAL A CG2  4  
ATOM 6577  H H    . VAL A 1 87  ? -2.523  -3.460  -12.837 1.00 0.00 ? 265 VAL A H    4  
ATOM 6578  H HA   . VAL A 1 87  ? -1.869  -4.286  -10.094 1.00 0.00 ? 265 VAL A HA   4  
ATOM 6579  H HB   . VAL A 1 87  ? 0.133   -4.037  -12.343 1.00 0.00 ? 265 VAL A HB   4  
ATOM 6580  H HG11 . VAL A 1 87  ? 1.811   -4.649  -10.713 1.00 0.00 ? 265 VAL A HG11 4  
ATOM 6581  H HG12 . VAL A 1 87  ? 0.966   -3.196  -10.176 1.00 0.00 ? 265 VAL A HG12 4  
ATOM 6582  H HG13 . VAL A 1 87  ? 0.586   -4.758  -9.450  1.00 0.00 ? 265 VAL A HG13 4  
ATOM 6583  H HG21 . VAL A 1 87  ? -1.402  -6.141  -12.050 1.00 0.00 ? 265 VAL A HG21 4  
ATOM 6584  H HG22 . VAL A 1 87  ? 0.321   -6.329  -12.378 1.00 0.00 ? 265 VAL A HG22 4  
ATOM 6585  H HG23 . VAL A 1 87  ? -0.289  -6.512  -10.733 1.00 0.00 ? 265 VAL A HG23 4  
ATOM 6586  N N    . VAL A 1 88  ? -1.190  -1.980  -9.462  1.00 0.00 ? 266 VAL A N    4  
ATOM 6587  C CA   . VAL A 1 88  ? -0.950  -0.595  -9.073  1.00 0.00 ? 266 VAL A CA   4  
ATOM 6588  C C    . VAL A 1 88  ? 0.459   -0.415  -8.522  1.00 0.00 ? 266 VAL A C    4  
ATOM 6589  O O    . VAL A 1 88  ? 0.962   -1.264  -7.786  1.00 0.00 ? 266 VAL A O    4  
ATOM 6590  C CB   . VAL A 1 88  ? -1.967  -0.126  -8.015  1.00 0.00 ? 266 VAL A CB   4  
ATOM 6591  C CG1  . VAL A 1 88  ? -1.779  1.353   -7.713  1.00 0.00 ? 266 VAL A CG1  4  
ATOM 6592  C CG2  . VAL A 1 88  ? -3.388  -0.407  -8.481  1.00 0.00 ? 266 VAL A CG2  4  
ATOM 6593  H H    . VAL A 1 88  ? -1.291  -2.661  -8.766  1.00 0.00 ? 266 VAL A H    4  
ATOM 6594  H HA   . VAL A 1 88  ? -1.065  0.024   -9.951  1.00 0.00 ? 266 VAL A HA   4  
ATOM 6595  H HB   . VAL A 1 88  ? -1.792  -0.681  -7.106  1.00 0.00 ? 266 VAL A HB   4  
ATOM 6596  H HG11 . VAL A 1 88  ? -2.694  1.884   -7.934  1.00 0.00 ? 266 VAL A HG11 4  
ATOM 6597  H HG12 . VAL A 1 88  ? -1.531  1.479   -6.669  1.00 0.00 ? 266 VAL A HG12 4  
ATOM 6598  H HG13 . VAL A 1 88  ? -0.979  1.746   -8.323  1.00 0.00 ? 266 VAL A HG13 4  
ATOM 6599  H HG21 . VAL A 1 88  ? -3.816  0.495   -8.891  1.00 0.00 ? 266 VAL A HG21 4  
ATOM 6600  H HG22 . VAL A 1 88  ? -3.373  -1.176  -9.240  1.00 0.00 ? 266 VAL A HG22 4  
ATOM 6601  H HG23 . VAL A 1 88  ? -3.982  -0.740  -7.643  1.00 0.00 ? 266 VAL A HG23 4  
ATOM 6602  N N    . SER A 1 89  ? 1.093   0.696   -8.882  1.00 0.00 ? 267 SER A N    4  
ATOM 6603  C CA   . SER A 1 89  ? 2.447   0.986   -8.426  1.00 0.00 ? 267 SER A CA   4  
ATOM 6604  C C    . SER A 1 89  ? 2.427   1.951   -7.244  1.00 0.00 ? 267 SER A C    4  
ATOM 6605  O O    . SER A 1 89  ? 1.982   3.093   -7.367  1.00 0.00 ? 267 SER A O    4  
ATOM 6606  C CB   . SER A 1 89  ? 3.276   1.578   -9.568  1.00 0.00 ? 267 SER A CB   4  
ATOM 6607  O OG   . SER A 1 89  ? 3.812   0.557   -10.392 1.00 0.00 ? 267 SER A OG   4  
ATOM 6608  H H    . SER A 1 89  ? 0.639   1.335   -9.471  1.00 0.00 ? 267 SER A H    4  
ATOM 6609  H HA   . SER A 1 89  ? 2.897   0.057   -8.110  1.00 0.00 ? 267 SER A HA   4  
ATOM 6610  H HB2  . SER A 1 89  ? 2.650   2.218   -10.170 1.00 0.00 ? 267 SER A HB2  4  
ATOM 6611  H HB3  . SER A 1 89  ? 4.091   2.156   -9.155  1.00 0.00 ? 267 SER A HB3  4  
ATOM 6612  H HG   . SER A 1 89  ? 3.239   0.424   -11.150 1.00 0.00 ? 267 SER A HG   4  
ATOM 6613  N N    . LEU A 1 90  ? 2.913   1.483   -6.099  1.00 0.00 ? 268 LEU A N    4  
ATOM 6614  C CA   . LEU A 1 90  ? 2.952   2.303   -4.893  1.00 0.00 ? 268 LEU A CA   4  
ATOM 6615  C C    . LEU A 1 90  ? 4.388   2.659   -4.524  1.00 0.00 ? 268 LEU A C    4  
ATOM 6616  O O    . LEU A 1 90  ? 5.330   1.973   -4.919  1.00 0.00 ? 268 LEU A O    4  
ATOM 6617  C CB   . LEU A 1 90  ? 2.282   1.567   -3.731  1.00 0.00 ? 268 LEU A CB   4  
ATOM 6618  C CG   . LEU A 1 90  ? 0.753   1.596   -3.711  1.00 0.00 ? 268 LEU A CG   4  
ATOM 6619  C CD1  . LEU A 1 90  ? 0.206   0.402   -2.945  1.00 0.00 ? 268 LEU A CD1  4  
ATOM 6620  C CD2  . LEU A 1 90  ? 0.253   2.898   -3.100  1.00 0.00 ? 268 LEU A CD2  4  
ATOM 6621  H H    . LEU A 1 90  ? 3.253   0.565   -6.063  1.00 0.00 ? 268 LEU A H    4  
ATOM 6622  H HA   . LEU A 1 90  ? 2.407   3.213   -5.094  1.00 0.00 ? 268 LEU A HA   4  
ATOM 6623  H HB2  . LEU A 1 90  ? 2.592   0.534   -3.771  1.00 0.00 ? 268 LEU A HB2  4  
ATOM 6624  H HB3  . LEU A 1 90  ? 2.635   2.012   -2.812  1.00 0.00 ? 268 LEU A HB3  4  
ATOM 6625  H HG   . LEU A 1 90  ? 0.384   1.539   -4.726  1.00 0.00 ? 268 LEU A HG   4  
ATOM 6626  H HD11 . LEU A 1 90  ? -0.840  0.558   -2.733  1.00 0.00 ? 268 LEU A HD11 4  
ATOM 6627  H HD12 . LEU A 1 90  ? 0.749   0.290   -2.018  1.00 0.00 ? 268 LEU A HD12 4  
ATOM 6628  H HD13 . LEU A 1 90  ? 0.325   -0.492  -3.540  1.00 0.00 ? 268 LEU A HD13 4  
ATOM 6629  H HD21 . LEU A 1 90  ? 1.050   3.626   -3.105  1.00 0.00 ? 268 LEU A HD21 4  
ATOM 6630  H HD22 . LEU A 1 90  ? -0.066  2.719   -2.084  1.00 0.00 ? 268 LEU A HD22 4  
ATOM 6631  H HD23 . LEU A 1 90  ? -0.580  3.270   -3.679  1.00 0.00 ? 268 LEU A HD23 4  
ATOM 6632  N N    . SER A 1 91  ? 4.547   3.737   -3.761  1.00 0.00 ? 269 SER A N    4  
ATOM 6633  C CA   . SER A 1 91  ? 5.869   4.186   -3.339  1.00 0.00 ? 269 SER A CA   4  
ATOM 6634  C C    . SER A 1 91  ? 5.803   4.858   -1.971  1.00 0.00 ? 269 SER A C    4  
ATOM 6635  O O    . SER A 1 91  ? 4.851   5.576   -1.664  1.00 0.00 ? 269 SER A O    4  
ATOM 6636  C CB   . SER A 1 91  ? 6.454   5.155   -4.368  1.00 0.00 ? 269 SER A CB   4  
ATOM 6637  O OG   . SER A 1 91  ? 6.305   4.652   -5.685  1.00 0.00 ? 269 SER A OG   4  
ATOM 6638  H H    . SER A 1 91  ? 3.757   4.243   -3.479  1.00 0.00 ? 269 SER A H    4  
ATOM 6639  H HA   . SER A 1 91  ? 6.507   3.318   -3.271  1.00 0.00 ? 269 SER A HA   4  
ATOM 6640  H HB2  . SER A 1 91  ? 5.942   6.103   -4.298  1.00 0.00 ? 269 SER A HB2  4  
ATOM 6641  H HB3  . SER A 1 91  ? 7.506   5.298   -4.167  1.00 0.00 ? 269 SER A HB3  4  
ATOM 6642  H HG   . SER A 1 91  ? 5.382   4.441   -5.845  1.00 0.00 ? 269 SER A HG   4  
ATOM 6643  N N    . VAL A 1 92  ? 6.822   4.619   -1.152  1.00 0.00 ? 270 VAL A N    4  
ATOM 6644  C CA   . VAL A 1 92  ? 6.881   5.200   0.184   1.00 0.00 ? 270 VAL A CA   4  
ATOM 6645  C C    . VAL A 1 92  ? 7.248   6.679   0.123   1.00 0.00 ? 270 VAL A C    4  
ATOM 6646  O O    . VAL A 1 92  ? 8.076   7.091   -0.687  1.00 0.00 ? 270 VAL A O    4  
ATOM 6647  C CB   . VAL A 1 92  ? 7.904   4.465   1.071   1.00 0.00 ? 270 VAL A CB   4  
ATOM 6648  C CG1  . VAL A 1 92  ? 7.851   4.993   2.497   1.00 0.00 ? 270 VAL A CG1  4  
ATOM 6649  C CG2  . VAL A 1 92  ? 7.655   2.965   1.039   1.00 0.00 ? 270 VAL A CG2  4  
ATOM 6650  H H    . VAL A 1 92  ? 7.551   4.038   -1.453  1.00 0.00 ? 270 VAL A H    4  
ATOM 6651  H HA   . VAL A 1 92  ? 5.905   5.099   0.636   1.00 0.00 ? 270 VAL A HA   4  
ATOM 6652  H HB   . VAL A 1 92  ? 8.892   4.653   0.678   1.00 0.00 ? 270 VAL A HB   4  
ATOM 6653  H HG11 . VAL A 1 92  ? 7.030   4.527   3.022   1.00 0.00 ? 270 VAL A HG11 4  
ATOM 6654  H HG12 . VAL A 1 92  ? 8.779   4.765   3.000   1.00 0.00 ? 270 VAL A HG12 4  
ATOM 6655  H HG13 . VAL A 1 92  ? 7.704   6.063   2.479   1.00 0.00 ? 270 VAL A HG13 4  
ATOM 6656  H HG21 . VAL A 1 92  ? 7.137   2.668   1.939   1.00 0.00 ? 270 VAL A HG21 4  
ATOM 6657  H HG22 . VAL A 1 92  ? 7.050   2.718   0.178   1.00 0.00 ? 270 VAL A HG22 4  
ATOM 6658  H HG23 . VAL A 1 92  ? 8.598   2.444   0.977   1.00 0.00 ? 270 VAL A HG23 4  
ATOM 6659  N N    . GLY A 1 93  ? 6.624   7.474   0.988   1.00 0.00 ? 271 GLY A N    4  
ATOM 6660  C CA   . GLY A 1 93  ? 6.898   8.899   1.016   1.00 0.00 ? 271 GLY A CA   4  
ATOM 6661  C C    . GLY A 1 93  ? 6.941   9.452   2.427   1.00 0.00 ? 271 GLY A C    4  
ATOM 6662  O O    . GLY A 1 93  ? 5.907   9.584   3.082   1.00 0.00 ? 271 GLY A O    4  
ATOM 6663  H H    . GLY A 1 93  ? 5.972   7.089   1.611   1.00 0.00 ? 271 GLY A H    4  
ATOM 6664  H HA2  . GLY A 1 93  ? 7.849   9.081   0.540   1.00 0.00 ? 271 GLY A HA2  4  
ATOM 6665  H HA3  . GLY A 1 93  ? 6.125   9.413   0.464   1.00 0.00 ? 271 GLY A HA3  4  
ATOM 6666  N N    . HIS A 1 94  ? 8.141   9.776   2.897   1.00 0.00 ? 272 HIS A N    4  
ATOM 6667  C CA   . HIS A 1 94  ? 8.316   10.318  4.240   1.00 0.00 ? 272 HIS A CA   4  
ATOM 6668  C C    . HIS A 1 94  ? 7.158   11.240  4.608   1.00 0.00 ? 272 HIS A C    4  
ATOM 6669  O O    . HIS A 1 94  ? 6.448   11.001  5.585   1.00 0.00 ? 272 HIS A O    4  
ATOM 6670  C CB   . HIS A 1 94  ? 9.639   11.077  4.339   1.00 0.00 ? 272 HIS A CB   4  
ATOM 6671  C CG   . HIS A 1 94  ? 9.965   11.875  3.114   1.00 0.00 ? 272 HIS A CG   4  
ATOM 6672  N ND1  . HIS A 1 94  ? 10.427  11.307  1.946   1.00 0.00 ? 272 HIS A ND1  4  
ATOM 6673  C CD2  . HIS A 1 94  ? 9.890   13.206  2.879   1.00 0.00 ? 272 HIS A CD2  4  
ATOM 6674  C CE1  . HIS A 1 94  ? 10.625  12.254  1.046   1.00 0.00 ? 272 HIS A CE1  4  
ATOM 6675  N NE2  . HIS A 1 94  ? 10.306  13.416  1.587   1.00 0.00 ? 272 HIS A NE2  4  
ATOM 6676  H H    . HIS A 1 94  ? 8.928   9.648   2.327   1.00 0.00 ? 272 HIS A H    4  
ATOM 6677  H HA   . HIS A 1 94  ? 8.334   9.490   4.932   1.00 0.00 ? 272 HIS A HA   4  
ATOM 6678  H HB2  . HIS A 1 94  ? 9.594   11.758  5.176   1.00 0.00 ? 272 HIS A HB2  4  
ATOM 6679  H HB3  . HIS A 1 94  ? 10.441  10.371  4.498   1.00 0.00 ? 272 HIS A HB3  4  
ATOM 6680  H HD1  . HIS A 1 94  ? 10.588  10.352  1.799   1.00 0.00 ? 272 HIS A HD1  4  
ATOM 6681  H HD2  . HIS A 1 94  ? 9.564   13.964  3.578   1.00 0.00 ? 272 HIS A HD2  4  
ATOM 6682  H HE1  . HIS A 1 94  ? 10.985  12.104  0.040   1.00 0.00 ? 272 HIS A HE1  4  
ATOM 6683  H HE2  . HIS A 1 94  ? 10.440  14.290  1.166   1.00 0.00 ? 272 HIS A HE2  4  
ATOM 6684  N N    . SER A 1 95  ? 6.974   12.295  3.821   1.00 0.00 ? 273 SER A N    4  
ATOM 6685  C CA   . SER A 1 95  ? 5.905   13.256  4.067   1.00 0.00 ? 273 SER A CA   4  
ATOM 6686  C C    . SER A 1 95  ? 5.783   14.241  2.908   1.00 0.00 ? 273 SER A C    4  
ATOM 6687  O O    . SER A 1 95  ? 6.727   14.967  2.595   1.00 0.00 ? 273 SER A O    4  
ATOM 6688  C CB   . SER A 1 95  ? 6.162   14.014  5.371   1.00 0.00 ? 273 SER A CB   4  
ATOM 6689  O OG   . SER A 1 95  ? 5.079   14.873  5.683   1.00 0.00 ? 273 SER A OG   4  
ATOM 6690  H H    . SER A 1 95  ? 7.574   12.431  3.057   1.00 0.00 ? 273 SER A H    4  
ATOM 6691  H HA   . SER A 1 95  ? 4.980   12.707  4.156   1.00 0.00 ? 273 SER A HA   4  
ATOM 6692  H HB2  . SER A 1 95  ? 6.289   13.306  6.176   1.00 0.00 ? 273 SER A HB2  4  
ATOM 6693  H HB3  . SER A 1 95  ? 7.059   14.607  5.268   1.00 0.00 ? 273 SER A HB3  4  
ATOM 6694  H HG   . SER A 1 95  ? 5.366   15.786  5.620   1.00 0.00 ? 273 SER A HG   4  
ATOM 6695  N N    . GLU A 1 96  ? 4.614   14.260  2.276   1.00 0.00 ? 274 GLU A N    4  
ATOM 6696  C CA   . GLU A 1 96  ? 4.368   15.156  1.152   1.00 0.00 ? 274 GLU A CA   4  
ATOM 6697  C C    . GLU A 1 96  ? 3.694   16.443  1.618   1.00 0.00 ? 274 GLU A C    4  
ATOM 6698  O O    . GLU A 1 96  ? 2.474   16.584  1.531   1.00 0.00 ? 274 GLU A O    4  
ATOM 6699  C CB   . GLU A 1 96  ? 3.499   14.464  0.100   1.00 0.00 ? 274 GLU A CB   4  
ATOM 6700  C CG   . GLU A 1 96  ? 4.279   13.548  -0.828  1.00 0.00 ? 274 GLU A CG   4  
ATOM 6701  C CD   . GLU A 1 96  ? 5.386   14.273  -1.568  1.00 0.00 ? 274 GLU A CD   4  
ATOM 6702  O OE1  . GLU A 1 96  ? 5.228   15.483  -1.833  1.00 0.00 ? 274 GLU A OE1  4  
ATOM 6703  O OE2  . GLU A 1 96  ? 6.410   13.631  -1.882  1.00 0.00 ? 274 GLU A OE2  4  
ATOM 6704  H H    . GLU A 1 96  ? 3.900   13.658  2.572   1.00 0.00 ? 274 GLU A H    4  
ATOM 6705  H HA   . GLU A 1 96  ? 5.322   15.403  0.711   1.00 0.00 ? 274 GLU A HA   4  
ATOM 6706  H HB2  . GLU A 1 96  ? 2.746   13.875  0.604   1.00 0.00 ? 274 GLU A HB2  4  
ATOM 6707  H HB3  . GLU A 1 96  ? 3.012   15.218  -0.499  1.00 0.00 ? 274 GLU A HB3  4  
ATOM 6708  H HG2  . GLU A 1 96  ? 4.719   12.754  -0.243  1.00 0.00 ? 274 GLU A HG2  4  
ATOM 6709  H HG3  . GLU A 1 96  ? 3.598   13.125  -1.552  1.00 0.00 ? 274 GLU A HG3  4  
ATOM 6710  N N    . VAL A 1 97  ? 4.497   17.379  2.115   1.00 0.00 ? 275 VAL A N    4  
ATOM 6711  C CA   . VAL A 1 97  ? 3.979   18.654  2.595   1.00 0.00 ? 275 VAL A CA   4  
ATOM 6712  C C    . VAL A 1 97  ? 3.752   19.624  1.441   1.00 0.00 ? 275 VAL A C    4  
ATOM 6713  O O    . VAL A 1 97  ? 2.786   20.387  1.439   1.00 0.00 ? 275 VAL A O    4  
ATOM 6714  C CB   . VAL A 1 97  ? 4.936   19.301  3.614   1.00 0.00 ? 275 VAL A CB   4  
ATOM 6715  C CG1  . VAL A 1 97  ? 6.247   19.686  2.945   1.00 0.00 ? 275 VAL A CG1  4  
ATOM 6716  C CG2  . VAL A 1 97  ? 4.283   20.511  4.264   1.00 0.00 ? 275 VAL A CG2  4  
ATOM 6717  H H    . VAL A 1 97  ? 5.461   17.207  2.158   1.00 0.00 ? 275 VAL A H    4  
ATOM 6718  H HA   . VAL A 1 97  ? 3.036   18.468  3.087   1.00 0.00 ? 275 VAL A HA   4  
ATOM 6719  H HB   . VAL A 1 97  ? 5.151   18.576  4.386   1.00 0.00 ? 275 VAL A HB   4  
ATOM 6720  H HG11 . VAL A 1 97  ? 7.014   19.800  3.697   1.00 0.00 ? 275 VAL A HG11 4  
ATOM 6721  H HG12 . VAL A 1 97  ? 6.537   18.914  2.247   1.00 0.00 ? 275 VAL A HG12 4  
ATOM 6722  H HG13 . VAL A 1 97  ? 6.121   20.620  2.418   1.00 0.00 ? 275 VAL A HG13 4  
ATOM 6723  H HG21 . VAL A 1 97  ? 5.021   21.051  4.839   1.00 0.00 ? 275 VAL A HG21 4  
ATOM 6724  H HG22 . VAL A 1 97  ? 3.880   21.158  3.498   1.00 0.00 ? 275 VAL A HG22 4  
ATOM 6725  H HG23 . VAL A 1 97  ? 3.487   20.184  4.915   1.00 0.00 ? 275 VAL A HG23 4  
ATOM 6726  N N    . SER A 1 98  ? 4.649   19.589  0.460   1.00 0.00 ? 276 SER A N    4  
ATOM 6727  C CA   . SER A 1 98  ? 4.549   20.468  -0.699  1.00 0.00 ? 276 SER A CA   4  
ATOM 6728  C C    . SER A 1 98  ? 3.952   19.728  -1.892  1.00 0.00 ? 276 SER A C    4  
ATOM 6729  O O    . SER A 1 98  ? 4.462   18.689  -2.313  1.00 0.00 ? 276 SER A O    4  
ATOM 6730  C CB   . SER A 1 98  ? 5.927   21.022  -1.066  1.00 0.00 ? 276 SER A CB   4  
ATOM 6731  O OG   . SER A 1 98  ? 6.823   19.978  -1.404  1.00 0.00 ? 276 SER A OG   4  
ATOM 6732  H H    . SER A 1 98  ? 5.397   18.959  0.520   1.00 0.00 ? 276 SER A H    4  
ATOM 6733  H HA   . SER A 1 98  ? 3.898   21.289  -0.437  1.00 0.00 ? 276 SER A HA   4  
ATOM 6734  H HB2  . SER A 1 98  ? 5.831   21.686  -1.912  1.00 0.00 ? 276 SER A HB2  4  
ATOM 6735  H HB3  . SER A 1 98  ? 6.328   21.567  -0.224  1.00 0.00 ? 276 SER A HB3  4  
ATOM 6736  H HG   . SER A 1 98  ? 7.523   20.325  -1.962  1.00 0.00 ? 276 SER A HG   4  
ATOM 6737  N N    . THR A 1 99  ? 2.865   20.270  -2.433  1.00 0.00 ? 277 THR A N    4  
ATOM 6738  C CA   . THR A 1 99  ? 2.196   19.662  -3.577  1.00 0.00 ? 277 THR A CA   4  
ATOM 6739  C C    . THR A 1 99  ? 1.959   20.685  -4.682  1.00 0.00 ? 277 THR A C    4  
ATOM 6740  O O    . THR A 1 99  ? 0.939   20.644  -5.369  1.00 0.00 ? 277 THR A O    4  
ATOM 6741  C CB   . THR A 1 99  ? 0.847   19.038  -3.172  1.00 0.00 ? 277 THR A CB   4  
ATOM 6742  O OG1  . THR A 1 99  ? 0.029   20.019  -2.524  1.00 0.00 ? 277 THR A OG1  4  
ATOM 6743  C CG2  . THR A 1 99  ? 1.057   17.852  -2.244  1.00 0.00 ? 277 THR A CG2  4  
ATOM 6744  H H    . THR A 1 99  ? 2.506   21.099  -2.053  1.00 0.00 ? 277 THR A H    4  
ATOM 6745  H HA   . THR A 1 99  ? 2.833   18.877  -3.957  1.00 0.00 ? 277 THR A HA   4  
ATOM 6746  H HB   . THR A 1 99  ? 0.345   18.694  -4.065  1.00 0.00 ? 277 THR A HB   4  
ATOM 6747  H HG1  . THR A 1 99  ? -0.854  19.998  -2.901  1.00 0.00 ? 277 THR A HG1  4  
ATOM 6748  H HG21 . THR A 1 99  ? 1.809   18.098  -1.508  1.00 0.00 ? 277 THR A HG21 4  
ATOM 6749  H HG22 . THR A 1 99  ? 1.382   16.998  -2.819  1.00 0.00 ? 277 THR A HG22 4  
ATOM 6750  H HG23 . THR A 1 99  ? 0.129   17.617  -1.744  1.00 0.00 ? 277 THR A HG23 4  
ATOM 6751  N N    . ALA A 1 100 ? 2.908   21.600  -4.849  1.00 0.00 ? 278 ALA A N    4  
ATOM 6752  C CA   . ALA A 1 100 ? 2.803   22.631  -5.874  1.00 0.00 ? 278 ALA A CA   4  
ATOM 6753  C C    . ALA A 1 100 ? 4.109   23.406  -6.009  1.00 0.00 ? 278 ALA A C    4  
ATOM 6754  O O    . ALA A 1 100 ? 5.015   23.262  -5.187  1.00 0.00 ? 278 ALA A O    4  
ATOM 6755  C CB   . ALA A 1 100 ? 1.656   23.578  -5.554  1.00 0.00 ? 278 ALA A CB   4  
ATOM 6756  H H    . ALA A 1 100 ? 3.698   21.580  -4.271  1.00 0.00 ? 278 ALA A H    4  
ATOM 6757  H HA   . ALA A 1 100 ? 2.585   22.146  -6.815  1.00 0.00 ? 278 ALA A HA   4  
ATOM 6758  H HB1  . ALA A 1 100 ? 1.497   23.601  -4.486  1.00 0.00 ? 278 ALA A HB1  4  
ATOM 6759  H HB2  . ALA A 1 100 ? 1.900   24.570  -5.904  1.00 0.00 ? 278 ALA A HB2  4  
ATOM 6760  H HB3  . ALA A 1 100 ? 0.758   23.234  -6.044  1.00 0.00 ? 278 ALA A HB3  4  
ATOM 6761  N N    . ILE A 1 101 ? 4.200   24.227  -7.049  1.00 0.00 ? 279 ILE A N    4  
ATOM 6762  C CA   . ILE A 1 101 ? 5.396   25.025  -7.291  1.00 0.00 ? 279 ILE A CA   4  
ATOM 6763  C C    . ILE A 1 101 ? 5.471   26.207  -6.330  1.00 0.00 ? 279 ILE A C    4  
ATOM 6764  O O    . ILE A 1 101 ? 4.448   26.762  -5.931  1.00 0.00 ? 279 ILE A O    4  
ATOM 6765  C CB   . ILE A 1 101 ? 5.440   25.550  -8.738  1.00 0.00 ? 279 ILE A CB   4  
ATOM 6766  C CG1  . ILE A 1 101 ? 5.497   24.383  -9.726  1.00 0.00 ? 279 ILE A CG1  4  
ATOM 6767  C CG2  . ILE A 1 101 ? 6.633   26.474  -8.930  1.00 0.00 ? 279 ILE A CG2  4  
ATOM 6768  C CD1  . ILE A 1 101 ? 4.169   23.684  -9.912  1.00 0.00 ? 279 ILE A CD1  4  
ATOM 6769  H H    . ILE A 1 101 ? 3.444   24.299  -7.669  1.00 0.00 ? 279 ILE A H    4  
ATOM 6770  H HA   . ILE A 1 101 ? 6.256   24.391  -7.133  1.00 0.00 ? 279 ILE A HA   4  
ATOM 6771  H HB   . ILE A 1 101 ? 4.541   26.121  -8.917  1.00 0.00 ? 279 ILE A HB   4  
ATOM 6772  H HG12 . ILE A 1 101 ? 5.817   24.750  -10.688 1.00 0.00 ? 279 ILE A HG12 4  
ATOM 6773  H HG13 . ILE A 1 101 ? 6.210   23.654  -9.368  1.00 0.00 ? 279 ILE A HG13 4  
ATOM 6774  H HG21 . ILE A 1 101 ? 6.425   27.431  -8.476  1.00 0.00 ? 279 ILE A HG21 4  
ATOM 6775  H HG22 . ILE A 1 101 ? 7.504   26.038  -8.464  1.00 0.00 ? 279 ILE A HG22 4  
ATOM 6776  H HG23 . ILE A 1 101 ? 6.819   26.608  -9.985  1.00 0.00 ? 279 ILE A HG23 4  
ATOM 6777  H HD11 . ILE A 1 101 ? 3.365   24.383  -9.737  1.00 0.00 ? 279 ILE A HD11 4  
ATOM 6778  H HD12 . ILE A 1 101 ? 4.102   23.301  -10.919 1.00 0.00 ? 279 ILE A HD12 4  
ATOM 6779  H HD13 . ILE A 1 101 ? 4.092   22.865  -9.211  1.00 0.00 ? 279 ILE A HD13 4  
ATOM 6780  N N    . ALA A 1 102 ? 6.690   26.589  -5.965  1.00 0.00 ? 280 ALA A N    4  
ATOM 6781  C CA   . ALA A 1 102 ? 6.900   27.707  -5.054  1.00 0.00 ? 280 ALA A CA   4  
ATOM 6782  C C    . ALA A 1 102 ? 6.278   28.987  -5.604  1.00 0.00 ? 280 ALA A C    4  
ATOM 6783  O O    . ALA A 1 102 ? 6.891   29.694  -6.405  1.00 0.00 ? 280 ALA A O    4  
ATOM 6784  C CB   . ALA A 1 102 ? 8.386   27.909  -4.799  1.00 0.00 ? 280 ALA A CB   4  
ATOM 6785  H H    . ALA A 1 102 ? 7.468   26.107  -6.317  1.00 0.00 ? 280 ALA A H    4  
ATOM 6786  H HA   . ALA A 1 102 ? 6.428   27.465  -4.113  1.00 0.00 ? 280 ALA A HA   4  
ATOM 6787  H HB1  . ALA A 1 102 ? 8.572   28.945  -4.554  1.00 0.00 ? 280 ALA A HB1  4  
ATOM 6788  H HB2  . ALA A 1 102 ? 8.698   27.283  -3.976  1.00 0.00 ? 280 ALA A HB2  4  
ATOM 6789  H HB3  . ALA A 1 102 ? 8.943   27.643  -5.685  1.00 0.00 ? 280 ALA A HB3  4  
ATOM 6790  N N    . THR A 1 103 ? 5.056   29.279  -5.169  1.00 0.00 ? 281 THR A N    4  
ATOM 6791  C CA   . THR A 1 103 ? 4.350   30.472  -5.619  1.00 0.00 ? 281 THR A CA   4  
ATOM 6792  C C    . THR A 1 103 ? 3.153   30.773  -4.724  1.00 0.00 ? 281 THR A C    4  
ATOM 6793  O O    . THR A 1 103 ? 2.638   29.887  -4.044  1.00 0.00 ? 281 THR A O    4  
ATOM 6794  C CB   . THR A 1 103 ? 3.864   30.322  -7.073  1.00 0.00 ? 281 THR A CB   4  
ATOM 6795  O OG1  . THR A 1 103 ? 3.349   31.571  -7.549  1.00 0.00 ? 281 THR A OG1  4  
ATOM 6796  C CG2  . THR A 1 103 ? 2.787   29.252  -7.177  1.00 0.00 ? 281 THR A CG2  4  
ATOM 6797  H H    . THR A 1 103 ? 4.620   28.677  -4.532  1.00 0.00 ? 281 THR A H    4  
ATOM 6798  H HA   . THR A 1 103 ? 5.038   31.303  -5.576  1.00 0.00 ? 281 THR A HA   4  
ATOM 6799  H HB   . THR A 1 103 ? 4.702   30.029  -7.689  1.00 0.00 ? 281 THR A HB   4  
ATOM 6800  H HG1  . THR A 1 103 ? 3.601   31.692  -8.468  1.00 0.00 ? 281 THR A HG1  4  
ATOM 6801  H HG21 . THR A 1 103 ? 3.035   28.569  -7.975  1.00 0.00 ? 281 THR A HG21 4  
ATOM 6802  H HG22 . THR A 1 103 ? 1.835   29.718  -7.383  1.00 0.00 ? 281 THR A HG22 4  
ATOM 6803  H HG23 . THR A 1 103 ? 2.729   28.710  -6.245  1.00 0.00 ? 281 THR A HG23 4  
ATOM 6804  N N    . GLU A 1 104 ? 2.717   32.029  -4.731  1.00 0.00 ? 282 GLU A N    4  
ATOM 6805  C CA   . GLU A 1 104 ? 1.580   32.446  -3.918  1.00 0.00 ? 282 GLU A CA   4  
ATOM 6806  C C    . GLU A 1 104 ? 0.342   31.617  -4.248  1.00 0.00 ? 282 GLU A C    4  
ATOM 6807  O O    . GLU A 1 104 ? 0.378   30.752  -5.122  1.00 0.00 ? 282 GLU A O    4  
ATOM 6808  C CB   . GLU A 1 104 ? 1.286   33.931  -4.137  1.00 0.00 ? 282 GLU A CB   4  
ATOM 6809  C CG   . GLU A 1 104 ? 2.174   34.855  -3.319  1.00 0.00 ? 282 GLU A CG   4  
ATOM 6810  C CD   . GLU A 1 104 ? 3.632   34.439  -3.349  1.00 0.00 ? 282 GLU A CD   4  
ATOM 6811  O OE1  . GLU A 1 104 ? 4.167   34.228  -4.457  1.00 0.00 ? 282 GLU A OE1  4  
ATOM 6812  O OE2  . GLU A 1 104 ? 4.237   34.325  -2.262  1.00 0.00 ? 282 GLU A OE2  4  
ATOM 6813  H H    . GLU A 1 104 ? 3.170   32.690  -5.294  1.00 0.00 ? 282 GLU A H    4  
ATOM 6814  H HA   . GLU A 1 104 ? 1.838   32.289  -2.881  1.00 0.00 ? 282 GLU A HA   4  
ATOM 6815  H HB2  . GLU A 1 104 ? 1.425   34.164  -5.182  1.00 0.00 ? 282 GLU A HB2  4  
ATOM 6816  H HB3  . GLU A 1 104 ? 0.258   34.125  -3.869  1.00 0.00 ? 282 GLU A HB3  4  
ATOM 6817  H HG2  . GLU A 1 104 ? 2.093   35.856  -3.717  1.00 0.00 ? 282 GLU A HG2  4  
ATOM 6818  H HG3  . GLU A 1 104 ? 1.833   34.847  -2.295  1.00 0.00 ? 282 GLU A HG3  4  
ATOM 6819  N N    . GLN A 1 105 ? -0.750  31.888  -3.540  1.00 0.00 ? 283 GLN A N    4  
ATOM 6820  C CA   . GLN A 1 105 ? -1.998  31.166  -3.757  1.00 0.00 ? 283 GLN A CA   4  
ATOM 6821  C C    . GLN A 1 105 ? -3.166  32.134  -3.918  1.00 0.00 ? 283 GLN A C    4  
ATOM 6822  O O    . GLN A 1 105 ? -3.150  33.236  -3.369  1.00 0.00 ? 283 GLN A O    4  
ATOM 6823  C CB   . GLN A 1 105 ? -2.269  30.212  -2.592  1.00 0.00 ? 283 GLN A CB   4  
ATOM 6824  C CG   . GLN A 1 105 ? -1.611  28.851  -2.756  1.00 0.00 ? 283 GLN A CG   4  
ATOM 6825  C CD   . GLN A 1 105 ? -2.110  27.837  -1.746  1.00 0.00 ? 283 GLN A CD   4  
ATOM 6826  O OE1  . GLN A 1 105 ? -3.288  27.481  -1.736  1.00 0.00 ? 283 GLN A OE1  4  
ATOM 6827  N NE2  . GLN A 1 105 ? -1.212  27.364  -0.888  1.00 0.00 ? 283 GLN A NE2  4  
ATOM 6828  H H    . GLN A 1 105 ? -0.715  32.589  -2.857  1.00 0.00 ? 283 GLN A H    4  
ATOM 6829  H HA   . GLN A 1 105 ? -1.895  30.592  -4.665  1.00 0.00 ? 283 GLN A HA   4  
ATOM 6830  H HB2  . GLN A 1 105 ? -1.899  30.660  -1.682  1.00 0.00 ? 283 GLN A HB2  4  
ATOM 6831  H HB3  . GLN A 1 105 ? -3.335  30.064  -2.504  1.00 0.00 ? 283 GLN A HB3  4  
ATOM 6832  H HG2  . GLN A 1 105 ? -1.821  28.480  -3.748  1.00 0.00 ? 283 GLN A HG2  4  
ATOM 6833  H HG3  . GLN A 1 105 ? -0.544  28.965  -2.634  1.00 0.00 ? 283 GLN A HG3  4  
ATOM 6834  H HE21 . GLN A 1 105 ? -0.291  27.694  -0.954  1.00 0.00 ? 283 GLN A HE21 4  
ATOM 6835  H HE22 . GLN A 1 105 ? -1.508  26.708  -0.224  1.00 0.00 ? 283 GLN A HE22 4  
ATOM 6836  N N    . GLN A 1 106 ? -4.175  31.715  -4.674  1.00 0.00 ? 284 GLN A N    4  
ATOM 6837  C CA   . GLN A 1 106 ? -5.350  32.547  -4.908  1.00 0.00 ? 284 GLN A CA   4  
ATOM 6838  C C    . GLN A 1 106 ? -6.397  32.327  -3.821  1.00 0.00 ? 284 GLN A C    4  
ATOM 6839  O O    . GLN A 1 106 ? -7.277  31.477  -3.956  1.00 0.00 ? 284 GLN A O    4  
ATOM 6840  C CB   . GLN A 1 106 ? -5.951  32.242  -6.281  1.00 0.00 ? 284 GLN A CB   4  
ATOM 6841  C CG   . GLN A 1 106 ? -6.895  33.323  -6.785  1.00 0.00 ? 284 GLN A CG   4  
ATOM 6842  C CD   . GLN A 1 106 ? -6.177  34.409  -7.561  1.00 0.00 ? 284 GLN A CD   4  
ATOM 6843  O OE1  . GLN A 1 106 ? -4.958  34.555  -7.464  1.00 0.00 ? 284 GLN A OE1  4  
ATOM 6844  N NE2  . GLN A 1 106 ? -6.930  35.179  -8.338  1.00 0.00 ? 284 GLN A NE2  4  
ATOM 6845  H H    . GLN A 1 106 ? -4.129  30.827  -5.085  1.00 0.00 ? 284 GLN A H    4  
ATOM 6846  H HA   . GLN A 1 106 ? -5.036  33.579  -4.884  1.00 0.00 ? 284 GLN A HA   4  
ATOM 6847  H HB2  . GLN A 1 106 ? -5.149  32.133  -6.996  1.00 0.00 ? 284 GLN A HB2  4  
ATOM 6848  H HB3  . GLN A 1 106 ? -6.500  31.314  -6.223  1.00 0.00 ? 284 GLN A HB3  4  
ATOM 6849  H HG2  . GLN A 1 106 ? -7.631  32.867  -7.431  1.00 0.00 ? 284 GLN A HG2  4  
ATOM 6850  H HG3  . GLN A 1 106 ? -7.390  33.773  -5.938  1.00 0.00 ? 284 GLN A HG3  4  
ATOM 6851  H HE21 . GLN A 1 106 ? -7.895  35.005  -8.364  1.00 0.00 ? 284 GLN A HE21 4  
ATOM 6852  H HE22 . GLN A 1 106 ? -6.492  35.889  -8.850  1.00 0.00 ? 284 GLN A HE22 4  
ATOM 6853  N N    . SER A 1 107 ? -6.296  33.099  -2.744  1.00 0.00 ? 285 SER A N    4  
ATOM 6854  C CA   . SER A 1 107 ? -7.232  32.986  -1.632  1.00 0.00 ? 285 SER A CA   4  
ATOM 6855  C C    . SER A 1 107 ? -8.674  33.043  -2.127  1.00 0.00 ? 285 SER A C    4  
ATOM 6856  O O    . SER A 1 107 ? -8.929  33.331  -3.297  1.00 0.00 ? 285 SER A O    4  
ATOM 6857  C CB   . SER A 1 107 ? -6.986  34.102  -0.615  1.00 0.00 ? 285 SER A CB   4  
ATOM 6858  O OG   . SER A 1 107 ? -7.588  35.315  -1.032  1.00 0.00 ? 285 SER A OG   4  
ATOM 6859  H H    . SER A 1 107 ? -5.573  33.759  -2.695  1.00 0.00 ? 285 SER A H    4  
ATOM 6860  H HA   . SER A 1 107 ? -7.066  32.032  -1.154  1.00 0.00 ? 285 SER A HA   4  
ATOM 6861  H HB2  . SER A 1 107 ? -7.405  33.816  0.338   1.00 0.00 ? 285 SER A HB2  4  
ATOM 6862  H HB3  . SER A 1 107 ? -5.922  34.259  -0.508  1.00 0.00 ? 285 SER A HB3  4  
ATOM 6863  H HG   . SER A 1 107 ? -7.151  35.632  -1.826  1.00 0.00 ? 285 SER A HG   4  
ATOM 6864  N N    . TRP A 1 108 ? -9.613  32.767  -1.229  1.00 0.00 ? 286 TRP A N    4  
ATOM 6865  C CA   . TRP A 1 108 ? -11.030 32.786  -1.574  1.00 0.00 ? 286 TRP A CA   4  
ATOM 6866  C C    . TRP A 1 108 ? -11.407 34.099  -2.252  1.00 0.00 ? 286 TRP A C    4  
ATOM 6867  O O    . TRP A 1 108 ? -10.563 34.972  -2.446  1.00 0.00 ? 286 TRP A O    4  
ATOM 6868  C CB   . TRP A 1 108 ? -11.883 32.580  -0.322  1.00 0.00 ? 286 TRP A CB   4  
ATOM 6869  C CG   . TRP A 1 108 ? -11.524 31.344  0.445   1.00 0.00 ? 286 TRP A CG   4  
ATOM 6870  C CD1  . TRP A 1 108 ? -12.087 30.107  0.317   1.00 0.00 ? 286 TRP A CD1  4  
ATOM 6871  C CD2  . TRP A 1 108 ? -10.522 31.228  1.461   1.00 0.00 ? 286 TRP A CD2  4  
ATOM 6872  N NE1  . TRP A 1 108 ? -11.495 29.228  1.192   1.00 0.00 ? 286 TRP A NE1  4  
ATOM 6873  C CE2  . TRP A 1 108 ? -10.531 29.891  1.905   1.00 0.00 ? 286 TRP A CE2  4  
ATOM 6874  C CE3  . TRP A 1 108 ? -9.616  32.122  2.039   1.00 0.00 ? 286 TRP A CE3  4  
ATOM 6875  C CZ2  . TRP A 1 108 ? -9.671  29.430  2.898   1.00 0.00 ? 286 TRP A CZ2  4  
ATOM 6876  C CZ3  . TRP A 1 108 ? -8.763  31.663  3.024   1.00 0.00 ? 286 TRP A CZ3  4  
ATOM 6877  C CH2  . TRP A 1 108 ? -8.795  30.327  3.445   1.00 0.00 ? 286 TRP A CH2  4  
ATOM 6878  H H    . TRP A 1 108 ? -9.347  32.544  -0.312  1.00 0.00 ? 286 TRP A H    4  
ATOM 6879  H HA   . TRP A 1 108 ? -11.214 31.974  -2.262  1.00 0.00 ? 286 TRP A HA   4  
ATOM 6880  H HB2  . TRP A 1 108 ? -11.759 33.428  0.334   1.00 0.00 ? 286 TRP A HB2  4  
ATOM 6881  H HB3  . TRP A 1 108 ? -12.921 32.503  -0.612  1.00 0.00 ? 286 TRP A HB3  4  
ATOM 6882  H HD1  . TRP A 1 108 ? -12.881 29.869  -0.374  1.00 0.00 ? 286 TRP A HD1  4  
ATOM 6883  H HE1  . TRP A 1 108 ? -11.725 28.280  1.288   1.00 0.00 ? 286 TRP A HE1  4  
ATOM 6884  H HE3  . TRP A 1 108 ? -9.576  33.155  1.727   1.00 0.00 ? 286 TRP A HE3  4  
ATOM 6885  H HZ2  . TRP A 1 108 ? -9.683  28.403  3.233   1.00 0.00 ? 286 TRP A HZ2  4  
ATOM 6886  H HZ3  . TRP A 1 108 ? -8.057  32.340  3.482   1.00 0.00 ? 286 TRP A HZ3  4  
ATOM 6887  H HH2  . TRP A 1 108 ? -8.111  30.012  4.218   1.00 0.00 ? 286 TRP A HH2  4  
ATOM 6888  N N    . ASN A 1 109 ? -12.680 34.232  -2.608  1.00 0.00 ? 287 ASN A N    4  
ATOM 6889  C CA   . ASN A 1 109 ? -13.169 35.439  -3.264  1.00 0.00 ? 287 ASN A CA   4  
ATOM 6890  C C    . ASN A 1 109 ? -14.322 36.057  -2.479  1.00 0.00 ? 287 ASN A C    4  
ATOM 6891  O O    . ASN A 1 109 ? -14.693 35.567  -1.412  1.00 0.00 ? 287 ASN A O    4  
ATOM 6892  C CB   . ASN A 1 109 ? -13.621 35.122  -4.691  1.00 0.00 ? 287 ASN A CB   4  
ATOM 6893  C CG   . ASN A 1 109 ? -13.547 36.331  -5.603  1.00 0.00 ? 287 ASN A CG   4  
ATOM 6894  O OD1  . ASN A 1 109 ? -13.159 37.420  -5.179  1.00 0.00 ? 287 ASN A OD1  4  
ATOM 6895  N ND2  . ASN A 1 109 ? -13.919 36.144  -6.864  1.00 0.00 ? 287 ASN A ND2  4  
ATOM 6896  H H    . ASN A 1 109 ? -13.307 33.500  -2.426  1.00 0.00 ? 287 ASN A H    4  
ATOM 6897  H HA   . ASN A 1 109 ? -12.355 36.147  -3.303  1.00 0.00 ? 287 ASN A HA   4  
ATOM 6898  H HB2  . ASN A 1 109 ? -12.987 34.348  -5.099  1.00 0.00 ? 287 ASN A HB2  4  
ATOM 6899  H HB3  . ASN A 1 109 ? -14.642 34.772  -4.670  1.00 0.00 ? 287 ASN A HB3  4  
ATOM 6900  H HD21 . ASN A 1 109 ? -14.217 35.250  -7.132  1.00 0.00 ? 287 ASN A HD21 4  
ATOM 6901  H HD22 . ASN A 1 109 ? -13.880 36.909  -7.476  1.00 0.00 ? 287 ASN A HD22 4  
ATOM 6902  N N    . LEU A 1 110 ? -14.884 37.134  -3.014  1.00 0.00 ? 288 LEU A N    4  
ATOM 6903  C CA   . LEU A 1 110 ? -15.996 37.820  -2.364  1.00 0.00 ? 288 LEU A CA   4  
ATOM 6904  C C    . LEU A 1 110 ? -16.697 38.764  -3.336  1.00 0.00 ? 288 LEU A C    4  
ATOM 6905  O O    . LEU A 1 110 ? -16.081 39.682  -3.877  1.00 0.00 ? 288 LEU A O    4  
ATOM 6906  C CB   . LEU A 1 110 ? -15.499 38.600  -1.146  1.00 0.00 ? 288 LEU A CB   4  
ATOM 6907  C CG   . LEU A 1 110 ? -16.507 38.789  -0.013  1.00 0.00 ? 288 LEU A CG   4  
ATOM 6908  C CD1  . LEU A 1 110 ? -17.525 39.858  -0.377  1.00 0.00 ? 288 LEU A CD1  4  
ATOM 6909  C CD2  . LEU A 1 110 ? -17.204 37.474  0.307   1.00 0.00 ? 288 LEU A CD2  4  
ATOM 6910  H H    . LEU A 1 110 ? -14.545 37.478  -3.866  1.00 0.00 ? 288 LEU A H    4  
ATOM 6911  H HA   . LEU A 1 110 ? -16.702 37.070  -2.038  1.00 0.00 ? 288 LEU A HA   4  
ATOM 6912  H HB2  . LEU A 1 110 ? -14.645 38.076  -0.745  1.00 0.00 ? 288 LEU A HB2  4  
ATOM 6913  H HB3  . LEU A 1 110 ? -15.192 39.579  -1.485  1.00 0.00 ? 288 LEU A HB3  4  
ATOM 6914  H HG   . LEU A 1 110 ? -15.984 39.116  0.875   1.00 0.00 ? 288 LEU A HG   4  
ATOM 6915  H HD11 . LEU A 1 110 ? -17.875 39.694  -1.385  1.00 0.00 ? 288 LEU A HD11 4  
ATOM 6916  H HD12 . LEU A 1 110 ? -17.064 40.832  -0.310  1.00 0.00 ? 288 LEU A HD12 4  
ATOM 6917  H HD13 . LEU A 1 110 ? -18.360 39.808  0.307   1.00 0.00 ? 288 LEU A HD13 4  
ATOM 6918  H HD21 . LEU A 1 110 ? -18.098 37.386  -0.292  1.00 0.00 ? 288 LEU A HD21 4  
ATOM 6919  H HD22 . LEU A 1 110 ? -17.469 37.452  1.354   1.00 0.00 ? 288 LEU A HD22 4  
ATOM 6920  H HD23 . LEU A 1 110 ? -16.539 36.652  0.086   1.00 0.00 ? 288 LEU A HD23 4  
ATOM 6921  N N    . ASN A 1 111 ? -17.988 38.533  -3.551  1.00 0.00 ? 289 ASN A N    4  
ATOM 6922  C CA   . ASN A 1 111 ? -18.773 39.365  -4.456  1.00 0.00 ? 289 ASN A CA   4  
ATOM 6923  C C    . ASN A 1 111 ? -19.531 40.442  -3.686  1.00 0.00 ? 289 ASN A C    4  
ATOM 6924  O O    . ASN A 1 111 ? -20.322 40.139  -2.793  1.00 0.00 ? 289 ASN A O    4  
ATOM 6925  C CB   . ASN A 1 111 ? -19.755 38.503  -5.252  1.00 0.00 ? 289 ASN A CB   4  
ATOM 6926  C CG   . ASN A 1 111 ? -20.966 39.287  -5.718  1.00 0.00 ? 289 ASN A CG   4  
ATOM 6927  O OD1  . ASN A 1 111 ? -20.904 40.014  -6.711  1.00 0.00 ? 289 ASN A OD1  4  
ATOM 6928  N ND2  . ASN A 1 111 ? -22.075 39.145  -5.002  1.00 0.00 ? 289 ASN A ND2  4  
ATOM 6929  H H    . ASN A 1 111 ? -18.423 37.786  -3.090  1.00 0.00 ? 289 ASN A H    4  
ATOM 6930  H HA   . ASN A 1 111 ? -18.090 39.843  -5.142  1.00 0.00 ? 289 ASN A HA   4  
ATOM 6931  H HB2  . ASN A 1 111 ? -19.252 38.104  -6.121  1.00 0.00 ? 289 ASN A HB2  4  
ATOM 6932  H HB3  . ASN A 1 111 ? -20.094 37.688  -4.631  1.00 0.00 ? 289 ASN A HB3  4  
ATOM 6933  H HD21 . ASN A 1 111 ? -22.051 38.549  -4.224  1.00 0.00 ? 289 ASN A HD21 4  
ATOM 6934  H HD22 . ASN A 1 111 ? -22.873 39.640  -5.282  1.00 0.00 ? 289 ASN A HD22 4  
ATOM 6935  N N    . ASN A 1 112 ? -19.285 41.699  -4.039  1.00 0.00 ? 290 ASN A N    4  
ATOM 6936  C CA   . ASN A 1 112 ? -19.945 42.821  -3.381  1.00 0.00 ? 290 ASN A CA   4  
ATOM 6937  C C    . ASN A 1 112 ? -19.734 44.112  -4.167  1.00 0.00 ? 290 ASN A C    4  
ATOM 6938  O O    . ASN A 1 112 ? -18.600 44.541  -4.385  1.00 0.00 ? 290 ASN A O    4  
ATOM 6939  C CB   . ASN A 1 112 ? -19.415 42.986  -1.955  1.00 0.00 ? 290 ASN A CB   4  
ATOM 6940  C CG   . ASN A 1 112 ? -17.915 43.201  -1.917  1.00 0.00 ? 290 ASN A CG   4  
ATOM 6941  O OD1  . ASN A 1 112 ? -17.220 42.986  -2.910  1.00 0.00 ? 290 ASN A OD1  4  
ATOM 6942  N ND2  . ASN A 1 112 ? -17.408 43.627  -0.766  1.00 0.00 ? 290 ASN A ND2  4  
ATOM 6943  H H    . ASN A 1 112 ? -18.644 41.877  -4.759  1.00 0.00 ? 290 ASN A H    4  
ATOM 6944  H HA   . ASN A 1 112 ? -21.002 42.606  -3.341  1.00 0.00 ? 290 ASN A HA   4  
ATOM 6945  H HB2  . ASN A 1 112 ? -19.894 43.839  -1.497  1.00 0.00 ? 290 ASN A HB2  4  
ATOM 6946  H HB3  . ASN A 1 112 ? -19.648 42.099  -1.386  1.00 0.00 ? 290 ASN A HB3  4  
ATOM 6947  H HD21 . ASN A 1 112 ? -18.021 43.777  -0.016  1.00 0.00 ? 290 ASN A HD21 4  
ATOM 6948  H HD22 . ASN A 1 112 ? -16.440 43.775  -0.713  1.00 0.00 ? 290 ASN A HD22 4  
ATOM 6949  N N    . LEU A 1 113 ? -20.833 44.728  -4.588  1.00 0.00 ? 291 LEU A N    4  
ATOM 6950  C CA   . LEU A 1 113 ? -20.770 45.971  -5.348  1.00 0.00 ? 291 LEU A CA   4  
ATOM 6951  C C    . LEU A 1 113 ? -20.098 47.073  -4.536  1.00 0.00 ? 291 LEU A C    4  
ATOM 6952  O O    . LEU A 1 113 ? -20.399 47.260  -3.357  1.00 0.00 ? 291 LEU A O    4  
ATOM 6953  C CB   . LEU A 1 113 ? -22.176 46.411  -5.761  1.00 0.00 ? 291 LEU A CB   4  
ATOM 6954  C CG   . LEU A 1 113 ? -22.253 47.600  -6.720  1.00 0.00 ? 291 LEU A CG   4  
ATOM 6955  C CD1  . LEU A 1 113 ? -21.878 47.173  -8.130  1.00 0.00 ? 291 LEU A CD1  4  
ATOM 6956  C CD2  . LEU A 1 113 ? -23.645 48.213  -6.698  1.00 0.00 ? 291 LEU A CD2  4  
ATOM 6957  H H    . LEU A 1 113 ? -21.708 44.338  -4.383  1.00 0.00 ? 291 LEU A H    4  
ATOM 6958  H HA   . LEU A 1 113 ? -20.184 45.787  -6.236  1.00 0.00 ? 291 LEU A HA   4  
ATOM 6959  H HB2  . LEU A 1 113 ? -22.659 45.571  -6.236  1.00 0.00 ? 291 LEU A HB2  4  
ATOM 6960  H HB3  . LEU A 1 113 ? -22.716 46.674  -4.863  1.00 0.00 ? 291 LEU A HB3  4  
ATOM 6961  H HG   . LEU A 1 113 ? -21.548 48.356  -6.402  1.00 0.00 ? 291 LEU A HG   4  
ATOM 6962  H HD11 . LEU A 1 113 ? -22.470 47.726  -8.843  1.00 0.00 ? 291 LEU A HD11 4  
ATOM 6963  H HD12 . LEU A 1 113 ? -22.066 46.116  -8.248  1.00 0.00 ? 291 LEU A HD12 4  
ATOM 6964  H HD13 . LEU A 1 113 ? -20.830 47.373  -8.300  1.00 0.00 ? 291 LEU A HD13 4  
ATOM 6965  H HD21 . LEU A 1 113 ? -23.879 48.607  -7.676  1.00 0.00 ? 291 LEU A HD21 4  
ATOM 6966  H HD22 . LEU A 1 113 ? -23.675 49.013  -5.972  1.00 0.00 ? 291 LEU A HD22 4  
ATOM 6967  H HD23 . LEU A 1 113 ? -24.368 47.456  -6.432  1.00 0.00 ? 291 LEU A HD23 4  
ATOM 6968  N N    . SER A 1 114 ? -19.188 47.801  -5.175  1.00 0.00 ? 292 SER A N    4  
ATOM 6969  C CA   . SER A 1 114 ? -18.472 48.884  -4.511  1.00 0.00 ? 292 SER A CA   4  
ATOM 6970  C C    . SER A 1 114 ? -18.567 50.174  -5.319  1.00 0.00 ? 292 SER A C    4  
ATOM 6971  O O    . SER A 1 114 ? -17.553 50.767  -5.684  1.00 0.00 ? 292 SER A O    4  
ATOM 6972  C CB   . SER A 1 114 ? -17.004 48.503  -4.307  1.00 0.00 ? 292 SER A CB   4  
ATOM 6973  O OG   . SER A 1 114 ? -16.849 47.645  -3.190  1.00 0.00 ? 292 SER A OG   4  
ATOM 6974  H H    . SER A 1 114 ? -18.992 47.603  -6.114  1.00 0.00 ? 292 SER A H    4  
ATOM 6975  H HA   . SER A 1 114 ? -18.930 49.042  -3.546  1.00 0.00 ? 292 SER A HA   4  
ATOM 6976  H HB2  . SER A 1 114 ? -16.641 47.996  -5.188  1.00 0.00 ? 292 SER A HB2  4  
ATOM 6977  H HB3  . SER A 1 114 ? -16.422 49.399  -4.142  1.00 0.00 ? 292 SER A HB3  4  
ATOM 6978  H HG   . SER A 1 114 ? -17.547 47.818  -2.554  1.00 0.00 ? 292 SER A HG   4  
ATOM 6979  N N    . GLY A 1 115 ? -19.795 50.603  -5.595  1.00 0.00 ? 293 GLY A N    4  
ATOM 6980  C CA   . GLY A 1 115 ? -20.002 51.819  -6.358  1.00 0.00 ? 293 GLY A CA   4  
ATOM 6981  C C    . GLY A 1 115 ? -19.365 53.030  -5.704  1.00 0.00 ? 293 GLY A C    4  
ATOM 6982  O O    . GLY A 1 115 ? -19.230 53.103  -4.483  1.00 0.00 ? 293 GLY A O    4  
ATOM 6983  H H    . GLY A 1 115 ? -20.567 50.088  -5.278  1.00 0.00 ? 293 GLY A H    4  
ATOM 6984  H HA2  . GLY A 1 115 ? -19.578 51.690  -7.343  1.00 0.00 ? 293 GLY A HA2  4  
ATOM 6985  H HA3  . GLY A 1 115 ? -21.064 51.994  -6.455  1.00 0.00 ? 293 GLY A HA3  4  
ATOM 6986  N N    . PRO A 1 116 ? -18.959 54.007  -6.528  1.00 0.00 ? 294 PRO A N    4  
ATOM 6987  C CA   . PRO A 1 116 ? -18.325 55.237  -6.045  1.00 0.00 ? 294 PRO A CA   4  
ATOM 6988  C C    . PRO A 1 116 ? -19.302 56.138  -5.298  1.00 0.00 ? 294 PRO A C    4  
ATOM 6989  O O    . PRO A 1 116 ? -18.906 57.140  -4.702  1.00 0.00 ? 294 PRO A O    4  
ATOM 6990  C CB   . PRO A 1 116 ? -17.845 55.917  -7.329  1.00 0.00 ? 294 PRO A CB   4  
ATOM 6991  C CG   . PRO A 1 116 ? -18.747 55.396  -8.394  1.00 0.00 ? 294 PRO A CG   4  
ATOM 6992  C CD   . PRO A 1 116 ? -19.088 53.987  -7.995  1.00 0.00 ? 294 PRO A CD   4  
ATOM 6993  H HA   . PRO A 1 116 ? -17.477 55.023  -5.410  1.00 0.00 ? 294 PRO A HA   4  
ATOM 6994  H HB2  . PRO A 1 116 ? -17.932 56.990  -7.226  1.00 0.00 ? 294 PRO A HB2  4  
ATOM 6995  H HB3  . PRO A 1 116 ? -16.816 55.651  -7.519  1.00 0.00 ? 294 PRO A HB3  4  
ATOM 6996  H HG2  . PRO A 1 116 ? -19.642 55.998  -8.444  1.00 0.00 ? 294 PRO A HG2  4  
ATOM 6997  H HG3  . PRO A 1 116 ? -18.235 55.403  -9.345  1.00 0.00 ? 294 PRO A HG3  4  
ATOM 6998  H HD2  . PRO A 1 116 ? -20.099 53.745  -8.290  1.00 0.00 ? 294 PRO A HD2  4  
ATOM 6999  H HD3  . PRO A 1 116 ? -18.388 53.291  -8.433  1.00 0.00 ? 294 PRO A HD3  4  
ATOM 7000  N N    . SER A 1 117 ? -20.580 55.776  -5.335  1.00 0.00 ? 295 SER A N    4  
ATOM 7001  C CA   . SER A 1 117 ? -21.615 56.554  -4.664  1.00 0.00 ? 295 SER A CA   4  
ATOM 7002  C C    . SER A 1 117 ? -22.646 55.639  -4.010  1.00 0.00 ? 295 SER A C    4  
ATOM 7003  O O    . SER A 1 117 ? -22.978 54.580  -4.543  1.00 0.00 ? 295 SER A O    4  
ATOM 7004  C CB   . SER A 1 117 ? -22.305 57.490  -5.659  1.00 0.00 ? 295 SER A CB   4  
ATOM 7005  O OG   . SER A 1 117 ? -21.391 58.433  -6.191  1.00 0.00 ? 295 SER A OG   4  
ATOM 7006  H H    . SER A 1 117 ? -20.834 54.967  -5.827  1.00 0.00 ? 295 SER A H    4  
ATOM 7007  H HA   . SER A 1 117 ? -21.139 57.147  -3.897  1.00 0.00 ? 295 SER A HA   4  
ATOM 7008  H HB2  . SER A 1 117 ? -22.716 56.908  -6.470  1.00 0.00 ? 295 SER A HB2  4  
ATOM 7009  H HB3  . SER A 1 117 ? -23.101 58.021  -5.157  1.00 0.00 ? 295 SER A HB3  4  
ATOM 7010  H HG   . SER A 1 117 ? -21.837 58.979  -6.842  1.00 0.00 ? 295 SER A HG   4  
ATOM 7011  N N    . SER A 1 118 ? -23.148 56.055  -2.852  1.00 0.00 ? 296 SER A N    4  
ATOM 7012  C CA   . SER A 1 118 ? -24.138 55.272  -2.123  1.00 0.00 ? 296 SER A CA   4  
ATOM 7013  C C    . SER A 1 118 ? -25.544 55.553  -2.643  1.00 0.00 ? 296 SER A C    4  
ATOM 7014  O O    . SER A 1 118 ? -26.161 56.557  -2.289  1.00 0.00 ? 296 SER A O    4  
ATOM 7015  C CB   . SER A 1 118 ? -24.064 55.584  -0.627  1.00 0.00 ? 296 SER A CB   4  
ATOM 7016  O OG   . SER A 1 118 ? -22.738 55.458  -0.144  1.00 0.00 ? 296 SER A OG   4  
ATOM 7017  H H    . SER A 1 118 ? -22.843 56.909  -2.479  1.00 0.00 ? 296 SER A H    4  
ATOM 7018  H HA   . SER A 1 118 ? -23.913 54.227  -2.276  1.00 0.00 ? 296 SER A HA   4  
ATOM 7019  H HB2  . SER A 1 118 ? -24.402 56.594  -0.455  1.00 0.00 ? 296 SER A HB2  4  
ATOM 7020  H HB3  . SER A 1 118 ? -24.698 54.895  -0.087  1.00 0.00 ? 296 SER A HB3  4  
ATOM 7021  H HG   . SER A 1 118 ? -22.283 54.768  -0.633  1.00 0.00 ? 296 SER A HG   4  
ATOM 7022  N N    . GLY A 1 119 ? -26.046 54.657  -3.488  1.00 0.00 ? 297 GLY A N    4  
ATOM 7023  C CA   . GLY A 1 119 ? -27.376 54.826  -4.045  1.00 0.00 ? 297 GLY A CA   4  
ATOM 7024  C C    . GLY A 1 119 ? -28.213 53.566  -3.939  1.00 0.00 ? 297 GLY A C    4  
ATOM 7025  O O    . GLY A 1 119 ? -28.966 53.393  -2.981  1.00 0.00 ? 297 GLY A O    4  
ATOM 7026  H H    . GLY A 1 119 ? -25.509 53.875  -3.735  1.00 0.00 ? 297 GLY A H    4  
ATOM 7027  H HA2  . GLY A 1 119 ? -27.876 55.624  -3.518  1.00 0.00 ? 297 GLY A HA2  4  
ATOM 7028  H HA3  . GLY A 1 119 ? -27.285 55.097  -5.087  1.00 0.00 ? 297 GLY A HA3  4  
ATOM 7029  N N    . GLY A 1 1   ? -22.673 32.225  5.828   1.00 0.00 ? 179 GLY A N    5  
ATOM 7030  C CA   . GLY A 1 1   ? -23.059 30.837  5.656   1.00 0.00 ? 179 GLY A CA   5  
ATOM 7031  C C    . GLY A 1 1   ? -22.287 29.903  6.567   1.00 0.00 ? 179 GLY A C    5  
ATOM 7032  O O    . GLY A 1 1   ? -22.262 30.092  7.783   1.00 0.00 ? 179 GLY A O    5  
ATOM 7033  H H1   . GLY A 1 1   ? -22.091 32.481  6.574   1.00 0.00 ? 179 GLY A H1   5  
ATOM 7034  H HA2  . GLY A 1 1   ? -24.113 30.739  5.866   1.00 0.00 ? 179 GLY A HA2  5  
ATOM 7035  H HA3  . GLY A 1 1   ? -22.878 30.550  4.630   1.00 0.00 ? 179 GLY A HA3  5  
ATOM 7036  N N    . SER A 1 2   ? -21.655 28.893  5.978   1.00 0.00 ? 180 SER A N    5  
ATOM 7037  C CA   . SER A 1 2   ? -20.883 27.922  6.746   1.00 0.00 ? 180 SER A CA   5  
ATOM 7038  C C    . SER A 1 2   ? -19.710 28.597  7.450   1.00 0.00 ? 180 SER A C    5  
ATOM 7039  O O    . SER A 1 2   ? -18.568 28.510  6.999   1.00 0.00 ? 180 SER A O    5  
ATOM 7040  C CB   . SER A 1 2   ? -20.372 26.808  5.831   1.00 0.00 ? 180 SER A CB   5  
ATOM 7041  O OG   . SER A 1 2   ? -21.366 26.415  4.901   1.00 0.00 ? 180 SER A OG   5  
ATOM 7042  H H    . SER A 1 2   ? -21.713 28.796  5.004   1.00 0.00 ? 180 SER A H    5  
ATOM 7043  H HA   . SER A 1 2   ? -21.537 27.494  7.491   1.00 0.00 ? 180 SER A HA   5  
ATOM 7044  H HB2  . SER A 1 2   ? -19.507 27.159  5.290   1.00 0.00 ? 180 SER A HB2  5  
ATOM 7045  H HB3  . SER A 1 2   ? -20.098 25.951  6.431   1.00 0.00 ? 180 SER A HB3  5  
ATOM 7046  H HG   . SER A 1 2   ? -20.947 26.137  4.083   1.00 0.00 ? 180 SER A HG   5  
ATOM 7047  N N    . SER A 1 3   ? -20.001 29.269  8.559   1.00 0.00 ? 181 SER A N    5  
ATOM 7048  C CA   . SER A 1 3   ? -18.971 29.962  9.325   1.00 0.00 ? 181 SER A CA   5  
ATOM 7049  C C    . SER A 1 3   ? -18.612 29.180  10.584  1.00 0.00 ? 181 SER A C    5  
ATOM 7050  O O    . SER A 1 3   ? -19.288 29.283  11.607  1.00 0.00 ? 181 SER A O    5  
ATOM 7051  C CB   . SER A 1 3   ? -19.446 31.367  9.702   1.00 0.00 ? 181 SER A CB   5  
ATOM 7052  O OG   . SER A 1 3   ? -20.837 31.381  9.972   1.00 0.00 ? 181 SER A OG   5  
ATOM 7053  H H    . SER A 1 3   ? -20.931 29.302  8.868   1.00 0.00 ? 181 SER A H    5  
ATOM 7054  H HA   . SER A 1 3   ? -18.093 30.043  8.702   1.00 0.00 ? 181 SER A HA   5  
ATOM 7055  H HB2  . SER A 1 3   ? -18.917 31.699  10.582  1.00 0.00 ? 181 SER A HB2  5  
ATOM 7056  H HB3  . SER A 1 3   ? -19.243 32.044  8.884   1.00 0.00 ? 181 SER A HB3  5  
ATOM 7057  H HG   . SER A 1 3   ? -21.314 31.643  9.182   1.00 0.00 ? 181 SER A HG   5  
ATOM 7058  N N    . GLY A 1 4   ? -17.541 28.396  10.501  1.00 0.00 ? 182 GLY A N    5  
ATOM 7059  C CA   . GLY A 1 4   ? -17.109 27.607  11.640  1.00 0.00 ? 182 GLY A CA   5  
ATOM 7060  C C    . GLY A 1 4   ? -16.823 26.165  11.271  1.00 0.00 ? 182 GLY A C    5  
ATOM 7061  O O    . GLY A 1 4   ? -16.014 25.893  10.384  1.00 0.00 ? 182 GLY A O    5  
ATOM 7062  H H    . GLY A 1 4   ? -17.040 28.353  9.660   1.00 0.00 ? 182 GLY A H    5  
ATOM 7063  H HA2  . GLY A 1 4   ? -16.213 28.047  12.050  1.00 0.00 ? 182 GLY A HA2  5  
ATOM 7064  H HA3  . GLY A 1 4   ? -17.885 27.627  12.392  1.00 0.00 ? 182 GLY A HA3  5  
ATOM 7065  N N    . SER A 1 5   ? -17.488 25.238  11.953  1.00 0.00 ? 183 SER A N    5  
ATOM 7066  C CA   . SER A 1 5   ? -17.297 23.815  11.696  1.00 0.00 ? 183 SER A CA   5  
ATOM 7067  C C    . SER A 1 5   ? -17.589 23.483  10.236  1.00 0.00 ? 183 SER A C    5  
ATOM 7068  O O    . SER A 1 5   ? -18.058 24.331  9.477   1.00 0.00 ? 183 SER A O    5  
ATOM 7069  C CB   . SER A 1 5   ? -18.200 22.985  12.610  1.00 0.00 ? 183 SER A CB   5  
ATOM 7070  O OG   . SER A 1 5   ? -18.106 23.422  13.955  1.00 0.00 ? 183 SER A OG   5  
ATOM 7071  H H    . SER A 1 5   ? -18.121 25.518  12.648  1.00 0.00 ? 183 SER A H    5  
ATOM 7072  H HA   . SER A 1 5   ? -16.266 23.576  11.909  1.00 0.00 ? 183 SER A HA   5  
ATOM 7073  H HB2  . SER A 1 5   ? -19.225 23.081  12.284  1.00 0.00 ? 183 SER A HB2  5  
ATOM 7074  H HB3  . SER A 1 5   ? -17.903 21.947  12.559  1.00 0.00 ? 183 SER A HB3  5  
ATOM 7075  H HG   . SER A 1 5   ? -17.182 23.470  14.211  1.00 0.00 ? 183 SER A HG   5  
ATOM 7076  N N    . SER A 1 6   ? -17.307 22.243  9.850   1.00 0.00 ? 184 SER A N    5  
ATOM 7077  C CA   . SER A 1 6   ? -17.535 21.798  8.480   1.00 0.00 ? 184 SER A CA   5  
ATOM 7078  C C    . SER A 1 6   ? -18.438 20.569  8.451   1.00 0.00 ? 184 SER A C    5  
ATOM 7079  O O    . SER A 1 6   ? -18.854 20.066  9.494   1.00 0.00 ? 184 SER A O    5  
ATOM 7080  C CB   . SER A 1 6   ? -16.203 21.483  7.795   1.00 0.00 ? 184 SER A CB   5  
ATOM 7081  O OG   . SER A 1 6   ? -15.468 20.520  8.530   1.00 0.00 ? 184 SER A OG   5  
ATOM 7082  H H    . SER A 1 6   ? -16.934 21.613  10.502  1.00 0.00 ? 184 SER A H    5  
ATOM 7083  H HA   . SER A 1 6   ? -18.023 22.601  7.948   1.00 0.00 ? 184 SER A HA   5  
ATOM 7084  H HB2  . SER A 1 6   ? -16.393 21.096  6.806   1.00 0.00 ? 184 SER A HB2  5  
ATOM 7085  H HB3  . SER A 1 6   ? -15.617 22.388  7.722   1.00 0.00 ? 184 SER A HB3  5  
ATOM 7086  H HG   . SER A 1 6   ? -15.952 19.691  8.546   1.00 0.00 ? 184 SER A HG   5  
ATOM 7087  N N    . GLY A 1 7   ? -18.737 20.090  7.247   1.00 0.00 ? 185 GLY A N    5  
ATOM 7088  C CA   . GLY A 1 7   ? -19.589 18.924  7.103   1.00 0.00 ? 185 GLY A CA   5  
ATOM 7089  C C    . GLY A 1 7   ? -19.050 17.934  6.090   1.00 0.00 ? 185 GLY A C    5  
ATOM 7090  O O    . GLY A 1 7   ? -18.192 18.273  5.274   1.00 0.00 ? 185 GLY A O    5  
ATOM 7091  H H    . GLY A 1 7   ? -18.377 20.533  6.450   1.00 0.00 ? 185 GLY A H    5  
ATOM 7092  H HA2  . GLY A 1 7   ? -19.674 18.433  8.061   1.00 0.00 ? 185 GLY A HA2  5  
ATOM 7093  H HA3  . GLY A 1 7   ? -20.570 19.246  6.787   1.00 0.00 ? 185 GLY A HA3  5  
ATOM 7094  N N    . LYS A 1 8   ? -19.552 16.705  6.141   1.00 0.00 ? 186 LYS A N    5  
ATOM 7095  C CA   . LYS A 1 8   ? -19.116 15.661  5.222   1.00 0.00 ? 186 LYS A CA   5  
ATOM 7096  C C    . LYS A 1 8   ? -19.848 15.770  3.888   1.00 0.00 ? 186 LYS A C    5  
ATOM 7097  O O    . LYS A 1 8   ? -20.839 16.489  3.771   1.00 0.00 ? 186 LYS A O    5  
ATOM 7098  C CB   . LYS A 1 8   ? -19.355 14.279  5.836   1.00 0.00 ? 186 LYS A CB   5  
ATOM 7099  C CG   . LYS A 1 8   ? -18.289 13.866  6.836   1.00 0.00 ? 186 LYS A CG   5  
ATOM 7100  C CD   . LYS A 1 8   ? -18.220 12.355  6.985   1.00 0.00 ? 186 LYS A CD   5  
ATOM 7101  C CE   . LYS A 1 8   ? -17.616 11.954  8.321   1.00 0.00 ? 186 LYS A CE   5  
ATOM 7102  N NZ   . LYS A 1 8   ? -17.299 10.500  8.373   1.00 0.00 ? 186 LYS A NZ   5  
ATOM 7103  H H    . LYS A 1 8   ? -20.233 16.495  6.814   1.00 0.00 ? 186 LYS A H    5  
ATOM 7104  H HA   . LYS A 1 8   ? -18.058 15.791  5.049   1.00 0.00 ? 186 LYS A HA   5  
ATOM 7105  H HB2  . LYS A 1 8   ? -20.310 14.283  6.340   1.00 0.00 ? 186 LYS A HB2  5  
ATOM 7106  H HB3  . LYS A 1 8   ? -19.379 13.546  5.043   1.00 0.00 ? 186 LYS A HB3  5  
ATOM 7107  H HG2  . LYS A 1 8   ? -17.330 14.227  6.496   1.00 0.00 ? 186 LYS A HG2  5  
ATOM 7108  H HG3  . LYS A 1 8   ? -18.520 14.303  7.796   1.00 0.00 ? 186 LYS A HG3  5  
ATOM 7109  H HD2  . LYS A 1 8   ? -19.219 11.950  6.918   1.00 0.00 ? 186 LYS A HD2  5  
ATOM 7110  H HD3  . LYS A 1 8   ? -17.612 11.951  6.188   1.00 0.00 ? 186 LYS A HD3  5  
ATOM 7111  H HE2  . LYS A 1 8   ? -16.708 12.517  8.475   1.00 0.00 ? 186 LYS A HE2  5  
ATOM 7112  H HE3  . LYS A 1 8   ? -18.321 12.188  9.105   1.00 0.00 ? 186 LYS A HE3  5  
ATOM 7113  H HZ1  . LYS A 1 8   ? -16.453 10.298  7.802   1.00 0.00 ? 186 LYS A HZ1  5  
ATOM 7114  H HZ2  . LYS A 1 8   ? -18.096 9.947   7.998   1.00 0.00 ? 186 LYS A HZ2  5  
ATOM 7115  H HZ3  . LYS A 1 8   ? -17.120 10.207  9.354   1.00 0.00 ? 186 LYS A HZ3  5  
ATOM 7116  N N    . ASN A 1 9   ? -19.355 15.049  2.886   1.00 0.00 ? 187 ASN A N    5  
ATOM 7117  C CA   . ASN A 1 9   ? -19.964 15.064  1.561   1.00 0.00 ? 187 ASN A CA   5  
ATOM 7118  C C    . ASN A 1 9   ? -21.128 14.081  1.486   1.00 0.00 ? 187 ASN A C    5  
ATOM 7119  O O    . ASN A 1 9   ? -21.342 13.285  2.400   1.00 0.00 ? 187 ASN A O    5  
ATOM 7120  C CB   . ASN A 1 9   ? -18.922 14.721  0.495   1.00 0.00 ? 187 ASN A CB   5  
ATOM 7121  C CG   . ASN A 1 9   ? -17.575 15.360  0.775   1.00 0.00 ? 187 ASN A CG   5  
ATOM 7122  O OD1  . ASN A 1 9   ? -16.557 14.674  0.861   1.00 0.00 ? 187 ASN A OD1  5  
ATOM 7123  N ND2  . ASN A 1 9   ? -17.565 16.680  0.918   1.00 0.00 ? 187 ASN A ND2  5  
ATOM 7124  H H    . ASN A 1 9   ? -18.562 14.494  3.042   1.00 0.00 ? 187 ASN A H    5  
ATOM 7125  H HA   . ASN A 1 9   ? -20.337 16.061  1.380   1.00 0.00 ? 187 ASN A HA   5  
ATOM 7126  H HB2  . ASN A 1 9   ? -18.790 13.649  0.461   1.00 0.00 ? 187 ASN A HB2  5  
ATOM 7127  H HB3  . ASN A 1 9   ? -19.271 15.067  -0.466  1.00 0.00 ? 187 ASN A HB3  5  
ATOM 7128  H HD21 . ASN A 1 9   ? -18.415 17.161  0.837   1.00 0.00 ? 187 ASN A HD21 5  
ATOM 7129  H HD22 . ASN A 1 9   ? -16.708 17.119  1.100   1.00 0.00 ? 187 ASN A HD22 5  
ATOM 7130  N N    . VAL A 1 10  ? -21.877 14.142  0.390   1.00 0.00 ? 188 VAL A N    5  
ATOM 7131  C CA   . VAL A 1 10  ? -23.019 13.257  0.194   1.00 0.00 ? 188 VAL A CA   5  
ATOM 7132  C C    . VAL A 1 10  ? -22.764 12.276  -0.945  1.00 0.00 ? 188 VAL A C    5  
ATOM 7133  O O    . VAL A 1 10  ? -22.694 11.066  -0.732  1.00 0.00 ? 188 VAL A O    5  
ATOM 7134  C CB   . VAL A 1 10  ? -24.302 14.053  -0.106  1.00 0.00 ? 188 VAL A CB   5  
ATOM 7135  C CG1  . VAL A 1 10  ? -25.442 13.113  -0.467  1.00 0.00 ? 188 VAL A CG1  5  
ATOM 7136  C CG2  . VAL A 1 10  ? -24.676 14.927  1.081   1.00 0.00 ? 188 VAL A CG2  5  
ATOM 7137  H H    . VAL A 1 10  ? -21.657 14.798  -0.304  1.00 0.00 ? 188 VAL A H    5  
ATOM 7138  H HA   . VAL A 1 10  ? -23.171 12.700  1.108   1.00 0.00 ? 188 VAL A HA   5  
ATOM 7139  H HB   . VAL A 1 10  ? -24.113 14.696  -0.954  1.00 0.00 ? 188 VAL A HB   5  
ATOM 7140  H HG11 . VAL A 1 10  ? -25.242 12.133  -0.061  1.00 0.00 ? 188 VAL A HG11 5  
ATOM 7141  H HG12 . VAL A 1 10  ? -26.366 13.493  -0.056  1.00 0.00 ? 188 VAL A HG12 5  
ATOM 7142  H HG13 . VAL A 1 10  ? -25.527 13.047  -1.542  1.00 0.00 ? 188 VAL A HG13 5  
ATOM 7143  H HG21 . VAL A 1 10  ? -23.785 15.383  1.487   1.00 0.00 ? 188 VAL A HG21 5  
ATOM 7144  H HG22 . VAL A 1 10  ? -25.361 15.699  0.760   1.00 0.00 ? 188 VAL A HG22 5  
ATOM 7145  H HG23 . VAL A 1 10  ? -25.149 14.322  1.840   1.00 0.00 ? 188 VAL A HG23 5  
ATOM 7146  N N    . ASN A 1 11  ? -22.626 12.807  -2.156  1.00 0.00 ? 189 ASN A N    5  
ATOM 7147  C CA   . ASN A 1 11  ? -22.379 11.978  -3.330  1.00 0.00 ? 189 ASN A CA   5  
ATOM 7148  C C    . ASN A 1 11  ? -20.939 12.132  -3.811  1.00 0.00 ? 189 ASN A C    5  
ATOM 7149  O O    . ASN A 1 11  ? -20.582 13.140  -4.421  1.00 0.00 ? 189 ASN A O    5  
ATOM 7150  C CB   . ASN A 1 11  ? -23.347 12.350  -4.455  1.00 0.00 ? 189 ASN A CB   5  
ATOM 7151  C CG   . ASN A 1 11  ? -23.341 11.335  -5.582  1.00 0.00 ? 189 ASN A CG   5  
ATOM 7152  O OD1  . ASN A 1 11  ? -23.621 10.154  -5.371  1.00 0.00 ? 189 ASN A OD1  5  
ATOM 7153  N ND2  . ASN A 1 11  ? -23.021 11.791  -6.787  1.00 0.00 ? 189 ASN A ND2  5  
ATOM 7154  H H    . ASN A 1 11  ? -22.692 13.779  -2.262  1.00 0.00 ? 189 ASN A H    5  
ATOM 7155  H HA   . ASN A 1 11  ? -22.545 10.949  -3.050  1.00 0.00 ? 189 ASN A HA   5  
ATOM 7156  H HB2  . ASN A 1 11  ? -24.349 12.408  -4.055  1.00 0.00 ? 189 ASN A HB2  5  
ATOM 7157  H HB3  . ASN A 1 11  ? -23.068 13.311  -4.859  1.00 0.00 ? 189 ASN A HB3  5  
ATOM 7158  H HD21 . ASN A 1 11  ? -22.809 12.743  -6.881  1.00 0.00 ? 189 ASN A HD21 5  
ATOM 7159  H HD22 . ASN A 1 11  ? -23.010 11.156  -7.534  1.00 0.00 ? 189 ASN A HD22 5  
ATOM 7160  N N    . ARG A 1 12  ? -20.118 11.125  -3.534  1.00 0.00 ? 190 ARG A N    5  
ATOM 7161  C CA   . ARG A 1 12  ? -18.717 11.148  -3.938  1.00 0.00 ? 190 ARG A CA   5  
ATOM 7162  C C    . ARG A 1 12  ? -18.529 10.463  -5.288  1.00 0.00 ? 190 ARG A C    5  
ATOM 7163  O O    . ARG A 1 12  ? -19.216 9.492   -5.604  1.00 0.00 ? 190 ARG A O    5  
ATOM 7164  C CB   . ARG A 1 12  ? -17.848 10.464  -2.881  1.00 0.00 ? 190 ARG A CB   5  
ATOM 7165  C CG   . ARG A 1 12  ? -17.366 11.403  -1.788  1.00 0.00 ? 190 ARG A CG   5  
ATOM 7166  C CD   . ARG A 1 12  ? -16.080 12.110  -2.188  1.00 0.00 ? 190 ARG A CD   5  
ATOM 7167  N NE   . ARG A 1 12  ? -16.342 13.363  -2.892  1.00 0.00 ? 190 ARG A NE   5  
ATOM 7168  C CZ   . ARG A 1 12  ? -15.412 14.283  -3.126  1.00 0.00 ? 190 ARG A CZ   5  
ATOM 7169  N NH1  . ARG A 1 12  ? -14.166 14.090  -2.715  1.00 0.00 ? 190 ARG A NH1  5  
ATOM 7170  N NH2  . ARG A 1 12  ? -15.727 15.397  -3.772  1.00 0.00 ? 190 ARG A NH2  5  
ATOM 7171  H H    . ARG A 1 12  ? -20.461 10.348  -3.045  1.00 0.00 ? 190 ARG A H    5  
ATOM 7172  H HA   . ARG A 1 12  ? -18.414 12.181  -4.026  1.00 0.00 ? 190 ARG A HA   5  
ATOM 7173  H HB2  . ARG A 1 12  ? -18.420 9.673   -2.419  1.00 0.00 ? 190 ARG A HB2  5  
ATOM 7174  H HB3  . ARG A 1 12  ? -16.984 10.036  -3.366  1.00 0.00 ? 190 ARG A HB3  5  
ATOM 7175  H HG2  . ARG A 1 12  ? -18.128 12.144  -1.600  1.00 0.00 ? 190 ARG A HG2  5  
ATOM 7176  H HG3  . ARG A 1 12  ? -17.187 10.832  -0.889  1.00 0.00 ? 190 ARG A HG3  5  
ATOM 7177  H HD2  . ARG A 1 12  ? -15.509 12.322  -1.297  1.00 0.00 ? 190 ARG A HD2  5  
ATOM 7178  H HD3  . ARG A 1 12  ? -15.512 11.457  -2.834  1.00 0.00 ? 190 ARG A HD3  5  
ATOM 7179  H HE   . ARG A 1 12  ? -17.256 13.526  -3.204  1.00 0.00 ? 190 ARG A HE   5  
ATOM 7180  H HH11 . ARG A 1 12  ? -13.926 13.250  -2.228  1.00 0.00 ? 190 ARG A HH11 5  
ATOM 7181  H HH12 . ARG A 1 12  ? -13.468 14.783  -2.893  1.00 0.00 ? 190 ARG A HH12 5  
ATOM 7182  H HH21 . ARG A 1 12  ? -16.665 15.546  -4.084  1.00 0.00 ? 190 ARG A HH21 5  
ATOM 7183  H HH22 . ARG A 1 12  ? -15.027 16.089  -3.948  1.00 0.00 ? 190 ARG A HH22 5  
ATOM 7184  N N    . VAL A 1 13  ? -17.594 10.976  -6.081  1.00 0.00 ? 191 VAL A N    5  
ATOM 7185  C CA   . VAL A 1 13  ? -17.315 10.413  -7.397  1.00 0.00 ? 191 VAL A CA   5  
ATOM 7186  C C    . VAL A 1 13  ? -15.947 9.739   -7.428  1.00 0.00 ? 191 VAL A C    5  
ATOM 7187  O O    . VAL A 1 13  ? -15.332 9.606   -8.487  1.00 0.00 ? 191 VAL A O    5  
ATOM 7188  C CB   . VAL A 1 13  ? -17.366 11.495  -8.492  1.00 0.00 ? 191 VAL A CB   5  
ATOM 7189  C CG1  . VAL A 1 13  ? -16.173 12.431  -8.376  1.00 0.00 ? 191 VAL A CG1  5  
ATOM 7190  C CG2  . VAL A 1 13  ? -17.420 10.855  -9.871  1.00 0.00 ? 191 VAL A CG2  5  
ATOM 7191  H H    . VAL A 1 13  ? -17.078 11.750  -5.773  1.00 0.00 ? 191 VAL A H    5  
ATOM 7192  H HA   . VAL A 1 13  ? -18.074 9.676   -7.613  1.00 0.00 ? 191 VAL A HA   5  
ATOM 7193  H HB   . VAL A 1 13  ? -18.266 12.076  -8.353  1.00 0.00 ? 191 VAL A HB   5  
ATOM 7194  H HG11 . VAL A 1 13  ? -15.321 11.990  -8.872  1.00 0.00 ? 191 VAL A HG11 5  
ATOM 7195  H HG12 . VAL A 1 13  ? -16.411 13.377  -8.838  1.00 0.00 ? 191 VAL A HG12 5  
ATOM 7196  H HG13 . VAL A 1 13  ? -15.940 12.588  -7.333  1.00 0.00 ? 191 VAL A HG13 5  
ATOM 7197  H HG21 . VAL A 1 13  ? -16.775 11.399  -10.545 1.00 0.00 ? 191 VAL A HG21 5  
ATOM 7198  H HG22 . VAL A 1 13  ? -17.087 9.829   -9.805  1.00 0.00 ? 191 VAL A HG22 5  
ATOM 7199  H HG23 . VAL A 1 13  ? -18.433 10.881  -10.242 1.00 0.00 ? 191 VAL A HG23 5  
ATOM 7200  N N    . LEU A 1 14  ? -15.477 9.315   -6.260  1.00 0.00 ? 192 LEU A N    5  
ATOM 7201  C CA   . LEU A 1 14  ? -14.181 8.654   -6.153  1.00 0.00 ? 192 LEU A CA   5  
ATOM 7202  C C    . LEU A 1 14  ? -14.192 7.314   -6.881  1.00 0.00 ? 192 LEU A C    5  
ATOM 7203  O O    . LEU A 1 14  ? -14.768 6.338   -6.399  1.00 0.00 ? 192 LEU A O    5  
ATOM 7204  C CB   . LEU A 1 14  ? -13.813 8.445   -4.683  1.00 0.00 ? 192 LEU A CB   5  
ATOM 7205  C CG   . LEU A 1 14  ? -12.366 8.040   -4.404  1.00 0.00 ? 192 LEU A CG   5  
ATOM 7206  C CD1  . LEU A 1 14  ? -11.409 9.132   -4.856  1.00 0.00 ? 192 LEU A CD1  5  
ATOM 7207  C CD2  . LEU A 1 14  ? -12.172 7.737   -2.925  1.00 0.00 ? 192 LEU A CD2  5  
ATOM 7208  H H    . LEU A 1 14  ? -16.012 9.450   -5.451  1.00 0.00 ? 192 LEU A H    5  
ATOM 7209  H HA   . LEU A 1 14  ? -13.443 9.294   -6.613  1.00 0.00 ? 192 LEU A HA   5  
ATOM 7210  H HB2  . LEU A 1 14  ? -14.004 9.369   -4.160  1.00 0.00 ? 192 LEU A HB2  5  
ATOM 7211  H HB3  . LEU A 1 14  ? -14.457 7.671   -4.288  1.00 0.00 ? 192 LEU A HB3  5  
ATOM 7212  H HG   . LEU A 1 14  ? -12.136 7.143   -4.962  1.00 0.00 ? 192 LEU A HG   5  
ATOM 7213  H HD11 . LEU A 1 14  ? -10.478 9.040   -4.318  1.00 0.00 ? 192 LEU A HD11 5  
ATOM 7214  H HD12 . LEU A 1 14  ? -11.846 10.099  -4.655  1.00 0.00 ? 192 LEU A HD12 5  
ATOM 7215  H HD13 . LEU A 1 14  ? -11.225 9.033   -5.916  1.00 0.00 ? 192 LEU A HD13 5  
ATOM 7216  H HD21 . LEU A 1 14  ? -11.534 8.489   -2.485  1.00 0.00 ? 192 LEU A HD21 5  
ATOM 7217  H HD22 . LEU A 1 14  ? -11.712 6.765   -2.814  1.00 0.00 ? 192 LEU A HD22 5  
ATOM 7218  H HD23 . LEU A 1 14  ? -13.131 7.741   -2.428  1.00 0.00 ? 192 LEU A HD23 5  
ATOM 7219  N N    . SER A 1 15  ? -13.549 7.273   -8.044  1.00 0.00 ? 193 SER A N    5  
ATOM 7220  C CA   . SER A 1 15  ? -13.486 6.053   -8.840  1.00 0.00 ? 193 SER A CA   5  
ATOM 7221  C C    . SER A 1 15  ? -12.050 5.549   -8.949  1.00 0.00 ? 193 SER A C    5  
ATOM 7222  O O    . SER A 1 15  ? -11.099 6.304   -8.750  1.00 0.00 ? 193 SER A O    5  
ATOM 7223  C CB   . SER A 1 15  ? -14.059 6.300   -10.237 1.00 0.00 ? 193 SER A CB   5  
ATOM 7224  O OG   . SER A 1 15  ? -15.440 6.612   -10.173 1.00 0.00 ? 193 SER A OG   5  
ATOM 7225  H H    . SER A 1 15  ? -13.109 8.084   -8.375  1.00 0.00 ? 193 SER A H    5  
ATOM 7226  H HA   . SER A 1 15  ? -14.081 5.302   -8.343  1.00 0.00 ? 193 SER A HA   5  
ATOM 7227  H HB2  . SER A 1 15  ? -13.536 7.124   -10.697 1.00 0.00 ? 193 SER A HB2  5  
ATOM 7228  H HB3  . SER A 1 15  ? -13.930 5.411   -10.838 1.00 0.00 ? 193 SER A HB3  5  
ATOM 7229  H HG   . SER A 1 15  ? -15.627 7.072   -9.351  1.00 0.00 ? 193 SER A HG   5  
ATOM 7230  N N    . ALA A 1 16  ? -11.901 4.267   -9.267  1.00 0.00 ? 194 ALA A N    5  
ATOM 7231  C CA   . ALA A 1 16  ? -10.582 3.662   -9.404  1.00 0.00 ? 194 ALA A CA   5  
ATOM 7232  C C    . ALA A 1 16  ? -9.826  4.256   -10.588 1.00 0.00 ? 194 ALA A C    5  
ATOM 7233  O O    . ALA A 1 16  ? -8.693  4.713   -10.445 1.00 0.00 ? 194 ALA A O    5  
ATOM 7234  C CB   . ALA A 1 16  ? -10.708 2.153   -9.560  1.00 0.00 ? 194 ALA A CB   5  
ATOM 7235  H H    . ALA A 1 16  ? -12.698 3.716   -9.413  1.00 0.00 ? 194 ALA A H    5  
ATOM 7236  H HA   . ALA A 1 16  ? -10.028 3.861   -8.499  1.00 0.00 ? 194 ALA A HA   5  
ATOM 7237  H HB1  . ALA A 1 16  ? -10.453 1.874   -10.572 1.00 0.00 ? 194 ALA A HB1  5  
ATOM 7238  H HB2  . ALA A 1 16  ? -10.036 1.664   -8.871  1.00 0.00 ? 194 ALA A HB2  5  
ATOM 7239  H HB3  . ALA A 1 16  ? -11.723 1.853   -9.348  1.00 0.00 ? 194 ALA A HB3  5  
ATOM 7240  N N    . GLU A 1 17  ? -10.462 4.246   -11.755 1.00 0.00 ? 195 GLU A N    5  
ATOM 7241  C CA   . GLU A 1 17  ? -9.847  4.784   -12.963 1.00 0.00 ? 195 GLU A CA   5  
ATOM 7242  C C    . GLU A 1 17  ? -9.707  6.301   -12.874 1.00 0.00 ? 195 GLU A C    5  
ATOM 7243  O O    . GLU A 1 17  ? -9.039  6.923   -13.699 1.00 0.00 ? 195 GLU A O    5  
ATOM 7244  C CB   . GLU A 1 17  ? -10.674 4.408   -14.194 1.00 0.00 ? 195 GLU A CB   5  
ATOM 7245  C CG   . GLU A 1 17  ? -12.087 4.967   -14.172 1.00 0.00 ? 195 GLU A CG   5  
ATOM 7246  C CD   . GLU A 1 17  ? -13.031 4.132   -13.329 1.00 0.00 ? 195 GLU A CD   5  
ATOM 7247  O OE1  . GLU A 1 17  ? -12.606 3.064   -12.842 1.00 0.00 ? 195 GLU A OE1  5  
ATOM 7248  O OE2  . GLU A 1 17  ? -14.196 4.549   -13.156 1.00 0.00 ? 195 GLU A OE2  5  
ATOM 7249  H H    . GLU A 1 17  ? -11.364 3.868   -11.806 1.00 0.00 ? 195 GLU A H    5  
ATOM 7250  H HA   . GLU A 1 17  ? -8.863  4.349   -13.056 1.00 0.00 ? 195 GLU A HA   5  
ATOM 7251  H HB2  . GLU A 1 17  ? -10.175 4.781   -15.077 1.00 0.00 ? 195 GLU A HB2  5  
ATOM 7252  H HB3  . GLU A 1 17  ? -10.737 3.332   -14.256 1.00 0.00 ? 195 GLU A HB3  5  
ATOM 7253  H HG2  . GLU A 1 17  ? -12.058 5.968   -13.768 1.00 0.00 ? 195 GLU A HG2  5  
ATOM 7254  H HG3  . GLU A 1 17  ? -12.464 4.999   -15.183 1.00 0.00 ? 195 GLU A HG3  5  
ATOM 7255  N N    . ALA A 1 18  ? -10.344 6.889   -11.867 1.00 0.00 ? 196 ALA A N    5  
ATOM 7256  C CA   . ALA A 1 18  ? -10.291 8.332   -11.669 1.00 0.00 ? 196 ALA A CA   5  
ATOM 7257  C C    . ALA A 1 18  ? -9.101  8.723   -10.798 1.00 0.00 ? 196 ALA A C    5  
ATOM 7258  O O    . ALA A 1 18  ? -8.714  9.891   -10.745 1.00 0.00 ? 196 ALA A O    5  
ATOM 7259  C CB   . ALA A 1 18  ? -11.588 8.828   -11.047 1.00 0.00 ? 196 ALA A CB   5  
ATOM 7260  H H    . ALA A 1 18  ? -10.861 6.340   -11.242 1.00 0.00 ? 196 ALA A H    5  
ATOM 7261  H HA   . ALA A 1 18  ? -10.183 8.799   -12.637 1.00 0.00 ? 196 ALA A HA   5  
ATOM 7262  H HB1  . ALA A 1 18  ? -11.534 9.898   -10.910 1.00 0.00 ? 196 ALA A HB1  5  
ATOM 7263  H HB2  . ALA A 1 18  ? -12.414 8.589   -11.700 1.00 0.00 ? 196 ALA A HB2  5  
ATOM 7264  H HB3  . ALA A 1 18  ? -11.734 8.349   -10.091 1.00 0.00 ? 196 ALA A HB3  5  
ATOM 7265  N N    . LEU A 1 19  ? -8.526  7.739   -10.115 1.00 0.00 ? 197 LEU A N    5  
ATOM 7266  C CA   . LEU A 1 19  ? -7.380  7.980   -9.245  1.00 0.00 ? 197 LEU A CA   5  
ATOM 7267  C C    . LEU A 1 19  ? -6.208  8.554   -10.034 1.00 0.00 ? 197 LEU A C    5  
ATOM 7268  O O    . LEU A 1 19  ? -6.064  8.295   -11.229 1.00 0.00 ? 197 LEU A O    5  
ATOM 7269  C CB   . LEU A 1 19  ? -6.958  6.683   -8.553  1.00 0.00 ? 197 LEU A CB   5  
ATOM 7270  C CG   . LEU A 1 19  ? -7.910  6.155   -7.479  1.00 0.00 ? 197 LEU A CG   5  
ATOM 7271  C CD1  . LEU A 1 19  ? -7.363  4.877   -6.863  1.00 0.00 ? 197 LEU A CD1  5  
ATOM 7272  C CD2  . LEU A 1 19  ? -8.141  7.209   -6.406  1.00 0.00 ? 197 LEU A CD2  5  
ATOM 7273  H H    . LEU A 1 19  ? -8.879  6.829   -10.197 1.00 0.00 ? 197 LEU A H    5  
ATOM 7274  H HA   . LEU A 1 19  ? -7.679  8.698   -8.495  1.00 0.00 ? 197 LEU A HA   5  
ATOM 7275  H HB2  . LEU A 1 19  ? -6.860  5.921   -9.311  1.00 0.00 ? 197 LEU A HB2  5  
ATOM 7276  H HB3  . LEU A 1 19  ? -5.997  6.854   -8.090  1.00 0.00 ? 197 LEU A HB3  5  
ATOM 7277  H HG   . LEU A 1 19  ? -8.864  5.924   -7.933  1.00 0.00 ? 197 LEU A HG   5  
ATOM 7278  H HD11 . LEU A 1 19  ? -6.955  5.093   -5.887  1.00 0.00 ? 197 LEU A HD11 5  
ATOM 7279  H HD12 . LEU A 1 19  ? -6.587  4.475   -7.497  1.00 0.00 ? 197 LEU A HD12 5  
ATOM 7280  H HD13 . LEU A 1 19  ? -8.160  4.154   -6.768  1.00 0.00 ? 197 LEU A HD13 5  
ATOM 7281  H HD21 . LEU A 1 19  ? -8.904  7.899   -6.738  1.00 0.00 ? 197 LEU A HD21 5  
ATOM 7282  H HD22 . LEU A 1 19  ? -7.222  7.749   -6.227  1.00 0.00 ? 197 LEU A HD22 5  
ATOM 7283  H HD23 . LEU A 1 19  ? -8.462  6.730   -5.493  1.00 0.00 ? 197 LEU A HD23 5  
ATOM 7284  N N    . LYS A 1 20  ? -5.370  9.332   -9.358  1.00 0.00 ? 198 LYS A N    5  
ATOM 7285  C CA   . LYS A 1 20  ? -4.207  9.940   -9.994  1.00 0.00 ? 198 LYS A CA   5  
ATOM 7286  C C    . LYS A 1 20  ? -2.936  9.637   -9.207  1.00 0.00 ? 198 LYS A C    5  
ATOM 7287  O O    . LYS A 1 20  ? -2.938  9.580   -7.977  1.00 0.00 ? 198 LYS A O    5  
ATOM 7288  C CB   . LYS A 1 20  ? -4.398  11.453  -10.113 1.00 0.00 ? 198 LYS A CB   5  
ATOM 7289  C CG   . LYS A 1 20  ? -5.707  11.852  -10.772 1.00 0.00 ? 198 LYS A CG   5  
ATOM 7290  C CD   . LYS A 1 20  ? -5.614  11.778  -12.287 1.00 0.00 ? 198 LYS A CD   5  
ATOM 7291  C CE   . LYS A 1 20  ? -6.663  12.654  -12.953 1.00 0.00 ? 198 LYS A CE   5  
ATOM 7292  N NZ   . LYS A 1 20  ? -6.165  14.039  -13.183 1.00 0.00 ? 198 LYS A NZ   5  
ATOM 7293  H H    . LYS A 1 20  ? -5.537  9.501   -8.407  1.00 0.00 ? 198 LYS A H    5  
ATOM 7294  H HA   . LYS A 1 20  ? -4.112  9.519   -10.983 1.00 0.00 ? 198 LYS A HA   5  
ATOM 7295  H HB2  . LYS A 1 20  ? -4.370  11.886  -9.124  1.00 0.00 ? 198 LYS A HB2  5  
ATOM 7296  H HB3  . LYS A 1 20  ? -3.586  11.862  -10.698 1.00 0.00 ? 198 LYS A HB3  5  
ATOM 7297  H HG2  . LYS A 1 20  ? -6.486  11.183  -10.437 1.00 0.00 ? 198 LYS A HG2  5  
ATOM 7298  H HG3  . LYS A 1 20  ? -5.951  12.865  -10.484 1.00 0.00 ? 198 LYS A HG3  5  
ATOM 7299  H HD2  . LYS A 1 20  ? -4.634  12.111  -12.595 1.00 0.00 ? 198 LYS A HD2  5  
ATOM 7300  H HD3  . LYS A 1 20  ? -5.762  10.753  -12.598 1.00 0.00 ? 198 LYS A HD3  5  
ATOM 7301  H HE2  . LYS A 1 20  ? -6.930  12.215  -13.902 1.00 0.00 ? 198 LYS A HE2  5  
ATOM 7302  H HE3  . LYS A 1 20  ? -7.535  12.695  -12.318 1.00 0.00 ? 198 LYS A HE3  5  
ATOM 7303  H HZ1  . LYS A 1 20  ? -6.679  14.708  -12.576 1.00 0.00 ? 198 LYS A HZ1  5  
ATOM 7304  H HZ2  . LYS A 1 20  ? -6.308  14.309  -14.177 1.00 0.00 ? 198 LYS A HZ2  5  
ATOM 7305  H HZ3  . LYS A 1 20  ? -5.150  14.095  -12.962 1.00 0.00 ? 198 LYS A HZ3  5  
ATOM 7306  N N    . PRO A 1 21  ? -1.824  9.439   -9.930  1.00 0.00 ? 199 PRO A N    5  
ATOM 7307  C CA   . PRO A 1 21  ? -0.525  9.141   -9.319  1.00 0.00 ? 199 PRO A CA   5  
ATOM 7308  C C    . PRO A 1 21  ? 0.054   10.340  -8.575  1.00 0.00 ? 199 PRO A C    5  
ATOM 7309  O O    . PRO A 1 21  ? 0.478   11.318  -9.189  1.00 0.00 ? 199 PRO A O    5  
ATOM 7310  C CB   . PRO A 1 21  ? 0.356   8.779   -10.518 1.00 0.00 ? 199 PRO A CB   5  
ATOM 7311  C CG   . PRO A 1 21  ? -0.270  9.480   -11.674 1.00 0.00 ? 199 PRO A CG   5  
ATOM 7312  C CD   . PRO A 1 21  ? -1.749  9.492   -11.400 1.00 0.00 ? 199 PRO A CD   5  
ATOM 7313  H HA   . PRO A 1 21  ? -0.587  8.298   -8.648  1.00 0.00 ? 199 PRO A HA   5  
ATOM 7314  H HB2  . PRO A 1 21  ? 1.365   9.125   -10.344 1.00 0.00 ? 199 PRO A HB2  5  
ATOM 7315  H HB3  . PRO A 1 21  ? 0.356   7.709   -10.659 1.00 0.00 ? 199 PRO A HB3  5  
ATOM 7316  H HG2  . PRO A 1 21  ? 0.107   10.490  -11.739 1.00 0.00 ? 199 PRO A HG2  5  
ATOM 7317  H HG3  . PRO A 1 21  ? -0.062  8.941   -12.586 1.00 0.00 ? 199 PRO A HG3  5  
ATOM 7318  H HD2  . PRO A 1 21  ? -2.195  10.400  -11.777 1.00 0.00 ? 199 PRO A HD2  5  
ATOM 7319  H HD3  . PRO A 1 21  ? -2.221  8.626   -11.840 1.00 0.00 ? 199 PRO A HD3  5  
ATOM 7320  N N    . GLY A 1 22  ? 0.070   10.256  -7.248  1.00 0.00 ? 200 GLY A N    5  
ATOM 7321  C CA   . GLY A 1 22  ? 0.600   11.340  -6.443  1.00 0.00 ? 200 GLY A CA   5  
ATOM 7322  C C    . GLY A 1 22  ? -0.120  11.483  -5.117  1.00 0.00 ? 200 GLY A C    5  
ATOM 7323  O O    . GLY A 1 22  ? 0.336   12.203  -4.229  1.00 0.00 ? 200 GLY A O    5  
ATOM 7324  H H    . GLY A 1 22  ? -0.282  9.451   -6.813  1.00 0.00 ? 200 GLY A H    5  
ATOM 7325  H HA2  . GLY A 1 22  ? 1.647   11.156  -6.254  1.00 0.00 ? 200 GLY A HA2  5  
ATOM 7326  H HA3  . GLY A 1 22  ? 0.501   12.264  -6.994  1.00 0.00 ? 200 GLY A HA3  5  
ATOM 7327  N N    . MET A 1 23  ? -1.251  10.797  -4.982  1.00 0.00 ? 201 MET A N    5  
ATOM 7328  C CA   . MET A 1 23  ? -2.036  10.852  -3.754  1.00 0.00 ? 201 MET A CA   5  
ATOM 7329  C C    . MET A 1 23  ? -1.428  9.955   -2.681  1.00 0.00 ? 201 MET A C    5  
ATOM 7330  O O    . MET A 1 23  ? -0.946  8.859   -2.972  1.00 0.00 ? 201 MET A O    5  
ATOM 7331  C CB   . MET A 1 23  ? -3.481  10.432  -4.029  1.00 0.00 ? 201 MET A CB   5  
ATOM 7332  C CG   . MET A 1 23  ? -4.296  11.494  -4.749  1.00 0.00 ? 201 MET A CG   5  
ATOM 7333  S SD   . MET A 1 23  ? -6.070  11.180  -4.670  1.00 0.00 ? 201 MET A SD   5  
ATOM 7334  C CE   . MET A 1 23  ? -6.424  10.801  -6.384  1.00 0.00 ? 201 MET A CE   5  
ATOM 7335  H H    . MET A 1 23  ? -1.564  10.240  -5.725  1.00 0.00 ? 201 MET A H    5  
ATOM 7336  H HA   . MET A 1 23  ? -2.028  11.872  -3.401  1.00 0.00 ? 201 MET A HA   5  
ATOM 7337  H HB2  . MET A 1 23  ? -3.475  9.539   -4.637  1.00 0.00 ? 201 MET A HB2  5  
ATOM 7338  H HB3  . MET A 1 23  ? -3.965  10.214  -3.088  1.00 0.00 ? 201 MET A HB3  5  
ATOM 7339  H HG2  . MET A 1 23  ? -4.094  12.453  -4.296  1.00 0.00 ? 201 MET A HG2  5  
ATOM 7340  H HG3  . MET A 1 23  ? -3.994  11.517  -5.786  1.00 0.00 ? 201 MET A HG3  5  
ATOM 7341  H HE1  . MET A 1 23  ? -5.777  11.385  -7.023  1.00 0.00 ? 201 MET A HE1  5  
ATOM 7342  H HE2  . MET A 1 23  ? -6.253  9.750   -6.562  1.00 0.00 ? 201 MET A HE2  5  
ATOM 7343  H HE3  . MET A 1 23  ? -7.455  11.040  -6.600  1.00 0.00 ? 201 MET A HE3  5  
ATOM 7344  N N    . LEU A 1 24  ? -1.454  10.425  -1.439  1.00 0.00 ? 202 LEU A N    5  
ATOM 7345  C CA   . LEU A 1 24  ? -0.906  9.665   -0.321  1.00 0.00 ? 202 LEU A CA   5  
ATOM 7346  C C    . LEU A 1 24  ? -2.009  8.922   0.426   1.00 0.00 ? 202 LEU A C    5  
ATOM 7347  O O    . LEU A 1 24  ? -2.815  9.531   1.132   1.00 0.00 ? 202 LEU A O    5  
ATOM 7348  C CB   . LEU A 1 24  ? -0.163  10.596  0.639   1.00 0.00 ? 202 LEU A CB   5  
ATOM 7349  C CG   . LEU A 1 24  ? 1.002   11.386  0.040   1.00 0.00 ? 202 LEU A CG   5  
ATOM 7350  C CD1  . LEU A 1 24  ? 0.511   12.702  -0.543  1.00 0.00 ? 202 LEU A CD1  5  
ATOM 7351  C CD2  . LEU A 1 24  ? 2.074   11.634  1.091   1.00 0.00 ? 202 LEU A CD2  5  
ATOM 7352  H H    . LEU A 1 24  ? -1.851  11.304  -1.268  1.00 0.00 ? 202 LEU A H    5  
ATOM 7353  H HA   . LEU A 1 24  ? -0.209  8.944   -0.721  1.00 0.00 ? 202 LEU A HA   5  
ATOM 7354  H HB2  . LEU A 1 24  ? -0.876  11.305  1.030   1.00 0.00 ? 202 LEU A HB2  5  
ATOM 7355  H HB3  . LEU A 1 24  ? 0.226   9.994   1.448   1.00 0.00 ? 202 LEU A HB3  5  
ATOM 7356  H HG   . LEU A 1 24  ? 1.445   10.811  -0.761  1.00 0.00 ? 202 LEU A HG   5  
ATOM 7357  H HD11 . LEU A 1 24  ? 1.069   12.929  -1.439  1.00 0.00 ? 202 LEU A HD11 5  
ATOM 7358  H HD12 . LEU A 1 24  ? 0.652   13.492  0.180   1.00 0.00 ? 202 LEU A HD12 5  
ATOM 7359  H HD13 . LEU A 1 24  ? -0.539  12.619  -0.784  1.00 0.00 ? 202 LEU A HD13 5  
ATOM 7360  H HD21 . LEU A 1 24  ? 1.695   11.357  2.064   1.00 0.00 ? 202 LEU A HD21 5  
ATOM 7361  H HD22 . LEU A 1 24  ? 2.341   12.681  1.093   1.00 0.00 ? 202 LEU A HD22 5  
ATOM 7362  H HD23 . LEU A 1 24  ? 2.947   11.041  0.862   1.00 0.00 ? 202 LEU A HD23 5  
ATOM 7363  N N    . LEU A 1 25  ? -2.038  7.604   0.268   1.00 0.00 ? 203 LEU A N    5  
ATOM 7364  C CA   . LEU A 1 25  ? -3.042  6.776   0.929   1.00 0.00 ? 203 LEU A CA   5  
ATOM 7365  C C    . LEU A 1 25  ? -2.387  5.797   1.899   1.00 0.00 ? 203 LEU A C    5  
ATOM 7366  O O    . LEU A 1 25  ? -1.463  5.069   1.535   1.00 0.00 ? 203 LEU A O    5  
ATOM 7367  C CB   . LEU A 1 25  ? -3.864  6.010   -0.108  1.00 0.00 ? 203 LEU A CB   5  
ATOM 7368  C CG   . LEU A 1 25  ? -4.896  6.829   -0.884  1.00 0.00 ? 203 LEU A CG   5  
ATOM 7369  C CD1  . LEU A 1 25  ? -5.783  7.613   0.071   1.00 0.00 ? 203 LEU A CD1  5  
ATOM 7370  C CD2  . LEU A 1 25  ? -4.206  7.767   -1.864  1.00 0.00 ? 203 LEU A CD2  5  
ATOM 7371  H H    . LEU A 1 25  ? -1.371  7.175   -0.306  1.00 0.00 ? 203 LEU A H    5  
ATOM 7372  H HA   . LEU A 1 25  ? -3.697  7.430   1.485   1.00 0.00 ? 203 LEU A HA   5  
ATOM 7373  H HB2  . LEU A 1 25  ? -3.178  5.581   -0.823  1.00 0.00 ? 203 LEU A HB2  5  
ATOM 7374  H HB3  . LEU A 1 25  ? -4.388  5.217   0.406   1.00 0.00 ? 203 LEU A HB3  5  
ATOM 7375  H HG   . LEU A 1 25  ? -5.528  6.158   -1.450  1.00 0.00 ? 203 LEU A HG   5  
ATOM 7376  H HD11 . LEU A 1 25  ? -5.666  7.224   1.071   1.00 0.00 ? 203 LEU A HD11 5  
ATOM 7377  H HD12 . LEU A 1 25  ? -6.814  7.517   -0.234  1.00 0.00 ? 203 LEU A HD12 5  
ATOM 7378  H HD13 . LEU A 1 25  ? -5.498  8.655   0.053   1.00 0.00 ? 203 LEU A HD13 5  
ATOM 7379  H HD21 . LEU A 1 25  ? -4.410  7.443   -2.875  1.00 0.00 ? 203 LEU A HD21 5  
ATOM 7380  H HD22 . LEU A 1 25  ? -3.140  7.749   -1.689  1.00 0.00 ? 203 LEU A HD22 5  
ATOM 7381  H HD23 . LEU A 1 25  ? -4.578  8.771   -1.725  1.00 0.00 ? 203 LEU A HD23 5  
ATOM 7382  N N    . THR A 1 26  ? -2.873  5.784   3.136   1.00 0.00 ? 204 THR A N    5  
ATOM 7383  C CA   . THR A 1 26  ? -2.337  4.894   4.158   1.00 0.00 ? 204 THR A CA   5  
ATOM 7384  C C    . THR A 1 26  ? -3.139  3.600   4.237   1.00 0.00 ? 204 THR A C    5  
ATOM 7385  O O    . THR A 1 26  ? -4.367  3.623   4.307   1.00 0.00 ? 204 THR A O    5  
ATOM 7386  C CB   . THR A 1 26  ? -2.333  5.568   5.544   1.00 0.00 ? 204 THR A CB   5  
ATOM 7387  O OG1  . THR A 1 26  ? -1.742  6.869   5.454   1.00 0.00 ? 204 THR A OG1  5  
ATOM 7388  C CG2  . THR A 1 26  ? -1.566  4.726   6.552   1.00 0.00 ? 204 THR A CG2  5  
ATOM 7389  H H    . THR A 1 26  ? -3.610  6.387   3.366   1.00 0.00 ? 204 THR A H    5  
ATOM 7390  H HA   . THR A 1 26  ? -1.316  4.658   3.893   1.00 0.00 ? 204 THR A HA   5  
ATOM 7391  H HB   . THR A 1 26  ? -3.354  5.667   5.882   1.00 0.00 ? 204 THR A HB   5  
ATOM 7392  H HG1  . THR A 1 26  ? -0.891  6.805   5.013   1.00 0.00 ? 204 THR A HG1  5  
ATOM 7393  H HG21 . THR A 1 26  ? -1.176  3.845   6.064   1.00 0.00 ? 204 THR A HG21 5  
ATOM 7394  H HG22 . THR A 1 26  ? -2.229  4.431   7.352   1.00 0.00 ? 204 THR A HG22 5  
ATOM 7395  H HG23 . THR A 1 26  ? -0.749  5.304   6.956   1.00 0.00 ? 204 THR A HG23 5  
ATOM 7396  N N    . GLY A 1 27  ? -2.436  2.471   4.226   1.00 0.00 ? 205 GLY A N    5  
ATOM 7397  C CA   . GLY A 1 27  ? -3.101  1.183   4.298   1.00 0.00 ? 205 GLY A CA   5  
ATOM 7398  C C    . GLY A 1 27  ? -2.401  0.222   5.238   1.00 0.00 ? 205 GLY A C    5  
ATOM 7399  O O    . GLY A 1 27  ? -1.583  0.631   6.062   1.00 0.00 ? 205 GLY A O    5  
ATOM 7400  H H    . GLY A 1 27  ? -1.459  2.514   4.169   1.00 0.00 ? 205 GLY A H    5  
ATOM 7401  H HA2  . GLY A 1 27  ? -4.114  1.331   4.639   1.00 0.00 ? 205 GLY A HA2  5  
ATOM 7402  H HA3  . GLY A 1 27  ? -3.124  0.748   3.309   1.00 0.00 ? 205 GLY A HA3  5  
ATOM 7403  N N    . THR A 1 28  ? -2.725  -1.062  5.118   1.00 0.00 ? 206 THR A N    5  
ATOM 7404  C CA   . THR A 1 28  ? -2.124  -2.084  5.965   1.00 0.00 ? 206 THR A CA   5  
ATOM 7405  C C    . THR A 1 28  ? -1.616  -3.258  5.136   1.00 0.00 ? 206 THR A C    5  
ATOM 7406  O O    . THR A 1 28  ? -2.205  -3.610  4.114   1.00 0.00 ? 206 THR A O    5  
ATOM 7407  C CB   . THR A 1 28  ? -3.127  -2.607  7.012   1.00 0.00 ? 206 THR A CB   5  
ATOM 7408  O OG1  . THR A 1 28  ? -4.406  -2.815  6.403   1.00 0.00 ? 206 THR A OG1  5  
ATOM 7409  C CG2  . THR A 1 28  ? -3.263  -1.626  8.167   1.00 0.00 ? 206 THR A CG2  5  
ATOM 7410  H H    . THR A 1 28  ? -3.384  -1.327  4.442   1.00 0.00 ? 206 THR A H    5  
ATOM 7411  H HA   . THR A 1 28  ? -1.291  -1.637  6.488   1.00 0.00 ? 206 THR A HA   5  
ATOM 7412  H HB   . THR A 1 28  ? -2.763  -3.548  7.399   1.00 0.00 ? 206 THR A HB   5  
ATOM 7413  H HG1  . THR A 1 28  ? -4.836  -1.968  6.264   1.00 0.00 ? 206 THR A HG1  5  
ATOM 7414  H HG21 . THR A 1 28  ? -2.357  -1.046  8.256   1.00 0.00 ? 206 THR A HG21 5  
ATOM 7415  H HG22 . THR A 1 28  ? -3.433  -2.172  9.083   1.00 0.00 ? 206 THR A HG22 5  
ATOM 7416  H HG23 . THR A 1 28  ? -4.097  -0.966  7.981   1.00 0.00 ? 206 THR A HG23 5  
ATOM 7417  N N    . VAL A 1 29  ? -0.518  -3.860  5.582   1.00 0.00 ? 207 VAL A N    5  
ATOM 7418  C CA   . VAL A 1 29  ? 0.069   -4.996  4.881   1.00 0.00 ? 207 VAL A CA   5  
ATOM 7419  C C    . VAL A 1 29  ? -0.874  -6.193  4.888   1.00 0.00 ? 207 VAL A C    5  
ATOM 7420  O O    . VAL A 1 29  ? -1.269  -6.680  5.947   1.00 0.00 ? 207 VAL A O    5  
ATOM 7421  C CB   . VAL A 1 29  ? 1.412   -5.411  5.510   1.00 0.00 ? 207 VAL A CB   5  
ATOM 7422  C CG1  . VAL A 1 29  ? 2.000   -6.606  4.776   1.00 0.00 ? 207 VAL A CG1  5  
ATOM 7423  C CG2  . VAL A 1 29  ? 2.385   -4.241  5.507   1.00 0.00 ? 207 VAL A CG2  5  
ATOM 7424  H H    . VAL A 1 29  ? -0.093  -3.533  6.402   1.00 0.00 ? 207 VAL A H    5  
ATOM 7425  H HA   . VAL A 1 29  ? 0.252   -4.699  3.858   1.00 0.00 ? 207 VAL A HA   5  
ATOM 7426  H HB   . VAL A 1 29  ? 1.232   -5.699  6.536   1.00 0.00 ? 207 VAL A HB   5  
ATOM 7427  H HG11 . VAL A 1 29  ? 2.853   -6.981  5.323   1.00 0.00 ? 207 VAL A HG11 5  
ATOM 7428  H HG12 . VAL A 1 29  ? 1.253   -7.382  4.695   1.00 0.00 ? 207 VAL A HG12 5  
ATOM 7429  H HG13 . VAL A 1 29  ? 2.313   -6.303  3.788   1.00 0.00 ? 207 VAL A HG13 5  
ATOM 7430  H HG21 . VAL A 1 29  ? 2.511   -3.876  6.516   1.00 0.00 ? 207 VAL A HG21 5  
ATOM 7431  H HG22 . VAL A 1 29  ? 3.340   -4.568  5.121   1.00 0.00 ? 207 VAL A HG22 5  
ATOM 7432  H HG23 . VAL A 1 29  ? 1.997   -3.451  4.883   1.00 0.00 ? 207 VAL A HG23 5  
ATOM 7433  N N    . SER A 1 30  ? -1.232  -6.665  3.697   1.00 0.00 ? 208 SER A N    5  
ATOM 7434  C CA   . SER A 1 30  ? -2.132  -7.804  3.566   1.00 0.00 ? 208 SER A CA   5  
ATOM 7435  C C    . SER A 1 30  ? -1.360  -9.118  3.635   1.00 0.00 ? 208 SER A C    5  
ATOM 7436  O O    . SER A 1 30  ? -1.786  -10.068 4.292   1.00 0.00 ? 208 SER A O    5  
ATOM 7437  C CB   . SER A 1 30  ? -2.904  -7.722  2.247   1.00 0.00 ? 208 SER A CB   5  
ATOM 7438  O OG   . SER A 1 30  ? -4.168  -8.353  2.355   1.00 0.00 ? 208 SER A OG   5  
ATOM 7439  H H    . SER A 1 30  ? -0.884  -6.234  2.889   1.00 0.00 ? 208 SER A H    5  
ATOM 7440  H HA   . SER A 1 30  ? -2.834  -7.769  4.386   1.00 0.00 ? 208 SER A HA   5  
ATOM 7441  H HB2  . SER A 1 30  ? -3.053  -6.686  1.984   1.00 0.00 ? 208 SER A HB2  5  
ATOM 7442  H HB3  . SER A 1 30  ? -2.335  -8.212  1.470   1.00 0.00 ? 208 SER A HB3  5  
ATOM 7443  H HG   . SER A 1 30  ? -4.136  -9.018  3.047   1.00 0.00 ? 208 SER A HG   5  
ATOM 7444  N N    . SER A 1 31  ? -0.221  -9.164  2.952   1.00 0.00 ? 209 SER A N    5  
ATOM 7445  C CA   . SER A 1 31  ? 0.611   -10.362 2.932   1.00 0.00 ? 209 SER A CA   5  
ATOM 7446  C C    . SER A 1 31  ? 2.056   -10.014 2.590   1.00 0.00 ? 209 SER A C    5  
ATOM 7447  O O    . SER A 1 31  ? 2.329   -8.990  1.962   1.00 0.00 ? 209 SER A O    5  
ATOM 7448  C CB   . SER A 1 31  ? 0.064   -11.371 1.921   1.00 0.00 ? 209 SER A CB   5  
ATOM 7449  O OG   . SER A 1 31  ? -1.023  -12.100 2.464   1.00 0.00 ? 209 SER A OG   5  
ATOM 7450  H H    . SER A 1 31  ? 0.066   -8.374  2.447   1.00 0.00 ? 209 SER A H    5  
ATOM 7451  H HA   . SER A 1 31  ? 0.582   -10.801 3.918   1.00 0.00 ? 209 SER A HA   5  
ATOM 7452  H HB2  . SER A 1 31  ? -0.274  -10.847 1.040   1.00 0.00 ? 209 SER A HB2  5  
ATOM 7453  H HB3  . SER A 1 31  ? 0.847   -12.064 1.649   1.00 0.00 ? 209 SER A HB3  5  
ATOM 7454  H HG   . SER A 1 31  ? -1.847  -11.663 2.238   1.00 0.00 ? 209 SER A HG   5  
ATOM 7455  N N    . LEU A 1 32  ? 2.980   -10.873 3.007   1.00 0.00 ? 210 LEU A N    5  
ATOM 7456  C CA   . LEU A 1 32  ? 4.399   -10.659 2.746   1.00 0.00 ? 210 LEU A CA   5  
ATOM 7457  C C    . LEU A 1 32  ? 4.904   -11.613 1.669   1.00 0.00 ? 210 LEU A C    5  
ATOM 7458  O O    . LEU A 1 32  ? 4.758   -12.829 1.786   1.00 0.00 ? 210 LEU A O    5  
ATOM 7459  C CB   . LEU A 1 32  ? 5.208   -10.846 4.030   1.00 0.00 ? 210 LEU A CB   5  
ATOM 7460  C CG   . LEU A 1 32  ? 5.215   -9.662  4.997   1.00 0.00 ? 210 LEU A CG   5  
ATOM 7461  C CD1  . LEU A 1 32  ? 3.956   -9.662  5.850   1.00 0.00 ? 210 LEU A CD1  5  
ATOM 7462  C CD2  . LEU A 1 32  ? 6.457   -9.699  5.876   1.00 0.00 ? 210 LEU A CD2  5  
ATOM 7463  H H    . LEU A 1 32  ? 2.701   -11.671 3.502   1.00 0.00 ? 210 LEU A H    5  
ATOM 7464  H HA   . LEU A 1 32  ? 4.521   -9.644  2.397   1.00 0.00 ? 210 LEU A HA   5  
ATOM 7465  H HB2  . LEU A 1 32  ? 4.804   -11.698 4.554   1.00 0.00 ? 210 LEU A HB2  5  
ATOM 7466  H HB3  . LEU A 1 32  ? 6.231   -11.051 3.748   1.00 0.00 ? 210 LEU A HB3  5  
ATOM 7467  H HG   . LEU A 1 32  ? 5.233   -8.742  4.430   1.00 0.00 ? 210 LEU A HG   5  
ATOM 7468  H HD11 . LEU A 1 32  ? 4.003   -10.473 6.560   1.00 0.00 ? 210 LEU A HD11 5  
ATOM 7469  H HD12 . LEU A 1 32  ? 3.092   -9.787  5.216   1.00 0.00 ? 210 LEU A HD12 5  
ATOM 7470  H HD13 . LEU A 1 32  ? 3.880   -8.723  6.380   1.00 0.00 ? 210 LEU A HD13 5  
ATOM 7471  H HD21 . LEU A 1 32  ? 6.300   -10.389 6.692   1.00 0.00 ? 210 LEU A HD21 5  
ATOM 7472  H HD22 . LEU A 1 32  ? 6.647   -8.712  6.272   1.00 0.00 ? 210 LEU A HD22 5  
ATOM 7473  H HD23 . LEU A 1 32  ? 7.304   -10.021 5.289   1.00 0.00 ? 210 LEU A HD23 5  
ATOM 7474  N N    . GLU A 1 33  ? 5.501   -11.053 0.621   1.00 0.00 ? 211 GLU A N    5  
ATOM 7475  C CA   . GLU A 1 33  ? 6.029   -11.855 -0.476  1.00 0.00 ? 211 GLU A CA   5  
ATOM 7476  C C    . GLU A 1 33  ? 7.543   -11.694 -0.588  1.00 0.00 ? 211 GLU A C    5  
ATOM 7477  O O    . GLU A 1 33  ? 8.118   -10.746 -0.053  1.00 0.00 ? 211 GLU A O    5  
ATOM 7478  C CB   . GLU A 1 33  ? 5.364   -11.457 -1.795  1.00 0.00 ? 211 GLU A CB   5  
ATOM 7479  C CG   . GLU A 1 33  ? 4.014   -12.117 -2.020  1.00 0.00 ? 211 GLU A CG   5  
ATOM 7480  C CD   . GLU A 1 33  ? 3.691   -12.298 -3.490  1.00 0.00 ? 211 GLU A CD   5  
ATOM 7481  O OE1  . GLU A 1 33  ? 4.187   -13.274 -4.090  1.00 0.00 ? 211 GLU A OE1  5  
ATOM 7482  O OE2  . GLU A 1 33  ? 2.943   -11.463 -4.041  1.00 0.00 ? 211 GLU A OE2  5  
ATOM 7483  H H    . GLU A 1 33  ? 5.587   -10.077 0.585   1.00 0.00 ? 211 GLU A H    5  
ATOM 7484  H HA   . GLU A 1 33  ? 5.804   -12.890 -0.268  1.00 0.00 ? 211 GLU A HA   5  
ATOM 7485  H HB2  . GLU A 1 33  ? 5.225   -10.386 -1.805  1.00 0.00 ? 211 GLU A HB2  5  
ATOM 7486  H HB3  . GLU A 1 33  ? 6.016   -11.733 -2.610  1.00 0.00 ? 211 GLU A HB3  5  
ATOM 7487  H HG2  . GLU A 1 33  ? 4.019   -13.087 -1.546  1.00 0.00 ? 211 GLU A HG2  5  
ATOM 7488  H HG3  . GLU A 1 33  ? 3.248   -11.502 -1.571  1.00 0.00 ? 211 GLU A HG3  5  
ATOM 7489  N N    . ASP A 1 34  ? 8.181   -12.627 -1.285  1.00 0.00 ? 212 ASP A N    5  
ATOM 7490  C CA   . ASP A 1 34  ? 9.627   -12.590 -1.468  1.00 0.00 ? 212 ASP A CA   5  
ATOM 7491  C C    . ASP A 1 34  ? 10.005  -11.670 -2.624  1.00 0.00 ? 212 ASP A C    5  
ATOM 7492  O O    . ASP A 1 34  ? 11.128  -11.169 -2.692  1.00 0.00 ? 212 ASP A O    5  
ATOM 7493  C CB   . ASP A 1 34  ? 10.167  -13.998 -1.724  1.00 0.00 ? 212 ASP A CB   5  
ATOM 7494  C CG   . ASP A 1 34  ? 10.009  -14.906 -0.520  1.00 0.00 ? 212 ASP A CG   5  
ATOM 7495  O OD1  . ASP A 1 34  ? 8.855   -15.156 -0.113  1.00 0.00 ? 212 ASP A OD1  5  
ATOM 7496  O OD2  . ASP A 1 34  ? 11.039  -15.366 0.016   1.00 0.00 ? 212 ASP A OD2  5  
ATOM 7497  H H    . ASP A 1 34  ? 7.667   -13.359 -1.687  1.00 0.00 ? 212 ASP A H    5  
ATOM 7498  H HA   . ASP A 1 34  ? 10.066  -12.205 -0.560  1.00 0.00 ? 212 ASP A HA   5  
ATOM 7499  H HB2  . ASP A 1 34  ? 9.632   -14.436 -2.554  1.00 0.00 ? 212 ASP A HB2  5  
ATOM 7500  H HB3  . ASP A 1 34  ? 11.217  -13.935 -1.969  1.00 0.00 ? 212 ASP A HB3  5  
ATOM 7501  N N    . HIS A 1 35  ? 9.060   -11.451 -3.534  1.00 0.00 ? 213 HIS A N    5  
ATOM 7502  C CA   . HIS A 1 35  ? 9.294   -10.591 -4.688  1.00 0.00 ? 213 HIS A CA   5  
ATOM 7503  C C    . HIS A 1 35  ? 8.784   -9.178  -4.425  1.00 0.00 ? 213 HIS A C    5  
ATOM 7504  O O    . HIS A 1 35  ? 9.046   -8.258  -5.199  1.00 0.00 ? 213 HIS A O    5  
ATOM 7505  C CB   . HIS A 1 35  ? 8.611   -11.169 -5.928  1.00 0.00 ? 213 HIS A CB   5  
ATOM 7506  C CG   . HIS A 1 35  ? 9.071   -12.552 -6.275  1.00 0.00 ? 213 HIS A CG   5  
ATOM 7507  N ND1  . HIS A 1 35  ? 10.325  -12.824 -6.778  1.00 0.00 ? 213 HIS A ND1  5  
ATOM 7508  C CD2  . HIS A 1 35  ? 8.436   -13.744 -6.187  1.00 0.00 ? 213 HIS A CD2  5  
ATOM 7509  C CE1  . HIS A 1 35  ? 10.442  -14.124 -6.986  1.00 0.00 ? 213 HIS A CE1  5  
ATOM 7510  N NE2  . HIS A 1 35  ? 9.309   -14.705 -6.635  1.00 0.00 ? 213 HIS A NE2  5  
ATOM 7511  H H    . HIS A 1 35  ? 8.185   -11.879 -3.425  1.00 0.00 ? 213 HIS A H    5  
ATOM 7512  H HA   . HIS A 1 35  ? 10.359  -10.550 -4.861  1.00 0.00 ? 213 HIS A HA   5  
ATOM 7513  H HB2  . HIS A 1 35  ? 7.545   -11.207 -5.759  1.00 0.00 ? 213 HIS A HB2  5  
ATOM 7514  H HB3  . HIS A 1 35  ? 8.815   -10.529 -6.775  1.00 0.00 ? 213 HIS A HB3  5  
ATOM 7515  H HD1  . HIS A 1 35  ? 11.026  -12.163 -6.957  1.00 0.00 ? 213 HIS A HD1  5  
ATOM 7516  H HD2  . HIS A 1 35  ? 7.428   -13.910 -5.831  1.00 0.00 ? 213 HIS A HD2  5  
ATOM 7517  H HE1  . HIS A 1 35  ? 11.314  -14.626 -7.376  1.00 0.00 ? 213 HIS A HE1  5  
ATOM 7518  H HE2  . HIS A 1 35  ? 9.096   -15.652 -6.768  1.00 0.00 ? 213 HIS A HE2  5  
ATOM 7519  N N    . GLY A 1 36  ? 8.054   -9.012  -3.326  1.00 0.00 ? 214 GLY A N    5  
ATOM 7520  C CA   . GLY A 1 36  ? 7.518   -7.708  -2.981  1.00 0.00 ? 214 GLY A CA   5  
ATOM 7521  C C    . GLY A 1 36  ? 6.663   -7.745  -1.730  1.00 0.00 ? 214 GLY A C    5  
ATOM 7522  O O    . GLY A 1 36  ? 6.749   -8.685  -0.939  1.00 0.00 ? 214 GLY A O    5  
ATOM 7523  H H    . GLY A 1 36  ? 7.877   -9.782  -2.745  1.00 0.00 ? 214 GLY A H    5  
ATOM 7524  H HA2  . GLY A 1 36  ? 8.339   -7.024  -2.823  1.00 0.00 ? 214 GLY A HA2  5  
ATOM 7525  H HA3  . GLY A 1 36  ? 6.917   -7.349  -3.803  1.00 0.00 ? 214 GLY A HA3  5  
ATOM 7526  N N    . TYR A 1 37  ? 5.836   -6.722  -1.550  1.00 0.00 ? 215 TYR A N    5  
ATOM 7527  C CA   . TYR A 1 37  ? 4.964   -6.639  -0.385  1.00 0.00 ? 215 TYR A CA   5  
ATOM 7528  C C    . TYR A 1 37  ? 3.540   -6.276  -0.794  1.00 0.00 ? 215 TYR A C    5  
ATOM 7529  O O    . TYR A 1 37  ? 3.327   -5.410  -1.644  1.00 0.00 ? 215 TYR A O    5  
ATOM 7530  C CB   . TYR A 1 37  ? 5.500   -5.605  0.607   1.00 0.00 ? 215 TYR A CB   5  
ATOM 7531  C CG   . TYR A 1 37  ? 6.765   -6.041  1.312   1.00 0.00 ? 215 TYR A CG   5  
ATOM 7532  C CD1  . TYR A 1 37  ? 8.015   -5.765  0.771   1.00 0.00 ? 215 TYR A CD1  5  
ATOM 7533  C CD2  . TYR A 1 37  ? 6.710   -6.727  2.518   1.00 0.00 ? 215 TYR A CD2  5  
ATOM 7534  C CE1  . TYR A 1 37  ? 9.173   -6.162  1.412   1.00 0.00 ? 215 TYR A CE1  5  
ATOM 7535  C CE2  . TYR A 1 37  ? 7.862   -7.127  3.166   1.00 0.00 ? 215 TYR A CE2  5  
ATOM 7536  C CZ   . TYR A 1 37  ? 9.091   -6.842  2.609   1.00 0.00 ? 215 TYR A CZ   5  
ATOM 7537  O OH   . TYR A 1 37  ? 10.243  -7.238  3.250   1.00 0.00 ? 215 TYR A OH   5  
ATOM 7538  H H    . TYR A 1 37  ? 5.812   -6.003  -2.216  1.00 0.00 ? 215 TYR A H    5  
ATOM 7539  H HA   . TYR A 1 37  ? 4.954   -7.608  0.091   1.00 0.00 ? 215 TYR A HA   5  
ATOM 7540  H HB2  . TYR A 1 37  ? 5.714   -4.688  0.080   1.00 0.00 ? 215 TYR A HB2  5  
ATOM 7541  H HB3  . TYR A 1 37  ? 4.749   -5.415  1.360   1.00 0.00 ? 215 TYR A HB3  5  
ATOM 7542  H HD1  . TYR A 1 37  ? 8.075   -5.231  -0.166  1.00 0.00 ? 215 TYR A HD1  5  
ATOM 7543  H HD2  . TYR A 1 37  ? 5.745   -6.949  2.953   1.00 0.00 ? 215 TYR A HD2  5  
ATOM 7544  H HE1  . TYR A 1 37  ? 10.135  -5.939  0.975   1.00 0.00 ? 215 TYR A HE1  5  
ATOM 7545  H HE2  . TYR A 1 37  ? 7.799   -7.660  4.103   1.00 0.00 ? 215 TYR A HE2  5  
ATOM 7546  H HH   . TYR A 1 37  ? 10.131  -7.139  4.198   1.00 0.00 ? 215 TYR A HH   5  
ATOM 7547  N N    . LEU A 1 38  ? 2.567   -6.945  -0.184  1.00 0.00 ? 216 LEU A N    5  
ATOM 7548  C CA   . LEU A 1 38  ? 1.162   -6.694  -0.484  1.00 0.00 ? 216 LEU A CA   5  
ATOM 7549  C C    . LEU A 1 38  ? 0.590   -5.625  0.442   1.00 0.00 ? 216 LEU A C    5  
ATOM 7550  O O    . LEU A 1 38  ? 0.739   -5.701  1.661   1.00 0.00 ? 216 LEU A O    5  
ATOM 7551  C CB   . LEU A 1 38  ? 0.353   -7.986  -0.350  1.00 0.00 ? 216 LEU A CB   5  
ATOM 7552  C CG   . LEU A 1 38  ? 0.323   -8.890  -1.583  1.00 0.00 ? 216 LEU A CG   5  
ATOM 7553  C CD1  . LEU A 1 38  ? -0.674  -8.367  -2.604  1.00 0.00 ? 216 LEU A CD1  5  
ATOM 7554  C CD2  . LEU A 1 38  ? 1.711   -9.000  -2.197  1.00 0.00 ? 216 LEU A CD2  5  
ATOM 7555  H H    . LEU A 1 38  ? 2.799   -7.624  0.483   1.00 0.00 ? 216 LEU A H    5  
ATOM 7556  H HA   . LEU A 1 38  ? 1.098   -6.343  -1.503  1.00 0.00 ? 216 LEU A HA   5  
ATOM 7557  H HB2  . LEU A 1 38  ? 0.771   -8.555  0.467   1.00 0.00 ? 216 LEU A HB2  5  
ATOM 7558  H HB3  . LEU A 1 38  ? -0.666  -7.714  -0.112  1.00 0.00 ? 216 LEU A HB3  5  
ATOM 7559  H HG   . LEU A 1 38  ? 0.008   -9.881  -1.287  1.00 0.00 ? 216 LEU A HG   5  
ATOM 7560  H HD11 . LEU A 1 38  ? -0.146  -7.850  -3.391  1.00 0.00 ? 216 LEU A HD11 5  
ATOM 7561  H HD12 . LEU A 1 38  ? -1.359  -7.685  -2.122  1.00 0.00 ? 216 LEU A HD12 5  
ATOM 7562  H HD13 . LEU A 1 38  ? -1.227  -9.195  -3.024  1.00 0.00 ? 216 LEU A HD13 5  
ATOM 7563  H HD21 . LEU A 1 38  ? 2.124   -8.011  -2.331  1.00 0.00 ? 216 LEU A HD21 5  
ATOM 7564  H HD22 . LEU A 1 38  ? 1.642   -9.494  -3.156  1.00 0.00 ? 216 LEU A HD22 5  
ATOM 7565  H HD23 . LEU A 1 38  ? 2.351   -9.572  -1.542  1.00 0.00 ? 216 LEU A HD23 5  
ATOM 7566  N N    . VAL A 1 39  ? -0.066  -4.630  -0.147  1.00 0.00 ? 217 VAL A N    5  
ATOM 7567  C CA   . VAL A 1 39  ? -0.663  -3.546  0.625   1.00 0.00 ? 217 VAL A CA   5  
ATOM 7568  C C    . VAL A 1 39  ? -2.183  -3.559  0.504   1.00 0.00 ? 217 VAL A C    5  
ATOM 7569  O O    . VAL A 1 39  ? -2.729  -3.857  -0.558  1.00 0.00 ? 217 VAL A O    5  
ATOM 7570  C CB   . VAL A 1 39  ? -0.134  -2.174  0.168   1.00 0.00 ? 217 VAL A CB   5  
ATOM 7571  C CG1  . VAL A 1 39  ? -0.684  -1.067  1.055   1.00 0.00 ? 217 VAL A CG1  5  
ATOM 7572  C CG2  . VAL A 1 39  ? 1.388   -2.163  0.170   1.00 0.00 ? 217 VAL A CG2  5  
ATOM 7573  H H    . VAL A 1 39  ? -0.151  -4.625  -1.123  1.00 0.00 ? 217 VAL A H    5  
ATOM 7574  H HA   . VAL A 1 39  ? -0.393  -3.686  1.662   1.00 0.00 ? 217 VAL A HA   5  
ATOM 7575  H HB   . VAL A 1 39  ? -0.473  -1.998  -0.842  1.00 0.00 ? 217 VAL A HB   5  
ATOM 7576  H HG11 . VAL A 1 39  ? -1.496  -0.569  0.545   1.00 0.00 ? 217 VAL A HG11 5  
ATOM 7577  H HG12 . VAL A 1 39  ? -1.045  -1.492  1.980   1.00 0.00 ? 217 VAL A HG12 5  
ATOM 7578  H HG13 . VAL A 1 39  ? 0.098   -0.354  1.267   1.00 0.00 ? 217 VAL A HG13 5  
ATOM 7579  H HG21 . VAL A 1 39  ? 1.751   -2.870  0.901   1.00 0.00 ? 217 VAL A HG21 5  
ATOM 7580  H HG22 . VAL A 1 39  ? 1.751   -2.438  -0.809  1.00 0.00 ? 217 VAL A HG22 5  
ATOM 7581  H HG23 . VAL A 1 39  ? 1.740   -1.173  0.420   1.00 0.00 ? 217 VAL A HG23 5  
ATOM 7582  N N    . ASP A 1 40  ? -2.860  -3.231  1.599   1.00 0.00 ? 218 ASP A N    5  
ATOM 7583  C CA   . ASP A 1 40  ? -4.318  -3.203  1.616   1.00 0.00 ? 218 ASP A CA   5  
ATOM 7584  C C    . ASP A 1 40  ? -4.837  -1.796  1.333   1.00 0.00 ? 218 ASP A C    5  
ATOM 7585  O O    . ASP A 1 40  ? -4.352  -0.819  1.904   1.00 0.00 ? 218 ASP A O    5  
ATOM 7586  C CB   . ASP A 1 40  ? -4.844  -3.692  2.966   1.00 0.00 ? 218 ASP A CB   5  
ATOM 7587  C CG   . ASP A 1 40  ? -6.200  -4.360  2.852   1.00 0.00 ? 218 ASP A CG   5  
ATOM 7588  O OD1  . ASP A 1 40  ? -6.273  -5.454  2.256   1.00 0.00 ? 218 ASP A OD1  5  
ATOM 7589  O OD2  . ASP A 1 40  ? -7.188  -3.788  3.358   1.00 0.00 ? 218 ASP A OD2  5  
ATOM 7590  H H    . ASP A 1 40  ? -2.368  -3.003  2.415   1.00 0.00 ? 218 ASP A H    5  
ATOM 7591  H HA   . ASP A 1 40  ? -4.672  -3.865  0.841   1.00 0.00 ? 218 ASP A HA   5  
ATOM 7592  H HB2  . ASP A 1 40  ? -4.146  -4.406  3.380   1.00 0.00 ? 218 ASP A HB2  5  
ATOM 7593  H HB3  . ASP A 1 40  ? -4.932  -2.850  3.637   1.00 0.00 ? 218 ASP A HB3  5  
ATOM 7594  N N    . ILE A 1 41  ? -5.825  -1.702  0.450   1.00 0.00 ? 219 ILE A N    5  
ATOM 7595  C CA   . ILE A 1 41  ? -6.409  -0.415  0.092   1.00 0.00 ? 219 ILE A CA   5  
ATOM 7596  C C    . ILE A 1 41  ? -7.920  -0.421  0.301   1.00 0.00 ? 219 ILE A C    5  
ATOM 7597  O O    . ILE A 1 41  ? -8.548  0.633   0.395   1.00 0.00 ? 219 ILE A O    5  
ATOM 7598  C CB   . ILE A 1 41  ? -6.106  -0.047  -1.372  1.00 0.00 ? 219 ILE A CB   5  
ATOM 7599  C CG1  . ILE A 1 41  ? -6.565  -1.166  -2.308  1.00 0.00 ? 219 ILE A CG1  5  
ATOM 7600  C CG2  . ILE A 1 41  ? -4.620  0.227   -1.552  1.00 0.00 ? 219 ILE A CG2  5  
ATOM 7601  C CD1  . ILE A 1 41  ? -6.356  -0.853  -3.773  1.00 0.00 ? 219 ILE A CD1  5  
ATOM 7602  H H    . ILE A 1 41  ? -6.169  -2.517  0.029   1.00 0.00 ? 219 ILE A H    5  
ATOM 7603  H HA   . ILE A 1 41  ? -5.971  0.338   0.731   1.00 0.00 ? 219 ILE A HA   5  
ATOM 7604  H HB   . ILE A 1 41  ? -6.646  0.857   -1.612  1.00 0.00 ? 219 ILE A HB   5  
ATOM 7605  H HG12 . ILE A 1 41  ? -6.014  -2.066  -2.081  1.00 0.00 ? 219 ILE A HG12 5  
ATOM 7606  H HG13 . ILE A 1 41  ? -7.619  -1.346  -2.153  1.00 0.00 ? 219 ILE A HG13 5  
ATOM 7607  H HG21 . ILE A 1 41  ? -4.224  -0.428  -2.314  1.00 0.00 ? 219 ILE A HG21 5  
ATOM 7608  H HG22 . ILE A 1 41  ? -4.478  1.254   -1.853  1.00 0.00 ? 219 ILE A HG22 5  
ATOM 7609  H HG23 . ILE A 1 41  ? -4.105  0.050   -0.620  1.00 0.00 ? 219 ILE A HG23 5  
ATOM 7610  H HD11 . ILE A 1 41  ? -5.320  -1.015  -4.033  1.00 0.00 ? 219 ILE A HD11 5  
ATOM 7611  H HD12 . ILE A 1 41  ? -6.983  -1.495  -4.373  1.00 0.00 ? 219 ILE A HD12 5  
ATOM 7612  H HD13 . ILE A 1 41  ? -6.615  0.180   -3.961  1.00 0.00 ? 219 ILE A HD13 5  
ATOM 7613  N N    . GLY A 1 42  ? -8.498  -1.616  0.374   1.00 0.00 ? 220 GLY A N    5  
ATOM 7614  C CA   . GLY A 1 42  ? -9.930  -1.736  0.573   1.00 0.00 ? 220 GLY A CA   5  
ATOM 7615  C C    . GLY A 1 42  ? -10.723 -1.320  -0.650  1.00 0.00 ? 220 GLY A C    5  
ATOM 7616  O O    . GLY A 1 42  ? -11.635 -0.498  -0.558  1.00 0.00 ? 220 GLY A O    5  
ATOM 7617  H H    . GLY A 1 42  ? -7.947  -2.422  0.292   1.00 0.00 ? 220 GLY A H    5  
ATOM 7618  H HA2  . GLY A 1 42  ? -10.165 -2.764  0.809   1.00 0.00 ? 220 GLY A HA2  5  
ATOM 7619  H HA3  . GLY A 1 42  ? -10.220 -1.112  1.405   1.00 0.00 ? 220 GLY A HA3  5  
ATOM 7620  N N    . VAL A 1 43  ? -10.373 -1.887  -1.801  1.00 0.00 ? 221 VAL A N    5  
ATOM 7621  C CA   . VAL A 1 43  ? -11.058 -1.569  -3.048  1.00 0.00 ? 221 VAL A CA   5  
ATOM 7622  C C    . VAL A 1 43  ? -11.496 -2.837  -3.773  1.00 0.00 ? 221 VAL A C    5  
ATOM 7623  O O    . VAL A 1 43  ? -10.856 -3.883  -3.658  1.00 0.00 ? 221 VAL A O    5  
ATOM 7624  C CB   . VAL A 1 43  ? -10.161 -0.739  -3.986  1.00 0.00 ? 221 VAL A CB   5  
ATOM 7625  C CG1  . VAL A 1 43  ? -10.871 -0.468  -5.303  1.00 0.00 ? 221 VAL A CG1  5  
ATOM 7626  C CG2  . VAL A 1 43  ? -9.749  0.562   -3.314  1.00 0.00 ? 221 VAL A CG2  5  
ATOM 7627  H H    . VAL A 1 43  ? -9.638  -2.534  -1.811  1.00 0.00 ? 221 VAL A H    5  
ATOM 7628  H HA   . VAL A 1 43  ? -11.933 -0.983  -2.809  1.00 0.00 ? 221 VAL A HA   5  
ATOM 7629  H HB   . VAL A 1 43  ? -9.268  -1.310  -4.195  1.00 0.00 ? 221 VAL A HB   5  
ATOM 7630  H HG11 . VAL A 1 43  ? -10.679 -1.279  -5.989  1.00 0.00 ? 221 VAL A HG11 5  
ATOM 7631  H HG12 . VAL A 1 43  ? -11.934 -0.386  -5.129  1.00 0.00 ? 221 VAL A HG12 5  
ATOM 7632  H HG13 . VAL A 1 43  ? -10.504 0.456   -5.726  1.00 0.00 ? 221 VAL A HG13 5  
ATOM 7633  H HG21 . VAL A 1 43  ? -8.805  0.893   -3.721  1.00 0.00 ? 221 VAL A HG21 5  
ATOM 7634  H HG22 . VAL A 1 43  ? -10.503 1.315   -3.495  1.00 0.00 ? 221 VAL A HG22 5  
ATOM 7635  H HG23 . VAL A 1 43  ? -9.648  0.403   -2.251  1.00 0.00 ? 221 VAL A HG23 5  
ATOM 7636  N N    . ASP A 1 44  ? -12.590 -2.737  -4.520  1.00 0.00 ? 222 ASP A N    5  
ATOM 7637  C CA   . ASP A 1 44  ? -13.114 -3.876  -5.265  1.00 0.00 ? 222 ASP A CA   5  
ATOM 7638  C C    . ASP A 1 44  ? -12.582 -3.880  -6.695  1.00 0.00 ? 222 ASP A C    5  
ATOM 7639  O O    . ASP A 1 44  ? -12.816 -2.943  -7.458  1.00 0.00 ? 222 ASP A O    5  
ATOM 7640  C CB   . ASP A 1 44  ? -14.643 -3.846  -5.276  1.00 0.00 ? 222 ASP A CB   5  
ATOM 7641  C CG   . ASP A 1 44  ? -15.244 -4.539  -4.070  1.00 0.00 ? 222 ASP A CG   5  
ATOM 7642  O OD1  . ASP A 1 44  ? -14.649 -5.530  -3.597  1.00 0.00 ? 222 ASP A OD1  5  
ATOM 7643  O OD2  . ASP A 1 44  ? -16.309 -4.090  -3.598  1.00 0.00 ? 222 ASP A OD2  5  
ATOM 7644  H H    . ASP A 1 44  ? -13.057 -1.877  -4.571  1.00 0.00 ? 222 ASP A H    5  
ATOM 7645  H HA   . ASP A 1 44  ? -12.784 -4.777  -4.770  1.00 0.00 ? 222 ASP A HA   5  
ATOM 7646  H HB2  . ASP A 1 44  ? -14.976 -2.818  -5.281  1.00 0.00 ? 222 ASP A HB2  5  
ATOM 7647  H HB3  . ASP A 1 44  ? -14.999 -4.340  -6.168  1.00 0.00 ? 222 ASP A HB3  5  
ATOM 7648  N N    . GLY A 1 45  ? -11.864 -4.941  -7.052  1.00 0.00 ? 223 GLY A N    5  
ATOM 7649  C CA   . GLY A 1 45  ? -11.310 -5.046  -8.388  1.00 0.00 ? 223 GLY A CA   5  
ATOM 7650  C C    . GLY A 1 45  ? -10.065 -4.200  -8.568  1.00 0.00 ? 223 GLY A C    5  
ATOM 7651  O O    . GLY A 1 45  ? -9.907  -3.521  -9.584  1.00 0.00 ? 223 GLY A O    5  
ATOM 7652  H H    . GLY A 1 45  ? -11.710 -5.658  -6.401  1.00 0.00 ? 223 GLY A H    5  
ATOM 7653  H HA2  . GLY A 1 45  ? -11.062 -6.079  -8.583  1.00 0.00 ? 223 GLY A HA2  5  
ATOM 7654  H HA3  . GLY A 1 45  ? -12.055 -4.725  -9.101  1.00 0.00 ? 223 GLY A HA3  5  
ATOM 7655  N N    . THR A 1 46  ? -9.178  -4.237  -7.579  1.00 0.00 ? 224 THR A N    5  
ATOM 7656  C CA   . THR A 1 46  ? -7.943  -3.466  -7.631  1.00 0.00 ? 224 THR A CA   5  
ATOM 7657  C C    . THR A 1 46  ? -6.864  -4.096  -6.758  1.00 0.00 ? 224 THR A C    5  
ATOM 7658  O O    . THR A 1 46  ? -7.062  -4.301  -5.560  1.00 0.00 ? 224 THR A O    5  
ATOM 7659  C CB   . THR A 1 46  ? -8.169  -2.011  -7.177  1.00 0.00 ? 224 THR A CB   5  
ATOM 7660  O OG1  . THR A 1 46  ? -9.168  -1.392  -7.996  1.00 0.00 ? 224 THR A OG1  5  
ATOM 7661  C CG2  . THR A 1 46  ? -6.877  -1.213  -7.254  1.00 0.00 ? 224 THR A CG2  5  
ATOM 7662  H H    . THR A 1 46  ? -9.361  -4.797  -6.795  1.00 0.00 ? 224 THR A H    5  
ATOM 7663  H HA   . THR A 1 46  ? -7.601  -3.452  -8.655  1.00 0.00 ? 224 THR A HA   5  
ATOM 7664  H HB   . THR A 1 46  ? -8.510  -2.019  -6.151  1.00 0.00 ? 224 THR A HB   5  
ATOM 7665  H HG1  . THR A 1 46  ? -8.748  -0.975  -8.752  1.00 0.00 ? 224 THR A HG1  5  
ATOM 7666  H HG21 . THR A 1 46  ? -7.098  -0.197  -7.548  1.00 0.00 ? 224 THR A HG21 5  
ATOM 7667  H HG22 . THR A 1 46  ? -6.219  -1.663  -7.982  1.00 0.00 ? 224 THR A HG22 5  
ATOM 7668  H HG23 . THR A 1 46  ? -6.397  -1.211  -6.287  1.00 0.00 ? 224 THR A HG23 5  
ATOM 7669  N N    . ARG A 1 47  ? -5.721  -4.401  -7.364  1.00 0.00 ? 225 ARG A N    5  
ATOM 7670  C CA   . ARG A 1 47  ? -4.611  -5.008  -6.641  1.00 0.00 ? 225 ARG A CA   5  
ATOM 7671  C C    . ARG A 1 47  ? -3.423  -4.053  -6.566  1.00 0.00 ? 225 ARG A C    5  
ATOM 7672  O O    . ARG A 1 47  ? -3.015  -3.474  -7.572  1.00 0.00 ? 225 ARG A O    5  
ATOM 7673  C CB   . ARG A 1 47  ? -4.187  -6.313  -7.318  1.00 0.00 ? 225 ARG A CB   5  
ATOM 7674  C CG   . ARG A 1 47  ? -3.303  -7.192  -6.448  1.00 0.00 ? 225 ARG A CG   5  
ATOM 7675  C CD   . ARG A 1 47  ? -2.669  -8.315  -7.253  1.00 0.00 ? 225 ARG A CD   5  
ATOM 7676  N NE   . ARG A 1 47  ? -3.531  -9.492  -7.323  1.00 0.00 ? 225 ARG A NE   5  
ATOM 7677  C CZ   . ARG A 1 47  ? -4.513  -9.632  -8.207  1.00 0.00 ? 225 ARG A CZ   5  
ATOM 7678  N NH1  . ARG A 1 47  ? -4.755  -8.673  -9.091  1.00 0.00 ? 225 ARG A NH1  5  
ATOM 7679  N NH2  . ARG A 1 47  ? -5.254  -10.733 -8.209  1.00 0.00 ? 225 ARG A NH2  5  
ATOM 7680  H H    . ARG A 1 47  ? -5.623  -4.213  -8.321  1.00 0.00 ? 225 ARG A H    5  
ATOM 7681  H HA   . ARG A 1 47  ? -4.947  -5.226  -5.639  1.00 0.00 ? 225 ARG A HA   5  
ATOM 7682  H HB2  . ARG A 1 47  ? -5.072  -6.875  -7.577  1.00 0.00 ? 225 ARG A HB2  5  
ATOM 7683  H HB3  . ARG A 1 47  ? -3.644  -6.076  -8.221  1.00 0.00 ? 225 ARG A HB3  5  
ATOM 7684  H HG2  . ARG A 1 47  ? -2.520  -6.585  -6.018  1.00 0.00 ? 225 ARG A HG2  5  
ATOM 7685  H HG3  . ARG A 1 47  ? -3.904  -7.620  -5.659  1.00 0.00 ? 225 ARG A HG3  5  
ATOM 7686  H HD2  . ARG A 1 47  ? -2.479  -7.960  -8.254  1.00 0.00 ? 225 ARG A HD2  5  
ATOM 7687  H HD3  . ARG A 1 47  ? -1.736  -8.592  -6.786  1.00 0.00 ? 225 ARG A HD3  5  
ATOM 7688  H HE   . ARG A 1 47  ? -3.369  -10.213 -6.680  1.00 0.00 ? 225 ARG A HE   5  
ATOM 7689  H HH11 . ARG A 1 47  ? -4.198  -7.844  -9.093  1.00 0.00 ? 225 ARG A HH11 5  
ATOM 7690  H HH12 . ARG A 1 47  ? -5.494  -8.782  -9.756  1.00 0.00 ? 225 ARG A HH12 5  
ATOM 7691  H HH21 . ARG A 1 47  ? -5.074  -11.457 -7.545  1.00 0.00 ? 225 ARG A HH21 5  
ATOM 7692  H HH22 . ARG A 1 47  ? -5.993  -10.837 -8.874  1.00 0.00 ? 225 ARG A HH22 5  
ATOM 7693  N N    . ALA A 1 48  ? -2.875  -3.893  -5.366  1.00 0.00 ? 226 ALA A N    5  
ATOM 7694  C CA   . ALA A 1 48  ? -1.734  -3.009  -5.159  1.00 0.00 ? 226 ALA A CA   5  
ATOM 7695  C C    . ALA A 1 48  ? -0.509  -3.792  -4.698  1.00 0.00 ? 226 ALA A C    5  
ATOM 7696  O O    . ALA A 1 48  ? -0.555  -4.501  -3.693  1.00 0.00 ? 226 ALA A O    5  
ATOM 7697  C CB   . ALA A 1 48  ? -2.081  -1.927  -4.148  1.00 0.00 ? 226 ALA A CB   5  
ATOM 7698  H H    . ALA A 1 48  ? -3.245  -4.382  -4.602  1.00 0.00 ? 226 ALA A H    5  
ATOM 7699  H HA   . ALA A 1 48  ? -1.509  -2.529  -6.101  1.00 0.00 ? 226 ALA A HA   5  
ATOM 7700  H HB1  . ALA A 1 48  ? -1.956  -0.956  -4.605  1.00 0.00 ? 226 ALA A HB1  5  
ATOM 7701  H HB2  . ALA A 1 48  ? -3.107  -2.046  -3.831  1.00 0.00 ? 226 ALA A HB2  5  
ATOM 7702  H HB3  . ALA A 1 48  ? -1.428  -2.010  -3.293  1.00 0.00 ? 226 ALA A HB3  5  
ATOM 7703  N N    . PHE A 1 49  ? 0.585   -3.661  -5.441  1.00 0.00 ? 227 PHE A N    5  
ATOM 7704  C CA   . PHE A 1 49  ? 1.822   -4.358  -5.109  1.00 0.00 ? 227 PHE A CA   5  
ATOM 7705  C C    . PHE A 1 49  ? 2.972   -3.370  -4.932  1.00 0.00 ? 227 PHE A C    5  
ATOM 7706  O O    . PHE A 1 49  ? 3.088   -2.395  -5.676  1.00 0.00 ? 227 PHE A O    5  
ATOM 7707  C CB   . PHE A 1 49  ? 2.169   -5.372  -6.201  1.00 0.00 ? 227 PHE A CB   5  
ATOM 7708  C CG   . PHE A 1 49  ? 3.588   -5.862  -6.134  1.00 0.00 ? 227 PHE A CG   5  
ATOM 7709  C CD1  . PHE A 1 49  ? 4.610   -5.150  -6.741  1.00 0.00 ? 227 PHE A CD1  5  
ATOM 7710  C CD2  . PHE A 1 49  ? 3.899   -7.035  -5.465  1.00 0.00 ? 227 PHE A CD2  5  
ATOM 7711  C CE1  . PHE A 1 49  ? 5.915   -5.599  -6.682  1.00 0.00 ? 227 PHE A CE1  5  
ATOM 7712  C CE2  . PHE A 1 49  ? 5.203   -7.489  -5.403  1.00 0.00 ? 227 PHE A CE2  5  
ATOM 7713  C CZ   . PHE A 1 49  ? 6.213   -6.769  -6.011  1.00 0.00 ? 227 PHE A CZ   5  
ATOM 7714  H H    . PHE A 1 49  ? 0.560   -3.081  -6.231  1.00 0.00 ? 227 PHE A H    5  
ATOM 7715  H HA   . PHE A 1 49  ? 1.667   -4.882  -4.179  1.00 0.00 ? 227 PHE A HA   5  
ATOM 7716  H HB2  . PHE A 1 49  ? 1.519   -6.228  -6.107  1.00 0.00 ? 227 PHE A HB2  5  
ATOM 7717  H HB3  . PHE A 1 49  ? 2.020   -4.915  -7.167  1.00 0.00 ? 227 PHE A HB3  5  
ATOM 7718  H HD1  . PHE A 1 49  ? 4.379   -4.234  -7.265  1.00 0.00 ? 227 PHE A HD1  5  
ATOM 7719  H HD2  . PHE A 1 49  ? 3.109   -7.598  -4.988  1.00 0.00 ? 227 PHE A HD2  5  
ATOM 7720  H HE1  . PHE A 1 49  ? 6.703   -5.035  -7.158  1.00 0.00 ? 227 PHE A HE1  5  
ATOM 7721  H HE2  . PHE A 1 49  ? 5.431   -8.404  -4.877  1.00 0.00 ? 227 PHE A HE2  5  
ATOM 7722  H HZ   . PHE A 1 49  ? 7.232   -7.123  -5.964  1.00 0.00 ? 227 PHE A HZ   5  
ATOM 7723  N N    . LEU A 1 50  ? 3.819   -3.630  -3.942  1.00 0.00 ? 228 LEU A N    5  
ATOM 7724  C CA   . LEU A 1 50  ? 4.961   -2.764  -3.666  1.00 0.00 ? 228 LEU A CA   5  
ATOM 7725  C C    . LEU A 1 50  ? 6.274   -3.491  -3.940  1.00 0.00 ? 228 LEU A C    5  
ATOM 7726  O O    . LEU A 1 50  ? 6.475   -4.635  -3.533  1.00 0.00 ? 228 LEU A O    5  
ATOM 7727  C CB   . LEU A 1 50  ? 4.923   -2.286  -2.214  1.00 0.00 ? 228 LEU A CB   5  
ATOM 7728  C CG   . LEU A 1 50  ? 5.951   -1.220  -1.831  1.00 0.00 ? 228 LEU A CG   5  
ATOM 7729  C CD1  . LEU A 1 50  ? 5.586   0.120   -2.451  1.00 0.00 ? 228 LEU A CD1  5  
ATOM 7730  C CD2  . LEU A 1 50  ? 6.057   -1.099  -0.318  1.00 0.00 ? 228 LEU A CD2  5  
ATOM 7731  H H    . LEU A 1 50  ? 3.675   -4.421  -3.384  1.00 0.00 ? 228 LEU A H    5  
ATOM 7732  H HA   . LEU A 1 50  ? 4.894   -1.908  -4.321  1.00 0.00 ? 228 LEU A HA   5  
ATOM 7733  H HB2  . LEU A 1 50  ? 3.941   -1.880  -2.025  1.00 0.00 ? 228 LEU A HB2  5  
ATOM 7734  H HB3  . LEU A 1 50  ? 5.084   -3.145  -1.579  1.00 0.00 ? 228 LEU A HB3  5  
ATOM 7735  H HG   . LEU A 1 50  ? 6.920   -1.510  -2.213  1.00 0.00 ? 228 LEU A HG   5  
ATOM 7736  H HD11 . LEU A 1 50  ? 6.488   0.657   -2.704  1.00 0.00 ? 228 LEU A HD11 5  
ATOM 7737  H HD12 . LEU A 1 50  ? 5.009   0.698   -1.744  1.00 0.00 ? 228 LEU A HD12 5  
ATOM 7738  H HD13 . LEU A 1 50  ? 5.001   -0.043  -3.344  1.00 0.00 ? 228 LEU A HD13 5  
ATOM 7739  H HD21 . LEU A 1 50  ? 5.331   -0.382  0.037   1.00 0.00 ? 228 LEU A HD21 5  
ATOM 7740  H HD22 . LEU A 1 50  ? 7.050   -0.768  -0.052  1.00 0.00 ? 228 LEU A HD22 5  
ATOM 7741  H HD23 . LEU A 1 50  ? 5.863   -2.061  0.134   1.00 0.00 ? 228 LEU A HD23 5  
ATOM 7742  N N    . PRO A 1 51  ? 7.191   -2.811  -4.644  1.00 0.00 ? 229 PRO A N    5  
ATOM 7743  C CA   . PRO A 1 51  ? 8.502   -3.371  -4.986  1.00 0.00 ? 229 PRO A CA   5  
ATOM 7744  C C    . PRO A 1 51  ? 9.405   -3.518  -3.766  1.00 0.00 ? 229 PRO A C    5  
ATOM 7745  O O    . PRO A 1 51  ? 9.345   -2.714  -2.835  1.00 0.00 ? 229 PRO A O    5  
ATOM 7746  C CB   . PRO A 1 51  ? 9.083   -2.345  -5.961  1.00 0.00 ? 229 PRO A CB   5  
ATOM 7747  C CG   . PRO A 1 51  ? 8.402   -1.066  -5.616  1.00 0.00 ? 229 PRO A CG   5  
ATOM 7748  C CD   . PRO A 1 51  ? 7.019   -1.443  -5.161  1.00 0.00 ? 229 PRO A CD   5  
ATOM 7749  H HA   . PRO A 1 51  ? 8.408   -4.327  -5.480  1.00 0.00 ? 229 PRO A HA   5  
ATOM 7750  H HB2  . PRO A 1 51  ? 10.152  -2.275  -5.819  1.00 0.00 ? 229 PRO A HB2  5  
ATOM 7751  H HB3  . PRO A 1 51  ? 8.868   -2.645  -6.976  1.00 0.00 ? 229 PRO A HB3  5  
ATOM 7752  H HG2  . PRO A 1 51  ? 8.935   -0.569  -4.820  1.00 0.00 ? 229 PRO A HG2  5  
ATOM 7753  H HG3  . PRO A 1 51  ? 8.349   -0.431  -6.488  1.00 0.00 ? 229 PRO A HG3  5  
ATOM 7754  H HD2  . PRO A 1 51  ? 6.683   -0.776  -4.382  1.00 0.00 ? 229 PRO A HD2  5  
ATOM 7755  H HD3  . PRO A 1 51  ? 6.331   -1.430  -5.994  1.00 0.00 ? 229 PRO A HD3  5  
ATOM 7756  N N    . LEU A 1 52  ? 10.242  -4.550  -3.777  1.00 0.00 ? 230 LEU A N    5  
ATOM 7757  C CA   . LEU A 1 52  ? 11.159  -4.802  -2.671  1.00 0.00 ? 230 LEU A CA   5  
ATOM 7758  C C    . LEU A 1 52  ? 12.155  -3.656  -2.516  1.00 0.00 ? 230 LEU A C    5  
ATOM 7759  O O    . LEU A 1 52  ? 12.721  -3.452  -1.442  1.00 0.00 ? 230 LEU A O    5  
ATOM 7760  C CB   . LEU A 1 52  ? 11.909  -6.117  -2.893  1.00 0.00 ? 230 LEU A CB   5  
ATOM 7761  C CG   . LEU A 1 52  ? 11.086  -7.395  -2.724  1.00 0.00 ? 230 LEU A CG   5  
ATOM 7762  C CD1  . LEU A 1 52  ? 11.918  -8.616  -3.083  1.00 0.00 ? 230 LEU A CD1  5  
ATOM 7763  C CD2  . LEU A 1 52  ? 10.559  -7.506  -1.301  1.00 0.00 ? 230 LEU A CD2  5  
ATOM 7764  H H    . LEU A 1 52  ? 10.245  -5.156  -4.546  1.00 0.00 ? 230 LEU A H    5  
ATOM 7765  H HA   . LEU A 1 52  ? 10.575  -4.879  -1.766  1.00 0.00 ? 230 LEU A HA   5  
ATOM 7766  H HB2  . LEU A 1 52  ? 12.302  -6.107  -3.898  1.00 0.00 ? 230 LEU A HB2  5  
ATOM 7767  H HB3  . LEU A 1 52  ? 12.727  -6.153  -2.189  1.00 0.00 ? 230 LEU A HB3  5  
ATOM 7768  H HG   . LEU A 1 52  ? 10.238  -7.361  -3.394  1.00 0.00 ? 230 LEU A HG   5  
ATOM 7769  H HD11 . LEU A 1 52  ? 11.412  -9.184  -3.849  1.00 0.00 ? 230 LEU A HD11 5  
ATOM 7770  H HD12 . LEU A 1 52  ? 12.050  -9.232  -2.206  1.00 0.00 ? 230 LEU A HD12 5  
ATOM 7771  H HD13 . LEU A 1 52  ? 12.884  -8.299  -3.448  1.00 0.00 ? 230 LEU A HD13 5  
ATOM 7772  H HD21 . LEU A 1 52  ? 9.828   -6.730  -1.127  1.00 0.00 ? 230 LEU A HD21 5  
ATOM 7773  H HD22 . LEU A 1 52  ? 11.378  -7.392  -0.604  1.00 0.00 ? 230 LEU A HD22 5  
ATOM 7774  H HD23 . LEU A 1 52  ? 10.099  -8.472  -1.162  1.00 0.00 ? 230 LEU A HD23 5  
ATOM 7775  N N    . LEU A 1 53  ? 12.361  -2.910  -3.596  1.00 0.00 ? 231 LEU A N    5  
ATOM 7776  C CA   . LEU A 1 53  ? 13.286  -1.782  -3.580  1.00 0.00 ? 231 LEU A CA   5  
ATOM 7777  C C    . LEU A 1 53  ? 12.803  -0.694  -2.627  1.00 0.00 ? 231 LEU A C    5  
ATOM 7778  O O    . LEU A 1 53  ? 13.581  -0.151  -1.842  1.00 0.00 ? 231 LEU A O    5  
ATOM 7779  C CB   . LEU A 1 53  ? 13.444  -1.208  -4.989  1.00 0.00 ? 231 LEU A CB   5  
ATOM 7780  C CG   . LEU A 1 53  ? 13.761  -2.216  -6.094  1.00 0.00 ? 231 LEU A CG   5  
ATOM 7781  C CD1  . LEU A 1 53  ? 13.569  -1.585  -7.464  1.00 0.00 ? 231 LEU A CD1  5  
ATOM 7782  C CD2  . LEU A 1 53  ? 15.180  -2.745  -5.943  1.00 0.00 ? 231 LEU A CD2  5  
ATOM 7783  H H    . LEU A 1 53  ? 11.881  -3.121  -4.423  1.00 0.00 ? 231 LEU A H    5  
ATOM 7784  H HA   . LEU A 1 53  ? 14.244  -2.144  -3.239  1.00 0.00 ? 231 LEU A HA   5  
ATOM 7785  H HB2  . LEU A 1 53  ? 12.522  -0.712  -5.249  1.00 0.00 ? 231 LEU A HB2  5  
ATOM 7786  H HB3  . LEU A 1 53  ? 14.246  -0.483  -4.962  1.00 0.00 ? 231 LEU A HB3  5  
ATOM 7787  H HG   . LEU A 1 53  ? 13.081  -3.053  -6.014  1.00 0.00 ? 231 LEU A HG   5  
ATOM 7788  H HD11 . LEU A 1 53  ? 14.192  -2.093  -8.185  1.00 0.00 ? 231 LEU A HD11 5  
ATOM 7789  H HD12 . LEU A 1 53  ? 13.844  -0.542  -7.422  1.00 0.00 ? 231 LEU A HD12 5  
ATOM 7790  H HD13 . LEU A 1 53  ? 12.533  -1.672  -7.758  1.00 0.00 ? 231 LEU A HD13 5  
ATOM 7791  H HD21 . LEU A 1 53  ? 15.170  -3.823  -5.996  1.00 0.00 ? 231 LEU A HD21 5  
ATOM 7792  H HD22 . LEU A 1 53  ? 15.580  -2.435  -4.987  1.00 0.00 ? 231 LEU A HD22 5  
ATOM 7793  H HD23 . LEU A 1 53  ? 15.798  -2.350  -6.736  1.00 0.00 ? 231 LEU A HD23 5  
ATOM 7794  N N    . LYS A 1 54  ? 11.514  -0.382  -2.698  1.00 0.00 ? 232 LYS A N    5  
ATOM 7795  C CA   . LYS A 1 54  ? 10.925  0.638   -1.838  1.00 0.00 ? 232 LYS A CA   5  
ATOM 7796  C C    . LYS A 1 54  ? 10.591  0.066   -0.464  1.00 0.00 ? 232 LYS A C    5  
ATOM 7797  O O    . LYS A 1 54  ? 10.753  0.738   0.554   1.00 0.00 ? 232 LYS A O    5  
ATOM 7798  C CB   . LYS A 1 54  ? 9.661   1.210   -2.485  1.00 0.00 ? 232 LYS A CB   5  
ATOM 7799  C CG   . LYS A 1 54  ? 9.929   2.383   -3.411  1.00 0.00 ? 232 LYS A CG   5  
ATOM 7800  C CD   . LYS A 1 54  ? 10.143  3.671   -2.633  1.00 0.00 ? 232 LYS A CD   5  
ATOM 7801  C CE   . LYS A 1 54  ? 10.863  4.716   -3.471  1.00 0.00 ? 232 LYS A CE   5  
ATOM 7802  N NZ   . LYS A 1 54  ? 12.296  4.369   -3.679  1.00 0.00 ? 232 LYS A NZ   5  
ATOM 7803  H H    . LYS A 1 54  ? 10.944  -0.851  -3.344  1.00 0.00 ? 232 LYS A H    5  
ATOM 7804  H HA   . LYS A 1 54  ? 11.648  1.430   -1.719  1.00 0.00 ? 232 LYS A HA   5  
ATOM 7805  H HB2  . LYS A 1 54  ? 9.178   0.431   -3.055  1.00 0.00 ? 232 LYS A HB2  5  
ATOM 7806  H HB3  . LYS A 1 54  ? 8.990   1.541   -1.704  1.00 0.00 ? 232 LYS A HB3  5  
ATOM 7807  H HG2  . LYS A 1 54  ? 10.815  2.176   -3.993  1.00 0.00 ? 232 LYS A HG2  5  
ATOM 7808  H HG3  . LYS A 1 54  ? 9.084   2.509   -4.072  1.00 0.00 ? 232 LYS A HG3  5  
ATOM 7809  H HD2  . LYS A 1 54  ? 9.183   4.065   -2.334  1.00 0.00 ? 232 LYS A HD2  5  
ATOM 7810  H HD3  . LYS A 1 54  ? 10.735  3.456   -1.754  1.00 0.00 ? 232 LYS A HD3  5  
ATOM 7811  H HE2  . LYS A 1 54  ? 10.376  4.786   -4.431  1.00 0.00 ? 232 LYS A HE2  5  
ATOM 7812  H HE3  . LYS A 1 54  ? 10.802  5.668   -2.965  1.00 0.00 ? 232 LYS A HE3  5  
ATOM 7813  H HZ1  . LYS A 1 54  ? 12.865  4.705   -2.875  1.00 0.00 ? 232 LYS A HZ1  5  
ATOM 7814  H HZ2  . LYS A 1 54  ? 12.649  4.815   -4.549  1.00 0.00 ? 232 LYS A HZ2  5  
ATOM 7815  H HZ3  . LYS A 1 54  ? 12.406  3.338   -3.760  1.00 0.00 ? 232 LYS A HZ3  5  
ATOM 7816  N N    . ALA A 1 55  ? 10.127  -1.179  -0.443  1.00 0.00 ? 233 ALA A N    5  
ATOM 7817  C CA   . ALA A 1 55  ? 9.774   -1.843  0.806   1.00 0.00 ? 233 ALA A CA   5  
ATOM 7818  C C    . ALA A 1 55  ? 11.001  -2.032  1.692   1.00 0.00 ? 233 ALA A C    5  
ATOM 7819  O O    . ALA A 1 55  ? 10.960  -1.757  2.890   1.00 0.00 ? 233 ALA A O    5  
ATOM 7820  C CB   . ALA A 1 55  ? 9.113   -3.183  0.523   1.00 0.00 ? 233 ALA A CB   5  
ATOM 7821  H H    . ALA A 1 55  ? 10.020  -1.664  -1.288  1.00 0.00 ? 233 ALA A H    5  
ATOM 7822  H HA   . ALA A 1 55  ? 9.061   -1.219  1.325   1.00 0.00 ? 233 ALA A HA   5  
ATOM 7823  H HB1  . ALA A 1 55  ? 8.323   -3.048  -0.202  1.00 0.00 ? 233 ALA A HB1  5  
ATOM 7824  H HB2  . ALA A 1 55  ? 9.847   -3.872  0.133   1.00 0.00 ? 233 ALA A HB2  5  
ATOM 7825  H HB3  . ALA A 1 55  ? 8.698   -3.579  1.438   1.00 0.00 ? 233 ALA A HB3  5  
ATOM 7826  N N    . GLN A 1 56  ? 12.090  -2.505  1.093   1.00 0.00 ? 234 GLN A N    5  
ATOM 7827  C CA   . GLN A 1 56  ? 13.328  -2.732  1.830   1.00 0.00 ? 234 GLN A CA   5  
ATOM 7828  C C    . GLN A 1 56  ? 13.906  -1.417  2.341   1.00 0.00 ? 234 GLN A C    5  
ATOM 7829  O O    . GLN A 1 56  ? 14.421  -1.348  3.457   1.00 0.00 ? 234 GLN A O    5  
ATOM 7830  C CB   . GLN A 1 56  ? 14.351  -3.442  0.942   1.00 0.00 ? 234 GLN A CB   5  
ATOM 7831  C CG   . GLN A 1 56  ? 15.531  -4.015  1.711   1.00 0.00 ? 234 GLN A CG   5  
ATOM 7832  C CD   . GLN A 1 56  ? 16.771  -4.164  0.852   1.00 0.00 ? 234 GLN A CD   5  
ATOM 7833  O OE1  . GLN A 1 56  ? 17.048  -5.242  0.324   1.00 0.00 ? 234 GLN A OE1  5  
ATOM 7834  N NE2  . GLN A 1 56  ? 17.524  -3.081  0.705   1.00 0.00 ? 234 GLN A NE2  5  
ATOM 7835  H H    . GLN A 1 56  ? 12.060  -2.705  0.135   1.00 0.00 ? 234 GLN A H    5  
ATOM 7836  H HA   . GLN A 1 56  ? 13.099  -3.364  2.675   1.00 0.00 ? 234 GLN A HA   5  
ATOM 7837  H HB2  . GLN A 1 56  ? 13.860  -4.252  0.423   1.00 0.00 ? 234 GLN A HB2  5  
ATOM 7838  H HB3  . GLN A 1 56  ? 14.730  -2.738  0.216   1.00 0.00 ? 234 GLN A HB3  5  
ATOM 7839  H HG2  . GLN A 1 56  ? 15.761  -3.356  2.535   1.00 0.00 ? 234 GLN A HG2  5  
ATOM 7840  H HG3  . GLN A 1 56  ? 15.256  -4.987  2.094   1.00 0.00 ? 234 GLN A HG3  5  
ATOM 7841  H HE21 . GLN A 1 56  ? 17.241  -2.257  1.156   1.00 0.00 ? 234 GLN A HE21 5  
ATOM 7842  H HE22 . GLN A 1 56  ? 18.331  -3.149  0.156   1.00 0.00 ? 234 GLN A HE22 5  
ATOM 7843  N N    . GLU A 1 57  ? 13.818  -0.377  1.518   1.00 0.00 ? 235 GLU A N    5  
ATOM 7844  C CA   . GLU A 1 57  ? 14.334  0.935   1.888   1.00 0.00 ? 235 GLU A CA   5  
ATOM 7845  C C    . GLU A 1 57  ? 13.547  1.520   3.058   1.00 0.00 ? 235 GLU A C    5  
ATOM 7846  O O    . GLU A 1 57  ? 14.124  2.079   3.991   1.00 0.00 ? 235 GLU A O    5  
ATOM 7847  C CB   . GLU A 1 57  ? 14.274  1.888   0.692   1.00 0.00 ? 235 GLU A CB   5  
ATOM 7848  C CG   . GLU A 1 57  ? 15.497  1.814   -0.207  1.00 0.00 ? 235 GLU A CG   5  
ATOM 7849  C CD   . GLU A 1 57  ? 16.635  2.687   0.285   1.00 0.00 ? 235 GLU A CD   5  
ATOM 7850  O OE1  . GLU A 1 57  ? 16.885  2.701   1.509   1.00 0.00 ? 235 GLU A OE1  5  
ATOM 7851  O OE2  . GLU A 1 57  ? 17.276  3.356   -0.553  1.00 0.00 ? 235 GLU A OE2  5  
ATOM 7852  H H    . GLU A 1 57  ? 13.396  -0.496  0.642   1.00 0.00 ? 235 GLU A H    5  
ATOM 7853  H HA   . GLU A 1 57  ? 15.364  0.814   2.188   1.00 0.00 ? 235 GLU A HA   5  
ATOM 7854  H HB2  . GLU A 1 57  ? 13.402  1.648   0.100   1.00 0.00 ? 235 GLU A HB2  5  
ATOM 7855  H HB3  . GLU A 1 57  ? 14.182  2.900   1.058   1.00 0.00 ? 235 GLU A HB3  5  
ATOM 7856  H HG2  . GLU A 1 57  ? 15.839  0.791   -0.245  1.00 0.00 ? 235 GLU A HG2  5  
ATOM 7857  H HG3  . GLU A 1 57  ? 15.218  2.137   -1.199  1.00 0.00 ? 235 GLU A HG3  5  
ATOM 7858  N N    . TYR A 1 58  ? 12.227  1.386   3.000   1.00 0.00 ? 236 TYR A N    5  
ATOM 7859  C CA   . TYR A 1 58  ? 11.360  1.903   4.052   1.00 0.00 ? 236 TYR A CA   5  
ATOM 7860  C C    . TYR A 1 58  ? 11.468  1.053   5.314   1.00 0.00 ? 236 TYR A C    5  
ATOM 7861  O O    . TYR A 1 58  ? 11.523  1.578   6.427   1.00 0.00 ? 236 TYR A O    5  
ATOM 7862  C CB   . TYR A 1 58  ? 9.908   1.941   3.572   1.00 0.00 ? 236 TYR A CB   5  
ATOM 7863  C CG   . TYR A 1 58  ? 8.902   2.051   4.695   1.00 0.00 ? 236 TYR A CG   5  
ATOM 7864  C CD1  . TYR A 1 58  ? 8.566   0.943   5.464   1.00 0.00 ? 236 TYR A CD1  5  
ATOM 7865  C CD2  . TYR A 1 58  ? 8.286   3.262   4.988   1.00 0.00 ? 236 TYR A CD2  5  
ATOM 7866  C CE1  . TYR A 1 58  ? 7.646   1.038   6.491   1.00 0.00 ? 236 TYR A CE1  5  
ATOM 7867  C CE2  . TYR A 1 58  ? 7.367   3.367   6.014   1.00 0.00 ? 236 TYR A CE2  5  
ATOM 7868  C CZ   . TYR A 1 58  ? 7.050   2.252   6.762   1.00 0.00 ? 236 TYR A CZ   5  
ATOM 7869  O OH   . TYR A 1 58  ? 6.134   2.352   7.784   1.00 0.00 ? 236 TYR A OH   5  
ATOM 7870  H H    . TYR A 1 58  ? 11.825  0.931   2.231   1.00 0.00 ? 236 TYR A H    5  
ATOM 7871  H HA   . TYR A 1 58  ? 11.679  2.909   4.281   1.00 0.00 ? 236 TYR A HA   5  
ATOM 7872  H HB2  . TYR A 1 58  ? 9.773   2.792   2.923   1.00 0.00 ? 236 TYR A HB2  5  
ATOM 7873  H HB3  . TYR A 1 58  ? 9.694   1.037   3.022   1.00 0.00 ? 236 TYR A HB3  5  
ATOM 7874  H HD1  . TYR A 1 58  ? 9.034   -0.006  5.249   1.00 0.00 ? 236 TYR A HD1  5  
ATOM 7875  H HD2  . TYR A 1 58  ? 8.537   4.133   4.399   1.00 0.00 ? 236 TYR A HD2  5  
ATOM 7876  H HE1  . TYR A 1 58  ? 7.398   0.166   7.078   1.00 0.00 ? 236 TYR A HE1  5  
ATOM 7877  H HE2  . TYR A 1 58  ? 6.900   4.317   6.226   1.00 0.00 ? 236 TYR A HE2  5  
ATOM 7878  H HH   . TYR A 1 58  ? 6.593   2.528   8.609   1.00 0.00 ? 236 TYR A HH   5  
ATOM 7879  N N    . ILE A 1 59  ? 11.498  -0.263  5.132   1.00 0.00 ? 237 ILE A N    5  
ATOM 7880  C CA   . ILE A 1 59  ? 11.602  -1.187  6.255   1.00 0.00 ? 237 ILE A CA   5  
ATOM 7881  C C    . ILE A 1 59  ? 12.939  -1.034  6.971   1.00 0.00 ? 237 ILE A C    5  
ATOM 7882  O O    . ILE A 1 59  ? 13.009  -1.102  8.198   1.00 0.00 ? 237 ILE A O    5  
ATOM 7883  C CB   . ILE A 1 59  ? 11.441  -2.649  5.798   1.00 0.00 ? 237 ILE A CB   5  
ATOM 7884  C CG1  . ILE A 1 59  ? 10.065  -2.860  5.163   1.00 0.00 ? 237 ILE A CG1  5  
ATOM 7885  C CG2  . ILE A 1 59  ? 11.640  -3.596  6.972   1.00 0.00 ? 237 ILE A CG2  5  
ATOM 7886  C CD1  . ILE A 1 59  ? 10.051  -3.928  4.092   1.00 0.00 ? 237 ILE A CD1  5  
ATOM 7887  H H    . ILE A 1 59  ? 11.451  -0.621  4.221   1.00 0.00 ? 237 ILE A H    5  
ATOM 7888  H HA   . ILE A 1 59  ? 10.805  -0.958  6.949   1.00 0.00 ? 237 ILE A HA   5  
ATOM 7889  H HB   . ILE A 1 59  ? 12.204  -2.859  5.064   1.00 0.00 ? 237 ILE A HB   5  
ATOM 7890  H HG12 . ILE A 1 59  ? 9.363   -3.149  5.928   1.00 0.00 ? 237 ILE A HG12 5  
ATOM 7891  H HG13 . ILE A 1 59  ? 9.739   -1.933  4.713   1.00 0.00 ? 237 ILE A HG13 5  
ATOM 7892  H HG21 . ILE A 1 59  ? 12.461  -3.248  7.580   1.00 0.00 ? 237 ILE A HG21 5  
ATOM 7893  H HG22 . ILE A 1 59  ? 10.739  -3.624  7.567   1.00 0.00 ? 237 ILE A HG22 5  
ATOM 7894  H HG23 . ILE A 1 59  ? 11.859  -4.586  6.603   1.00 0.00 ? 237 ILE A HG23 5  
ATOM 7895  H HD11 . ILE A 1 59  ? 9.903   -4.895  4.549   1.00 0.00 ? 237 ILE A HD11 5  
ATOM 7896  H HD12 . ILE A 1 59  ? 9.249   -3.731  3.396   1.00 0.00 ? 237 ILE A HD12 5  
ATOM 7897  H HD13 . ILE A 1 59  ? 10.994  -3.921  3.564   1.00 0.00 ? 237 ILE A HD13 5  
ATOM 7898  N N    . ARG A 1 60  ? 13.998  -0.825  6.197   1.00 0.00 ? 238 ARG A N    5  
ATOM 7899  C CA   . ARG A 1 60  ? 15.334  -0.661  6.757   1.00 0.00 ? 238 ARG A CA   5  
ATOM 7900  C C    . ARG A 1 60  ? 15.444  0.652   7.526   1.00 0.00 ? 238 ARG A C    5  
ATOM 7901  O O    . ARG A 1 60  ? 16.005  0.696   8.621   1.00 0.00 ? 238 ARG A O    5  
ATOM 7902  C CB   . ARG A 1 60  ? 16.385  -0.704  5.646   1.00 0.00 ? 238 ARG A CB   5  
ATOM 7903  C CG   . ARG A 1 60  ? 17.600  0.166   5.924   1.00 0.00 ? 238 ARG A CG   5  
ATOM 7904  C CD   . ARG A 1 60  ? 18.854  -0.405  5.279   1.00 0.00 ? 238 ARG A CD   5  
ATOM 7905  N NE   . ARG A 1 60  ? 19.926  0.583   5.199   1.00 0.00 ? 238 ARG A NE   5  
ATOM 7906  C CZ   . ARG A 1 60  ? 20.716  0.895   6.220   1.00 0.00 ? 238 ARG A CZ   5  
ATOM 7907  N NH1  . ARG A 1 60  ? 20.555  0.299   7.393   1.00 0.00 ? 238 ARG A NH1  5  
ATOM 7908  N NH2  . ARG A 1 60  ? 21.671  1.804   6.069   1.00 0.00 ? 238 ARG A NH2  5  
ATOM 7909  H H    . ARG A 1 60  ? 13.879  -0.780  5.225   1.00 0.00 ? 238 ARG A H    5  
ATOM 7910  H HA   . ARG A 1 60  ? 15.511  -1.480  7.439   1.00 0.00 ? 238 ARG A HA   5  
ATOM 7911  H HB2  . ARG A 1 60  ? 16.721  -1.723  5.523   1.00 0.00 ? 238 ARG A HB2  5  
ATOM 7912  H HB3  . ARG A 1 60  ? 15.932  -0.368  4.726   1.00 0.00 ? 238 ARG A HB3  5  
ATOM 7913  H HG2  . ARG A 1 60  ? 17.423  1.155   5.526   1.00 0.00 ? 238 ARG A HG2  5  
ATOM 7914  H HG3  . ARG A 1 60  ? 17.751  0.228   6.991   1.00 0.00 ? 238 ARG A HG3  5  
ATOM 7915  H HD2  . ARG A 1 60  ? 19.194  -1.244  5.866   1.00 0.00 ? 238 ARG A HD2  5  
ATOM 7916  H HD3  . ARG A 1 60  ? 18.609  -0.739  4.282   1.00 0.00 ? 238 ARG A HD3  5  
ATOM 7917  H HE   . ARG A 1 60  ? 20.063  1.035   4.341   1.00 0.00 ? 238 ARG A HE   5  
ATOM 7918  H HH11 . ARG A 1 60  ? 19.837  -0.387  7.510   1.00 0.00 ? 238 ARG A HH11 5  
ATOM 7919  H HH12 . ARG A 1 60  ? 21.152  0.535   8.161   1.00 0.00 ? 238 ARG A HH12 5  
ATOM 7920  H HH21 . ARG A 1 60  ? 21.796  2.255   5.185   1.00 0.00 ? 238 ARG A HH21 5  
ATOM 7921  H HH22 . ARG A 1 60  ? 22.265  2.038   6.838   1.00 0.00 ? 238 ARG A HH22 5  
ATOM 7922  N N    . GLN A 1 61  ? 14.906  1.719   6.944   1.00 0.00 ? 239 GLN A N    5  
ATOM 7923  C CA   . GLN A 1 61  ? 14.945  3.033   7.575   1.00 0.00 ? 239 GLN A CA   5  
ATOM 7924  C C    . GLN A 1 61  ? 13.876  3.150   8.656   1.00 0.00 ? 239 GLN A C    5  
ATOM 7925  O O    . GLN A 1 61  ? 13.979  3.981   9.559   1.00 0.00 ? 239 GLN A O    5  
ATOM 7926  C CB   . GLN A 1 61  ? 14.749  4.131   6.527   1.00 0.00 ? 239 GLN A CB   5  
ATOM 7927  C CG   . GLN A 1 61  ? 16.000  4.426   5.715   1.00 0.00 ? 239 GLN A CG   5  
ATOM 7928  C CD   . GLN A 1 61  ? 16.862  5.504   6.341   1.00 0.00 ? 239 GLN A CD   5  
ATOM 7929  O OE1  . GLN A 1 61  ? 16.513  6.070   7.378   1.00 0.00 ? 239 GLN A OE1  5  
ATOM 7930  N NE2  . GLN A 1 61  ? 17.995  5.795   5.713   1.00 0.00 ? 239 GLN A NE2  5  
ATOM 7931  H H    . GLN A 1 61  ? 14.473  1.620   6.072   1.00 0.00 ? 239 GLN A H    5  
ATOM 7932  H HA   . GLN A 1 61  ? 15.915  3.153   8.031   1.00 0.00 ? 239 GLN A HA   5  
ATOM 7933  H HB2  . GLN A 1 61  ? 13.967  3.828   5.848   1.00 0.00 ? 239 GLN A HB2  5  
ATOM 7934  H HB3  . GLN A 1 61  ? 14.449  5.040   7.027   1.00 0.00 ? 239 GLN A HB3  5  
ATOM 7935  H HG2  . GLN A 1 61  ? 16.584  3.521   5.635   1.00 0.00 ? 239 GLN A HG2  5  
ATOM 7936  H HG3  . GLN A 1 61  ? 15.703  4.750   4.728   1.00 0.00 ? 239 GLN A HG3  5  
ATOM 7937  H HE21 . GLN A 1 61  ? 18.207  5.305   4.891   1.00 0.00 ? 239 GLN A HE21 5  
ATOM 7938  H HE22 . GLN A 1 61  ? 18.571  6.489   6.095   1.00 0.00 ? 239 GLN A HE22 5  
ATOM 7939  N N    . LYS A 1 62  ? 12.849  2.313   8.559   1.00 0.00 ? 240 LYS A N    5  
ATOM 7940  C CA   . LYS A 1 62  ? 11.760  2.321   9.529   1.00 0.00 ? 240 LYS A CA   5  
ATOM 7941  C C    . LYS A 1 62  ? 11.943  1.212   10.561  1.00 0.00 ? 240 LYS A C    5  
ATOM 7942  O O    . LYS A 1 62  ? 12.212  1.479   11.731  1.00 0.00 ? 240 LYS A O    5  
ATOM 7943  C CB   . LYS A 1 62  ? 10.415  2.154   8.819   1.00 0.00 ? 240 LYS A CB   5  
ATOM 7944  C CG   . LYS A 1 62  ? 10.113  3.260   7.822   1.00 0.00 ? 240 LYS A CG   5  
ATOM 7945  C CD   . LYS A 1 62  ? 9.536   4.486   8.508   1.00 0.00 ? 240 LYS A CD   5  
ATOM 7946  C CE   . LYS A 1 62  ? 9.356   5.638   7.531   1.00 0.00 ? 240 LYS A CE   5  
ATOM 7947  N NZ   . LYS A 1 62  ? 9.385   6.959   8.219   1.00 0.00 ? 240 LYS A NZ   5  
ATOM 7948  H H    . LYS A 1 62  ? 12.823  1.673   7.817   1.00 0.00 ? 240 LYS A H    5  
ATOM 7949  H HA   . LYS A 1 62  ? 11.774  3.274   10.036  1.00 0.00 ? 240 LYS A HA   5  
ATOM 7950  H HB2  . LYS A 1 62  ? 10.415  1.212   8.291   1.00 0.00 ? 240 LYS A HB2  5  
ATOM 7951  H HB3  . LYS A 1 62  ? 9.629   2.142   9.560   1.00 0.00 ? 240 LYS A HB3  5  
ATOM 7952  H HG2  . LYS A 1 62  ? 11.027  3.539   7.319   1.00 0.00 ? 240 LYS A HG2  5  
ATOM 7953  H HG3  . LYS A 1 62  ? 9.398   2.894   7.098   1.00 0.00 ? 240 LYS A HG3  5  
ATOM 7954  H HD2  . LYS A 1 62  ? 8.574   4.234   8.930   1.00 0.00 ? 240 LYS A HD2  5  
ATOM 7955  H HD3  . LYS A 1 62  ? 10.207  4.796   9.297   1.00 0.00 ? 240 LYS A HD3  5  
ATOM 7956  H HE2  . LYS A 1 62  ? 10.152  5.604   6.803   1.00 0.00 ? 240 LYS A HE2  5  
ATOM 7957  H HE3  . LYS A 1 62  ? 8.405   5.524   7.031   1.00 0.00 ? 240 LYS A HE3  5  
ATOM 7958  H HZ1  . LYS A 1 62  ? 10.345  7.357   8.187   1.00 0.00 ? 240 LYS A HZ1  5  
ATOM 7959  H HZ2  . LYS A 1 62  ? 9.100   6.850   9.213   1.00 0.00 ? 240 LYS A HZ2  5  
ATOM 7960  H HZ3  . LYS A 1 62  ? 8.732   7.620   7.753   1.00 0.00 ? 240 LYS A HZ3  5  
ATOM 7961  N N    . ASN A 1 63  ? 11.795  -0.032  10.118  1.00 0.00 ? 241 ASN A N    5  
ATOM 7962  C CA   . ASN A 1 63  ? 11.945  -1.181  11.003  1.00 0.00 ? 241 ASN A CA   5  
ATOM 7963  C C    . ASN A 1 63  ? 13.413  -1.575  11.140  1.00 0.00 ? 241 ASN A C    5  
ATOM 7964  O O    . ASN A 1 63  ? 13.741  -2.754  11.273  1.00 0.00 ? 241 ASN A O    5  
ATOM 7965  C CB   . ASN A 1 63  ? 11.134  -2.367  10.476  1.00 0.00 ? 241 ASN A CB   5  
ATOM 7966  C CG   . ASN A 1 63  ? 10.642  -3.271  11.589  1.00 0.00 ? 241 ASN A CG   5  
ATOM 7967  O OD1  . ASN A 1 63  ? 11.007  -3.098  12.752  1.00 0.00 ? 241 ASN A OD1  5  
ATOM 7968  N ND2  . ASN A 1 63  ? 9.810   -4.244  11.237  1.00 0.00 ? 241 ASN A ND2  5  
ATOM 7969  H H    . ASN A 1 63  ? 11.581  -0.182  9.173   1.00 0.00 ? 241 ASN A H    5  
ATOM 7970  H HA   . ASN A 1 63  ? 11.568  -0.902  11.975  1.00 0.00 ? 241 ASN A HA   5  
ATOM 7971  H HB2  . ASN A 1 63  ? 10.277  -1.996  9.934   1.00 0.00 ? 241 ASN A HB2  5  
ATOM 7972  H HB3  . ASN A 1 63  ? 11.752  -2.950  9.809   1.00 0.00 ? 241 ASN A HB3  5  
ATOM 7973  H HD21 . ASN A 1 63  ? 9.563   -4.323  10.291  1.00 0.00 ? 241 ASN A HD21 5  
ATOM 7974  H HD22 . ASN A 1 63  ? 9.476   -4.843  11.936  1.00 0.00 ? 241 ASN A HD22 5  
ATOM 7975  N N    . LYS A 1 64  ? 14.292  -0.580  11.107  1.00 0.00 ? 242 LYS A N    5  
ATOM 7976  C CA   . LYS A 1 64  ? 15.725  -0.820  11.228  1.00 0.00 ? 242 LYS A CA   5  
ATOM 7977  C C    . LYS A 1 64  ? 16.115  -2.135  10.561  1.00 0.00 ? 242 LYS A C    5  
ATOM 7978  O O    . LYS A 1 64  ? 17.021  -2.831  11.020  1.00 0.00 ? 242 LYS A O    5  
ATOM 7979  C CB   . LYS A 1 64  ? 16.136  -0.843  12.702  1.00 0.00 ? 242 LYS A CB   5  
ATOM 7980  C CG   . LYS A 1 64  ? 16.197  0.536   13.338  1.00 0.00 ? 242 LYS A CG   5  
ATOM 7981  C CD   . LYS A 1 64  ? 16.340  0.448   14.848  1.00 0.00 ? 242 LYS A CD   5  
ATOM 7982  C CE   . LYS A 1 64  ? 16.509  1.824   15.473  1.00 0.00 ? 242 LYS A CE   5  
ATOM 7983  N NZ   . LYS A 1 64  ? 16.192  1.815   16.928  1.00 0.00 ? 242 LYS A NZ   5  
ATOM 7984  H H    . LYS A 1 64  ? 13.969  0.340   10.998  1.00 0.00 ? 242 LYS A H    5  
ATOM 7985  H HA   . LYS A 1 64  ? 16.241  -0.012  10.732  1.00 0.00 ? 242 LYS A HA   5  
ATOM 7986  H HB2  . LYS A 1 64  ? 15.424  -1.439  13.253  1.00 0.00 ? 242 LYS A HB2  5  
ATOM 7987  H HB3  . LYS A 1 64  ? 17.113  -1.297  12.784  1.00 0.00 ? 242 LYS A HB3  5  
ATOM 7988  H HG2  . LYS A 1 64  ? 17.047  1.069   12.938  1.00 0.00 ? 242 LYS A HG2  5  
ATOM 7989  H HG3  . LYS A 1 64  ? 15.289  1.072   13.101  1.00 0.00 ? 242 LYS A HG3  5  
ATOM 7990  H HD2  . LYS A 1 64  ? 15.454  -0.015  15.258  1.00 0.00 ? 242 LYS A HD2  5  
ATOM 7991  H HD3  . LYS A 1 64  ? 17.205  -0.155  15.085  1.00 0.00 ? 242 LYS A HD3  5  
ATOM 7992  H HE2  . LYS A 1 64  ? 17.531  2.143   15.338  1.00 0.00 ? 242 LYS A HE2  5  
ATOM 7993  H HE3  . LYS A 1 64  ? 15.847  2.515   14.974  1.00 0.00 ? 242 LYS A HE3  5  
ATOM 7994  H HZ1  . LYS A 1 64  ? 15.170  1.688   17.071  1.00 0.00 ? 242 LYS A HZ1  5  
ATOM 7995  H HZ2  . LYS A 1 64  ? 16.482  2.714   17.363  1.00 0.00 ? 242 LYS A HZ2  5  
ATOM 7996  H HZ3  . LYS A 1 64  ? 16.697  1.037   17.399  1.00 0.00 ? 242 LYS A HZ3  5  
ATOM 7997  N N    . GLY A 1 65  ? 15.427  -2.469  9.474   1.00 0.00 ? 243 GLY A N    5  
ATOM 7998  C CA   . GLY A 1 65  ? 15.717  -3.699  8.760   1.00 0.00 ? 243 GLY A CA   5  
ATOM 7999  C C    . GLY A 1 65  ? 15.133  -4.918  9.445   1.00 0.00 ? 243 GLY A C    5  
ATOM 8000  O O    . GLY A 1 65  ? 15.857  -5.695  10.067  1.00 0.00 ? 243 GLY A O    5  
ATOM 8001  H H    . GLY A 1 65  ? 14.715  -1.875  9.153   1.00 0.00 ? 243 GLY A H    5  
ATOM 8002  H HA2  . GLY A 1 65  ? 15.309  -3.629  7.763   1.00 0.00 ? 243 GLY A HA2  5  
ATOM 8003  H HA3  . GLY A 1 65  ? 16.788  -3.817  8.692   1.00 0.00 ? 243 GLY A HA3  5  
ATOM 8004  N N    . ALA A 1 66  ? 13.820  -5.086  9.334   1.00 0.00 ? 244 ALA A N    5  
ATOM 8005  C CA   . ALA A 1 66  ? 13.139  -6.219  9.947   1.00 0.00 ? 244 ALA A CA   5  
ATOM 8006  C C    . ALA A 1 66  ? 11.875  -6.584  9.176   1.00 0.00 ? 244 ALA A C    5  
ATOM 8007  O O    . ALA A 1 66  ? 10.953  -5.777  9.056   1.00 0.00 ? 244 ALA A O    5  
ATOM 8008  C CB   . ALA A 1 66  ? 12.803  -5.911  11.399  1.00 0.00 ? 244 ALA A CB   5  
ATOM 8009  H H    . ALA A 1 66  ? 13.296  -4.432  8.825   1.00 0.00 ? 244 ALA A H    5  
ATOM 8010  H HA   . ALA A 1 66  ? 13.814  -7.063  9.931   1.00 0.00 ? 244 ALA A HA   5  
ATOM 8011  H HB1  . ALA A 1 66  ? 12.232  -6.727  11.817  1.00 0.00 ? 244 ALA A HB1  5  
ATOM 8012  H HB2  . ALA A 1 66  ? 13.716  -5.785  11.960  1.00 0.00 ? 244 ALA A HB2  5  
ATOM 8013  H HB3  . ALA A 1 66  ? 12.221  -5.002  11.448  1.00 0.00 ? 244 ALA A HB3  5  
ATOM 8014  N N    . LYS A 1 67  ? 11.839  -7.805  8.653   1.00 0.00 ? 245 LYS A N    5  
ATOM 8015  C CA   . LYS A 1 67  ? 10.688  -8.278  7.893   1.00 0.00 ? 245 LYS A CA   5  
ATOM 8016  C C    . LYS A 1 67  ? 9.389   -7.725  8.471   1.00 0.00 ? 245 LYS A C    5  
ATOM 8017  O O    . LYS A 1 67  ? 9.193   -7.717  9.687   1.00 0.00 ? 245 LYS A O    5  
ATOM 8018  C CB   . LYS A 1 67  ? 10.647  -9.808  7.890   1.00 0.00 ? 245 LYS A CB   5  
ATOM 8019  C CG   . LYS A 1 67  ? 11.477  -10.437 6.784   1.00 0.00 ? 245 LYS A CG   5  
ATOM 8020  C CD   . LYS A 1 67  ? 12.898  -10.716 7.245   1.00 0.00 ? 245 LYS A CD   5  
ATOM 8021  C CE   . LYS A 1 67  ? 12.960  -11.932 8.156   1.00 0.00 ? 245 LYS A CE   5  
ATOM 8022  N NZ   . LYS A 1 67  ? 12.651  -13.191 7.424   1.00 0.00 ? 245 LYS A NZ   5  
ATOM 8023  H H    . LYS A 1 67  ? 12.605  -8.404  8.782   1.00 0.00 ? 245 LYS A H    5  
ATOM 8024  H HA   . LYS A 1 67  ? 10.794  -7.928  6.877   1.00 0.00 ? 245 LYS A HA   5  
ATOM 8025  H HB2  . LYS A 1 67  ? 11.017  -10.168 8.838   1.00 0.00 ? 245 LYS A HB2  5  
ATOM 8026  H HB3  . LYS A 1 67  ? 9.622   -10.128 7.768   1.00 0.00 ? 245 LYS A HB3  5  
ATOM 8027  H HG2  . LYS A 1 67  ? 11.018  -11.367 6.486   1.00 0.00 ? 245 LYS A HG2  5  
ATOM 8028  H HG3  . LYS A 1 67  ? 11.508  -9.761  5.941   1.00 0.00 ? 245 LYS A HG3  5  
ATOM 8029  H HD2  . LYS A 1 67  ? 13.519  -10.897 6.380   1.00 0.00 ? 245 LYS A HD2  5  
ATOM 8030  H HD3  . LYS A 1 67  ? 13.269  -9.855  7.782   1.00 0.00 ? 245 LYS A HD3  5  
ATOM 8031  H HE2  . LYS A 1 67  ? 13.953  -12.003 8.574   1.00 0.00 ? 245 LYS A HE2  5  
ATOM 8032  H HE3  . LYS A 1 67  ? 12.243  -11.804 8.954   1.00 0.00 ? 245 LYS A HE3  5  
ATOM 8033  H HZ1  . LYS A 1 67  ? 12.216  -13.882 8.068   1.00 0.00 ? 245 LYS A HZ1  5  
ATOM 8034  H HZ2  . LYS A 1 67  ? 13.523  -13.600 7.033   1.00 0.00 ? 245 LYS A HZ2  5  
ATOM 8035  H HZ3  . LYS A 1 67  ? 11.991  -12.998 6.643   1.00 0.00 ? 245 LYS A HZ3  5  
ATOM 8036  N N    . LEU A 1 68  ? 8.505   -7.266  7.593   1.00 0.00 ? 246 LEU A N    5  
ATOM 8037  C CA   . LEU A 1 68  ? 7.223   -6.712  8.016   1.00 0.00 ? 246 LEU A CA   5  
ATOM 8038  C C    . LEU A 1 68  ? 6.317   -7.804  8.577   1.00 0.00 ? 246 LEU A C    5  
ATOM 8039  O O    . LEU A 1 68  ? 6.723   -8.960  8.700   1.00 0.00 ? 246 LEU A O    5  
ATOM 8040  C CB   . LEU A 1 68  ? 6.534   -6.014  6.842   1.00 0.00 ? 246 LEU A CB   5  
ATOM 8041  C CG   . LEU A 1 68  ? 7.238   -4.774  6.292   1.00 0.00 ? 246 LEU A CG   5  
ATOM 8042  C CD1  . LEU A 1 68  ? 6.693   -4.416  4.918   1.00 0.00 ? 246 LEU A CD1  5  
ATOM 8043  C CD2  . LEU A 1 68  ? 7.082   -3.602  7.251   1.00 0.00 ? 246 LEU A CD2  5  
ATOM 8044  H H    . LEU A 1 68  ? 8.718   -7.299  6.637   1.00 0.00 ? 246 LEU A H    5  
ATOM 8045  H HA   . LEU A 1 68  ? 7.416   -5.987  8.793   1.00 0.00 ? 246 LEU A HA   5  
ATOM 8046  H HB2  . LEU A 1 68  ? 6.446   -6.729  6.038   1.00 0.00 ? 246 LEU A HB2  5  
ATOM 8047  H HB3  . LEU A 1 68  ? 5.547   -5.719  7.168   1.00 0.00 ? 246 LEU A HB3  5  
ATOM 8048  H HG   . LEU A 1 68  ? 8.294   -4.983  6.187   1.00 0.00 ? 246 LEU A HG   5  
ATOM 8049  H HD11 . LEU A 1 68  ? 7.208   -4.993  4.165   1.00 0.00 ? 246 LEU A HD11 5  
ATOM 8050  H HD12 . LEU A 1 68  ? 6.846   -3.364  4.732   1.00 0.00 ? 246 LEU A HD12 5  
ATOM 8051  H HD13 . LEU A 1 68  ? 5.636   -4.637  4.881   1.00 0.00 ? 246 LEU A HD13 5  
ATOM 8052  H HD21 . LEU A 1 68  ? 7.631   -2.753  6.873   1.00 0.00 ? 246 LEU A HD21 5  
ATOM 8053  H HD22 . LEU A 1 68  ? 7.469   -3.878  8.221   1.00 0.00 ? 246 LEU A HD22 5  
ATOM 8054  H HD23 . LEU A 1 68  ? 6.037   -3.346  7.338   1.00 0.00 ? 246 LEU A HD23 5  
ATOM 8055  N N    . LYS A 1 69  ? 5.087   -7.430  8.913   1.00 0.00 ? 247 LYS A N    5  
ATOM 8056  C CA   . LYS A 1 69  ? 4.121   -8.377  9.457   1.00 0.00 ? 247 LYS A CA   5  
ATOM 8057  C C    . LYS A 1 69  ? 2.711   -8.052  8.976   1.00 0.00 ? 247 LYS A C    5  
ATOM 8058  O O    . LYS A 1 69  ? 2.261   -6.910  9.066   1.00 0.00 ? 247 LYS A O    5  
ATOM 8059  C CB   . LYS A 1 69  ? 4.166   -8.360  10.987  1.00 0.00 ? 247 LYS A CB   5  
ATOM 8060  C CG   . LYS A 1 69  ? 5.571   -8.461  11.556  1.00 0.00 ? 247 LYS A CG   5  
ATOM 8061  C CD   . LYS A 1 69  ? 5.639   -7.916  12.973  1.00 0.00 ? 247 LYS A CD   5  
ATOM 8062  C CE   . LYS A 1 69  ? 5.092   -8.915  13.981  1.00 0.00 ? 247 LYS A CE   5  
ATOM 8063  N NZ   . LYS A 1 69  ? 3.612   -8.815  14.113  1.00 0.00 ? 247 LYS A NZ   5  
ATOM 8064  H H    . LYS A 1 69  ? 4.823   -6.493  8.791   1.00 0.00 ? 247 LYS A H    5  
ATOM 8065  H HA   . LYS A 1 69  ? 4.390   -9.362  9.109   1.00 0.00 ? 247 LYS A HA   5  
ATOM 8066  H HB2  . LYS A 1 69  ? 3.723   -7.439  11.338  1.00 0.00 ? 247 LYS A HB2  5  
ATOM 8067  H HB3  . LYS A 1 69  ? 3.588   -9.193  11.361  1.00 0.00 ? 247 LYS A HB3  5  
ATOM 8068  H HG2  . LYS A 1 69  ? 5.872   -9.498  11.566  1.00 0.00 ? 247 LYS A HG2  5  
ATOM 8069  H HG3  . LYS A 1 69  ? 6.244   -7.894  10.929  1.00 0.00 ? 247 LYS A HG3  5  
ATOM 8070  H HD2  . LYS A 1 69  ? 6.668   -7.702  13.218  1.00 0.00 ? 247 LYS A HD2  5  
ATOM 8071  H HD3  . LYS A 1 69  ? 5.057   -7.006  13.028  1.00 0.00 ? 247 LYS A HD3  5  
ATOM 8072  H HE2  . LYS A 1 69  ? 5.349   -9.911  13.656  1.00 0.00 ? 247 LYS A HE2  5  
ATOM 8073  H HE3  . LYS A 1 69  ? 5.545   -8.721  14.942  1.00 0.00 ? 247 LYS A HE3  5  
ATOM 8074  H HZ1  . LYS A 1 69  ? 3.206   -9.754  14.303  1.00 0.00 ? 247 LYS A HZ1  5  
ATOM 8075  H HZ2  . LYS A 1 69  ? 3.199   -8.443  13.235  1.00 0.00 ? 247 LYS A HZ2  5  
ATOM 8076  H HZ3  . LYS A 1 69  ? 3.365   -8.177  14.897  1.00 0.00 ? 247 LYS A HZ3  5  
ATOM 8077  N N    . VAL A 1 70  ? 2.017   -9.064  8.465   1.00 0.00 ? 248 VAL A N    5  
ATOM 8078  C CA   . VAL A 1 70  ? 0.657   -8.887  7.972   1.00 0.00 ? 248 VAL A CA   5  
ATOM 8079  C C    . VAL A 1 70  ? -0.215  -8.181  9.004   1.00 0.00 ? 248 VAL A C    5  
ATOM 8080  O O    . VAL A 1 70  ? -0.310  -8.614  10.152  1.00 0.00 ? 248 VAL A O    5  
ATOM 8081  C CB   . VAL A 1 70  ? 0.011   -10.237 7.608   1.00 0.00 ? 248 VAL A CB   5  
ATOM 8082  C CG1  . VAL A 1 70  ? -1.499  -10.093 7.490   1.00 0.00 ? 248 VAL A CG1  5  
ATOM 8083  C CG2  . VAL A 1 70  ? 0.605   -10.781 6.318   1.00 0.00 ? 248 VAL A CG2  5  
ATOM 8084  H H    . VAL A 1 70  ? 2.430   -9.952  8.420   1.00 0.00 ? 248 VAL A H    5  
ATOM 8085  H HA   . VAL A 1 70  ? 0.702   -8.281  7.078   1.00 0.00 ? 248 VAL A HA   5  
ATOM 8086  H HB   . VAL A 1 70  ? 0.222   -10.939 8.401   1.00 0.00 ? 248 VAL A HB   5  
ATOM 8087  H HG11 . VAL A 1 70  ? -1.963  -10.400 8.416   1.00 0.00 ? 248 VAL A HG11 5  
ATOM 8088  H HG12 . VAL A 1 70  ? -1.747  -9.062  7.286   1.00 0.00 ? 248 VAL A HG12 5  
ATOM 8089  H HG13 . VAL A 1 70  ? -1.858  -10.716 6.684   1.00 0.00 ? 248 VAL A HG13 5  
ATOM 8090  H HG21 . VAL A 1 70  ? -0.145  -11.350 5.789   1.00 0.00 ? 248 VAL A HG21 5  
ATOM 8091  H HG22 . VAL A 1 70  ? 0.937   -9.960  5.699   1.00 0.00 ? 248 VAL A HG22 5  
ATOM 8092  H HG23 . VAL A 1 70  ? 1.445   -11.420 6.549   1.00 0.00 ? 248 VAL A HG23 5  
ATOM 8093  N N    . GLY A 1 71  ? -0.851  -7.090  8.588   1.00 0.00 ? 249 GLY A N    5  
ATOM 8094  C CA   . GLY A 1 71  ? -1.707  -6.341  9.489   1.00 0.00 ? 249 GLY A CA   5  
ATOM 8095  C C    . GLY A 1 71  ? -1.118  -4.996  9.864   1.00 0.00 ? 249 GLY A C    5  
ATOM 8096  O O    . GLY A 1 71  ? -1.851  -4.036  10.103  1.00 0.00 ? 249 GLY A O    5  
ATOM 8097  H H    . GLY A 1 71  ? -0.738  -6.792  7.661   1.00 0.00 ? 249 GLY A H    5  
ATOM 8098  H HA2  . GLY A 1 71  ? -2.663  -6.184  9.012   1.00 0.00 ? 249 GLY A HA2  5  
ATOM 8099  H HA3  . GLY A 1 71  ? -1.856  -6.919  10.389  1.00 0.00 ? 249 GLY A HA3  5  
ATOM 8100  N N    . GLN A 1 72  ? 0.208   -4.926  9.917   1.00 0.00 ? 250 GLN A N    5  
ATOM 8101  C CA   . GLN A 1 72  ? 0.894   -3.689  10.269  1.00 0.00 ? 250 GLN A CA   5  
ATOM 8102  C C    . GLN A 1 72  ? 0.611   -2.598  9.241   1.00 0.00 ? 250 GLN A C    5  
ATOM 8103  O O    . GLN A 1 72  ? 0.420   -2.881  8.058   1.00 0.00 ? 250 GLN A O    5  
ATOM 8104  C CB   . GLN A 1 72  ? 2.401   -3.928  10.374  1.00 0.00 ? 250 GLN A CB   5  
ATOM 8105  C CG   . GLN A 1 72  ? 3.110   -3.942  9.029   1.00 0.00 ? 250 GLN A CG   5  
ATOM 8106  C CD   . GLN A 1 72  ? 4.615   -3.816  9.161   1.00 0.00 ? 250 GLN A CD   5  
ATOM 8107  O OE1  . GLN A 1 72  ? 5.332   -4.817  9.195   1.00 0.00 ? 250 GLN A OE1  5  
ATOM 8108  N NE2  . GLN A 1 72  ? 5.102   -2.583  9.237   1.00 0.00 ? 250 GLN A NE2  5  
ATOM 8109  H H    . GLN A 1 72  ? 0.737   -5.726  9.717   1.00 0.00 ? 250 GLN A H    5  
ATOM 8110  H HA   . GLN A 1 72  ? 0.523   -3.365  11.230  1.00 0.00 ? 250 GLN A HA   5  
ATOM 8111  H HB2  . GLN A 1 72  ? 2.837   -3.147  10.978  1.00 0.00 ? 250 GLN A HB2  5  
ATOM 8112  H HB3  . GLN A 1 72  ? 2.569   -4.881  10.854  1.00 0.00 ? 250 GLN A HB3  5  
ATOM 8113  H HG2  . GLN A 1 72  ? 2.885   -4.872  8.527   1.00 0.00 ? 250 GLN A HG2  5  
ATOM 8114  H HG3  . GLN A 1 72  ? 2.745   -3.117  8.436   1.00 0.00 ? 250 GLN A HG3  5  
ATOM 8115  H HE21 . GLN A 1 72  ? 4.470   -1.834  9.205   1.00 0.00 ? 250 GLN A HE21 5  
ATOM 8116  H HE22 . GLN A 1 72  ? 6.071   -2.473  9.323   1.00 0.00 ? 250 GLN A HE22 5  
ATOM 8117  N N    . TYR A 1 73  ? 0.583   -1.352  9.700   1.00 0.00 ? 251 TYR A N    5  
ATOM 8118  C CA   . TYR A 1 73  ? 0.320   -0.219  8.821   1.00 0.00 ? 251 TYR A CA   5  
ATOM 8119  C C    . TYR A 1 73  ? 1.580   0.185   8.062   1.00 0.00 ? 251 TYR A C    5  
ATOM 8120  O O    . TYR A 1 73  ? 2.649   0.352   8.652   1.00 0.00 ? 251 TYR A O    5  
ATOM 8121  C CB   . TYR A 1 73  ? -0.206  0.969   9.628   1.00 0.00 ? 251 TYR A CB   5  
ATOM 8122  C CG   . TYR A 1 73  ? -1.711  0.991   9.762   1.00 0.00 ? 251 TYR A CG   5  
ATOM 8123  C CD1  . TYR A 1 73  ? -2.507  1.569   8.781   1.00 0.00 ? 251 TYR A CD1  5  
ATOM 8124  C CD2  . TYR A 1 73  ? -2.339  0.433   10.869  1.00 0.00 ? 251 TYR A CD2  5  
ATOM 8125  C CE1  . TYR A 1 73  ? -3.883  1.593   8.899   1.00 0.00 ? 251 TYR A CE1  5  
ATOM 8126  C CE2  . TYR A 1 73  ? -3.714  0.450   10.995  1.00 0.00 ? 251 TYR A CE2  5  
ATOM 8127  C CZ   . TYR A 1 73  ? -4.482  1.032   10.007  1.00 0.00 ? 251 TYR A CZ   5  
ATOM 8128  O OH   . TYR A 1 73  ? -5.853  1.051   10.128  1.00 0.00 ? 251 TYR A OH   5  
ATOM 8129  H H    . TYR A 1 73  ? 0.743   -1.190  10.653  1.00 0.00 ? 251 TYR A H    5  
ATOM 8130  H HA   . TYR A 1 73  ? -0.434  -0.520  8.109   1.00 0.00 ? 251 TYR A HA   5  
ATOM 8131  H HB2  . TYR A 1 73  ? 0.214   0.934   10.622  1.00 0.00 ? 251 TYR A HB2  5  
ATOM 8132  H HB3  . TYR A 1 73  ? 0.099   1.886   9.146   1.00 0.00 ? 251 TYR A HB3  5  
ATOM 8133  H HD1  . TYR A 1 73  ? -2.035  2.008   7.913   1.00 0.00 ? 251 TYR A HD1  5  
ATOM 8134  H HD2  . TYR A 1 73  ? -1.735  -0.022  11.640  1.00 0.00 ? 251 TYR A HD2  5  
ATOM 8135  H HE1  . TYR A 1 73  ? -4.485  2.048   8.126   1.00 0.00 ? 251 TYR A HE1  5  
ATOM 8136  H HE2  . TYR A 1 73  ? -4.184  0.011   11.863  1.00 0.00 ? 251 TYR A HE2  5  
ATOM 8137  H HH   . TYR A 1 73  ? -6.111  0.578   10.923  1.00 0.00 ? 251 TYR A HH   5  
ATOM 8138  N N    . LEU A 1 74  ? 1.448   0.342   6.749   1.00 0.00 ? 252 LEU A N    5  
ATOM 8139  C CA   . LEU A 1 74  ? 2.574   0.728   5.907   1.00 0.00 ? 252 LEU A CA   5  
ATOM 8140  C C    . LEU A 1 74  ? 2.251   1.987   5.109   1.00 0.00 ? 252 LEU A C    5  
ATOM 8141  O O    . LEU A 1 74  ? 1.112   2.195   4.694   1.00 0.00 ? 252 LEU A O    5  
ATOM 8142  C CB   . LEU A 1 74  ? 2.940   -0.413  4.956   1.00 0.00 ? 252 LEU A CB   5  
ATOM 8143  C CG   . LEU A 1 74  ? 4.337   -0.350  4.338   1.00 0.00 ? 252 LEU A CG   5  
ATOM 8144  C CD1  . LEU A 1 74  ? 5.401   -0.611  5.393   1.00 0.00 ? 252 LEU A CD1  5  
ATOM 8145  C CD2  . LEU A 1 74  ? 4.460   -1.348  3.195   1.00 0.00 ? 252 LEU A CD2  5  
ATOM 8146  H H    . LEU A 1 74  ? 0.572   0.195   6.336   1.00 0.00 ? 252 LEU A H    5  
ATOM 8147  H HA   . LEU A 1 74  ? 3.416   0.931   6.552   1.00 0.00 ? 252 LEU A HA   5  
ATOM 8148  H HB2  . LEU A 1 74  ? 2.864   -1.339  5.506   1.00 0.00 ? 252 LEU A HB2  5  
ATOM 8149  H HB3  . LEU A 1 74  ? 2.220   -0.414  4.150   1.00 0.00 ? 252 LEU A HB3  5  
ATOM 8150  H HG   . LEU A 1 74  ? 4.502   0.641   3.937   1.00 0.00 ? 252 LEU A HG   5  
ATOM 8151  H HD11 . LEU A 1 74  ? 5.169   -0.048  6.284   1.00 0.00 ? 252 LEU A HD11 5  
ATOM 8152  H HD12 . LEU A 1 74  ? 6.365   -0.305  5.015   1.00 0.00 ? 252 LEU A HD12 5  
ATOM 8153  H HD13 . LEU A 1 74  ? 5.424   -1.665  5.627   1.00 0.00 ? 252 LEU A HD13 5  
ATOM 8154  H HD21 . LEU A 1 74  ? 3.516   -1.851  3.055   1.00 0.00 ? 252 LEU A HD21 5  
ATOM 8155  H HD22 . LEU A 1 74  ? 5.224   -2.075  3.433   1.00 0.00 ? 252 LEU A HD22 5  
ATOM 8156  H HD23 . LEU A 1 74  ? 4.729   -0.826  2.289   1.00 0.00 ? 252 LEU A HD23 5  
ATOM 8157  N N    . ASN A 1 75  ? 3.263   2.822   4.896   1.00 0.00 ? 253 ASN A N    5  
ATOM 8158  C CA   . ASN A 1 75  ? 3.087   4.060   4.145   1.00 0.00 ? 253 ASN A CA   5  
ATOM 8159  C C    . ASN A 1 75  ? 3.411   3.852   2.669   1.00 0.00 ? 253 ASN A C    5  
ATOM 8160  O O    . ASN A 1 75  ? 4.482   3.352   2.323   1.00 0.00 ? 253 ASN A O    5  
ATOM 8161  C CB   . ASN A 1 75  ? 3.976   5.163   4.724   1.00 0.00 ? 253 ASN A CB   5  
ATOM 8162  C CG   . ASN A 1 75  ? 3.557   6.545   4.263   1.00 0.00 ? 253 ASN A CG   5  
ATOM 8163  O OD1  . ASN A 1 75  ? 2.398   6.935   4.407   1.00 0.00 ? 253 ASN A OD1  5  
ATOM 8164  N ND2  . ASN A 1 75  ? 4.501   7.294   3.705   1.00 0.00 ? 253 ASN A ND2  5  
ATOM 8165  H H    . ASN A 1 75  ? 4.149   2.601   5.252   1.00 0.00 ? 253 ASN A H    5  
ATOM 8166  H HA   . ASN A 1 75  ? 2.054   4.359   4.237   1.00 0.00 ? 253 ASN A HA   5  
ATOM 8167  H HB2  . ASN A 1 75  ? 3.922   5.132   5.802   1.00 0.00 ? 253 ASN A HB2  5  
ATOM 8168  H HB3  . ASN A 1 75  ? 4.997   4.994   4.414   1.00 0.00 ? 253 ASN A HB3  5  
ATOM 8169  H HD21 . ASN A 1 75  ? 5.402   6.918   3.622   1.00 0.00 ? 253 ASN A HD21 5  
ATOM 8170  H HD22 . ASN A 1 75  ? 4.257   8.192   3.398   1.00 0.00 ? 253 ASN A HD22 5  
ATOM 8171  N N    . CYS A 1 76  ? 2.480   4.240   1.805   1.00 0.00 ? 254 CYS A N    5  
ATOM 8172  C CA   . CYS A 1 76  ? 2.666   4.096   0.365   1.00 0.00 ? 254 CYS A CA   5  
ATOM 8173  C C    . CYS A 1 76  ? 1.975   5.228   -0.388  1.00 0.00 ? 254 CYS A C    5  
ATOM 8174  O O    . CYS A 1 76  ? 1.022   5.828   0.110   1.00 0.00 ? 254 CYS A O    5  
ATOM 8175  C CB   . CYS A 1 76  ? 2.123   2.746   -0.108  1.00 0.00 ? 254 CYS A CB   5  
ATOM 8176  S SG   . CYS A 1 76  ? 3.215   1.348   0.242   1.00 0.00 ? 254 CYS A SG   5  
ATOM 8177  H H    . CYS A 1 76  ? 1.647   4.631   2.141   1.00 0.00 ? 254 CYS A H    5  
ATOM 8178  H HA   . CYS A 1 76  ? 3.725   4.139   0.163   1.00 0.00 ? 254 CYS A HA   5  
ATOM 8179  H HB2  . CYS A 1 76  ? 1.179   2.555   0.381   1.00 0.00 ? 254 CYS A HB2  5  
ATOM 8180  H HB3  . CYS A 1 76  ? 1.967   2.784   -1.176  1.00 0.00 ? 254 CYS A HB3  5  
ATOM 8181  H HG   . CYS A 1 76  ? 2.932   0.384   -0.621  1.00 0.00 ? 254 CYS A HG   5  
ATOM 8182  N N    . ILE A 1 77  ? 2.463   5.515   -1.590  1.00 0.00 ? 255 ILE A N    5  
ATOM 8183  C CA   . ILE A 1 77  ? 1.893   6.576   -2.412  1.00 0.00 ? 255 ILE A CA   5  
ATOM 8184  C C    . ILE A 1 77  ? 1.675   6.104   -3.845  1.00 0.00 ? 255 ILE A C    5  
ATOM 8185  O O    . ILE A 1 77  ? 2.510   5.400   -4.412  1.00 0.00 ? 255 ILE A O    5  
ATOM 8186  C CB   . ILE A 1 77  ? 2.795   7.824   -2.426  1.00 0.00 ? 255 ILE A CB   5  
ATOM 8187  C CG1  . ILE A 1 77  ? 2.908   8.414   -1.018  1.00 0.00 ? 255 ILE A CG1  5  
ATOM 8188  C CG2  . ILE A 1 77  ? 2.250   8.860   -3.397  1.00 0.00 ? 255 ILE A CG2  5  
ATOM 8189  C CD1  . ILE A 1 77  ? 3.990   9.463   -0.888  1.00 0.00 ? 255 ILE A CD1  5  
ATOM 8190  H H    . ILE A 1 77  ? 3.223   5.002   -1.933  1.00 0.00 ? 255 ILE A H    5  
ATOM 8191  H HA   . ILE A 1 77  ? 0.938   6.851   -1.986  1.00 0.00 ? 255 ILE A HA   5  
ATOM 8192  H HB   . ILE A 1 77  ? 3.776   7.528   -2.764  1.00 0.00 ? 255 ILE A HB   5  
ATOM 8193  H HG12 . ILE A 1 77  ? 1.969   8.871   -0.749  1.00 0.00 ? 255 ILE A HG12 5  
ATOM 8194  H HG13 . ILE A 1 77  ? 3.130   7.619   -0.320  1.00 0.00 ? 255 ILE A HG13 5  
ATOM 8195  H HG21 . ILE A 1 77  ? 2.862   9.749   -3.355  1.00 0.00 ? 255 ILE A HG21 5  
ATOM 8196  H HG22 . ILE A 1 77  ? 2.270   8.458   -4.399  1.00 0.00 ? 255 ILE A HG22 5  
ATOM 8197  H HG23 . ILE A 1 77  ? 1.235   9.109   -3.128  1.00 0.00 ? 255 ILE A HG23 5  
ATOM 8198  H HD11 . ILE A 1 77  ? 4.408   9.428   0.107   1.00 0.00 ? 255 ILE A HD11 5  
ATOM 8199  H HD12 . ILE A 1 77  ? 4.767   9.272   -1.613  1.00 0.00 ? 255 ILE A HD12 5  
ATOM 8200  H HD13 . ILE A 1 77  ? 3.566   10.441  -1.065  1.00 0.00 ? 255 ILE A HD13 5  
ATOM 8201  N N    . VAL A 1 78  ? 0.547   6.499   -4.428  1.00 0.00 ? 256 VAL A N    5  
ATOM 8202  C CA   . VAL A 1 78  ? 0.220   6.119   -5.797  1.00 0.00 ? 256 VAL A CA   5  
ATOM 8203  C C    . VAL A 1 78  ? 1.232   6.692   -6.783  1.00 0.00 ? 256 VAL A C    5  
ATOM 8204  O O    . VAL A 1 78  ? 1.392   7.907   -6.886  1.00 0.00 ? 256 VAL A O    5  
ATOM 8205  C CB   . VAL A 1 78  ? -1.191  6.597   -6.190  1.00 0.00 ? 256 VAL A CB   5  
ATOM 8206  C CG1  . VAL A 1 78  ? -1.630  5.949   -7.495  1.00 0.00 ? 256 VAL A CG1  5  
ATOM 8207  C CG2  . VAL A 1 78  ? -2.184  6.298   -5.077  1.00 0.00 ? 256 VAL A CG2  5  
ATOM 8208  H H    . VAL A 1 78  ? -0.080  7.059   -3.924  1.00 0.00 ? 256 VAL A H    5  
ATOM 8209  H HA   . VAL A 1 78  ? 0.242   5.040   -5.859  1.00 0.00 ? 256 VAL A HA   5  
ATOM 8210  H HB   . VAL A 1 78  ? -1.158  7.666   -6.338  1.00 0.00 ? 256 VAL A HB   5  
ATOM 8211  H HG11 . VAL A 1 78  ? -2.227  5.076   -7.279  1.00 0.00 ? 256 VAL A HG11 5  
ATOM 8212  H HG12 . VAL A 1 78  ? -2.213  6.654   -8.068  1.00 0.00 ? 256 VAL A HG12 5  
ATOM 8213  H HG13 . VAL A 1 78  ? -0.758  5.657   -8.062  1.00 0.00 ? 256 VAL A HG13 5  
ATOM 8214  H HG21 . VAL A 1 78  ? -2.287  7.168   -4.445  1.00 0.00 ? 256 VAL A HG21 5  
ATOM 8215  H HG22 . VAL A 1 78  ? -3.143  6.049   -5.507  1.00 0.00 ? 256 VAL A HG22 5  
ATOM 8216  H HG23 . VAL A 1 78  ? -1.826  5.466   -4.488  1.00 0.00 ? 256 VAL A HG23 5  
ATOM 8217  N N    . GLU A 1 79  ? 1.911   5.807   -7.506  1.00 0.00 ? 257 GLU A N    5  
ATOM 8218  C CA   . GLU A 1 79  ? 2.908   6.226   -8.484  1.00 0.00 ? 257 GLU A CA   5  
ATOM 8219  C C    . GLU A 1 79  ? 2.363   6.102   -9.904  1.00 0.00 ? 257 GLU A C    5  
ATOM 8220  O O    . GLU A 1 79  ? 2.480   7.026   -10.709 1.00 0.00 ? 257 GLU A O    5  
ATOM 8221  C CB   . GLU A 1 79  ? 4.180   5.387   -8.339  1.00 0.00 ? 257 GLU A CB   5  
ATOM 8222  C CG   . GLU A 1 79  ? 5.174   5.957   -7.341  1.00 0.00 ? 257 GLU A CG   5  
ATOM 8223  C CD   . GLU A 1 79  ? 5.609   7.367   -7.690  1.00 0.00 ? 257 GLU A CD   5  
ATOM 8224  O OE1  . GLU A 1 79  ? 4.866   8.315   -7.359  1.00 0.00 ? 257 GLU A OE1  5  
ATOM 8225  O OE2  . GLU A 1 79  ? 6.690   7.522   -8.295  1.00 0.00 ? 257 GLU A OE2  5  
ATOM 8226  H H    . GLU A 1 79  ? 1.738   4.851   -7.378  1.00 0.00 ? 257 GLU A H    5  
ATOM 8227  H HA   . GLU A 1 79  ? 3.147   7.261   -8.292  1.00 0.00 ? 257 GLU A HA   5  
ATOM 8228  H HB2  . GLU A 1 79  ? 3.907   4.393   -8.017  1.00 0.00 ? 257 GLU A HB2  5  
ATOM 8229  H HB3  . GLU A 1 79  ? 4.666   5.323   -9.302  1.00 0.00 ? 257 GLU A HB3  5  
ATOM 8230  H HG2  . GLU A 1 79  ? 4.716   5.970   -6.363  1.00 0.00 ? 257 GLU A HG2  5  
ATOM 8231  H HG3  . GLU A 1 79  ? 6.047   5.322   -7.319  1.00 0.00 ? 257 GLU A HG3  5  
ATOM 8232  N N    . LYS A 1 80  ? 1.768   4.953   -10.204 1.00 0.00 ? 258 LYS A N    5  
ATOM 8233  C CA   . LYS A 1 80  ? 1.203   4.705   -11.526 1.00 0.00 ? 258 LYS A CA   5  
ATOM 8234  C C    . LYS A 1 80  ? -0.140  3.991   -11.419 1.00 0.00 ? 258 LYS A C    5  
ATOM 8235  O O    . LYS A 1 80  ? -0.317  3.101   -10.587 1.00 0.00 ? 258 LYS A O    5  
ATOM 8236  C CB   . LYS A 1 80  ? 2.171   3.871   -12.368 1.00 0.00 ? 258 LYS A CB   5  
ATOM 8237  C CG   . LYS A 1 80  ? 3.179   4.704   -13.140 1.00 0.00 ? 258 LYS A CG   5  
ATOM 8238  C CD   . LYS A 1 80  ? 2.654   5.082   -14.515 1.00 0.00 ? 258 LYS A CD   5  
ATOM 8239  C CE   . LYS A 1 80  ? 3.790   5.352   -15.491 1.00 0.00 ? 258 LYS A CE   5  
ATOM 8240  N NZ   . LYS A 1 80  ? 4.366   6.712   -15.308 1.00 0.00 ? 258 LYS A NZ   5  
ATOM 8241  H H    . LYS A 1 80  ? 1.705   4.253   -9.519  1.00 0.00 ? 258 LYS A H    5  
ATOM 8242  H HA   . LYS A 1 80  ? 1.052   5.660   -12.006 1.00 0.00 ? 258 LYS A HA   5  
ATOM 8243  H HB2  . LYS A 1 80  ? 2.712   3.202   -11.716 1.00 0.00 ? 258 LYS A HB2  5  
ATOM 8244  H HB3  . LYS A 1 80  ? 1.601   3.287   -13.076 1.00 0.00 ? 258 LYS A HB3  5  
ATOM 8245  H HG2  . LYS A 1 80  ? 3.387   5.607   -12.585 1.00 0.00 ? 258 LYS A HG2  5  
ATOM 8246  H HG3  . LYS A 1 80  ? 4.090   4.134   -13.257 1.00 0.00 ? 258 LYS A HG3  5  
ATOM 8247  H HD2  . LYS A 1 80  ? 2.052   4.271   -14.897 1.00 0.00 ? 258 LYS A HD2  5  
ATOM 8248  H HD3  . LYS A 1 80  ? 2.048   5.973   -14.427 1.00 0.00 ? 258 LYS A HD3  5  
ATOM 8249  H HE2  . LYS A 1 80  ? 4.564   4.617   -15.332 1.00 0.00 ? 258 LYS A HE2  5  
ATOM 8250  H HE3  . LYS A 1 80  ? 3.410   5.263   -16.498 1.00 0.00 ? 258 LYS A HE3  5  
ATOM 8251  H HZ1  . LYS A 1 80  ? 5.312   6.645   -14.881 1.00 0.00 ? 258 LYS A HZ1  5  
ATOM 8252  H HZ2  . LYS A 1 80  ? 3.757   7.279   -14.685 1.00 0.00 ? 258 LYS A HZ2  5  
ATOM 8253  H HZ3  . LYS A 1 80  ? 4.446   7.193   -16.227 1.00 0.00 ? 258 LYS A HZ3  5  
ATOM 8254  N N    . VAL A 1 81  ? -1.085  4.386   -12.266 1.00 0.00 ? 259 VAL A N    5  
ATOM 8255  C CA   . VAL A 1 81  ? -2.412  3.782   -12.269 1.00 0.00 ? 259 VAL A CA   5  
ATOM 8256  C C    . VAL A 1 81  ? -2.745  3.194   -13.635 1.00 0.00 ? 259 VAL A C    5  
ATOM 8257  O O    . VAL A 1 81  ? -2.617  3.864   -14.660 1.00 0.00 ? 259 VAL A O    5  
ATOM 8258  C CB   . VAL A 1 81  ? -3.496  4.806   -11.884 1.00 0.00 ? 259 VAL A CB   5  
ATOM 8259  C CG1  . VAL A 1 81  ? -4.875  4.167   -11.929 1.00 0.00 ? 259 VAL A CG1  5  
ATOM 8260  C CG2  . VAL A 1 81  ? -3.214  5.388   -10.507 1.00 0.00 ? 259 VAL A CG2  5  
ATOM 8261  H H    . VAL A 1 81  ? -0.884  5.101   -12.906 1.00 0.00 ? 259 VAL A H    5  
ATOM 8262  H HA   . VAL A 1 81  ? -2.419  2.989   -11.535 1.00 0.00 ? 259 VAL A HA   5  
ATOM 8263  H HB   . VAL A 1 81  ? -3.473  5.611   -12.603 1.00 0.00 ? 259 VAL A HB   5  
ATOM 8264  H HG11 . VAL A 1 81  ? -5.545  4.797   -12.495 1.00 0.00 ? 259 VAL A HG11 5  
ATOM 8265  H HG12 . VAL A 1 81  ? -4.807  3.197   -12.400 1.00 0.00 ? 259 VAL A HG12 5  
ATOM 8266  H HG13 . VAL A 1 81  ? -5.252  4.054   -10.924 1.00 0.00 ? 259 VAL A HG13 5  
ATOM 8267  H HG21 . VAL A 1 81  ? -2.738  4.639   -9.891  1.00 0.00 ? 259 VAL A HG21 5  
ATOM 8268  H HG22 . VAL A 1 81  ? -2.560  6.243   -10.604 1.00 0.00 ? 259 VAL A HG22 5  
ATOM 8269  H HG23 . VAL A 1 81  ? -4.142  5.695   -10.049 1.00 0.00 ? 259 VAL A HG23 5  
ATOM 8270  N N    . LYS A 1 82  ? -3.176  1.937   -13.643 1.00 0.00 ? 260 LYS A N    5  
ATOM 8271  C CA   . LYS A 1 82  ? -3.531  1.257   -14.883 1.00 0.00 ? 260 LYS A CA   5  
ATOM 8272  C C    . LYS A 1 82  ? -4.975  1.555   -15.273 1.00 0.00 ? 260 LYS A C    5  
ATOM 8273  O O    . LYS A 1 82  ? -5.699  2.228   -14.541 1.00 0.00 ? 260 LYS A O    5  
ATOM 8274  C CB   . LYS A 1 82  ? -3.332  -0.253  -14.736 1.00 0.00 ? 260 LYS A CB   5  
ATOM 8275  C CG   . LYS A 1 82  ? -1.895  -0.701  -14.939 1.00 0.00 ? 260 LYS A CG   5  
ATOM 8276  C CD   . LYS A 1 82  ? -1.822  -2.139  -15.424 1.00 0.00 ? 260 LYS A CD   5  
ATOM 8277  C CE   . LYS A 1 82  ? -1.910  -2.222  -16.940 1.00 0.00 ? 260 LYS A CE   5  
ATOM 8278  N NZ   . LYS A 1 82  ? -3.298  -1.990  -17.428 1.00 0.00 ? 260 LYS A NZ   5  
ATOM 8279  H H    . LYS A 1 82  ? -3.257  1.454   -12.793 1.00 0.00 ? 260 LYS A H    5  
ATOM 8280  H HA   . LYS A 1 82  ? -2.878  1.623   -15.661 1.00 0.00 ? 260 LYS A HA   5  
ATOM 8281  H HB2  . LYS A 1 82  ? -3.643  -0.550  -13.745 1.00 0.00 ? 260 LYS A HB2  5  
ATOM 8282  H HB3  . LYS A 1 82  ? -3.951  -0.758  -15.464 1.00 0.00 ? 260 LYS A HB3  5  
ATOM 8283  H HG2  . LYS A 1 82  ? -1.429  -0.061  -15.674 1.00 0.00 ? 260 LYS A HG2  5  
ATOM 8284  H HG3  . LYS A 1 82  ? -1.366  -0.619  -14.000 1.00 0.00 ? 260 LYS A HG3  5  
ATOM 8285  H HD2  . LYS A 1 82  ? -0.885  -2.570  -15.105 1.00 0.00 ? 260 LYS A HD2  5  
ATOM 8286  H HD3  . LYS A 1 82  ? -2.642  -2.697  -14.993 1.00 0.00 ? 260 LYS A HD3  5  
ATOM 8287  H HE2  . LYS A 1 82  ? -1.258  -1.475  -17.367 1.00 0.00 ? 260 LYS A HE2  5  
ATOM 8288  H HE3  . LYS A 1 82  ? -1.587  -3.203  -17.253 1.00 0.00 ? 260 LYS A HE3  5  
ATOM 8289  H HZ1  . LYS A 1 82  ? -3.421  -2.417  -18.369 1.00 0.00 ? 260 LYS A HZ1  5  
ATOM 8290  H HZ2  . LYS A 1 82  ? -3.487  -0.970  -17.496 1.00 0.00 ? 260 LYS A HZ2  5  
ATOM 8291  H HZ3  . LYS A 1 82  ? -3.983  -2.417  -16.773 1.00 0.00 ? 260 LYS A HZ3  5  
ATOM 8292  N N    . GLY A 1 83  ? -5.387  1.048   -16.431 1.00 0.00 ? 261 GLY A N    5  
ATOM 8293  C CA   . GLY A 1 83  ? -6.744  1.270   -16.897 1.00 0.00 ? 261 GLY A CA   5  
ATOM 8294  C C    . GLY A 1 83  ? -7.711  0.222   -16.385 1.00 0.00 ? 261 GLY A C    5  
ATOM 8295  O O    . GLY A 1 83  ? -8.730  0.551   -15.779 1.00 0.00 ? 261 GLY A O    5  
ATOM 8296  H H    . GLY A 1 83  ? -4.765  0.520   -16.974 1.00 0.00 ? 261 GLY A H    5  
ATOM 8297  H HA2  . GLY A 1 83  ? -7.073  2.243   -16.563 1.00 0.00 ? 261 GLY A HA2  5  
ATOM 8298  H HA3  . GLY A 1 83  ? -6.749  1.251   -17.977 1.00 0.00 ? 261 GLY A HA3  5  
ATOM 8299  N N    . ASN A 1 84  ? -7.393  -1.045  -16.629 1.00 0.00 ? 262 ASN A N    5  
ATOM 8300  C CA   . ASN A 1 84  ? -8.243  -2.145  -16.190 1.00 0.00 ? 262 ASN A CA   5  
ATOM 8301  C C    . ASN A 1 84  ? -7.916  -2.547  -14.755 1.00 0.00 ? 262 ASN A C    5  
ATOM 8302  O O    . ASN A 1 84  ? -8.060  -3.708  -14.376 1.00 0.00 ? 262 ASN A O    5  
ATOM 8303  C CB   . ASN A 1 84  ? -8.075  -3.349  -17.119 1.00 0.00 ? 262 ASN A CB   5  
ATOM 8304  C CG   . ASN A 1 84  ? -6.622  -3.744  -17.297 1.00 0.00 ? 262 ASN A CG   5  
ATOM 8305  O OD1  . ASN A 1 84  ? -5.899  -3.951  -16.322 1.00 0.00 ? 262 ASN A OD1  5  
ATOM 8306  N ND2  . ASN A 1 84  ? -6.186  -3.849  -18.547 1.00 0.00 ? 262 ASN A ND2  5  
ATOM 8307  H H    . ASN A 1 84  ? -6.567  -1.245  -17.117 1.00 0.00 ? 262 ASN A H    5  
ATOM 8308  H HA   . ASN A 1 84  ? -9.268  -1.809  -16.233 1.00 0.00 ? 262 ASN A HA   5  
ATOM 8309  H HB2  . ASN A 1 84  ? -8.609  -4.193  -16.706 1.00 0.00 ? 262 ASN A HB2  5  
ATOM 8310  H HB3  . ASN A 1 84  ? -8.485  -3.109  -18.089 1.00 0.00 ? 262 ASN A HB3  5  
ATOM 8311  H HD21 . ASN A 1 84  ? -6.817  -3.669  -19.275 1.00 0.00 ? 262 ASN A HD21 5  
ATOM 8312  H HD22 . ASN A 1 84  ? -5.250  -4.103  -18.691 1.00 0.00 ? 262 ASN A HD22 5  
ATOM 8313  N N    . GLY A 1 85  ? -7.476  -1.576  -13.961 1.00 0.00 ? 263 GLY A N    5  
ATOM 8314  C CA   . GLY A 1 85  ? -7.136  -1.847  -12.576 1.00 0.00 ? 263 GLY A CA   5  
ATOM 8315  C C    . GLY A 1 85  ? -6.302  -3.103  -12.420 1.00 0.00 ? 263 GLY A C    5  
ATOM 8316  O O    . GLY A 1 85  ? -6.402  -3.802  -11.412 1.00 0.00 ? 263 GLY A O    5  
ATOM 8317  H H    . GLY A 1 85  ? -7.382  -0.668  -14.317 1.00 0.00 ? 263 GLY A H    5  
ATOM 8318  H HA2  . GLY A 1 85  ? -6.582  -1.008  -12.182 1.00 0.00 ? 263 GLY A HA2  5  
ATOM 8319  H HA3  . GLY A 1 85  ? -8.048  -1.962  -12.009 1.00 0.00 ? 263 GLY A HA3  5  
ATOM 8320  N N    . GLY A 1 86  ? -5.476  -3.392  -13.421 1.00 0.00 ? 264 GLY A N    5  
ATOM 8321  C CA   . GLY A 1 86  ? -4.635  -4.574  -13.371 1.00 0.00 ? 264 GLY A CA   5  
ATOM 8322  C C    . GLY A 1 86  ? -3.688  -4.562  -12.187 1.00 0.00 ? 264 GLY A C    5  
ATOM 8323  O O    . GLY A 1 86  ? -3.889  -5.290  -11.215 1.00 0.00 ? 264 GLY A O    5  
ATOM 8324  H H    . GLY A 1 86  ? -5.438  -2.799  -14.200 1.00 0.00 ? 264 GLY A H    5  
ATOM 8325  H HA2  . GLY A 1 86  ? -5.265  -5.449  -13.306 1.00 0.00 ? 264 GLY A HA2  5  
ATOM 8326  H HA3  . GLY A 1 86  ? -4.055  -4.627  -14.281 1.00 0.00 ? 264 GLY A HA3  5  
ATOM 8327  N N    . VAL A 1 87  ? -2.652  -3.734  -12.269 1.00 0.00 ? 265 VAL A N    5  
ATOM 8328  C CA   . VAL A 1 87  ? -1.669  -3.630  -11.197 1.00 0.00 ? 265 VAL A CA   5  
ATOM 8329  C C    . VAL A 1 87  ? -1.384  -2.173  -10.852 1.00 0.00 ? 265 VAL A C    5  
ATOM 8330  O O    . VAL A 1 87  ? -1.188  -1.341  -11.738 1.00 0.00 ? 265 VAL A O    5  
ATOM 8331  C CB   . VAL A 1 87  ? -0.348  -4.325  -11.577 1.00 0.00 ? 265 VAL A CB   5  
ATOM 8332  C CG1  . VAL A 1 87  ? 0.685   -4.147  -10.475 1.00 0.00 ? 265 VAL A CG1  5  
ATOM 8333  C CG2  . VAL A 1 87  ? -0.585  -5.800  -11.863 1.00 0.00 ? 265 VAL A CG2  5  
ATOM 8334  H H    . VAL A 1 87  ? -2.545  -3.179  -13.070 1.00 0.00 ? 265 VAL A H    5  
ATOM 8335  H HA   . VAL A 1 87  ? -2.074  -4.124  -10.325 1.00 0.00 ? 265 VAL A HA   5  
ATOM 8336  H HB   . VAL A 1 87  ? 0.033   -3.862  -12.475 1.00 0.00 ? 265 VAL A HB   5  
ATOM 8337  H HG11 . VAL A 1 87  ? 1.671   -4.336  -10.872 1.00 0.00 ? 265 VAL A HG11 5  
ATOM 8338  H HG12 . VAL A 1 87  ? 0.636   -3.137  -10.094 1.00 0.00 ? 265 VAL A HG12 5  
ATOM 8339  H HG13 . VAL A 1 87  ? 0.481   -4.843  -9.675  1.00 0.00 ? 265 VAL A HG13 5  
ATOM 8340  H HG21 . VAL A 1 87  ? 0.349   -6.268  -12.134 1.00 0.00 ? 265 VAL A HG21 5  
ATOM 8341  H HG22 . VAL A 1 87  ? -0.985  -6.279  -10.981 1.00 0.00 ? 265 VAL A HG22 5  
ATOM 8342  H HG23 . VAL A 1 87  ? -1.288  -5.900  -12.677 1.00 0.00 ? 265 VAL A HG23 5  
ATOM 8343  N N    . VAL A 1 88  ? -1.362  -1.870  -9.558  1.00 0.00 ? 266 VAL A N    5  
ATOM 8344  C CA   . VAL A 1 88  ? -1.098  -0.513  -9.094  1.00 0.00 ? 266 VAL A CA   5  
ATOM 8345  C C    . VAL A 1 88  ? 0.317   -0.385  -8.544  1.00 0.00 ? 266 VAL A C    5  
ATOM 8346  O O    . VAL A 1 88  ? 0.810   -1.278  -7.855  1.00 0.00 ? 266 VAL A O    5  
ATOM 8347  C CB   . VAL A 1 88  ? -2.101  -0.087  -8.005  1.00 0.00 ? 266 VAL A CB   5  
ATOM 8348  C CG1  . VAL A 1 88  ? -1.970  1.399   -7.710  1.00 0.00 ? 266 VAL A CG1  5  
ATOM 8349  C CG2  . VAL A 1 88  ? -3.522  -0.432  -8.426  1.00 0.00 ? 266 VAL A CG2  5  
ATOM 8350  H H    . VAL A 1 88  ? -1.526  -2.577  -8.899  1.00 0.00 ? 266 VAL A H    5  
ATOM 8351  H HA   . VAL A 1 88  ? -1.209  0.155   -9.936  1.00 0.00 ? 266 VAL A HA   5  
ATOM 8352  H HB   . VAL A 1 88  ? -1.873  -0.633  -7.101  1.00 0.00 ? 266 VAL A HB   5  
ATOM 8353  H HG11 . VAL A 1 88  ? -1.995  1.557   -6.641  1.00 0.00 ? 266 VAL A HG11 5  
ATOM 8354  H HG12 . VAL A 1 88  ? -1.034  1.764   -8.107  1.00 0.00 ? 266 VAL A HG12 5  
ATOM 8355  H HG13 . VAL A 1 88  ? -2.789  1.931   -8.171  1.00 0.00 ? 266 VAL A HG13 5  
ATOM 8356  H HG21 . VAL A 1 88  ? -4.138  0.452   -8.366  1.00 0.00 ? 266 VAL A HG21 5  
ATOM 8357  H HG22 . VAL A 1 88  ? -3.518  -0.801  -9.441  1.00 0.00 ? 266 VAL A HG22 5  
ATOM 8358  H HG23 . VAL A 1 88  ? -3.918  -1.192  -7.769  1.00 0.00 ? 266 VAL A HG23 5  
ATOM 8359  N N    . SER A 1 89  ? 0.968   0.732   -8.853  1.00 0.00 ? 267 SER A N    5  
ATOM 8360  C CA   . SER A 1 89  ? 2.330   0.976   -8.392  1.00 0.00 ? 267 SER A CA   5  
ATOM 8361  C C    . SER A 1 89  ? 2.335   1.898   -7.177  1.00 0.00 ? 267 SER A C    5  
ATOM 8362  O O    . SER A 1 89  ? 1.893   3.046   -7.251  1.00 0.00 ? 267 SER A O    5  
ATOM 8363  C CB   . SER A 1 89  ? 3.169   1.589   -9.515  1.00 0.00 ? 267 SER A CB   5  
ATOM 8364  O OG   . SER A 1 89  ? 4.543   1.284   -9.350  1.00 0.00 ? 267 SER A OG   5  
ATOM 8365  H H    . SER A 1 89  ? 0.522   1.407   -9.406  1.00 0.00 ? 267 SER A H    5  
ATOM 8366  H HA   . SER A 1 89  ? 2.760   0.026   -8.110  1.00 0.00 ? 267 SER A HA   5  
ATOM 8367  H HB2  . SER A 1 89  ? 2.837   1.196   -10.464 1.00 0.00 ? 267 SER A HB2  5  
ATOM 8368  H HB3  . SER A 1 89  ? 3.047   2.662   -9.507  1.00 0.00 ? 267 SER A HB3  5  
ATOM 8369  H HG   . SER A 1 89  ? 4.943   1.132   -10.209 1.00 0.00 ? 267 SER A HG   5  
ATOM 8370  N N    . LEU A 1 90  ? 2.838   1.389   -6.058  1.00 0.00 ? 268 LEU A N    5  
ATOM 8371  C CA   . LEU A 1 90  ? 2.901   2.166   -4.825  1.00 0.00 ? 268 LEU A CA   5  
ATOM 8372  C C    . LEU A 1 90  ? 4.348   2.446   -4.432  1.00 0.00 ? 268 LEU A C    5  
ATOM 8373  O O    . LEU A 1 90  ? 5.246   1.656   -4.723  1.00 0.00 ? 268 LEU A O    5  
ATOM 8374  C CB   . LEU A 1 90  ? 2.189   1.423   -3.693  1.00 0.00 ? 268 LEU A CB   5  
ATOM 8375  C CG   . LEU A 1 90  ? 0.675   1.620   -3.610  1.00 0.00 ? 268 LEU A CG   5  
ATOM 8376  C CD1  . LEU A 1 90  ? 0.065   0.653   -2.607  1.00 0.00 ? 268 LEU A CD1  5  
ATOM 8377  C CD2  . LEU A 1 90  ? 0.344   3.058   -3.236  1.00 0.00 ? 268 LEU A CD2  5  
ATOM 8378  H H    . LEU A 1 90  ? 3.175   0.469   -6.060  1.00 0.00 ? 268 LEU A H    5  
ATOM 8379  H HA   . LEU A 1 90  ? 2.400   3.106   -4.999  1.00 0.00 ? 268 LEU A HA   5  
ATOM 8380  H HB2  . LEU A 1 90  ? 2.378   0.368   -3.820  1.00 0.00 ? 268 LEU A HB2  5  
ATOM 8381  H HB3  . LEU A 1 90  ? 2.619   1.754   -2.759  1.00 0.00 ? 268 LEU A HB3  5  
ATOM 8382  H HG   . LEU A 1 90  ? 0.238   1.416   -4.577  1.00 0.00 ? 268 LEU A HG   5  
ATOM 8383  H HD11 . LEU A 1 90  ? 0.723   0.554   -1.757  1.00 0.00 ? 268 LEU A HD11 5  
ATOM 8384  H HD12 . LEU A 1 90  ? -0.069  -0.312  -3.073  1.00 0.00 ? 268 LEU A HD12 5  
ATOM 8385  H HD13 . LEU A 1 90  ? -0.893  1.030   -2.280  1.00 0.00 ? 268 LEU A HD13 5  
ATOM 8386  H HD21 . LEU A 1 90  ? 1.235   3.549   -2.873  1.00 0.00 ? 268 LEU A HD21 5  
ATOM 8387  H HD22 . LEU A 1 90  ? -0.411  3.064   -2.463  1.00 0.00 ? 268 LEU A HD22 5  
ATOM 8388  H HD23 . LEU A 1 90  ? -0.026  3.579   -4.106  1.00 0.00 ? 268 LEU A HD23 5  
ATOM 8389  N N    . SER A 1 91  ? 4.567   3.577   -3.767  1.00 0.00 ? 269 SER A N    5  
ATOM 8390  C CA   . SER A 1 91  ? 5.905   3.963   -3.336  1.00 0.00 ? 269 SER A CA   5  
ATOM 8391  C C    . SER A 1 91  ? 5.853   4.709   -2.006  1.00 0.00 ? 269 SER A C    5  
ATOM 8392  O O    . SER A 1 91  ? 4.943   5.501   -1.761  1.00 0.00 ? 269 SER A O    5  
ATOM 8393  C CB   . SER A 1 91  ? 6.575   4.837   -4.398  1.00 0.00 ? 269 SER A CB   5  
ATOM 8394  O OG   . SER A 1 91  ? 6.038   6.148   -4.392  1.00 0.00 ? 269 SER A OG   5  
ATOM 8395  H H    . SER A 1 91  ? 3.811   4.166   -3.565  1.00 0.00 ? 269 SER A H    5  
ATOM 8396  H HA   . SER A 1 91  ? 6.485   3.061   -3.206  1.00 0.00 ? 269 SER A HA   5  
ATOM 8397  H HB2  . SER A 1 91  ? 7.634   4.893   -4.199  1.00 0.00 ? 269 SER A HB2  5  
ATOM 8398  H HB3  . SER A 1 91  ? 6.414   4.399   -5.373  1.00 0.00 ? 269 SER A HB3  5  
ATOM 8399  H HG   . SER A 1 91  ? 6.687   6.758   -4.031  1.00 0.00 ? 269 SER A HG   5  
ATOM 8400  N N    . VAL A 1 92  ? 6.837   4.450   -1.150  1.00 0.00 ? 270 VAL A N    5  
ATOM 8401  C CA   . VAL A 1 92  ? 6.905   5.097   0.155   1.00 0.00 ? 270 VAL A CA   5  
ATOM 8402  C C    . VAL A 1 92  ? 7.338   6.553   0.024   1.00 0.00 ? 270 VAL A C    5  
ATOM 8403  O O    . VAL A 1 92  ? 8.281   6.868   -0.700  1.00 0.00 ? 270 VAL A O    5  
ATOM 8404  C CB   . VAL A 1 92  ? 7.881   4.365   1.094   1.00 0.00 ? 270 VAL A CB   5  
ATOM 8405  C CG1  . VAL A 1 92  ? 7.508   2.895   1.211   1.00 0.00 ? 270 VAL A CG1  5  
ATOM 8406  C CG2  . VAL A 1 92  ? 9.312   4.523   0.603   1.00 0.00 ? 270 VAL A CG2  5  
ATOM 8407  H H    . VAL A 1 92  ? 7.533   3.809   -1.403  1.00 0.00 ? 270 VAL A H    5  
ATOM 8408  H HA   . VAL A 1 92  ? 5.919   5.063   0.596   1.00 0.00 ? 270 VAL A HA   5  
ATOM 8409  H HB   . VAL A 1 92  ? 7.808   4.811   2.075   1.00 0.00 ? 270 VAL A HB   5  
ATOM 8410  H HG11 . VAL A 1 92  ? 6.690   2.677   0.541   1.00 0.00 ? 270 VAL A HG11 5  
ATOM 8411  H HG12 . VAL A 1 92  ? 8.361   2.285   0.950   1.00 0.00 ? 270 VAL A HG12 5  
ATOM 8412  H HG13 . VAL A 1 92  ? 7.208   2.679   2.226   1.00 0.00 ? 270 VAL A HG13 5  
ATOM 8413  H HG21 . VAL A 1 92  ? 9.785   5.336   1.133   1.00 0.00 ? 270 VAL A HG21 5  
ATOM 8414  H HG22 . VAL A 1 92  ? 9.859   3.609   0.785   1.00 0.00 ? 270 VAL A HG22 5  
ATOM 8415  H HG23 . VAL A 1 92  ? 9.309   4.735   -0.455  1.00 0.00 ? 270 VAL A HG23 5  
ATOM 8416  N N    . GLY A 1 93  ? 6.642   7.438   0.732   1.00 0.00 ? 271 GLY A N    5  
ATOM 8417  C CA   . GLY A 1 93  ? 6.970   8.851   0.681   1.00 0.00 ? 271 GLY A CA   5  
ATOM 8418  C C    . GLY A 1 93  ? 6.600   9.578   1.959   1.00 0.00 ? 271 GLY A C    5  
ATOM 8419  O O    . GLY A 1 93  ? 5.421   9.800   2.236   1.00 0.00 ? 271 GLY A O    5  
ATOM 8420  H H    . GLY A 1 93  ? 5.900   7.129   1.292   1.00 0.00 ? 271 GLY A H    5  
ATOM 8421  H HA2  . GLY A 1 93  ? 8.031   8.957   0.513   1.00 0.00 ? 271 GLY A HA2  5  
ATOM 8422  H HA3  . GLY A 1 93  ? 6.438   9.303   -0.143  1.00 0.00 ? 271 GLY A HA3  5  
ATOM 8423  N N    . HIS A 1 94  ? 7.609   9.948   2.741   1.00 0.00 ? 272 HIS A N    5  
ATOM 8424  C CA   . HIS A 1 94  ? 7.383   10.653  3.998   1.00 0.00 ? 272 HIS A CA   5  
ATOM 8425  C C    . HIS A 1 94  ? 7.309   12.160  3.770   1.00 0.00 ? 272 HIS A C    5  
ATOM 8426  O O    . HIS A 1 94  ? 7.785   12.945  4.589   1.00 0.00 ? 272 HIS A O    5  
ATOM 8427  C CB   . HIS A 1 94  ? 8.496   10.330  4.995   1.00 0.00 ? 272 HIS A CB   5  
ATOM 8428  C CG   . HIS A 1 94  ? 9.748   11.121  4.772   1.00 0.00 ? 272 HIS A CG   5  
ATOM 8429  N ND1  . HIS A 1 94  ? 10.679  10.801  3.806   1.00 0.00 ? 272 HIS A ND1  5  
ATOM 8430  C CD2  . HIS A 1 94  ? 10.220  12.226  5.395   1.00 0.00 ? 272 HIS A CD2  5  
ATOM 8431  C CE1  . HIS A 1 94  ? 11.670  11.673  3.846   1.00 0.00 ? 272 HIS A CE1  5  
ATOM 8432  N NE2  . HIS A 1 94  ? 11.416  12.549  4.802   1.00 0.00 ? 272 HIS A NE2  5  
ATOM 8433  H H    . HIS A 1 94  ? 8.526   9.742   2.466   1.00 0.00 ? 272 HIS A H    5  
ATOM 8434  H HA   . HIS A 1 94  ? 6.441   10.316  4.402   1.00 0.00 ? 272 HIS A HA   5  
ATOM 8435  H HB2  . HIS A 1 94  ? 8.146   10.539  5.995   1.00 0.00 ? 272 HIS A HB2  5  
ATOM 8436  H HB3  . HIS A 1 94  ? 8.747   9.282   4.918   1.00 0.00 ? 272 HIS A HB3  5  
ATOM 8437  H HD1  . HIS A 1 94  ? 10.622  10.045  3.185   1.00 0.00 ? 272 HIS A HD1  5  
ATOM 8438  H HD2  . HIS A 1 94  ? 9.745   12.756  6.209   1.00 0.00 ? 272 HIS A HD2  5  
ATOM 8439  H HE1  . HIS A 1 94  ? 12.540  11.672  3.207   1.00 0.00 ? 272 HIS A HE1  5  
ATOM 8440  H HE2  . HIS A 1 94  ? 12.029  13.252  5.101   1.00 0.00 ? 272 HIS A HE2  5  
ATOM 8441  N N    . SER A 1 95  ? 6.711   12.555  2.651   1.00 0.00 ? 273 SER A N    5  
ATOM 8442  C CA   . SER A 1 95  ? 6.579   13.968  2.312   1.00 0.00 ? 273 SER A CA   5  
ATOM 8443  C C    . SER A 1 95  ? 5.137   14.434  2.481   1.00 0.00 ? 273 SER A C    5  
ATOM 8444  O O    . SER A 1 95  ? 4.329   14.334  1.558   1.00 0.00 ? 273 SER A O    5  
ATOM 8445  C CB   . SER A 1 95  ? 7.042   14.215  0.875   1.00 0.00 ? 273 SER A CB   5  
ATOM 8446  O OG   . SER A 1 95  ? 8.455   14.303  0.803   1.00 0.00 ? 273 SER A OG   5  
ATOM 8447  H H    . SER A 1 95  ? 6.352   11.881  2.037   1.00 0.00 ? 273 SER A H    5  
ATOM 8448  H HA   . SER A 1 95  ? 7.208   14.530  2.986   1.00 0.00 ? 273 SER A HA   5  
ATOM 8449  H HB2  . SER A 1 95  ? 6.712   13.401  0.248   1.00 0.00 ? 273 SER A HB2  5  
ATOM 8450  H HB3  . SER A 1 95  ? 6.617   15.141  0.517   1.00 0.00 ? 273 SER A HB3  5  
ATOM 8451  H HG   . SER A 1 95  ? 8.838   13.436  0.952   1.00 0.00 ? 273 SER A HG   5  
ATOM 8452  N N    . GLU A 1 96  ? 4.821   14.944  3.668   1.00 0.00 ? 274 GLU A N    5  
ATOM 8453  C CA   . GLU A 1 96  ? 3.476   15.426  3.958   1.00 0.00 ? 274 GLU A CA   5  
ATOM 8454  C C    . GLU A 1 96  ? 3.451   16.217  5.263   1.00 0.00 ? 274 GLU A C    5  
ATOM 8455  O O    . GLU A 1 96  ? 4.028   15.799  6.266   1.00 0.00 ? 274 GLU A O    5  
ATOM 8456  C CB   . GLU A 1 96  ? 2.497   14.253  4.042   1.00 0.00 ? 274 GLU A CB   5  
ATOM 8457  C CG   . GLU A 1 96  ? 2.732   13.349  5.240   1.00 0.00 ? 274 GLU A CG   5  
ATOM 8458  C CD   . GLU A 1 96  ? 1.612   12.346  5.443   1.00 0.00 ? 274 GLU A CD   5  
ATOM 8459  O OE1  . GLU A 1 96  ? 1.033   11.891  4.435   1.00 0.00 ? 274 GLU A OE1  5  
ATOM 8460  O OE2  . GLU A 1 96  ? 1.316   12.017  6.611   1.00 0.00 ? 274 GLU A OE2  5  
ATOM 8461  H H    . GLU A 1 96  ? 5.509   14.997  4.364   1.00 0.00 ? 274 GLU A H    5  
ATOM 8462  H HA   . GLU A 1 96  ? 3.175   16.076  3.151   1.00 0.00 ? 274 GLU A HA   5  
ATOM 8463  H HB2  . GLU A 1 96  ? 1.491   14.642  4.101   1.00 0.00 ? 274 GLU A HB2  5  
ATOM 8464  H HB3  . GLU A 1 96  ? 2.591   13.658  3.145   1.00 0.00 ? 274 GLU A HB3  5  
ATOM 8465  H HG2  . GLU A 1 96  ? 3.655   12.809  5.093   1.00 0.00 ? 274 GLU A HG2  5  
ATOM 8466  H HG3  . GLU A 1 96  ? 2.812   13.961  6.127   1.00 0.00 ? 274 GLU A HG3  5  
ATOM 8467  N N    . VAL A 1 97  ? 2.778   17.364  5.240   1.00 0.00 ? 275 VAL A N    5  
ATOM 8468  C CA   . VAL A 1 97  ? 2.677   18.214  6.420   1.00 0.00 ? 275 VAL A CA   5  
ATOM 8469  C C    . VAL A 1 97  ? 3.959   18.166  7.244   1.00 0.00 ? 275 VAL A C    5  
ATOM 8470  O O    . VAL A 1 97  ? 3.926   18.283  8.469   1.00 0.00 ? 275 VAL A O    5  
ATOM 8471  C CB   . VAL A 1 97  ? 1.491   17.799  7.310   1.00 0.00 ? 275 VAL A CB   5  
ATOM 8472  C CG1  . VAL A 1 97  ? 1.173   18.892  8.319   1.00 0.00 ? 275 VAL A CG1  5  
ATOM 8473  C CG2  . VAL A 1 97  ? 0.273   17.477  6.459   1.00 0.00 ? 275 VAL A CG2  5  
ATOM 8474  H H    . VAL A 1 97  ? 2.339   17.644  4.410   1.00 0.00 ? 275 VAL A H    5  
ATOM 8475  H HA   . VAL A 1 97  ? 2.513   19.229  6.087   1.00 0.00 ? 275 VAL A HA   5  
ATOM 8476  H HB   . VAL A 1 97  ? 1.770   16.908  7.854   1.00 0.00 ? 275 VAL A HB   5  
ATOM 8477  H HG11 . VAL A 1 97  ? 1.386   19.857  7.883   1.00 0.00 ? 275 VAL A HG11 5  
ATOM 8478  H HG12 . VAL A 1 97  ? 0.128   18.841  8.589   1.00 0.00 ? 275 VAL A HG12 5  
ATOM 8479  H HG13 . VAL A 1 97  ? 1.780   18.755  9.202   1.00 0.00 ? 275 VAL A HG13 5  
ATOM 8480  H HG21 . VAL A 1 97  ? 0.583   16.936  5.578   1.00 0.00 ? 275 VAL A HG21 5  
ATOM 8481  H HG22 . VAL A 1 97  ? -0.416  16.871  7.029   1.00 0.00 ? 275 VAL A HG22 5  
ATOM 8482  H HG23 . VAL A 1 97  ? -0.214  18.395  6.165   1.00 0.00 ? 275 VAL A HG23 5  
ATOM 8483  N N    . SER A 1 98  ? 5.087   17.992  6.563   1.00 0.00 ? 276 SER A N    5  
ATOM 8484  C CA   . SER A 1 98  ? 6.381   17.925  7.232   1.00 0.00 ? 276 SER A CA   5  
ATOM 8485  C C    . SER A 1 98  ? 6.587   19.134  8.140   1.00 0.00 ? 276 SER A C    5  
ATOM 8486  O O    . SER A 1 98  ? 7.058   19.004  9.271   1.00 0.00 ? 276 SER A O    5  
ATOM 8487  C CB   . SER A 1 98  ? 7.509   17.849  6.201   1.00 0.00 ? 276 SER A CB   5  
ATOM 8488  O OG   . SER A 1 98  ? 7.678   19.090  5.538   1.00 0.00 ? 276 SER A OG   5  
ATOM 8489  H H    . SER A 1 98  ? 5.048   17.905  5.587   1.00 0.00 ? 276 SER A H    5  
ATOM 8490  H HA   . SER A 1 98  ? 6.396   17.030  7.836   1.00 0.00 ? 276 SER A HA   5  
ATOM 8491  H HB2  . SER A 1 98  ? 8.432   17.593  6.699   1.00 0.00 ? 276 SER A HB2  5  
ATOM 8492  H HB3  . SER A 1 98  ? 7.273   17.092  5.468   1.00 0.00 ? 276 SER A HB3  5  
ATOM 8493  H HG   . SER A 1 98  ? 8.600   19.354  5.582   1.00 0.00 ? 276 SER A HG   5  
ATOM 8494  N N    . THR A 1 99  ? 6.230   20.312  7.637   1.00 0.00 ? 277 THR A N    5  
ATOM 8495  C CA   . THR A 1 99  ? 6.376   21.545  8.400   1.00 0.00 ? 277 THR A CA   5  
ATOM 8496  C C    . THR A 1 99  ? 5.033   22.012  8.951   1.00 0.00 ? 277 THR A C    5  
ATOM 8497  O O    . THR A 1 99  ? 3.993   21.822  8.321   1.00 0.00 ? 277 THR A O    5  
ATOM 8498  C CB   . THR A 1 99  ? 6.985   22.668  7.541   1.00 0.00 ? 277 THR A CB   5  
ATOM 8499  O OG1  . THR A 1 99  ? 6.138   22.941  6.418   1.00 0.00 ? 277 THR A OG1  5  
ATOM 8500  C CG2  . THR A 1 99  ? 8.374   22.285  7.053   1.00 0.00 ? 277 THR A CG2  5  
ATOM 8501  H H    . THR A 1 99  ? 5.861   20.350  6.730   1.00 0.00 ? 277 THR A H    5  
ATOM 8502  H HA   . THR A 1 99  ? 7.044   21.349  9.226   1.00 0.00 ? 277 THR A HA   5  
ATOM 8503  H HB   . THR A 1 99  ? 7.066   23.560  8.146   1.00 0.00 ? 277 THR A HB   5  
ATOM 8504  H HG1  . THR A 1 99  ? 6.651   23.364  5.726   1.00 0.00 ? 277 THR A HG1  5  
ATOM 8505  H HG21 . THR A 1 99  ? 8.597   22.821  6.143   1.00 0.00 ? 277 THR A HG21 5  
ATOM 8506  H HG22 . THR A 1 99  ? 8.408   21.222  6.863   1.00 0.00 ? 277 THR A HG22 5  
ATOM 8507  H HG23 . THR A 1 99  ? 9.103   22.539  7.808   1.00 0.00 ? 277 THR A HG23 5  
ATOM 8508  N N    . ALA A 1 100 ? 5.064   22.626  10.129  1.00 0.00 ? 278 ALA A N    5  
ATOM 8509  C CA   . ALA A 1 100 ? 3.849   23.123  10.763  1.00 0.00 ? 278 ALA A CA   5  
ATOM 8510  C C    . ALA A 1 100 ? 3.165   24.172  9.892   1.00 0.00 ? 278 ALA A C    5  
ATOM 8511  O O    . ALA A 1 100 ? 3.577   25.332  9.863   1.00 0.00 ? 278 ALA A O    5  
ATOM 8512  C CB   . ALA A 1 100 ? 4.168   23.700  12.135  1.00 0.00 ? 278 ALA A CB   5  
ATOM 8513  H H    . ALA A 1 100 ? 5.924   22.748  10.582  1.00 0.00 ? 278 ALA A H    5  
ATOM 8514  H HA   . ALA A 1 100 ? 3.177   22.288  10.898  1.00 0.00 ? 278 ALA A HA   5  
ATOM 8515  H HB1  . ALA A 1 100 ? 4.385   24.754  12.039  1.00 0.00 ? 278 ALA A HB1  5  
ATOM 8516  H HB2  . ALA A 1 100 ? 3.319   23.565  12.788  1.00 0.00 ? 278 ALA A HB2  5  
ATOM 8517  H HB3  . ALA A 1 100 ? 5.026   23.191  12.548  1.00 0.00 ? 278 ALA A HB3  5  
ATOM 8518  N N    . ILE A 1 101 ? 2.121   23.756  9.184   1.00 0.00 ? 279 ILE A N    5  
ATOM 8519  C CA   . ILE A 1 101 ? 1.381   24.660  8.313   1.00 0.00 ? 279 ILE A CA   5  
ATOM 8520  C C    . ILE A 1 101 ? 0.372   25.485  9.106   1.00 0.00 ? 279 ILE A C    5  
ATOM 8521  O O    . ILE A 1 101 ? -0.252  24.987  10.042  1.00 0.00 ? 279 ILE A O    5  
ATOM 8522  C CB   . ILE A 1 101 ? 0.639   23.891  7.203   1.00 0.00 ? 279 ILE A CB   5  
ATOM 8523  C CG1  . ILE A 1 101 ? 1.635   23.119  6.335   1.00 0.00 ? 279 ILE A CG1  5  
ATOM 8524  C CG2  . ILE A 1 101 ? -0.182  24.849  6.353   1.00 0.00 ? 279 ILE A CG2  5  
ATOM 8525  C CD1  . ILE A 1 101 ? 1.048   21.876  5.703   1.00 0.00 ? 279 ILE A CD1  5  
ATOM 8526  H H    . ILE A 1 101 ? 1.841   22.819  9.249   1.00 0.00 ? 279 ILE A H    5  
ATOM 8527  H HA   . ILE A 1 101 ? 2.090   25.329  7.847   1.00 0.00 ? 279 ILE A HA   5  
ATOM 8528  H HB   . ILE A 1 101 ? -0.038  23.193  7.671   1.00 0.00 ? 279 ILE A HB   5  
ATOM 8529  H HG12 . ILE A 1 101 ? 1.984   23.760  5.541   1.00 0.00 ? 279 ILE A HG12 5  
ATOM 8530  H HG13 . ILE A 1 101 ? 2.474   22.818  6.945   1.00 0.00 ? 279 ILE A HG13 5  
ATOM 8531  H HG21 . ILE A 1 101 ? 0.479   25.536  5.844   1.00 0.00 ? 279 ILE A HG21 5  
ATOM 8532  H HG22 . ILE A 1 101 ? -0.747  24.289  5.623   1.00 0.00 ? 279 ILE A HG22 5  
ATOM 8533  H HG23 . ILE A 1 101 ? -0.858  25.403  6.985   1.00 0.00 ? 279 ILE A HG23 5  
ATOM 8534  H HD11 . ILE A 1 101 ? 1.740   21.054  5.814   1.00 0.00 ? 279 ILE A HD11 5  
ATOM 8535  H HD12 . ILE A 1 101 ? 0.116   21.630  6.189   1.00 0.00 ? 279 ILE A HD12 5  
ATOM 8536  H HD13 . ILE A 1 101 ? 0.870   22.056  4.653   1.00 0.00 ? 279 ILE A HD13 5  
ATOM 8537  N N    . ALA A 1 102 ? 0.217   26.748  8.722   1.00 0.00 ? 280 ALA A N    5  
ATOM 8538  C CA   . ALA A 1 102 ? -0.719  27.640  9.395   1.00 0.00 ? 280 ALA A CA   5  
ATOM 8539  C C    . ALA A 1 102 ? -1.723  28.226  8.408   1.00 0.00 ? 280 ALA A C    5  
ATOM 8540  O O    . ALA A 1 102 ? -1.545  29.338  7.910   1.00 0.00 ? 280 ALA A O    5  
ATOM 8541  C CB   . ALA A 1 102 ? 0.034   28.753  10.108  1.00 0.00 ? 280 ALA A CB   5  
ATOM 8542  H H    . ALA A 1 102 ? 0.743   27.086  7.968   1.00 0.00 ? 280 ALA A H    5  
ATOM 8543  H HA   . ALA A 1 102 ? -1.252  27.066  10.138  1.00 0.00 ? 280 ALA A HA   5  
ATOM 8544  H HB1  . ALA A 1 102 ? -0.673  29.458  10.521  1.00 0.00 ? 280 ALA A HB1  5  
ATOM 8545  H HB2  . ALA A 1 102 ? 0.630   28.332  10.904  1.00 0.00 ? 280 ALA A HB2  5  
ATOM 8546  H HB3  . ALA A 1 102 ? 0.678   29.260  9.405   1.00 0.00 ? 280 ALA A HB3  5  
ATOM 8547  N N    . THR A 1 103 ? -2.782  27.471  8.130   1.00 0.00 ? 281 THR A N    5  
ATOM 8548  C CA   . THR A 1 103 ? -3.814  27.915  7.202   1.00 0.00 ? 281 THR A CA   5  
ATOM 8549  C C    . THR A 1 103 ? -5.205  27.722  7.794   1.00 0.00 ? 281 THR A C    5  
ATOM 8550  O O    . THR A 1 103 ? -5.362  27.099  8.843   1.00 0.00 ? 281 THR A O    5  
ATOM 8551  C CB   . THR A 1 103 ? -3.729  27.158  5.863   1.00 0.00 ? 281 THR A CB   5  
ATOM 8552  O OG1  . THR A 1 103 ? -3.673  25.747  6.101   1.00 0.00 ? 281 THR A OG1  5  
ATOM 8553  C CG2  . THR A 1 103 ? -2.505  27.593  5.072   1.00 0.00 ? 281 THR A CG2  5  
ATOM 8554  H H    . THR A 1 103 ? -2.868  26.595  8.559   1.00 0.00 ? 281 THR A H    5  
ATOM 8555  H HA   . THR A 1 103 ? -3.658  28.966  7.007   1.00 0.00 ? 281 THR A HA   5  
ATOM 8556  H HB   . THR A 1 103 ? -4.613  27.383  5.283   1.00 0.00 ? 281 THR A HB   5  
ATOM 8557  H HG1  . THR A 1 103 ? -4.465  25.469  6.567   1.00 0.00 ? 281 THR A HG1  5  
ATOM 8558  H HG21 . THR A 1 103 ? -2.796  28.321  4.329   1.00 0.00 ? 281 THR A HG21 5  
ATOM 8559  H HG22 . THR A 1 103 ? -2.068  26.734  4.583   1.00 0.00 ? 281 THR A HG22 5  
ATOM 8560  H HG23 . THR A 1 103 ? -1.781  28.032  5.742   1.00 0.00 ? 281 THR A HG23 5  
ATOM 8561  N N    . GLU A 1 104 ? -6.213  28.261  7.114   1.00 0.00 ? 282 GLU A N    5  
ATOM 8562  C CA   . GLU A 1 104 ? -7.592  28.147  7.575   1.00 0.00 ? 282 GLU A CA   5  
ATOM 8563  C C    . GLU A 1 104 ? -8.401  27.242  6.651   1.00 0.00 ? 282 GLU A C    5  
ATOM 8564  O O    . GLU A 1 104 ? -8.514  27.503  5.453   1.00 0.00 ? 282 GLU A O    5  
ATOM 8565  C CB   . GLU A 1 104 ? -8.243  29.530  7.651   1.00 0.00 ? 282 GLU A CB   5  
ATOM 8566  C CG   . GLU A 1 104 ? -7.733  30.380  8.802   1.00 0.00 ? 282 GLU A CG   5  
ATOM 8567  C CD   . GLU A 1 104 ? -6.225  30.537  8.788   1.00 0.00 ? 282 GLU A CD   5  
ATOM 8568  O OE1  . GLU A 1 104 ? -5.697  31.120  7.818   1.00 0.00 ? 282 GLU A OE1  5  
ATOM 8569  O OE2  . GLU A 1 104 ? -5.572  30.078  9.749   1.00 0.00 ? 282 GLU A OE2  5  
ATOM 8570  H H    . GLU A 1 104 ? -6.024  28.746  6.284   1.00 0.00 ? 282 GLU A H    5  
ATOM 8571  H HA   . GLU A 1 104 ? -7.576  27.712  8.562   1.00 0.00 ? 282 GLU A HA   5  
ATOM 8572  H HB2  . GLU A 1 104 ? -8.050  30.057  6.728   1.00 0.00 ? 282 GLU A HB2  5  
ATOM 8573  H HB3  . GLU A 1 104 ? -9.309  29.406  7.768   1.00 0.00 ? 282 GLU A HB3  5  
ATOM 8574  H HG2  . GLU A 1 104 ? -8.182  31.360  8.736   1.00 0.00 ? 282 GLU A HG2  5  
ATOM 8575  H HG3  . GLU A 1 104 ? -8.023  29.914  9.733   1.00 0.00 ? 282 GLU A HG3  5  
ATOM 8576  N N    . GLN A 1 105 ? -8.961  26.178  7.216   1.00 0.00 ? 283 GLN A N    5  
ATOM 8577  C CA   . GLN A 1 105 ? -9.759  25.233  6.443   1.00 0.00 ? 283 GLN A CA   5  
ATOM 8578  C C    . GLN A 1 105 ? -10.760 25.965  5.556   1.00 0.00 ? 283 GLN A C    5  
ATOM 8579  O O    . GLN A 1 105 ? -11.101 27.120  5.811   1.00 0.00 ? 283 GLN A O    5  
ATOM 8580  C CB   . GLN A 1 105 ? -10.494 24.270  7.377   1.00 0.00 ? 283 GLN A CB   5  
ATOM 8581  C CG   . GLN A 1 105 ? -10.883 22.959  6.715   1.00 0.00 ? 283 GLN A CG   5  
ATOM 8582  C CD   . GLN A 1 105 ? -9.704  22.257  6.071   1.00 0.00 ? 283 GLN A CD   5  
ATOM 8583  O OE1  . GLN A 1 105 ? -8.675  22.033  6.711   1.00 0.00 ? 283 GLN A OE1  5  
ATOM 8584  N NE2  . GLN A 1 105 ? -9.846  21.905  4.799   1.00 0.00 ? 283 GLN A NE2  5  
ATOM 8585  H H    . GLN A 1 105 ? -8.834  26.024  8.175   1.00 0.00 ? 283 GLN A H    5  
ATOM 8586  H HA   . GLN A 1 105 ? -9.087  24.668  5.815   1.00 0.00 ? 283 GLN A HA   5  
ATOM 8587  H HB2  . GLN A 1 105 ? -9.857  24.048  8.220   1.00 0.00 ? 283 GLN A HB2  5  
ATOM 8588  H HB3  . GLN A 1 105 ? -11.394 24.750  7.732   1.00 0.00 ? 283 GLN A HB3  5  
ATOM 8589  H HG2  . GLN A 1 105 ? -11.307 22.304  7.462   1.00 0.00 ? 283 GLN A HG2  5  
ATOM 8590  H HG3  . GLN A 1 105 ? -11.623 23.160  5.954   1.00 0.00 ? 283 GLN A HG3  5  
ATOM 8591  H HE21 . GLN A 1 105 ? -10.693 22.117  4.352   1.00 0.00 ? 283 GLN A HE21 5  
ATOM 8592  H HE22 . GLN A 1 105 ? -9.099  21.451  4.358   1.00 0.00 ? 283 GLN A HE22 5  
ATOM 8593  N N    . GLN A 1 106 ? -11.228 25.285  4.514   1.00 0.00 ? 284 GLN A N    5  
ATOM 8594  C CA   . GLN A 1 106 ? -12.190 25.872  3.589   1.00 0.00 ? 284 GLN A CA   5  
ATOM 8595  C C    . GLN A 1 106 ? -13.305 24.883  3.263   1.00 0.00 ? 284 GLN A C    5  
ATOM 8596  O O    . GLN A 1 106 ? -13.082 23.885  2.578   1.00 0.00 ? 284 GLN A O    5  
ATOM 8597  C CB   . GLN A 1 106 ? -11.490 26.311  2.302   1.00 0.00 ? 284 GLN A CB   5  
ATOM 8598  C CG   . GLN A 1 106 ? -10.392 25.360  1.853   1.00 0.00 ? 284 GLN A CG   5  
ATOM 8599  C CD   . GLN A 1 106 ? -10.087 25.480  0.372   1.00 0.00 ? 284 GLN A CD   5  
ATOM 8600  O OE1  . GLN A 1 106 ? -10.200 24.509  -0.377  1.00 0.00 ? 284 GLN A OE1  5  
ATOM 8601  N NE2  . GLN A 1 106 ? -9.698  26.674  -0.058  1.00 0.00 ? 284 GLN A NE2  5  
ATOM 8602  H H    . GLN A 1 106 ? -10.919 24.368  4.364   1.00 0.00 ? 284 GLN A H    5  
ATOM 8603  H HA   . GLN A 1 106 ? -12.623 26.738  4.066   1.00 0.00 ? 284 GLN A HA   5  
ATOM 8604  H HB2  . GLN A 1 106 ? -12.223 26.379  1.513   1.00 0.00 ? 284 GLN A HB2  5  
ATOM 8605  H HB3  . GLN A 1 106 ? -11.050 27.285  2.460   1.00 0.00 ? 284 GLN A HB3  5  
ATOM 8606  H HG2  . GLN A 1 106 ? -9.492  25.581  2.408   1.00 0.00 ? 284 GLN A HG2  5  
ATOM 8607  H HG3  . GLN A 1 106 ? -10.703 24.347  2.061   1.00 0.00 ? 284 GLN A HG3  5  
ATOM 8608  H HE21 . GLN A 1 106 ? -9.629  27.401  0.596   1.00 0.00 ? 284 GLN A HE21 5  
ATOM 8609  H HE22 . GLN A 1 106 ? -9.493  26.779  -1.010  1.00 0.00 ? 284 GLN A HE22 5  
ATOM 8610  N N    . SER A 1 107 ? -14.505 25.167  3.759   1.00 0.00 ? 285 SER A N    5  
ATOM 8611  C CA   . SER A 1 107 ? -15.654 24.301  3.524   1.00 0.00 ? 285 SER A CA   5  
ATOM 8612  C C    . SER A 1 107 ? -16.930 25.122  3.366   1.00 0.00 ? 285 SER A C    5  
ATOM 8613  O O    . SER A 1 107 ? -17.127 26.123  4.055   1.00 0.00 ? 285 SER A O    5  
ATOM 8614  C CB   . SER A 1 107 ? -15.814 23.306  4.676   1.00 0.00 ? 285 SER A CB   5  
ATOM 8615  O OG   . SER A 1 107 ? -16.399 22.096  4.228   1.00 0.00 ? 285 SER A OG   5  
ATOM 8616  H H    . SER A 1 107 ? -14.619 25.978  4.298   1.00 0.00 ? 285 SER A H    5  
ATOM 8617  H HA   . SER A 1 107 ? -15.476 23.754  2.610   1.00 0.00 ? 285 SER A HA   5  
ATOM 8618  H HB2  . SER A 1 107 ? -14.844 23.088  5.097   1.00 0.00 ? 285 SER A HB2  5  
ATOM 8619  H HB3  . SER A 1 107 ? -16.447 23.739  5.437   1.00 0.00 ? 285 SER A HB3  5  
ATOM 8620  H HG   . SER A 1 107 ? -15.932 21.783  3.450   1.00 0.00 ? 285 SER A HG   5  
ATOM 8621  N N    . TRP A 1 108 ? -17.794 24.690  2.454   1.00 0.00 ? 286 TRP A N    5  
ATOM 8622  C CA   . TRP A 1 108 ? -19.052 25.385  2.204   1.00 0.00 ? 286 TRP A CA   5  
ATOM 8623  C C    . TRP A 1 108 ? -20.242 24.484  2.513   1.00 0.00 ? 286 TRP A C    5  
ATOM 8624  O O    . TRP A 1 108 ? -20.973 24.075  1.612   1.00 0.00 ? 286 TRP A O    5  
ATOM 8625  C CB   . TRP A 1 108 ? -19.117 25.857  0.750   1.00 0.00 ? 286 TRP A CB   5  
ATOM 8626  C CG   . TRP A 1 108 ? -18.230 27.031  0.466   1.00 0.00 ? 286 TRP A CG   5  
ATOM 8627  C CD1  . TRP A 1 108 ? -16.865 27.053  0.498   1.00 0.00 ? 286 TRP A CD1  5  
ATOM 8628  C CD2  . TRP A 1 108 ? -18.646 28.353  0.108   1.00 0.00 ? 286 TRP A CD2  5  
ATOM 8629  N NE1  . TRP A 1 108 ? -16.408 28.310  0.182   1.00 0.00 ? 286 TRP A NE1  5  
ATOM 8630  C CE2  . TRP A 1 108 ? -17.481 29.125  -0.062  1.00 0.00 ? 286 TRP A CE2  5  
ATOM 8631  C CE3  . TRP A 1 108 ? -19.890 28.959  -0.087  1.00 0.00 ? 286 TRP A CE3  5  
ATOM 8632  C CZ2  . TRP A 1 108 ? -17.525 30.471  -0.417  1.00 0.00 ? 286 TRP A CZ2  5  
ATOM 8633  C CZ3  . TRP A 1 108 ? -19.932 30.295  -0.438  1.00 0.00 ? 286 TRP A CZ3  5  
ATOM 8634  C CH2  . TRP A 1 108 ? -18.756 31.039  -0.601  1.00 0.00 ? 286 TRP A CH2  5  
ATOM 8635  H H    . TRP A 1 108 ? -17.581 23.886  1.936   1.00 0.00 ? 286 TRP A H    5  
ATOM 8636  H HA   . TRP A 1 108 ? -19.088 26.246  2.854   1.00 0.00 ? 286 TRP A HA   5  
ATOM 8637  H HB2  . TRP A 1 108 ? -18.817 25.047  0.101   1.00 0.00 ? 286 TRP A HB2  5  
ATOM 8638  H HB3  . TRP A 1 108 ? -20.133 26.142  0.518   1.00 0.00 ? 286 TRP A HB3  5  
ATOM 8639  H HD1  . TRP A 1 108 ? -16.248 26.201  0.740   1.00 0.00 ? 286 TRP A HD1  5  
ATOM 8640  H HE1  . TRP A 1 108 ? -15.465 28.577  0.137   1.00 0.00 ? 286 TRP A HE1  5  
ATOM 8641  H HE3  . TRP A 1 108 ? -20.808 28.403  0.034   1.00 0.00 ? 286 TRP A HE3  5  
ATOM 8642  H HZ2  . TRP A 1 108 ? -16.627 31.058  -0.546  1.00 0.00 ? 286 TRP A HZ2  5  
ATOM 8643  H HZ3  . TRP A 1 108 ? -20.885 30.781  -0.592  1.00 0.00 ? 286 TRP A HZ3  5  
ATOM 8644  H HH2  . TRP A 1 108 ? -18.836 32.079  -0.876  1.00 0.00 ? 286 TRP A HH2  5  
ATOM 8645  N N    . ASN A 1 109 ? -20.430 24.178  3.792   1.00 0.00 ? 287 ASN A N    5  
ATOM 8646  C CA   . ASN A 1 109 ? -21.532 23.324  4.220   1.00 0.00 ? 287 ASN A CA   5  
ATOM 8647  C C    . ASN A 1 109 ? -21.777 23.461  5.719   1.00 0.00 ? 287 ASN A C    5  
ATOM 8648  O O    . ASN A 1 109 ? -20.846 23.686  6.494   1.00 0.00 ? 287 ASN A O    5  
ATOM 8649  C CB   . ASN A 1 109 ? -21.238 21.863  3.872   1.00 0.00 ? 287 ASN A CB   5  
ATOM 8650  C CG   . ASN A 1 109 ? -19.766 21.523  4.001   1.00 0.00 ? 287 ASN A CG   5  
ATOM 8651  O OD1  . ASN A 1 109 ? -19.225 21.470  5.106   1.00 0.00 ? 287 ASN A OD1  5  
ATOM 8652  N ND2  . ASN A 1 109 ? -19.111 21.292  2.870   1.00 0.00 ? 287 ASN A ND2  5  
ATOM 8653  H H    . ASN A 1 109 ? -19.813 24.534  4.465   1.00 0.00 ? 287 ASN A H    5  
ATOM 8654  H HA   . ASN A 1 109 ? -22.420 23.639  3.691   1.00 0.00 ? 287 ASN A HA   5  
ATOM 8655  H HB2  . ASN A 1 109 ? -21.796 21.221  4.538   1.00 0.00 ? 287 ASN A HB2  5  
ATOM 8656  H HB3  . ASN A 1 109 ? -21.545 21.672  2.854   1.00 0.00 ? 287 ASN A HB3  5  
ATOM 8657  H HD21 . ASN A 1 109 ? -19.606 21.352  2.026   1.00 0.00 ? 287 ASN A HD21 5  
ATOM 8658  H HD22 . ASN A 1 109 ? -18.158 21.069  2.924   1.00 0.00 ? 287 ASN A HD22 5  
ATOM 8659  N N    . LEU A 1 110 ? -23.036 23.325  6.122   1.00 0.00 ? 288 LEU A N    5  
ATOM 8660  C CA   . LEU A 1 110 ? -23.404 23.433  7.530   1.00 0.00 ? 288 LEU A CA   5  
ATOM 8661  C C    . LEU A 1 110 ? -24.066 22.149  8.020   1.00 0.00 ? 288 LEU A C    5  
ATOM 8662  O O    . LEU A 1 110 ? -24.739 21.456  7.258   1.00 0.00 ? 288 LEU A O    5  
ATOM 8663  C CB   . LEU A 1 110 ? -24.348 24.618  7.741   1.00 0.00 ? 288 LEU A CB   5  
ATOM 8664  C CG   . LEU A 1 110 ? -24.920 24.778  9.149   1.00 0.00 ? 288 LEU A CG   5  
ATOM 8665  C CD1  . LEU A 1 110 ? -23.864 25.330  10.095  1.00 0.00 ? 288 LEU A CD1  5  
ATOM 8666  C CD2  . LEU A 1 110 ? -26.144 25.683  9.128   1.00 0.00 ? 288 LEU A CD2  5  
ATOM 8667  H H    . LEU A 1 110 ? -23.734 23.147  5.459   1.00 0.00 ? 288 LEU A H    5  
ATOM 8668  H HA   . LEU A 1 110 ? -22.500 23.597  8.097   1.00 0.00 ? 288 LEU A HA   5  
ATOM 8669  H HB2  . LEU A 1 110 ? -23.805 25.520  7.500   1.00 0.00 ? 288 LEU A HB2  5  
ATOM 8670  H HB3  . LEU A 1 110 ? -25.176 24.506  7.056   1.00 0.00 ? 288 LEU A HB3  5  
ATOM 8671  H HG   . LEU A 1 110 ? -25.225 23.809  9.519   1.00 0.00 ? 288 LEU A HG   5  
ATOM 8672  H HD11 . LEU A 1 110 ? -23.216 26.004  9.557   1.00 0.00 ? 288 LEU A HD11 5  
ATOM 8673  H HD12 . LEU A 1 110 ? -23.281 24.515  10.498  1.00 0.00 ? 288 LEU A HD12 5  
ATOM 8674  H HD13 . LEU A 1 110 ? -24.347 25.860  10.903  1.00 0.00 ? 288 LEU A HD13 5  
ATOM 8675  H HD21 . LEU A 1 110 ? -26.341 26.044  10.127  1.00 0.00 ? 288 LEU A HD21 5  
ATOM 8676  H HD22 . LEU A 1 110 ? -26.998 25.124  8.773   1.00 0.00 ? 288 LEU A HD22 5  
ATOM 8677  H HD23 . LEU A 1 110 ? -25.962 26.519  8.471   1.00 0.00 ? 288 LEU A HD23 5  
ATOM 8678  N N    . ASN A 1 111 ? -23.871 21.839  9.297   1.00 0.00 ? 289 ASN A N    5  
ATOM 8679  C CA   . ASN A 1 111 ? -24.450 20.639  9.890   1.00 0.00 ? 289 ASN A CA   5  
ATOM 8680  C C    . ASN A 1 111 ? -24.618 20.803  11.397  1.00 0.00 ? 289 ASN A C    5  
ATOM 8681  O O    . ASN A 1 111 ? -24.112 21.756  11.988  1.00 0.00 ? 289 ASN A O    5  
ATOM 8682  C CB   . ASN A 1 111 ? -23.571 19.423  9.592   1.00 0.00 ? 289 ASN A CB   5  
ATOM 8683  C CG   . ASN A 1 111 ? -23.947 18.742  8.291   1.00 0.00 ? 289 ASN A CG   5  
ATOM 8684  O OD1  . ASN A 1 111 ? -23.709 19.275  7.207   1.00 0.00 ? 289 ASN A OD1  5  
ATOM 8685  N ND2  . ASN A 1 111 ? -24.539 17.557  8.392   1.00 0.00 ? 289 ASN A ND2  5  
ATOM 8686  H H    . ASN A 1 111 ? -23.325 22.431  9.855   1.00 0.00 ? 289 ASN A H    5  
ATOM 8687  H HA   . ASN A 1 111 ? -25.423 20.486  9.446   1.00 0.00 ? 289 ASN A HA   5  
ATOM 8688  H HB2  . ASN A 1 111 ? -22.540 19.739  9.525   1.00 0.00 ? 289 ASN A HB2  5  
ATOM 8689  H HB3  . ASN A 1 111 ? -23.673 18.707  10.394  1.00 0.00 ? 289 ASN A HB3  5  
ATOM 8690  H HD21 . ASN A 1 111 ? -24.698 17.194  9.289   1.00 0.00 ? 289 ASN A HD21 5  
ATOM 8691  H HD22 . ASN A 1 111 ? -24.792 17.095  7.566   1.00 0.00 ? 289 ASN A HD22 5  
ATOM 8692  N N    . ASN A 1 112 ? -25.331 19.866  12.013  1.00 0.00 ? 290 ASN A N    5  
ATOM 8693  C CA   . ASN A 1 112 ? -25.566 19.906  13.452  1.00 0.00 ? 290 ASN A CA   5  
ATOM 8694  C C    . ASN A 1 112 ? -25.122 18.604  14.112  1.00 0.00 ? 290 ASN A C    5  
ATOM 8695  O O    . ASN A 1 112 ? -25.859 17.616  14.119  1.00 0.00 ? 290 ASN A O    5  
ATOM 8696  C CB   . ASN A 1 112 ? -27.046 20.160  13.742  1.00 0.00 ? 290 ASN A CB   5  
ATOM 8697  C CG   . ASN A 1 112 ? -27.421 21.622  13.600  1.00 0.00 ? 290 ASN A CG   5  
ATOM 8698  O OD1  . ASN A 1 112 ? -26.658 22.510  13.982  1.00 0.00 ? 290 ASN A OD1  5  
ATOM 8699  N ND2  . ASN A 1 112 ? -28.601 21.880  13.048  1.00 0.00 ? 290 ASN A ND2  5  
ATOM 8700  H H    . ASN A 1 112 ? -25.709 19.130  11.488  1.00 0.00 ? 290 ASN A H    5  
ATOM 8701  H HA   . ASN A 1 112 ? -24.984 20.719  13.860  1.00 0.00 ? 290 ASN A HA   5  
ATOM 8702  H HB2  . ASN A 1 112 ? -27.646 19.586  13.050  1.00 0.00 ? 290 ASN A HB2  5  
ATOM 8703  H HB3  . ASN A 1 112 ? -27.269 19.846  14.751  1.00 0.00 ? 290 ASN A HB3  5  
ATOM 8704  H HD21 . ASN A 1 112 ? -29.156 21.122  12.767  1.00 0.00 ? 290 ASN A HD21 5  
ATOM 8705  H HD22 . ASN A 1 112 ? -28.868 22.817  12.944  1.00 0.00 ? 290 ASN A HD22 5  
ATOM 8706  N N    . LEU A 1 113 ? -23.915 18.609  14.667  1.00 0.00 ? 291 LEU A N    5  
ATOM 8707  C CA   . LEU A 1 113 ? -23.373 17.428  15.331  1.00 0.00 ? 291 LEU A CA   5  
ATOM 8708  C C    . LEU A 1 113 ? -22.987 17.744  16.772  1.00 0.00 ? 291 LEU A C    5  
ATOM 8709  O O    . LEU A 1 113 ? -22.775 18.903  17.129  1.00 0.00 ? 291 LEU A O    5  
ATOM 8710  C CB   . LEU A 1 113 ? -22.156 16.903  14.567  1.00 0.00 ? 291 LEU A CB   5  
ATOM 8711  C CG   . LEU A 1 113 ? -20.804 17.491  14.974  1.00 0.00 ? 291 LEU A CG   5  
ATOM 8712  C CD1  . LEU A 1 113 ? -19.671 16.578  14.531  1.00 0.00 ? 291 LEU A CD1  5  
ATOM 8713  C CD2  . LEU A 1 113 ? -20.630 18.884  14.387  1.00 0.00 ? 291 LEU A CD2  5  
ATOM 8714  H H    . LEU A 1 113 ? -23.375 19.425  14.630  1.00 0.00 ? 291 LEU A H    5  
ATOM 8715  H HA   . LEU A 1 113 ? -24.141 16.669  15.335  1.00 0.00 ? 291 LEU A HA   5  
ATOM 8716  H HB2  . LEU A 1 113 ? -22.110 15.835  14.713  1.00 0.00 ? 291 LEU A HB2  5  
ATOM 8717  H HB3  . LEU A 1 113 ? -22.308 17.115  13.518  1.00 0.00 ? 291 LEU A HB3  5  
ATOM 8718  H HG   . LEU A 1 113 ? -20.764 17.574  16.051  1.00 0.00 ? 291 LEU A HG   5  
ATOM 8719  H HD11 . LEU A 1 113 ? -20.058 15.587  14.348  1.00 0.00 ? 291 LEU A HD11 5  
ATOM 8720  H HD12 . LEU A 1 113 ? -18.920 16.535  15.307  1.00 0.00 ? 291 LEU A HD12 5  
ATOM 8721  H HD13 . LEU A 1 113 ? -19.229 16.966  13.625  1.00 0.00 ? 291 LEU A HD13 5  
ATOM 8722  H HD21 . LEU A 1 113 ? -19.595 19.032  14.114  1.00 0.00 ? 291 LEU A HD21 5  
ATOM 8723  H HD22 . LEU A 1 113 ? -20.918 19.622  15.121  1.00 0.00 ? 291 LEU A HD22 5  
ATOM 8724  H HD23 . LEU A 1 113 ? -21.251 18.985  13.510  1.00 0.00 ? 291 LEU A HD23 5  
ATOM 8725  N N    . SER A 1 114 ? -22.894 16.704  17.595  1.00 0.00 ? 292 SER A N    5  
ATOM 8726  C CA   . SER A 1 114 ? -22.534 16.870  18.999  1.00 0.00 ? 292 SER A CA   5  
ATOM 8727  C C    . SER A 1 114 ? -22.065 15.549  19.600  1.00 0.00 ? 292 SER A C    5  
ATOM 8728  O O    . SER A 1 114 ? -22.725 14.520  19.455  1.00 0.00 ? 292 SER A O    5  
ATOM 8729  C CB   . SER A 1 114 ? -23.725 17.411  19.792  1.00 0.00 ? 292 SER A CB   5  
ATOM 8730  O OG   . SER A 1 114 ? -23.341 17.769  21.108  1.00 0.00 ? 292 SER A OG   5  
ATOM 8731  H H    . SER A 1 114 ? -23.075 15.805  17.251  1.00 0.00 ? 292 SER A H    5  
ATOM 8732  H HA   . SER A 1 114 ? -21.724 17.583  19.051  1.00 0.00 ? 292 SER A HA   5  
ATOM 8733  H HB2  . SER A 1 114 ? -24.120 18.284  19.295  1.00 0.00 ? 292 SER A HB2  5  
ATOM 8734  H HB3  . SER A 1 114 ? -24.491 16.651  19.848  1.00 0.00 ? 292 SER A HB3  5  
ATOM 8735  H HG   . SER A 1 114 ? -22.587 17.239  21.378  1.00 0.00 ? 292 SER A HG   5  
ATOM 8736  N N    . GLY A 1 115 ? -20.920 15.585  20.274  1.00 0.00 ? 293 GLY A N    5  
ATOM 8737  C CA   . GLY A 1 115 ? -20.382 14.385  20.887  1.00 0.00 ? 293 GLY A CA   5  
ATOM 8738  C C    . GLY A 1 115 ? -20.174 14.540  22.381  1.00 0.00 ? 293 GLY A C    5  
ATOM 8739  O O    . GLY A 1 115 ? -19.047 14.655  22.863  1.00 0.00 ? 293 GLY A O    5  
ATOM 8740  H H    . GLY A 1 115 ? -20.437 16.434  20.357  1.00 0.00 ? 293 GLY A H    5  
ATOM 8741  H HA2  . GLY A 1 115 ? -21.065 13.567  20.712  1.00 0.00 ? 293 GLY A HA2  5  
ATOM 8742  H HA3  . GLY A 1 115 ? -19.433 14.154  20.425  1.00 0.00 ? 293 GLY A HA3  5  
ATOM 8743  N N    . PRO A 1 116 ? -21.280 14.546  23.139  1.00 0.00 ? 294 PRO A N    5  
ATOM 8744  C CA   . PRO A 1 116 ? -21.240 14.689  24.597  1.00 0.00 ? 294 PRO A CA   5  
ATOM 8745  C C    . PRO A 1 116 ? -20.657 13.458  25.284  1.00 0.00 ? 294 PRO A C    5  
ATOM 8746  O O    . PRO A 1 116 ? -21.393 12.579  25.732  1.00 0.00 ? 294 PRO A O    5  
ATOM 8747  C CB   . PRO A 1 116 ? -22.712 14.867  24.977  1.00 0.00 ? 294 PRO A CB   5  
ATOM 8748  C CG   . PRO A 1 116 ? -23.469 14.205  23.878  1.00 0.00 ? 294 PRO A CG   5  
ATOM 8749  C CD   . PRO A 1 116 ? -22.656 14.413  22.631  1.00 0.00 ? 294 PRO A CD   5  
ATOM 8750  H HA   . PRO A 1 116 ? -20.681 15.564  24.895  1.00 0.00 ? 294 PRO A HA   5  
ATOM 8751  H HB2  . PRO A 1 116 ? -22.900 14.392  25.930  1.00 0.00 ? 294 PRO A HB2  5  
ATOM 8752  H HB3  . PRO A 1 116 ? -22.946 15.919  25.040  1.00 0.00 ? 294 PRO A HB3  5  
ATOM 8753  H HG2  . PRO A 1 116 ? -23.574 13.152  24.087  1.00 0.00 ? 294 PRO A HG2  5  
ATOM 8754  H HG3  . PRO A 1 116 ? -24.440 14.666  23.773  1.00 0.00 ? 294 PRO A HG3  5  
ATOM 8755  H HD2  . PRO A 1 116 ? -22.745 13.560  21.976  1.00 0.00 ? 294 PRO A HD2  5  
ATOM 8756  H HD3  . PRO A 1 116 ? -22.967 15.315  22.123  1.00 0.00 ? 294 PRO A HD3  5  
ATOM 8757  N N    . SER A 1 117 ? -19.332 13.402  25.364  1.00 0.00 ? 295 SER A N    5  
ATOM 8758  C CA   . SER A 1 117 ? -18.651 12.277  25.993  1.00 0.00 ? 295 SER A CA   5  
ATOM 8759  C C    . SER A 1 117 ? -18.031 12.693  27.324  1.00 0.00 ? 295 SER A C    5  
ATOM 8760  O O    . SER A 1 117 ? -17.066 13.456  27.361  1.00 0.00 ? 295 SER A O    5  
ATOM 8761  C CB   . SER A 1 117 ? -17.568 11.724  25.065  1.00 0.00 ? 295 SER A CB   5  
ATOM 8762  O OG   . SER A 1 117 ? -18.127 11.267  23.845  1.00 0.00 ? 295 SER A OG   5  
ATOM 8763  H H    . SER A 1 117 ? -18.799 14.134  24.987  1.00 0.00 ? 295 SER A H    5  
ATOM 8764  H HA   . SER A 1 117 ? -19.384 11.506  26.177  1.00 0.00 ? 295 SER A HA   5  
ATOM 8765  H HB2  . SER A 1 117 ? -16.851 12.501  24.849  1.00 0.00 ? 295 SER A HB2  5  
ATOM 8766  H HB3  . SER A 1 117 ? -17.069 10.898  25.550  1.00 0.00 ? 295 SER A HB3  5  
ATOM 8767  H HG   . SER A 1 117 ? -17.577 10.570  23.482  1.00 0.00 ? 295 SER A HG   5  
ATOM 8768  N N    . SER A 1 118 ? -18.593 12.184  28.416  1.00 0.00 ? 296 SER A N    5  
ATOM 8769  C CA   . SER A 1 118 ? -18.100 12.505  29.750  1.00 0.00 ? 296 SER A CA   5  
ATOM 8770  C C    . SER A 1 118 ? -16.960 11.571  30.147  1.00 0.00 ? 296 SER A C    5  
ATOM 8771  O O    . SER A 1 118 ? -16.888 10.432  29.687  1.00 0.00 ? 296 SER A O    5  
ATOM 8772  C CB   . SER A 1 118 ? -19.233 12.409  30.773  1.00 0.00 ? 296 SER A CB   5  
ATOM 8773  O OG   . SER A 1 118 ? -18.738 12.529  32.096  1.00 0.00 ? 296 SER A OG   5  
ATOM 8774  H H    . SER A 1 118 ? -19.360 11.581  28.322  1.00 0.00 ? 296 SER A H    5  
ATOM 8775  H HA   . SER A 1 118 ? -17.728 13.519  29.731  1.00 0.00 ? 296 SER A HA   5  
ATOM 8776  H HB2  . SER A 1 118 ? -19.944 13.201  30.594  1.00 0.00 ? 296 SER A HB2  5  
ATOM 8777  H HB3  . SER A 1 118 ? -19.726 11.453  30.671  1.00 0.00 ? 296 SER A HB3  5  
ATOM 8778  H HG   . SER A 1 118 ? -18.123 11.814  32.274  1.00 0.00 ? 296 SER A HG   5  
ATOM 8779  N N    . GLY A 1 119 ? -16.072 12.063  31.005  1.00 0.00 ? 297 GLY A N    5  
ATOM 8780  C CA   . GLY A 1 119 ? -14.948 11.260  31.450  1.00 0.00 ? 297 GLY A CA   5  
ATOM 8781  C C    . GLY A 1 119 ? -15.158 10.686  32.837  1.00 0.00 ? 297 GLY A C    5  
ATOM 8782  O O    . GLY A 1 119 ? -15.907 11.243  33.640  1.00 0.00 ? 297 GLY A O    5  
ATOM 8783  H H    . GLY A 1 119 ? -16.180 12.978  31.339  1.00 0.00 ? 297 GLY A H    5  
ATOM 8784  H HA2  . GLY A 1 119 ? -14.801 10.448  30.754  1.00 0.00 ? 297 GLY A HA2  5  
ATOM 8785  H HA3  . GLY A 1 119 ? -14.061 11.877  31.459  1.00 0.00 ? 297 GLY A HA3  5  
ATOM 8786  N N    . GLY A 1 1   ? -13.798 -4.492  -18.162 1.00 0.00 ? 179 GLY A N    6  
ATOM 8787  C CA   . GLY A 1 1   ? -14.734 -3.718  -18.958 1.00 0.00 ? 179 GLY A CA   6  
ATOM 8788  C C    . GLY A 1 1   ? -14.181 -3.367  -20.324 1.00 0.00 ? 179 GLY A C    6  
ATOM 8789  O O    . GLY A 1 1   ? -12.999 -3.049  -20.460 1.00 0.00 ? 179 GLY A O    6  
ATOM 8790  H H1   . GLY A 1 1   ? -13.981 -5.436  -17.975 1.00 0.00 ? 179 GLY A H1   6  
ATOM 8791  H HA2  . GLY A 1 1   ? -15.641 -4.290  -19.084 1.00 0.00 ? 179 GLY A HA2  6  
ATOM 8792  H HA3  . GLY A 1 1   ? -14.967 -2.805  -18.431 1.00 0.00 ? 179 GLY A HA3  6  
ATOM 8793  N N    . SER A 1 2   ? -15.036 -3.424  -21.340 1.00 0.00 ? 180 SER A N    6  
ATOM 8794  C CA   . SER A 1 2   ? -14.625 -3.115  -22.704 1.00 0.00 ? 180 SER A CA   6  
ATOM 8795  C C    . SER A 1 2   ? -14.818 -1.632  -23.007 1.00 0.00 ? 180 SER A C    6  
ATOM 8796  O O    . SER A 1 2   ? -15.418 -1.266  -24.017 1.00 0.00 ? 180 SER A O    6  
ATOM 8797  C CB   . SER A 1 2   ? -15.419 -3.958  -23.703 1.00 0.00 ? 180 SER A CB   6  
ATOM 8798  O OG   . SER A 1 2   ? -16.799 -3.635  -23.659 1.00 0.00 ? 180 SER A OG   6  
ATOM 8799  H H    . SER A 1 2   ? -15.965 -3.684  -21.168 1.00 0.00 ? 180 SER A H    6  
ATOM 8800  H HA   . SER A 1 2   ? -13.576 -3.356  -22.797 1.00 0.00 ? 180 SER A HA   6  
ATOM 8801  H HB2  . SER A 1 2   ? -15.050 -3.774  -24.700 1.00 0.00 ? 180 SER A HB2  6  
ATOM 8802  H HB3  . SER A 1 2   ? -15.299 -5.005  -23.462 1.00 0.00 ? 180 SER A HB3  6  
ATOM 8803  H HG   . SER A 1 2   ? -16.936 -2.764  -24.039 1.00 0.00 ? 180 SER A HG   6  
ATOM 8804  N N    . SER A 1 3   ? -14.304 -0.782  -22.123 1.00 0.00 ? 181 SER A N    6  
ATOM 8805  C CA   . SER A 1 3   ? -14.423 0.661   -22.291 1.00 0.00 ? 181 SER A CA   6  
ATOM 8806  C C    . SER A 1 3   ? -13.072 1.280   -22.639 1.00 0.00 ? 181 SER A C    6  
ATOM 8807  O O    . SER A 1 3   ? -12.352 1.758   -21.764 1.00 0.00 ? 181 SER A O    6  
ATOM 8808  C CB   . SER A 1 3   ? -14.977 1.301   -21.017 1.00 0.00 ? 181 SER A CB   6  
ATOM 8809  O OG   . SER A 1 3   ? -16.393 1.334   -21.037 1.00 0.00 ? 181 SER A OG   6  
ATOM 8810  H H    . SER A 1 3   ? -13.837 -1.136  -21.337 1.00 0.00 ? 181 SER A H    6  
ATOM 8811  H HA   . SER A 1 3   ? -15.110 0.844   -23.104 1.00 0.00 ? 181 SER A HA   6  
ATOM 8812  H HB2  . SER A 1 3   ? -14.654 0.729   -20.160 1.00 0.00 ? 181 SER A HB2  6  
ATOM 8813  H HB3  . SER A 1 3   ? -14.606 2.313   -20.935 1.00 0.00 ? 181 SER A HB3  6  
ATOM 8814  H HG   . SER A 1 3   ? -16.689 2.060   -21.592 1.00 0.00 ? 181 SER A HG   6  
ATOM 8815  N N    . GLY A 1 4   ? -12.736 1.267   -23.926 1.00 0.00 ? 182 GLY A N    6  
ATOM 8816  C CA   . GLY A 1 4   ? -11.474 1.829   -24.368 1.00 0.00 ? 182 GLY A CA   6  
ATOM 8817  C C    . GLY A 1 4   ? -11.550 3.327   -24.586 1.00 0.00 ? 182 GLY A C    6  
ATOM 8818  O O    . GLY A 1 4   ? -11.812 3.787   -25.697 1.00 0.00 ? 182 GLY A O    6  
ATOM 8819  H H    . GLY A 1 4   ? -13.350 0.872   -24.580 1.00 0.00 ? 182 GLY A H    6  
ATOM 8820  H HA2  . GLY A 1 4   ? -10.719 1.622   -23.624 1.00 0.00 ? 182 GLY A HA2  6  
ATOM 8821  H HA3  . GLY A 1 4   ? -11.188 1.357   -25.297 1.00 0.00 ? 182 GLY A HA3  6  
ATOM 8822  N N    . SER A 1 5   ? -11.324 4.091   -23.522 1.00 0.00 ? 183 SER A N    6  
ATOM 8823  C CA   . SER A 1 5   ? -11.374 5.546   -23.600 1.00 0.00 ? 183 SER A CA   6  
ATOM 8824  C C    . SER A 1 5   ? -10.117 6.166   -22.999 1.00 0.00 ? 183 SER A C    6  
ATOM 8825  O O    . SER A 1 5   ? -9.301  5.475   -22.389 1.00 0.00 ? 183 SER A O    6  
ATOM 8826  C CB   . SER A 1 5   ? -12.614 6.074   -22.876 1.00 0.00 ? 183 SER A CB   6  
ATOM 8827  O OG   . SER A 1 5   ? -13.799 5.540   -23.438 1.00 0.00 ? 183 SER A OG   6  
ATOM 8828  H H    . SER A 1 5   ? -11.120 3.665   -22.663 1.00 0.00 ? 183 SER A H    6  
ATOM 8829  H HA   . SER A 1 5   ? -11.433 5.820   -24.643 1.00 0.00 ? 183 SER A HA   6  
ATOM 8830  H HB2  . SER A 1 5   ? -12.566 5.794   -21.835 1.00 0.00 ? 183 SER A HB2  6  
ATOM 8831  H HB3  . SER A 1 5   ? -12.643 7.151   -22.958 1.00 0.00 ? 183 SER A HB3  6  
ATOM 8832  H HG   . SER A 1 5   ? -14.016 4.713   -23.002 1.00 0.00 ? 183 SER A HG   6  
ATOM 8833  N N    . SER A 1 6   ? -9.967  7.475   -23.176 1.00 0.00 ? 184 SER A N    6  
ATOM 8834  C CA   . SER A 1 6   ? -8.808  8.190   -22.655 1.00 0.00 ? 184 SER A CA   6  
ATOM 8835  C C    . SER A 1 6   ? -8.941  8.417   -21.152 1.00 0.00 ? 184 SER A C    6  
ATOM 8836  O O    . SER A 1 6   ? -10.019 8.259   -20.582 1.00 0.00 ? 184 SER A O    6  
ATOM 8837  C CB   . SER A 1 6   ? -8.644  9.531   -23.373 1.00 0.00 ? 184 SER A CB   6  
ATOM 8838  O OG   . SER A 1 6   ? -7.285  9.932   -23.399 1.00 0.00 ? 184 SER A OG   6  
ATOM 8839  H H    . SER A 1 6   ? -10.652 7.971   -23.671 1.00 0.00 ? 184 SER A H    6  
ATOM 8840  H HA   . SER A 1 6   ? -7.934  7.583   -22.839 1.00 0.00 ? 184 SER A HA   6  
ATOM 8841  H HB2  . SER A 1 6   ? -8.999  9.438   -24.388 1.00 0.00 ? 184 SER A HB2  6  
ATOM 8842  H HB3  . SER A 1 6   ? -9.220  10.285  -22.857 1.00 0.00 ? 184 SER A HB3  6  
ATOM 8843  H HG   . SER A 1 6   ? -6.747  9.220   -23.755 1.00 0.00 ? 184 SER A HG   6  
ATOM 8844  N N    . GLY A 1 7   ? -7.834  8.790   -20.516 1.00 0.00 ? 185 GLY A N    6  
ATOM 8845  C CA   . GLY A 1 7   ? -7.847  9.034   -19.086 1.00 0.00 ? 185 GLY A CA   6  
ATOM 8846  C C    . GLY A 1 7   ? -8.248  10.455  -18.743 1.00 0.00 ? 185 GLY A C    6  
ATOM 8847  O O    . GLY A 1 7   ? -7.511  11.170  -18.063 1.00 0.00 ? 185 GLY A O    6  
ATOM 8848  H H    . GLY A 1 7   ? -7.002  8.901   -21.023 1.00 0.00 ? 185 GLY A H    6  
ATOM 8849  H HA2  . GLY A 1 7   ? -8.543  8.352   -18.621 1.00 0.00 ? 185 GLY A HA2  6  
ATOM 8850  H HA3  . GLY A 1 7   ? -6.858  8.847   -18.691 1.00 0.00 ? 185 GLY A HA3  6  
ATOM 8851  N N    . LYS A 1 8   ? -9.420  10.867  -19.215 1.00 0.00 ? 186 LYS A N    6  
ATOM 8852  C CA   . LYS A 1 8   ? -9.919  12.212  -18.956 1.00 0.00 ? 186 LYS A CA   6  
ATOM 8853  C C    . LYS A 1 8   ? -11.285 12.164  -18.278 1.00 0.00 ? 186 LYS A C    6  
ATOM 8854  O O    . LYS A 1 8   ? -12.299 11.899  -18.921 1.00 0.00 ? 186 LYS A O    6  
ATOM 8855  C CB   . LYS A 1 8   ? -10.015 13.003  -20.263 1.00 0.00 ? 186 LYS A CB   6  
ATOM 8856  C CG   . LYS A 1 8   ? -9.913  14.507  -20.072 1.00 0.00 ? 186 LYS A CG   6  
ATOM 8857  C CD   . LYS A 1 8   ? -8.472  14.983  -20.148 1.00 0.00 ? 186 LYS A CD   6  
ATOM 8858  C CE   . LYS A 1 8   ? -8.353  16.457  -19.793 1.00 0.00 ? 186 LYS A CE   6  
ATOM 8859  N NZ   . LYS A 1 8   ? -8.623  16.703  -18.349 1.00 0.00 ? 186 LYS A NZ   6  
ATOM 8860  H H    . LYS A 1 8   ? -9.963  10.251  -19.751 1.00 0.00 ? 186 LYS A H    6  
ATOM 8861  H HA   . LYS A 1 8   ? -9.220  12.704  -18.297 1.00 0.00 ? 186 LYS A HA   6  
ATOM 8862  H HB2  . LYS A 1 8   ? -9.216  12.690  -20.918 1.00 0.00 ? 186 LYS A HB2  6  
ATOM 8863  H HB3  . LYS A 1 8   ? -10.962 12.784  -20.733 1.00 0.00 ? 186 LYS A HB3  6  
ATOM 8864  H HG2  . LYS A 1 8   ? -10.485 14.998  -20.845 1.00 0.00 ? 186 LYS A HG2  6  
ATOM 8865  H HG3  . LYS A 1 8   ? -10.318 14.766  -19.103 1.00 0.00 ? 186 LYS A HG3  6  
ATOM 8866  H HD2  . LYS A 1 8   ? -7.875  14.408  -19.456 1.00 0.00 ? 186 LYS A HD2  6  
ATOM 8867  H HD3  . LYS A 1 8   ? -8.106  14.833  -21.154 1.00 0.00 ? 186 LYS A HD3  6  
ATOM 8868  H HE2  . LYS A 1 8   ? -7.353  16.790  -20.025 1.00 0.00 ? 186 LYS A HE2  6  
ATOM 8869  H HE3  . LYS A 1 8   ? -9.064  17.015  -20.384 1.00 0.00 ? 186 LYS A HE3  6  
ATOM 8870  H HZ1  . LYS A 1 8   ? -7.877  16.271  -17.768 1.00 0.00 ? 186 LYS A HZ1  6  
ATOM 8871  H HZ2  . LYS A 1 8   ? -9.538  16.289  -18.081 1.00 0.00 ? 186 LYS A HZ2  6  
ATOM 8872  H HZ3  . LYS A 1 8   ? -8.648  17.725  -18.159 1.00 0.00 ? 186 LYS A HZ3  6  
ATOM 8873  N N    . ASN A 1 9   ? -11.302 12.424  -16.974 1.00 0.00 ? 187 ASN A N    6  
ATOM 8874  C CA   . ASN A 1 9   ? -12.543 12.411  -16.209 1.00 0.00 ? 187 ASN A CA   6  
ATOM 8875  C C    . ASN A 1 9   ? -12.427 13.292  -14.969 1.00 0.00 ? 187 ASN A C    6  
ATOM 8876  O O    . ASN A 1 9   ? -11.452 13.205  -14.222 1.00 0.00 ? 187 ASN A O    6  
ATOM 8877  C CB   . ASN A 1 9   ? -12.901 10.980  -15.801 1.00 0.00 ? 187 ASN A CB   6  
ATOM 8878  C CG   . ASN A 1 9   ? -12.633 9.979   -16.908 1.00 0.00 ? 187 ASN A CG   6  
ATOM 8879  O OD1  . ASN A 1 9   ? -11.514 9.491   -17.062 1.00 0.00 ? 187 ASN A OD1  6  
ATOM 8880  N ND2  . ASN A 1 9   ? -13.664 9.669   -17.687 1.00 0.00 ? 187 ASN A ND2  6  
ATOM 8881  H H    . ASN A 1 9   ? -10.460 12.629  -16.516 1.00 0.00 ? 187 ASN A H    6  
ATOM 8882  H HA   . ASN A 1 9   ? -13.326 12.802  -16.841 1.00 0.00 ? 187 ASN A HA   6  
ATOM 8883  H HB2  . ASN A 1 9   ? -12.311 10.701  -14.940 1.00 0.00 ? 187 ASN A HB2  6  
ATOM 8884  H HB3  . ASN A 1 9   ? -13.948 10.936  -15.545 1.00 0.00 ? 187 ASN A HB3  6  
ATOM 8885  H HD21 . ASN A 1 9   ? -14.527 10.098  -17.505 1.00 0.00 ? 187 ASN A HD21 6  
ATOM 8886  H HD22 . ASN A 1 9   ? -13.519 9.024   -18.410 1.00 0.00 ? 187 ASN A HD22 6  
ATOM 8887  N N    . VAL A 1 10  ? -13.429 14.139  -14.755 1.00 0.00 ? 188 VAL A N    6  
ATOM 8888  C CA   . VAL A 1 10  ? -13.440 15.034  -13.604 1.00 0.00 ? 188 VAL A CA   6  
ATOM 8889  C C    . VAL A 1 10  ? -12.944 14.324  -12.350 1.00 0.00 ? 188 VAL A C    6  
ATOM 8890  O O    . VAL A 1 10  ? -13.153 13.124  -12.180 1.00 0.00 ? 188 VAL A O    6  
ATOM 8891  C CB   . VAL A 1 10  ? -14.852 15.591  -13.341 1.00 0.00 ? 188 VAL A CB   6  
ATOM 8892  C CG1  . VAL A 1 10  ? -14.832 16.567  -12.174 1.00 0.00 ? 188 VAL A CG1  6  
ATOM 8893  C CG2  . VAL A 1 10  ? -15.405 16.256  -14.593 1.00 0.00 ? 188 VAL A CG2  6  
ATOM 8894  H H    . VAL A 1 10  ? -14.179 14.161  -15.385 1.00 0.00 ? 188 VAL A H    6  
ATOM 8895  H HA   . VAL A 1 10  ? -12.783 15.864  -13.820 1.00 0.00 ? 188 VAL A HA   6  
ATOM 8896  H HB   . VAL A 1 10  ? -15.500 14.767  -13.080 1.00 0.00 ? 188 VAL A HB   6  
ATOM 8897  H HG11 . VAL A 1 10  ? -13.822 16.916  -12.015 1.00 0.00 ? 188 VAL A HG11 6  
ATOM 8898  H HG12 . VAL A 1 10  ? -15.474 17.407  -12.396 1.00 0.00 ? 188 VAL A HG12 6  
ATOM 8899  H HG13 . VAL A 1 10  ? -15.184 16.069  -11.282 1.00 0.00 ? 188 VAL A HG13 6  
ATOM 8900  H HG21 . VAL A 1 10  ? -14.615 16.801  -15.088 1.00 0.00 ? 188 VAL A HG21 6  
ATOM 8901  H HG22 . VAL A 1 10  ? -15.793 15.500  -15.260 1.00 0.00 ? 188 VAL A HG22 6  
ATOM 8902  H HG23 . VAL A 1 10  ? -16.197 16.936  -14.320 1.00 0.00 ? 188 VAL A HG23 6  
ATOM 8903  N N    . ASN A 1 11  ? -12.285 15.075  -11.473 1.00 0.00 ? 189 ASN A N    6  
ATOM 8904  C CA   . ASN A 1 11  ? -11.758 14.517  -10.233 1.00 0.00 ? 189 ASN A CA   6  
ATOM 8905  C C    . ASN A 1 11  ? -12.763 13.563  -9.595  1.00 0.00 ? 189 ASN A C    6  
ATOM 8906  O O    . ASN A 1 11  ? -13.715 13.993  -8.944  1.00 0.00 ? 189 ASN A O    6  
ATOM 8907  C CB   . ASN A 1 11  ? -11.409 15.638  -9.253  1.00 0.00 ? 189 ASN A CB   6  
ATOM 8908  C CG   . ASN A 1 11  ? -12.460 16.731  -9.226  1.00 0.00 ? 189 ASN A CG   6  
ATOM 8909  O OD1  . ASN A 1 11  ? -12.415 17.671  -10.020 1.00 0.00 ? 189 ASN A OD1  6  
ATOM 8910  N ND2  . ASN A 1 11  ? -13.414 16.612  -8.310  1.00 0.00 ? 189 ASN A ND2  6  
ATOM 8911  H H    . ASN A 1 11  ? -12.149 16.026  -11.665 1.00 0.00 ? 189 ASN A H    6  
ATOM 8912  H HA   . ASN A 1 11  ? -10.860 13.968  -10.472 1.00 0.00 ? 189 ASN A HA   6  
ATOM 8913  H HB2  . ASN A 1 11  ? -11.322 15.225  -8.258  1.00 0.00 ? 189 ASN A HB2  6  
ATOM 8914  H HB3  . ASN A 1 11  ? -10.465 16.078  -9.539  1.00 0.00 ? 189 ASN A HB3  6  
ATOM 8915  H HD21 . ASN A 1 11  ? -13.386 15.836  -7.710  1.00 0.00 ? 189 ASN A HD21 6  
ATOM 8916  H HD22 . ASN A 1 11  ? -14.107 17.304  -8.270  1.00 0.00 ? 189 ASN A HD22 6  
ATOM 8917  N N    . ARG A 1 12  ? -12.544 12.266  -9.786  1.00 0.00 ? 190 ARG A N    6  
ATOM 8918  C CA   . ARG A 1 12  ? -13.431 11.252  -9.230  1.00 0.00 ? 190 ARG A CA   6  
ATOM 8919  C C    . ARG A 1 12  ? -12.630 10.090  -8.647  1.00 0.00 ? 190 ARG A C    6  
ATOM 8920  O O    . ARG A 1 12  ? -11.574 9.729   -9.166  1.00 0.00 ? 190 ARG A O    6  
ATOM 8921  C CB   . ARG A 1 12  ? -14.388 10.736  -10.306 1.00 0.00 ? 190 ARG A CB   6  
ATOM 8922  C CG   . ARG A 1 12  ? -13.684 10.104  -11.496 1.00 0.00 ? 190 ARG A CG   6  
ATOM 8923  C CD   . ARG A 1 12  ? -14.678 9.647   -12.552 1.00 0.00 ? 190 ARG A CD   6  
ATOM 8924  N NE   . ARG A 1 12  ? -15.454 10.760  -13.092 1.00 0.00 ? 190 ARG A NE   6  
ATOM 8925  C CZ   . ARG A 1 12  ? -16.438 10.612  -13.972 1.00 0.00 ? 190 ARG A CZ   6  
ATOM 8926  N NH1  . ARG A 1 12  ? -16.764 9.404   -14.409 1.00 0.00 ? 190 ARG A NH1  6  
ATOM 8927  N NH2  . ARG A 1 12  ? -17.098 11.674  -14.416 1.00 0.00 ? 190 ARG A NH2  6  
ATOM 8928  H H    . ARG A 1 12  ? -11.768 11.985  -10.314 1.00 0.00 ? 190 ARG A H    6  
ATOM 8929  H HA   . ARG A 1 12  ? -14.005 11.710  -8.439  1.00 0.00 ? 190 ARG A HA   6  
ATOM 8930  H HB2  . ARG A 1 12  ? -15.040 9.995   -9.866  1.00 0.00 ? 190 ARG A HB2  6  
ATOM 8931  H HB3  . ARG A 1 12  ? -14.985 11.561  -10.665 1.00 0.00 ? 190 ARG A HB3  6  
ATOM 8932  H HG2  . ARG A 1 12  ? -13.017 10.831  -11.935 1.00 0.00 ? 190 ARG A HG2  6  
ATOM 8933  H HG3  . ARG A 1 12  ? -13.117 9.251   -11.155 1.00 0.00 ? 190 ARG A HG3  6  
ATOM 8934  H HD2  . ARG A 1 12  ? -14.135 9.176   -13.358 1.00 0.00 ? 190 ARG A HD2  6  
ATOM 8935  H HD3  . ARG A 1 12  ? -15.353 8.932   -12.107 1.00 0.00 ? 190 ARG A HD3  6  
ATOM 8936  H HE   . ARG A 1 12  ? -15.229 11.662  -12.782 1.00 0.00 ? 190 ARG A HE   6  
ATOM 8937  H HH11 . ARG A 1 12  ? -16.269 8.602   -14.075 1.00 0.00 ? 190 ARG A HH11 6  
ATOM 8938  H HH12 . ARG A 1 12  ? -17.507 9.295   -15.070 1.00 0.00 ? 190 ARG A HH12 6  
ATOM 8939  H HH21 . ARG A 1 12  ? -16.855 12.587  -14.088 1.00 0.00 ? 190 ARG A HH21 6  
ATOM 8940  H HH22 . ARG A 1 12  ? -17.838 11.562  -15.078 1.00 0.00 ? 190 ARG A HH22 6  
ATOM 8941  N N    . VAL A 1 13  ? -13.141 9.510   -7.566  1.00 0.00 ? 191 VAL A N    6  
ATOM 8942  C CA   . VAL A 1 13  ? -12.475 8.390   -6.913  1.00 0.00 ? 191 VAL A CA   6  
ATOM 8943  C C    . VAL A 1 13  ? -13.355 7.145   -6.923  1.00 0.00 ? 191 VAL A C    6  
ATOM 8944  O O    . VAL A 1 13  ? -13.729 6.627   -5.870  1.00 0.00 ? 191 VAL A O    6  
ATOM 8945  C CB   . VAL A 1 13  ? -12.102 8.729   -5.457  1.00 0.00 ? 191 VAL A CB   6  
ATOM 8946  C CG1  . VAL A 1 13  ? -11.261 7.618   -4.848  1.00 0.00 ? 191 VAL A CG1  6  
ATOM 8947  C CG2  . VAL A 1 13  ? -11.368 10.060  -5.393  1.00 0.00 ? 191 VAL A CG2  6  
ATOM 8948  H H    . VAL A 1 13  ? -13.987 9.843   -7.199  1.00 0.00 ? 191 VAL A H    6  
ATOM 8949  H HA   . VAL A 1 13  ? -11.565 8.180   -7.456  1.00 0.00 ? 191 VAL A HA   6  
ATOM 8950  H HB   . VAL A 1 13  ? -13.014 8.816   -4.885  1.00 0.00 ? 191 VAL A HB   6  
ATOM 8951  H HG11 . VAL A 1 13  ? -10.263 7.984   -4.659  1.00 0.00 ? 191 VAL A HG11 6  
ATOM 8952  H HG12 . VAL A 1 13  ? -11.710 7.295   -3.920  1.00 0.00 ? 191 VAL A HG12 6  
ATOM 8953  H HG13 . VAL A 1 13  ? -11.214 6.785   -5.534  1.00 0.00 ? 191 VAL A HG13 6  
ATOM 8954  H HG21 . VAL A 1 13  ? -11.951 10.817  -5.897  1.00 0.00 ? 191 VAL A HG21 6  
ATOM 8955  H HG22 . VAL A 1 13  ? -11.227 10.344  -4.360  1.00 0.00 ? 191 VAL A HG22 6  
ATOM 8956  H HG23 . VAL A 1 13  ? -10.407 9.966   -5.874  1.00 0.00 ? 191 VAL A HG23 6  
ATOM 8957  N N    . LEU A 1 14  ? -13.683 6.669   -8.119  1.00 0.00 ? 192 LEU A N    6  
ATOM 8958  C CA   . LEU A 1 14  ? -14.519 5.483   -8.268  1.00 0.00 ? 192 LEU A CA   6  
ATOM 8959  C C    . LEU A 1 14  ? -13.709 4.309   -8.807  1.00 0.00 ? 192 LEU A C    6  
ATOM 8960  O O    . LEU A 1 14  ? -13.825 3.185   -8.318  1.00 0.00 ? 192 LEU A O    6  
ATOM 8961  C CB   . LEU A 1 14  ? -15.694 5.778   -9.202  1.00 0.00 ? 192 LEU A CB   6  
ATOM 8962  C CG   . LEU A 1 14  ? -16.970 6.291   -8.534  1.00 0.00 ? 192 LEU A CG   6  
ATOM 8963  C CD1  . LEU A 1 14  ? -17.588 5.210   -7.661  1.00 0.00 ? 192 LEU A CD1  6  
ATOM 8964  C CD2  . LEU A 1 14  ? -16.677 7.539   -7.714  1.00 0.00 ? 192 LEU A CD2  6  
ATOM 8965  H H    . LEU A 1 14  ? -13.355 7.125   -8.922  1.00 0.00 ? 192 LEU A H    6  
ATOM 8966  H HA   . LEU A 1 14  ? -14.902 5.223   -7.292  1.00 0.00 ? 192 LEU A HA   6  
ATOM 8967  H HB2  . LEU A 1 14  ? -15.372 6.521   -9.914  1.00 0.00 ? 192 LEU A HB2  6  
ATOM 8968  H HB3  . LEU A 1 14  ? -15.938 4.863   -9.724  1.00 0.00 ? 192 LEU A HB3  6  
ATOM 8969  H HG   . LEU A 1 14  ? -17.689 6.554   -9.298  1.00 0.00 ? 192 LEU A HG   6  
ATOM 8970  H HD11 . LEU A 1 14  ? -16.813 4.548   -7.306  1.00 0.00 ? 192 LEU A HD11 6  
ATOM 8971  H HD12 . LEU A 1 14  ? -18.306 4.648   -8.239  1.00 0.00 ? 192 LEU A HD12 6  
ATOM 8972  H HD13 . LEU A 1 14  ? -18.085 5.669   -6.818  1.00 0.00 ? 192 LEU A HD13 6  
ATOM 8973  H HD21 . LEU A 1 14  ? -16.990 7.380   -6.692  1.00 0.00 ? 192 LEU A HD21 6  
ATOM 8974  H HD22 . LEU A 1 14  ? -17.218 8.378   -8.129  1.00 0.00 ? 192 LEU A HD22 6  
ATOM 8975  H HD23 . LEU A 1 14  ? -15.618 7.746   -7.738  1.00 0.00 ? 192 LEU A HD23 6  
ATOM 8976  N N    . SER A 1 15  ? -12.885 4.578   -9.815  1.00 0.00 ? 193 SER A N    6  
ATOM 8977  C CA   . SER A 1 15  ? -12.056 3.543   -10.421 1.00 0.00 ? 193 SER A CA   6  
ATOM 8978  C C    . SER A 1 15  ? -10.576 3.894   -10.302 1.00 0.00 ? 193 SER A C    6  
ATOM 8979  O O    . SER A 1 15  ? -10.218 5.045   -10.055 1.00 0.00 ? 193 SER A O    6  
ATOM 8980  C CB   . SER A 1 15  ? -12.430 3.357   -11.893 1.00 0.00 ? 193 SER A CB   6  
ATOM 8981  O OG   . SER A 1 15  ? -13.802 3.027   -12.032 1.00 0.00 ? 193 SER A OG   6  
ATOM 8982  H H    . SER A 1 15  ? -12.837 5.494   -10.161 1.00 0.00 ? 193 SER A H    6  
ATOM 8983  H HA   . SER A 1 15  ? -12.238 2.619   -9.892  1.00 0.00 ? 193 SER A HA   6  
ATOM 8984  H HB2  . SER A 1 15  ? -12.236 4.273   -12.430 1.00 0.00 ? 193 SER A HB2  6  
ATOM 8985  H HB3  . SER A 1 15  ? -11.836 2.559   -12.315 1.00 0.00 ? 193 SER A HB3  6  
ATOM 8986  H HG   . SER A 1 15  ? -14.019 2.950   -12.964 1.00 0.00 ? 193 SER A HG   6  
ATOM 8987  N N    . ALA A 1 16  ? -9.721  2.892   -10.479 1.00 0.00 ? 194 ALA A N    6  
ATOM 8988  C CA   . ALA A 1 16  ? -8.280  3.094   -10.393 1.00 0.00 ? 194 ALA A CA   6  
ATOM 8989  C C    . ALA A 1 16  ? -7.788  4.019   -11.501 1.00 0.00 ? 194 ALA A C    6  
ATOM 8990  O O    . ALA A 1 16  ? -6.851  4.793   -11.306 1.00 0.00 ? 194 ALA A O    6  
ATOM 8991  C CB   . ALA A 1 16  ? -7.555  1.758   -10.459 1.00 0.00 ? 194 ALA A CB   6  
ATOM 8992  H H    . ALA A 1 16  ? -10.067 1.996   -10.673 1.00 0.00 ? 194 ALA A H    6  
ATOM 8993  H HA   . ALA A 1 16  ? -8.062  3.547   -9.437  1.00 0.00 ? 194 ALA A HA   6  
ATOM 8994  H HB1  . ALA A 1 16  ? -7.312  1.431   -9.457  1.00 0.00 ? 194 ALA A HB1  6  
ATOM 8995  H HB2  . ALA A 1 16  ? -8.192  1.026   -10.932 1.00 0.00 ? 194 ALA A HB2  6  
ATOM 8996  H HB3  . ALA A 1 16  ? -6.646  1.869   -11.031 1.00 0.00 ? 194 ALA A HB3  6  
ATOM 8997  N N    . GLU A 1 17  ? -8.426  3.933   -12.664 1.00 0.00 ? 195 GLU A N    6  
ATOM 8998  C CA   . GLU A 1 17  ? -8.051  4.763   -13.804 1.00 0.00 ? 195 GLU A CA   6  
ATOM 8999  C C    . GLU A 1 17  ? -8.231  6.243   -13.481 1.00 0.00 ? 195 GLU A C    6  
ATOM 9000  O O    . GLU A 1 17  ? -7.533  7.097   -14.027 1.00 0.00 ? 195 GLU A O    6  
ATOM 9001  C CB   . GLU A 1 17  ? -8.887  4.391   -15.030 1.00 0.00 ? 195 GLU A CB   6  
ATOM 9002  C CG   . GLU A 1 17  ? -10.382 4.578   -14.827 1.00 0.00 ? 195 GLU A CG   6  
ATOM 9003  C CD   . GLU A 1 17  ? -11.202 3.994   -15.961 1.00 0.00 ? 195 GLU A CD   6  
ATOM 9004  O OE1  . GLU A 1 17  ? -10.913 4.321   -17.131 1.00 0.00 ? 195 GLU A OE1  6  
ATOM 9005  O OE2  . GLU A 1 17  ? -12.133 3.211   -15.678 1.00 0.00 ? 195 GLU A OE2  6  
ATOM 9006  H H    . GLU A 1 17  ? -9.165  3.297   -12.759 1.00 0.00 ? 195 GLU A H    6  
ATOM 9007  H HA   . GLU A 1 17  ? -7.010  4.578   -14.020 1.00 0.00 ? 195 GLU A HA   6  
ATOM 9008  H HB2  . GLU A 1 17  ? -8.578  5.007   -15.862 1.00 0.00 ? 195 GLU A HB2  6  
ATOM 9009  H HB3  . GLU A 1 17  ? -8.706  3.355   -15.274 1.00 0.00 ? 195 GLU A HB3  6  
ATOM 9010  H HG2  . GLU A 1 17  ? -10.671 4.092   -13.907 1.00 0.00 ? 195 GLU A HG2  6  
ATOM 9011  H HG3  . GLU A 1 17  ? -10.593 5.635   -14.757 1.00 0.00 ? 195 GLU A HG3  6  
ATOM 9012  N N    . ALA A 1 18  ? -9.172  6.539   -12.590 1.00 0.00 ? 196 ALA A N    6  
ATOM 9013  C CA   . ALA A 1 18  ? -9.443  7.915   -12.194 1.00 0.00 ? 196 ALA A CA   6  
ATOM 9014  C C    . ALA A 1 18  ? -8.407  8.411   -11.191 1.00 0.00 ? 196 ALA A C    6  
ATOM 9015  O O    . ALA A 1 18  ? -8.078  9.598   -11.158 1.00 0.00 ? 196 ALA A O    6  
ATOM 9016  C CB   . ALA A 1 18  ? -10.843 8.030   -11.609 1.00 0.00 ? 196 ALA A CB   6  
ATOM 9017  H H    . ALA A 1 18  ? -9.695  5.814   -12.190 1.00 0.00 ? 196 ALA A H    6  
ATOM 9018  H HA   . ALA A 1 18  ? -9.397  8.533   -13.079 1.00 0.00 ? 196 ALA A HA   6  
ATOM 9019  H HB1  . ALA A 1 18  ? -11.551 7.566   -12.280 1.00 0.00 ? 196 ALA A HB1  6  
ATOM 9020  H HB2  . ALA A 1 18  ? -10.875 7.533   -10.651 1.00 0.00 ? 196 ALA A HB2  6  
ATOM 9021  H HB3  . ALA A 1 18  ? -11.096 9.072   -11.483 1.00 0.00 ? 196 ALA A HB3  6  
ATOM 9022  N N    . LEU A 1 19  ? -7.896  7.497   -10.374 1.00 0.00 ? 197 LEU A N    6  
ATOM 9023  C CA   . LEU A 1 19  ? -6.897  7.842   -9.368  1.00 0.00 ? 197 LEU A CA   6  
ATOM 9024  C C    . LEU A 1 19  ? -5.639  8.406   -10.022 1.00 0.00 ? 197 LEU A C    6  
ATOM 9025  O O    . LEU A 1 19  ? -5.147  7.867   -11.014 1.00 0.00 ? 197 LEU A O    6  
ATOM 9026  C CB   . LEU A 1 19  ? -6.543  6.613   -8.530  1.00 0.00 ? 197 LEU A CB   6  
ATOM 9027  C CG   . LEU A 1 19  ? -7.712  5.914   -7.836  1.00 0.00 ? 197 LEU A CG   6  
ATOM 9028  C CD1  . LEU A 1 19  ? -7.219  4.730   -7.020  1.00 0.00 ? 197 LEU A CD1  6  
ATOM 9029  C CD2  . LEU A 1 19  ? -8.472  6.894   -6.953  1.00 0.00 ? 197 LEU A CD2  6  
ATOM 9030  H H    . LEU A 1 19  ? -8.197  6.568   -10.447 1.00 0.00 ? 197 LEU A H    6  
ATOM 9031  H HA   . LEU A 1 19  ? -7.322  8.597   -8.724  1.00 0.00 ? 197 LEU A HA   6  
ATOM 9032  H HB2  . LEU A 1 19  ? -6.067  5.895   -9.180  1.00 0.00 ? 197 LEU A HB2  6  
ATOM 9033  H HB3  . LEU A 1 19  ? -5.843  6.925   -7.767  1.00 0.00 ? 197 LEU A HB3  6  
ATOM 9034  H HG   . LEU A 1 19  ? -8.396  5.540   -8.586  1.00 0.00 ? 197 LEU A HG   6  
ATOM 9035  H HD11 . LEU A 1 19  ? -7.172  3.854   -7.648  1.00 0.00 ? 197 LEU A HD11 6  
ATOM 9036  H HD12 . LEU A 1 19  ? -7.898  4.549   -6.200  1.00 0.00 ? 197 LEU A HD12 6  
ATOM 9037  H HD13 . LEU A 1 19  ? -6.235  4.947   -6.629  1.00 0.00 ? 197 LEU A HD13 6  
ATOM 9038  H HD21 . LEU A 1 19  ? -7.886  7.793   -6.828  1.00 0.00 ? 197 LEU A HD21 6  
ATOM 9039  H HD22 . LEU A 1 19  ? -8.650  6.444   -5.987  1.00 0.00 ? 197 LEU A HD22 6  
ATOM 9040  H HD23 . LEU A 1 19  ? -9.415  7.139   -7.417  1.00 0.00 ? 197 LEU A HD23 6  
ATOM 9041  N N    . LYS A 1 20  ? -5.121  9.492   -9.459  1.00 0.00 ? 198 LYS A N    6  
ATOM 9042  C CA   . LYS A 1 20  ? -3.918  10.128  -9.983  1.00 0.00 ? 198 LYS A CA   6  
ATOM 9043  C C    . LYS A 1 20  ? -2.694  9.736   -9.162  1.00 0.00 ? 198 LYS A C    6  
ATOM 9044  O O    . LYS A 1 20  ? -2.777  9.490   -7.958  1.00 0.00 ? 198 LYS A O    6  
ATOM 9045  C CB   . LYS A 1 20  ? -4.080  11.649  -9.984  1.00 0.00 ? 198 LYS A CB   6  
ATOM 9046  C CG   . LYS A 1 20  ? -3.887  12.283  -8.618  1.00 0.00 ? 198 LYS A CG   6  
ATOM 9047  C CD   . LYS A 1 20  ? -4.149  13.779  -8.654  1.00 0.00 ? 198 LYS A CD   6  
ATOM 9048  C CE   . LYS A 1 20  ? -2.886  14.559  -8.984  1.00 0.00 ? 198 LYS A CE   6  
ATOM 9049  N NZ   . LYS A 1 20  ? -1.881  14.477  -7.888  1.00 0.00 ? 198 LYS A NZ   6  
ATOM 9050  H H    . LYS A 1 20  ? -5.559  9.876   -8.669  1.00 0.00 ? 198 LYS A H    6  
ATOM 9051  H HA   . LYS A 1 20  ? -3.780  9.788   -10.998 1.00 0.00 ? 198 LYS A HA   6  
ATOM 9052  H HB2  . LYS A 1 20  ? -3.355  12.076  -10.662 1.00 0.00 ? 198 LYS A HB2  6  
ATOM 9053  H HB3  . LYS A 1 20  ? -5.073  11.894  -10.334 1.00 0.00 ? 198 LYS A HB3  6  
ATOM 9054  H HG2  . LYS A 1 20  ? -4.571  11.825  -7.919  1.00 0.00 ? 198 LYS A HG2  6  
ATOM 9055  H HG3  . LYS A 1 20  ? -2.870  12.112  -8.293  1.00 0.00 ? 198 LYS A HG3  6  
ATOM 9056  H HD2  . LYS A 1 20  ? -4.894  13.987  -9.408  1.00 0.00 ? 198 LYS A HD2  6  
ATOM 9057  H HD3  . LYS A 1 20  ? -4.515  14.095  -7.687  1.00 0.00 ? 198 LYS A HD3  6  
ATOM 9058  H HE2  . LYS A 1 20  ? -2.454  14.154  -9.887  1.00 0.00 ? 198 LYS A HE2  6  
ATOM 9059  H HE3  . LYS A 1 20  ? -3.149  15.594  -9.144  1.00 0.00 ? 198 LYS A HE3  6  
ATOM 9060  H HZ1  . LYS A 1 20  ? -1.548  15.430  -7.638  1.00 0.00 ? 198 LYS A HZ1  6  
ATOM 9061  H HZ2  . LYS A 1 20  ? -1.067  13.906  -8.191  1.00 0.00 ? 198 LYS A HZ2  6  
ATOM 9062  H HZ3  . LYS A 1 20  ? -2.306  14.038  -7.046  1.00 0.00 ? 198 LYS A HZ3  6  
ATOM 9063  N N    . PRO A 1 21  ? -1.529  9.679   -9.825  1.00 0.00 ? 199 PRO A N    6  
ATOM 9064  C CA   . PRO A 1 21  ? -0.265  9.320   -9.175  1.00 0.00 ? 199 PRO A CA   6  
ATOM 9065  C C    . PRO A 1 21  ? 0.221   10.402  -8.217  1.00 0.00 ? 199 PRO A C    6  
ATOM 9066  O O    . PRO A 1 21  ? 0.639   11.478  -8.641  1.00 0.00 ? 199 PRO A O    6  
ATOM 9067  C CB   . PRO A 1 21  ? 0.706   9.168   -10.348 1.00 0.00 ? 199 PRO A CB   6  
ATOM 9068  C CG   . PRO A 1 21  ? 0.136   10.025  -11.425 1.00 0.00 ? 199 PRO A CG   6  
ATOM 9069  C CD   . PRO A 1 21  ? -1.357  9.959   -11.260 1.00 0.00 ? 199 PRO A CD   6  
ATOM 9070  H HA   . PRO A 1 21  ? -0.344  8.381   -8.646  1.00 0.00 ? 199 PRO A HA   6  
ATOM 9071  H HB2  . PRO A 1 21  ? 1.689   9.506   -10.051 1.00 0.00 ? 199 PRO A HB2  6  
ATOM 9072  H HB3  . PRO A 1 21  ? 0.752   8.132   -10.650 1.00 0.00 ? 199 PRO A HB3  6  
ATOM 9073  H HG2  . PRO A 1 21  ? 0.482   11.040  -11.308 1.00 0.00 ? 199 PRO A HG2  6  
ATOM 9074  H HG3  . PRO A 1 21  ? 0.423   9.638   -12.392 1.00 0.00 ? 199 PRO A HG3  6  
ATOM 9075  H HD2  . PRO A 1 21  ? -1.808  10.904  -11.525 1.00 0.00 ? 199 PRO A HD2  6  
ATOM 9076  H HD3  . PRO A 1 21  ? -1.768  9.161   -11.860 1.00 0.00 ? 199 PRO A HD3  6  
ATOM 9077  N N    . GLY A 1 22  ? 0.164   10.109  -6.921  1.00 0.00 ? 200 GLY A N    6  
ATOM 9078  C CA   . GLY A 1 22  ? 0.603   11.067  -5.924  1.00 0.00 ? 200 GLY A CA   6  
ATOM 9079  C C    . GLY A 1 22  ? -0.422  11.272  -4.826  1.00 0.00 ? 200 GLY A C    6  
ATOM 9080  O O    . GLY A 1 22  ? -0.273  12.157  -3.985  1.00 0.00 ? 200 GLY A O    6  
ATOM 9081  H H    . GLY A 1 22  ? -0.178  9.234   -6.641  1.00 0.00 ? 200 GLY A H    6  
ATOM 9082  H HA2  . GLY A 1 22  ? 1.523   10.714  -5.482  1.00 0.00 ? 200 GLY A HA2  6  
ATOM 9083  H HA3  . GLY A 1 22  ? 0.788   12.014  -6.408  1.00 0.00 ? 200 GLY A HA3  6  
ATOM 9084  N N    . MET A 1 23  ? -1.468  10.451  -4.835  1.00 0.00 ? 201 MET A N    6  
ATOM 9085  C CA   . MET A 1 23  ? -2.522  10.547  -3.832  1.00 0.00 ? 201 MET A CA   6  
ATOM 9086  C C    . MET A 1 23  ? -2.063  9.957   -2.502  1.00 0.00 ? 201 MET A C    6  
ATOM 9087  O O    . MET A 1 23  ? -1.383  8.931   -2.468  1.00 0.00 ? 201 MET A O    6  
ATOM 9088  C CB   . MET A 1 23  ? -3.782  9.826   -4.315  1.00 0.00 ? 201 MET A CB   6  
ATOM 9089  C CG   . MET A 1 23  ? -4.498  10.546  -5.447  1.00 0.00 ? 201 MET A CG   6  
ATOM 9090  S SD   . MET A 1 23  ? -5.979  9.676   -5.996  1.00 0.00 ? 201 MET A SD   6  
ATOM 9091  C CE   . MET A 1 23  ? -7.115  11.044  -6.211  1.00 0.00 ? 201 MET A CE   6  
ATOM 9092  H H    . MET A 1 23  ? -1.532  9.764   -5.531  1.00 0.00 ? 201 MET A H    6  
ATOM 9093  H HA   . MET A 1 23  ? -2.749  11.593  -3.689  1.00 0.00 ? 201 MET A HA   6  
ATOM 9094  H HB2  . MET A 1 23  ? -3.508  8.840   -4.660  1.00 0.00 ? 201 MET A HB2  6  
ATOM 9095  H HB3  . MET A 1 23  ? -4.469  9.731   -3.487  1.00 0.00 ? 201 MET A HB3  6  
ATOM 9096  H HG2  . MET A 1 23  ? -4.782  11.531  -5.107  1.00 0.00 ? 201 MET A HG2  6  
ATOM 9097  H HG3  . MET A 1 23  ? -3.819  10.637  -6.282  1.00 0.00 ? 201 MET A HG3  6  
ATOM 9098  H HE1  . MET A 1 23  ? -8.127  10.669  -6.248  1.00 0.00 ? 201 MET A HE1  6  
ATOM 9099  H HE2  . MET A 1 23  ? -7.014  11.728  -5.382  1.00 0.00 ? 201 MET A HE2  6  
ATOM 9100  H HE3  . MET A 1 23  ? -6.887  11.559  -7.133  1.00 0.00 ? 201 MET A HE3  6  
ATOM 9101  N N    . LEU A 1 24  ? -2.439  10.612  -1.409  1.00 0.00 ? 202 LEU A N    6  
ATOM 9102  C CA   . LEU A 1 24  ? -2.066  10.152  -0.076  1.00 0.00 ? 202 LEU A CA   6  
ATOM 9103  C C    . LEU A 1 24  ? -3.069  9.130   0.449   1.00 0.00 ? 202 LEU A C    6  
ATOM 9104  O O    . LEU A 1 24  ? -4.202  9.474   0.788   1.00 0.00 ? 202 LEU A O    6  
ATOM 9105  C CB   . LEU A 1 24  ? -1.977  11.337  0.888   1.00 0.00 ? 202 LEU A CB   6  
ATOM 9106  C CG   . LEU A 1 24  ? -0.922  12.394  0.557   1.00 0.00 ? 202 LEU A CG   6  
ATOM 9107  C CD1  . LEU A 1 24  ? -1.459  13.384  -0.465  1.00 0.00 ? 202 LEU A CD1  6  
ATOM 9108  C CD2  . LEU A 1 24  ? -0.477  13.117  1.820   1.00 0.00 ? 202 LEU A CD2  6  
ATOM 9109  H H    . LEU A 1 24  ? -2.980  11.424  -1.499  1.00 0.00 ? 202 LEU A H    6  
ATOM 9110  H HA   . LEU A 1 24  ? -1.095  9.683   -0.147  1.00 0.00 ? 202 LEU A HA   6  
ATOM 9111  H HB2  . LEU A 1 24  ? -2.939  11.825  0.901   1.00 0.00 ? 202 LEU A HB2  6  
ATOM 9112  H HB3  . LEU A 1 24  ? -1.759  10.947  1.872   1.00 0.00 ? 202 LEU A HB3  6  
ATOM 9113  H HG   . LEU A 1 24  ? -0.057  11.907  0.127   1.00 0.00 ? 202 LEU A HG   6  
ATOM 9114  H HD11 . LEU A 1 24  ? -1.058  13.149  -1.439  1.00 0.00 ? 202 LEU A HD11 6  
ATOM 9115  H HD12 . LEU A 1 24  ? -1.165  14.384  -0.185  1.00 0.00 ? 202 LEU A HD12 6  
ATOM 9116  H HD13 . LEU A 1 24  ? -2.537  13.321  -0.494  1.00 0.00 ? 202 LEU A HD13 6  
ATOM 9117  H HD21 . LEU A 1 24  ? -0.362  12.402  2.622   1.00 0.00 ? 202 LEU A HD21 6  
ATOM 9118  H HD22 . LEU A 1 24  ? -1.221  13.850  2.096   1.00 0.00 ? 202 LEU A HD22 6  
ATOM 9119  H HD23 . LEU A 1 24  ? 0.466   13.610  1.639   1.00 0.00 ? 202 LEU A HD23 6  
ATOM 9120  N N    . LEU A 1 25  ? -2.645  7.873   0.515   1.00 0.00 ? 203 LEU A N    6  
ATOM 9121  C CA   . LEU A 1 25  ? -3.505  6.800   1.000   1.00 0.00 ? 203 LEU A CA   6  
ATOM 9122  C C    . LEU A 1 25  ? -2.790  5.964   2.057   1.00 0.00 ? 203 LEU A C    6  
ATOM 9123  O O    . LEU A 1 25  ? -1.594  5.691   1.944   1.00 0.00 ? 203 LEU A O    6  
ATOM 9124  C CB   . LEU A 1 25  ? -3.945  5.907   -0.161  1.00 0.00 ? 203 LEU A CB   6  
ATOM 9125  C CG   . LEU A 1 25  ? -4.465  6.630   -1.404  1.00 0.00 ? 203 LEU A CG   6  
ATOM 9126  C CD1  . LEU A 1 25  ? -4.782  5.633   -2.508  1.00 0.00 ? 203 LEU A CD1  6  
ATOM 9127  C CD2  . LEU A 1 25  ? -5.694  7.460   -1.063  1.00 0.00 ? 203 LEU A CD2  6  
ATOM 9128  H H    . LEU A 1 25  ? -1.732  7.660   0.230   1.00 0.00 ? 203 LEU A H    6  
ATOM 9129  H HA   . LEU A 1 25  ? -4.378  7.252   1.447   1.00 0.00 ? 203 LEU A HA   6  
ATOM 9130  H HB2  . LEU A 1 25  ? -3.097  5.308   -0.457  1.00 0.00 ? 203 LEU A HB2  6  
ATOM 9131  H HB3  . LEU A 1 25  ? -4.732  5.260   0.200   1.00 0.00 ? 203 LEU A HB3  6  
ATOM 9132  H HG   . LEU A 1 25  ? -3.699  7.300   -1.770  1.00 0.00 ? 203 LEU A HG   6  
ATOM 9133  H HD11 . LEU A 1 25  ? -4.792  4.634   -2.099  1.00 0.00 ? 203 LEU A HD11 6  
ATOM 9134  H HD12 . LEU A 1 25  ? -4.028  5.698   -3.279  1.00 0.00 ? 203 LEU A HD12 6  
ATOM 9135  H HD13 . LEU A 1 25  ? -5.749  5.860   -2.931  1.00 0.00 ? 203 LEU A HD13 6  
ATOM 9136  H HD21 . LEU A 1 25  ? -6.207  7.014   -0.224  1.00 0.00 ? 203 LEU A HD21 6  
ATOM 9137  H HD22 . LEU A 1 25  ? -6.357  7.488   -1.916  1.00 0.00 ? 203 LEU A HD22 6  
ATOM 9138  H HD23 . LEU A 1 25  ? -5.391  8.464   -0.809  1.00 0.00 ? 203 LEU A HD23 6  
ATOM 9139  N N    . THR A 1 26  ? -3.529  5.558   3.084   1.00 0.00 ? 204 THR A N    6  
ATOM 9140  C CA   . THR A 1 26  ? -2.966  4.752   4.160   1.00 0.00 ? 204 THR A CA   6  
ATOM 9141  C C    . THR A 1 26  ? -3.672  3.405   4.266   1.00 0.00 ? 204 THR A C    6  
ATOM 9142  O O    . THR A 1 26  ? -4.887  3.343   4.451   1.00 0.00 ? 204 THR A O    6  
ATOM 9143  C CB   . THR A 1 26  ? -3.064  5.478   5.515   1.00 0.00 ? 204 THR A CB   6  
ATOM 9144  O OG1  . THR A 1 26  ? -2.628  6.835   5.377   1.00 0.00 ? 204 THR A OG1  6  
ATOM 9145  C CG2  . THR A 1 26  ? -2.222  4.774   6.568   1.00 0.00 ? 204 THR A CG2  6  
ATOM 9146  H H    . THR A 1 26  ? -4.476  5.808   3.118   1.00 0.00 ? 204 THR A H    6  
ATOM 9147  H HA   . THR A 1 26  ? -1.922  4.584   3.940   1.00 0.00 ? 204 THR A HA   6  
ATOM 9148  H HB   . THR A 1 26  ? -4.096  5.470   5.837   1.00 0.00 ? 204 THR A HB   6  
ATOM 9149  H HG1  . THR A 1 26  ? -3.378  7.391   5.155   1.00 0.00 ? 204 THR A HG1  6  
ATOM 9150  H HG21 . THR A 1 26  ? -1.774  3.890   6.139   1.00 0.00 ? 204 THR A HG21 6  
ATOM 9151  H HG22 . THR A 1 26  ? -2.849  4.492   7.401   1.00 0.00 ? 204 THR A HG22 6  
ATOM 9152  H HG23 . THR A 1 26  ? -1.445  5.440   6.912   1.00 0.00 ? 204 THR A HG23 6  
ATOM 9153  N N    . GLY A 1 27  ? -2.903  2.328   4.147   1.00 0.00 ? 205 GLY A N    6  
ATOM 9154  C CA   . GLY A 1 27  ? -3.473  0.996   4.232   1.00 0.00 ? 205 GLY A CA   6  
ATOM 9155  C C    . GLY A 1 27  ? -2.703  0.095   5.178   1.00 0.00 ? 205 GLY A C    6  
ATOM 9156  O O    . GLY A 1 27  ? -1.738  0.526   5.811   1.00 0.00 ? 205 GLY A O    6  
ATOM 9157  H H    . GLY A 1 27  ? -1.940  2.438   4.000   1.00 0.00 ? 205 GLY A H    6  
ATOM 9158  H HA2  . GLY A 1 27  ? -4.493  1.074   4.577   1.00 0.00 ? 205 GLY A HA2  6  
ATOM 9159  H HA3  . GLY A 1 27  ? -3.469  0.551   3.248   1.00 0.00 ? 205 GLY A HA3  6  
ATOM 9160  N N    . THR A 1 28  ? -3.130  -1.160  5.277   1.00 0.00 ? 206 THR A N    6  
ATOM 9161  C CA   . THR A 1 28  ? -2.476  -2.123  6.154   1.00 0.00 ? 206 THR A CA   6  
ATOM 9162  C C    . THR A 1 28  ? -2.034  -3.360  5.380   1.00 0.00 ? 206 THR A C    6  
ATOM 9163  O O    . THR A 1 28  ? -2.766  -3.867  4.530   1.00 0.00 ? 206 THR A O    6  
ATOM 9164  C CB   . THR A 1 28  ? -3.404  -2.555  7.304   1.00 0.00 ? 206 THR A CB   6  
ATOM 9165  O OG1  . THR A 1 28  ? -4.757  -2.634  6.840   1.00 0.00 ? 206 THR A OG1  6  
ATOM 9166  C CG2  . THR A 1 28  ? -3.318  -1.577  8.466   1.00 0.00 ? 206 THR A CG2  6  
ATOM 9167  H H    . THR A 1 28  ? -3.904  -1.443  4.747   1.00 0.00 ? 206 THR A H    6  
ATOM 9168  H HA   . THR A 1 28  ? -1.605  -1.647  6.581   1.00 0.00 ? 206 THR A HA   6  
ATOM 9169  H HB   . THR A 1 28  ? -3.093  -3.530  7.651   1.00 0.00 ? 206 THR A HB   6  
ATOM 9170  H HG1  . THR A 1 28  ? -5.044  -1.767  6.543   1.00 0.00 ? 206 THR A HG1  6  
ATOM 9171  H HG21 . THR A 1 28  ? -2.710  -0.731  8.180   1.00 0.00 ? 206 THR A HG21 6  
ATOM 9172  H HG22 . THR A 1 28  ? -2.874  -2.068  9.319   1.00 0.00 ? 206 THR A HG22 6  
ATOM 9173  H HG23 . THR A 1 28  ? -4.309  -1.235  8.723   1.00 0.00 ? 206 THR A HG23 6  
ATOM 9174  N N    . VAL A 1 29  ? -0.833  -3.843  5.681   1.00 0.00 ? 207 VAL A N    6  
ATOM 9175  C CA   . VAL A 1 29  ? -0.294  -5.022  5.015   1.00 0.00 ? 207 VAL A CA   6  
ATOM 9176  C C    . VAL A 1 29  ? -1.170  -6.244  5.268   1.00 0.00 ? 207 VAL A C    6  
ATOM 9177  O O    . VAL A 1 29  ? -1.411  -6.622  6.414   1.00 0.00 ? 207 VAL A O    6  
ATOM 9178  C CB   . VAL A 1 29  ? 1.140   -5.327  5.485   1.00 0.00 ? 207 VAL A CB   6  
ATOM 9179  C CG1  . VAL A 1 29  ? 1.727   -6.487  4.695   1.00 0.00 ? 207 VAL A CG1  6  
ATOM 9180  C CG2  . VAL A 1 29  ? 2.016   -4.089  5.359   1.00 0.00 ? 207 VAL A CG2  6  
ATOM 9181  H H    . VAL A 1 29  ? -0.296  -3.395  6.368   1.00 0.00 ? 207 VAL A H    6  
ATOM 9182  H HA   . VAL A 1 29  ? -0.268  -4.824  3.953   1.00 0.00 ? 207 VAL A HA   6  
ATOM 9183  H HB   . VAL A 1 29  ? 1.103   -5.611  6.526   1.00 0.00 ? 207 VAL A HB   6  
ATOM 9184  H HG11 . VAL A 1 29  ? 1.438   -7.419  5.158   1.00 0.00 ? 207 VAL A HG11 6  
ATOM 9185  H HG12 . VAL A 1 29  ? 1.355   -6.457  3.681   1.00 0.00 ? 207 VAL A HG12 6  
ATOM 9186  H HG13 . VAL A 1 29  ? 2.804   -6.409  4.687   1.00 0.00 ? 207 VAL A HG13 6  
ATOM 9187  H HG21 . VAL A 1 29  ? 2.975   -4.368  4.949   1.00 0.00 ? 207 VAL A HG21 6  
ATOM 9188  H HG22 . VAL A 1 29  ? 1.538   -3.375  4.704   1.00 0.00 ? 207 VAL A HG22 6  
ATOM 9189  H HG23 . VAL A 1 29  ? 2.156   -3.646  6.334   1.00 0.00 ? 207 VAL A HG23 6  
ATOM 9190  N N    . SER A 1 30  ? -1.644  -6.859  4.189   1.00 0.00 ? 208 SER A N    6  
ATOM 9191  C CA   . SER A 1 30  ? -2.497  -8.038  4.293   1.00 0.00 ? 208 SER A CA   6  
ATOM 9192  C C    . SER A 1 30  ? -1.659  -9.311  4.346   1.00 0.00 ? 208 SER A C    6  
ATOM 9193  O O    . SER A 1 30  ? -1.958  -10.233 5.105   1.00 0.00 ? 208 SER A O    6  
ATOM 9194  C CB   . SER A 1 30  ? -3.465  -8.099  3.110   1.00 0.00 ? 208 SER A CB   6  
ATOM 9195  O OG   . SER A 1 30  ? -4.278  -9.258  3.176   1.00 0.00 ? 208 SER A OG   6  
ATOM 9196  H H    . SER A 1 30  ? -1.417  -6.510  3.301   1.00 0.00 ? 208 SER A H    6  
ATOM 9197  H HA   . SER A 1 30  ? -3.065  -7.956  5.208   1.00 0.00 ? 208 SER A HA   6  
ATOM 9198  H HB2  . SER A 1 30  ? -4.101  -7.227  3.123   1.00 0.00 ? 208 SER A HB2  6  
ATOM 9199  H HB3  . SER A 1 30  ? -2.902  -8.120  2.188   1.00 0.00 ? 208 SER A HB3  6  
ATOM 9200  H HG   . SER A 1 30  ? -3.734  -10.019 3.395   1.00 0.00 ? 208 SER A HG   6  
ATOM 9201  N N    . SER A 1 31  ? -0.608  -9.355  3.534   1.00 0.00 ? 209 SER A N    6  
ATOM 9202  C CA   . SER A 1 31  ? 0.272   -10.517 3.485   1.00 0.00 ? 209 SER A CA   6  
ATOM 9203  C C    . SER A 1 31  ? 1.649   -10.133 2.952   1.00 0.00 ? 209 SER A C    6  
ATOM 9204  O O    . SER A 1 31  ? 1.797   -9.140  2.237   1.00 0.00 ? 209 SER A O    6  
ATOM 9205  C CB   . SER A 1 31  ? -0.341  -11.610 2.607   1.00 0.00 ? 209 SER A CB   6  
ATOM 9206  O OG   . SER A 1 31  ? 0.123   -12.893 2.993   1.00 0.00 ? 209 SER A OG   6  
ATOM 9207  H H    . SER A 1 31  ? -0.422  -8.588  2.952   1.00 0.00 ? 209 SER A H    6  
ATOM 9208  H HA   . SER A 1 31  ? 0.381   -10.893 4.491   1.00 0.00 ? 209 SER A HA   6  
ATOM 9209  H HB2  . SER A 1 31  ? -1.415  -11.585 2.703   1.00 0.00 ? 209 SER A HB2  6  
ATOM 9210  H HB3  . SER A 1 31  ? -0.067  -11.436 1.577   1.00 0.00 ? 209 SER A HB3  6  
ATOM 9211  H HG   . SER A 1 31  ? -0.343  -13.178 3.781   1.00 0.00 ? 209 SER A HG   6  
ATOM 9212  N N    . LEU A 1 32  ? 2.655   -10.926 3.304   1.00 0.00 ? 210 LEU A N    6  
ATOM 9213  C CA   . LEU A 1 32  ? 4.021   -10.671 2.861   1.00 0.00 ? 210 LEU A CA   6  
ATOM 9214  C C    . LEU A 1 32  ? 4.386   -11.561 1.677   1.00 0.00 ? 210 LEU A C    6  
ATOM 9215  O O    . LEU A 1 32  ? 4.444   -12.783 1.803   1.00 0.00 ? 210 LEU A O    6  
ATOM 9216  C CB   . LEU A 1 32  ? 5.003   -10.905 4.011   1.00 0.00 ? 210 LEU A CB   6  
ATOM 9217  C CG   . LEU A 1 32  ? 5.036   -9.828  5.095   1.00 0.00 ? 210 LEU A CG   6  
ATOM 9218  C CD1  . LEU A 1 32  ? 5.428   -8.484  4.501   1.00 0.00 ? 210 LEU A CD1  6  
ATOM 9219  C CD2  . LEU A 1 32  ? 3.687   -9.731  5.793   1.00 0.00 ? 210 LEU A CD2  6  
ATOM 9220  H H    . LEU A 1 32  ? 2.475   -11.702 3.874   1.00 0.00 ? 210 LEU A H    6  
ATOM 9221  H HA   . LEU A 1 32  ? 4.082   -9.638  2.552   1.00 0.00 ? 210 LEU A HA   6  
ATOM 9222  H HB2  . LEU A 1 32  ? 4.742   -11.840 4.482   1.00 0.00 ? 210 LEU A HB2  6  
ATOM 9223  H HB3  . LEU A 1 32  ? 5.994   -10.981 3.588   1.00 0.00 ? 210 LEU A HB3  6  
ATOM 9224  H HG   . LEU A 1 32  ? 5.778   -10.094 5.836   1.00 0.00 ? 210 LEU A HG   6  
ATOM 9225  H HD11 . LEU A 1 32  ? 6.064   -8.642  3.643   1.00 0.00 ? 210 LEU A HD11 6  
ATOM 9226  H HD12 . LEU A 1 32  ? 5.960   -7.904  5.241   1.00 0.00 ? 210 LEU A HD12 6  
ATOM 9227  H HD13 . LEU A 1 32  ? 4.539   -7.952  4.197   1.00 0.00 ? 210 LEU A HD13 6  
ATOM 9228  H HD21 . LEU A 1 32  ? 3.768   -9.069  6.642   1.00 0.00 ? 210 LEU A HD21 6  
ATOM 9229  H HD22 . LEU A 1 32  ? 3.385   -10.712 6.129   1.00 0.00 ? 210 LEU A HD22 6  
ATOM 9230  H HD23 . LEU A 1 32  ? 2.952   -9.344  5.103   1.00 0.00 ? 210 LEU A HD23 6  
ATOM 9231  N N    . GLU A 1 33  ? 4.632   -10.938 0.529   1.00 0.00 ? 211 GLU A N    6  
ATOM 9232  C CA   . GLU A 1 33  ? 4.992   -11.674 -0.677  1.00 0.00 ? 211 GLU A CA   6  
ATOM 9233  C C    . GLU A 1 33  ? 6.504   -11.673 -0.884  1.00 0.00 ? 211 GLU A C    6  
ATOM 9234  O O    . GLU A 1 33  ? 7.165   -10.650 -0.707  1.00 0.00 ? 211 GLU A O    6  
ATOM 9235  C CB   . GLU A 1 33  ? 4.299   -11.066 -1.898  1.00 0.00 ? 211 GLU A CB   6  
ATOM 9236  C CG   . GLU A 1 33  ? 2.881   -11.572 -2.108  1.00 0.00 ? 211 GLU A CG   6  
ATOM 9237  C CD   . GLU A 1 33  ? 2.369   -11.307 -3.510  1.00 0.00 ? 211 GLU A CD   6  
ATOM 9238  O OE1  . GLU A 1 33  ? 2.699   -10.242 -4.072  1.00 0.00 ? 211 GLU A OE1  6  
ATOM 9239  O OE2  . GLU A 1 33  ? 1.638   -12.166 -4.046  1.00 0.00 ? 211 GLU A OE2  6  
ATOM 9240  H H    . GLU A 1 33  ? 4.569   -9.960  0.492   1.00 0.00 ? 211 GLU A H    6  
ATOM 9241  H HA   . GLU A 1 33  ? 4.658   -12.693 -0.555  1.00 0.00 ? 211 GLU A HA   6  
ATOM 9242  H HB2  . GLU A 1 33  ? 4.263   -9.993  -1.781  1.00 0.00 ? 211 GLU A HB2  6  
ATOM 9243  H HB3  . GLU A 1 33  ? 4.877   -11.303 -2.780  1.00 0.00 ? 211 GLU A HB3  6  
ATOM 9244  H HG2  . GLU A 1 33  ? 2.862   -12.636 -1.930  1.00 0.00 ? 211 GLU A HG2  6  
ATOM 9245  H HG3  . GLU A 1 33  ? 2.229   -11.078 -1.403  1.00 0.00 ? 211 GLU A HG3  6  
ATOM 9246  N N    . ASP A 1 34  ? 7.044   -12.827 -1.259  1.00 0.00 ? 212 ASP A N    6  
ATOM 9247  C CA   . ASP A 1 34  ? 8.478   -12.961 -1.490  1.00 0.00 ? 212 ASP A CA   6  
ATOM 9248  C C    . ASP A 1 34  ? 8.953   -11.966 -2.545  1.00 0.00 ? 212 ASP A C    6  
ATOM 9249  O O    . ASP A 1 34  ? 10.140  -11.648 -2.623  1.00 0.00 ? 212 ASP A O    6  
ATOM 9250  C CB   . ASP A 1 34  ? 8.814   -14.387 -1.929  1.00 0.00 ? 212 ASP A CB   6  
ATOM 9251  C CG   . ASP A 1 34  ? 10.238  -14.517 -2.434  1.00 0.00 ? 212 ASP A CG   6  
ATOM 9252  O OD1  . ASP A 1 34  ? 11.120  -13.806 -1.910  1.00 0.00 ? 212 ASP A OD1  6  
ATOM 9253  O OD2  . ASP A 1 34  ? 10.469  -15.329 -3.354  1.00 0.00 ? 212 ASP A OD2  6  
ATOM 9254  H H    . ASP A 1 34  ? 6.465   -13.608 -1.384  1.00 0.00 ? 212 ASP A H    6  
ATOM 9255  H HA   . ASP A 1 34  ? 8.985   -12.751 -0.561  1.00 0.00 ? 212 ASP A HA   6  
ATOM 9256  H HB2  . ASP A 1 34  ? 8.688   -15.054 -1.088  1.00 0.00 ? 212 ASP A HB2  6  
ATOM 9257  H HB3  . ASP A 1 34  ? 8.142   -14.682 -2.721  1.00 0.00 ? 212 ASP A HB3  6  
ATOM 9258  N N    . HIS A 1 35  ? 8.019   -11.479 -3.355  1.00 0.00 ? 213 HIS A N    6  
ATOM 9259  C CA   . HIS A 1 35  ? 8.342   -10.521 -4.406  1.00 0.00 ? 213 HIS A CA   6  
ATOM 9260  C C    . HIS A 1 35  ? 8.127   -9.090  -3.921  1.00 0.00 ? 213 HIS A C    6  
ATOM 9261  O O    . HIS A 1 35  ? 8.898   -8.190  -4.251  1.00 0.00 ? 213 HIS A O    6  
ATOM 9262  C CB   . HIS A 1 35  ? 7.489   -10.784 -5.647  1.00 0.00 ? 213 HIS A CB   6  
ATOM 9263  C CG   . HIS A 1 35  ? 7.557   -12.200 -6.131  1.00 0.00 ? 213 HIS A CG   6  
ATOM 9264  N ND1  . HIS A 1 35  ? 8.388   -12.607 -7.153  1.00 0.00 ? 213 HIS A ND1  6  
ATOM 9265  C CD2  . HIS A 1 35  ? 6.893   -13.308 -5.725  1.00 0.00 ? 213 HIS A CD2  6  
ATOM 9266  C CE1  . HIS A 1 35  ? 8.230   -13.903 -7.357  1.00 0.00 ? 213 HIS A CE1  6  
ATOM 9267  N NE2  . HIS A 1 35  ? 7.329   -14.352 -6.502  1.00 0.00 ? 213 HIS A NE2  6  
ATOM 9268  H H    . HIS A 1 35  ? 7.090   -11.771 -3.244  1.00 0.00 ? 213 HIS A H    6  
ATOM 9269  H HA   . HIS A 1 35  ? 9.383   -10.648 -4.662  1.00 0.00 ? 213 HIS A HA   6  
ATOM 9270  H HB2  . HIS A 1 35  ? 6.457   -10.561 -5.420  1.00 0.00 ? 213 HIS A HB2  6  
ATOM 9271  H HB3  . HIS A 1 35  ? 7.823   -10.142 -6.449  1.00 0.00 ? 213 HIS A HB3  6  
ATOM 9272  H HD1  . HIS A 1 35  ? 9.000   -12.031 -7.656  1.00 0.00 ? 213 HIS A HD1  6  
ATOM 9273  H HD2  . HIS A 1 35  ? 6.155   -13.361 -4.936  1.00 0.00 ? 213 HIS A HD2  6  
ATOM 9274  H HE1  . HIS A 1 35  ? 8.750   -14.495 -8.095  1.00 0.00 ? 213 HIS A HE1  6  
ATOM 9275  H HE2  . HIS A 1 35  ? 6.962   -15.260 -6.495  1.00 0.00 ? 213 HIS A HE2  6  
ATOM 9276  N N    . GLY A 1 36  ? 7.073   -8.888  -3.137  1.00 0.00 ? 214 GLY A N    6  
ATOM 9277  C CA   . GLY A 1 36  ? 6.775   -7.565  -2.620  1.00 0.00 ? 214 GLY A CA   6  
ATOM 9278  C C    . GLY A 1 36  ? 5.848   -7.605  -1.422  1.00 0.00 ? 214 GLY A C    6  
ATOM 9279  O O    . GLY A 1 36  ? 5.693   -8.646  -0.783  1.00 0.00 ? 214 GLY A O    6  
ATOM 9280  H H    . GLY A 1 36  ? 6.492   -9.643  -2.907  1.00 0.00 ? 214 GLY A H    6  
ATOM 9281  H HA2  . GLY A 1 36  ? 7.699   -7.087  -2.331  1.00 0.00 ? 214 GLY A HA2  6  
ATOM 9282  H HA3  . GLY A 1 36  ? 6.309   -6.982  -3.402  1.00 0.00 ? 214 GLY A HA3  6  
ATOM 9283  N N    . TYR A 1 37  ? 5.231   -6.470  -1.115  1.00 0.00 ? 215 TYR A N    6  
ATOM 9284  C CA   . TYR A 1 37  ? 4.317   -6.378  0.017   1.00 0.00 ? 215 TYR A CA   6  
ATOM 9285  C C    . TYR A 1 37  ? 2.907   -6.026  -0.447  1.00 0.00 ? 215 TYR A C    6  
ATOM 9286  O O    . TYR A 1 37  ? 2.714   -5.103  -1.240  1.00 0.00 ? 215 TYR A O    6  
ATOM 9287  C CB   . TYR A 1 37  ? 4.813   -5.332  1.017   1.00 0.00 ? 215 TYR A CB   6  
ATOM 9288  C CG   . TYR A 1 37  ? 6.197   -5.616  1.554   1.00 0.00 ? 215 TYR A CG   6  
ATOM 9289  C CD1  . TYR A 1 37  ? 7.327   -5.376  0.782   1.00 0.00 ? 215 TYR A CD1  6  
ATOM 9290  C CD2  . TYR A 1 37  ? 6.375   -6.124  2.835   1.00 0.00 ? 215 TYR A CD2  6  
ATOM 9291  C CE1  . TYR A 1 37  ? 8.593   -5.635  1.269   1.00 0.00 ? 215 TYR A CE1  6  
ATOM 9292  C CE2  . TYR A 1 37  ? 7.638   -6.384  3.331   1.00 0.00 ? 215 TYR A CE2  6  
ATOM 9293  C CZ   . TYR A 1 37  ? 8.744   -6.139  2.544   1.00 0.00 ? 215 TYR A CZ   6  
ATOM 9294  O OH   . TYR A 1 37  ? 10.004  -6.397  3.033   1.00 0.00 ? 215 TYR A OH   6  
ATOM 9295  H H    . TYR A 1 37  ? 5.394   -5.673  -1.662  1.00 0.00 ? 215 TYR A H    6  
ATOM 9296  H HA   . TYR A 1 37  ? 4.293   -7.343  0.503   1.00 0.00 ? 215 TYR A HA   6  
ATOM 9297  H HB2  . TYR A 1 37  ? 4.836   -4.367  0.535   1.00 0.00 ? 215 TYR A HB2  6  
ATOM 9298  H HB3  . TYR A 1 37  ? 4.132   -5.293  1.855   1.00 0.00 ? 215 TYR A HB3  6  
ATOM 9299  H HD1  . TYR A 1 37  ? 7.205   -4.980  -0.216  1.00 0.00 ? 215 TYR A HD1  6  
ATOM 9300  H HD2  . TYR A 1 37  ? 5.507   -6.315  3.449   1.00 0.00 ? 215 TYR A HD2  6  
ATOM 9301  H HE1  . TYR A 1 37  ? 9.459   -5.442  0.653   1.00 0.00 ? 215 TYR A HE1  6  
ATOM 9302  H HE2  . TYR A 1 37  ? 7.756   -6.779  4.329   1.00 0.00 ? 215 TYR A HE2  6  
ATOM 9303  H HH   . TYR A 1 37  ? 10.659  -6.131  2.384   1.00 0.00 ? 215 TYR A HH   6  
ATOM 9304  N N    . LEU A 1 38  ? 1.924   -6.768  0.052   1.00 0.00 ? 216 LEU A N    6  
ATOM 9305  C CA   . LEU A 1 38  ? 0.530   -6.535  -0.310  1.00 0.00 ? 216 LEU A CA   6  
ATOM 9306  C C    . LEU A 1 38  ? -0.136  -5.579  0.674   1.00 0.00 ? 216 LEU A C    6  
ATOM 9307  O O    . LEU A 1 38  ? -0.002  -5.729  1.889   1.00 0.00 ? 216 LEU A O    6  
ATOM 9308  C CB   . LEU A 1 38  ? -0.235  -7.859  -0.350  1.00 0.00 ? 216 LEU A CB   6  
ATOM 9309  C CG   . LEU A 1 38  ? -0.234  -8.595  -1.690  1.00 0.00 ? 216 LEU A CG   6  
ATOM 9310  C CD1  . LEU A 1 38  ? -1.278  -8.002  -2.624  1.00 0.00 ? 216 LEU A CD1  6  
ATOM 9311  C CD2  . LEU A 1 38  ? 1.146   -8.541  -2.328  1.00 0.00 ? 216 LEU A CD2  6  
ATOM 9312  H H    . LEU A 1 38  ? 2.140   -7.489  0.679   1.00 0.00 ? 216 LEU A H    6  
ATOM 9313  H HA   . LEU A 1 38  ? 0.514   -6.090  -1.294  1.00 0.00 ? 216 LEU A HA   6  
ATOM 9314  H HB2  . LEU A 1 38  ? 0.202   -8.516  0.387   1.00 0.00 ? 216 LEU A HB2  6  
ATOM 9315  H HB3  . LEU A 1 38  ? -1.262  -7.655  -0.083  1.00 0.00 ? 216 LEU A HB3  6  
ATOM 9316  H HG   . LEU A 1 38  ? -0.487  -9.633  -1.524  1.00 0.00 ? 216 LEU A HG   6  
ATOM 9317  H HD11 . LEU A 1 38  ? -0.861  -7.148  -3.134  1.00 0.00 ? 216 LEU A HD11 6  
ATOM 9318  H HD12 . LEU A 1 38  ? -2.140  -7.695  -2.051  1.00 0.00 ? 216 LEU A HD12 6  
ATOM 9319  H HD13 . LEU A 1 38  ? -1.575  -8.746  -3.350  1.00 0.00 ? 216 LEU A HD13 6  
ATOM 9320  H HD21 . LEU A 1 38  ? 1.832   -9.143  -1.751  1.00 0.00 ? 216 LEU A HD21 6  
ATOM 9321  H HD22 . LEU A 1 38  ? 1.494   -7.518  -2.348  1.00 0.00 ? 216 LEU A HD22 6  
ATOM 9322  H HD23 . LEU A 1 38  ? 1.092   -8.923  -3.336  1.00 0.00 ? 216 LEU A HD23 6  
ATOM 9323  N N    . VAL A 1 39  ? -0.856  -4.597  0.142   1.00 0.00 ? 217 VAL A N    6  
ATOM 9324  C CA   . VAL A 1 39  ? -1.547  -3.618  0.973   1.00 0.00 ? 217 VAL A CA   6  
ATOM 9325  C C    . VAL A 1 39  ? -3.059  -3.767  0.855   1.00 0.00 ? 217 VAL A C    6  
ATOM 9326  O O    . VAL A 1 39  ? -3.583  -4.050  -0.222  1.00 0.00 ? 217 VAL A O    6  
ATOM 9327  C CB   . VAL A 1 39  ? -1.151  -2.180  0.592   1.00 0.00 ? 217 VAL A CB   6  
ATOM 9328  C CG1  . VAL A 1 39  ? -1.691  -1.189  1.612   1.00 0.00 ? 217 VAL A CG1  6  
ATOM 9329  C CG2  . VAL A 1 39  ? 0.360   -2.058  0.467   1.00 0.00 ? 217 VAL A CG2  6  
ATOM 9330  H H    . VAL A 1 39  ? -0.926  -4.530  -0.833  1.00 0.00 ? 217 VAL A H    6  
ATOM 9331  H HA   . VAL A 1 39  ? -1.257  -3.789  2.000   1.00 0.00 ? 217 VAL A HA   6  
ATOM 9332  H HB   . VAL A 1 39  ? -1.590  -1.950  -0.368  1.00 0.00 ? 217 VAL A HB   6  
ATOM 9333  H HG11 . VAL A 1 39  ? -1.218  -0.229  1.467   1.00 0.00 ? 217 VAL A HG11 6  
ATOM 9334  H HG12 . VAL A 1 39  ? -2.759  -1.088  1.486   1.00 0.00 ? 217 VAL A HG12 6  
ATOM 9335  H HG13 . VAL A 1 39  ? -1.479  -1.547  2.609   1.00 0.00 ? 217 VAL A HG13 6  
ATOM 9336  H HG21 . VAL A 1 39  ? 0.833   -2.720  1.176   1.00 0.00 ? 217 VAL A HG21 6  
ATOM 9337  H HG22 . VAL A 1 39  ? 0.662   -2.329  -0.535  1.00 0.00 ? 217 VAL A HG22 6  
ATOM 9338  H HG23 . VAL A 1 39  ? 0.658   -1.040  0.669   1.00 0.00 ? 217 VAL A HG23 6  
ATOM 9339  N N    . ASP A 1 40  ? -3.756  -3.573  1.970   1.00 0.00 ? 218 ASP A N    6  
ATOM 9340  C CA   . ASP A 1 40  ? -5.210  -3.683  1.992   1.00 0.00 ? 218 ASP A CA   6  
ATOM 9341  C C    . ASP A 1 40  ? -5.861  -2.341  1.676   1.00 0.00 ? 218 ASP A C    6  
ATOM 9342  O O    . ASP A 1 40  ? -5.610  -1.343  2.354   1.00 0.00 ? 218 ASP A O    6  
ATOM 9343  C CB   . ASP A 1 40  ? -5.684  -4.186  3.356   1.00 0.00 ? 218 ASP A CB   6  
ATOM 9344  C CG   . ASP A 1 40  ? -6.973  -4.979  3.265   1.00 0.00 ? 218 ASP A CG   6  
ATOM 9345  O OD1  . ASP A 1 40  ? -7.973  -4.430  2.757   1.00 0.00 ? 218 ASP A OD1  6  
ATOM 9346  O OD2  . ASP A 1 40  ? -6.981  -6.149  3.702   1.00 0.00 ? 218 ASP A OD2  6  
ATOM 9347  H H    . ASP A 1 40  ? -3.281  -3.350  2.798   1.00 0.00 ? 218 ASP A H    6  
ATOM 9348  H HA   . ASP A 1 40  ? -5.500  -4.396  1.235   1.00 0.00 ? 218 ASP A HA   6  
ATOM 9349  H HB2  . ASP A 1 40  ? -4.922  -4.822  3.783   1.00 0.00 ? 218 ASP A HB2  6  
ATOM 9350  H HB3  . ASP A 1 40  ? -5.847  -3.340  4.007   1.00 0.00 ? 218 ASP A HB3  6  
ATOM 9351  N N    . ILE A 1 41  ? -6.697  -2.323  0.644   1.00 0.00 ? 219 ILE A N    6  
ATOM 9352  C CA   . ILE A 1 41  ? -7.384  -1.103  0.239   1.00 0.00 ? 219 ILE A CA   6  
ATOM 9353  C C    . ILE A 1 41  ? -8.898  -1.279  0.295   1.00 0.00 ? 219 ILE A C    6  
ATOM 9354  O O    . ILE A 1 41  ? -9.633  -0.339  0.594   1.00 0.00 ? 219 ILE A O    6  
ATOM 9355  C CB   . ILE A 1 41  ? -6.982  -0.676  -1.185  1.00 0.00 ? 219 ILE A CB   6  
ATOM 9356  C CG1  . ILE A 1 41  ? -7.046  -1.872  -2.137  1.00 0.00 ? 219 ILE A CG1  6  
ATOM 9357  C CG2  . ILE A 1 41  ? -5.587  -0.069  -1.182  1.00 0.00 ? 219 ILE A CG2  6  
ATOM 9358  C CD1  . ILE A 1 41  ? -6.635  -1.539  -3.554  1.00 0.00 ? 219 ILE A CD1  6  
ATOM 9359  H H    . ILE A 1 41  ? -6.856  -3.149  0.143   1.00 0.00 ? 219 ILE A H    6  
ATOM 9360  H HA   . ILE A 1 41  ? -7.098  -0.317  0.923   1.00 0.00 ? 219 ILE A HA   6  
ATOM 9361  H HB   . ILE A 1 41  ? -7.676  0.079   -1.521  1.00 0.00 ? 219 ILE A HB   6  
ATOM 9362  H HG12 . ILE A 1 41  ? -6.389  -2.647  -1.775  1.00 0.00 ? 219 ILE A HG12 6  
ATOM 9363  H HG13 . ILE A 1 41  ? -8.058  -2.248  -2.163  1.00 0.00 ? 219 ILE A HG13 6  
ATOM 9364  H HG21 . ILE A 1 41  ? -5.525  0.695   -1.943  1.00 0.00 ? 219 ILE A HG21 6  
ATOM 9365  H HG22 . ILE A 1 41  ? -5.388  0.371   -0.216  1.00 0.00 ? 219 ILE A HG22 6  
ATOM 9366  H HG23 . ILE A 1 41  ? -4.858  -0.839  -1.384  1.00 0.00 ? 219 ILE A HG23 6  
ATOM 9367  H HD11 . ILE A 1 41  ? -5.581  -1.739  -3.681  1.00 0.00 ? 219 ILE A HD11 6  
ATOM 9368  H HD12 . ILE A 1 41  ? -7.203  -2.144  -4.246  1.00 0.00 ? 219 ILE A HD12 6  
ATOM 9369  H HD13 . ILE A 1 41  ? -6.828  -0.494  -3.749  1.00 0.00 ? 219 ILE A HD13 6  
ATOM 9370  N N    . GLY A 1 42  ? -9.358  -2.493  0.008   1.00 0.00 ? 220 GLY A N    6  
ATOM 9371  C CA   . GLY A 1 42  ? -10.782 -2.773  0.034   1.00 0.00 ? 220 GLY A CA   6  
ATOM 9372  C C    . GLY A 1 42  ? -11.491 -2.283  -1.213  1.00 0.00 ? 220 GLY A C    6  
ATOM 9373  O O    . GLY A 1 42  ? -12.621 -1.801  -1.145  1.00 0.00 ? 220 GLY A O    6  
ATOM 9374  H H    . GLY A 1 42  ? -8.725  -3.205  -0.223  1.00 0.00 ? 220 GLY A H    6  
ATOM 9375  H HA2  . GLY A 1 42  ? -10.927 -3.839  0.123   1.00 0.00 ? 220 GLY A HA2  6  
ATOM 9376  H HA3  . GLY A 1 42  ? -11.217 -2.287  0.895   1.00 0.00 ? 220 GLY A HA3  6  
ATOM 9377  N N    . VAL A 1 43  ? -10.825 -2.406  -2.357  1.00 0.00 ? 221 VAL A N    6  
ATOM 9378  C CA   . VAL A 1 43  ? -11.399 -1.973  -3.626  1.00 0.00 ? 221 VAL A CA   6  
ATOM 9379  C C    . VAL A 1 43  ? -11.668 -3.161  -4.542  1.00 0.00 ? 221 VAL A C    6  
ATOM 9380  O O    . VAL A 1 43  ? -10.929 -4.145  -4.532  1.00 0.00 ? 221 VAL A O    6  
ATOM 9381  C CB   . VAL A 1 43  ? -10.471 -0.979  -4.350  1.00 0.00 ? 221 VAL A CB   6  
ATOM 9382  C CG1  . VAL A 1 43  ? -11.086 -0.541  -5.671  1.00 0.00 ? 221 VAL A CG1  6  
ATOM 9383  C CG2  . VAL A 1 43  ? -10.181 0.222   -3.464  1.00 0.00 ? 221 VAL A CG2  6  
ATOM 9384  H H    . VAL A 1 43  ? -9.928  -2.799  -2.348  1.00 0.00 ? 221 VAL A H    6  
ATOM 9385  H HA   . VAL A 1 43  ? -12.333 -1.473  -3.416  1.00 0.00 ? 221 VAL A HA   6  
ATOM 9386  H HB   . VAL A 1 43  ? -9.537  -1.479  -4.562  1.00 0.00 ? 221 VAL A HB   6  
ATOM 9387  H HG11 . VAL A 1 43  ? -10.682 -1.142  -6.473  1.00 0.00 ? 221 VAL A HG11 6  
ATOM 9388  H HG12 . VAL A 1 43  ? -12.158 -0.667  -5.629  1.00 0.00 ? 221 VAL A HG12 6  
ATOM 9389  H HG13 . VAL A 1 43  ? -10.852 0.499   -5.849  1.00 0.00 ? 221 VAL A HG13 6  
ATOM 9390  H HG21 . VAL A 1 43  ? -9.135  0.480   -3.540  1.00 0.00 ? 221 VAL A HG21 6  
ATOM 9391  H HG22 . VAL A 1 43  ? -10.782 1.060   -3.784  1.00 0.00 ? 221 VAL A HG22 6  
ATOM 9392  H HG23 . VAL A 1 43  ? -10.419 -0.021  -2.439  1.00 0.00 ? 221 VAL A HG23 6  
ATOM 9393  N N    . ASP A 1 44  ? -12.730 -3.062  -5.334  1.00 0.00 ? 222 ASP A N    6  
ATOM 9394  C CA   . ASP A 1 44  ? -13.097 -4.128  -6.259  1.00 0.00 ? 222 ASP A CA   6  
ATOM 9395  C C    . ASP A 1 44  ? -12.570 -3.837  -7.660  1.00 0.00 ? 222 ASP A C    6  
ATOM 9396  O O    . ASP A 1 44  ? -13.172 -3.075  -8.415  1.00 0.00 ? 222 ASP A O    6  
ATOM 9397  C CB   . ASP A 1 44  ? -14.616 -4.299  -6.297  1.00 0.00 ? 222 ASP A CB   6  
ATOM 9398  C CG   . ASP A 1 44  ? -15.149 -5.025  -5.077  1.00 0.00 ? 222 ASP A CG   6  
ATOM 9399  O OD1  . ASP A 1 44  ? -14.433 -5.902  -4.549  1.00 0.00 ? 222 ASP A OD1  6  
ATOM 9400  O OD2  . ASP A 1 44  ? -16.280 -4.715  -4.649  1.00 0.00 ? 222 ASP A OD2  6  
ATOM 9401  H H    . ASP A 1 44  ? -13.281 -2.251  -5.296  1.00 0.00 ? 222 ASP A H    6  
ATOM 9402  H HA   . ASP A 1 44  ? -12.650 -5.044  -5.903  1.00 0.00 ? 222 ASP A HA   6  
ATOM 9403  H HB2  . ASP A 1 44  ? -15.081 -3.324  -6.344  1.00 0.00 ? 222 ASP A HB2  6  
ATOM 9404  H HB3  . ASP A 1 44  ? -14.886 -4.864  -7.177  1.00 0.00 ? 222 ASP A HB3  6  
ATOM 9405  N N    . GLY A 1 45  ? -11.439 -4.449  -8.001  1.00 0.00 ? 223 GLY A N    6  
ATOM 9406  C CA   . GLY A 1 45  ? -10.849 -4.242  -9.310  1.00 0.00 ? 223 GLY A CA   6  
ATOM 9407  C C    . GLY A 1 45  ? -9.603  -3.381  -9.255  1.00 0.00 ? 223 GLY A C    6  
ATOM 9408  O O    . GLY A 1 45  ? -9.442  -2.455  -10.051 1.00 0.00 ? 223 GLY A O    6  
ATOM 9409  H H    . GLY A 1 45  ? -11.003 -5.046  -7.358  1.00 0.00 ? 223 GLY A H    6  
ATOM 9410  H HA2  . GLY A 1 45  ? -10.593 -5.201  -9.734  1.00 0.00 ? 223 GLY A HA2  6  
ATOM 9411  H HA3  . GLY A 1 45  ? -11.577 -3.761  -9.948  1.00 0.00 ? 223 GLY A HA3  6  
ATOM 9412  N N    . THR A 1 46  ? -8.718  -3.684  -8.310  1.00 0.00 ? 224 THR A N    6  
ATOM 9413  C CA   . THR A 1 46  ? -7.481  -2.929  -8.152  1.00 0.00 ? 224 THR A CA   6  
ATOM 9414  C C    . THR A 1 46  ? -6.429  -3.747  -7.410  1.00 0.00 ? 224 THR A C    6  
ATOM 9415  O O    . THR A 1 46  ? -6.667  -4.219  -6.298  1.00 0.00 ? 224 THR A O    6  
ATOM 9416  C CB   . THR A 1 46  ? -7.720  -1.611  -7.392  1.00 0.00 ? 224 THR A CB   6  
ATOM 9417  O OG1  . THR A 1 46  ? -8.616  -0.775  -8.132  1.00 0.00 ? 224 THR A OG1  6  
ATOM 9418  C CG2  . THR A 1 46  ? -6.409  -0.877  -7.156  1.00 0.00 ? 224 THR A CG2  6  
ATOM 9419  H H    . THR A 1 46  ? -8.903  -4.432  -7.706  1.00 0.00 ? 224 THR A H    6  
ATOM 9420  H HA   . THR A 1 46  ? -7.108  -2.690  -9.137  1.00 0.00 ? 224 THR A HA   6  
ATOM 9421  H HB   . THR A 1 46  ? -8.164  -1.842  -6.433  1.00 0.00 ? 224 THR A HB   6  
ATOM 9422  H HG1  . THR A 1 46  ? -8.503  0.138   -7.856  1.00 0.00 ? 224 THR A HG1  6  
ATOM 9423  H HG21 . THR A 1 46  ? -6.307  -0.649  -6.106  1.00 0.00 ? 224 THR A HG21 6  
ATOM 9424  H HG22 . THR A 1 46  ? -6.404  0.041   -7.726  1.00 0.00 ? 224 THR A HG22 6  
ATOM 9425  H HG23 . THR A 1 46  ? -5.586  -1.500  -7.471  1.00 0.00 ? 224 THR A HG23 6  
ATOM 9426  N N    . ARG A 1 47  ? -5.266  -3.910  -8.032  1.00 0.00 ? 225 ARG A N    6  
ATOM 9427  C CA   . ARG A 1 47  ? -4.178  -4.671  -7.430  1.00 0.00 ? 225 ARG A CA   6  
ATOM 9428  C C    . ARG A 1 47  ? -2.967  -3.779  -7.174  1.00 0.00 ? 225 ARG A C    6  
ATOM 9429  O O    . ARG A 1 47  ? -2.451  -3.139  -8.090  1.00 0.00 ? 225 ARG A O    6  
ATOM 9430  C CB   . ARG A 1 47  ? -3.783  -5.839  -8.336  1.00 0.00 ? 225 ARG A CB   6  
ATOM 9431  C CG   . ARG A 1 47  ? -4.878  -6.880  -8.501  1.00 0.00 ? 225 ARG A CG   6  
ATOM 9432  C CD   . ARG A 1 47  ? -4.536  -7.880  -9.594  1.00 0.00 ? 225 ARG A CD   6  
ATOM 9433  N NE   . ARG A 1 47  ? -4.965  -7.420  -10.912 1.00 0.00 ? 225 ARG A NE   6  
ATOM 9434  C CZ   . ARG A 1 47  ? -5.043  -8.211  -11.976 1.00 0.00 ? 225 ARG A CZ   6  
ATOM 9435  N NH1  . ARG A 1 47  ? -4.723  -9.493  -11.879 1.00 0.00 ? 225 ARG A NH1  6  
ATOM 9436  N NH2  . ARG A 1 47  ? -5.443  -7.718  -13.142 1.00 0.00 ? 225 ARG A NH2  6  
ATOM 9437  H H    . ARG A 1 47  ? -5.137  -3.509  -8.917  1.00 0.00 ? 225 ARG A H    6  
ATOM 9438  H HA   . ARG A 1 47  ? -4.529  -5.062  -6.486  1.00 0.00 ? 225 ARG A HA   6  
ATOM 9439  H HB2  . ARG A 1 47  ? -3.533  -5.453  -9.313  1.00 0.00 ? 225 ARG A HB2  6  
ATOM 9440  H HB3  . ARG A 1 47  ? -2.915  -6.326  -7.917  1.00 0.00 ? 225 ARG A HB3  6  
ATOM 9441  H HG2  . ARG A 1 47  ? -5.002  -7.410  -7.569  1.00 0.00 ? 225 ARG A HG2  6  
ATOM 9442  H HG3  . ARG A 1 47  ? -5.800  -6.380  -8.759  1.00 0.00 ? 225 ARG A HG3  6  
ATOM 9443  H HD2  . ARG A 1 47  ? -3.466  -8.028  -9.606  1.00 0.00 ? 225 ARG A HD2  6  
ATOM 9444  H HD3  . ARG A 1 47  ? -5.026  -8.817  -9.372  1.00 0.00 ? 225 ARG A HD3  6  
ATOM 9445  H HE   . ARG A 1 47  ? -5.207  -6.476  -11.006 1.00 0.00 ? 225 ARG A HE   6  
ATOM 9446  H HH11 . ARG A 1 47  ? -4.422  -9.868  -11.002 1.00 0.00 ? 225 ARG A HH11 6  
ATOM 9447  H HH12 . ARG A 1 47  ? -4.784  -10.087 -12.682 1.00 0.00 ? 225 ARG A HH12 6  
ATOM 9448  H HH21 . ARG A 1 47  ? -5.686  -6.752  -13.219 1.00 0.00 ? 225 ARG A HH21 6  
ATOM 9449  H HH22 . ARG A 1 47  ? -5.501  -8.313  -13.943 1.00 0.00 ? 225 ARG A HH22 6  
ATOM 9450  N N    . ALA A 1 48  ? -2.520  -3.742  -5.923  1.00 0.00 ? 226 ALA A N    6  
ATOM 9451  C CA   . ALA A 1 48  ? -1.369  -2.930  -5.547  1.00 0.00 ? 226 ALA A CA   6  
ATOM 9452  C C    . ALA A 1 48  ? -0.216  -3.803  -5.063  1.00 0.00 ? 226 ALA A C    6  
ATOM 9453  O O    . ALA A 1 48  ? -0.395  -4.664  -4.201  1.00 0.00 ? 226 ALA A O    6  
ATOM 9454  C CB   . ALA A 1 48  ? -1.760  -1.926  -4.473  1.00 0.00 ? 226 ALA A CB   6  
ATOM 9455  H H    . ALA A 1 48  ? -2.974  -4.275  -5.237  1.00 0.00 ? 226 ALA A H    6  
ATOM 9456  H HA   . ALA A 1 48  ? -1.049  -2.380  -6.420  1.00 0.00 ? 226 ALA A HA   6  
ATOM 9457  H HB1  . ALA A 1 48  ? -1.311  -2.212  -3.533  1.00 0.00 ? 226 ALA A HB1  6  
ATOM 9458  H HB2  . ALA A 1 48  ? -1.411  -0.944  -4.755  1.00 0.00 ? 226 ALA A HB2  6  
ATOM 9459  H HB3  . ALA A 1 48  ? -2.835  -1.911  -4.370  1.00 0.00 ? 226 ALA A HB3  6  
ATOM 9460  N N    . PHE A 1 49  ? 0.967   -3.576  -5.623  1.00 0.00 ? 227 PHE A N    6  
ATOM 9461  C CA   . PHE A 1 49  ? 2.150   -4.343  -5.249  1.00 0.00 ? 227 PHE A CA   6  
ATOM 9462  C C    . PHE A 1 49  ? 3.323   -3.418  -4.941  1.00 0.00 ? 227 PHE A C    6  
ATOM 9463  O O    . PHE A 1 49  ? 3.560   -2.439  -5.650  1.00 0.00 ? 227 PHE A O    6  
ATOM 9464  C CB   . PHE A 1 49  ? 2.531   -5.312  -6.371  1.00 0.00 ? 227 PHE A CB   6  
ATOM 9465  C CG   . PHE A 1 49  ? 3.873   -5.957  -6.175  1.00 0.00 ? 227 PHE A CG   6  
ATOM 9466  C CD1  . PHE A 1 49  ? 5.034   -5.300  -6.551  1.00 0.00 ? 227 PHE A CD1  6  
ATOM 9467  C CD2  . PHE A 1 49  ? 3.974   -7.221  -5.615  1.00 0.00 ? 227 PHE A CD2  6  
ATOM 9468  C CE1  . PHE A 1 49  ? 6.270   -5.892  -6.373  1.00 0.00 ? 227 PHE A CE1  6  
ATOM 9469  C CE2  . PHE A 1 49  ? 5.207   -7.818  -5.434  1.00 0.00 ? 227 PHE A CE2  6  
ATOM 9470  C CZ   . PHE A 1 49  ? 6.357   -7.152  -5.813  1.00 0.00 ? 227 PHE A CZ   6  
ATOM 9471  H H    . PHE A 1 49  ? 1.047   -2.876  -6.304  1.00 0.00 ? 227 PHE A H    6  
ATOM 9472  H HA   . PHE A 1 49  ? 1.910   -4.909  -4.362  1.00 0.00 ? 227 PHE A HA   6  
ATOM 9473  H HB2  . PHE A 1 49  ? 1.791   -6.096  -6.426  1.00 0.00 ? 227 PHE A HB2  6  
ATOM 9474  H HB3  . PHE A 1 49  ? 2.552   -4.776  -7.308  1.00 0.00 ? 227 PHE A HB3  6  
ATOM 9475  H HD1  . PHE A 1 49  ? 4.967   -4.315  -6.988  1.00 0.00 ? 227 PHE A HD1  6  
ATOM 9476  H HD2  . PHE A 1 49  ? 3.075   -7.742  -5.319  1.00 0.00 ? 227 PHE A HD2  6  
ATOM 9477  H HE1  . PHE A 1 49  ? 7.167   -5.370  -6.669  1.00 0.00 ? 227 PHE A HE1  6  
ATOM 9478  H HE2  . PHE A 1 49  ? 5.272   -8.803  -4.996  1.00 0.00 ? 227 PHE A HE2  6  
ATOM 9479  H HZ   . PHE A 1 49  ? 7.321   -7.617  -5.673  1.00 0.00 ? 227 PHE A HZ   6  
ATOM 9480  N N    . LEU A 1 50  ? 4.055   -3.734  -3.878  1.00 0.00 ? 228 LEU A N    6  
ATOM 9481  C CA   . LEU A 1 50  ? 5.204   -2.932  -3.473  1.00 0.00 ? 228 LEU A CA   6  
ATOM 9482  C C    . LEU A 1 50  ? 6.509   -3.664  -3.767  1.00 0.00 ? 228 LEU A C    6  
ATOM 9483  O O    . LEU A 1 50  ? 6.714   -4.808  -3.360  1.00 0.00 ? 228 LEU A O    6  
ATOM 9484  C CB   . LEU A 1 50  ? 5.118   -2.597  -1.983  1.00 0.00 ? 228 LEU A CB   6  
ATOM 9485  C CG   . LEU A 1 50  ? 6.117   -1.560  -1.470  1.00 0.00 ? 228 LEU A CG   6  
ATOM 9486  C CD1  . LEU A 1 50  ? 7.544   -2.039  -1.687  1.00 0.00 ? 228 LEU A CD1  6  
ATOM 9487  C CD2  . LEU A 1 50  ? 5.893   -0.219  -2.154  1.00 0.00 ? 228 LEU A CD2  6  
ATOM 9488  H H    . LEU A 1 50  ? 3.817   -4.526  -3.352  1.00 0.00 ? 228 LEU A H    6  
ATOM 9489  H HA   . LEU A 1 50  ? 5.184   -2.014  -4.042  1.00 0.00 ? 228 LEU A HA   6  
ATOM 9490  H HB2  . LEU A 1 50  ? 4.124   -2.226  -1.785  1.00 0.00 ? 228 LEU A HB2  6  
ATOM 9491  H HB3  . LEU A 1 50  ? 5.276   -3.512  -1.430  1.00 0.00 ? 228 LEU A HB3  6  
ATOM 9492  H HG   . LEU A 1 50  ? 5.970   -1.422  -0.407  1.00 0.00 ? 228 LEU A HG   6  
ATOM 9493  H HD11 . LEU A 1 50  ? 7.877   -1.744  -2.670  1.00 0.00 ? 228 LEU A HD11 6  
ATOM 9494  H HD12 . LEU A 1 50  ? 7.578   -3.116  -1.603  1.00 0.00 ? 228 LEU A HD12 6  
ATOM 9495  H HD13 . LEU A 1 50  ? 8.189   -1.600  -0.940  1.00 0.00 ? 228 LEU A HD13 6  
ATOM 9496  H HD21 . LEU A 1 50  ? 5.511   0.492   -1.436  1.00 0.00 ? 228 LEU A HD21 6  
ATOM 9497  H HD22 . LEU A 1 50  ? 5.179   -0.339  -2.956  1.00 0.00 ? 228 LEU A HD22 6  
ATOM 9498  H HD23 . LEU A 1 50  ? 6.829   0.141   -2.556  1.00 0.00 ? 228 LEU A HD23 6  
ATOM 9499  N N    . PRO A 1 51  ? 7.416   -2.990  -4.489  1.00 0.00 ? 229 PRO A N    6  
ATOM 9500  C CA   . PRO A 1 51  ? 8.719   -3.556  -4.851  1.00 0.00 ? 229 PRO A CA   6  
ATOM 9501  C C    . PRO A 1 51  ? 9.643   -3.702  -3.647  1.00 0.00 ? 229 PRO A C    6  
ATOM 9502  O O    . PRO A 1 51  ? 9.806   -2.768  -2.859  1.00 0.00 ? 229 PRO A O    6  
ATOM 9503  C CB   . PRO A 1 51  ? 9.287   -2.534  -5.840  1.00 0.00 ? 229 PRO A CB   6  
ATOM 9504  C CG   . PRO A 1 51  ? 8.616   -1.252  -5.487  1.00 0.00 ? 229 PRO A CG   6  
ATOM 9505  C CD   . PRO A 1 51  ? 7.240   -1.623  -5.008  1.00 0.00 ? 229 PRO A CD   6  
ATOM 9506  H HA   . PRO A 1 51  ? 8.614   -4.513  -5.341  1.00 0.00 ? 229 PRO A HA   6  
ATOM 9507  H HB2  . PRO A 1 51  ? 10.359  -2.467  -5.716  1.00 0.00 ? 229 PRO A HB2  6  
ATOM 9508  H HB3  . PRO A 1 51  ? 9.054   -2.837  -6.850  1.00 0.00 ? 229 PRO A HB3  6  
ATOM 9509  H HG2  . PRO A 1 51  ? 9.165   -0.754  -4.702  1.00 0.00 ? 229 PRO A HG2  6  
ATOM 9510  H HG3  . PRO A 1 51  ? 8.551   -0.620  -6.360  1.00 0.00 ? 229 PRO A HG3  6  
ATOM 9511  H HD2  . PRO A 1 51  ? 6.920   -0.952  -4.225  1.00 0.00 ? 229 PRO A HD2  6  
ATOM 9512  H HD3  . PRO A 1 51  ? 6.538   -1.610  -5.829  1.00 0.00 ? 229 PRO A HD3  6  
ATOM 9513  N N    . LEU A 1 52  ? 10.246  -4.877  -3.509  1.00 0.00 ? 230 LEU A N    6  
ATOM 9514  C CA   . LEU A 1 52  ? 11.154  -5.145  -2.399  1.00 0.00 ? 230 LEU A CA   6  
ATOM 9515  C C    . LEU A 1 52  ? 12.364  -4.217  -2.449  1.00 0.00 ? 230 LEU A C    6  
ATOM 9516  O O    . LEU A 1 52  ? 12.995  -3.947  -1.427  1.00 0.00 ? 230 LEU A O    6  
ATOM 9517  C CB   . LEU A 1 52  ? 11.615  -6.604  -2.433  1.00 0.00 ? 230 LEU A CB   6  
ATOM 9518  C CG   . LEU A 1 52  ? 10.635  -7.630  -1.864  1.00 0.00 ? 230 LEU A CG   6  
ATOM 9519  C CD1  . LEU A 1 52  ? 11.082  -9.043  -2.208  1.00 0.00 ? 230 LEU A CD1  6  
ATOM 9520  C CD2  . LEU A 1 52  ? 10.502  -7.463  -0.358  1.00 0.00 ? 230 LEU A CD2  6  
ATOM 9521  H H    . LEU A 1 52  ? 10.077  -5.582  -4.168  1.00 0.00 ? 230 LEU A H    6  
ATOM 9522  H HA   . LEU A 1 52  ? 10.616  -4.967  -1.480  1.00 0.00 ? 230 LEU A HA   6  
ATOM 9523  H HB2  . LEU A 1 52  ? 11.808  -6.866  -3.462  1.00 0.00 ? 230 LEU A HB2  6  
ATOM 9524  H HB3  . LEU A 1 52  ? 12.533  -6.673  -1.867  1.00 0.00 ? 230 LEU A HB3  6  
ATOM 9525  H HG   . LEU A 1 52  ? 9.661   -7.472  -2.307  1.00 0.00 ? 230 LEU A HG   6  
ATOM 9526  H HD11 . LEU A 1 52  ? 10.602  -9.360  -3.122  1.00 0.00 ? 230 LEU A HD11 6  
ATOM 9527  H HD12 . LEU A 1 52  ? 10.808  -9.712  -1.407  1.00 0.00 ? 230 LEU A HD12 6  
ATOM 9528  H HD13 . LEU A 1 52  ? 12.154  -9.059  -2.339  1.00 0.00 ? 230 LEU A HD13 6  
ATOM 9529  H HD21 . LEU A 1 52  ? 11.051  -6.588  -0.043  1.00 0.00 ? 230 LEU A HD21 6  
ATOM 9530  H HD22 . LEU A 1 52  ? 10.902  -8.336  0.138   1.00 0.00 ? 230 LEU A HD22 6  
ATOM 9531  H HD23 . LEU A 1 52  ? 9.460   -7.348  -0.099  1.00 0.00 ? 230 LEU A HD23 6  
ATOM 9532  N N    . LEU A 1 53  ? 12.680  -3.729  -3.644  1.00 0.00 ? 231 LEU A N    6  
ATOM 9533  C CA   . LEU A 1 53  ? 13.812  -2.828  -3.827  1.00 0.00 ? 231 LEU A CA   6  
ATOM 9534  C C    . LEU A 1 53  ? 13.576  -1.503  -3.109  1.00 0.00 ? 231 LEU A C    6  
ATOM 9535  O O    . LEU A 1 53  ? 14.483  -0.952  -2.485  1.00 0.00 ? 231 LEU A O    6  
ATOM 9536  C CB   . LEU A 1 53  ? 14.054  -2.578  -5.317  1.00 0.00 ? 231 LEU A CB   6  
ATOM 9537  C CG   . LEU A 1 53  ? 14.004  -3.810  -6.221  1.00 0.00 ? 231 LEU A CG   6  
ATOM 9538  C CD1  . LEU A 1 53  ? 14.081  -3.402  -7.684  1.00 0.00 ? 231 LEU A CD1  6  
ATOM 9539  C CD2  . LEU A 1 53  ? 15.130  -4.773  -5.874  1.00 0.00 ? 231 LEU A CD2  6  
ATOM 9540  H H    . LEU A 1 53  ? 12.139  -3.980  -4.421  1.00 0.00 ? 231 LEU A H    6  
ATOM 9541  H HA   . LEU A 1 53  ? 14.685  -3.303  -3.404  1.00 0.00 ? 231 LEU A HA   6  
ATOM 9542  H HB2  . LEU A 1 53  ? 13.303  -1.884  -5.662  1.00 0.00 ? 231 LEU A HB2  6  
ATOM 9543  H HB3  . LEU A 1 53  ? 15.032  -2.130  -5.421  1.00 0.00 ? 231 LEU A HB3  6  
ATOM 9544  H HG   . LEU A 1 53  ? 13.064  -4.324  -6.067  1.00 0.00 ? 231 LEU A HG   6  
ATOM 9545  H HD11 . LEU A 1 53  ? 13.135  -3.604  -8.164  1.00 0.00 ? 231 LEU A HD11 6  
ATOM 9546  H HD12 . LEU A 1 53  ? 14.860  -3.966  -8.174  1.00 0.00 ? 231 LEU A HD12 6  
ATOM 9547  H HD13 . LEU A 1 53  ? 14.303  -2.347  -7.752  1.00 0.00 ? 231 LEU A HD13 6  
ATOM 9548  H HD21 . LEU A 1 53  ? 15.924  -4.673  -6.599  1.00 0.00 ? 231 LEU A HD21 6  
ATOM 9549  H HD22 . LEU A 1 53  ? 14.755  -5.786  -5.889  1.00 0.00 ? 231 LEU A HD22 6  
ATOM 9550  H HD23 . LEU A 1 53  ? 15.510  -4.543  -4.890  1.00 0.00 ? 231 LEU A HD23 6  
ATOM 9551  N N    . LYS A 1 54  ? 12.350  -0.998  -3.200  1.00 0.00 ? 232 LYS A N    6  
ATOM 9552  C CA   . LYS A 1 54  ? 11.992  0.261   -2.557  1.00 0.00 ? 232 LYS A CA   6  
ATOM 9553  C C    . LYS A 1 54  ? 11.696  0.050   -1.076  1.00 0.00 ? 232 LYS A C    6  
ATOM 9554  O O    . LYS A 1 54  ? 12.115  0.840   -0.231  1.00 0.00 ? 232 LYS A O    6  
ATOM 9555  C CB   . LYS A 1 54  ? 10.776  0.882   -3.248  1.00 0.00 ? 232 LYS A CB   6  
ATOM 9556  C CG   . LYS A 1 54  ? 10.793  2.401   -3.260  1.00 0.00 ? 232 LYS A CG   6  
ATOM 9557  C CD   . LYS A 1 54  ? 10.426  2.974   -1.901  1.00 0.00 ? 232 LYS A CD   6  
ATOM 9558  C CE   . LYS A 1 54  ? 8.959   2.740   -1.576  1.00 0.00 ? 232 LYS A CE   6  
ATOM 9559  N NZ   . LYS A 1 54  ? 8.751   1.464   -0.837  1.00 0.00 ? 232 LYS A NZ   6  
ATOM 9560  H H    . LYS A 1 54  ? 11.670  -1.484  -3.712  1.00 0.00 ? 232 LYS A H    6  
ATOM 9561  H HA   . LYS A 1 54  ? 12.831  0.933   -2.652  1.00 0.00 ? 232 LYS A HA   6  
ATOM 9562  H HB2  . LYS A 1 54  ? 10.741  0.535   -4.270  1.00 0.00 ? 232 LYS A HB2  6  
ATOM 9563  H HB3  . LYS A 1 54  ? 9.881   0.557   -2.736  1.00 0.00 ? 232 LYS A HB3  6  
ATOM 9564  H HG2  . LYS A 1 54  ? 11.784  2.738   -3.525  1.00 0.00 ? 232 LYS A HG2  6  
ATOM 9565  H HG3  . LYS A 1 54  ? 10.082  2.754   -3.993  1.00 0.00 ? 232 LYS A HG3  6  
ATOM 9566  H HD2  . LYS A 1 54  ? 11.031  2.497   -1.144  1.00 0.00 ? 232 LYS A HD2  6  
ATOM 9567  H HD3  . LYS A 1 54  ? 10.621  4.037   -1.904  1.00 0.00 ? 232 LYS A HD3  6  
ATOM 9568  H HE2  . LYS A 1 54  ? 8.603   3.559   -0.969  1.00 0.00 ? 232 LYS A HE2  6  
ATOM 9569  H HE3  . LYS A 1 54  ? 8.400   2.707   -2.499  1.00 0.00 ? 232 LYS A HE3  6  
ATOM 9570  H HZ1  . LYS A 1 54  ? 9.608   0.878   -0.889  1.00 0.00 ? 232 LYS A HZ1  6  
ATOM 9571  H HZ2  . LYS A 1 54  ? 7.957   0.936   -1.253  1.00 0.00 ? 232 LYS A HZ2  6  
ATOM 9572  H HZ3  . LYS A 1 54  ? 8.537   1.660   0.162   1.00 0.00 ? 232 LYS A HZ3  6  
ATOM 9573  N N    . ALA A 1 55  ? 10.972  -1.022  -0.768  1.00 0.00 ? 233 ALA A N    6  
ATOM 9574  C CA   . ALA A 1 55  ? 10.623  -1.338  0.611   1.00 0.00 ? 233 ALA A CA   6  
ATOM 9575  C C    . ALA A 1 55  ? 11.873  -1.527  1.464   1.00 0.00 ? 233 ALA A C    6  
ATOM 9576  O O    . ALA A 1 55  ? 11.885  -1.187  2.647   1.00 0.00 ? 233 ALA A O    6  
ATOM 9577  C CB   . ALA A 1 55  ? 9.753   -2.585  0.663   1.00 0.00 ? 233 ALA A CB   6  
ATOM 9578  H H    . ALA A 1 55  ? 10.666  -1.614  -1.486  1.00 0.00 ? 233 ALA A H    6  
ATOM 9579  H HA   . ALA A 1 55  ? 10.050  -0.512  1.008   1.00 0.00 ? 233 ALA A HA   6  
ATOM 9580  H HB1  . ALA A 1 55  ? 8.751   -2.312  0.958   1.00 0.00 ? 233 ALA A HB1  6  
ATOM 9581  H HB2  . ALA A 1 55  ? 9.729   -3.047  -0.312  1.00 0.00 ? 233 ALA A HB2  6  
ATOM 9582  H HB3  . ALA A 1 55  ? 10.163  -3.280  1.381   1.00 0.00 ? 233 ALA A HB3  6  
ATOM 9583  N N    . GLN A 1 56  ? 12.923  -2.070  0.856   1.00 0.00 ? 234 GLN A N    6  
ATOM 9584  C CA   . GLN A 1 56  ? 14.177  -2.305  1.561   1.00 0.00 ? 234 GLN A CA   6  
ATOM 9585  C C    . GLN A 1 56  ? 14.735  -1.003  2.127   1.00 0.00 ? 234 GLN A C    6  
ATOM 9586  O O    . GLN A 1 56  ? 15.351  -0.993  3.192   1.00 0.00 ? 234 GLN A O    6  
ATOM 9587  C CB   . GLN A 1 56  ? 15.201  -2.947  0.624   1.00 0.00 ? 234 GLN A CB   6  
ATOM 9588  C CG   . GLN A 1 56  ? 16.524  -3.273  1.299   1.00 0.00 ? 234 GLN A CG   6  
ATOM 9589  C CD   . GLN A 1 56  ? 17.686  -3.294  0.326   1.00 0.00 ? 234 GLN A CD   6  
ATOM 9590  O OE1  . GLN A 1 56  ? 17.842  -2.386  -0.492  1.00 0.00 ? 234 GLN A OE1  6  
ATOM 9591  N NE2  . GLN A 1 56  ? 18.510  -4.332  0.409   1.00 0.00 ? 234 GLN A NE2  6  
ATOM 9592  H H    . GLN A 1 56  ? 12.851  -2.319  -0.089  1.00 0.00 ? 234 GLN A H    6  
ATOM 9593  H HA   . GLN A 1 56  ? 13.976  -2.981  2.378   1.00 0.00 ? 234 GLN A HA   6  
ATOM 9594  H HB2  . GLN A 1 56  ? 14.787  -3.864  0.231   1.00 0.00 ? 234 GLN A HB2  6  
ATOM 9595  H HB3  . GLN A 1 56  ? 15.397  -2.270  -0.195  1.00 0.00 ? 234 GLN A HB3  6  
ATOM 9596  H HG2  . GLN A 1 56  ? 16.721  -2.527  2.054   1.00 0.00 ? 234 GLN A HG2  6  
ATOM 9597  H HG3  . GLN A 1 56  ? 16.445  -4.244  1.765   1.00 0.00 ? 234 GLN A HG3  6  
ATOM 9598  H HE21 . GLN A 1 56  ? 18.322  -5.018  1.084   1.00 0.00 ? 234 GLN A HE21 6  
ATOM 9599  H HE22 . GLN A 1 56  ? 19.269  -4.371  -0.208  1.00 0.00 ? 234 GLN A HE22 6  
ATOM 9600  N N    . GLU A 1 57  ? 14.515  0.092   1.407   1.00 0.00 ? 235 GLU A N    6  
ATOM 9601  C CA   . GLU A 1 57  ? 14.997  1.399   1.839   1.00 0.00 ? 235 GLU A CA   6  
ATOM 9602  C C    . GLU A 1 57  ? 14.251  1.871   3.083   1.00 0.00 ? 235 GLU A C    6  
ATOM 9603  O O    . GLU A 1 57  ? 14.855  2.385   4.025   1.00 0.00 ? 235 GLU A O    6  
ATOM 9604  C CB   . GLU A 1 57  ? 14.835  2.424   0.714   1.00 0.00 ? 235 GLU A CB   6  
ATOM 9605  C CG   . GLU A 1 57  ? 15.685  3.670   0.899   1.00 0.00 ? 235 GLU A CG   6  
ATOM 9606  C CD   . GLU A 1 57  ? 15.170  4.851   0.100   1.00 0.00 ? 235 GLU A CD   6  
ATOM 9607  O OE1  . GLU A 1 57  ? 13.964  5.160   0.208   1.00 0.00 ? 235 GLU A OE1  6  
ATOM 9608  O OE2  . GLU A 1 57  ? 15.971  5.467   -0.634  1.00 0.00 ? 235 GLU A OE2  6  
ATOM 9609  H H    . GLU A 1 57  ? 14.017  0.020   0.566   1.00 0.00 ? 235 GLU A H    6  
ATOM 9610  H HA   . GLU A 1 57  ? 16.045  1.303   2.077   1.00 0.00 ? 235 GLU A HA   6  
ATOM 9611  H HB2  . GLU A 1 57  ? 15.110  1.961   -0.222  1.00 0.00 ? 235 GLU A HB2  6  
ATOM 9612  H HB3  . GLU A 1 57  ? 13.799  2.725   0.665   1.00 0.00 ? 235 GLU A HB3  6  
ATOM 9613  H HG2  . GLU A 1 57  ? 15.687  3.937   1.945   1.00 0.00 ? 235 GLU A HG2  6  
ATOM 9614  H HG3  . GLU A 1 57  ? 16.694  3.452   0.582   1.00 0.00 ? 235 GLU A HG3  6  
ATOM 9615  N N    . TYR A 1 58  ? 12.935  1.692   3.080   1.00 0.00 ? 236 TYR A N    6  
ATOM 9616  C CA   . TYR A 1 58  ? 12.105  2.102   4.206   1.00 0.00 ? 236 TYR A CA   6  
ATOM 9617  C C    . TYR A 1 58  ? 12.302  1.168   5.396   1.00 0.00 ? 236 TYR A C    6  
ATOM 9618  O O    . TYR A 1 58  ? 12.315  1.606   6.547   1.00 0.00 ? 236 TYR A O    6  
ATOM 9619  C CB   . TYR A 1 58  ? 10.630  2.123   3.800   1.00 0.00 ? 236 TYR A CB   6  
ATOM 9620  C CG   . TYR A 1 58  ? 9.679   1.941   4.961   1.00 0.00 ? 236 TYR A CG   6  
ATOM 9621  C CD1  . TYR A 1 58  ? 9.391   0.675   5.456   1.00 0.00 ? 236 TYR A CD1  6  
ATOM 9622  C CD2  . TYR A 1 58  ? 9.068   3.034   5.562   1.00 0.00 ? 236 TYR A CD2  6  
ATOM 9623  C CE1  . TYR A 1 58  ? 8.522   0.503   6.516   1.00 0.00 ? 236 TYR A CE1  6  
ATOM 9624  C CE2  . TYR A 1 58  ? 8.199   2.872   6.624   1.00 0.00 ? 236 TYR A CE2  6  
ATOM 9625  C CZ   . TYR A 1 58  ? 7.929   1.605   7.097   1.00 0.00 ? 236 TYR A CZ   6  
ATOM 9626  O OH   . TYR A 1 58  ? 7.063   1.439   8.153   1.00 0.00 ? 236 TYR A OH   6  
ATOM 9627  H H    . TYR A 1 58  ? 12.510  1.277   2.300   1.00 0.00 ? 236 TYR A H    6  
ATOM 9628  H HA   . TYR A 1 58  ? 12.403  3.100   4.493   1.00 0.00 ? 236 TYR A HA   6  
ATOM 9629  H HB2  . TYR A 1 58  ? 10.406  3.070   3.333   1.00 0.00 ? 236 TYR A HB2  6  
ATOM 9630  H HB3  . TYR A 1 58  ? 10.448  1.327   3.093   1.00 0.00 ? 236 TYR A HB3  6  
ATOM 9631  H HD1  . TYR A 1 58  ? 9.857   -0.186  4.999   1.00 0.00 ? 236 TYR A HD1  6  
ATOM 9632  H HD2  . TYR A 1 58  ? 9.281   4.025   5.188   1.00 0.00 ? 236 TYR A HD2  6  
ATOM 9633  H HE1  . TYR A 1 58  ? 8.311   -0.489  6.888   1.00 0.00 ? 236 TYR A HE1  6  
ATOM 9634  H HE2  . TYR A 1 58  ? 7.734   3.734   7.078   1.00 0.00 ? 236 TYR A HE2  6  
ATOM 9635  H HH   . TYR A 1 58  ? 7.353   0.699   8.692   1.00 0.00 ? 236 TYR A HH   6  
ATOM 9636  N N    . ILE A 1 59  ? 12.457  -0.120  5.110   1.00 0.00 ? 237 ILE A N    6  
ATOM 9637  C CA   . ILE A 1 59  ? 12.656  -1.116  6.155   1.00 0.00 ? 237 ILE A CA   6  
ATOM 9638  C C    . ILE A 1 59  ? 14.012  -0.941  6.831   1.00 0.00 ? 237 ILE A C    6  
ATOM 9639  O O    . ILE A 1 59  ? 14.123  -1.025  8.054   1.00 0.00 ? 237 ILE A O    6  
ATOM 9640  C CB   . ILE A 1 59  ? 12.555  -2.547  5.596   1.00 0.00 ? 237 ILE A CB   6  
ATOM 9641  C CG1  . ILE A 1 59  ? 11.184  -2.772  4.954   1.00 0.00 ? 237 ILE A CG1  6  
ATOM 9642  C CG2  . ILE A 1 59  ? 12.804  -3.566  6.698   1.00 0.00 ? 237 ILE A CG2  6  
ATOM 9643  C CD1  . ILE A 1 59  ? 11.181  -3.858  3.901   1.00 0.00 ? 237 ILE A CD1  6  
ATOM 9644  H H    . ILE A 1 59  ? 12.438  -0.407  4.173   1.00 0.00 ? 237 ILE A H    6  
ATOM 9645  H HA   . ILE A 1 59  ? 11.878  -0.984  6.894   1.00 0.00 ? 237 ILE A HA   6  
ATOM 9646  H HB   . ILE A 1 59  ? 13.321  -2.671  4.845   1.00 0.00 ? 237 ILE A HB   6  
ATOM 9647  H HG12 . ILE A 1 59  ? 10.477  -3.051  5.719   1.00 0.00 ? 237 ILE A HG12 6  
ATOM 9648  H HG13 . ILE A 1 59  ? 10.859  -1.854  4.487   1.00 0.00 ? 237 ILE A HG13 6  
ATOM 9649  H HG21 . ILE A 1 59  ? 11.875  -3.778  7.208   1.00 0.00 ? 237 ILE A HG21 6  
ATOM 9650  H HG22 . ILE A 1 59  ? 13.192  -4.476  6.266   1.00 0.00 ? 237 ILE A HG22 6  
ATOM 9651  H HG23 . ILE A 1 59  ? 13.518  -3.167  7.403   1.00 0.00 ? 237 ILE A HG23 6  
ATOM 9652  H HD11 . ILE A 1 59  ? 11.882  -4.631  4.178   1.00 0.00 ? 237 ILE A HD11 6  
ATOM 9653  H HD12 . ILE A 1 59  ? 10.191  -4.279  3.821   1.00 0.00 ? 237 ILE A HD12 6  
ATOM 9654  H HD13 . ILE A 1 59  ? 11.470  -3.436  2.949   1.00 0.00 ? 237 ILE A HD13 6  
ATOM 9655  N N    . ARG A 1 60  ? 15.040  -0.694  6.026   1.00 0.00 ? 238 ARG A N    6  
ATOM 9656  C CA   . ARG A 1 60  ? 16.389  -0.505  6.546   1.00 0.00 ? 238 ARG A CA   6  
ATOM 9657  C C    . ARG A 1 60  ? 16.491  0.798   7.333   1.00 0.00 ? 238 ARG A C    6  
ATOM 9658  O O    . ARG A 1 60  ? 17.201  0.874   8.336   1.00 0.00 ? 238 ARG A O    6  
ATOM 9659  C CB   . ARG A 1 60  ? 17.404  -0.503  5.401   1.00 0.00 ? 238 ARG A CB   6  
ATOM 9660  C CG   . ARG A 1 60  ? 17.413  0.787   4.598   1.00 0.00 ? 238 ARG A CG   6  
ATOM 9661  C CD   . ARG A 1 60  ? 18.664  0.901   3.741   1.00 0.00 ? 238 ARG A CD   6  
ATOM 9662  N NE   . ARG A 1 60  ? 18.621  2.066   2.862   1.00 0.00 ? 238 ARG A NE   6  
ATOM 9663  C CZ   . ARG A 1 60  ? 19.569  2.355   1.977   1.00 0.00 ? 238 ARG A CZ   6  
ATOM 9664  N NH1  . ARG A 1 60  ? 20.628  1.566   1.854   1.00 0.00 ? 238 ARG A NH1  6  
ATOM 9665  N NH2  . ARG A 1 60  ? 19.458  3.433   1.212   1.00 0.00 ? 238 ARG A NH2  6  
ATOM 9666  H H    . ARG A 1 60  ? 14.889  -0.638  5.059   1.00 0.00 ? 238 ARG A H    6  
ATOM 9667  H HA   . ARG A 1 60  ? 16.608  -1.330  7.208   1.00 0.00 ? 238 ARG A HA   6  
ATOM 9668  H HB2  . ARG A 1 60  ? 18.392  -0.653  5.811   1.00 0.00 ? 238 ARG A HB2  6  
ATOM 9669  H HB3  . ARG A 1 60  ? 17.174  -1.317  4.731   1.00 0.00 ? 238 ARG A HB3  6  
ATOM 9670  H HG2  . ARG A 1 60  ? 16.546  0.806   3.955   1.00 0.00 ? 238 ARG A HG2  6  
ATOM 9671  H HG3  . ARG A 1 60  ? 17.377  1.624   5.279   1.00 0.00 ? 238 ARG A HG3  6  
ATOM 9672  H HD2  . ARG A 1 60  ? 19.523  0.983   4.390   1.00 0.00 ? 238 ARG A HD2  6  
ATOM 9673  H HD3  . ARG A 1 60  ? 18.752  0.009   3.138   1.00 0.00 ? 238 ARG A HD3  6  
ATOM 9674  H HE   . ARG A 1 60  ? 17.847  2.662   2.936   1.00 0.00 ? 238 ARG A HE   6  
ATOM 9675  H HH11 . ARG A 1 60  ? 20.713  0.752   2.428   1.00 0.00 ? 238 ARG A HH11 6  
ATOM 9676  H HH12 . ARG A 1 60  ? 21.339  1.785   1.186   1.00 0.00 ? 238 ARG A HH12 6  
ATOM 9677  H HH21 . ARG A 1 60  ? 18.661  4.030   1.302   1.00 0.00 ? 238 ARG A HH21 6  
ATOM 9678  H HH22 . ARG A 1 60  ? 20.172  3.650   0.547   1.00 0.00 ? 238 ARG A HH22 6  
ATOM 9679  N N    . GLN A 1 61  ? 15.778  1.820   6.872   1.00 0.00 ? 239 GLN A N    6  
ATOM 9680  C CA   . GLN A 1 61  ? 15.790  3.119   7.532   1.00 0.00 ? 239 GLN A CA   6  
ATOM 9681  C C    . GLN A 1 61  ? 14.899  3.109   8.770   1.00 0.00 ? 239 GLN A C    6  
ATOM 9682  O O    . GLN A 1 61  ? 15.245  3.684   9.802   1.00 0.00 ? 239 GLN A O    6  
ATOM 9683  C CB   . GLN A 1 61  ? 15.327  4.211   6.565   1.00 0.00 ? 239 GLN A CB   6  
ATOM 9684  C CG   . GLN A 1 61  ? 16.409  4.667   5.600   1.00 0.00 ? 239 GLN A CG   6  
ATOM 9685  C CD   . GLN A 1 61  ? 17.625  5.230   6.310   1.00 0.00 ? 239 GLN A CD   6  
ATOM 9686  O OE1  . GLN A 1 61  ? 18.541  4.493   6.676   1.00 0.00 ? 239 GLN A OE1  6  
ATOM 9687  N NE2  . GLN A 1 61  ? 17.640  6.543   6.510   1.00 0.00 ? 239 GLN A NE2  6  
ATOM 9688  H H    . GLN A 1 61  ? 15.231  1.697   6.068   1.00 0.00 ? 239 GLN A H    6  
ATOM 9689  H HA   . GLN A 1 61  ? 16.804  3.327   7.836   1.00 0.00 ? 239 GLN A HA   6  
ATOM 9690  H HB2  . GLN A 1 61  ? 14.495  3.835   5.989   1.00 0.00 ? 239 GLN A HB2  6  
ATOM 9691  H HB3  . GLN A 1 61  ? 15.001  5.067   7.137   1.00 0.00 ? 239 GLN A HB3  6  
ATOM 9692  H HG2  . GLN A 1 61  ? 16.720  3.824   5.002   1.00 0.00 ? 239 GLN A HG2  6  
ATOM 9693  H HG3  . GLN A 1 61  ? 16.000  5.432   4.957   1.00 0.00 ? 239 GLN A HG3  6  
ATOM 9694  H HE21 . GLN A 1 61  ? 16.874  7.067   6.192   1.00 0.00 ? 239 GLN A HE21 6  
ATOM 9695  H HE22 . GLN A 1 61  ? 18.413  6.933   6.967   1.00 0.00 ? 239 GLN A HE22 6  
ATOM 9696  N N    . LYS A 1 62  ? 13.749  2.452   8.660   1.00 0.00 ? 240 LYS A N    6  
ATOM 9697  C CA   . LYS A 1 62  ? 12.808  2.365   9.770   1.00 0.00 ? 240 LYS A CA   6  
ATOM 9698  C C    . LYS A 1 62  ? 12.965  1.042   10.514  1.00 0.00 ? 240 LYS A C    6  
ATOM 9699  O O    . LYS A 1 62  ? 13.518  0.999   11.612  1.00 0.00 ? 240 LYS A O    6  
ATOM 9700  C CB   . LYS A 1 62  ? 11.372  2.508   9.261   1.00 0.00 ? 240 LYS A CB   6  
ATOM 9701  C CG   . LYS A 1 62  ? 11.043  3.902   8.754   1.00 0.00 ? 240 LYS A CG   6  
ATOM 9702  C CD   . LYS A 1 62  ? 10.711  4.847   9.898   1.00 0.00 ? 240 LYS A CD   6  
ATOM 9703  C CE   . LYS A 1 62  ? 9.995   6.093   9.401   1.00 0.00 ? 240 LYS A CE   6  
ATOM 9704  N NZ   . LYS A 1 62  ? 10.939  7.068   8.788   1.00 0.00 ? 240 LYS A NZ   6  
ATOM 9705  H H    . LYS A 1 62  ? 13.529  2.013   7.811   1.00 0.00 ? 240 LYS A H    6  
ATOM 9706  H HA   . LYS A 1 62  ? 13.022  3.174   10.451  1.00 0.00 ? 240 LYS A HA   6  
ATOM 9707  H HB2  . LYS A 1 62  ? 11.218  1.809   8.452   1.00 0.00 ? 240 LYS A HB2  6  
ATOM 9708  H HB3  . LYS A 1 62  ? 10.692  2.271   10.066  1.00 0.00 ? 240 LYS A HB3  6  
ATOM 9709  H HG2  . LYS A 1 62  ? 11.895  4.291   8.217   1.00 0.00 ? 240 LYS A HG2  6  
ATOM 9710  H HG3  . LYS A 1 62  ? 10.193  3.843   8.090   1.00 0.00 ? 240 LYS A HG3  6  
ATOM 9711  H HD2  . LYS A 1 62  ? 10.072  4.335   10.602  1.00 0.00 ? 240 LYS A HD2  6  
ATOM 9712  H HD3  . LYS A 1 62  ? 11.628  5.140   10.388  1.00 0.00 ? 240 LYS A HD3  6  
ATOM 9713  H HE2  . LYS A 1 62  ? 9.263   5.802   8.663   1.00 0.00 ? 240 LYS A HE2  6  
ATOM 9714  H HE3  . LYS A 1 62  ? 9.497   6.563   10.236  1.00 0.00 ? 240 LYS A HE3  6  
ATOM 9715  H HZ1  . LYS A 1 62  ? 10.668  8.038   9.048   1.00 0.00 ? 240 LYS A HZ1  6  
ATOM 9716  H HZ2  . LYS A 1 62  ? 10.919  6.981   7.752   1.00 0.00 ? 240 LYS A HZ2  6  
ATOM 9717  H HZ3  . LYS A 1 62  ? 11.906  6.888   9.123   1.00 0.00 ? 240 LYS A HZ3  6  
ATOM 9718  N N    . ASN A 1 63  ? 12.474  -0.034  9.908   1.00 0.00 ? 241 ASN A N    6  
ATOM 9719  C CA   . ASN A 1 63  ? 12.561  -1.358  10.513  1.00 0.00 ? 241 ASN A CA   6  
ATOM 9720  C C    . ASN A 1 63  ? 13.997  -1.679  10.916  1.00 0.00 ? 241 ASN A C    6  
ATOM 9721  O O    . ASN A 1 63  ? 14.244  -2.598  11.698  1.00 0.00 ? 241 ASN A O    6  
ATOM 9722  C CB   . ASN A 1 63  ? 12.043  -2.421  9.542   1.00 0.00 ? 241 ASN A CB   6  
ATOM 9723  C CG   . ASN A 1 63  ? 10.550  -2.649  9.679   1.00 0.00 ? 241 ASN A CG   6  
ATOM 9724  O OD1  . ASN A 1 63  ? 9.747   -1.994  9.014   1.00 0.00 ? 241 ASN A OD1  6  
ATOM 9725  N ND2  . ASN A 1 63  ? 10.171  -3.583  10.544  1.00 0.00 ? 241 ASN A ND2  6  
ATOM 9726  H H    . ASN A 1 63  ? 12.044  0.064   9.033   1.00 0.00 ? 241 ASN A H    6  
ATOM 9727  H HA   . ASN A 1 63  ? 11.942  -1.359  11.398  1.00 0.00 ? 241 ASN A HA   6  
ATOM 9728  H HB2  . ASN A 1 63  ? 12.248  -2.105  8.530   1.00 0.00 ? 241 ASN A HB2  6  
ATOM 9729  H HB3  . ASN A 1 63  ? 12.551  -3.354  9.734   1.00 0.00 ? 241 ASN A HB3  6  
ATOM 9730  H HD21 . ASN A 1 63  ? 10.866  -4.065  11.039  1.00 0.00 ? 241 ASN A HD21 6  
ATOM 9731  H HD22 . ASN A 1 63  ? 9.212   -3.752  10.652  1.00 0.00 ? 241 ASN A HD22 6  
ATOM 9732  N N    . LYS A 1 64  ? 14.942  -0.915  10.379  1.00 0.00 ? 242 LYS A N    6  
ATOM 9733  C CA   . LYS A 1 64  ? 16.354  -1.115  10.682  1.00 0.00 ? 242 LYS A CA   6  
ATOM 9734  C C    . LYS A 1 64  ? 16.802  -2.518  10.286  1.00 0.00 ? 242 LYS A C    6  
ATOM 9735  O O    . LYS A 1 64  ? 17.620  -3.134  10.968  1.00 0.00 ? 242 LYS A O    6  
ATOM 9736  C CB   . LYS A 1 64  ? 16.613  -0.887  12.173  1.00 0.00 ? 242 LYS A CB   6  
ATOM 9737  C CG   . LYS A 1 64  ? 16.929  0.557   12.522  1.00 0.00 ? 242 LYS A CG   6  
ATOM 9738  C CD   . LYS A 1 64  ? 17.601  0.669   13.880  1.00 0.00 ? 242 LYS A CD   6  
ATOM 9739  C CE   . LYS A 1 64  ? 18.277  2.020   14.058  1.00 0.00 ? 242 LYS A CE   6  
ATOM 9740  N NZ   . LYS A 1 64  ? 17.293  3.097   14.360  1.00 0.00 ? 242 LYS A NZ   6  
ATOM 9741  H H    . LYS A 1 64  ? 14.682  -0.197  9.762   1.00 0.00 ? 242 LYS A H    6  
ATOM 9742  H HA   . LYS A 1 64  ? 16.921  -0.395  10.113  1.00 0.00 ? 242 LYS A HA   6  
ATOM 9743  H HB2  . LYS A 1 64  ? 15.736  -1.186  12.729  1.00 0.00 ? 242 LYS A HB2  6  
ATOM 9744  H HB3  . LYS A 1 64  ? 17.449  -1.500  12.479  1.00 0.00 ? 242 LYS A HB3  6  
ATOM 9745  H HG2  . LYS A 1 64  ? 17.590  0.963   11.770  1.00 0.00 ? 242 LYS A HG2  6  
ATOM 9746  H HG3  . LYS A 1 64  ? 16.009  1.124   12.538  1.00 0.00 ? 242 LYS A HG3  6  
ATOM 9747  H HD2  . LYS A 1 64  ? 16.856  0.548   14.652  1.00 0.00 ? 242 LYS A HD2  6  
ATOM 9748  H HD3  . LYS A 1 64  ? 18.345  -0.110  13.969  1.00 0.00 ? 242 LYS A HD3  6  
ATOM 9749  H HE2  . LYS A 1 64  ? 18.982  1.951   14.871  1.00 0.00 ? 242 LYS A HE2  6  
ATOM 9750  H HE3  . LYS A 1 64  ? 18.801  2.269   13.147  1.00 0.00 ? 242 LYS A HE3  6  
ATOM 9751  H HZ1  . LYS A 1 64  ? 16.512  2.716   14.931  1.00 0.00 ? 242 LYS A HZ1  6  
ATOM 9752  H HZ2  . LYS A 1 64  ? 16.904  3.484   13.477  1.00 0.00 ? 242 LYS A HZ2  6  
ATOM 9753  H HZ3  . LYS A 1 64  ? 17.754  3.864   14.889  1.00 0.00 ? 242 LYS A HZ3  6  
ATOM 9754  N N    . GLY A 1 65  ? 16.261  -3.017  9.179   1.00 0.00 ? 243 GLY A N    6  
ATOM 9755  C CA   . GLY A 1 65  ? 16.618  -4.344  8.712   1.00 0.00 ? 243 GLY A CA   6  
ATOM 9756  C C    . GLY A 1 65  ? 15.774  -5.430  9.348   1.00 0.00 ? 243 GLY A C    6  
ATOM 9757  O O    . GLY A 1 65  ? 16.299  -6.444  9.807   1.00 0.00 ? 243 GLY A O    6  
ATOM 9758  H H    . GLY A 1 65  ? 15.613  -2.480  8.676   1.00 0.00 ? 243 GLY A H    6  
ATOM 9759  H HA2  . GLY A 1 65  ? 16.489  -4.383  7.640   1.00 0.00 ? 243 GLY A HA2  6  
ATOM 9760  H HA3  . GLY A 1 65  ? 17.657  -4.527  8.946   1.00 0.00 ? 243 GLY A HA3  6  
ATOM 9761  N N    . ALA A 1 66  ? 14.462  -5.218  9.376   1.00 0.00 ? 244 ALA A N    6  
ATOM 9762  C CA   . ALA A 1 66  ? 13.544  -6.187  9.961   1.00 0.00 ? 244 ALA A CA   6  
ATOM 9763  C C    . ALA A 1 66  ? 12.312  -6.375  9.082   1.00 0.00 ? 244 ALA A C    6  
ATOM 9764  O O    . ALA A 1 66  ? 11.544  -5.437  8.863   1.00 0.00 ? 244 ALA A O    6  
ATOM 9765  C CB   . ALA A 1 66  ? 13.136  -5.750  11.360  1.00 0.00 ? 244 ALA A CB   6  
ATOM 9766  H H    . ALA A 1 66  ? 14.104  -4.390  8.994   1.00 0.00 ? 244 ALA A H    6  
ATOM 9767  H HA   . ALA A 1 66  ? 14.063  -7.131  10.042  1.00 0.00 ? 244 ALA A HA   6  
ATOM 9768  H HB1  . ALA A 1 66  ? 12.649  -4.787  11.307  1.00 0.00 ? 244 ALA A HB1  6  
ATOM 9769  H HB2  . ALA A 1 66  ? 12.454  -6.476  11.779  1.00 0.00 ? 244 ALA A HB2  6  
ATOM 9770  H HB3  . ALA A 1 66  ? 14.013  -5.677  11.984  1.00 0.00 ? 244 ALA A HB3  6  
ATOM 9771  N N    . LYS A 1 67  ? 12.129  -7.591  8.581   1.00 0.00 ? 245 LYS A N    6  
ATOM 9772  C CA   . LYS A 1 67  ? 10.989  -7.903  7.726   1.00 0.00 ? 245 LYS A CA   6  
ATOM 9773  C C    . LYS A 1 67  ? 9.687   -7.420  8.357   1.00 0.00 ? 245 LYS A C    6  
ATOM 9774  O O    . LYS A 1 67  ? 9.457   -7.609  9.552   1.00 0.00 ? 245 LYS A O    6  
ATOM 9775  C CB   . LYS A 1 67  ? 10.915  -9.410  7.469   1.00 0.00 ? 245 LYS A CB   6  
ATOM 9776  C CG   . LYS A 1 67  ? 11.954  -9.910  6.480   1.00 0.00 ? 245 LYS A CG   6  
ATOM 9777  C CD   . LYS A 1 67  ? 11.484  -9.741  5.045   1.00 0.00 ? 245 LYS A CD   6  
ATOM 9778  C CE   . LYS A 1 67  ? 12.539  -10.209 4.054   1.00 0.00 ? 245 LYS A CE   6  
ATOM 9779  N NZ   . LYS A 1 67  ? 12.032  -10.189 2.654   1.00 0.00 ? 245 LYS A NZ   6  
ATOM 9780  H H    . LYS A 1 67  ? 12.775  -8.298  8.792   1.00 0.00 ? 245 LYS A H    6  
ATOM 9781  H HA   . LYS A 1 67  ? 11.131  -7.393  6.785   1.00 0.00 ? 245 LYS A HA   6  
ATOM 9782  H HB2  . LYS A 1 67  ? 11.060  -9.930  8.405   1.00 0.00 ? 245 LYS A HB2  6  
ATOM 9783  H HB3  . LYS A 1 67  ? 9.935   -9.650  7.082   1.00 0.00 ? 245 LYS A HB3  6  
ATOM 9784  H HG2  . LYS A 1 67  ? 12.867  -9.351  6.617   1.00 0.00 ? 245 LYS A HG2  6  
ATOM 9785  H HG3  . LYS A 1 67  ? 12.140  -10.958 6.667   1.00 0.00 ? 245 LYS A HG3  6  
ATOM 9786  H HD2  . LYS A 1 67  ? 10.586  -10.323 4.898   1.00 0.00 ? 245 LYS A HD2  6  
ATOM 9787  H HD3  . LYS A 1 67  ? 11.272  -8.697  4.866   1.00 0.00 ? 245 LYS A HD3  6  
ATOM 9788  H HE2  . LYS A 1 67  ? 13.396  -9.558  4.127   1.00 0.00 ? 245 LYS A HE2  6  
ATOM 9789  H HE3  . LYS A 1 67  ? 12.830  -11.218 4.308   1.00 0.00 ? 245 LYS A HE3  6  
ATOM 9790  H HZ1  . LYS A 1 67  ? 12.388  -9.346  2.158   1.00 0.00 ? 245 LYS A HZ1  6  
ATOM 9791  H HZ2  . LYS A 1 67  ? 10.993  -10.167 2.650   1.00 0.00 ? 245 LYS A HZ2  6  
ATOM 9792  H HZ3  . LYS A 1 67  ? 12.352  -11.038 2.146   1.00 0.00 ? 245 LYS A HZ3  6  
ATOM 9793  N N    . LEU A 1 68  ? 8.839   -6.796  7.547   1.00 0.00 ? 246 LEU A N    6  
ATOM 9794  C CA   . LEU A 1 68  ? 7.558   -6.287  8.026   1.00 0.00 ? 246 LEU A CA   6  
ATOM 9795  C C    . LEU A 1 68  ? 6.672   -7.424  8.525   1.00 0.00 ? 246 LEU A C    6  
ATOM 9796  O O    . LEU A 1 68  ? 7.058   -8.592  8.478   1.00 0.00 ? 246 LEU A O    6  
ATOM 9797  C CB   . LEU A 1 68  ? 6.843   -5.520  6.912   1.00 0.00 ? 246 LEU A CB   6  
ATOM 9798  C CG   . LEU A 1 68  ? 7.624   -4.365  6.284   1.00 0.00 ? 246 LEU A CG   6  
ATOM 9799  C CD1  . LEU A 1 68  ? 6.982   -3.935  4.975   1.00 0.00 ? 246 LEU A CD1  6  
ATOM 9800  C CD2  . LEU A 1 68  ? 7.709   -3.192  7.249   1.00 0.00 ? 246 LEU A CD2  6  
ATOM 9801  H H    . LEU A 1 68  ? 9.078   -6.675  6.605   1.00 0.00 ? 246 LEU A H    6  
ATOM 9802  H HA   . LEU A 1 68  ? 7.756   -5.614  8.846   1.00 0.00 ? 246 LEU A HA   6  
ATOM 9803  H HB2  . LEU A 1 68  ? 6.605   -6.222  6.128   1.00 0.00 ? 246 LEU A HB2  6  
ATOM 9804  H HB3  . LEU A 1 68  ? 5.929   -5.118  7.323   1.00 0.00 ? 246 LEU A HB3  6  
ATOM 9805  H HG   . LEU A 1 68  ? 8.631   -4.695  6.068   1.00 0.00 ? 246 LEU A HG   6  
ATOM 9806  H HD11 . LEU A 1 68  ? 7.652   -4.151  4.157   1.00 0.00 ? 246 LEU A HD11 6  
ATOM 9807  H HD12 . LEU A 1 68  ? 6.779   -2.875  5.004   1.00 0.00 ? 246 LEU A HD12 6  
ATOM 9808  H HD13 . LEU A 1 68  ? 6.056   -4.474  4.834   1.00 0.00 ? 246 LEU A HD13 6  
ATOM 9809  H HD21 . LEU A 1 68  ? 7.006   -2.428  6.949   1.00 0.00 ? 246 LEU A HD21 6  
ATOM 9810  H HD22 . LEU A 1 68  ? 8.710   -2.785  7.235   1.00 0.00 ? 246 LEU A HD22 6  
ATOM 9811  H HD23 . LEU A 1 68  ? 7.470   -3.529  8.247   1.00 0.00 ? 246 LEU A HD23 6  
ATOM 9812  N N    . LYS A 1 69  ? 5.482   -7.074  9.002   1.00 0.00 ? 247 LYS A N    6  
ATOM 9813  C CA   . LYS A 1 69  ? 4.539   -8.065  9.507   1.00 0.00 ? 247 LYS A CA   6  
ATOM 9814  C C    . LYS A 1 69  ? 3.152   -7.848  8.911   1.00 0.00 ? 247 LYS A C    6  
ATOM 9815  O O    . LYS A 1 69  ? 2.899   -6.839  8.252   1.00 0.00 ? 247 LYS A O    6  
ATOM 9816  C CB   . LYS A 1 69  ? 4.466   -7.997  11.034  1.00 0.00 ? 247 LYS A CB   6  
ATOM 9817  C CG   . LYS A 1 69  ? 5.778   -8.333  11.721  1.00 0.00 ? 247 LYS A CG   6  
ATOM 9818  C CD   . LYS A 1 69  ? 5.612   -8.417  13.229  1.00 0.00 ? 247 LYS A CD   6  
ATOM 9819  C CE   . LYS A 1 69  ? 5.769   -7.053  13.884  1.00 0.00 ? 247 LYS A CE   6  
ATOM 9820  N NZ   . LYS A 1 69  ? 5.723   -7.142  15.369  1.00 0.00 ? 247 LYS A NZ   6  
ATOM 9821  H H    . LYS A 1 69  ? 5.232   -6.126  9.013   1.00 0.00 ? 247 LYS A H    6  
ATOM 9822  H HA   . LYS A 1 69  ? 4.895   -9.041  9.215   1.00 0.00 ? 247 LYS A HA   6  
ATOM 9823  H HB2  . LYS A 1 69  ? 4.177   -6.998  11.325  1.00 0.00 ? 247 LYS A HB2  6  
ATOM 9824  H HB3  . LYS A 1 69  ? 3.715   -8.694  11.378  1.00 0.00 ? 247 LYS A HB3  6  
ATOM 9825  H HG2  . LYS A 1 69  ? 6.132   -9.286  11.356  1.00 0.00 ? 247 LYS A HG2  6  
ATOM 9826  H HG3  . LYS A 1 69  ? 6.502   -7.565  11.490  1.00 0.00 ? 247 LYS A HG3  6  
ATOM 9827  H HD2  . LYS A 1 69  ? 4.628   -8.800  13.454  1.00 0.00 ? 247 LYS A HD2  6  
ATOM 9828  H HD3  . LYS A 1 69  ? 6.362   -9.086  13.628  1.00 0.00 ? 247 LYS A HD3  6  
ATOM 9829  H HE2  . LYS A 1 69  ? 6.716   -6.631  13.586  1.00 0.00 ? 247 LYS A HE2  6  
ATOM 9830  H HE3  . LYS A 1 69  ? 4.968   -6.412  13.545  1.00 0.00 ? 247 LYS A HE3  6  
ATOM 9831  H HZ1  . LYS A 1 69  ? 4.833   -7.586  15.673  1.00 0.00 ? 247 LYS A HZ1  6  
ATOM 9832  H HZ2  . LYS A 1 69  ? 5.783   -6.191  15.786  1.00 0.00 ? 247 LYS A HZ2  6  
ATOM 9833  H HZ3  . LYS A 1 69  ? 6.520   -7.712  15.718  1.00 0.00 ? 247 LYS A HZ3  6  
ATOM 9834  N N    . VAL A 1 70  ? 2.255   -8.800  9.148   1.00 0.00 ? 248 VAL A N    6  
ATOM 9835  C CA   . VAL A 1 70  ? 0.893   -8.712  8.637   1.00 0.00 ? 248 VAL A CA   6  
ATOM 9836  C C    . VAL A 1 70  ? -0.010  -7.956  9.606   1.00 0.00 ? 248 VAL A C    6  
ATOM 9837  O O    . VAL A 1 70  ? -0.061  -8.268  10.795  1.00 0.00 ? 248 VAL A O    6  
ATOM 9838  C CB   . VAL A 1 70  ? 0.297   -10.110 8.382   1.00 0.00 ? 248 VAL A CB   6  
ATOM 9839  C CG1  . VAL A 1 70  ? -1.218  -10.032 8.269   1.00 0.00 ? 248 VAL A CG1  6  
ATOM 9840  C CG2  . VAL A 1 70  ? 0.903   -10.726 7.130   1.00 0.00 ? 248 VAL A CG2  6  
ATOM 9841  H H    . VAL A 1 70  ? 2.517   -9.581  9.680   1.00 0.00 ? 248 VAL A H    6  
ATOM 9842  H HA   . VAL A 1 70  ? 0.922   -8.180  7.697   1.00 0.00 ? 248 VAL A HA   6  
ATOM 9843  H HB   . VAL A 1 70  ? 0.541   -10.742 9.223   1.00 0.00 ? 248 VAL A HB   6  
ATOM 9844  H HG11 . VAL A 1 70  ? -1.506  -9.033  7.978   1.00 0.00 ? 248 VAL A HG11 6  
ATOM 9845  H HG12 . VAL A 1 70  ? -1.560  -10.737 7.525   1.00 0.00 ? 248 VAL A HG12 6  
ATOM 9846  H HG13 . VAL A 1 70  ? -1.662  -10.271 9.224   1.00 0.00 ? 248 VAL A HG13 6  
ATOM 9847  H HG21 . VAL A 1 70  ? 1.429   -9.965  6.574   1.00 0.00 ? 248 VAL A HG21 6  
ATOM 9848  H HG22 . VAL A 1 70  ? 1.594   -11.508 7.411   1.00 0.00 ? 248 VAL A HG22 6  
ATOM 9849  H HG23 . VAL A 1 70  ? 0.118   -11.143 6.517   1.00 0.00 ? 248 VAL A HG23 6  
ATOM 9850  N N    . GLY A 1 71  ? -0.721  -6.960  9.088   1.00 0.00 ? 249 GLY A N    6  
ATOM 9851  C CA   . GLY A 1 71  ? -1.613  -6.174  9.921   1.00 0.00 ? 249 GLY A CA   6  
ATOM 9852  C C    . GLY A 1 71  ? -1.039  -4.814  10.264  1.00 0.00 ? 249 GLY A C    6  
ATOM 9853  O O    . GLY A 1 71  ? -1.777  -3.889  10.602  1.00 0.00 ? 249 GLY A O    6  
ATOM 9854  H H    . GLY A 1 71  ? -0.640  -6.756  8.133   1.00 0.00 ? 249 GLY A H    6  
ATOM 9855  H HA2  . GLY A 1 71  ? -2.548  -6.037  9.399   1.00 0.00 ? 249 GLY A HA2  6  
ATOM 9856  H HA3  . GLY A 1 71  ? -1.800  -6.715  10.837  1.00 0.00 ? 249 GLY A HA3  6  
ATOM 9857  N N    . GLN A 1 72  ? 0.282   -4.693  10.179  1.00 0.00 ? 250 GLN A N    6  
ATOM 9858  C CA   . GLN A 1 72  ? 0.955   -3.436  10.486  1.00 0.00 ? 250 GLN A CA   6  
ATOM 9859  C C    . GLN A 1 72  ? 0.550   -2.347  9.499   1.00 0.00 ? 250 GLN A C    6  
ATOM 9860  O O    . GLN A 1 72  ? 0.272   -2.625  8.332   1.00 0.00 ? 250 GLN A O    6  
ATOM 9861  C CB   . GLN A 1 72  ? 2.472   -3.626  10.460  1.00 0.00 ? 250 GLN A CB   6  
ATOM 9862  C CG   . GLN A 1 72  ? 3.054   -3.686  9.057   1.00 0.00 ? 250 GLN A CG   6  
ATOM 9863  C CD   . GLN A 1 72  ? 4.547   -3.422  9.032   1.00 0.00 ? 250 GLN A CD   6  
ATOM 9864  O OE1  . GLN A 1 72  ? 5.034   -2.625  8.230   1.00 0.00 ? 250 GLN A OE1  6  
ATOM 9865  N NE2  . GLN A 1 72  ? 5.281   -4.090  9.913   1.00 0.00 ? 250 GLN A NE2  6  
ATOM 9866  H H    . GLN A 1 72  ? 0.816   -5.466  9.904   1.00 0.00 ? 250 GLN A H    6  
ATOM 9867  H HA   . GLN A 1 72  ? 0.656   -3.134  11.478  1.00 0.00 ? 250 GLN A HA   6  
ATOM 9868  H HB2  . GLN A 1 72  ? 2.935   -2.803  10.984  1.00 0.00 ? 250 GLN A HB2  6  
ATOM 9869  H HB3  . GLN A 1 72  ? 2.716   -4.548  10.967  1.00 0.00 ? 250 GLN A HB3  6  
ATOM 9870  H HG2  . GLN A 1 72  ? 2.872   -4.669  8.647   1.00 0.00 ? 250 GLN A HG2  6  
ATOM 9871  H HG3  . GLN A 1 72  ? 2.561   -2.945  8.445   1.00 0.00 ? 250 GLN A HG3  6  
ATOM 9872  H HE21 . GLN A 1 72  ? 4.824   -4.710  10.521  1.00 0.00 ? 250 GLN A HE21 6  
ATOM 9873  H HE22 . GLN A 1 72  ? 6.249   -3.939  9.919   1.00 0.00 ? 250 GLN A HE22 6  
ATOM 9874  N N    . TYR A 1 73  ? 0.517   -1.107  9.974   1.00 0.00 ? 251 TYR A N    6  
ATOM 9875  C CA   . TYR A 1 73  ? 0.143   0.024   9.133   1.00 0.00 ? 251 TYR A CA   6  
ATOM 9876  C C    . TYR A 1 73  ? 1.323   0.484   8.282   1.00 0.00 ? 251 TYR A C    6  
ATOM 9877  O O    . TYR A 1 73  ? 2.410   0.749   8.796   1.00 0.00 ? 251 TYR A O    6  
ATOM 9878  C CB   . TYR A 1 73  ? -0.359  1.183   9.996   1.00 0.00 ? 251 TYR A CB   6  
ATOM 9879  C CG   . TYR A 1 73  ? -1.850  1.150   10.247  1.00 0.00 ? 251 TYR A CG   6  
ATOM 9880  C CD1  . TYR A 1 73  ? -2.735  1.777   9.379   1.00 0.00 ? 251 TYR A CD1  6  
ATOM 9881  C CD2  . TYR A 1 73  ? -2.373  0.489   11.352  1.00 0.00 ? 251 TYR A CD2  6  
ATOM 9882  C CE1  . TYR A 1 73  ? -4.097  1.749   9.605   1.00 0.00 ? 251 TYR A CE1  6  
ATOM 9883  C CE2  . TYR A 1 73  ? -3.734  0.455   11.585  1.00 0.00 ? 251 TYR A CE2  6  
ATOM 9884  C CZ   . TYR A 1 73  ? -4.592  1.087   10.709  1.00 0.00 ? 251 TYR A CZ   6  
ATOM 9885  O OH   . TYR A 1 73  ? -5.949  1.055   10.937  1.00 0.00 ? 251 TYR A OH   6  
ATOM 9886  H H    . TYR A 1 73  ? 0.749   -0.948  10.913  1.00 0.00 ? 251 TYR A H    6  
ATOM 9887  H HA   . TYR A 1 73  ? -0.654  -0.297  8.480   1.00 0.00 ? 251 TYR A HA   6  
ATOM 9888  H HB2  . TYR A 1 73  ? 0.139   1.153   10.953  1.00 0.00 ? 251 TYR A HB2  6  
ATOM 9889  H HB3  . TYR A 1 73  ? -0.126  2.117   9.504   1.00 0.00 ? 251 TYR A HB3  6  
ATOM 9890  H HD1  . TYR A 1 73  ? -2.344  2.295   8.515   1.00 0.00 ? 251 TYR A HD1  6  
ATOM 9891  H HD2  . TYR A 1 73  ? -1.698  -0.005  12.036  1.00 0.00 ? 251 TYR A HD2  6  
ATOM 9892  H HE1  . TYR A 1 73  ? -4.769  2.243   8.919   1.00 0.00 ? 251 TYR A HE1  6  
ATOM 9893  H HE2  . TYR A 1 73  ? -4.122  -0.064  12.449  1.00 0.00 ? 251 TYR A HE2  6  
ATOM 9894  H HH   . TYR A 1 73  ? -6.339  0.330   10.444  1.00 0.00 ? 251 TYR A HH   6  
ATOM 9895  N N    . LEU A 1 74  ? 1.100   0.576   6.975   1.00 0.00 ? 252 LEU A N    6  
ATOM 9896  C CA   . LEU A 1 74  ? 2.143   1.004   6.050   1.00 0.00 ? 252 LEU A CA   6  
ATOM 9897  C C    . LEU A 1 74  ? 1.668   2.177   5.199   1.00 0.00 ? 252 LEU A C    6  
ATOM 9898  O O    . LEU A 1 74  ? 0.551   2.171   4.683   1.00 0.00 ? 252 LEU A O    6  
ATOM 9899  C CB   . LEU A 1 74  ? 2.561   -0.159  5.148   1.00 0.00 ? 252 LEU A CB   6  
ATOM 9900  C CG   . LEU A 1 74  ? 3.924   -0.025  4.467   1.00 0.00 ? 252 LEU A CG   6  
ATOM 9901  C CD1  . LEU A 1 74  ? 5.025   0.127   5.505   1.00 0.00 ? 252 LEU A CD1  6  
ATOM 9902  C CD2  . LEU A 1 74  ? 4.193   -1.225  3.572   1.00 0.00 ? 252 LEU A CD2  6  
ATOM 9903  H H    . LEU A 1 74  ? 0.214   0.352   6.624   1.00 0.00 ? 252 LEU A H    6  
ATOM 9904  H HA   . LEU A 1 74  ? 2.995   1.320   6.633   1.00 0.00 ? 252 LEU A HA   6  
ATOM 9905  H HB2  . LEU A 1 74  ? 2.578   -1.054  5.750   1.00 0.00 ? 252 LEU A HB2  6  
ATOM 9906  H HB3  . LEU A 1 74  ? 1.812   -0.262  4.375   1.00 0.00 ? 252 LEU A HB3  6  
ATOM 9907  H HG   . LEU A 1 74  ? 3.924   0.862   3.849   1.00 0.00 ? 252 LEU A HG   6  
ATOM 9908  H HD11 . LEU A 1 74  ? 5.987   0.042   5.023   1.00 0.00 ? 252 LEU A HD11 6  
ATOM 9909  H HD12 . LEU A 1 74  ? 4.927   -0.649  6.250   1.00 0.00 ? 252 LEU A HD12 6  
ATOM 9910  H HD13 . LEU A 1 74  ? 4.943   1.094   5.979   1.00 0.00 ? 252 LEU A HD13 6  
ATOM 9911  H HD21 . LEU A 1 74  ? 5.080   -1.738  3.915   1.00 0.00 ? 252 LEU A HD21 6  
ATOM 9912  H HD22 . LEU A 1 74  ? 4.342   -0.890  2.556   1.00 0.00 ? 252 LEU A HD22 6  
ATOM 9913  H HD23 . LEU A 1 74  ? 3.350   -1.899  3.610   1.00 0.00 ? 252 LEU A HD23 6  
ATOM 9914  N N    . ASN A 1 75  ? 2.525   3.183   5.054   1.00 0.00 ? 253 ASN A N    6  
ATOM 9915  C CA   . ASN A 1 75  ? 2.194   4.363   4.264   1.00 0.00 ? 253 ASN A CA   6  
ATOM 9916  C C    . ASN A 1 75  ? 2.682   4.209   2.826   1.00 0.00 ? 253 ASN A C    6  
ATOM 9917  O O    . ASN A 1 75  ? 3.862   3.952   2.585   1.00 0.00 ? 253 ASN A O    6  
ATOM 9918  C CB   . ASN A 1 75  ? 2.810   5.613   4.893   1.00 0.00 ? 253 ASN A CB   6  
ATOM 9919  C CG   . ASN A 1 75  ? 4.151   5.332   5.543   1.00 0.00 ? 253 ASN A CG   6  
ATOM 9920  O OD1  . ASN A 1 75  ? 4.240   4.568   6.505   1.00 0.00 ? 253 ASN A OD1  6  
ATOM 9921  N ND2  . ASN A 1 75  ? 5.203   5.951   5.020   1.00 0.00 ? 253 ASN A ND2  6  
ATOM 9922  H H    . ASN A 1 75  ? 3.402   3.130   5.489   1.00 0.00 ? 253 ASN A H    6  
ATOM 9923  H HA   . ASN A 1 75  ? 1.119   4.466   4.257   1.00 0.00 ? 253 ASN A HA   6  
ATOM 9924  H HB2  . ASN A 1 75  ? 2.954   6.361   4.127   1.00 0.00 ? 253 ASN A HB2  6  
ATOM 9925  H HB3  . ASN A 1 75  ? 2.139   5.999   5.646   1.00 0.00 ? 253 ASN A HB3  6  
ATOM 9926  H HD21 . ASN A 1 75  ? 5.058   6.546   4.255   1.00 0.00 ? 253 ASN A HD21 6  
ATOM 9927  H HD22 . ASN A 1 75  ? 6.083   5.787   5.421   1.00 0.00 ? 253 ASN A HD22 6  
ATOM 9928  N N    . CYS A 1 76  ? 1.768   4.370   1.877   1.00 0.00 ? 254 CYS A N    6  
ATOM 9929  C CA   . CYS A 1 76  ? 2.104   4.249   0.463   1.00 0.00 ? 254 CYS A CA   6  
ATOM 9930  C C    . CYS A 1 76  ? 1.377   5.306   -0.362  1.00 0.00 ? 254 CYS A C    6  
ATOM 9931  O O    . CYS A 1 76  ? 0.349   5.837   0.060   1.00 0.00 ? 254 CYS A O    6  
ATOM 9932  C CB   . CYS A 1 76  ? 1.751   2.852   -0.050  1.00 0.00 ? 254 CYS A CB   6  
ATOM 9933  S SG   . CYS A 1 76  ? 2.289   1.510   1.035   1.00 0.00 ? 254 CYS A SG   6  
ATOM 9934  H H    . CYS A 1 76  ? 0.843   4.573   2.132   1.00 0.00 ? 254 CYS A H    6  
ATOM 9935  H HA   . CYS A 1 76  ? 3.168   4.402   0.362   1.00 0.00 ? 254 CYS A HA   6  
ATOM 9936  H HB2  . CYS A 1 76  ? 0.679   2.777   -0.157  1.00 0.00 ? 254 CYS A HB2  6  
ATOM 9937  H HB3  . CYS A 1 76  ? 2.214   2.703   -1.014  1.00 0.00 ? 254 CYS A HB3  6  
ATOM 9938  H HG   . CYS A 1 76  ? 2.310   0.393   0.323   1.00 0.00 ? 254 CYS A HG   6  
ATOM 9939  N N    . ILE A 1 77  ? 1.917   5.608   -1.537  1.00 0.00 ? 255 ILE A N    6  
ATOM 9940  C CA   . ILE A 1 77  ? 1.319   6.602   -2.420  1.00 0.00 ? 255 ILE A CA   6  
ATOM 9941  C C    . ILE A 1 77  ? 1.319   6.122   -3.868  1.00 0.00 ? 255 ILE A C    6  
ATOM 9942  O O    . ILE A 1 77  ? 2.279   5.504   -4.329  1.00 0.00 ? 255 ILE A O    6  
ATOM 9943  C CB   . ILE A 1 77  ? 2.063   7.948   -2.337  1.00 0.00 ? 255 ILE A CB   6  
ATOM 9944  C CG1  . ILE A 1 77  ? 2.066   8.466   -0.898  1.00 0.00 ? 255 ILE A CG1  6  
ATOM 9945  C CG2  . ILE A 1 77  ? 1.422   8.965   -3.271  1.00 0.00 ? 255 ILE A CG2  6  
ATOM 9946  C CD1  . ILE A 1 77  ? 2.998   9.637   -0.679  1.00 0.00 ? 255 ILE A CD1  6  
ATOM 9947  H H    . ILE A 1 77  ? 2.737   5.150   -1.818  1.00 0.00 ? 255 ILE A H    6  
ATOM 9948  H HA   . ILE A 1 77  ? 0.298   6.757   -2.103  1.00 0.00 ? 255 ILE A HA   6  
ATOM 9949  H HB   . ILE A 1 77  ? 3.081   7.792   -2.659  1.00 0.00 ? 255 ILE A HB   6  
ATOM 9950  H HG12 . ILE A 1 77  ? 1.069   8.782   -0.633  1.00 0.00 ? 255 ILE A HG12 6  
ATOM 9951  H HG13 . ILE A 1 77  ? 2.373   7.668   -0.237  1.00 0.00 ? 255 ILE A HG13 6  
ATOM 9952  H HG21 . ILE A 1 77  ? 0.523   8.546   -3.696  1.00 0.00 ? 255 ILE A HG21 6  
ATOM 9953  H HG22 . ILE A 1 77  ? 1.175   9.857   -2.715  1.00 0.00 ? 255 ILE A HG22 6  
ATOM 9954  H HG23 . ILE A 1 77  ? 2.113   9.213   -4.062  1.00 0.00 ? 255 ILE A HG23 6  
ATOM 9955  H HD11 . ILE A 1 77  ? 2.950   10.300  -1.530  1.00 0.00 ? 255 ILE A HD11 6  
ATOM 9956  H HD12 . ILE A 1 77  ? 2.704   10.170  0.212   1.00 0.00 ? 255 ILE A HD12 6  
ATOM 9957  H HD13 . ILE A 1 77  ? 4.010   9.274   -0.563  1.00 0.00 ? 255 ILE A HD13 6  
ATOM 9958  N N    . VAL A 1 78  ? 0.236   6.412   -4.581  1.00 0.00 ? 256 VAL A N    6  
ATOM 9959  C CA   . VAL A 1 78  ? 0.111   6.013   -5.978  1.00 0.00 ? 256 VAL A CA   6  
ATOM 9960  C C    . VAL A 1 78  ? 1.207   6.644   -6.830  1.00 0.00 ? 256 VAL A C    6  
ATOM 9961  O O    . VAL A 1 78  ? 1.307   7.866   -6.924  1.00 0.00 ? 256 VAL A O    6  
ATOM 9962  C CB   . VAL A 1 78  ? -1.262  6.408   -6.554  1.00 0.00 ? 256 VAL A CB   6  
ATOM 9963  C CG1  . VAL A 1 78  ? -1.422  5.871   -7.968  1.00 0.00 ? 256 VAL A CG1  6  
ATOM 9964  C CG2  . VAL A 1 78  ? -2.381  5.906   -5.654  1.00 0.00 ? 256 VAL A CG2  6  
ATOM 9965  H H    . VAL A 1 78  ? -0.497  6.907   -4.158  1.00 0.00 ? 256 VAL A H    6  
ATOM 9966  H HA   . VAL A 1 78  ? 0.203   4.938   -6.028  1.00 0.00 ? 256 VAL A HA   6  
ATOM 9967  H HB   . VAL A 1 78  ? -1.317  7.486   -6.594  1.00 0.00 ? 256 VAL A HB   6  
ATOM 9968  H HG11 . VAL A 1 78  ? -2.346  5.316   -8.040  1.00 0.00 ? 256 VAL A HG11 6  
ATOM 9969  H HG12 . VAL A 1 78  ? -1.441  6.695   -8.667  1.00 0.00 ? 256 VAL A HG12 6  
ATOM 9970  H HG13 . VAL A 1 78  ? -0.593  5.219   -8.202  1.00 0.00 ? 256 VAL A HG13 6  
ATOM 9971  H HG21 . VAL A 1 78  ? -3.128  6.678   -5.545  1.00 0.00 ? 256 VAL A HG21 6  
ATOM 9972  H HG22 . VAL A 1 78  ? -2.832  5.028   -6.095  1.00 0.00 ? 256 VAL A HG22 6  
ATOM 9973  H HG23 . VAL A 1 78  ? -1.978  5.654   -4.685  1.00 0.00 ? 256 VAL A HG23 6  
ATOM 9974  N N    . GLU A 1 79  ? 2.028   5.800   -7.448  1.00 0.00 ? 257 GLU A N    6  
ATOM 9975  C CA   . GLU A 1 79  ? 3.118   6.276   -8.292  1.00 0.00 ? 257 GLU A CA   6  
ATOM 9976  C C    . GLU A 1 79  ? 2.734   6.206   -9.767  1.00 0.00 ? 257 GLU A C    6  
ATOM 9977  O O    . GLU A 1 79  ? 2.939   7.158   -10.520 1.00 0.00 ? 257 GLU A O    6  
ATOM 9978  C CB   . GLU A 1 79  ? 4.382   5.451   -8.043  1.00 0.00 ? 257 GLU A CB   6  
ATOM 9979  C CG   . GLU A 1 79  ? 5.144   5.865   -6.795  1.00 0.00 ? 257 GLU A CG   6  
ATOM 9980  C CD   . GLU A 1 79  ? 5.640   7.297   -6.864  1.00 0.00 ? 257 GLU A CD   6  
ATOM 9981  O OE1  . GLU A 1 79  ? 6.438   7.606   -7.773  1.00 0.00 ? 257 GLU A OE1  6  
ATOM 9982  O OE2  . GLU A 1 79  ? 5.229   8.108   -6.007  1.00 0.00 ? 257 GLU A OE2  6  
ATOM 9983  H H    . GLU A 1 79  ? 1.897   4.835   -7.333  1.00 0.00 ? 257 GLU A H    6  
ATOM 9984  H HA   . GLU A 1 79  ? 3.314   7.305   -8.031  1.00 0.00 ? 257 GLU A HA   6  
ATOM 9985  H HB2  . GLU A 1 79  ? 4.106   4.411   -7.943  1.00 0.00 ? 257 GLU A HB2  6  
ATOM 9986  H HB3  . GLU A 1 79  ? 5.040   5.558   -8.893  1.00 0.00 ? 257 GLU A HB3  6  
ATOM 9987  H HG2  . GLU A 1 79  ? 4.491   5.767   -5.941  1.00 0.00 ? 257 GLU A HG2  6  
ATOM 9988  H HG3  . GLU A 1 79  ? 5.994   5.211   -6.674  1.00 0.00 ? 257 GLU A HG3  6  
ATOM 9989  N N    . LYS A 1 80  ? 2.175   5.071   -10.174 1.00 0.00 ? 258 LYS A N    6  
ATOM 9990  C CA   . LYS A 1 80  ? 1.761   4.875   -11.558 1.00 0.00 ? 258 LYS A CA   6  
ATOM 9991  C C    . LYS A 1 80  ? 0.431   4.131   -11.628 1.00 0.00 ? 258 LYS A C    6  
ATOM 9992  O O    . LYS A 1 80  ? 0.090   3.363   -10.728 1.00 0.00 ? 258 LYS A O    6  
ATOM 9993  C CB   . LYS A 1 80  ? 2.832   4.099   -12.327 1.00 0.00 ? 258 LYS A CB   6  
ATOM 9994  C CG   . LYS A 1 80  ? 3.932   4.980   -12.894 1.00 0.00 ? 258 LYS A CG   6  
ATOM 9995  C CD   . LYS A 1 80  ? 3.489   5.673   -14.171 1.00 0.00 ? 258 LYS A CD   6  
ATOM 9996  C CE   . LYS A 1 80  ? 3.811   4.836   -15.400 1.00 0.00 ? 258 LYS A CE   6  
ATOM 9997  N NZ   . LYS A 1 80  ? 3.860   5.663   -16.637 1.00 0.00 ? 258 LYS A NZ   6  
ATOM 9998  H H    . LYS A 1 80  ? 2.037   4.347   -9.526  1.00 0.00 ? 258 LYS A H    6  
ATOM 9999  H HA   . LYS A 1 80  ? 1.639   5.848   -12.009 1.00 0.00 ? 258 LYS A HA   6  
ATOM 10000 H HB2  . LYS A 1 80  ? 3.284   3.377   -11.663 1.00 0.00 ? 258 LYS A HB2  6  
ATOM 10001 H HB3  . LYS A 1 80  ? 2.362   3.575   -13.147 1.00 0.00 ? 258 LYS A HB3  6  
ATOM 10002 H HG2  . LYS A 1 80  ? 4.193   5.730   -12.162 1.00 0.00 ? 258 LYS A HG2  6  
ATOM 10003 H HG3  . LYS A 1 80  ? 4.797   4.368   -13.108 1.00 0.00 ? 258 LYS A HG3  6  
ATOM 10004 H HD2  . LYS A 1 80  ? 2.423   5.837   -14.131 1.00 0.00 ? 258 LYS A HD2  6  
ATOM 10005 H HD3  . LYS A 1 80  ? 3.999   6.623   -14.250 1.00 0.00 ? 258 LYS A HD3  6  
ATOM 10006 H HE2  . LYS A 1 80  ? 4.770   4.363   -15.256 1.00 0.00 ? 258 LYS A HE2  6  
ATOM 10007 H HE3  . LYS A 1 80  ? 3.049   4.079   -15.513 1.00 0.00 ? 258 LYS A HE3  6  
ATOM 10008 H HZ1  . LYS A 1 80  ? 3.000   6.244   -16.712 1.00 0.00 ? 258 LYS A HZ1  6  
ATOM 10009 H HZ2  . LYS A 1 80  ? 3.923   5.049   -17.475 1.00 0.00 ? 258 LYS A HZ2  6  
ATOM 10010 H HZ3  . LYS A 1 80  ? 4.689   6.290   -16.616 1.00 0.00 ? 258 LYS A HZ3  6  
ATOM 10011 N N    . VAL A 1 81  ? -0.316  4.363   -12.702 1.00 0.00 ? 259 VAL A N    6  
ATOM 10012 C CA   . VAL A 1 81  ? -1.607  3.713   -12.891 1.00 0.00 ? 259 VAL A CA   6  
ATOM 10013 C C    . VAL A 1 81  ? -1.655  2.959   -14.215 1.00 0.00 ? 259 VAL A C    6  
ATOM 10014 O O    . VAL A 1 81  ? -1.367  3.520   -15.273 1.00 0.00 ? 259 VAL A O    6  
ATOM 10015 C CB   . VAL A 1 81  ? -2.761  4.733   -12.851 1.00 0.00 ? 259 VAL A CB   6  
ATOM 10016 C CG1  . VAL A 1 81  ? -4.096  4.038   -13.065 1.00 0.00 ? 259 VAL A CG1  6  
ATOM 10017 C CG2  . VAL A 1 81  ? -2.752  5.496   -11.535 1.00 0.00 ? 259 VAL A CG2  6  
ATOM 10018 H H    . VAL A 1 81  ? 0.009   4.986   -13.385 1.00 0.00 ? 259 VAL A H    6  
ATOM 10019 H HA   . VAL A 1 81  ? -1.748  3.010   -12.082 1.00 0.00 ? 259 VAL A HA   6  
ATOM 10020 H HB   . VAL A 1 81  ? -2.616  5.441   -13.654 1.00 0.00 ? 259 VAL A HB   6  
ATOM 10021 H HG11 . VAL A 1 81  ? -4.795  4.730   -13.511 1.00 0.00 ? 259 VAL A HG11 6  
ATOM 10022 H HG12 . VAL A 1 81  ? -3.961  3.189   -13.719 1.00 0.00 ? 259 VAL A HG12 6  
ATOM 10023 H HG13 . VAL A 1 81  ? -4.483  3.701   -12.114 1.00 0.00 ? 259 VAL A HG13 6  
ATOM 10024 H HG21 . VAL A 1 81  ? -2.581  6.544   -11.729 1.00 0.00 ? 259 VAL A HG21 6  
ATOM 10025 H HG22 . VAL A 1 81  ? -3.704  5.372   -11.040 1.00 0.00 ? 259 VAL A HG22 6  
ATOM 10026 H HG23 . VAL A 1 81  ? -1.965  5.113   -10.902 1.00 0.00 ? 259 VAL A HG23 6  
ATOM 10027 N N    . LYS A 1 82  ? -2.022  1.683   -14.151 1.00 0.00 ? 260 LYS A N    6  
ATOM 10028 C CA   . LYS A 1 82  ? -2.110  0.851   -15.345 1.00 0.00 ? 260 LYS A CA   6  
ATOM 10029 C C    . LYS A 1 82  ? -3.547  0.772   -15.848 1.00 0.00 ? 260 LYS A C    6  
ATOM 10030 O O    . LYS A 1 82  ? -4.482  1.168   -15.152 1.00 0.00 ? 260 LYS A O    6  
ATOM 10031 C CB   . LYS A 1 82  ? -1.583  -0.556  -15.051 1.00 0.00 ? 260 LYS A CB   6  
ATOM 10032 C CG   . LYS A 1 82  ? -0.097  -0.717  -15.320 1.00 0.00 ? 260 LYS A CG   6  
ATOM 10033 C CD   . LYS A 1 82  ? 0.741   0.000   -14.275 1.00 0.00 ? 260 LYS A CD   6  
ATOM 10034 C CE   . LYS A 1 82  ? 1.051   1.429   -14.695 1.00 0.00 ? 260 LYS A CE   6  
ATOM 10035 N NZ   . LYS A 1 82  ? 2.197   1.492   -15.643 1.00 0.00 ? 260 LYS A NZ   6  
ATOM 10036 H H    . LYS A 1 82  ? -2.239  1.292   -13.278 1.00 0.00 ? 260 LYS A H    6  
ATOM 10037 H HA   . LYS A 1 82  ? -1.497  1.303   -16.110 1.00 0.00 ? 260 LYS A HA   6  
ATOM 10038 H HB2  . LYS A 1 82  ? -1.766  -0.786  -14.011 1.00 0.00 ? 260 LYS A HB2  6  
ATOM 10039 H HB3  . LYS A 1 82  ? -2.119  -1.263  -15.667 1.00 0.00 ? 260 LYS A HB3  6  
ATOM 10040 H HG2  . LYS A 1 82  ? 0.150   -1.769  -15.305 1.00 0.00 ? 260 LYS A HG2  6  
ATOM 10041 H HG3  . LYS A 1 82  ? 0.129   -0.307  -16.294 1.00 0.00 ? 260 LYS A HG3  6  
ATOM 10042 H HD2  . LYS A 1 82  ? 0.197   0.021   -13.343 1.00 0.00 ? 260 LYS A HD2  6  
ATOM 10043 H HD3  . LYS A 1 82  ? 1.669   -0.536  -14.141 1.00 0.00 ? 260 LYS A HD3  6  
ATOM 10044 H HE2  . LYS A 1 82  ? 0.178   1.848   -15.170 1.00 0.00 ? 260 LYS A HE2  6  
ATOM 10045 H HE3  . LYS A 1 82  ? 1.291   2.004   -13.813 1.00 0.00 ? 260 LYS A HE3  6  
ATOM 10046 H HZ1  . LYS A 1 82  ? 2.258   2.440   -16.066 1.00 0.00 ? 260 LYS A HZ1  6  
ATOM 10047 H HZ2  . LYS A 1 82  ? 2.072   0.793   -16.402 1.00 0.00 ? 260 LYS A HZ2  6  
ATOM 10048 H HZ3  . LYS A 1 82  ? 3.086   1.290   -15.143 1.00 0.00 ? 260 LYS A HZ3  6  
ATOM 10049 N N    . GLY A 1 83  ? -3.718  0.257   -17.062 1.00 0.00 ? 261 GLY A N    6  
ATOM 10050 C CA   . GLY A 1 83  ? -5.044  0.134   -17.637 1.00 0.00 ? 261 GLY A CA   6  
ATOM 10051 C C    . GLY A 1 83  ? -5.709  -1.182  -17.286 1.00 0.00 ? 261 GLY A C    6  
ATOM 10052 O O    . GLY A 1 83  ? -5.075  -2.074  -16.724 1.00 0.00 ? 261 GLY A O    6  
ATOM 10053 H H    . GLY A 1 83  ? -2.935  -0.042  -17.571 1.00 0.00 ? 261 GLY A H    6  
ATOM 10054 H HA2  . GLY A 1 83  ? -5.659  0.944   -17.272 1.00 0.00 ? 261 GLY A HA2  6  
ATOM 10055 H HA3  . GLY A 1 83  ? -4.967  0.210   -18.711 1.00 0.00 ? 261 GLY A HA3  6  
ATOM 10056 N N    . ASN A 1 84  ? -6.991  -1.303  -17.616 1.00 0.00 ? 262 ASN A N    6  
ATOM 10057 C CA   . ASN A 1 84  ? -7.742  -2.520  -17.330 1.00 0.00 ? 262 ASN A CA   6  
ATOM 10058 C C    . ASN A 1 84  ? -7.476  -3.001  -15.907 1.00 0.00 ? 262 ASN A C    6  
ATOM 10059 O O    . ASN A 1 84  ? -7.334  -4.199  -15.662 1.00 0.00 ? 262 ASN A O    6  
ATOM 10060 C CB   . ASN A 1 84  ? -7.374  -3.618  -18.330 1.00 0.00 ? 262 ASN A CB   6  
ATOM 10061 C CG   . ASN A 1 84  ? -5.876  -3.740  -18.529 1.00 0.00 ? 262 ASN A CG   6  
ATOM 10062 O OD1  . ASN A 1 84  ? -5.276  -2.979  -19.288 1.00 0.00 ? 262 ASN A OD1  6  
ATOM 10063 N ND2  . ASN A 1 84  ? -5.265  -4.701  -17.847 1.00 0.00 ? 262 ASN A ND2  6  
ATOM 10064 H H    . ASN A 1 84  ? -7.442  -0.556  -18.063 1.00 0.00 ? 262 ASN A H    6  
ATOM 10065 H HA   . ASN A 1 84  ? -8.793  -2.291  -17.430 1.00 0.00 ? 262 ASN A HA   6  
ATOM 10066 H HB2  . ASN A 1 84  ? -7.748  -4.565  -17.968 1.00 0.00 ? 262 ASN A HB2  6  
ATOM 10067 H HB3  . ASN A 1 84  ? -7.830  -3.397  -19.283 1.00 0.00 ? 262 ASN A HB3  6  
ATOM 10068 H HD21 . ASN A 1 84  ? -5.807  -5.270  -17.261 1.00 0.00 ? 262 ASN A HD21 6  
ATOM 10069 H HD22 . ASN A 1 84  ? -4.296  -4.802  -17.956 1.00 0.00 ? 262 ASN A HD22 6  
ATOM 10070 N N    . GLY A 1 85  ? -7.411  -2.059  -14.971 1.00 0.00 ? 263 GLY A N    6  
ATOM 10071 C CA   . GLY A 1 85  ? -7.163  -2.407  -13.584 1.00 0.00 ? 263 GLY A CA   6  
ATOM 10072 C C    . GLY A 1 85  ? -6.122  -3.498  -13.438 1.00 0.00 ? 263 GLY A C    6  
ATOM 10073 O O    . GLY A 1 85  ? -6.322  -4.462  -12.700 1.00 0.00 ? 263 GLY A O    6  
ATOM 10074 H H    . GLY A 1 85  ? -7.532  -1.120  -15.225 1.00 0.00 ? 263 GLY A H    6  
ATOM 10075 H HA2  . GLY A 1 85  ? -6.824  -1.526  -13.059 1.00 0.00 ? 263 GLY A HA2  6  
ATOM 10076 H HA3  . GLY A 1 85  ? -8.087  -2.745  -13.139 1.00 0.00 ? 263 GLY A HA3  6  
ATOM 10077 N N    . GLY A 1 86  ? -5.005  -3.348  -14.144 1.00 0.00 ? 264 GLY A N    6  
ATOM 10078 C CA   . GLY A 1 86  ? -3.946  -4.337  -14.077 1.00 0.00 ? 264 GLY A CA   6  
ATOM 10079 C C    . GLY A 1 86  ? -3.212  -4.311  -12.751 1.00 0.00 ? 264 GLY A C    6  
ATOM 10080 O O    . GLY A 1 86  ? -3.677  -4.883  -11.764 1.00 0.00 ? 264 GLY A O    6  
ATOM 10081 H H    . GLY A 1 86  ? -4.900  -2.559  -14.716 1.00 0.00 ? 264 GLY A H    6  
ATOM 10082 H HA2  . GLY A 1 86  ? -4.374  -5.318  -14.220 1.00 0.00 ? 264 GLY A HA2  6  
ATOM 10083 H HA3  . GLY A 1 86  ? -3.238  -4.145  -14.870 1.00 0.00 ? 264 GLY A HA3  6  
ATOM 10084 N N    . VAL A 1 87  ? -2.061  -3.648  -12.726 1.00 0.00 ? 265 VAL A N    6  
ATOM 10085 C CA   . VAL A 1 87  ? -1.260  -3.550  -11.511 1.00 0.00 ? 265 VAL A CA   6  
ATOM 10086 C C    . VAL A 1 87  ? -1.063  -2.096  -11.099 1.00 0.00 ? 265 VAL A C    6  
ATOM 10087 O O    . VAL A 1 87  ? -0.977  -1.205  -11.944 1.00 0.00 ? 265 VAL A O    6  
ATOM 10088 C CB   . VAL A 1 87  ? 0.118   -4.212  -11.693 1.00 0.00 ? 265 VAL A CB   6  
ATOM 10089 C CG1  . VAL A 1 87  ? 0.828   -4.343  -10.354 1.00 0.00 ? 265 VAL A CG1  6  
ATOM 10090 C CG2  . VAL A 1 87  ? -0.027  -5.570  -12.363 1.00 0.00 ? 265 VAL A CG2  6  
ATOM 10091 H H    . VAL A 1 87  ? -1.742  -3.213  -13.544 1.00 0.00 ? 265 VAL A H    6  
ATOM 10092 H HA   . VAL A 1 87  ? -1.785  -4.070  -10.723 1.00 0.00 ? 265 VAL A HA   6  
ATOM 10093 H HB   . VAL A 1 87  ? 0.717   -3.581  -12.332 1.00 0.00 ? 265 VAL A HB   6  
ATOM 10094 H HG11 . VAL A 1 87  ? 0.528   -5.264  -9.876  1.00 0.00 ? 265 VAL A HG11 6  
ATOM 10095 H HG12 . VAL A 1 87  ? 1.897   -4.350  -10.512 1.00 0.00 ? 265 VAL A HG12 6  
ATOM 10096 H HG13 . VAL A 1 87  ? 0.562   -3.508  -9.722  1.00 0.00 ? 265 VAL A HG13 6  
ATOM 10097 H HG21 . VAL A 1 87  ? 0.952   -5.989  -12.542 1.00 0.00 ? 265 VAL A HG21 6  
ATOM 10098 H HG22 . VAL A 1 87  ? -0.590  -6.231  -11.721 1.00 0.00 ? 265 VAL A HG22 6  
ATOM 10099 H HG23 . VAL A 1 87  ? -0.546  -5.454  -13.303 1.00 0.00 ? 265 VAL A HG23 6  
ATOM 10100 N N    . VAL A 1 88  ? -0.991  -1.861  -9.792  1.00 0.00 ? 266 VAL A N    6  
ATOM 10101 C CA   . VAL A 1 88  ? -0.802  -0.515  -9.266  1.00 0.00 ? 266 VAL A CA   6  
ATOM 10102 C C    . VAL A 1 88  ? 0.557   -0.374  -8.591  1.00 0.00 ? 266 VAL A C    6  
ATOM 10103 O O    . VAL A 1 88  ? 1.013   -1.281  -7.894  1.00 0.00 ? 266 VAL A O    6  
ATOM 10104 C CB   . VAL A 1 88  ? -1.905  -0.147  -8.256  1.00 0.00 ? 266 VAL A CB   6  
ATOM 10105 C CG1  . VAL A 1 88  ? -1.721  1.279   -7.760  1.00 0.00 ? 266 VAL A CG1  6  
ATOM 10106 C CG2  . VAL A 1 88  ? -3.281  -0.330  -8.880  1.00 0.00 ? 266 VAL A CG2  6  
ATOM 10107 H H    . VAL A 1 88  ? -1.066  -2.612  -9.167  1.00 0.00 ? 266 VAL A H    6  
ATOM 10108 H HA   . VAL A 1 88  ? -0.855  0.178   -10.094 1.00 0.00 ? 266 VAL A HA   6  
ATOM 10109 H HB   . VAL A 1 88  ? -1.826  -0.812  -7.409  1.00 0.00 ? 266 VAL A HB   6  
ATOM 10110 H HG11 . VAL A 1 88  ? -1.740  1.290   -6.680  1.00 0.00 ? 266 VAL A HG11 6  
ATOM 10111 H HG12 . VAL A 1 88  ? -0.773  1.663   -8.109  1.00 0.00 ? 266 VAL A HG12 6  
ATOM 10112 H HG13 . VAL A 1 88  ? -2.521  1.898   -8.140  1.00 0.00 ? 266 VAL A HG13 6  
ATOM 10113 H HG21 . VAL A 1 88  ? -3.706  -1.264  -8.545  1.00 0.00 ? 266 VAL A HG21 6  
ATOM 10114 H HG22 . VAL A 1 88  ? -3.924  0.486   -8.581  1.00 0.00 ? 266 VAL A HG22 6  
ATOM 10115 H HG23 . VAL A 1 88  ? -3.190  -0.340  -9.956  1.00 0.00 ? 266 VAL A HG23 6  
ATOM 10116 N N    . SER A 1 89  ? 1.201   0.769   -8.801  1.00 0.00 ? 267 SER A N    6  
ATOM 10117 C CA   . SER A 1 89  ? 2.511   1.028   -8.215  1.00 0.00 ? 267 SER A CA   6  
ATOM 10118 C C    . SER A 1 89  ? 2.384   1.882   -6.957  1.00 0.00 ? 267 SER A C    6  
ATOM 10119 O O    . SER A 1 89  ? 1.962   3.037   -7.016  1.00 0.00 ? 267 SER A O    6  
ATOM 10120 C CB   . SER A 1 89  ? 3.418   1.727   -9.230  1.00 0.00 ? 267 SER A CB   6  
ATOM 10121 O OG   . SER A 1 89  ? 4.120   0.783   -10.021 1.00 0.00 ? 267 SER A OG   6  
ATOM 10122 H H    . SER A 1 89  ? 0.786   1.454   -9.366  1.00 0.00 ? 267 SER A H    6  
ATOM 10123 H HA   . SER A 1 89  ? 2.949   0.077   -7.949  1.00 0.00 ? 267 SER A HA   6  
ATOM 10124 H HB2  . SER A 1 89  ? 2.818   2.347   -9.878  1.00 0.00 ? 267 SER A HB2  6  
ATOM 10125 H HB3  . SER A 1 89  ? 4.134   2.342   -8.705  1.00 0.00 ? 267 SER A HB3  6  
ATOM 10126 H HG   . SER A 1 89  ? 4.344   1.178   -10.867 1.00 0.00 ? 267 SER A HG   6  
ATOM 10127 N N    . LEU A 1 90  ? 2.754   1.304   -5.819  1.00 0.00 ? 268 LEU A N    6  
ATOM 10128 C CA   . LEU A 1 90  ? 2.682   2.011   -4.544  1.00 0.00 ? 268 LEU A CA   6  
ATOM 10129 C C    . LEU A 1 90  ? 4.077   2.259   -3.980  1.00 0.00 ? 268 LEU A C    6  
ATOM 10130 O O    . LEU A 1 90  ? 4.996   1.469   -4.199  1.00 0.00 ? 268 LEU A O    6  
ATOM 10131 C CB   . LEU A 1 90  ? 1.849   1.211   -3.542  1.00 0.00 ? 268 LEU A CB   6  
ATOM 10132 C CG   . LEU A 1 90  ? 0.349   1.509   -3.526  1.00 0.00 ? 268 LEU A CG   6  
ATOM 10133 C CD1  . LEU A 1 90  ? -0.356  0.643   -2.494  1.00 0.00 ? 268 LEU A CD1  6  
ATOM 10134 C CD2  . LEU A 1 90  ? 0.101   2.984   -3.247  1.00 0.00 ? 268 LEU A CD2  6  
ATOM 10135 H H    . LEU A 1 90  ? 3.082   0.382   -5.835  1.00 0.00 ? 268 LEU A H    6  
ATOM 10136 H HA   . LEU A 1 90  ? 2.203   2.963   -4.720  1.00 0.00 ? 268 LEU A HA   6  
ATOM 10137 H HB2  . LEU A 1 90  ? 1.976   0.163   -3.768  1.00 0.00 ? 268 LEU A HB2  6  
ATOM 10138 H HB3  . LEU A 1 90  ? 2.238   1.414   -2.554  1.00 0.00 ? 268 LEU A HB3  6  
ATOM 10139 H HG   . LEU A 1 90  ? -0.067  1.276   -4.497  1.00 0.00 ? 268 LEU A HG   6  
ATOM 10140 H HD11 . LEU A 1 90  ? -1.060  1.245   -1.940  1.00 0.00 ? 268 LEU A HD11 6  
ATOM 10141 H HD12 . LEU A 1 90  ? 0.373   0.225   -1.816  1.00 0.00 ? 268 LEU A HD12 6  
ATOM 10142 H HD13 . LEU A 1 90  ? -0.882  -0.157  -2.995  1.00 0.00 ? 268 LEU A HD13 6  
ATOM 10143 H HD21 . LEU A 1 90  ? 0.140   3.537   -4.174  1.00 0.00 ? 268 LEU A HD21 6  
ATOM 10144 H HD22 . LEU A 1 90  ? 0.860   3.355   -2.574  1.00 0.00 ? 268 LEU A HD22 6  
ATOM 10145 H HD23 . LEU A 1 90  ? -0.872  3.106   -2.796  1.00 0.00 ? 268 LEU A HD23 6  
ATOM 10146 N N    . SER A 1 91  ? 4.228   3.361   -3.252  1.00 0.00 ? 269 SER A N    6  
ATOM 10147 C CA   . SER A 1 91  ? 5.512   3.714   -2.657  1.00 0.00 ? 269 SER A CA   6  
ATOM 10148 C C    . SER A 1 91  ? 5.323   4.677   -1.489  1.00 0.00 ? 269 SER A C    6  
ATOM 10149 O O    . SER A 1 91  ? 4.471   5.564   -1.533  1.00 0.00 ? 269 SER A O    6  
ATOM 10150 C CB   . SER A 1 91  ? 6.429   4.343   -3.708  1.00 0.00 ? 269 SER A CB   6  
ATOM 10151 O OG   . SER A 1 91  ? 6.627   3.465   -4.803  1.00 0.00 ? 269 SER A OG   6  
ATOM 10152 H H    . SER A 1 91  ? 3.458   3.951   -3.114  1.00 0.00 ? 269 SER A H    6  
ATOM 10153 H HA   . SER A 1 91  ? 5.968   2.806   -2.290  1.00 0.00 ? 269 SER A HA   6  
ATOM 10154 H HB2  . SER A 1 91  ? 5.984   5.256   -4.071  1.00 0.00 ? 269 SER A HB2  6  
ATOM 10155 H HB3  . SER A 1 91  ? 7.388   4.562   -3.260  1.00 0.00 ? 269 SER A HB3  6  
ATOM 10156 H HG   . SER A 1 91  ? 7.489   3.629   -5.193  1.00 0.00 ? 269 SER A HG   6  
ATOM 10157 N N    . VAL A 1 92  ? 6.125   4.495   -0.445  1.00 0.00 ? 270 VAL A N    6  
ATOM 10158 C CA   . VAL A 1 92  ? 6.048   5.347   0.736   1.00 0.00 ? 270 VAL A CA   6  
ATOM 10159 C C    . VAL A 1 92  ? 6.665   6.715   0.467   1.00 0.00 ? 270 VAL A C    6  
ATOM 10160 O O    . VAL A 1 92  ? 7.666   6.829   -0.239  1.00 0.00 ? 270 VAL A O    6  
ATOM 10161 C CB   . VAL A 1 92  ? 6.760   4.703   1.940   1.00 0.00 ? 270 VAL A CB   6  
ATOM 10162 C CG1  . VAL A 1 92  ? 6.447   3.216   2.013   1.00 0.00 ? 270 VAL A CG1  6  
ATOM 10163 C CG2  . VAL A 1 92  ? 8.261   4.937   1.859   1.00 0.00 ? 270 VAL A CG2  6  
ATOM 10164 H H    . VAL A 1 92  ? 6.785   3.770   -0.469  1.00 0.00 ? 270 VAL A H    6  
ATOM 10165 H HA   . VAL A 1 92  ? 5.006   5.476   0.987   1.00 0.00 ? 270 VAL A HA   6  
ATOM 10166 H HB   . VAL A 1 92  ? 6.393   5.170   2.842   1.00 0.00 ? 270 VAL A HB   6  
ATOM 10167 H HG11 . VAL A 1 92  ? 6.102   2.970   3.007   1.00 0.00 ? 270 VAL A HG11 6  
ATOM 10168 H HG12 . VAL A 1 92  ? 5.679   2.974   1.294   1.00 0.00 ? 270 VAL A HG12 6  
ATOM 10169 H HG13 . VAL A 1 92  ? 7.340   2.650   1.792   1.00 0.00 ? 270 VAL A HG13 6  
ATOM 10170 H HG21 . VAL A 1 92  ? 8.471   5.984   2.018   1.00 0.00 ? 270 VAL A HG21 6  
ATOM 10171 H HG22 . VAL A 1 92  ? 8.759   4.351   2.618   1.00 0.00 ? 270 VAL A HG22 6  
ATOM 10172 H HG23 . VAL A 1 92  ? 8.620   4.642   0.884   1.00 0.00 ? 270 VAL A HG23 6  
ATOM 10173 N N    . GLY A 1 93  ? 6.059   7.754   1.035   1.00 0.00 ? 271 GLY A N    6  
ATOM 10174 C CA   . GLY A 1 93  ? 6.562   9.101   0.845   1.00 0.00 ? 271 GLY A CA   6  
ATOM 10175 C C    . GLY A 1 93  ? 6.744   9.842   2.155   1.00 0.00 ? 271 GLY A C    6  
ATOM 10176 O O    . GLY A 1 93  ? 7.759   9.679   2.833   1.00 0.00 ? 271 GLY A O    6  
ATOM 10177 H H    . GLY A 1 93  ? 5.263   7.603   1.588   1.00 0.00 ? 271 GLY A H    6  
ATOM 10178 H HA2  . GLY A 1 93  ? 7.514   9.050   0.337   1.00 0.00 ? 271 GLY A HA2  6  
ATOM 10179 H HA3  . GLY A 1 93  ? 5.865   9.650   0.229   1.00 0.00 ? 271 GLY A HA3  6  
ATOM 10180 N N    . HIS A 1 94  ? 5.759   10.660  2.513   1.00 0.00 ? 272 HIS A N    6  
ATOM 10181 C CA   . HIS A 1 94  ? 5.816   11.430  3.750   1.00 0.00 ? 272 HIS A CA   6  
ATOM 10182 C C    . HIS A 1 94  ? 5.141   10.675  4.891   1.00 0.00 ? 272 HIS A C    6  
ATOM 10183 O O    . HIS A 1 94  ? 4.111   10.030  4.698   1.00 0.00 ? 272 HIS A O    6  
ATOM 10184 C CB   . HIS A 1 94  ? 5.148   12.792  3.559   1.00 0.00 ? 272 HIS A CB   6  
ATOM 10185 C CG   . HIS A 1 94  ? 5.456   13.430  2.240   1.00 0.00 ? 272 HIS A CG   6  
ATOM 10186 N ND1  . HIS A 1 94  ? 4.584   13.411  1.173   1.00 0.00 ? 272 HIS A ND1  6  
ATOM 10187 C CD2  . HIS A 1 94  ? 6.548   14.111  1.819   1.00 0.00 ? 272 HIS A CD2  6  
ATOM 10188 C CE1  . HIS A 1 94  ? 5.126   14.050  0.152   1.00 0.00 ? 272 HIS A CE1  6  
ATOM 10189 N NE2  . HIS A 1 94  ? 6.318   14.485  0.518   1.00 0.00 ? 272 HIS A NE2  6  
ATOM 10190 H H    . HIS A 1 94  ? 4.976   10.747  1.931   1.00 0.00 ? 272 HIS A H    6  
ATOM 10191 H HA   . HIS A 1 94  ? 6.855   11.580  4.000   1.00 0.00 ? 272 HIS A HA   6  
ATOM 10192 H HB2  . HIS A 1 94  ? 4.077   12.673  3.628   1.00 0.00 ? 272 HIS A HB2  6  
ATOM 10193 H HB3  . HIS A 1 94  ? 5.481   13.462  4.339   1.00 0.00 ? 272 HIS A HB3  6  
ATOM 10194 H HD1  . HIS A 1 94  ? 3.699   12.989  1.164   1.00 0.00 ? 272 HIS A HD1  6  
ATOM 10195 H HD2  . HIS A 1 94  ? 7.436   14.321  2.399   1.00 0.00 ? 272 HIS A HD2  6  
ATOM 10196 H HE1  . HIS A 1 94  ? 4.673   14.194  -0.818  1.00 0.00 ? 272 HIS A HE1  6  
ATOM 10197 H HE2  . HIS A 1 94  ? 6.968   14.916  -0.074  1.00 0.00 ? 272 HIS A HE2  6  
ATOM 10198 N N    . SER A 1 95  ? 5.730   10.759  6.080   1.00 0.00 ? 273 SER A N    6  
ATOM 10199 C CA   . SER A 1 95  ? 5.188   10.079  7.251   1.00 0.00 ? 273 SER A CA   6  
ATOM 10200 C C    . SER A 1 95  ? 4.857   11.080  8.354   1.00 0.00 ? 273 SER A C    6  
ATOM 10201 O O    . SER A 1 95  ? 4.969   12.290  8.163   1.00 0.00 ? 273 SER A O    6  
ATOM 10202 C CB   . SER A 1 95  ? 6.184   9.041   7.771   1.00 0.00 ? 273 SER A CB   6  
ATOM 10203 O OG   . SER A 1 95  ? 6.462   8.062   6.785   1.00 0.00 ? 273 SER A OG   6  
ATOM 10204 H H    . SER A 1 95  ? 6.550   11.288  6.171   1.00 0.00 ? 273 SER A H    6  
ATOM 10205 H HA   . SER A 1 95  ? 4.280   9.577   6.952   1.00 0.00 ? 273 SER A HA   6  
ATOM 10206 H HB2  . SER A 1 95  ? 7.106   9.534   8.041   1.00 0.00 ? 273 SER A HB2  6  
ATOM 10207 H HB3  . SER A 1 95  ? 5.769   8.552   8.640   1.00 0.00 ? 273 SER A HB3  6  
ATOM 10208 H HG   . SER A 1 95  ? 7.397   7.845   6.804   1.00 0.00 ? 273 SER A HG   6  
ATOM 10209 N N    . GLU A 1 96  ? 4.447   10.564  9.509   1.00 0.00 ? 274 GLU A N    6  
ATOM 10210 C CA   . GLU A 1 96  ? 4.098   11.411  10.643  1.00 0.00 ? 274 GLU A CA   6  
ATOM 10211 C C    . GLU A 1 96  ? 5.329   11.718  11.492  1.00 0.00 ? 274 GLU A C    6  
ATOM 10212 O O    . GLU A 1 96  ? 5.773   10.886  12.284  1.00 0.00 ? 274 GLU A O    6  
ATOM 10213 C CB   . GLU A 1 96  ? 3.027   10.737  11.502  1.00 0.00 ? 274 GLU A CB   6  
ATOM 10214 C CG   . GLU A 1 96  ? 3.151   9.223   11.553  1.00 0.00 ? 274 GLU A CG   6  
ATOM 10215 C CD   . GLU A 1 96  ? 2.523   8.546   10.350  1.00 0.00 ? 274 GLU A CD   6  
ATOM 10216 O OE1  . GLU A 1 96  ? 1.357   8.861   10.035  1.00 0.00 ? 274 GLU A OE1  6  
ATOM 10217 O OE2  . GLU A 1 96  ? 3.198   7.701   9.725   1.00 0.00 ? 274 GLU A OE2  6  
ATOM 10218 H H    . GLU A 1 96  ? 4.378   9.590   9.600   1.00 0.00 ? 274 GLU A H    6  
ATOM 10219 H HA   . GLU A 1 96  ? 3.704   12.338  10.255  1.00 0.00 ? 274 GLU A HA   6  
ATOM 10220 H HB2  . GLU A 1 96  ? 3.099   11.117  12.510  1.00 0.00 ? 274 GLU A HB2  6  
ATOM 10221 H HB3  . GLU A 1 96  ? 2.055   10.984  11.102  1.00 0.00 ? 274 GLU A HB3  6  
ATOM 10222 H HG2  . GLU A 1 96  ? 4.198   8.962   11.587  1.00 0.00 ? 274 GLU A HG2  6  
ATOM 10223 H HG3  . GLU A 1 96  ? 2.662   8.864   12.446  1.00 0.00 ? 274 GLU A HG3  6  
ATOM 10224 N N    . VAL A 1 97  ? 5.875   12.917  11.321  1.00 0.00 ? 275 VAL A N    6  
ATOM 10225 C CA   . VAL A 1 97  ? 7.053   13.335  12.071  1.00 0.00 ? 275 VAL A CA   6  
ATOM 10226 C C    . VAL A 1 97  ? 6.674   13.813  13.469  1.00 0.00 ? 275 VAL A C    6  
ATOM 10227 O O    . VAL A 1 97  ? 7.389   13.557  14.438  1.00 0.00 ? 275 VAL A O    6  
ATOM 10228 C CB   . VAL A 1 97  ? 7.812   14.461  11.344  1.00 0.00 ? 275 VAL A CB   6  
ATOM 10229 C CG1  . VAL A 1 97  ? 6.906   15.664  11.130  1.00 0.00 ? 275 VAL A CG1  6  
ATOM 10230 C CG2  . VAL A 1 97  ? 9.058   14.853  12.124  1.00 0.00 ? 275 VAL A CG2  6  
ATOM 10231 H H    . VAL A 1 97  ? 5.475   13.537  10.675  1.00 0.00 ? 275 VAL A H    6  
ATOM 10232 H HA   . VAL A 1 97  ? 7.712   12.483  12.159  1.00 0.00 ? 275 VAL A HA   6  
ATOM 10233 H HB   . VAL A 1 97  ? 8.120   14.093  10.376  1.00 0.00 ? 275 VAL A HB   6  
ATOM 10234 H HG11 . VAL A 1 97  ? 6.032   15.361  10.571  1.00 0.00 ? 275 VAL A HG11 6  
ATOM 10235 H HG12 . VAL A 1 97  ? 6.603   16.062  12.087  1.00 0.00 ? 275 VAL A HG12 6  
ATOM 10236 H HG13 . VAL A 1 97  ? 7.440   16.422  10.577  1.00 0.00 ? 275 VAL A HG13 6  
ATOM 10237 H HG21 . VAL A 1 97  ? 9.780   14.052  12.074  1.00 0.00 ? 275 VAL A HG21 6  
ATOM 10238 H HG22 . VAL A 1 97  ? 9.484   15.749  11.695  1.00 0.00 ? 275 VAL A HG22 6  
ATOM 10239 H HG23 . VAL A 1 97  ? 8.794   15.039  13.154  1.00 0.00 ? 275 VAL A HG23 6  
ATOM 10240 N N    . SER A 1 98  ? 5.545   14.507  13.565  1.00 0.00 ? 276 SER A N    6  
ATOM 10241 C CA   . SER A 1 98  ? 5.072   15.024  14.843  1.00 0.00 ? 276 SER A CA   6  
ATOM 10242 C C    . SER A 1 98  ? 5.210   13.972  15.939  1.00 0.00 ? 276 SER A C    6  
ATOM 10243 O O    . SER A 1 98  ? 5.624   14.274  17.059  1.00 0.00 ? 276 SER A O    6  
ATOM 10244 C CB   . SER A 1 98  ? 3.613   15.470  14.729  1.00 0.00 ? 276 SER A CB   6  
ATOM 10245 O OG   . SER A 1 98  ? 3.097   15.855  15.991  1.00 0.00 ? 276 SER A OG   6  
ATOM 10246 H H    . SER A 1 98  ? 5.019   14.678  12.755  1.00 0.00 ? 276 SER A H    6  
ATOM 10247 H HA   . SER A 1 98  ? 5.681   15.878  15.102  1.00 0.00 ? 276 SER A HA   6  
ATOM 10248 H HB2  . SER A 1 98  ? 3.548   16.310  14.055  1.00 0.00 ? 276 SER A HB2  6  
ATOM 10249 H HB3  . SER A 1 98  ? 3.019   14.653  14.345  1.00 0.00 ? 276 SER A HB3  6  
ATOM 10250 H HG   . SER A 1 98  ? 2.146   15.967  15.928  1.00 0.00 ? 276 SER A HG   6  
ATOM 10251 N N    . THR A 1 99  ? 4.860   12.733  15.609  1.00 0.00 ? 277 THR A N    6  
ATOM 10252 C CA   . THR A 1 99  ? 4.943   11.635  16.563  1.00 0.00 ? 277 THR A CA   6  
ATOM 10253 C C    . THR A 1 99  ? 5.877   10.539  16.061  1.00 0.00 ? 277 THR A C    6  
ATOM 10254 O O    . THR A 1 99  ? 6.160   10.451  14.867  1.00 0.00 ? 277 THR A O    6  
ATOM 10255 C CB   . THR A 1 99  ? 3.556   11.024  16.840  1.00 0.00 ? 277 THR A CB   6  
ATOM 10256 O OG1  . THR A 1 99  ? 3.641   10.083  17.915  1.00 0.00 ? 277 THR A OG1  6  
ATOM 10257 C CG2  . THR A 1 99  ? 3.011   10.336  15.598  1.00 0.00 ? 277 THR A CG2  6  
ATOM 10258 H H    . THR A 1 99  ? 4.538   12.555  14.701  1.00 0.00 ? 277 THR A H    6  
ATOM 10259 H HA   . THR A 1 99  ? 5.332   12.028  17.491  1.00 0.00 ? 277 THR A HA   6  
ATOM 10260 H HB   . THR A 1 99  ? 2.879   11.819  17.119  1.00 0.00 ? 277 THR A HB   6  
ATOM 10261 H HG1  . THR A 1 99  ? 3.566   10.546  18.753  1.00 0.00 ? 277 THR A HG1  6  
ATOM 10262 H HG21 . THR A 1 99  ? 2.282   10.976  15.122  1.00 0.00 ? 277 THR A HG21 6  
ATOM 10263 H HG22 . THR A 1 99  ? 2.543   9.404   15.879  1.00 0.00 ? 277 THR A HG22 6  
ATOM 10264 H HG23 . THR A 1 99  ? 3.820   10.140  14.911  1.00 0.00 ? 277 THR A HG23 6  
ATOM 10265 N N    . ALA A 1 100 ? 6.352   9.706   16.981  1.00 0.00 ? 278 ALA A N    6  
ATOM 10266 C CA   . ALA A 1 100 ? 7.252   8.614   16.631  1.00 0.00 ? 278 ALA A CA   6  
ATOM 10267 C C    . ALA A 1 100 ? 7.503   7.703   17.828  1.00 0.00 ? 278 ALA A C    6  
ATOM 10268 O O    . ALA A 1 100 ? 7.693   8.175   18.949  1.00 0.00 ? 278 ALA A O    6  
ATOM 10269 C CB   . ALA A 1 100 ? 8.567   9.164   16.099  1.00 0.00 ? 278 ALA A CB   6  
ATOM 10270 H H    . ALA A 1 100 ? 6.090   9.827   17.917  1.00 0.00 ? 278 ALA A H    6  
ATOM 10271 H HA   . ALA A 1 100 ? 6.787   8.037   15.844  1.00 0.00 ? 278 ALA A HA   6  
ATOM 10272 H HB1  . ALA A 1 100 ? 8.569   9.109   15.020  1.00 0.00 ? 278 ALA A HB1  6  
ATOM 10273 H HB2  . ALA A 1 100 ? 8.678   10.193  16.408  1.00 0.00 ? 278 ALA A HB2  6  
ATOM 10274 H HB3  . ALA A 1 100 ? 9.386   8.580   16.491  1.00 0.00 ? 278 ALA A HB3  6  
ATOM 10275 N N    . ILE A 1 101 ? 7.500   6.397   17.583  1.00 0.00 ? 279 ILE A N    6  
ATOM 10276 C CA   . ILE A 1 101 ? 7.728   5.422   18.642  1.00 0.00 ? 279 ILE A CA   6  
ATOM 10277 C C    . ILE A 1 101 ? 9.151   5.518   19.181  1.00 0.00 ? 279 ILE A C    6  
ATOM 10278 O O    . ILE A 1 101 ? 10.074  5.897   18.461  1.00 0.00 ? 279 ILE A O    6  
ATOM 10279 C CB   . ILE A 1 101 ? 7.474   3.985   18.147  1.00 0.00 ? 279 ILE A CB   6  
ATOM 10280 C CG1  . ILE A 1 101 ? 6.041   3.847   17.630  1.00 0.00 ? 279 ILE A CG1  6  
ATOM 10281 C CG2  . ILE A 1 101 ? 7.738   2.986   19.264  1.00 0.00 ? 279 ILE A CG2  6  
ATOM 10282 C CD1  . ILE A 1 101 ? 5.817   2.604   16.796  1.00 0.00 ? 279 ILE A CD1  6  
ATOM 10283 H H    . ILE A 1 101 ? 7.342   6.083   16.669  1.00 0.00 ? 279 ILE A H    6  
ATOM 10284 H HA   . ILE A 1 101 ? 7.035   5.633   19.444  1.00 0.00 ? 279 ILE A HA   6  
ATOM 10285 H HB   . ILE A 1 101 ? 8.161   3.779   17.342  1.00 0.00 ? 279 ILE A HB   6  
ATOM 10286 H HG12 . ILE A 1 101 ? 5.364   3.809   18.468  1.00 0.00 ? 279 ILE A HG12 6  
ATOM 10287 H HG13 . ILE A 1 101 ? 5.802   4.705   17.018  1.00 0.00 ? 279 ILE A HG13 6  
ATOM 10288 H HG21 . ILE A 1 101 ? 7.111   3.220   20.112  1.00 0.00 ? 279 ILE A HG21 6  
ATOM 10289 H HG22 . ILE A 1 101 ? 7.515   1.990   18.915  1.00 0.00 ? 279 ILE A HG22 6  
ATOM 10290 H HG23 . ILE A 1 101 ? 8.776   3.041   19.558  1.00 0.00 ? 279 ILE A HG23 6  
ATOM 10291 H HD11 . ILE A 1 101 ? 6.327   1.768   17.251  1.00 0.00 ? 279 ILE A HD11 6  
ATOM 10292 H HD12 . ILE A 1 101 ? 4.759   2.395   16.738  1.00 0.00 ? 279 ILE A HD12 6  
ATOM 10293 H HD13 . ILE A 1 101 ? 6.206   2.764   15.801  1.00 0.00 ? 279 ILE A HD13 6  
ATOM 10294 N N    . ALA A 1 102 ? 9.321   5.170   20.452  1.00 0.00 ? 280 ALA A N    6  
ATOM 10295 C CA   . ALA A 1 102 ? 10.632  5.213   21.087  1.00 0.00 ? 280 ALA A CA   6  
ATOM 10296 C C    . ALA A 1 102 ? 10.921  3.917   21.839  1.00 0.00 ? 280 ALA A C    6  
ATOM 10297 O O    . ALA A 1 102 ? 10.521  3.754   22.992  1.00 0.00 ? 280 ALA A O    6  
ATOM 10298 C CB   . ALA A 1 102 ? 10.723  6.403   22.030  1.00 0.00 ? 280 ALA A CB   6  
ATOM 10299 H H    . ALA A 1 102 ? 8.546   4.876   20.975  1.00 0.00 ? 280 ALA A H    6  
ATOM 10300 H HA   . ALA A 1 102 ? 11.374  5.340   20.312  1.00 0.00 ? 280 ALA A HA   6  
ATOM 10301 H HB1  . ALA A 1 102 ? 11.357  6.151   22.867  1.00 0.00 ? 280 ALA A HB1  6  
ATOM 10302 H HB2  . ALA A 1 102 ? 11.141  7.248   21.503  1.00 0.00 ? 280 ALA A HB2  6  
ATOM 10303 H HB3  . ALA A 1 102 ? 9.736   6.655   22.388  1.00 0.00 ? 280 ALA A HB3  6  
ATOM 10304 N N    . THR A 1 103 ? 11.617  2.998   21.178  1.00 0.00 ? 281 THR A N    6  
ATOM 10305 C CA   . THR A 1 103 ? 11.958  1.716   21.783  1.00 0.00 ? 281 THR A CA   6  
ATOM 10306 C C    . THR A 1 103 ? 13.319  1.226   21.303  1.00 0.00 ? 281 THR A C    6  
ATOM 10307 O O    . THR A 1 103 ? 13.632  1.303   20.115  1.00 0.00 ? 281 THR A O    6  
ATOM 10308 C CB   . THR A 1 103 ? 10.897  0.645   21.464  1.00 0.00 ? 281 THR A CB   6  
ATOM 10309 O OG1  . THR A 1 103 ? 9.594   1.128   21.809  1.00 0.00 ? 281 THR A OG1  6  
ATOM 10310 C CG2  . THR A 1 103 ? 11.184  -0.642  22.222  1.00 0.00 ? 281 THR A CG2  6  
ATOM 10311 H H    . THR A 1 103 ? 11.908  3.187   20.261  1.00 0.00 ? 281 THR A H    6  
ATOM 10312 H HA   . THR A 1 103 ? 11.992  1.852   22.854  1.00 0.00 ? 281 THR A HA   6  
ATOM 10313 H HB   . THR A 1 103 ? 10.927  0.436   20.404  1.00 0.00 ? 281 THR A HB   6  
ATOM 10314 H HG1  . THR A 1 103 ? 9.362   1.862   21.234  1.00 0.00 ? 281 THR A HG1  6  
ATOM 10315 H HG21 . THR A 1 103 ? 10.872  -1.488  21.627  1.00 0.00 ? 281 THR A HG21 6  
ATOM 10316 H HG22 . THR A 1 103 ? 10.640  -0.639  23.155  1.00 0.00 ? 281 THR A HG22 6  
ATOM 10317 H HG23 . THR A 1 103 ? 12.242  -0.714  22.422  1.00 0.00 ? 281 THR A HG23 6  
ATOM 10318 N N    . GLU A 1 104 ? 14.123  0.722   22.234  1.00 0.00 ? 282 GLU A N    6  
ATOM 10319 C CA   . GLU A 1 104 ? 15.451  0.219   21.903  1.00 0.00 ? 282 GLU A CA   6  
ATOM 10320 C C    . GLU A 1 104 ? 15.482  -1.306  21.944  1.00 0.00 ? 282 GLU A C    6  
ATOM 10321 O O    . GLU A 1 104 ? 14.718  -1.932  22.679  1.00 0.00 ? 282 GLU A O    6  
ATOM 10322 C CB   . GLU A 1 104 ? 16.491  0.787   22.872  1.00 0.00 ? 282 GLU A CB   6  
ATOM 10323 C CG   . GLU A 1 104 ? 17.876  0.187   22.698  1.00 0.00 ? 282 GLU A CG   6  
ATOM 10324 C CD   . GLU A 1 104 ? 18.556  0.649   21.423  1.00 0.00 ? 282 GLU A CD   6  
ATOM 10325 O OE1  . GLU A 1 104 ? 18.063  0.302   20.330  1.00 0.00 ? 282 GLU A OE1  6  
ATOM 10326 O OE2  . GLU A 1 104 ? 19.581  1.355   21.519  1.00 0.00 ? 282 GLU A OE2  6  
ATOM 10327 H H    . GLU A 1 104 ? 13.816  0.688   23.163  1.00 0.00 ? 282 GLU A H    6  
ATOM 10328 H HA   . GLU A 1 104 ? 15.690  0.545   20.902  1.00 0.00 ? 282 GLU A HA   6  
ATOM 10329 H HB2  . GLU A 1 104 ? 16.561  1.854   22.721  1.00 0.00 ? 282 GLU A HB2  6  
ATOM 10330 H HB3  . GLU A 1 104 ? 16.164  0.597   23.883  1.00 0.00 ? 282 GLU A HB3  6  
ATOM 10331 H HG2  . GLU A 1 104 ? 18.488  0.477   23.539  1.00 0.00 ? 282 GLU A HG2  6  
ATOM 10332 H HG3  . GLU A 1 104 ? 17.788  -0.889  22.672  1.00 0.00 ? 282 GLU A HG3  6  
ATOM 10333 N N    . GLN A 1 105 ? 16.369  -1.896  21.149  1.00 0.00 ? 283 GLN A N    6  
ATOM 10334 C CA   . GLN A 1 105 ? 16.498  -3.347  21.094  1.00 0.00 ? 283 GLN A CA   6  
ATOM 10335 C C    . GLN A 1 105 ? 17.796  -3.752  20.403  1.00 0.00 ? 283 GLN A C    6  
ATOM 10336 O O    . GLN A 1 105 ? 18.482  -2.918  19.813  1.00 0.00 ? 283 GLN A O    6  
ATOM 10337 C CB   . GLN A 1 105 ? 15.303  -3.959  20.360  1.00 0.00 ? 283 GLN A CB   6  
ATOM 10338 C CG   . GLN A 1 105 ? 15.179  -3.504  18.915  1.00 0.00 ? 283 GLN A CG   6  
ATOM 10339 C CD   . GLN A 1 105 ? 16.284  -4.052  18.033  1.00 0.00 ? 283 GLN A CD   6  
ATOM 10340 O OE1  . GLN A 1 105 ? 17.026  -3.296  17.406  1.00 0.00 ? 283 GLN A OE1  6  
ATOM 10341 N NE2  . GLN A 1 105 ? 16.398  -5.374  17.981  1.00 0.00 ? 283 GLN A NE2  6  
ATOM 10342 H H    . GLN A 1 105 ? 16.950  -1.342  20.587  1.00 0.00 ? 283 GLN A H    6  
ATOM 10343 H HA   . GLN A 1 105 ? 16.514  -3.717  22.108  1.00 0.00 ? 283 GLN A HA   6  
ATOM 10344 H HB2  . GLN A 1 105 ? 15.402  -5.034  20.370  1.00 0.00 ? 283 GLN A HB2  6  
ATOM 10345 H HB3  . GLN A 1 105 ? 14.397  -3.684  20.880  1.00 0.00 ? 283 GLN A HB3  6  
ATOM 10346 H HG2  . GLN A 1 105 ? 14.229  -3.839  18.525  1.00 0.00 ? 283 GLN A HG2  6  
ATOM 10347 H HG3  . GLN A 1 105 ? 15.217  -2.425  18.886  1.00 0.00 ? 283 GLN A HG3  6  
ATOM 10348 H HE21 . GLN A 1 105 ? 15.770  -5.914  18.507  1.00 0.00 ? 283 GLN A HE21 6  
ATOM 10349 H HE22 . GLN A 1 105 ? 17.103  -5.756  17.419  1.00 0.00 ? 283 GLN A HE22 6  
ATOM 10350 N N    . GLN A 1 106 ? 18.126  -5.037  20.481  1.00 0.00 ? 284 GLN A N    6  
ATOM 10351 C CA   . GLN A 1 106 ? 19.342  -5.552  19.864  1.00 0.00 ? 284 GLN A CA   6  
ATOM 10352 C C    . GLN A 1 106 ? 19.648  -4.814  18.564  1.00 0.00 ? 284 GLN A C    6  
ATOM 10353 O O    . GLN A 1 106 ? 18.886  -4.892  17.601  1.00 0.00 ? 284 GLN A O    6  
ATOM 10354 C CB   . GLN A 1 106 ? 19.207  -7.051  19.593  1.00 0.00 ? 284 GLN A CB   6  
ATOM 10355 C CG   . GLN A 1 106 ? 19.571  -7.921  20.786  1.00 0.00 ? 284 GLN A CG   6  
ATOM 10356 C CD   . GLN A 1 106 ? 18.920  -9.289  20.731  1.00 0.00 ? 284 GLN A CD   6  
ATOM 10357 O OE1  . GLN A 1 106 ? 17.941  -9.495  20.013  1.00 0.00 ? 284 GLN A OE1  6  
ATOM 10358 N NE2  . GLN A 1 106 ? 19.462  -10.233 21.490  1.00 0.00 ? 284 GLN A NE2  6  
ATOM 10359 H H    . GLN A 1 106 ? 17.538  -5.653  20.965  1.00 0.00 ? 284 GLN A H    6  
ATOM 10360 H HA   . GLN A 1 106 ? 20.157  -5.392  20.553  1.00 0.00 ? 284 GLN A HA   6  
ATOM 10361 H HB2  . GLN A 1 106 ? 18.185  -7.264  19.317  1.00 0.00 ? 284 GLN A HB2  6  
ATOM 10362 H HB3  . GLN A 1 106 ? 19.856  -7.316  18.771  1.00 0.00 ? 284 GLN A HB3  6  
ATOM 10363 H HG2  . GLN A 1 106 ? 20.643  -8.050  20.807  1.00 0.00 ? 284 GLN A HG2  6  
ATOM 10364 H HG3  . GLN A 1 106 ? 19.251  -7.422  21.689  1.00 0.00 ? 284 GLN A HG3  6  
ATOM 10365 H HE21 . GLN A 1 106 ? 20.241  -9.996  22.037  1.00 0.00 ? 284 GLN A HE21 6  
ATOM 10366 H HE22 . GLN A 1 106 ? 19.062  -11.127 21.475  1.00 0.00 ? 284 GLN A HE22 6  
ATOM 10367 N N    . SER A 1 107 ? 20.767  -4.097  18.546  1.00 0.00 ? 285 SER A N    6  
ATOM 10368 C CA   . SER A 1 107 ? 21.171  -3.341  17.366  1.00 0.00 ? 285 SER A CA   6  
ATOM 10369 C C    . SER A 1 107 ? 22.307  -4.046  16.632  1.00 0.00 ? 285 SER A C    6  
ATOM 10370 O O    . SER A 1 107 ? 23.330  -4.383  17.227  1.00 0.00 ? 285 SER A O    6  
ATOM 10371 C CB   . SER A 1 107 ? 21.604  -1.929  17.763  1.00 0.00 ? 285 SER A CB   6  
ATOM 10372 O OG   . SER A 1 107 ? 20.532  -1.213  18.352  1.00 0.00 ? 285 SER A OG   6  
ATOM 10373 H H    . SER A 1 107 ? 21.333  -4.074  19.346  1.00 0.00 ? 285 SER A H    6  
ATOM 10374 H HA   . SER A 1 107 ? 20.318  -3.275  16.707  1.00 0.00 ? 285 SER A HA   6  
ATOM 10375 H HB2  . SER A 1 107 ? 22.414  -1.990  18.474  1.00 0.00 ? 285 SER A HB2  6  
ATOM 10376 H HB3  . SER A 1 107 ? 21.937  -1.397  16.883  1.00 0.00 ? 285 SER A HB3  6  
ATOM 10377 H HG   . SER A 1 107 ? 19.769  -1.243  17.770  1.00 0.00 ? 285 SER A HG   6  
ATOM 10378 N N    . TRP A 1 108 ? 22.118  -4.266  15.336  1.00 0.00 ? 286 TRP A N    6  
ATOM 10379 C CA   . TRP A 1 108 ? 23.127  -4.932  14.519  1.00 0.00 ? 286 TRP A CA   6  
ATOM 10380 C C    . TRP A 1 108 ? 22.937  -4.599  13.043  1.00 0.00 ? 286 TRP A C    6  
ATOM 10381 O O    . TRP A 1 108 ? 21.874  -4.842  12.474  1.00 0.00 ? 286 TRP A O    6  
ATOM 10382 C CB   . TRP A 1 108 ? 23.062  -6.446  14.725  1.00 0.00 ? 286 TRP A CB   6  
ATOM 10383 C CG   . TRP A 1 108 ? 23.529  -6.880  16.082  1.00 0.00 ? 286 TRP A CG   6  
ATOM 10384 C CD1  . TRP A 1 108 ? 22.747  -7.240  17.142  1.00 0.00 ? 286 TRP A CD1  6  
ATOM 10385 C CD2  . TRP A 1 108 ? 24.886  -6.999  16.523  1.00 0.00 ? 286 TRP A CD2  6  
ATOM 10386 N NE1  . TRP A 1 108 ? 23.536  -7.575  18.216  1.00 0.00 ? 286 TRP A NE1  6  
ATOM 10387 C CE2  . TRP A 1 108 ? 24.852  -7.436  17.862  1.00 0.00 ? 286 TRP A CE2  6  
ATOM 10388 C CE3  . TRP A 1 108 ? 26.126  -6.780  15.918  1.00 0.00 ? 286 TRP A CE3  6  
ATOM 10389 C CZ2  . TRP A 1 108 ? 26.010  -7.657  18.603  1.00 0.00 ? 286 TRP A CZ2  6  
ATOM 10390 C CZ3  . TRP A 1 108 ? 27.275  -6.999  16.655  1.00 0.00 ? 286 TRP A CZ3  6  
ATOM 10391 C CH2  . TRP A 1 108 ? 27.210  -7.434  17.985  1.00 0.00 ? 286 TRP A CH2  6  
ATOM 10392 H H    . TRP A 1 108 ? 21.281  -3.974  14.918  1.00 0.00 ? 286 TRP A H    6  
ATOM 10393 H HA   . TRP A 1 108 ? 24.096  -4.575  14.835  1.00 0.00 ? 286 TRP A HA   6  
ATOM 10394 H HB2  . TRP A 1 108 ? 22.042  -6.777  14.603  1.00 0.00 ? 286 TRP A HB2  6  
ATOM 10395 H HB3  . TRP A 1 108 ? 23.685  -6.929  13.987  1.00 0.00 ? 286 TRP A HB3  6  
ATOM 10396 H HD1  . TRP A 1 108 ? 21.668  -7.253  17.124  1.00 0.00 ? 286 TRP A HD1  6  
ATOM 10397 H HE1  . TRP A 1 108 ? 23.208  -7.868  19.092  1.00 0.00 ? 286 TRP A HE1  6  
ATOM 10398 H HE3  . TRP A 1 108 ? 26.197  -6.444  14.894  1.00 0.00 ? 286 TRP A HE3  6  
ATOM 10399 H HZ2  . TRP A 1 108 ? 25.977  -7.993  19.629  1.00 0.00 ? 286 TRP A HZ2  6  
ATOM 10400 H HZ3  . TRP A 1 108 ? 28.243  -6.834  16.204  1.00 0.00 ? 286 TRP A HZ3  6  
ATOM 10401 H HH2  . TRP A 1 108 ? 28.133  -7.592  18.522  1.00 0.00 ? 286 TRP A HH2  6  
ATOM 10402 N N    . ASN A 1 109 ? 23.976  -4.043  12.428  1.00 0.00 ? 287 ASN A N    6  
ATOM 10403 C CA   . ASN A 1 109 ? 23.923  -3.677  11.017  1.00 0.00 ? 287 ASN A CA   6  
ATOM 10404 C C    . ASN A 1 109 ? 25.326  -3.594  10.424  1.00 0.00 ? 287 ASN A C    6  
ATOM 10405 O O    . ASN A 1 109 ? 26.222  -2.979  11.004  1.00 0.00 ? 287 ASN A O    6  
ATOM 10406 C CB   . ASN A 1 109 ? 23.203  -2.338  10.843  1.00 0.00 ? 287 ASN A CB   6  
ATOM 10407 C CG   . ASN A 1 109 ? 21.708  -2.453  11.066  1.00 0.00 ? 287 ASN A CG   6  
ATOM 10408 O OD1  . ASN A 1 109 ? 21.157  -1.842  11.982  1.00 0.00 ? 287 ASN A OD1  6  
ATOM 10409 N ND2  . ASN A 1 109 ? 21.043  -3.238  10.227  1.00 0.00 ? 287 ASN A ND2  6  
ATOM 10410 H H    . ASN A 1 109 ? 24.798  -3.874  12.935  1.00 0.00 ? 287 ASN A H    6  
ATOM 10411 H HA   . ASN A 1 109 ? 23.370  -4.444  10.497  1.00 0.00 ? 287 ASN A HA   6  
ATOM 10412 H HB2  . ASN A 1 109 ? 23.600  -1.628  11.553  1.00 0.00 ? 287 ASN A HB2  6  
ATOM 10413 H HB3  . ASN A 1 109 ? 23.373  -1.972  9.841   1.00 0.00 ? 287 ASN A HB3  6  
ATOM 10414 H HD21 . ASN A 1 109 ? 21.547  -3.693  9.520   1.00 0.00 ? 287 ASN A HD21 6  
ATOM 10415 H HD22 . ASN A 1 109 ? 20.075  -3.330  10.348  1.00 0.00 ? 287 ASN A HD22 6  
ATOM 10416 N N    . LEU A 1 110 ? 25.510  -4.215  9.265   1.00 0.00 ? 288 LEU A N    6  
ATOM 10417 C CA   . LEU A 1 110 ? 26.804  -4.211  8.591   1.00 0.00 ? 288 LEU A CA   6  
ATOM 10418 C C    . LEU A 1 110 ? 26.637  -4.422  7.090   1.00 0.00 ? 288 LEU A C    6  
ATOM 10419 O O    . LEU A 1 110 ? 26.122  -5.450  6.651   1.00 0.00 ? 288 LEU A O    6  
ATOM 10420 C CB   . LEU A 1 110 ? 27.708  -5.300  9.173   1.00 0.00 ? 288 LEU A CB   6  
ATOM 10421 C CG   . LEU A 1 110 ? 29.201  -5.166  8.871   1.00 0.00 ? 288 LEU A CG   6  
ATOM 10422 C CD1  . LEU A 1 110 ? 29.453  -5.260  7.375   1.00 0.00 ? 288 LEU A CD1  6  
ATOM 10423 C CD2  . LEU A 1 110 ? 29.741  -3.855  9.424   1.00 0.00 ? 288 LEU A CD2  6  
ATOM 10424 H H    . LEU A 1 110 ? 24.759  -4.688  8.851   1.00 0.00 ? 288 LEU A H    6  
ATOM 10425 H HA   . LEU A 1 110 ? 27.262  -3.248  8.758   1.00 0.00 ? 288 LEU A HA   6  
ATOM 10426 H HB2  . LEU A 1 110 ? 27.586  -5.292  10.245  1.00 0.00 ? 288 LEU A HB2  6  
ATOM 10427 H HB3  . LEU A 1 110 ? 27.374  -6.250  8.781   1.00 0.00 ? 288 LEU A HB3  6  
ATOM 10428 H HG   . LEU A 1 110 ? 29.733  -5.976  9.350   1.00 0.00 ? 288 LEU A HG   6  
ATOM 10429 H HD11 . LEU A 1 110 ? 28.961  -6.136  6.981   1.00 0.00 ? 288 LEU A HD11 6  
ATOM 10430 H HD12 . LEU A 1 110 ? 30.515  -5.331  7.193   1.00 0.00 ? 288 LEU A HD12 6  
ATOM 10431 H HD13 . LEU A 1 110 ? 29.063  -4.378  6.888   1.00 0.00 ? 288 LEU A HD13 6  
ATOM 10432 H HD21 . LEU A 1 110 ? 29.245  -3.028  8.937   1.00 0.00 ? 288 LEU A HD21 6  
ATOM 10433 H HD22 . LEU A 1 110 ? 30.804  -3.796  9.238   1.00 0.00 ? 288 LEU A HD22 6  
ATOM 10434 H HD23 . LEU A 1 110 ? 29.557  -3.809  10.487  1.00 0.00 ? 288 LEU A HD23 6  
ATOM 10435 N N    . ASN A 1 111 ? 27.079  -3.443  6.307   1.00 0.00 ? 289 ASN A N    6  
ATOM 10436 C CA   . ASN A 1 111 ? 26.980  -3.523  4.854   1.00 0.00 ? 289 ASN A CA   6  
ATOM 10437 C C    . ASN A 1 111 ? 27.994  -4.515  4.293   1.00 0.00 ? 289 ASN A C    6  
ATOM 10438 O O    . ASN A 1 111 ? 29.164  -4.505  4.674   1.00 0.00 ? 289 ASN A O    6  
ATOM 10439 C CB   . ASN A 1 111 ? 27.202  -2.143  4.231   1.00 0.00 ? 289 ASN A CB   6  
ATOM 10440 C CG   . ASN A 1 111 ? 28.433  -1.450  4.782   1.00 0.00 ? 289 ASN A CG   6  
ATOM 10441 O OD1  . ASN A 1 111 ? 29.312  -2.090  5.360   1.00 0.00 ? 289 ASN A OD1  6  
ATOM 10442 N ND2  . ASN A 1 111 ? 28.501  -0.136  4.606   1.00 0.00 ? 289 ASN A ND2  6  
ATOM 10443 H H    . ASN A 1 111 ? 27.481  -2.649  6.716   1.00 0.00 ? 289 ASN A H    6  
ATOM 10444 H HA   . ASN A 1 111 ? 25.986  -3.864  4.608   1.00 0.00 ? 289 ASN A HA   6  
ATOM 10445 H HB2  . ASN A 1 111 ? 27.322  -2.252  3.163   1.00 0.00 ? 289 ASN A HB2  6  
ATOM 10446 H HB3  . ASN A 1 111 ? 26.342  -1.522  4.430   1.00 0.00 ? 289 ASN A HB3  6  
ATOM 10447 H HD21 . ASN A 1 111 ? 27.764  0.307   4.136   1.00 0.00 ? 289 ASN A HD21 6  
ATOM 10448 H HD22 . ASN A 1 111 ? 29.287  0.337   4.952   1.00 0.00 ? 289 ASN A HD22 6  
ATOM 10449 N N    . ASN A 1 112 ? 27.537  -5.371  3.385   1.00 0.00 ? 290 ASN A N    6  
ATOM 10450 C CA   . ASN A 1 112 ? 28.403  -6.370  2.771   1.00 0.00 ? 290 ASN A CA   6  
ATOM 10451 C C    . ASN A 1 112 ? 27.747  -6.973  1.533   1.00 0.00 ? 290 ASN A C    6  
ATOM 10452 O O    . ASN A 1 112 ? 26.522  -6.966  1.400   1.00 0.00 ? 290 ASN A O    6  
ATOM 10453 C CB   . ASN A 1 112 ? 28.734  -7.476  3.776   1.00 0.00 ? 290 ASN A CB   6  
ATOM 10454 C CG   . ASN A 1 112 ? 29.952  -8.282  3.369   1.00 0.00 ? 290 ASN A CG   6  
ATOM 10455 O OD1  . ASN A 1 112 ? 30.987  -7.723  3.006   1.00 0.00 ? 290 ASN A OD1  6  
ATOM 10456 N ND2  . ASN A 1 112 ? 29.834  -9.603  3.428   1.00 0.00 ? 290 ASN A ND2  6  
ATOM 10457 H H    . ASN A 1 112 ? 26.593  -5.330  3.122   1.00 0.00 ? 290 ASN A H    6  
ATOM 10458 H HA   . ASN A 1 112 ? 29.318  -5.879  2.476   1.00 0.00 ? 290 ASN A HA   6  
ATOM 10459 H HB2  . ASN A 1 112 ? 28.927  -7.030  4.741   1.00 0.00 ? 290 ASN A HB2  6  
ATOM 10460 H HB3  . ASN A 1 112 ? 27.891  -8.146  3.856   1.00 0.00 ? 290 ASN A HB3  6  
ATOM 10461 H HD21 . ASN A 1 112 ? 28.979  -9.979  3.727   1.00 0.00 ? 290 ASN A HD21 6  
ATOM 10462 H HD22 . ASN A 1 112 ? 30.606  -10.149 3.171   1.00 0.00 ? 290 ASN A HD22 6  
ATOM 10463 N N    . LEU A 1 113 ? 28.569  -7.494  0.629   1.00 0.00 ? 291 LEU A N    6  
ATOM 10464 C CA   . LEU A 1 113 ? 28.069  -8.102  -0.599  1.00 0.00 ? 291 LEU A CA   6  
ATOM 10465 C C    . LEU A 1 113 ? 29.173  -8.876  -1.313  1.00 0.00 ? 291 LEU A C    6  
ATOM 10466 O O    . LEU A 1 113 ? 30.329  -8.857  -0.891  1.00 0.00 ? 291 LEU A O    6  
ATOM 10467 C CB   . LEU A 1 113 ? 27.501  -7.029  -1.529  1.00 0.00 ? 291 LEU A CB   6  
ATOM 10468 C CG   . LEU A 1 113 ? 28.525  -6.121  -2.210  1.00 0.00 ? 291 LEU A CG   6  
ATOM 10469 C CD1  . LEU A 1 113 ? 29.609  -5.707  -1.228  1.00 0.00 ? 291 LEU A CD1  6  
ATOM 10470 C CD2  . LEU A 1 113 ? 29.135  -6.817  -3.418  1.00 0.00 ? 291 LEU A CD2  6  
ATOM 10471 H H    . LEU A 1 113 ? 29.535  -7.470  0.790   1.00 0.00 ? 291 LEU A H    6  
ATOM 10472 H HA   . LEU A 1 113 ? 27.280  -8.789  -0.331  1.00 0.00 ? 291 LEU A HA   6  
ATOM 10473 H HB2  . LEU A 1 113 ? 26.934  -7.526  -2.301  1.00 0.00 ? 291 LEU A HB2  6  
ATOM 10474 H HB3  . LEU A 1 113 ? 26.839  -6.404  -0.945  1.00 0.00 ? 291 LEU A HB3  6  
ATOM 10475 H HG   . LEU A 1 113 ? 28.028  -5.224  -2.555  1.00 0.00 ? 291 LEU A HG   6  
ATOM 10476 H HD11 . LEU A 1 113 ? 30.106  -4.821  -1.592  1.00 0.00 ? 291 LEU A HD11 6  
ATOM 10477 H HD12 . LEU A 1 113 ? 30.327  -6.507  -1.126  1.00 0.00 ? 291 LEU A HD12 6  
ATOM 10478 H HD13 . LEU A 1 113 ? 29.163  -5.499  -0.266  1.00 0.00 ? 291 LEU A HD13 6  
ATOM 10479 H HD21 . LEU A 1 113 ? 29.519  -6.076  -4.104  1.00 0.00 ? 291 LEU A HD21 6  
ATOM 10480 H HD22 . LEU A 1 113 ? 28.377  -7.407  -3.914  1.00 0.00 ? 291 LEU A HD22 6  
ATOM 10481 H HD23 . LEU A 1 113 ? 29.939  -7.461  -3.094  1.00 0.00 ? 291 LEU A HD23 6  
ATOM 10482 N N    . SER A 1 114 ? 28.809  -9.554  -2.396  1.00 0.00 ? 292 SER A N    6  
ATOM 10483 C CA   . SER A 1 114 ? 29.768  -10.335 -3.168  1.00 0.00 ? 292 SER A CA   6  
ATOM 10484 C C    . SER A 1 114 ? 29.136  -10.853 -4.456  1.00 0.00 ? 292 SER A C    6  
ATOM 10485 O O    . SER A 1 114 ? 27.924  -11.053 -4.530  1.00 0.00 ? 292 SER A O    6  
ATOM 10486 C CB   . SER A 1 114 ? 30.290  -11.508 -2.335  1.00 0.00 ? 292 SER A CB   6  
ATOM 10487 O OG   . SER A 1 114 ? 31.106  -12.364 -3.115  1.00 0.00 ? 292 SER A OG   6  
ATOM 10488 H H    . SER A 1 114 ? 27.871  -9.529  -2.682  1.00 0.00 ? 292 SER A H    6  
ATOM 10489 H HA   . SER A 1 114 ? 30.595  -9.688  -3.421  1.00 0.00 ? 292 SER A HA   6  
ATOM 10490 H HB2  . SER A 1 114 ? 30.872  -11.129 -1.510  1.00 0.00 ? 292 SER A HB2  6  
ATOM 10491 H HB3  . SER A 1 114 ? 29.453  -12.076 -1.955  1.00 0.00 ? 292 SER A HB3  6  
ATOM 10492 H HG   . SER A 1 114 ? 31.753  -12.792 -2.550  1.00 0.00 ? 292 SER A HG   6  
ATOM 10493 N N    . GLY A 1 115 ? 29.967  -11.067 -5.472  1.00 0.00 ? 293 GLY A N    6  
ATOM 10494 C CA   . GLY A 1 115 ? 29.473  -11.559 -6.744  1.00 0.00 ? 293 GLY A CA   6  
ATOM 10495 C C    . GLY A 1 115 ? 30.191  -10.937 -7.925  1.00 0.00 ? 293 GLY A C    6  
ATOM 10496 O O    . GLY A 1 115 ? 29.719  -9.972  -8.527  1.00 0.00 ? 293 GLY A O    6  
ATOM 10497 H H    . GLY A 1 115 ? 30.924  -10.890 -5.355  1.00 0.00 ? 293 GLY A H    6  
ATOM 10498 H HA2  . GLY A 1 115 ? 29.605  -12.630 -6.779  1.00 0.00 ? 293 GLY A HA2  6  
ATOM 10499 H HA3  . GLY A 1 115 ? 28.419  -11.334 -6.819  1.00 0.00 ? 293 GLY A HA3  6  
ATOM 10500 N N    . PRO A 1 116 ? 31.361  -11.493 -8.271  1.00 0.00 ? 294 PRO A N    6  
ATOM 10501 C CA   . PRO A 1 116 ? 32.171  -11.001 -9.390  1.00 0.00 ? 294 PRO A CA   6  
ATOM 10502 C C    . PRO A 1 116 ? 31.525  -11.284 -10.742 1.00 0.00 ? 294 PRO A C    6  
ATOM 10503 O O    . PRO A 1 116 ? 31.284  -12.438 -11.096 1.00 0.00 ? 294 PRO A O    6  
ATOM 10504 C CB   . PRO A 1 116 ? 33.481  -11.781 -9.249  1.00 0.00 ? 294 PRO A CB   6  
ATOM 10505 C CG   . PRO A 1 116 ? 33.104  -13.027 -8.526  1.00 0.00 ? 294 PRO A CG   6  
ATOM 10506 C CD   . PRO A 1 116 ? 31.984  -12.645 -7.598  1.00 0.00 ? 294 PRO A CD   6  
ATOM 10507 H HA   . PRO A 1 116 ? 32.369  -9.943  -9.301  1.00 0.00 ? 294 PRO A HA   6  
ATOM 10508 H HB2  . PRO A 1 116 ? 33.880  -11.998 -10.230 1.00 0.00 ? 294 PRO A HB2  6  
ATOM 10509 H HB3  . PRO A 1 116 ? 34.193  -11.197 -8.685  1.00 0.00 ? 294 PRO A HB3  6  
ATOM 10510 H HG2  . PRO A 1 116 ? 32.769  -13.774 -9.230  1.00 0.00 ? 294 PRO A HG2  6  
ATOM 10511 H HG3  . PRO A 1 116 ? 33.949  -13.394 -7.962  1.00 0.00 ? 294 PRO A HG3  6  
ATOM 10512 H HD2  . PRO A 1 116 ? 31.282  -13.459 -7.498  1.00 0.00 ? 294 PRO A HD2  6  
ATOM 10513 H HD3  . PRO A 1 116 ? 32.375  -12.360 -6.632  1.00 0.00 ? 294 PRO A HD3  6  
ATOM 10514 N N    . SER A 1 117 ? 31.247  -10.223 -11.493 1.00 0.00 ? 295 SER A N    6  
ATOM 10515 C CA   . SER A 1 117 ? 30.626  -10.358 -12.805 1.00 0.00 ? 295 SER A CA   6  
ATOM 10516 C C    . SER A 1 117 ? 29.237  -10.979 -12.688 1.00 0.00 ? 295 SER A C    6  
ATOM 10517 O O    . SER A 1 117 ? 28.794  -11.709 -13.574 1.00 0.00 ? 295 SER A O    6  
ATOM 10518 C CB   . SER A 1 117 ? 31.502  -11.212 -13.723 1.00 0.00 ? 295 SER A CB   6  
ATOM 10519 O OG   . SER A 1 117 ? 32.531  -10.436 -14.314 1.00 0.00 ? 295 SER A OG   6  
ATOM 10520 H H    . SER A 1 117 ? 31.463  -9.329  -11.156 1.00 0.00 ? 295 SER A H    6  
ATOM 10521 H HA   . SER A 1 117 ? 30.530  -9.370  -13.230 1.00 0.00 ? 295 SER A HA   6  
ATOM 10522 H HB2  . SER A 1 117 ? 31.953  -12.007 -13.149 1.00 0.00 ? 295 SER A HB2  6  
ATOM 10523 H HB3  . SER A 1 117 ? 30.892  -11.636 -14.507 1.00 0.00 ? 295 SER A HB3  6  
ATOM 10524 H HG   . SER A 1 117 ? 32.236  -10.110 -15.167 1.00 0.00 ? 295 SER A HG   6  
ATOM 10525 N N    . SER A 1 118 ? 28.555  -10.683 -11.586 1.00 0.00 ? 296 SER A N    6  
ATOM 10526 C CA   . SER A 1 118 ? 27.218  -11.214 -11.349 1.00 0.00 ? 296 SER A CA   6  
ATOM 10527 C C    . SER A 1 118 ? 26.426  -11.295 -12.651 1.00 0.00 ? 296 SER A C    6  
ATOM 10528 O O    . SER A 1 118 ? 26.023  -10.276 -13.209 1.00 0.00 ? 296 SER A O    6  
ATOM 10529 C CB   . SER A 1 118 ? 26.471  -10.342 -10.338 1.00 0.00 ? 296 SER A CB   6  
ATOM 10530 O OG   . SER A 1 118 ? 26.751  -10.747 -9.009  1.00 0.00 ? 296 SER A OG   6  
ATOM 10531 H H    . SER A 1 118 ? 28.962  -10.095 -10.916 1.00 0.00 ? 296 SER A H    6  
ATOM 10532 H HA   . SER A 1 118 ? 27.324  -12.209 -10.943 1.00 0.00 ? 296 SER A HA   6  
ATOM 10533 H HB2  . SER A 1 118 ? 26.776  -9.314  -10.460 1.00 0.00 ? 296 SER A HB2  6  
ATOM 10534 H HB3  . SER A 1 118 ? 25.408  -10.425 -10.511 1.00 0.00 ? 296 SER A HB3  6  
ATOM 10535 H HG   . SER A 1 118 ? 27.454  -10.202 -8.650  1.00 0.00 ? 296 SER A HG   6  
ATOM 10536 N N    . GLY A 1 119 ? 26.208  -12.517 -13.129 1.00 0.00 ? 297 GLY A N    6  
ATOM 10537 C CA   . GLY A 1 119 ? 25.466  -12.709 -14.361 1.00 0.00 ? 297 GLY A CA   6  
ATOM 10538 C C    . GLY A 1 119 ? 24.610  -13.960 -14.333 1.00 0.00 ? 297 GLY A C    6  
ATOM 10539 O O    . GLY A 1 119 ? 24.995  -14.971 -13.746 1.00 0.00 ? 297 GLY A O    6  
ATOM 10540 H H    . GLY A 1 119 ? 26.554  -13.293 -12.640 1.00 0.00 ? 297 GLY A H    6  
ATOM 10541 H HA2  . GLY A 1 119 ? 24.829  -11.853 -14.523 1.00 0.00 ? 297 GLY A HA2  6  
ATOM 10542 H HA3  . GLY A 1 119 ? 26.166  -12.785 -15.181 1.00 0.00 ? 297 GLY A HA3  6  
ATOM 10543 N N    . GLY A 1 1   ? -15.112 18.271  -12.606 1.00 0.00 ? 179 GLY A N    7  
ATOM 10544 C CA   . GLY A 1 1   ? -14.856 18.657  -11.230 1.00 0.00 ? 179 GLY A CA   7  
ATOM 10545 C C    . GLY A 1 1   ? -16.129 18.976  -10.472 1.00 0.00 ? 179 GLY A C    7  
ATOM 10546 O O    . GLY A 1 1   ? -17.189 19.155  -11.072 1.00 0.00 ? 179 GLY A O    7  
ATOM 10547 H H1   . GLY A 1 1   ? -14.759 17.422  -12.948 1.00 0.00 ? 179 GLY A H1   7  
ATOM 10548 H HA2  . GLY A 1 1   ? -14.344 17.849  -10.730 1.00 0.00 ? 179 GLY A HA2  7  
ATOM 10549 H HA3  . GLY A 1 1   ? -14.221 19.531  -11.226 1.00 0.00 ? 179 GLY A HA3  7  
ATOM 10550 N N    . SER A 1 2   ? -16.026 19.045  -9.148  1.00 0.00 ? 180 SER A N    7  
ATOM 10551 C CA   . SER A 1 2   ? -17.180 19.339  -8.306  1.00 0.00 ? 180 SER A CA   7  
ATOM 10552 C C    . SER A 1 2   ? -16.876 20.489  -7.350  1.00 0.00 ? 180 SER A C    7  
ATOM 10553 O O    . SER A 1 2   ? -15.908 20.440  -6.591  1.00 0.00 ? 180 SER A O    7  
ATOM 10554 C CB   . SER A 1 2   ? -17.589 18.096  -7.513  1.00 0.00 ? 180 SER A CB   7  
ATOM 10555 O OG   . SER A 1 2   ? -18.739 18.349  -6.726  1.00 0.00 ? 180 SER A OG   7  
ATOM 10556 H H    . SER A 1 2   ? -15.154 18.893  -8.729  1.00 0.00 ? 180 SER A H    7  
ATOM 10557 H HA   . SER A 1 2   ? -17.996 19.629  -8.951  1.00 0.00 ? 180 SER A HA   7  
ATOM 10558 H HB2  . SER A 1 2   ? -17.807 17.291  -8.198  1.00 0.00 ? 180 SER A HB2  7  
ATOM 10559 H HB3  . SER A 1 2   ? -16.777 17.805  -6.862  1.00 0.00 ? 180 SER A HB3  7  
ATOM 10560 H HG   . SER A 1 2   ? -19.285 19.009  -7.159  1.00 0.00 ? 180 SER A HG   7  
ATOM 10561 N N    . SER A 1 3   ? -17.710 21.523  -7.394  1.00 0.00 ? 181 SER A N    7  
ATOM 10562 C CA   . SER A 1 3   ? -17.529 22.687  -6.535  1.00 0.00 ? 181 SER A CA   7  
ATOM 10563 C C    . SER A 1 3   ? -18.700 22.836  -5.568  1.00 0.00 ? 181 SER A C    7  
ATOM 10564 O O    . SER A 1 3   ? -19.862 22.797  -5.971  1.00 0.00 ? 181 SER A O    7  
ATOM 10565 C CB   . SER A 1 3   ? -17.388 23.954  -7.381  1.00 0.00 ? 181 SER A CB   7  
ATOM 10566 O OG   . SER A 1 3   ? -16.165 23.956  -8.096  1.00 0.00 ? 181 SER A OG   7  
ATOM 10567 H H    . SER A 1 3   ? -18.463 21.503  -8.021  1.00 0.00 ? 181 SER A H    7  
ATOM 10568 H HA   . SER A 1 3   ? -16.623 22.542  -5.966  1.00 0.00 ? 181 SER A HA   7  
ATOM 10569 H HB2  . SER A 1 3   ? -18.203 24.006  -8.086  1.00 0.00 ? 181 SER A HB2  7  
ATOM 10570 H HB3  . SER A 1 3   ? -17.415 24.820  -6.735  1.00 0.00 ? 181 SER A HB3  7  
ATOM 10571 H HG   . SER A 1 3   ? -16.216 24.589  -8.816  1.00 0.00 ? 181 SER A HG   7  
ATOM 10572 N N    . GLY A 1 4   ? -18.384 23.005  -4.287  1.00 0.00 ? 182 GLY A N    7  
ATOM 10573 C CA   . GLY A 1 4   ? -19.419 23.157  -3.282  1.00 0.00 ? 182 GLY A CA   7  
ATOM 10574 C C    . GLY A 1 4   ? -19.938 21.824  -2.778  1.00 0.00 ? 182 GLY A C    7  
ATOM 10575 O O    . GLY A 1 4   ? -19.859 20.815  -3.478  1.00 0.00 ? 182 GLY A O    7  
ATOM 10576 H H    . GLY A 1 4   ? -17.440 23.028  -4.024  1.00 0.00 ? 182 GLY A H    7  
ATOM 10577 H HA2  . GLY A 1 4   ? -19.018 23.714  -2.448  1.00 0.00 ? 182 GLY A HA2  7  
ATOM 10578 H HA3  . GLY A 1 4   ? -20.242 23.711  -3.709  1.00 0.00 ? 182 GLY A HA3  7  
ATOM 10579 N N    . SER A 1 5   ? -20.468 21.820  -1.559  1.00 0.00 ? 183 SER A N    7  
ATOM 10580 C CA   . SER A 1 5   ? -20.996 20.600  -0.960  1.00 0.00 ? 183 SER A CA   7  
ATOM 10581 C C    . SER A 1 5   ? -22.501 20.491  -1.186  1.00 0.00 ? 183 SER A C    7  
ATOM 10582 O O    . SER A 1 5   ? -23.293 21.109  -0.476  1.00 0.00 ? 183 SER A O    7  
ATOM 10583 C CB   . SER A 1 5   ? -20.691 20.570  0.539   1.00 0.00 ? 183 SER A CB   7  
ATOM 10584 O OG   . SER A 1 5   ? -21.203 21.722  1.187   1.00 0.00 ? 183 SER A OG   7  
ATOM 10585 H H    . SER A 1 5   ? -20.502 22.657  -1.050  1.00 0.00 ? 183 SER A H    7  
ATOM 10586 H HA   . SER A 1 5   ? -20.510 19.761  -1.434  1.00 0.00 ? 183 SER A HA   7  
ATOM 10587 H HB2  . SER A 1 5   ? -21.143 19.694  0.978   1.00 0.00 ? 183 SER A HB2  7  
ATOM 10588 H HB3  . SER A 1 5   ? -19.621 20.535  0.686   1.00 0.00 ? 183 SER A HB3  7  
ATOM 10589 H HG   . SER A 1 5   ? -21.997 22.018  0.735   1.00 0.00 ? 183 SER A HG   7  
ATOM 10590 N N    . SER A 1 6   ? -22.887 19.700  -2.182  1.00 0.00 ? 184 SER A N    7  
ATOM 10591 C CA   . SER A 1 6   ? -24.296 19.512  -2.506  1.00 0.00 ? 184 SER A CA   7  
ATOM 10592 C C    . SER A 1 6   ? -24.566 18.075  -2.943  1.00 0.00 ? 184 SER A C    7  
ATOM 10593 O O    . SER A 1 6   ? -23.963 17.580  -3.894  1.00 0.00 ? 184 SER A O    7  
ATOM 10594 C CB   . SER A 1 6   ? -24.721 20.481  -3.612  1.00 0.00 ? 184 SER A CB   7  
ATOM 10595 O OG   . SER A 1 6   ? -24.000 20.238  -4.807  1.00 0.00 ? 184 SER A OG   7  
ATOM 10596 H H    . SER A 1 6   ? -22.207 19.234  -2.713  1.00 0.00 ? 184 SER A H    7  
ATOM 10597 H HA   . SER A 1 6   ? -24.871 19.719  -1.617  1.00 0.00 ? 184 SER A HA   7  
ATOM 10598 H HB2  . SER A 1 6   ? -25.774 20.357  -3.809  1.00 0.00 ? 184 SER A HB2  7  
ATOM 10599 H HB3  . SER A 1 6   ? -24.531 21.494  -3.290  1.00 0.00 ? 184 SER A HB3  7  
ATOM 10600 H HG   . SER A 1 6   ? -24.452 20.655  -5.544  1.00 0.00 ? 184 SER A HG   7  
ATOM 10601 N N    . GLY A 1 7   ? -25.477 17.410  -2.239  1.00 0.00 ? 185 GLY A N    7  
ATOM 10602 C CA   . GLY A 1 7   ? -25.811 16.037  -2.568  1.00 0.00 ? 185 GLY A CA   7  
ATOM 10603 C C    . GLY A 1 7   ? -24.664 15.082  -2.305  1.00 0.00 ? 185 GLY A C    7  
ATOM 10604 O O    . GLY A 1 7   ? -23.623 15.479  -1.781  1.00 0.00 ? 185 GLY A O    7  
ATOM 10605 H H    . GLY A 1 7   ? -25.926 17.856  -1.490  1.00 0.00 ? 185 GLY A H    7  
ATOM 10606 H HA2  . GLY A 1 7   ? -26.661 15.733  -1.975  1.00 0.00 ? 185 GLY A HA2  7  
ATOM 10607 H HA3  . GLY A 1 7   ? -26.077 15.983  -3.613  1.00 0.00 ? 185 GLY A HA3  7  
ATOM 10608 N N    . LYS A 1 8   ? -24.853 13.818  -2.669  1.00 0.00 ? 186 LYS A N    7  
ATOM 10609 C CA   . LYS A 1 8   ? -23.826 12.802  -2.470  1.00 0.00 ? 186 LYS A CA   7  
ATOM 10610 C C    . LYS A 1 8   ? -23.537 12.058  -3.770  1.00 0.00 ? 186 LYS A C    7  
ATOM 10611 O O    . LYS A 1 8   ? -24.415 11.910  -4.619  1.00 0.00 ? 186 LYS A O    7  
ATOM 10612 C CB   . LYS A 1 8   ? -24.262 11.811  -1.389  1.00 0.00 ? 186 LYS A CB   7  
ATOM 10613 C CG   . LYS A 1 8   ? -23.103 11.191  -0.628  1.00 0.00 ? 186 LYS A CG   7  
ATOM 10614 C CD   . LYS A 1 8   ? -22.680 12.058  0.546   1.00 0.00 ? 186 LYS A CD   7  
ATOM 10615 C CE   . LYS A 1 8   ? -21.644 11.356  1.412   1.00 0.00 ? 186 LYS A CE   7  
ATOM 10616 N NZ   . LYS A 1 8   ? -20.791 12.327  2.151   1.00 0.00 ? 186 LYS A NZ   7  
ATOM 10617 H H    . LYS A 1 8   ? -25.705 13.562  -3.082  1.00 0.00 ? 186 LYS A H    7  
ATOM 10618 H HA   . LYS A 1 8   ? -22.924 13.300  -2.147  1.00 0.00 ? 186 LYS A HA   7  
ATOM 10619 H HB2  . LYS A 1 8   ? -24.897 12.324  -0.682  1.00 0.00 ? 186 LYS A HB2  7  
ATOM 10620 H HB3  . LYS A 1 8   ? -24.826 11.015  -1.854  1.00 0.00 ? 186 LYS A HB3  7  
ATOM 10621 H HG2  . LYS A 1 8   ? -23.404 10.223  -0.257  1.00 0.00 ? 186 LYS A HG2  7  
ATOM 10622 H HG3  . LYS A 1 8   ? -22.264 11.076  -1.300  1.00 0.00 ? 186 LYS A HG3  7  
ATOM 10623 H HD2  . LYS A 1 8   ? -22.255 12.976  0.170   1.00 0.00 ? 186 LYS A HD2  7  
ATOM 10624 H HD3  . LYS A 1 8   ? -23.549 12.281  1.149   1.00 0.00 ? 186 LYS A HD3  7  
ATOM 10625 H HE2  . LYS A 1 8   ? -22.156 10.726  2.123   1.00 0.00 ? 186 LYS A HE2  7  
ATOM 10626 H HE3  . LYS A 1 8   ? -21.017 10.748  0.778   1.00 0.00 ? 186 LYS A HE3  7  
ATOM 10627 H HZ1  . LYS A 1 8   ? -21.364 13.131  2.476   1.00 0.00 ? 186 LYS A HZ1  7  
ATOM 10628 H HZ2  . LYS A 1 8   ? -20.035 12.682  1.531   1.00 0.00 ? 186 LYS A HZ2  7  
ATOM 10629 H HZ3  . LYS A 1 8   ? -20.359 11.866  2.977   1.00 0.00 ? 186 LYS A HZ3  7  
ATOM 10630 N N    . ASN A 1 9   ? -22.302 11.592  -3.918  1.00 0.00 ? 187 ASN A N    7  
ATOM 10631 C CA   . ASN A 1 9   ? -21.898 10.863  -5.115  1.00 0.00 ? 187 ASN A CA   7  
ATOM 10632 C C    . ASN A 1 9   ? -22.509 9.465   -5.132  1.00 0.00 ? 187 ASN A C    7  
ATOM 10633 O O    . ASN A 1 9   ? -22.537 8.775   -4.112  1.00 0.00 ? 187 ASN A O    7  
ATOM 10634 C CB   . ASN A 1 9   ? -20.373 10.766  -5.189  1.00 0.00 ? 187 ASN A CB   7  
ATOM 10635 C CG   . ASN A 1 9   ? -19.720 12.109  -5.449  1.00 0.00 ? 187 ASN A CG   7  
ATOM 10636 O OD1  . ASN A 1 9   ? -18.953 12.609  -4.625  1.00 0.00 ? 187 ASN A OD1  7  
ATOM 10637 N ND2  . ASN A 1 9   ? -20.023 12.702  -6.598  1.00 0.00 ? 187 ASN A ND2  7  
ATOM 10638 H H    . ASN A 1 9   ? -21.645 11.742  -3.206  1.00 0.00 ? 187 ASN A H    7  
ATOM 10639 H HA   . ASN A 1 9   ? -22.257 11.410  -5.973  1.00 0.00 ? 187 ASN A HA   7  
ATOM 10640 H HB2  . ASN A 1 9   ? -19.997 10.380  -4.252  1.00 0.00 ? 187 ASN A HB2  7  
ATOM 10641 H HB3  . ASN A 1 9   ? -20.099 10.092  -5.987  1.00 0.00 ? 187 ASN A HB3  7  
ATOM 10642 H HD21 . ASN A 1 9   ? -20.642 12.245  -7.205  1.00 0.00 ? 187 ASN A HD21 7  
ATOM 10643 H HD22 . ASN A 1 9   ? -19.615 13.571  -6.792  1.00 0.00 ? 187 ASN A HD22 7  
ATOM 10644 N N    . VAL A 1 10  ? -22.998 9.052   -6.297  1.00 0.00 ? 188 VAL A N    7  
ATOM 10645 C CA   . VAL A 1 10  ? -23.607 7.736   -6.448  1.00 0.00 ? 188 VAL A CA   7  
ATOM 10646 C C    . VAL A 1 10  ? -22.738 6.653   -5.819  1.00 0.00 ? 188 VAL A C    7  
ATOM 10647 O O    . VAL A 1 10  ? -23.124 6.030   -4.830  1.00 0.00 ? 188 VAL A O    7  
ATOM 10648 C CB   . VAL A 1 10  ? -23.842 7.393   -7.931  1.00 0.00 ? 188 VAL A CB   7  
ATOM 10649 C CG1  . VAL A 1 10  ? -24.451 6.006   -8.069  1.00 0.00 ? 188 VAL A CG1  7  
ATOM 10650 C CG2  . VAL A 1 10  ? -24.729 8.441   -8.586  1.00 0.00 ? 188 VAL A CG2  7  
ATOM 10651 H H    . VAL A 1 10  ? -22.947 9.647   -7.074  1.00 0.00 ? 188 VAL A H    7  
ATOM 10652 H HA   . VAL A 1 10  ? -24.565 7.752   -5.948  1.00 0.00 ? 188 VAL A HA   7  
ATOM 10653 H HB   . VAL A 1 10  ? -22.887 7.394   -8.436  1.00 0.00 ? 188 VAL A HB   7  
ATOM 10654 H HG11 . VAL A 1 10  ? -24.696 5.622   -7.089  1.00 0.00 ? 188 VAL A HG11 7  
ATOM 10655 H HG12 . VAL A 1 10  ? -25.346 6.064   -8.669  1.00 0.00 ? 188 VAL A HG12 7  
ATOM 10656 H HG13 . VAL A 1 10  ? -23.739 5.347   -8.544  1.00 0.00 ? 188 VAL A HG13 7  
ATOM 10657 H HG21 . VAL A 1 10  ? -24.111 9.192   -9.056  1.00 0.00 ? 188 VAL A HG21 7  
ATOM 10658 H HG22 . VAL A 1 10  ? -25.353 7.970   -9.332  1.00 0.00 ? 188 VAL A HG22 7  
ATOM 10659 H HG23 . VAL A 1 10  ? -25.352 8.905   -7.836  1.00 0.00 ? 188 VAL A HG23 7  
ATOM 10660 N N    . ASN A 1 11  ? -21.562 6.434   -6.398  1.00 0.00 ? 189 ASN A N    7  
ATOM 10661 C CA   . ASN A 1 11  ? -20.638 5.425   -5.894  1.00 0.00 ? 189 ASN A CA   7  
ATOM 10662 C C    . ASN A 1 11  ? -19.381 6.076   -5.323  1.00 0.00 ? 189 ASN A C    7  
ATOM 10663 O O    . ASN A 1 11  ? -18.267 5.609   -5.558  1.00 0.00 ? 189 ASN A O    7  
ATOM 10664 C CB   . ASN A 1 11  ? -20.258 4.448   -7.009  1.00 0.00 ? 189 ASN A CB   7  
ATOM 10665 C CG   . ASN A 1 11  ? -21.467 3.954   -7.780  1.00 0.00 ? 189 ASN A CG   7  
ATOM 10666 O OD1  . ASN A 1 11  ? -22.588 3.966   -7.273  1.00 0.00 ? 189 ASN A OD1  7  
ATOM 10667 N ND2  . ASN A 1 11  ? -21.242 3.515   -9.013  1.00 0.00 ? 189 ASN A ND2  7  
ATOM 10668 H H    . ASN A 1 11  ? -21.311 6.963   -7.184  1.00 0.00 ? 189 ASN A H    7  
ATOM 10669 H HA   . ASN A 1 11  ? -21.137 4.882   -5.106  1.00 0.00 ? 189 ASN A HA   7  
ATOM 10670 H HB2  . ASN A 1 11  ? -19.591 4.942   -7.701  1.00 0.00 ? 189 ASN A HB2  7  
ATOM 10671 H HB3  . ASN A 1 11  ? -19.756 3.596   -6.577  1.00 0.00 ? 189 ASN A HB3  7  
ATOM 10672 H HD21 . ASN A 1 11  ? -20.322 3.534   -9.352  1.00 0.00 ? 189 ASN A HD21 7  
ATOM 10673 H HD22 . ASN A 1 11  ? -22.006 3.190   -9.535  1.00 0.00 ? 189 ASN A HD22 7  
ATOM 10674 N N    . ARG A 1 12  ? -19.570 7.156   -4.572  1.00 0.00 ? 190 ARG A N    7  
ATOM 10675 C CA   . ARG A 1 12  ? -18.452 7.871   -3.968  1.00 0.00 ? 190 ARG A CA   7  
ATOM 10676 C C    . ARG A 1 12  ? -17.275 7.957   -4.935  1.00 0.00 ? 190 ARG A C    7  
ATOM 10677 O O    . ARG A 1 12  ? -16.116 7.904   -4.525  1.00 0.00 ? 190 ARG A O    7  
ATOM 10678 C CB   . ARG A 1 12  ? -18.015 7.179   -2.676  1.00 0.00 ? 190 ARG A CB   7  
ATOM 10679 C CG   . ARG A 1 12  ? -19.173 6.648   -1.847  1.00 0.00 ? 190 ARG A CG   7  
ATOM 10680 C CD   . ARG A 1 12  ? -18.748 5.468   -0.987  1.00 0.00 ? 190 ARG A CD   7  
ATOM 10681 N NE   . ARG A 1 12  ? -19.875 4.605   -0.647  1.00 0.00 ? 190 ARG A NE   7  
ATOM 10682 C CZ   . ARG A 1 12  ? -20.687 4.826   0.381   1.00 0.00 ? 190 ARG A CZ   7  
ATOM 10683 N NH1  . ARG A 1 12  ? -20.497 5.879   1.164   1.00 0.00 ? 190 ARG A NH1  7  
ATOM 10684 N NH2  . ARG A 1 12  ? -21.692 3.995   0.626   1.00 0.00 ? 190 ARG A NH2  7  
ATOM 10685 H H    . ARG A 1 12  ? -20.482 7.480   -4.421  1.00 0.00 ? 190 ARG A H    7  
ATOM 10686 H HA   . ARG A 1 12  ? -18.785 8.871   -3.735  1.00 0.00 ? 190 ARG A HA   7  
ATOM 10687 H HB2  . ARG A 1 12  ? -17.370 6.350   -2.926  1.00 0.00 ? 190 ARG A HB2  7  
ATOM 10688 H HB3  . ARG A 1 12  ? -17.463 7.885   -2.073  1.00 0.00 ? 190 ARG A HB3  7  
ATOM 10689 H HG2  . ARG A 1 12  ? -19.534 7.437   -1.203  1.00 0.00 ? 190 ARG A HG2  7  
ATOM 10690 H HG3  . ARG A 1 12  ? -19.964 6.333   -2.511  1.00 0.00 ? 190 ARG A HG3  7  
ATOM 10691 H HD2  . ARG A 1 12  ? -18.015 4.890   -1.530  1.00 0.00 ? 190 ARG A HD2  7  
ATOM 10692 H HD3  . ARG A 1 12  ? -18.307 5.844   -0.077  1.00 0.00 ? 190 ARG A HD3  7  
ATOM 10693 H HE   . ARG A 1 12  ? -20.034 3.821   -1.213  1.00 0.00 ? 190 ARG A HE   7  
ATOM 10694 H HH11 . ARG A 1 12  ? -19.742 6.508   0.981   1.00 0.00 ? 190 ARG A HH11 7  
ATOM 10695 H HH12 . ARG A 1 12  ? -21.111 6.045   1.937   1.00 0.00 ? 190 ARG A HH12 7  
ATOM 10696 H HH21 . ARG A 1 12  ? -21.838 3.200   0.037   1.00 0.00 ? 190 ARG A HH21 7  
ATOM 10697 H HH22 . ARG A 1 12  ? -22.302 4.163   1.399   1.00 0.00 ? 190 ARG A HH22 7  
ATOM 10698 N N    . VAL A 1 13  ? -17.582 8.089   -6.222  1.00 0.00 ? 191 VAL A N    7  
ATOM 10699 C CA   . VAL A 1 13  ? -16.550 8.183   -7.248  1.00 0.00 ? 191 VAL A CA   7  
ATOM 10700 C C    . VAL A 1 13  ? -15.372 7.270   -6.927  1.00 0.00 ? 191 VAL A C    7  
ATOM 10701 O O    . VAL A 1 13  ? -14.214 7.633   -7.142  1.00 0.00 ? 191 VAL A O    7  
ATOM 10702 C CB   . VAL A 1 13  ? -16.039 9.628   -7.400  1.00 0.00 ? 191 VAL A CB   7  
ATOM 10703 C CG1  . VAL A 1 13  ? -15.439 9.840   -8.782  1.00 0.00 ? 191 VAL A CG1  7  
ATOM 10704 C CG2  . VAL A 1 13  ? -17.163 10.620  -7.140  1.00 0.00 ? 191 VAL A CG2  7  
ATOM 10705 H H    . VAL A 1 13  ? -18.524 8.126   -6.488  1.00 0.00 ? 191 VAL A H    7  
ATOM 10706 H HA   . VAL A 1 13  ? -16.985 7.877   -8.188  1.00 0.00 ? 191 VAL A HA   7  
ATOM 10707 H HB   . VAL A 1 13  ? -15.264 9.794   -6.666  1.00 0.00 ? 191 VAL A HB   7  
ATOM 10708 H HG11 . VAL A 1 13  ? -15.615 10.858  -9.098  1.00 0.00 ? 191 VAL A HG11 7  
ATOM 10709 H HG12 . VAL A 1 13  ? -14.376 9.652   -8.745  1.00 0.00 ? 191 VAL A HG12 7  
ATOM 10710 H HG13 . VAL A 1 13  ? -15.901 9.161   -9.483  1.00 0.00 ? 191 VAL A HG13 7  
ATOM 10711 H HG21 . VAL A 1 13  ? -16.806 11.623  -7.323  1.00 0.00 ? 191 VAL A HG21 7  
ATOM 10712 H HG22 . VAL A 1 13  ? -17.991 10.407  -7.800  1.00 0.00 ? 191 VAL A HG22 7  
ATOM 10713 H HG23 . VAL A 1 13  ? -17.489 10.535  -6.115  1.00 0.00 ? 191 VAL A HG23 7  
ATOM 10714 N N    . LEU A 1 14  ? -15.673 6.083   -6.413  1.00 0.00 ? 192 LEU A N    7  
ATOM 10715 C CA   . LEU A 1 14  ? -14.639 5.116   -6.062  1.00 0.00 ? 192 LEU A CA   7  
ATOM 10716 C C    . LEU A 1 14  ? -14.396 4.139   -7.208  1.00 0.00 ? 192 LEU A C    7  
ATOM 10717 O O    . LEU A 1 14  ? -15.061 3.108   -7.309  1.00 0.00 ? 192 LEU A O    7  
ATOM 10718 C CB   . LEU A 1 14  ? -15.036 4.350   -4.799  1.00 0.00 ? 192 LEU A CB   7  
ATOM 10719 C CG   . LEU A 1 14  ? -13.884 3.866   -3.918  1.00 0.00 ? 192 LEU A CG   7  
ATOM 10720 C CD1  . LEU A 1 14  ? -13.511 4.928   -2.895  1.00 0.00 ? 192 LEU A CD1  7  
ATOM 10721 C CD2  . LEU A 1 14  ? -14.253 2.562   -3.226  1.00 0.00 ? 192 LEU A CD2  7  
ATOM 10722 H H    . LEU A 1 14  ? -16.613 5.851   -6.264  1.00 0.00 ? 192 LEU A H    7  
ATOM 10723 H HA   . LEU A 1 14  ? -13.727 5.662   -5.871  1.00 0.00 ? 192 LEU A HA   7  
ATOM 10724 H HB2  . LEU A 1 14  ? -15.659 4.998   -4.202  1.00 0.00 ? 192 LEU A HB2  7  
ATOM 10725 H HB3  . LEU A 1 14  ? -15.607 3.485   -5.104  1.00 0.00 ? 192 LEU A HB3  7  
ATOM 10726 H HG   . LEU A 1 14  ? -13.017 3.682   -4.538  1.00 0.00 ? 192 LEU A HG   7  
ATOM 10727 H HD11 . LEU A 1 14  ? -14.073 4.766   -1.988  1.00 0.00 ? 192 LEU A HD11 7  
ATOM 10728 H HD12 . LEU A 1 14  ? -13.740 5.906   -3.292  1.00 0.00 ? 192 LEU A HD12 7  
ATOM 10729 H HD13 . LEU A 1 14  ? -12.454 4.865   -2.681  1.00 0.00 ? 192 LEU A HD13 7  
ATOM 10730 H HD21 . LEU A 1 14  ? -14.089 1.737   -3.903  1.00 0.00 ? 192 LEU A HD21 7  
ATOM 10731 H HD22 . LEU A 1 14  ? -15.295 2.590   -2.939  1.00 0.00 ? 192 LEU A HD22 7  
ATOM 10732 H HD23 . LEU A 1 14  ? -13.640 2.435   -2.346  1.00 0.00 ? 192 LEU A HD23 7  
ATOM 10733 N N    . SER A 1 15  ? -13.439 4.470   -8.069  1.00 0.00 ? 193 SER A N    7  
ATOM 10734 C CA   . SER A 1 15  ? -13.109 3.622   -9.209  1.00 0.00 ? 193 SER A CA   7  
ATOM 10735 C C    . SER A 1 15  ? -11.620 3.702   -9.532  1.00 0.00 ? 193 SER A C    7  
ATOM 10736 O O    . SER A 1 15  ? -10.998 4.754   -9.388  1.00 0.00 ? 193 SER A O    7  
ATOM 10737 C CB   . SER A 1 15  ? -13.931 4.034   -10.431 1.00 0.00 ? 193 SER A CB   7  
ATOM 10738 O OG   . SER A 1 15  ? -15.317 3.850   -10.200 1.00 0.00 ? 193 SER A OG   7  
ATOM 10739 H H    . SER A 1 15  ? -12.944 5.306   -7.935  1.00 0.00 ? 193 SER A H    7  
ATOM 10740 H HA   . SER A 1 15  ? -13.355 2.604   -8.946  1.00 0.00 ? 193 SER A HA   7  
ATOM 10741 H HB2  . SER A 1 15  ? -13.750 5.075   -10.650 1.00 0.00 ? 193 SER A HB2  7  
ATOM 10742 H HB3  . SER A 1 15  ? -13.637 3.431   -11.279 1.00 0.00 ? 193 SER A HB3  7  
ATOM 10743 H HG   . SER A 1 15  ? -15.491 2.924   -10.018 1.00 0.00 ? 193 SER A HG   7  
ATOM 10744 N N    . ALA A 1 16  ? -11.056 2.581   -9.970  1.00 0.00 ? 194 ALA A N    7  
ATOM 10745 C CA   . ALA A 1 16  ? -9.641  2.524   -10.317 1.00 0.00 ? 194 ALA A CA   7  
ATOM 10746 C C    . ALA A 1 16  ? -9.288  3.577   -11.361 1.00 0.00 ? 194 ALA A C    7  
ATOM 10747 O O    . ALA A 1 16  ? -8.217  4.181   -11.308 1.00 0.00 ? 194 ALA A O    7  
ATOM 10748 C CB   . ALA A 1 16  ? -9.278  1.135   -10.822 1.00 0.00 ? 194 ALA A CB   7  
ATOM 10749 H H    . ALA A 1 16  ? -11.604 1.775   -10.065 1.00 0.00 ? 194 ALA A H    7  
ATOM 10750 H HA   . ALA A 1 16  ? -9.070  2.714   -9.420  1.00 0.00 ? 194 ALA A HA   7  
ATOM 10751 H HB1  . ALA A 1 16  ? -9.549  1.050   -11.864 1.00 0.00 ? 194 ALA A HB1  7  
ATOM 10752 H HB2  . ALA A 1 16  ? -8.215  0.979   -10.712 1.00 0.00 ? 194 ALA A HB2  7  
ATOM 10753 H HB3  . ALA A 1 16  ? -9.812  0.393   -10.249 1.00 0.00 ? 194 ALA A HB3  7  
ATOM 10754 N N    . GLU A 1 17  ? -10.195 3.792   -12.308 1.00 0.00 ? 195 GLU A N    7  
ATOM 10755 C CA   . GLU A 1 17  ? -9.977  4.773   -13.365 1.00 0.00 ? 195 GLU A CA   7  
ATOM 10756 C C    . GLU A 1 17  ? -10.072 6.194   -12.818 1.00 0.00 ? 195 GLU A C    7  
ATOM 10757 O O    . GLU A 1 17  ? -9.737  7.159   -13.504 1.00 0.00 ? 195 GLU A O    7  
ATOM 10758 C CB   . GLU A 1 17  ? -10.996 4.579   -14.490 1.00 0.00 ? 195 GLU A CB   7  
ATOM 10759 C CG   . GLU A 1 17  ? -12.436 4.780   -14.048 1.00 0.00 ? 195 GLU A CG   7  
ATOM 10760 C CD   . GLU A 1 17  ? -13.435 4.411   -15.128 1.00 0.00 ? 195 GLU A CD   7  
ATOM 10761 O OE1  . GLU A 1 17  ? -13.403 3.254   -15.596 1.00 0.00 ? 195 GLU A OE1  7  
ATOM 10762 O OE2  . GLU A 1 17  ? -14.249 5.280   -15.504 1.00 0.00 ? 195 GLU A OE2  7  
ATOM 10763 H H    . GLU A 1 17  ? -11.030 3.280   -12.297 1.00 0.00 ? 195 GLU A H    7  
ATOM 10764 H HA   . GLU A 1 17  ? -8.984  4.619   -13.761 1.00 0.00 ? 195 GLU A HA   7  
ATOM 10765 H HB2  . GLU A 1 17  ? -10.781 5.284   -15.280 1.00 0.00 ? 195 GLU A HB2  7  
ATOM 10766 H HB3  . GLU A 1 17  ? -10.898 3.576   -14.879 1.00 0.00 ? 195 GLU A HB3  7  
ATOM 10767 H HG2  . GLU A 1 17  ? -12.622 4.164   -13.181 1.00 0.00 ? 195 GLU A HG2  7  
ATOM 10768 H HG3  . GLU A 1 17  ? -12.577 5.819   -13.787 1.00 0.00 ? 195 GLU A HG3  7  
ATOM 10769 N N    . ALA A 1 18  ? -10.532 6.314   -11.577 1.00 0.00 ? 196 ALA A N    7  
ATOM 10770 C CA   . ALA A 1 18  ? -10.671 7.615   -10.935 1.00 0.00 ? 196 ALA A CA   7  
ATOM 10771 C C    . ALA A 1 18  ? -9.406  7.987   -10.169 1.00 0.00 ? 196 ALA A C    7  
ATOM 10772 O O    . ALA A 1 18  ? -9.144  9.164   -9.916  1.00 0.00 ? 196 ALA A O    7  
ATOM 10773 C CB   . ALA A 1 18  ? -11.875 7.620   -10.005 1.00 0.00 ? 196 ALA A CB   7  
ATOM 10774 H H    . ALA A 1 18  ? -10.783 5.507   -11.080 1.00 0.00 ? 196 ALA A H    7  
ATOM 10775 H HA   . ALA A 1 18  ? -10.841 8.352   -11.708 1.00 0.00 ? 196 ALA A HA   7  
ATOM 10776 H HB1  . ALA A 1 18  ? -11.692 6.949   -9.178  1.00 0.00 ? 196 ALA A HB1  7  
ATOM 10777 H HB2  . ALA A 1 18  ? -12.036 8.620   -9.630  1.00 0.00 ? 196 ALA A HB2  7  
ATOM 10778 H HB3  . ALA A 1 18  ? -12.750 7.293   -10.547 1.00 0.00 ? 196 ALA A HB3  7  
ATOM 10779 N N    . LEU A 1 19  ? -8.625  6.978   -9.801  1.00 0.00 ? 197 LEU A N    7  
ATOM 10780 C CA   . LEU A 1 19  ? -7.387  7.198   -9.062  1.00 0.00 ? 197 LEU A CA   7  
ATOM 10781 C C    . LEU A 1 19  ? -6.356  7.915   -9.928  1.00 0.00 ? 197 LEU A C    7  
ATOM 10782 O O    . LEU A 1 19  ? -6.477  7.954   -11.152 1.00 0.00 ? 197 LEU A O    7  
ATOM 10783 C CB   . LEU A 1 19  ? -6.819  5.866   -8.570  1.00 0.00 ? 197 LEU A CB   7  
ATOM 10784 C CG   . LEU A 1 19  ? -7.511  5.249   -7.354  1.00 0.00 ? 197 LEU A CG   7  
ATOM 10785 C CD1  . LEU A 1 19  ? -6.662  4.132   -6.767  1.00 0.00 ? 197 LEU A CD1  7  
ATOM 10786 C CD2  . LEU A 1 19  ? -7.794  6.314   -6.304  1.00 0.00 ? 197 LEU A CD2  7  
ATOM 10787 H H    . LEU A 1 19  ? -8.886  6.062   -10.031 1.00 0.00 ? 197 LEU A H    7  
ATOM 10788 H HA   . LEU A 1 19  ? -7.617  7.819   -8.208  1.00 0.00 ? 197 LEU A HA   7  
ATOM 10789 H HB2  . LEU A 1 19  ? -6.885  5.158   -9.382  1.00 0.00 ? 197 LEU A HB2  7  
ATOM 10790 H HB3  . LEU A 1 19  ? -5.780  6.023   -8.317  1.00 0.00 ? 197 LEU A HB3  7  
ATOM 10791 H HG   . LEU A 1 19  ? -8.455  4.823   -7.663  1.00 0.00 ? 197 LEU A HG   7  
ATOM 10792 H HD11 . LEU A 1 19  ? -5.695  4.522   -6.488  1.00 0.00 ? 197 LEU A HD11 7  
ATOM 10793 H HD12 . LEU A 1 19  ? -6.536  3.351   -7.502  1.00 0.00 ? 197 LEU A HD12 7  
ATOM 10794 H HD13 . LEU A 1 19  ? -7.153  3.727   -5.894  1.00 0.00 ? 197 LEU A HD13 7  
ATOM 10795 H HD21 . LEU A 1 19  ? -7.914  5.844   -5.339  1.00 0.00 ? 197 LEU A HD21 7  
ATOM 10796 H HD22 . LEU A 1 19  ? -8.700  6.841   -6.563  1.00 0.00 ? 197 LEU A HD22 7  
ATOM 10797 H HD23 . LEU A 1 19  ? -6.969  7.010   -6.266  1.00 0.00 ? 197 LEU A HD23 7  
ATOM 10798 N N    . LYS A 1 20  ? -5.340  8.480   -9.284  1.00 0.00 ? 198 LYS A N    7  
ATOM 10799 C CA   . LYS A 1 20  ? -4.285  9.193   -9.994  1.00 0.00 ? 198 LYS A CA   7  
ATOM 10800 C C    . LYS A 1 20  ? -2.982  9.166   -9.202  1.00 0.00 ? 198 LYS A C    7  
ATOM 10801 O O    . LYS A 1 20  ? -2.974  9.023   -7.979  1.00 0.00 ? 198 LYS A O    7  
ATOM 10802 C CB   . LYS A 1 20  ? -4.706  10.641  -10.255 1.00 0.00 ? 198 LYS A CB   7  
ATOM 10803 C CG   . LYS A 1 20  ? -5.532  10.816  -11.518 1.00 0.00 ? 198 LYS A CG   7  
ATOM 10804 C CD   . LYS A 1 20  ? -5.445  12.237  -12.049 1.00 0.00 ? 198 LYS A CD   7  
ATOM 10805 C CE   . LYS A 1 20  ? -6.062  13.233  -11.079 1.00 0.00 ? 198 LYS A CE   7  
ATOM 10806 N NZ   . LYS A 1 20  ? -5.092  13.665  -10.036 1.00 0.00 ? 198 LYS A NZ   7  
ATOM 10807 H H    . LYS A 1 20  ? -5.299  8.415   -8.306  1.00 0.00 ? 198 LYS A H    7  
ATOM 10808 H HA   . LYS A 1 20  ? -4.128  8.696   -10.940 1.00 0.00 ? 198 LYS A HA   7  
ATOM 10809 H HB2  . LYS A 1 20  ? -5.290  10.990  -9.417  1.00 0.00 ? 198 LYS A HB2  7  
ATOM 10810 H HB3  . LYS A 1 20  ? -3.819  11.251  -10.344 1.00 0.00 ? 198 LYS A HB3  7  
ATOM 10811 H HG2  . LYS A 1 20  ? -5.165  10.137  -12.274 1.00 0.00 ? 198 LYS A HG2  7  
ATOM 10812 H HG3  . LYS A 1 20  ? -6.565  10.586  -11.297 1.00 0.00 ? 198 LYS A HG3  7  
ATOM 10813 H HD2  . LYS A 1 20  ? -4.407  12.493  -12.198 1.00 0.00 ? 198 LYS A HD2  7  
ATOM 10814 H HD3  . LYS A 1 20  ? -5.970  12.292  -12.992 1.00 0.00 ? 198 LYS A HD3  7  
ATOM 10815 H HE2  . LYS A 1 20  ? -6.391  14.098  -11.633 1.00 0.00 ? 198 LYS A HE2  7  
ATOM 10816 H HE3  . LYS A 1 20  ? -6.911  12.769  -10.599 1.00 0.00 ? 198 LYS A HE3  7  
ATOM 10817 H HZ1  . LYS A 1 20  ? -4.151  13.800  -10.457 1.00 0.00 ? 198 LYS A HZ1  7  
ATOM 10818 H HZ2  . LYS A 1 20  ? -5.024  12.944  -9.290  1.00 0.00 ? 198 LYS A HZ2  7  
ATOM 10819 H HZ3  . LYS A 1 20  ? -5.401  14.562  -9.609  1.00 0.00 ? 198 LYS A HZ3  7  
ATOM 10820 N N    . PRO A 1 21  ? -1.853  9.308   -9.913  1.00 0.00 ? 199 PRO A N    7  
ATOM 10821 C CA   . PRO A 1 21  ? -0.524  9.306   -9.295  1.00 0.00 ? 199 PRO A CA   7  
ATOM 10822 C C    . PRO A 1 21  ? -0.270  10.556  -8.459  1.00 0.00 ? 199 PRO A C    7  
ATOM 10823 O O    . PRO A 1 21  ? -0.188  11.663  -8.989  1.00 0.00 ? 199 PRO A O    7  
ATOM 10824 C CB   . PRO A 1 21  ? 0.425   9.265   -10.496 1.00 0.00 ? 199 PRO A CB   7  
ATOM 10825 C CG   . PRO A 1 21  ? -0.354  9.865   -11.615 1.00 0.00 ? 199 PRO A CG   7  
ATOM 10826 C CD   . PRO A 1 21  ? -1.788  9.483   -11.373 1.00 0.00 ? 199 PRO A CD   7  
ATOM 10827 H HA   . PRO A 1 21  ? -0.371  8.428   -8.684  1.00 0.00 ? 199 PRO A HA   7  
ATOM 10828 H HB2  . PRO A 1 21  ? 1.312   9.842   -10.277 1.00 0.00 ? 199 PRO A HB2  7  
ATOM 10829 H HB3  . PRO A 1 21  ? 0.697   8.242   -10.710 1.00 0.00 ? 199 PRO A HB3  7  
ATOM 10830 H HG2  . PRO A 1 21  ? -0.246  10.939  -11.603 1.00 0.00 ? 199 PRO A HG2  7  
ATOM 10831 H HG3  . PRO A 1 21  ? -0.013  9.463   -12.557 1.00 0.00 ? 199 PRO A HG3  7  
ATOM 10832 H HD2  . PRO A 1 21  ? -2.449  10.273  -11.697 1.00 0.00 ? 199 PRO A HD2  7  
ATOM 10833 H HD3  . PRO A 1 21  ? -2.023  8.559   -11.882 1.00 0.00 ? 199 PRO A HD3  7  
ATOM 10834 N N    . GLY A 1 22  ? -0.147  10.370  -7.148  1.00 0.00 ? 200 GLY A N    7  
ATOM 10835 C CA   . GLY A 1 22  ? 0.096   11.492  -6.260  1.00 0.00 ? 200 GLY A CA   7  
ATOM 10836 C C    . GLY A 1 22  ? -0.850  11.509  -5.076  1.00 0.00 ? 200 GLY A C    7  
ATOM 10837 O O    . GLY A 1 22  ? -0.828  12.438  -4.269  1.00 0.00 ? 200 GLY A O    7  
ATOM 10838 H H    . GLY A 1 22  ? -0.222  9.465   -6.781  1.00 0.00 ? 200 GLY A H    7  
ATOM 10839 H HA2  . GLY A 1 22  ? 1.111   11.436  -5.896  1.00 0.00 ? 200 GLY A HA2  7  
ATOM 10840 H HA3  . GLY A 1 22  ? -0.026  12.410  -6.817  1.00 0.00 ? 200 GLY A HA3  7  
ATOM 10841 N N    . MET A 1 23  ? -1.685  10.481  -4.972  1.00 0.00 ? 201 MET A N    7  
ATOM 10842 C CA   . MET A 1 23  ? -2.644  10.382  -3.878  1.00 0.00 ? 201 MET A CA   7  
ATOM 10843 C C    . MET A 1 23  ? -2.043  9.628   -2.695  1.00 0.00 ? 201 MET A C    7  
ATOM 10844 O O    . MET A 1 23  ? -1.475  8.547   -2.859  1.00 0.00 ? 201 MET A O    7  
ATOM 10845 C CB   . MET A 1 23  ? -3.919  9.681   -4.350  1.00 0.00 ? 201 MET A CB   7  
ATOM 10846 C CG   . MET A 1 23  ? -4.856  10.587  -5.132  1.00 0.00 ? 201 MET A CG   7  
ATOM 10847 S SD   . MET A 1 23  ? -6.525  9.915   -5.261  1.00 0.00 ? 201 MET A SD   7  
ATOM 10848 C CE   . MET A 1 23  ? -6.908  10.286  -6.970  1.00 0.00 ? 201 MET A CE   7  
ATOM 10849 H H    . MET A 1 23  ? -1.656  9.770   -5.647  1.00 0.00 ? 201 MET A H    7  
ATOM 10850 H HA   . MET A 1 23  ? -2.890  11.385  -3.562  1.00 0.00 ? 201 MET A HA   7  
ATOM 10851 H HB2  . MET A 1 23  ? -3.646  8.850   -4.982  1.00 0.00 ? 201 MET A HB2  7  
ATOM 10852 H HB3  . MET A 1 23  ? -4.451  9.308   -3.488  1.00 0.00 ? 201 MET A HB3  7  
ATOM 10853 H HG2  . MET A 1 23  ? -4.907  11.545  -4.636  1.00 0.00 ? 201 MET A HG2  7  
ATOM 10854 H HG3  . MET A 1 23  ? -4.458  10.720  -6.127  1.00 0.00 ? 201 MET A HG3  7  
ATOM 10855 H HE1  . MET A 1 23  ? -6.019  10.166  -7.573  1.00 0.00 ? 201 MET A HE1  7  
ATOM 10856 H HE2  . MET A 1 23  ? -7.675  9.611   -7.321  1.00 0.00 ? 201 MET A HE2  7  
ATOM 10857 H HE3  . MET A 1 23  ? -7.260  11.304  -7.048  1.00 0.00 ? 201 MET A HE3  7  
ATOM 10858 N N    . LEU A 1 24  ? -2.171  10.204  -1.505  1.00 0.00 ? 202 LEU A N    7  
ATOM 10859 C CA   . LEU A 1 24  ? -1.641  9.586   -0.295  1.00 0.00 ? 202 LEU A CA   7  
ATOM 10860 C C    . LEU A 1 24  ? -2.696  8.714   0.378   1.00 0.00 ? 202 LEU A C    7  
ATOM 10861 O O    . LEU A 1 24  ? -3.664  9.220   0.948   1.00 0.00 ? 202 LEU A O    7  
ATOM 10862 C CB   . LEU A 1 24  ? -1.154  10.661  0.679   1.00 0.00 ? 202 LEU A CB   7  
ATOM 10863 C CG   . LEU A 1 24  ? -0.108  11.635  0.135   1.00 0.00 ? 202 LEU A CG   7  
ATOM 10864 C CD1  . LEU A 1 24  ? -0.783  12.815  -0.548  1.00 0.00 ? 202 LEU A CD1  7  
ATOM 10865 C CD2  . LEU A 1 24  ? 0.806   12.115  1.252   1.00 0.00 ? 202 LEU A CD2  7  
ATOM 10866 H H    . LEU A 1 24  ? -2.634  11.065  -1.438  1.00 0.00 ? 202 LEU A H    7  
ATOM 10867 H HA   . LEU A 1 24  ? -0.805  8.964   -0.579  1.00 0.00 ? 202 LEU A HA   7  
ATOM 10868 H HB2  . LEU A 1 24  ? -2.011  11.237  0.991   1.00 0.00 ? 202 LEU A HB2  7  
ATOM 10869 H HB3  . LEU A 1 24  ? -0.727  10.160  1.536   1.00 0.00 ? 202 LEU A HB3  7  
ATOM 10870 H HG   . LEU A 1 24  ? 0.500   11.127  -0.601  1.00 0.00 ? 202 LEU A HG   7  
ATOM 10871 H HD11 . LEU A 1 24  ? -1.850  12.752  -0.405  1.00 0.00 ? 202 LEU A HD11 7  
ATOM 10872 H HD12 . LEU A 1 24  ? -0.559  12.795  -1.605  1.00 0.00 ? 202 LEU A HD12 7  
ATOM 10873 H HD13 . LEU A 1 24  ? -0.415  13.737  -0.121  1.00 0.00 ? 202 LEU A HD13 7  
ATOM 10874 H HD21 . LEU A 1 24  ? 1.700   11.509  1.270   1.00 0.00 ? 202 LEU A HD21 7  
ATOM 10875 H HD22 . LEU A 1 24  ? 0.293   12.028  2.199   1.00 0.00 ? 202 LEU A HD22 7  
ATOM 10876 H HD23 . LEU A 1 24  ? 1.073   13.147  1.081   1.00 0.00 ? 202 LEU A HD23 7  
ATOM 10877 N N    . LEU A 1 25  ? -2.501  7.402   0.312   1.00 0.00 ? 203 LEU A N    7  
ATOM 10878 C CA   . LEU A 1 25  ? -3.434  6.458   0.917   1.00 0.00 ? 203 LEU A CA   7  
ATOM 10879 C C    . LEU A 1 25  ? -2.720  5.545   1.908   1.00 0.00 ? 203 LEU A C    7  
ATOM 10880 O O    . LEU A 1 25  ? -1.709  4.924   1.579   1.00 0.00 ? 203 LEU A O    7  
ATOM 10881 C CB   . LEU A 1 25  ? -4.117  5.620   -0.165  1.00 0.00 ? 203 LEU A CB   7  
ATOM 10882 C CG   . LEU A 1 25  ? -5.172  6.340   -1.006  1.00 0.00 ? 203 LEU A CG   7  
ATOM 10883 C CD1  . LEU A 1 25  ? -6.289  6.871   -0.120  1.00 0.00 ? 203 LEU A CD1  7  
ATOM 10884 C CD2  . LEU A 1 25  ? -4.539  7.470   -1.804  1.00 0.00 ? 203 LEU A CD2  7  
ATOM 10885 H H    . LEU A 1 25  ? -1.712  7.058   -0.156  1.00 0.00 ? 203 LEU A H    7  
ATOM 10886 H HA   . LEU A 1 25  ? -4.184  7.027   1.446   1.00 0.00 ? 203 LEU A HA   7  
ATOM 10887 H HB2  . LEU A 1 25  ? -3.352  5.258   -0.835  1.00 0.00 ? 203 LEU A HB2  7  
ATOM 10888 H HB3  . LEU A 1 25  ? -4.595  4.781   0.320   1.00 0.00 ? 203 LEU A HB3  7  
ATOM 10889 H HG   . LEU A 1 25  ? -5.607  5.638   -1.704  1.00 0.00 ? 203 LEU A HG   7  
ATOM 10890 H HD11 . LEU A 1 25  ? -6.540  6.132   0.625   1.00 0.00 ? 203 LEU A HD11 7  
ATOM 10891 H HD12 . LEU A 1 25  ? -7.158  7.083   -0.725  1.00 0.00 ? 203 LEU A HD12 7  
ATOM 10892 H HD13 . LEU A 1 25  ? -5.960  7.778   0.367   1.00 0.00 ? 203 LEU A HD13 7  
ATOM 10893 H HD21 . LEU A 1 25  ? -4.780  8.416   -1.342  1.00 0.00 ? 203 LEU A HD21 7  
ATOM 10894 H HD22 . LEU A 1 25  ? -4.921  7.455   -2.815  1.00 0.00 ? 203 LEU A HD22 7  
ATOM 10895 H HD23 . LEU A 1 25  ? -3.467  7.341   -1.822  1.00 0.00 ? 203 LEU A HD23 7  
ATOM 10896 N N    . THR A 1 26  ? -3.253  5.467   3.123   1.00 0.00 ? 204 THR A N    7  
ATOM 10897 C CA   . THR A 1 26  ? -2.667  4.629   4.162   1.00 0.00 ? 204 THR A CA   7  
ATOM 10898 C C    . THR A 1 26  ? -3.384  3.287   4.256   1.00 0.00 ? 204 THR A C    7  
ATOM 10899 O O    . THR A 1 26  ? -4.583  3.230   4.526   1.00 0.00 ? 204 THR A O    7  
ATOM 10900 C CB   . THR A 1 26  ? -2.717  5.322   5.537   1.00 0.00 ? 204 THR A CB   7  
ATOM 10901 O OG1  . THR A 1 26  ? -2.262  6.675   5.421   1.00 0.00 ? 204 THR A OG1  7  
ATOM 10902 C CG2  . THR A 1 26  ? -1.859  4.578   6.549   1.00 0.00 ? 204 THR A CG2  7  
ATOM 10903 H H    . THR A 1 26  ? -4.059  5.986   3.325   1.00 0.00 ? 204 THR A H    7  
ATOM 10904 H HA   . THR A 1 26  ? -1.632  4.456   3.907   1.00 0.00 ? 204 THR A HA   7  
ATOM 10905 H HB   . THR A 1 26  ? -3.740  5.323   5.886   1.00 0.00 ? 204 THR A HB   7  
ATOM 10906 H HG1  . THR A 1 26  ? -1.604  6.732   4.724   1.00 0.00 ? 204 THR A HG1  7  
ATOM 10907 H HG21 . THR A 1 26  ? -0.956  5.140   6.738   1.00 0.00 ? 204 THR A HG21 7  
ATOM 10908 H HG22 . THR A 1 26  ? -1.602  3.605   6.158   1.00 0.00 ? 204 THR A HG22 7  
ATOM 10909 H HG23 . THR A 1 26  ? -2.409  4.462   7.471   1.00 0.00 ? 204 THR A HG23 7  
ATOM 10910 N N    . GLY A 1 27  ? -2.641  2.207   4.031   1.00 0.00 ? 205 GLY A N    7  
ATOM 10911 C CA   . GLY A 1 27  ? -3.224  0.880   4.096   1.00 0.00 ? 205 GLY A CA   7  
ATOM 10912 C C    . GLY A 1 27  ? -2.528  -0.011  5.105   1.00 0.00 ? 205 GLY A C    7  
ATOM 10913 O O    . GLY A 1 27  ? -1.673  0.448   5.864   1.00 0.00 ? 205 GLY A O    7  
ATOM 10914 H H    . GLY A 1 27  ? -1.690  2.313   3.820   1.00 0.00 ? 205 GLY A H    7  
ATOM 10915 H HA2  . GLY A 1 27  ? -4.265  0.968   4.367   1.00 0.00 ? 205 GLY A HA2  7  
ATOM 10916 H HA3  . GLY A 1 27  ? -3.154  0.421   3.120   1.00 0.00 ? 205 GLY A HA3  7  
ATOM 10917 N N    . THR A 1 28  ? -2.894  -1.289  5.117   1.00 0.00 ? 206 THR A N    7  
ATOM 10918 C CA   . THR A 1 28  ? -2.301  -2.245  6.043   1.00 0.00 ? 206 THR A CA   7  
ATOM 10919 C C    . THR A 1 28  ? -1.796  -3.481  5.308   1.00 0.00 ? 206 THR A C    7  
ATOM 10920 O O    . THR A 1 28  ? -2.449  -3.981  4.392   1.00 0.00 ? 206 THR A O    7  
ATOM 10921 C CB   . THR A 1 28  ? -3.309  -2.681  7.124   1.00 0.00 ? 206 THR A CB   7  
ATOM 10922 O OG1  . THR A 1 28  ? -4.626  -2.749  6.565   1.00 0.00 ? 206 THR A OG1  7  
ATOM 10923 C CG2  . THR A 1 28  ? -3.299  -1.710  8.295   1.00 0.00 ? 206 THR A CG2  7  
ATOM 10924 H H    . THR A 1 28  ? -3.580  -1.594  4.488   1.00 0.00 ? 206 THR A H    7  
ATOM 10925 H HA   . THR A 1 28  ? -1.467  -1.763  6.532   1.00 0.00 ? 206 THR A HA   7  
ATOM 10926 H HB   . THR A 1 28  ? -3.027  -3.659  7.484   1.00 0.00 ? 206 THR A HB   7  
ATOM 10927 H HG1  . THR A 1 28  ? -4.615  -3.314  5.789   1.00 0.00 ? 206 THR A HG1  7  
ATOM 10928 H HG21 . THR A 1 28  ? -4.299  -1.337  8.462   1.00 0.00 ? 206 THR A HG21 7  
ATOM 10929 H HG22 . THR A 1 28  ? -2.640  -0.885  8.073   1.00 0.00 ? 206 THR A HG22 7  
ATOM 10930 H HG23 . THR A 1 28  ? -2.953  -2.220  9.181   1.00 0.00 ? 206 THR A HG23 7  
ATOM 10931 N N    . VAL A 1 29  ? -0.629  -3.971  5.716   1.00 0.00 ? 207 VAL A N    7  
ATOM 10932 C CA   . VAL A 1 29  ? -0.037  -5.151  5.097   1.00 0.00 ? 207 VAL A CA   7  
ATOM 10933 C C    . VAL A 1 29  ? -0.940  -6.369  5.260   1.00 0.00 ? 207 VAL A C    7  
ATOM 10934 O O    . VAL A 1 29  ? -1.288  -6.751  6.377   1.00 0.00 ? 207 VAL A O    7  
ATOM 10935 C CB   . VAL A 1 29  ? 1.345   -5.467  5.698   1.00 0.00 ? 207 VAL A CB   7  
ATOM 10936 C CG1  . VAL A 1 29  ? 1.998   -6.624  4.958   1.00 0.00 ? 207 VAL A CG1  7  
ATOM 10937 C CG2  . VAL A 1 29  ? 2.234   -4.233  5.665   1.00 0.00 ? 207 VAL A CG2  7  
ATOM 10938 H H    . VAL A 1 29  ? -0.156  -3.529  6.451   1.00 0.00 ? 207 VAL A H    7  
ATOM 10939 H HA   . VAL A 1 29  ? 0.090   -4.947  4.043   1.00 0.00 ? 207 VAL A HA   7  
ATOM 10940 H HB   . VAL A 1 29  ? 1.209   -5.759  6.729   1.00 0.00 ? 207 VAL A HB   7  
ATOM 10941 H HG11 . VAL A 1 29  ? 1.770   -7.550  5.466   1.00 0.00 ? 207 VAL A HG11 7  
ATOM 10942 H HG12 . VAL A 1 29  ? 1.621   -6.664  3.947   1.00 0.00 ? 207 VAL A HG12 7  
ATOM 10943 H HG13 . VAL A 1 29  ? 3.069   -6.480  4.938   1.00 0.00 ? 207 VAL A HG13 7  
ATOM 10944 H HG21 . VAL A 1 29  ? 2.579   -4.011  6.664   1.00 0.00 ? 207 VAL A HG21 7  
ATOM 10945 H HG22 . VAL A 1 29  ? 3.085   -4.418  5.025   1.00 0.00 ? 207 VAL A HG22 7  
ATOM 10946 H HG23 . VAL A 1 29  ? 1.672   -3.394  5.283   1.00 0.00 ? 207 VAL A HG23 7  
ATOM 10947 N N    . SER A 1 30  ? -1.316  -6.974  4.138   1.00 0.00 ? 208 SER A N    7  
ATOM 10948 C CA   . SER A 1 30  ? -2.181  -8.148  4.155   1.00 0.00 ? 208 SER A CA   7  
ATOM 10949 C C    . SER A 1 30  ? -1.356  -9.431  4.167   1.00 0.00 ? 208 SER A C    7  
ATOM 10950 O O    . SER A 1 30  ? -1.689  -10.390 4.864   1.00 0.00 ? 208 SER A O    7  
ATOM 10951 C CB   . SER A 1 30  ? -3.113  -8.138  2.942   1.00 0.00 ? 208 SER A CB   7  
ATOM 10952 O OG   . SER A 1 30  ? -4.003  -9.241  2.974   1.00 0.00 ? 208 SER A OG   7  
ATOM 10953 H H    . SER A 1 30  ? -1.005  -6.622  3.277   1.00 0.00 ? 208 SER A H    7  
ATOM 10954 H HA   . SER A 1 30  ? -2.776  -8.108  5.056   1.00 0.00 ? 208 SER A HA   7  
ATOM 10955 H HB2  . SER A 1 30  ? -3.690  -7.226  2.942   1.00 0.00 ? 208 SER A HB2  7  
ATOM 10956 H HB3  . SER A 1 30  ? -2.524  -8.192  2.038   1.00 0.00 ? 208 SER A HB3  7  
ATOM 10957 H HG   . SER A 1 30  ? -4.411  -9.299  3.841   1.00 0.00 ? 208 SER A HG   7  
ATOM 10958 N N    . SER A 1 31  ? -0.278  -9.441  3.389   1.00 0.00 ? 209 SER A N    7  
ATOM 10959 C CA   . SER A 1 31  ? 0.593   -10.607 3.306   1.00 0.00 ? 209 SER A CA   7  
ATOM 10960 C C    . SER A 1 31  ? 1.991   -10.209 2.841   1.00 0.00 ? 209 SER A C    7  
ATOM 10961 O O    . SER A 1 31  ? 2.171   -9.181  2.187   1.00 0.00 ? 209 SER A O    7  
ATOM 10962 C CB   . SER A 1 31  ? 0.002   -11.645 2.351   1.00 0.00 ? 209 SER A CB   7  
ATOM 10963 O OG   . SER A 1 31  ? 0.442   -12.951 2.681   1.00 0.00 ? 209 SER A OG   7  
ATOM 10964 H H    . SER A 1 31  ? -0.065  -8.646  2.857   1.00 0.00 ? 209 SER A H    7  
ATOM 10965 H HA   . SER A 1 31  ? 0.665   -11.039 4.294   1.00 0.00 ? 209 SER A HA   7  
ATOM 10966 H HB2  . SER A 1 31  ? -1.075  -11.615 2.412   1.00 0.00 ? 209 SER A HB2  7  
ATOM 10967 H HB3  . SER A 1 31  ? 0.311   -11.418 1.341   1.00 0.00 ? 209 SER A HB3  7  
ATOM 10968 H HG   . SER A 1 31  ? -0.076  -13.596 2.194   1.00 0.00 ? 209 SER A HG   7  
ATOM 10969 N N    . LEU A 1 32  ? 2.977   -11.030 3.182   1.00 0.00 ? 210 LEU A N    7  
ATOM 10970 C CA   . LEU A 1 32  ? 4.360   -10.766 2.800   1.00 0.00 ? 210 LEU A CA   7  
ATOM 10971 C C    . LEU A 1 32  ? 4.830   -11.753 1.737   1.00 0.00 ? 210 LEU A C    7  
ATOM 10972 O O    . LEU A 1 32  ? 4.754   -12.967 1.928   1.00 0.00 ? 210 LEU A O    7  
ATOM 10973 C CB   . LEU A 1 32  ? 5.273   -10.845 4.026   1.00 0.00 ? 210 LEU A CB   7  
ATOM 10974 C CG   . LEU A 1 32  ? 5.270   -9.623  4.945   1.00 0.00 ? 210 LEU A CG   7  
ATOM 10975 C CD1  . LEU A 1 32  ? 3.999   -9.586  5.779   1.00 0.00 ? 210 LEU A CD1  7  
ATOM 10976 C CD2  . LEU A 1 32  ? 6.499   -9.627  5.842   1.00 0.00 ? 210 LEU A CD2  7  
ATOM 10977 H H    . LEU A 1 32  ? 2.772   -11.834 3.703   1.00 0.00 ? 210 LEU A H    7  
ATOM 10978 H HA   . LEU A 1 32  ? 4.406   -9.767  2.392   1.00 0.00 ? 210 LEU A HA   7  
ATOM 10979 H HB2  . LEU A 1 32  ? 4.967   -11.699 4.610   1.00 0.00 ? 210 LEU A HB2  7  
ATOM 10980 H HB3  . LEU A 1 32  ? 6.284   -10.994 3.675   1.00 0.00 ? 210 LEU A HB3  7  
ATOM 10981 H HG   . LEU A 1 32  ? 5.298   -8.726  4.341   1.00 0.00 ? 210 LEU A HG   7  
ATOM 10982 H HD11 . LEU A 1 32  ? 4.101   -10.253 6.621   1.00 0.00 ? 210 LEU A HD11 7  
ATOM 10983 H HD12 . LEU A 1 32  ? 3.161   -9.897  5.173   1.00 0.00 ? 210 LEU A HD12 7  
ATOM 10984 H HD13 . LEU A 1 32  ? 3.831   -8.579  6.134   1.00 0.00 ? 210 LEU A HD13 7  
ATOM 10985 H HD21 . LEU A 1 32  ? 6.582   -8.674  6.342   1.00 0.00 ? 210 LEU A HD21 7  
ATOM 10986 H HD22 . LEU A 1 32  ? 7.381   -9.797  5.242   1.00 0.00 ? 210 LEU A HD22 7  
ATOM 10987 H HD23 . LEU A 1 32  ? 6.405   -10.413 6.577   1.00 0.00 ? 210 LEU A HD23 7  
ATOM 10988 N N    . GLU A 1 33  ? 5.318   -11.224 0.620   1.00 0.00 ? 211 GLU A N    7  
ATOM 10989 C CA   . GLU A 1 33  ? 5.802   -12.061 -0.472  1.00 0.00 ? 211 GLU A CA   7  
ATOM 10990 C C    . GLU A 1 33  ? 7.303   -11.876 -0.675  1.00 0.00 ? 211 GLU A C    7  
ATOM 10991 O O    . GLU A 1 33  ? 7.852   -10.809 -0.397  1.00 0.00 ? 211 GLU A O    7  
ATOM 10992 C CB   . GLU A 1 33  ? 5.057   -11.729 -1.767  1.00 0.00 ? 211 GLU A CB   7  
ATOM 10993 C CG   . GLU A 1 33  ? 3.574   -12.058 -1.717  1.00 0.00 ? 211 GLU A CG   7  
ATOM 10994 C CD   . GLU A 1 33  ? 2.986   -12.308 -3.092  1.00 0.00 ? 211 GLU A CD   7  
ATOM 10995 O OE1  . GLU A 1 33  ? 3.579   -11.840 -4.086  1.00 0.00 ? 211 GLU A OE1  7  
ATOM 10996 O OE2  . GLU A 1 33  ? 1.931   -12.972 -3.173  1.00 0.00 ? 211 GLU A OE2  7  
ATOM 10997 H H    . GLU A 1 33  ? 5.353   -10.250 0.527   1.00 0.00 ? 211 GLU A H    7  
ATOM 10998 H HA   . GLU A 1 33  ? 5.611   -13.091 -0.212  1.00 0.00 ? 211 GLU A HA   7  
ATOM 10999 H HB2  . GLU A 1 33  ? 5.164   -10.674 -1.970  1.00 0.00 ? 211 GLU A HB2  7  
ATOM 11000 H HB3  . GLU A 1 33  ? 5.501   -12.289 -2.577  1.00 0.00 ? 211 GLU A HB3  7  
ATOM 11001 H HG2  . GLU A 1 33  ? 3.435   -12.944 -1.116  1.00 0.00 ? 211 GLU A HG2  7  
ATOM 11002 H HG3  . GLU A 1 33  ? 3.050   -11.230 -1.262  1.00 0.00 ? 211 GLU A HG3  7  
ATOM 11003 N N    . ASP A 1 34  ? 7.962   -12.922 -1.161  1.00 0.00 ? 212 ASP A N    7  
ATOM 11004 C CA   . ASP A 1 34  ? 9.399   -12.877 -1.402  1.00 0.00 ? 212 ASP A CA   7  
ATOM 11005 C C    . ASP A 1 34  ? 9.724   -11.964 -2.581  1.00 0.00 ? 212 ASP A C    7  
ATOM 11006 O O    . ASP A 1 34  ? 10.868  -11.544 -2.758  1.00 0.00 ? 212 ASP A O    7  
ATOM 11007 C CB   . ASP A 1 34  ? 9.939   -14.283 -1.666  1.00 0.00 ? 212 ASP A CB   7  
ATOM 11008 C CG   . ASP A 1 34  ? 10.159  -15.068 -0.388  1.00 0.00 ? 212 ASP A CG   7  
ATOM 11009 O OD1  . ASP A 1 34  ? 10.510  -14.447 0.637   1.00 0.00 ? 212 ASP A OD1  7  
ATOM 11010 O OD2  . ASP A 1 34  ? 9.979   -16.303 -0.412  1.00 0.00 ? 212 ASP A OD2  7  
ATOM 11011 H H    . ASP A 1 34  ? 7.469   -13.745 -1.364  1.00 0.00 ? 212 ASP A H    7  
ATOM 11012 H HA   . ASP A 1 34  ? 9.872   -12.480 -0.516  1.00 0.00 ? 212 ASP A HA   7  
ATOM 11013 H HB2  . ASP A 1 34  ? 9.233   -14.823 -2.281  1.00 0.00 ? 212 ASP A HB2  7  
ATOM 11014 H HB3  . ASP A 1 34  ? 10.881  -14.208 -2.189  1.00 0.00 ? 212 ASP A HB3  7  
ATOM 11015 N N    . HIS A 1 35  ? 8.710   -11.663 -3.386  1.00 0.00 ? 213 HIS A N    7  
ATOM 11016 C CA   . HIS A 1 35  ? 8.887   -10.800 -4.549  1.00 0.00 ? 213 HIS A CA   7  
ATOM 11017 C C    . HIS A 1 35  ? 8.465   -9.369  -4.234  1.00 0.00 ? 213 HIS A C    7  
ATOM 11018 O O    . HIS A 1 35  ? 8.942   -8.419  -4.854  1.00 0.00 ? 213 HIS A O    7  
ATOM 11019 C CB   . HIS A 1 35  ? 8.080   -11.333 -5.734  1.00 0.00 ? 213 HIS A CB   7  
ATOM 11020 C CG   . HIS A 1 35  ? 8.635   -12.596 -6.317  1.00 0.00 ? 213 HIS A CG   7  
ATOM 11021 N ND1  . HIS A 1 35  ? 7.860   -13.522 -6.982  1.00 0.00 ? 213 HIS A ND1  7  
ATOM 11022 C CD2  . HIS A 1 35  ? 9.898   -13.084 -6.333  1.00 0.00 ? 213 HIS A CD2  7  
ATOM 11023 C CE1  . HIS A 1 35  ? 8.621   -14.526 -7.381  1.00 0.00 ? 213 HIS A CE1  7  
ATOM 11024 N NE2  . HIS A 1 35  ? 9.863   -14.284 -7.000  1.00 0.00 ? 213 HIS A NE2  7  
ATOM 11025 H H    . HIS A 1 35  ? 7.822   -12.028 -3.193  1.00 0.00 ? 213 HIS A H    7  
ATOM 11026 H HA   . HIS A 1 35  ? 9.935   -10.805 -4.808  1.00 0.00 ? 213 HIS A HA   7  
ATOM 11027 H HB2  . HIS A 1 35  ? 7.070   -11.534 -5.411  1.00 0.00 ? 213 HIS A HB2  7  
ATOM 11028 H HB3  . HIS A 1 35  ? 8.062   -10.586 -6.514  1.00 0.00 ? 213 HIS A HB3  7  
ATOM 11029 H HD1  . HIS A 1 35  ? 6.895   -13.455 -7.137  1.00 0.00 ? 213 HIS A HD1  7  
ATOM 11030 H HD2  . HIS A 1 35  ? 10.772  -12.617 -5.901  1.00 0.00 ? 213 HIS A HD2  7  
ATOM 11031 H HE1  . HIS A 1 35  ? 8.287   -15.395 -7.926  1.00 0.00 ? 213 HIS A HE1  7  
ATOM 11032 H HE2  . HIS A 1 35  ? 10.613  -14.907 -7.092  1.00 0.00 ? 213 HIS A HE2  7  
ATOM 11033 N N    . GLY A 1 36  ? 7.566   -9.222  -3.265  1.00 0.00 ? 214 GLY A N    7  
ATOM 11034 C CA   . GLY A 1 36  ? 7.094   -7.903  -2.885  1.00 0.00 ? 214 GLY A CA   7  
ATOM 11035 C C    . GLY A 1 36  ? 6.221   -7.934  -1.646  1.00 0.00 ? 214 GLY A C    7  
ATOM 11036 O O    . GLY A 1 36  ? 6.132   -8.957  -0.967  1.00 0.00 ? 214 GLY A O    7  
ATOM 11037 H H    . GLY A 1 36  ? 7.220   -10.015 -2.805  1.00 0.00 ? 214 GLY A H    7  
ATOM 11038 H HA2  . GLY A 1 36  ? 7.947   -7.268  -2.696  1.00 0.00 ? 214 GLY A HA2  7  
ATOM 11039 H HA3  . GLY A 1 36  ? 6.523   -7.488  -3.703  1.00 0.00 ? 214 GLY A HA3  7  
ATOM 11040 N N    . TYR A 1 37  ? 5.577   -6.811  -1.350  1.00 0.00 ? 215 TYR A N    7  
ATOM 11041 C CA   . TYR A 1 37  ? 4.710   -6.712  -0.182  1.00 0.00 ? 215 TYR A CA   7  
ATOM 11042 C C    . TYR A 1 37  ? 3.293   -6.318  -0.587  1.00 0.00 ? 215 TYR A C    7  
ATOM 11043 O O    . TYR A 1 37  ? 3.092   -5.369  -1.345  1.00 0.00 ? 215 TYR A O    7  
ATOM 11044 C CB   . TYR A 1 37  ? 5.271   -5.693  0.811   1.00 0.00 ? 215 TYR A CB   7  
ATOM 11045 C CG   . TYR A 1 37  ? 6.523   -6.161  1.518   1.00 0.00 ? 215 TYR A CG   7  
ATOM 11046 C CD1  . TYR A 1 37  ? 6.446   -6.935  2.669   1.00 0.00 ? 215 TYR A CD1  7  
ATOM 11047 C CD2  . TYR A 1 37  ? 7.783   -5.829  1.035   1.00 0.00 ? 215 TYR A CD2  7  
ATOM 11048 C CE1  . TYR A 1 37  ? 7.586   -7.365  3.319   1.00 0.00 ? 215 TYR A CE1  7  
ATOM 11049 C CE2  . TYR A 1 37  ? 8.929   -6.256  1.677   1.00 0.00 ? 215 TYR A CE2  7  
ATOM 11050 C CZ   . TYR A 1 37  ? 8.826   -7.023  2.819   1.00 0.00 ? 215 TYR A CZ   7  
ATOM 11051 O OH   . TYR A 1 37  ? 9.965   -7.449  3.462   1.00 0.00 ? 215 TYR A OH   7  
ATOM 11052 H H    . TYR A 1 37  ? 5.688   -6.029  -1.929  1.00 0.00 ? 215 TYR A H    7  
ATOM 11053 H HA   . TYR A 1 37  ? 4.681   -7.683  0.292   1.00 0.00 ? 215 TYR A HA   7  
ATOM 11054 H HB2  . TYR A 1 37  ? 5.510   -4.781  0.285   1.00 0.00 ? 215 TYR A HB2  7  
ATOM 11055 H HB3  . TYR A 1 37  ? 4.524   -5.484  1.562   1.00 0.00 ? 215 TYR A HB3  7  
ATOM 11056 H HD1  . TYR A 1 37  ? 5.473   -7.201  3.059   1.00 0.00 ? 215 TYR A HD1  7  
ATOM 11057 H HD2  . TYR A 1 37  ? 7.860   -5.228  0.141   1.00 0.00 ? 215 TYR A HD2  7  
ATOM 11058 H HE1  . TYR A 1 37  ? 7.506   -7.965  4.213   1.00 0.00 ? 215 TYR A HE1  7  
ATOM 11059 H HE2  . TYR A 1 37  ? 9.899   -5.988  1.286   1.00 0.00 ? 215 TYR A HE2  7  
ATOM 11060 H HH   . TYR A 1 37  ? 10.561  -7.850  2.826   1.00 0.00 ? 215 TYR A HH   7  
ATOM 11061 N N    . LEU A 1 38  ? 2.313   -7.054  -0.075  1.00 0.00 ? 216 LEU A N    7  
ATOM 11062 C CA   . LEU A 1 38  ? 0.912   -6.783  -0.382  1.00 0.00 ? 216 LEU A CA   7  
ATOM 11063 C C    . LEU A 1 38  ? 0.342   -5.730  0.563   1.00 0.00 ? 216 LEU A C    7  
ATOM 11064 O O    . LEU A 1 38  ? 0.391   -5.884  1.783   1.00 0.00 ? 216 LEU A O    7  
ATOM 11065 C CB   . LEU A 1 38  ? 0.090   -8.070  -0.286  1.00 0.00 ? 216 LEU A CB   7  
ATOM 11066 C CG   . LEU A 1 38  ? -0.012  -8.898  -1.566  1.00 0.00 ? 216 LEU A CG   7  
ATOM 11067 C CD1  . LEU A 1 38  ? -1.088  -8.336  -2.482  1.00 0.00 ? 216 LEU A CD1  7  
ATOM 11068 C CD2  . LEU A 1 38  ? 1.330   -8.941  -2.282  1.00 0.00 ? 216 LEU A CD2  7  
ATOM 11069 H H    . LEU A 1 38  ? 2.534   -7.798  0.522   1.00 0.00 ? 216 LEU A H    7  
ATOM 11070 H HA   . LEU A 1 38  ? 0.861   -6.408  -1.393  1.00 0.00 ? 216 LEU A HA   7  
ATOM 11071 H HB2  . LEU A 1 38  ? 0.537   -8.691  0.475   1.00 0.00 ? 216 LEU A HB2  7  
ATOM 11072 H HB3  . LEU A 1 38  ? -0.912  -7.799  0.015   1.00 0.00 ? 216 LEU A HB3  7  
ATOM 11073 H HG   . LEU A 1 38  ? -0.288  -9.912  -1.311  1.00 0.00 ? 216 LEU A HG   7  
ATOM 11074 H HD11 . LEU A 1 38  ? -0.821  -7.334  -2.779  1.00 0.00 ? 216 LEU A HD11 7  
ATOM 11075 H HD12 . LEU A 1 38  ? -2.032  -8.316  -1.957  1.00 0.00 ? 216 LEU A HD12 7  
ATOM 11076 H HD13 . LEU A 1 38  ? -1.177  -8.961  -3.359  1.00 0.00 ? 216 LEU A HD13 7  
ATOM 11077 H HD21 . LEU A 1 38  ? 2.009   -9.578  -1.735  1.00 0.00 ? 216 LEU A HD21 7  
ATOM 11078 H HD22 . LEU A 1 38  ? 1.740   -7.943  -2.339  1.00 0.00 ? 216 LEU A HD22 7  
ATOM 11079 H HD23 . LEU A 1 38  ? 1.194   -9.333  -3.279  1.00 0.00 ? 216 LEU A HD23 7  
ATOM 11080 N N    . VAL A 1 39  ? -0.200  -4.660  -0.010  1.00 0.00 ? 217 VAL A N    7  
ATOM 11081 C CA   . VAL A 1 39  ? -0.783  -3.582  0.780   1.00 0.00 ? 217 VAL A CA   7  
ATOM 11082 C C    . VAL A 1 39  ? -2.296  -3.525  0.600   1.00 0.00 ? 217 VAL A C    7  
ATOM 11083 O O    . VAL A 1 39  ? -2.797  -3.523  -0.525  1.00 0.00 ? 217 VAL A O    7  
ATOM 11084 C CB   . VAL A 1 39  ? -0.179  -2.217  0.400   1.00 0.00 ? 217 VAL A CB   7  
ATOM 11085 C CG1  . VAL A 1 39  ? -0.695  -1.128  1.327   1.00 0.00 ? 217 VAL A CG1  7  
ATOM 11086 C CG2  . VAL A 1 39  ? 1.341   -2.280  0.432   1.00 0.00 ? 217 VAL A CG2  7  
ATOM 11087 H H    . VAL A 1 39  ? -0.209  -4.594  -0.988  1.00 0.00 ? 217 VAL A H    7  
ATOM 11088 H HA   . VAL A 1 39  ? -0.561  -3.773  1.820   1.00 0.00 ? 217 VAL A HA   7  
ATOM 11089 H HB   . VAL A 1 39  ? -0.487  -1.978  -0.607  1.00 0.00 ? 217 VAL A HB   7  
ATOM 11090 H HG11 . VAL A 1 39  ? -0.914  -1.553  2.296   1.00 0.00 ? 217 VAL A HG11 7  
ATOM 11091 H HG12 . VAL A 1 39  ? 0.055   -0.358  1.432   1.00 0.00 ? 217 VAL A HG12 7  
ATOM 11092 H HG13 . VAL A 1 39  ? -1.596  -0.699  0.912   1.00 0.00 ? 217 VAL A HG13 7  
ATOM 11093 H HG21 . VAL A 1 39  ? 1.652   -3.219  0.864   1.00 0.00 ? 217 VAL A HG21 7  
ATOM 11094 H HG22 . VAL A 1 39  ? 1.726   -2.202  -0.575  1.00 0.00 ? 217 VAL A HG22 7  
ATOM 11095 H HG23 . VAL A 1 39  ? 1.723   -1.465  1.028   1.00 0.00 ? 217 VAL A HG23 7  
ATOM 11096 N N    . ASP A 1 40  ? -3.017  -3.476  1.714   1.00 0.00 ? 218 ASP A N    7  
ATOM 11097 C CA   . ASP A 1 40  ? -4.474  -3.417  1.679   1.00 0.00 ? 218 ASP A CA   7  
ATOM 11098 C C    . ASP A 1 40  ? -4.953  -1.996  1.396   1.00 0.00 ? 218 ASP A C    7  
ATOM 11099 O O    . ASP A 1 40  ? -4.427  -1.031  1.951   1.00 0.00 ? 218 ASP A O    7  
ATOM 11100 C CB   . ASP A 1 40  ? -5.057  -3.910  3.004   1.00 0.00 ? 218 ASP A CB   7  
ATOM 11101 C CG   . ASP A 1 40  ? -6.441  -4.508  2.841   1.00 0.00 ? 218 ASP A CG   7  
ATOM 11102 O OD1  . ASP A 1 40  ? -7.223  -3.980  2.022   1.00 0.00 ? 218 ASP A OD1  7  
ATOM 11103 O OD2  . ASP A 1 40  ? -6.741  -5.505  3.530   1.00 0.00 ? 218 ASP A OD2  7  
ATOM 11104 H H    . ASP A 1 40  ? -2.559  -3.480  2.581   1.00 0.00 ? 218 ASP A H    7  
ATOM 11105 H HA   . ASP A 1 40  ? -4.814  -4.063  0.884   1.00 0.00 ? 218 ASP A HA   7  
ATOM 11106 H HB2  . ASP A 1 40  ? -4.406  -4.666  3.418   1.00 0.00 ? 218 ASP A HB2  7  
ATOM 11107 H HB3  . ASP A 1 40  ? -5.122  -3.081  3.693   1.00 0.00 ? 218 ASP A HB3  7  
ATOM 11108 N N    . ILE A 1 41  ? -5.953  -1.877  0.529   1.00 0.00 ? 219 ILE A N    7  
ATOM 11109 C CA   . ILE A 1 41  ? -6.502  -0.574  0.172   1.00 0.00 ? 219 ILE A CA   7  
ATOM 11110 C C    . ILE A 1 41  ? -8.001  -0.517  0.445   1.00 0.00 ? 219 ILE A C    7  
ATOM 11111 O O    . ILE A 1 41  ? -8.542  0.536   0.778   1.00 0.00 ? 219 ILE A O    7  
ATOM 11112 C CB   . ILE A 1 41  ? -6.248  -0.243  -1.310  1.00 0.00 ? 219 ILE A CB   7  
ATOM 11113 C CG1  . ILE A 1 41  ? -6.515  -1.471  -2.183  1.00 0.00 ? 219 ILE A CG1  7  
ATOM 11114 C CG2  . ILE A 1 41  ? -4.823  0.252   -1.506  1.00 0.00 ? 219 ILE A CG2  7  
ATOM 11115 C CD1  . ILE A 1 41  ? -6.067  -1.302  -3.618  1.00 0.00 ? 219 ILE A CD1  7  
ATOM 11116 H H    . ILE A 1 41  ? -6.330  -2.683  0.120   1.00 0.00 ? 219 ILE A H    7  
ATOM 11117 H HA   . ILE A 1 41  ? -6.008  0.172   0.777   1.00 0.00 ? 219 ILE A HA   7  
ATOM 11118 H HB   . ILE A 1 41  ? -6.922  0.549   -1.600  1.00 0.00 ? 219 ILE A HB   7  
ATOM 11119 H HG12 . ILE A 1 41  ? -5.992  -2.319  -1.770  1.00 0.00 ? 219 ILE A HG12 7  
ATOM 11120 H HG13 . ILE A 1 41  ? -7.576  -1.676  -2.188  1.00 0.00 ? 219 ILE A HG13 7  
ATOM 11121 H HG21 . ILE A 1 41  ? -4.294  -0.423  -2.162  1.00 0.00 ? 219 ILE A HG21 7  
ATOM 11122 H HG22 . ILE A 1 41  ? -4.842  1.239   -1.944  1.00 0.00 ? 219 ILE A HG22 7  
ATOM 11123 H HG23 . ILE A 1 41  ? -4.321  0.292   -0.551  1.00 0.00 ? 219 ILE A HG23 7  
ATOM 11124 H HD11 . ILE A 1 41  ? -5.068  -1.696  -3.732  1.00 0.00 ? 219 ILE A HD11 7  
ATOM 11125 H HD12 . ILE A 1 41  ? -6.742  -1.834  -4.271  1.00 0.00 ? 219 ILE A HD12 7  
ATOM 11126 H HD13 . ILE A 1 41  ? -6.071  -0.252  -3.874  1.00 0.00 ? 219 ILE A HD13 7  
ATOM 11127 N N    . GLY A 1 42  ? -8.668  -1.659  0.303   1.00 0.00 ? 220 GLY A N    7  
ATOM 11128 C CA   . GLY A 1 42  ? -10.098 -1.717  0.539   1.00 0.00 ? 220 GLY A CA   7  
ATOM 11129 C C    . GLY A 1 42  ? -10.904 -1.285  -0.670  1.00 0.00 ? 220 GLY A C    7  
ATOM 11130 O O    . GLY A 1 42  ? -11.865 -0.526  -0.546  1.00 0.00 ? 220 GLY A O    7  
ATOM 11131 H H    . GLY A 1 42  ? -8.184  -2.468  0.035   1.00 0.00 ? 220 GLY A H    7  
ATOM 11132 H HA2  . GLY A 1 42  ? -10.369 -2.731  0.795   1.00 0.00 ? 220 GLY A HA2  7  
ATOM 11133 H HA3  . GLY A 1 42  ? -10.341 -1.070  1.369   1.00 0.00 ? 220 GLY A HA3  7  
ATOM 11134 N N    . VAL A 1 43  ? -10.511 -1.767  -1.845  1.00 0.00 ? 221 VAL A N    7  
ATOM 11135 C CA   . VAL A 1 43  ? -11.203 -1.426  -3.082  1.00 0.00 ? 221 VAL A CA   7  
ATOM 11136 C C    . VAL A 1 43  ? -11.449 -2.665  -3.934  1.00 0.00 ? 221 VAL A C    7  
ATOM 11137 O O    . VAL A 1 43  ? -10.595 -3.547  -4.028  1.00 0.00 ? 221 VAL A O    7  
ATOM 11138 C CB   . VAL A 1 43  ? -10.403 -0.400  -3.907  1.00 0.00 ? 221 VAL A CB   7  
ATOM 11139 C CG1  . VAL A 1 43  ? -11.130 -0.074  -5.203  1.00 0.00 ? 221 VAL A CG1  7  
ATOM 11140 C CG2  . VAL A 1 43  ? -10.157 0.862   -3.093  1.00 0.00 ? 221 VAL A CG2  7  
ATOM 11141 H H    . VAL A 1 43  ? -9.737  -2.368  -1.880  1.00 0.00 ? 221 VAL A H    7  
ATOM 11142 H HA   . VAL A 1 43  ? -12.154 -0.984  -2.822  1.00 0.00 ? 221 VAL A HA   7  
ATOM 11143 H HB   . VAL A 1 43  ? -9.447  -0.835  -4.156  1.00 0.00 ? 221 VAL A HB   7  
ATOM 11144 H HG11 . VAL A 1 43  ? -10.583 -0.491  -6.036  1.00 0.00 ? 221 VAL A HG11 7  
ATOM 11145 H HG12 . VAL A 1 43  ? -12.123 -0.497  -5.175  1.00 0.00 ? 221 VAL A HG12 7  
ATOM 11146 H HG13 . VAL A 1 43  ? -11.197 0.998   -5.319  1.00 0.00 ? 221 VAL A HG13 7  
ATOM 11147 H HG21 . VAL A 1 43  ? -9.171  1.244   -3.313  1.00 0.00 ? 221 VAL A HG21 7  
ATOM 11148 H HG22 . VAL A 1 43  ? -10.896 1.607   -3.350  1.00 0.00 ? 221 VAL A HG22 7  
ATOM 11149 H HG23 . VAL A 1 43  ? -10.228 0.632   -2.041  1.00 0.00 ? 221 VAL A HG23 7  
ATOM 11150 N N    . ASP A 1 44  ? -12.623 -2.726  -4.554  1.00 0.00 ? 222 ASP A N    7  
ATOM 11151 C CA   . ASP A 1 44  ? -12.982 -3.858  -5.401  1.00 0.00 ? 222 ASP A CA   7  
ATOM 11152 C C    . ASP A 1 44  ? -12.660 -3.566  -6.863  1.00 0.00 ? 222 ASP A C    7  
ATOM 11153 O O    . ASP A 1 44  ? -13.291 -2.718  -7.491  1.00 0.00 ? 222 ASP A O    7  
ATOM 11154 C CB   . ASP A 1 44  ? -14.469 -4.184  -5.248  1.00 0.00 ? 222 ASP A CB   7  
ATOM 11155 C CG   . ASP A 1 44  ? -14.733 -5.169  -4.126  1.00 0.00 ? 222 ASP A CG   7  
ATOM 11156 O OD1  . ASP A 1 44  ? -14.383 -6.357  -4.285  1.00 0.00 ? 222 ASP A OD1  7  
ATOM 11157 O OD2  . ASP A 1 44  ? -15.289 -4.751  -3.090  1.00 0.00 ? 222 ASP A OD2  7  
ATOM 11158 H H    . ASP A 1 44  ? -13.262 -1.992  -4.440  1.00 0.00 ? 222 ASP A H    7  
ATOM 11159 H HA   . ASP A 1 44  ? -12.402 -4.710  -5.080  1.00 0.00 ? 222 ASP A HA   7  
ATOM 11160 H HB2  . ASP A 1 44  ? -15.011 -3.274  -5.038  1.00 0.00 ? 222 ASP A HB2  7  
ATOM 11161 H HB3  . ASP A 1 44  ? -14.833 -4.611  -6.171  1.00 0.00 ? 222 ASP A HB3  7  
ATOM 11162 N N    . GLY A 1 45  ? -11.671 -4.276  -7.399  1.00 0.00 ? 223 GLY A N    7  
ATOM 11163 C CA   . GLY A 1 45  ? -11.282 -4.078  -8.783  1.00 0.00 ? 223 GLY A CA   7  
ATOM 11164 C C    . GLY A 1 45  ? -10.007 -3.269  -8.915  1.00 0.00 ? 223 GLY A C    7  
ATOM 11165 O O    . GLY A 1 45  ? -9.876  -2.446  -9.823  1.00 0.00 ? 223 GLY A O    7  
ATOM 11166 H H    . GLY A 1 45  ? -11.203 -4.940  -6.850  1.00 0.00 ? 223 GLY A H    7  
ATOM 11167 H HA2  . GLY A 1 45  ? -11.133 -5.042  -9.245  1.00 0.00 ? 223 GLY A HA2  7  
ATOM 11168 H HA3  . GLY A 1 45  ? -12.077 -3.561  -9.298  1.00 0.00 ? 223 GLY A HA3  7  
ATOM 11169 N N    . THR A 1 46  ? -9.063  -3.500  -8.008  1.00 0.00 ? 224 THR A N    7  
ATOM 11170 C CA   . THR A 1 46  ? -7.793  -2.785  -8.026  1.00 0.00 ? 224 THR A CA   7  
ATOM 11171 C C    . THR A 1 46  ? -6.696  -3.595  -7.346  1.00 0.00 ? 224 THR A C    7  
ATOM 11172 O O    . THR A 1 46  ? -6.825  -3.979  -6.183  1.00 0.00 ? 224 THR A O    7  
ATOM 11173 C CB   . THR A 1 46  ? -7.911  -1.415  -7.331  1.00 0.00 ? 224 THR A CB   7  
ATOM 11174 O OG1  . THR A 1 46  ? -8.892  -0.611  -7.994  1.00 0.00 ? 224 THR A OG1  7  
ATOM 11175 C CG2  . THR A 1 46  ? -6.572  -0.693  -7.330  1.00 0.00 ? 224 THR A CG2  7  
ATOM 11176 H H    . THR A 1 46  ? -9.227  -4.168  -7.310  1.00 0.00 ? 224 THR A H    7  
ATOM 11177 H HA   . THR A 1 46  ? -7.519  -2.619  -9.057  1.00 0.00 ? 224 THR A HA   7  
ATOM 11178 H HB   . THR A 1 46  ? -8.218  -1.574  -6.307  1.00 0.00 ? 224 THR A HB   7  
ATOM 11179 H HG1  . THR A 1 46  ? -8.564  -0.354  -8.859  1.00 0.00 ? 224 THR A HG1  7  
ATOM 11180 H HG21 . THR A 1 46  ? -6.647  0.205   -7.926  1.00 0.00 ? 224 THR A HG21 7  
ATOM 11181 H HG22 . THR A 1 46  ? -5.814  -1.339  -7.745  1.00 0.00 ? 224 THR A HG22 7  
ATOM 11182 H HG23 . THR A 1 46  ? -6.306  -0.430  -6.317  1.00 0.00 ? 224 THR A HG23 7  
ATOM 11183 N N    . ARG A 1 47  ? -5.617  -3.852  -8.077  1.00 0.00 ? 225 ARG A N    7  
ATOM 11184 C CA   . ARG A 1 47  ? -4.497  -4.618  -7.544  1.00 0.00 ? 225 ARG A CA   7  
ATOM 11185 C C    . ARG A 1 47  ? -3.300  -3.712  -7.271  1.00 0.00 ? 225 ARG A C    7  
ATOM 11186 O O    . ARG A 1 47  ? -2.812  -3.024  -8.168  1.00 0.00 ? 225 ARG A O    7  
ATOM 11187 C CB   . ARG A 1 47  ? -4.099  -5.727  -8.520  1.00 0.00 ? 225 ARG A CB   7  
ATOM 11188 C CG   . ARG A 1 47  ? -4.861  -7.025  -8.310  1.00 0.00 ? 225 ARG A CG   7  
ATOM 11189 C CD   . ARG A 1 47  ? -4.154  -7.932  -7.315  1.00 0.00 ? 225 ARG A CD   7  
ATOM 11190 N NE   . ARG A 1 47  ? -4.540  -7.638  -5.937  1.00 0.00 ? 225 ARG A NE   7  
ATOM 11191 C CZ   . ARG A 1 47  ? -4.315  -8.461  -4.920  1.00 0.00 ? 225 ARG A CZ   7  
ATOM 11192 N NH1  . ARG A 1 47  ? -3.709  -9.623  -5.124  1.00 0.00 ? 225 ARG A NH1  7  
ATOM 11193 N NH2  . ARG A 1 47  ? -4.695  -8.123  -3.694  1.00 0.00 ? 225 ARG A NH2  7  
ATOM 11194 H H    . ARG A 1 47  ? -5.573  -3.520  -8.998  1.00 0.00 ? 225 ARG A H    7  
ATOM 11195 H HA   . ARG A 1 47  ? -4.814  -5.066  -6.614  1.00 0.00 ? 225 ARG A HA   7  
ATOM 11196 H HB2  . ARG A 1 47  ? -4.282  -5.386  -9.528  1.00 0.00 ? 225 ARG A HB2  7  
ATOM 11197 H HB3  . ARG A 1 47  ? -3.045  -5.931  -8.403  1.00 0.00 ? 225 ARG A HB3  7  
ATOM 11198 H HG2  . ARG A 1 47  ? -5.847  -6.796  -7.934  1.00 0.00 ? 225 ARG A HG2  7  
ATOM 11199 H HG3  . ARG A 1 47  ? -4.945  -7.539  -9.256  1.00 0.00 ? 225 ARG A HG3  7  
ATOM 11200 H HD2  . ARG A 1 47  ? -4.409  -8.957  -7.539  1.00 0.00 ? 225 ARG A HD2  7  
ATOM 11201 H HD3  . ARG A 1 47  ? -3.088  -7.795  -7.418  1.00 0.00 ? 225 ARG A HD3  7  
ATOM 11202 H HE   . ARG A 1 47  ? -4.989  -6.785  -5.764  1.00 0.00 ? 225 ARG A HE   7  
ATOM 11203 H HH11 . ARG A 1 47  ? -3.421  -9.880  -6.046  1.00 0.00 ? 225 ARG A HH11 7  
ATOM 11204 H HH12 . ARG A 1 47  ? -3.540  -10.241 -4.356  1.00 0.00 ? 225 ARG A HH12 7  
ATOM 11205 H HH21 . ARG A 1 47  ? -5.152  -7.248  -3.536  1.00 0.00 ? 225 ARG A HH21 7  
ATOM 11206 H HH22 . ARG A 1 47  ? -4.526  -8.743  -2.929  1.00 0.00 ? 225 ARG A HH22 7  
ATOM 11207 N N    . ALA A 1 48  ? -2.832  -3.716  -6.027  1.00 0.00 ? 226 ALA A N    7  
ATOM 11208 C CA   . ALA A 1 48  ? -1.692  -2.897  -5.637  1.00 0.00 ? 226 ALA A CA   7  
ATOM 11209 C C    . ALA A 1 48  ? -0.534  -3.762  -5.152  1.00 0.00 ? 226 ALA A C    7  
ATOM 11210 O O    . ALA A 1 48  ? -0.704  -4.611  -4.276  1.00 0.00 ? 226 ALA A O    7  
ATOM 11211 C CB   . ALA A 1 48  ? -2.100  -1.905  -4.557  1.00 0.00 ? 226 ALA A CB   7  
ATOM 11212 H H    . ALA A 1 48  ? -3.263  -4.286  -5.356  1.00 0.00 ? 226 ALA A H    7  
ATOM 11213 H HA   . ALA A 1 48  ? -1.371  -2.336  -6.503  1.00 0.00 ? 226 ALA A HA   7  
ATOM 11214 H HB1  . ALA A 1 48  ? -1.681  -0.935  -4.784  1.00 0.00 ? 226 ALA A HB1  7  
ATOM 11215 H HB2  . ALA A 1 48  ? -3.177  -1.833  -4.523  1.00 0.00 ? 226 ALA A HB2  7  
ATOM 11216 H HB3  . ALA A 1 48  ? -1.730  -2.242  -3.601  1.00 0.00 ? 226 ALA A HB3  7  
ATOM 11217 N N    . PHE A 1 49  ? 0.644   -3.542  -5.727  1.00 0.00 ? 227 PHE A N    7  
ATOM 11218 C CA   . PHE A 1 49  ? 1.831   -4.304  -5.354  1.00 0.00 ? 227 PHE A CA   7  
ATOM 11219 C C    . PHE A 1 49  ? 3.011   -3.375  -5.084  1.00 0.00 ? 227 PHE A C    7  
ATOM 11220 O O    . PHE A 1 49  ? 3.242   -2.415  -5.821  1.00 0.00 ? 227 PHE A O    7  
ATOM 11221 C CB   . PHE A 1 49  ? 2.192   -5.298  -6.459  1.00 0.00 ? 227 PHE A CB   7  
ATOM 11222 C CG   . PHE A 1 49  ? 3.562   -5.895  -6.304  1.00 0.00 ? 227 PHE A CG   7  
ATOM 11223 C CD1  . PHE A 1 49  ? 4.674   -5.258  -6.830  1.00 0.00 ? 227 PHE A CD1  7  
ATOM 11224 C CD2  . PHE A 1 49  ? 3.737   -7.094  -5.631  1.00 0.00 ? 227 PHE A CD2  7  
ATOM 11225 C CE1  . PHE A 1 49  ? 5.935   -5.806  -6.689  1.00 0.00 ? 227 PHE A CE1  7  
ATOM 11226 C CE2  . PHE A 1 49  ? 4.996   -7.646  -5.486  1.00 0.00 ? 227 PHE A CE2  7  
ATOM 11227 C CZ   . PHE A 1 49  ? 6.096   -7.001  -6.015  1.00 0.00 ? 227 PHE A CZ   7  
ATOM 11228 H H    . PHE A 1 49  ? 0.717   -2.852  -6.419  1.00 0.00 ? 227 PHE A H    7  
ATOM 11229 H HA   . PHE A 1 49  ? 1.603   -4.849  -4.451  1.00 0.00 ? 227 PHE A HA   7  
ATOM 11230 H HB2  . PHE A 1 49  ? 1.476   -6.106  -6.455  1.00 0.00 ? 227 PHE A HB2  7  
ATOM 11231 H HB3  . PHE A 1 49  ? 2.155   -4.794  -7.413  1.00 0.00 ? 227 PHE A HB3  7  
ATOM 11232 H HD1  . PHE A 1 49  ? 4.550   -4.323  -7.356  1.00 0.00 ? 227 PHE A HD1  7  
ATOM 11233 H HD2  . PHE A 1 49  ? 2.876   -7.600  -5.216  1.00 0.00 ? 227 PHE A HD2  7  
ATOM 11234 H HE1  . PHE A 1 49  ? 6.794   -5.299  -7.103  1.00 0.00 ? 227 PHE A HE1  7  
ATOM 11235 H HE2  . PHE A 1 49  ? 5.118   -8.581  -4.959  1.00 0.00 ? 227 PHE A HE2  7  
ATOM 11236 H HZ   . PHE A 1 49  ? 7.080   -7.431  -5.904  1.00 0.00 ? 227 PHE A HZ   7  
ATOM 11237 N N    . LEU A 1 50  ? 3.754   -3.666  -4.022  1.00 0.00 ? 228 LEU A N    7  
ATOM 11238 C CA   . LEU A 1 50  ? 4.911   -2.857  -3.653  1.00 0.00 ? 228 LEU A CA   7  
ATOM 11239 C C    . LEU A 1 50  ? 6.209   -3.615  -3.911  1.00 0.00 ? 228 LEU A C    7  
ATOM 11240 O O    . LEU A 1 50  ? 6.389   -4.753  -3.478  1.00 0.00 ? 228 LEU A O    7  
ATOM 11241 C CB   . LEU A 1 50  ? 4.826   -2.454  -2.180  1.00 0.00 ? 228 LEU A CB   7  
ATOM 11242 C CG   . LEU A 1 50  ? 6.093   -1.845  -1.577  1.00 0.00 ? 228 LEU A CG   7  
ATOM 11243 C CD1  . LEU A 1 50  ? 6.305   -0.432  -2.098  1.00 0.00 ? 228 LEU A CD1  7  
ATOM 11244 C CD2  . LEU A 1 50  ? 6.015   -1.849  -0.057  1.00 0.00 ? 228 LEU A CD2  7  
ATOM 11245 H H    . LEU A 1 50  ? 3.521   -4.443  -3.473  1.00 0.00 ? 228 LEU A H    7  
ATOM 11246 H HA   . LEU A 1 50  ? 4.900   -1.966  -4.263  1.00 0.00 ? 228 LEU A HA   7  
ATOM 11247 H HB2  . LEU A 1 50  ? 4.032   -1.730  -2.081  1.00 0.00 ? 228 LEU A HB2  7  
ATOM 11248 H HB3  . LEU A 1 50  ? 4.579   -3.338  -1.610  1.00 0.00 ? 228 LEU A HB3  7  
ATOM 11249 H HG   . LEU A 1 50  ? 6.946   -2.440  -1.871  1.00 0.00 ? 228 LEU A HG   7  
ATOM 11250 H HD11 . LEU A 1 50  ? 6.239   0.268   -1.278  1.00 0.00 ? 228 LEU A HD11 7  
ATOM 11251 H HD12 . LEU A 1 50  ? 5.547   -0.200  -2.831  1.00 0.00 ? 228 LEU A HD12 7  
ATOM 11252 H HD13 . LEU A 1 50  ? 7.281   -0.360  -2.555  1.00 0.00 ? 228 LEU A HD13 7  
ATOM 11253 H HD21 . LEU A 1 50  ? 7.002   -2.006  0.352   1.00 0.00 ? 228 LEU A HD21 7  
ATOM 11254 H HD22 . LEU A 1 50  ? 5.360   -2.645  0.267   1.00 0.00 ? 228 LEU A HD22 7  
ATOM 11255 H HD23 . LEU A 1 50  ? 5.629   -0.901  0.286   1.00 0.00 ? 228 LEU A HD23 7  
ATOM 11256 N N    . PRO A 1 51  ? 7.138   -2.969  -4.631  1.00 0.00 ? 229 PRO A N    7  
ATOM 11257 C CA   . PRO A 1 51  ? 8.438   -3.561  -4.960  1.00 0.00 ? 229 PRO A CA   7  
ATOM 11258 C C    . PRO A 1 51  ? 9.340   -3.697  -3.738  1.00 0.00 ? 229 PRO A C    7  
ATOM 11259 O O    . PRO A 1 51  ? 9.339   -2.839  -2.854  1.00 0.00 ? 229 PRO A O    7  
ATOM 11260 C CB   . PRO A 1 51  ? 9.038   -2.568  -5.959  1.00 0.00 ? 229 PRO A CB   7  
ATOM 11261 C CG   . PRO A 1 51  ? 8.381   -1.269  -5.642  1.00 0.00 ? 229 PRO A CG   7  
ATOM 11262 C CD   . PRO A 1 51  ? 6.992   -1.610  -5.179  1.00 0.00 ? 229 PRO A CD   7  
ATOM 11263 H HA   . PRO A 1 51  ? 8.326   -4.526  -5.433  1.00 0.00 ? 229 PRO A HA   7  
ATOM 11264 H HB2  . PRO A 1 51  ? 10.109  -2.515  -5.819  1.00 0.00 ? 229 PRO A HB2  7  
ATOM 11265 H HB3  . PRO A 1 51  ? 8.817   -2.887  -6.966  1.00 0.00 ? 229 PRO A HB3  7  
ATOM 11266 H HG2  . PRO A 1 51  ? 8.925   -0.764  -4.859  1.00 0.00 ? 229 PRO A HG2  7  
ATOM 11267 H HG3  . PRO A 1 51  ? 8.340   -0.654  -6.529  1.00 0.00 ? 229 PRO A HG3  7  
ATOM 11268 H HD2  . PRO A 1 51  ? 6.669   -0.918  -4.415  1.00 0.00 ? 229 PRO A HD2  7  
ATOM 11269 H HD3  . PRO A 1 51  ? 6.304   -1.603  -6.012  1.00 0.00 ? 229 PRO A HD3  7  
ATOM 11270 N N    . LEU A 1 52  ? 10.108  -4.780  -3.693  1.00 0.00 ? 230 LEU A N    7  
ATOM 11271 C CA   . LEU A 1 52  ? 11.016  -5.028  -2.578  1.00 0.00 ? 230 LEU A CA   7  
ATOM 11272 C C    . LEU A 1 52  ? 12.083  -3.942  -2.493  1.00 0.00 ? 230 LEU A C    7  
ATOM 11273 O O    . LEU A 1 52  ? 12.617  -3.665  -1.418  1.00 0.00 ? 230 LEU A O    7  
ATOM 11274 C CB   . LEU A 1 52  ? 11.678  -6.399  -2.730  1.00 0.00 ? 230 LEU A CB   7  
ATOM 11275 C CG   . LEU A 1 52  ? 10.783  -7.610  -2.462  1.00 0.00 ? 230 LEU A CG   7  
ATOM 11276 C CD1  . LEU A 1 52  ? 11.499  -8.897  -2.842  1.00 0.00 ? 230 LEU A CD1  7  
ATOM 11277 C CD2  . LEU A 1 52  ? 10.356  -7.645  -1.002  1.00 0.00 ? 230 LEU A CD2  7  
ATOM 11278 H H    . LEU A 1 52  ? 10.065  -5.428  -4.427  1.00 0.00 ? 230 LEU A H    7  
ATOM 11279 H HA   . LEU A 1 52  ? 10.434  -5.017  -1.669  1.00 0.00 ? 230 LEU A HA   7  
ATOM 11280 H HB2  . LEU A 1 52  ? 12.047  -6.478  -3.741  1.00 0.00 ? 230 LEU A HB2  7  
ATOM 11281 H HB3  . LEU A 1 52  ? 12.509  -6.442  -2.040  1.00 0.00 ? 230 LEU A HB3  7  
ATOM 11282 H HG   . LEU A 1 52  ? 9.892   -7.533  -3.070  1.00 0.00 ? 230 LEU A HG   7  
ATOM 11283 H HD11 . LEU A 1 52  ? 12.519  -8.674  -3.115  1.00 0.00 ? 230 LEU A HD11 7  
ATOM 11284 H HD12 . LEU A 1 52  ? 10.993  -9.357  -3.678  1.00 0.00 ? 230 LEU A HD12 7  
ATOM 11285 H HD13 . LEU A 1 52  ? 11.491  -9.575  -2.000  1.00 0.00 ? 230 LEU A HD13 7  
ATOM 11286 H HD21 . LEU A 1 52  ? 10.926  -8.399  -0.479  1.00 0.00 ? 230 LEU A HD21 7  
ATOM 11287 H HD22 . LEU A 1 52  ? 9.304   -7.882  -0.940  1.00 0.00 ? 230 LEU A HD22 7  
ATOM 11288 H HD23 . LEU A 1 52  ? 10.536  -6.681  -0.551  1.00 0.00 ? 230 LEU A HD23 7  
ATOM 11289 N N    . LEU A 1 53  ? 12.388  -3.329  -3.631  1.00 0.00 ? 231 LEU A N    7  
ATOM 11290 C CA   . LEU A 1 53  ? 13.390  -2.270  -3.685  1.00 0.00 ? 231 LEU A CA   7  
ATOM 11291 C C    . LEU A 1 53  ? 12.946  -1.058  -2.873  1.00 0.00 ? 231 LEU A C    7  
ATOM 11292 O O    . LEU A 1 53  ? 13.748  -0.437  -2.175  1.00 0.00 ? 231 LEU A O    7  
ATOM 11293 C CB   . LEU A 1 53  ? 13.649  -1.860  -5.136  1.00 0.00 ? 231 LEU A CB   7  
ATOM 11294 C CG   . LEU A 1 53  ? 13.841  -3.003  -6.133  1.00 0.00 ? 231 LEU A CG   7  
ATOM 11295 C CD1  . LEU A 1 53  ? 13.934  -2.463  -7.552  1.00 0.00 ? 231 LEU A CD1  7  
ATOM 11296 C CD2  . LEU A 1 53  ? 15.082  -3.811  -5.785  1.00 0.00 ? 231 LEU A CD2  7  
ATOM 11297 H H    . LEU A 1 53  ? 11.929  -3.593  -4.455  1.00 0.00 ? 231 LEU A H    7  
ATOM 11298 H HA   . LEU A 1 53  ? 14.304  -2.658  -3.260  1.00 0.00 ? 231 LEU A HA   7  
ATOM 11299 H HB2  . LEU A 1 53  ? 12.809  -1.269  -5.467  1.00 0.00 ? 231 LEU A HB2  7  
ATOM 11300 H HB3  . LEU A 1 53  ? 14.543  -1.252  -5.152  1.00 0.00 ? 231 LEU A HB3  7  
ATOM 11301 H HG   . LEU A 1 53  ? 12.986  -3.663  -6.083  1.00 0.00 ? 231 LEU A HG   7  
ATOM 11302 H HD11 . LEU A 1 53  ? 13.492  -1.480  -7.592  1.00 0.00 ? 231 LEU A HD11 7  
ATOM 11303 H HD12 . LEU A 1 53  ? 13.405  -3.124  -8.223  1.00 0.00 ? 231 LEU A HD12 7  
ATOM 11304 H HD13 . LEU A 1 53  ? 14.971  -2.406  -7.847  1.00 0.00 ? 231 LEU A HD13 7  
ATOM 11305 H HD21 . LEU A 1 53  ? 14.798  -4.670  -5.194  1.00 0.00 ? 231 LEU A HD21 7  
ATOM 11306 H HD22 . LEU A 1 53  ? 15.766  -3.195  -5.220  1.00 0.00 ? 231 LEU A HD22 7  
ATOM 11307 H HD23 . LEU A 1 53  ? 15.562  -4.142  -6.694  1.00 0.00 ? 231 LEU A HD23 7  
ATOM 11308 N N    . LYS A 1 54  ? 11.663  -0.727  -2.967  1.00 0.00 ? 232 LYS A N    7  
ATOM 11309 C CA   . LYS A 1 54  ? 11.109  0.408   -2.239  1.00 0.00 ? 232 LYS A CA   7  
ATOM 11310 C C    . LYS A 1 54  ? 10.757  0.017   -0.807  1.00 0.00 ? 232 LYS A C    7  
ATOM 11311 O O    . LYS A 1 54  ? 10.906  0.815   0.118   1.00 0.00 ? 232 LYS A O    7  
ATOM 11312 C CB   . LYS A 1 54  ? 9.866   0.942   -2.954  1.00 0.00 ? 232 LYS A CB   7  
ATOM 11313 C CG   . LYS A 1 54  ? 9.176   2.074   -2.211  1.00 0.00 ? 232 LYS A CG   7  
ATOM 11314 C CD   . LYS A 1 54  ? 10.052  3.314   -2.147  1.00 0.00 ? 232 LYS A CD   7  
ATOM 11315 C CE   . LYS A 1 54  ? 9.967   4.124   -3.431  1.00 0.00 ? 232 LYS A CE   7  
ATOM 11316 N NZ   . LYS A 1 54  ? 10.930  3.638   -4.458  1.00 0.00 ? 232 LYS A NZ   7  
ATOM 11317 H H    . LYS A 1 54  ? 11.073  -1.261  -3.540  1.00 0.00 ? 232 LYS A H    7  
ATOM 11318 H HA   . LYS A 1 54  ? 11.860  1.184   -2.213  1.00 0.00 ? 232 LYS A HA   7  
ATOM 11319 H HB2  . LYS A 1 54  ? 10.154  1.303   -3.930  1.00 0.00 ? 232 LYS A HB2  7  
ATOM 11320 H HB3  . LYS A 1 54  ? 9.159   0.134   -3.072  1.00 0.00 ? 232 LYS A HB3  7  
ATOM 11321 H HG2  . LYS A 1 54  ? 8.258   2.321   -2.723  1.00 0.00 ? 232 LYS A HG2  7  
ATOM 11322 H HG3  . LYS A 1 54  ? 8.953   1.748   -1.205  1.00 0.00 ? 232 LYS A HG3  7  
ATOM 11323 H HD2  . LYS A 1 54  ? 9.727   3.931   -1.323  1.00 0.00 ? 232 LYS A HD2  7  
ATOM 11324 H HD3  . LYS A 1 54  ? 11.078  3.011   -1.989  1.00 0.00 ? 232 LYS A HD3  7  
ATOM 11325 H HE2  . LYS A 1 54  ? 8.966   4.046   -3.825  1.00 0.00 ? 232 LYS A HE2  7  
ATOM 11326 H HE3  . LYS A 1 54  ? 10.186  5.157   -3.205  1.00 0.00 ? 232 LYS A HE3  7  
ATOM 11327 H HZ1  . LYS A 1 54  ? 11.574  4.406   -4.736  1.00 0.00 ? 232 LYS A HZ1  7  
ATOM 11328 H HZ2  . LYS A 1 54  ? 10.418  3.308   -5.301  1.00 0.00 ? 232 LYS A HZ2  7  
ATOM 11329 H HZ3  . LYS A 1 54  ? 11.492  2.850   -4.077  1.00 0.00 ? 232 LYS A HZ3  7  
ATOM 11330 N N    . ALA A 1 55  ? 10.290  -1.215  -0.633  1.00 0.00 ? 233 ALA A N    7  
ATOM 11331 C CA   . ALA A 1 55  ? 9.921   -1.712  0.686   1.00 0.00 ? 233 ALA A CA   7  
ATOM 11332 C C    . ALA A 1 55  ? 11.150  -1.886  1.572   1.00 0.00 ? 233 ALA A C    7  
ATOM 11333 O O    . ALA A 1 55  ? 11.167  -1.438  2.718   1.00 0.00 ? 233 ALA A O    7  
ATOM 11334 C CB   . ALA A 1 55  ? 9.167   -3.028  0.562   1.00 0.00 ? 233 ALA A CB   7  
ATOM 11335 H H    . ALA A 1 55  ? 10.194  -1.803  -1.410  1.00 0.00 ? 233 ALA A H    7  
ATOM 11336 H HA   . ALA A 1 55  ? 9.260   -0.989  1.142   1.00 0.00 ? 233 ALA A HA   7  
ATOM 11337 H HB1  . ALA A 1 55  ? 9.874   -3.844  0.527   1.00 0.00 ? 233 ALA A HB1  7  
ATOM 11338 H HB2  . ALA A 1 55  ? 8.516   -3.152  1.415   1.00 0.00 ? 233 ALA A HB2  7  
ATOM 11339 H HB3  . ALA A 1 55  ? 8.579   -3.021  -0.343  1.00 0.00 ? 233 ALA A HB3  7  
ATOM 11340 N N    . GLN A 1 56  ? 12.174  -2.539  1.033   1.00 0.00 ? 234 GLN A N    7  
ATOM 11341 C CA   . GLN A 1 56  ? 13.407  -2.772  1.777   1.00 0.00 ? 234 GLN A CA   7  
ATOM 11342 C C    . GLN A 1 56  ? 14.026  -1.454  2.231   1.00 0.00 ? 234 GLN A C    7  
ATOM 11343 O O    . GLN A 1 56  ? 14.611  -1.373  3.310   1.00 0.00 ? 234 GLN A O    7  
ATOM 11344 C CB   . GLN A 1 56  ? 14.405  -3.550  0.918   1.00 0.00 ? 234 GLN A CB   7  
ATOM 11345 C CG   . GLN A 1 56  ? 15.541  -4.169  1.716   1.00 0.00 ? 234 GLN A CG   7  
ATOM 11346 C CD   . GLN A 1 56  ? 15.152  -5.485  2.361   1.00 0.00 ? 234 GLN A CD   7  
ATOM 11347 O OE1  . GLN A 1 56  ? 13.969  -5.810  2.469   1.00 0.00 ? 234 GLN A OE1  7  
ATOM 11348 N NE2  . GLN A 1 56  ? 16.147  -6.250  2.794   1.00 0.00 ? 234 GLN A NE2  7  
ATOM 11349 H H    . GLN A 1 56  ? 12.099  -2.871  0.115   1.00 0.00 ? 234 GLN A H    7  
ATOM 11350 H HA   . GLN A 1 56  ? 13.162  -3.359  2.648   1.00 0.00 ? 234 GLN A HA   7  
ATOM 11351 H HB2  . GLN A 1 56  ? 13.881  -4.342  0.405   1.00 0.00 ? 234 GLN A HB2  7  
ATOM 11352 H HB3  . GLN A 1 56  ? 14.832  -2.879  0.187   1.00 0.00 ? 234 GLN A HB3  7  
ATOM 11353 H HG2  . GLN A 1 56  ? 16.376  -4.344  1.054   1.00 0.00 ? 234 GLN A HG2  7  
ATOM 11354 H HG3  . GLN A 1 56  ? 15.837  -3.478  2.492   1.00 0.00 ? 234 GLN A HG3  7  
ATOM 11355 H HE21 . GLN A 1 56  ? 17.065  -5.925  2.675   1.00 0.00 ? 234 GLN A HE21 7  
ATOM 11356 H HE22 . GLN A 1 56  ? 15.924  -7.105  3.215   1.00 0.00 ? 234 GLN A HE22 7  
ATOM 11357 N N    . GLU A 1 57  ? 13.895  -0.426  1.398   1.00 0.00 ? 235 GLU A N    7  
ATOM 11358 C CA   . GLU A 1 57  ? 14.443  0.887   1.715   1.00 0.00 ? 235 GLU A CA   7  
ATOM 11359 C C    . GLU A 1 57  ? 13.718  1.507   2.906   1.00 0.00 ? 235 GLU A C    7  
ATOM 11360 O O    . GLU A 1 57  ? 14.346  2.036   3.823   1.00 0.00 ? 235 GLU A O    7  
ATOM 11361 C CB   . GLU A 1 57  ? 14.340  1.814   0.502   1.00 0.00 ? 235 GLU A CB   7  
ATOM 11362 C CG   . GLU A 1 57  ? 14.944  3.189   0.733   1.00 0.00 ? 235 GLU A CG   7  
ATOM 11363 C CD   . GLU A 1 57  ? 14.370  4.241   -0.196  1.00 0.00 ? 235 GLU A CD   7  
ATOM 11364 O OE1  . GLU A 1 57  ? 13.138  4.446   -0.170  1.00 0.00 ? 235 GLU A OE1  7  
ATOM 11365 O OE2  . GLU A 1 57  ? 15.151  4.860   -0.947  1.00 0.00 ? 235 GLU A OE2  7  
ATOM 11366 H H    . GLU A 1 57  ? 13.418  -0.554  0.552   1.00 0.00 ? 235 GLU A H    7  
ATOM 11367 H HA   . GLU A 1 57  ? 15.484  0.759   1.970   1.00 0.00 ? 235 GLU A HA   7  
ATOM 11368 H HB2  . GLU A 1 57  ? 14.850  1.354   -0.332  1.00 0.00 ? 235 GLU A HB2  7  
ATOM 11369 H HB3  . GLU A 1 57  ? 13.298  1.940   0.248   1.00 0.00 ? 235 GLU A HB3  7  
ATOM 11370 H HG2  . GLU A 1 57  ? 14.751  3.486   1.752   1.00 0.00 ? 235 GLU A HG2  7  
ATOM 11371 H HG3  . GLU A 1 57  ? 16.010  3.131   0.572   1.00 0.00 ? 235 GLU A HG3  7  
ATOM 11372 N N    . TYR A 1 58  ? 12.391  1.439   2.883   1.00 0.00 ? 236 TYR A N    7  
ATOM 11373 C CA   . TYR A 1 58  ? 11.579  1.995   3.959   1.00 0.00 ? 236 TYR A CA   7  
ATOM 11374 C C    . TYR A 1 58  ? 11.703  1.156   5.226   1.00 0.00 ? 236 TYR A C    7  
ATOM 11375 O O    . TYR A 1 58  ? 11.716  1.687   6.337   1.00 0.00 ? 236 TYR A O    7  
ATOM 11376 C CB   . TYR A 1 58  ? 10.113  2.077   3.529   1.00 0.00 ? 236 TYR A CB   7  
ATOM 11377 C CG   . TYR A 1 58  ? 9.143   2.112   4.688   1.00 0.00 ? 236 TYR A CG   7  
ATOM 11378 C CD1  . TYR A 1 58  ? 8.880   0.969   5.433   1.00 0.00 ? 236 TYR A CD1  7  
ATOM 11379 C CD2  . TYR A 1 58  ? 8.490   3.287   5.038   1.00 0.00 ? 236 TYR A CD2  7  
ATOM 11380 C CE1  . TYR A 1 58  ? 7.994   0.995   6.493   1.00 0.00 ? 236 TYR A CE1  7  
ATOM 11381 C CE2  . TYR A 1 58  ? 7.603   3.323   6.097   1.00 0.00 ? 236 TYR A CE2  7  
ATOM 11382 C CZ   . TYR A 1 58  ? 7.359   2.175   6.822   1.00 0.00 ? 236 TYR A CZ   7  
ATOM 11383 O OH   . TYR A 1 58  ? 6.476   2.206   7.876   1.00 0.00 ? 236 TYR A OH   7  
ATOM 11384 H H    . TYR A 1 58  ? 11.947  1.004   2.125   1.00 0.00 ? 236 TYR A H    7  
ATOM 11385 H HA   . TYR A 1 58  ? 11.940  2.993   4.164   1.00 0.00 ? 236 TYR A HA   7  
ATOM 11386 H HB2  . TYR A 1 58  ? 9.965   2.974   2.947   1.00 0.00 ? 236 TYR A HB2  7  
ATOM 11387 H HB3  . TYR A 1 58  ? 9.875   1.216   2.922   1.00 0.00 ? 236 TYR A HB3  7  
ATOM 11388 H HD1  . TYR A 1 58  ? 9.379   0.046   5.174   1.00 0.00 ? 236 TYR A HD1  7  
ATOM 11389 H HD2  . TYR A 1 58  ? 8.683   4.184   4.468   1.00 0.00 ? 236 TYR A HD2  7  
ATOM 11390 H HE1  . TYR A 1 58  ? 7.803   0.097   7.061   1.00 0.00 ? 236 TYR A HE1  7  
ATOM 11391 H HE2  . TYR A 1 58  ? 7.105   4.246   6.354   1.00 0.00 ? 236 TYR A HE2  7  
ATOM 11392 H HH   . TYR A 1 58  ? 6.197   1.312   8.087   1.00 0.00 ? 236 TYR A HH   7  
ATOM 11393 N N    . ILE A 1 59  ? 11.794  -0.158  5.051   1.00 0.00 ? 237 ILE A N    7  
ATOM 11394 C CA   . ILE A 1 59  ? 11.919  -1.072  6.179   1.00 0.00 ? 237 ILE A CA   7  
ATOM 11395 C C    . ILE A 1 59  ? 13.273  -0.920  6.863   1.00 0.00 ? 237 ILE A C    7  
ATOM 11396 O O    . ILE A 1 59  ? 13.372  -0.978  8.089   1.00 0.00 ? 237 ILE A O    7  
ATOM 11397 C CB   . ILE A 1 59  ? 11.741  -2.537  5.739   1.00 0.00 ? 237 ILE A CB   7  
ATOM 11398 C CG1  . ILE A 1 59  ? 10.369  -2.735  5.091   1.00 0.00 ? 237 ILE A CG1  7  
ATOM 11399 C CG2  . ILE A 1 59  ? 11.910  -3.472  6.928   1.00 0.00 ? 237 ILE A CG2  7  
ATOM 11400 C CD1  . ILE A 1 59  ? 10.337  -3.852  4.072   1.00 0.00 ? 237 ILE A CD1  7  
ATOM 11401 H H    . ILE A 1 59  ? 11.778  -0.521  4.141   1.00 0.00 ? 237 ILE A H    7  
ATOM 11402 H HA   . ILE A 1 59  ? 11.140  -0.833  6.889   1.00 0.00 ? 237 ILE A HA   7  
ATOM 11403 H HB   . ILE A 1 59  ? 12.509  -2.769  5.018   1.00 0.00 ? 237 ILE A HB   7  
ATOM 11404 H HG12 . ILE A 1 59  ? 9.645   -2.965  5.857   1.00 0.00 ? 237 ILE A HG12 7  
ATOM 11405 H HG13 . ILE A 1 59  ? 10.081  -1.821  4.591   1.00 0.00 ? 237 ILE A HG13 7  
ATOM 11406 H HG21 . ILE A 1 59  ? 12.047  -4.483  6.575   1.00 0.00 ? 237 ILE A HG21 7  
ATOM 11407 H HG22 . ILE A 1 59  ? 12.774  -3.172  7.501   1.00 0.00 ? 237 ILE A HG22 7  
ATOM 11408 H HG23 . ILE A 1 59  ? 11.030  -3.424  7.552   1.00 0.00 ? 237 ILE A HG23 7  
ATOM 11409 H HD11 . ILE A 1 59  ? 11.200  -3.776  3.427   1.00 0.00 ? 237 ILE A HD11 7  
ATOM 11410 H HD12 . ILE A 1 59  ? 10.350  -4.804  4.581   1.00 0.00 ? 237 ILE A HD12 7  
ATOM 11411 H HD13 . ILE A 1 59  ? 9.438   -3.773  3.479   1.00 0.00 ? 237 ILE A HD13 7  
ATOM 11412 N N    . ARG A 1 60  ? 14.316  -0.723  6.062   1.00 0.00 ? 238 ARG A N    7  
ATOM 11413 C CA   . ARG A 1 60  ? 15.665  -0.561  6.590   1.00 0.00 ? 238 ARG A CA   7  
ATOM 11414 C C    . ARG A 1 60  ? 15.801  0.761   7.340   1.00 0.00 ? 238 ARG A C    7  
ATOM 11415 O O    . ARG A 1 60  ? 16.425  0.823   8.398   1.00 0.00 ? 238 ARG A O    7  
ATOM 11416 C CB   . ARG A 1 60  ? 16.690  -0.624  5.456   1.00 0.00 ? 238 ARG A CB   7  
ATOM 11417 C CG   . ARG A 1 60  ? 17.917  0.241   5.695   1.00 0.00 ? 238 ARG A CG   7  
ATOM 11418 C CD   . ARG A 1 60  ? 19.147  -0.335  5.011   1.00 0.00 ? 238 ARG A CD   7  
ATOM 11419 N NE   . ARG A 1 60  ? 19.812  -1.339  5.837   1.00 0.00 ? 238 ARG A NE   7  
ATOM 11420 C CZ   . ARG A 1 60  ? 20.500  -1.048  6.936   1.00 0.00 ? 238 ARG A CZ   7  
ATOM 11421 N NH1  . ARG A 1 60  ? 20.612  0.210   7.338   1.00 0.00 ? 238 ARG A NH1  7  
ATOM 11422 N NH2  . ARG A 1 60  ? 21.077  -2.017  7.634   1.00 0.00 ? 238 ARG A NH2  7  
ATOM 11423 H H    . ARG A 1 60  ? 14.174  -0.687  5.093   1.00 0.00 ? 238 ARG A H    7  
ATOM 11424 H HA   . ARG A 1 60  ? 15.852  -1.372  7.277   1.00 0.00 ? 238 ARG A HA   7  
ATOM 11425 H HB2  . ARG A 1 60  ? 17.016  -1.647  5.337   1.00 0.00 ? 238 ARG A HB2  7  
ATOM 11426 H HB3  . ARG A 1 60  ? 16.218  -0.297  4.542   1.00 0.00 ? 238 ARG A HB3  7  
ATOM 11427 H HG2  . ARG A 1 60  ? 17.730  1.230   5.302   1.00 0.00 ? 238 ARG A HG2  7  
ATOM 11428 H HG3  . ARG A 1 60  ? 18.101  0.302   6.757   1.00 0.00 ? 238 ARG A HG3  7  
ATOM 11429 H HD2  . ARG A 1 60  ? 18.844  -0.792  4.081   1.00 0.00 ? 238 ARG A HD2  7  
ATOM 11430 H HD3  . ARG A 1 60  ? 19.839  0.468   4.809   1.00 0.00 ? 238 ARG A HD3  7  
ATOM 11431 H HE   . ARG A 1 60  ? 19.742  -2.275  5.558   1.00 0.00 ? 238 ARG A HE   7  
ATOM 11432 H HH11 . ARG A 1 60  ? 20.177  0.942   6.814   1.00 0.00 ? 238 ARG A HH11 7  
ATOM 11433 H HH12 . ARG A 1 60  ? 21.129  0.426   8.167   1.00 0.00 ? 238 ARG A HH12 7  
ATOM 11434 H HH21 . ARG A 1 60  ? 20.995  -2.967  7.334   1.00 0.00 ? 238 ARG A HH21 7  
ATOM 11435 H HH22 . ARG A 1 60  ? 21.595  -1.797  8.461   1.00 0.00 ? 238 ARG A HH22 7  
ATOM 11436 N N    . GLN A 1 61  ? 15.212  1.814   6.782   1.00 0.00 ? 239 GLN A N    7  
ATOM 11437 C CA   . GLN A 1 61  ? 15.269  3.135   7.398   1.00 0.00 ? 239 GLN A CA   7  
ATOM 11438 C C    . GLN A 1 61  ? 14.257  3.250   8.533   1.00 0.00 ? 239 GLN A C    7  
ATOM 11439 O O    . GLN A 1 61  ? 14.379  4.112   9.403   1.00 0.00 ? 239 GLN A O    7  
ATOM 11440 C CB   . GLN A 1 61  ? 15.006  4.220   6.353   1.00 0.00 ? 239 GLN A CB   7  
ATOM 11441 C CG   . GLN A 1 61  ? 16.201  4.504   5.457   1.00 0.00 ? 239 GLN A CG   7  
ATOM 11442 C CD   . GLN A 1 61  ? 16.125  5.867   4.798   1.00 0.00 ? 239 GLN A CD   7  
ATOM 11443 O OE1  . GLN A 1 61  ? 15.075  6.270   4.297   1.00 0.00 ? 239 GLN A OE1  7  
ATOM 11444 N NE2  . GLN A 1 61  ? 17.241  6.587   4.795   1.00 0.00 ? 239 GLN A NE2  7  
ATOM 11445 H H    . GLN A 1 61  ? 14.729  1.701   5.938   1.00 0.00 ? 239 GLN A H    7  
ATOM 11446 H HA   . GLN A 1 61  ? 16.260  3.270   7.802   1.00 0.00 ? 239 GLN A HA   7  
ATOM 11447 H HB2  . GLN A 1 61  ? 14.181  3.910   5.729   1.00 0.00 ? 239 GLN A HB2  7  
ATOM 11448 H HB3  . GLN A 1 61  ? 14.738  5.135   6.860   1.00 0.00 ? 239 GLN A HB3  7  
ATOM 11449 H HG2  . GLN A 1 61  ? 17.100  4.460   6.053   1.00 0.00 ? 239 GLN A HG2  7  
ATOM 11450 H HG3  . GLN A 1 61  ? 16.244  3.749   4.686   1.00 0.00 ? 239 GLN A HG3  7  
ATOM 11451 H HE21 . GLN A 1 61  ? 18.040  6.202   5.212   1.00 0.00 ? 239 GLN A HE21 7  
ATOM 11452 H HE22 . GLN A 1 61  ? 17.221  7.471   4.375   1.00 0.00 ? 239 GLN A HE22 7  
ATOM 11453 N N    . LYS A 1 62  ? 13.256  2.375   8.519   1.00 0.00 ? 240 LYS A N    7  
ATOM 11454 C CA   . LYS A 1 62  ? 12.223  2.377   9.547   1.00 0.00 ? 240 LYS A CA   7  
ATOM 11455 C C    . LYS A 1 62  ? 12.467  1.269   10.567  1.00 0.00 ? 240 LYS A C    7  
ATOM 11456 O O    . LYS A 1 62  ? 12.818  1.536   11.715  1.00 0.00 ? 240 LYS A O    7  
ATOM 11457 C CB   . LYS A 1 62  ? 10.842  2.204   8.911   1.00 0.00 ? 240 LYS A CB   7  
ATOM 11458 C CG   . LYS A 1 62  ? 10.434  3.362   8.017   1.00 0.00 ? 240 LYS A CG   7  
ATOM 11459 C CD   . LYS A 1 62  ? 9.749   4.463   8.809   1.00 0.00 ? 240 LYS A CD   7  
ATOM 11460 C CE   . LYS A 1 62  ? 9.979   5.828   8.178   1.00 0.00 ? 240 LYS A CE   7  
ATOM 11461 N NZ   . LYS A 1 62  ? 8.943   6.149   7.158   1.00 0.00 ? 240 LYS A NZ   7  
ATOM 11462 H H    . LYS A 1 62  ? 13.213  1.711   7.799   1.00 0.00 ? 240 LYS A H    7  
ATOM 11463 H HA   . LYS A 1 62  ? 12.260  3.330   10.053  1.00 0.00 ? 240 LYS A HA   7  
ATOM 11464 H HB2  . LYS A 1 62  ? 10.843  1.301   8.318   1.00 0.00 ? 240 LYS A HB2  7  
ATOM 11465 H HB3  . LYS A 1 62  ? 10.106  2.107   9.697   1.00 0.00 ? 240 LYS A HB3  7  
ATOM 11466 H HG2  . LYS A 1 62  ? 11.316  3.768   7.544   1.00 0.00 ? 240 LYS A HG2  7  
ATOM 11467 H HG3  . LYS A 1 62  ? 9.753   2.998   7.261   1.00 0.00 ? 240 LYS A HG3  7  
ATOM 11468 H HD2  . LYS A 1 62  ? 8.688   4.267   8.838   1.00 0.00 ? 240 LYS A HD2  7  
ATOM 11469 H HD3  . LYS A 1 62  ? 10.144  4.470   9.815   1.00 0.00 ? 240 LYS A HD3  7  
ATOM 11470 H HE2  . LYS A 1 62  ? 9.952   6.578   8.954   1.00 0.00 ? 240 LYS A HE2  7  
ATOM 11471 H HE3  . LYS A 1 62  ? 10.951  5.833   7.707   1.00 0.00 ? 240 LYS A HE3  7  
ATOM 11472 H HZ1  . LYS A 1 62  ? 8.841   5.357   6.491   1.00 0.00 ? 240 LYS A HZ1  7  
ATOM 11473 H HZ2  . LYS A 1 62  ? 9.217   7.000   6.627   1.00 0.00 ? 240 LYS A HZ2  7  
ATOM 11474 H HZ3  . LYS A 1 62  ? 8.028   6.321   7.619   1.00 0.00 ? 240 LYS A HZ3  7  
ATOM 11475 N N    . ASN A 1 63  ? 12.281  0.025   10.138  1.00 0.00 ? 241 ASN A N    7  
ATOM 11476 C CA   . ASN A 1 63  ? 12.483  -1.124  11.014  1.00 0.00 ? 241 ASN A CA   7  
ATOM 11477 C C    . ASN A 1 63  ? 13.953  -1.529  11.050  1.00 0.00 ? 241 ASN A C    7  
ATOM 11478 O O    . ASN A 1 63  ? 14.281  -2.709  11.171  1.00 0.00 ? 241 ASN A O    7  
ATOM 11479 C CB   . ASN A 1 63  ? 11.628  -2.304  10.547  1.00 0.00 ? 241 ASN A CB   7  
ATOM 11480 C CG   . ASN A 1 63  ? 11.298  -3.260  11.676  1.00 0.00 ? 241 ASN A CG   7  
ATOM 11481 O OD1  . ASN A 1 63  ? 11.787  -3.109  12.796  1.00 0.00 ? 241 ASN A OD1  7  
ATOM 11482 N ND2  . ASN A 1 63  ? 10.464  -4.252  11.386  1.00 0.00 ? 241 ASN A ND2  7  
ATOM 11483 H H    . ASN A 1 63  ? 12.002  -0.125  9.211   1.00 0.00 ? 241 ASN A H    7  
ATOM 11484 H HA   . ASN A 1 63  ? 12.176  -0.839  12.009  1.00 0.00 ? 241 ASN A HA   7  
ATOM 11485 H HB2  . ASN A 1 63  ? 10.702  -1.929  10.136  1.00 0.00 ? 241 ASN A HB2  7  
ATOM 11486 H HB3  . ASN A 1 63  ? 12.163  -2.848  9.783   1.00 0.00 ? 241 ASN A HB3  7  
ATOM 11487 H HD21 . ASN A 1 63  ? 10.113  -4.310  10.472  1.00 0.00 ? 241 ASN A HD21 7  
ATOM 11488 H HD22 . ASN A 1 63  ? 10.232  -4.885  12.098  1.00 0.00 ? 241 ASN A HD22 7  
ATOM 11489 N N    . LYS A 1 64  ? 14.836  -0.542  10.943  1.00 0.00 ? 242 LYS A N    7  
ATOM 11490 C CA   . LYS A 1 64  ? 16.272  -0.793  10.965  1.00 0.00 ? 242 LYS A CA   7  
ATOM 11491 C C    . LYS A 1 64  ? 16.603  -2.120  10.290  1.00 0.00 ? 242 LYS A C    7  
ATOM 11492 O O    . LYS A 1 64  ? 17.523  -2.825  10.702  1.00 0.00 ? 242 LYS A O    7  
ATOM 11493 C CB   . LYS A 1 64  ? 16.788  -0.799  12.406  1.00 0.00 ? 242 LYS A CB   7  
ATOM 11494 C CG   . LYS A 1 64  ? 17.216  0.570   12.905  1.00 0.00 ? 242 LYS A CG   7  
ATOM 11495 C CD   . LYS A 1 64  ? 18.131  0.463   14.113  1.00 0.00 ? 242 LYS A CD   7  
ATOM 11496 C CE   . LYS A 1 64  ? 18.381  1.823   14.746  1.00 0.00 ? 242 LYS A CE   7  
ATOM 11497 N NZ   . LYS A 1 64  ? 19.225  1.719   15.969  1.00 0.00 ? 242 LYS A NZ   7  
ATOM 11498 H H    . LYS A 1 64  ? 14.514  0.380   10.848  1.00 0.00 ? 242 LYS A H    7  
ATOM 11499 H HA   . LYS A 1 64  ? 16.757  0.004   10.422  1.00 0.00 ? 242 LYS A HA   7  
ATOM 11500 H HB2  . LYS A 1 64  ? 16.006  -1.167  13.054  1.00 0.00 ? 242 LYS A HB2  7  
ATOM 11501 H HB3  . LYS A 1 64  ? 17.638  -1.464  12.469  1.00 0.00 ? 242 LYS A HB3  7  
ATOM 11502 H HG2  . LYS A 1 64  ? 17.742  1.083   12.113  1.00 0.00 ? 242 LYS A HG2  7  
ATOM 11503 H HG3  . LYS A 1 64  ? 16.336  1.134   13.180  1.00 0.00 ? 242 LYS A HG3  7  
ATOM 11504 H HD2  . LYS A 1 64  ? 17.672  -0.184  14.846  1.00 0.00 ? 242 LYS A HD2  7  
ATOM 11505 H HD3  . LYS A 1 64  ? 19.077  0.041   13.801  1.00 0.00 ? 242 LYS A HD3  7  
ATOM 11506 H HE2  . LYS A 1 64  ? 18.879  2.454   14.027  1.00 0.00 ? 242 LYS A HE2  7  
ATOM 11507 H HE3  . LYS A 1 64  ? 17.430  2.261   15.012  1.00 0.00 ? 242 LYS A HE3  7  
ATOM 11508 H HZ1  . LYS A 1 64  ? 18.944  0.888   16.527  1.00 0.00 ? 242 LYS A HZ1  7  
ATOM 11509 H HZ2  . LYS A 1 64  ? 19.111  2.571   16.555  1.00 0.00 ? 242 LYS A HZ2  7  
ATOM 11510 H HZ3  . LYS A 1 64  ? 20.226  1.624   15.705  1.00 0.00 ? 242 LYS A HZ3  7  
ATOM 11511 N N    . GLY A 1 65  ? 15.846  -2.455  9.249   1.00 0.00 ? 243 GLY A N    7  
ATOM 11512 C CA   . GLY A 1 65  ? 16.075  -3.696  8.533   1.00 0.00 ? 243 GLY A CA   7  
ATOM 11513 C C    . GLY A 1 65  ? 15.523  -4.900  9.269   1.00 0.00 ? 243 GLY A C    7  
ATOM 11514 O O    . GLY A 1 65  ? 16.279  -5.695  9.827   1.00 0.00 ? 243 GLY A O    7  
ATOM 11515 H H    . GLY A 1 65  ? 15.126  -1.853  8.965   1.00 0.00 ? 243 GLY A H    7  
ATOM 11516 H HA2  . GLY A 1 65  ? 15.604  -3.632  7.564   1.00 0.00 ? 243 GLY A HA2  7  
ATOM 11517 H HA3  . GLY A 1 65  ? 17.139  -3.828  8.397   1.00 0.00 ? 243 GLY A HA3  7  
ATOM 11518 N N    . ALA A 1 66  ? 14.201  -5.035  9.273   1.00 0.00 ? 244 ALA A N    7  
ATOM 11519 C CA   . ALA A 1 66  ? 13.548  -6.151  9.946   1.00 0.00 ? 244 ALA A CA   7  
ATOM 11520 C C    . ALA A 1 66  ? 12.224  -6.499  9.274   1.00 0.00 ? 244 ALA A C    7  
ATOM 11521 O O    . ALA A 1 66  ? 11.349  -5.645  9.124   1.00 0.00 ? 244 ALA A O    7  
ATOM 11522 C CB   . ALA A 1 66  ? 13.327  -5.824  11.415  1.00 0.00 ? 244 ALA A CB   7  
ATOM 11523 H H    . ALA A 1 66  ? 13.652  -4.368  8.810   1.00 0.00 ? 244 ALA A H    7  
ATOM 11524 H HA   . ALA A 1 66  ? 14.206  -7.006  9.887   1.00 0.00 ? 244 ALA A HA   7  
ATOM 11525 H HB1  . ALA A 1 66  ? 13.967  -5.002  11.701  1.00 0.00 ? 244 ALA A HB1  7  
ATOM 11526 H HB2  . ALA A 1 66  ? 12.294  -5.549  11.571  1.00 0.00 ? 244 ALA A HB2  7  
ATOM 11527 H HB3  . ALA A 1 66  ? 13.563  -6.690  12.015  1.00 0.00 ? 244 ALA A HB3  7  
ATOM 11528 N N    . LYS A 1 67  ? 12.083  -7.757  8.870   1.00 0.00 ? 245 LYS A N    7  
ATOM 11529 C CA   . LYS A 1 67  ? 10.866  -8.218  8.214   1.00 0.00 ? 245 LYS A CA   7  
ATOM 11530 C C    . LYS A 1 67  ? 9.634   -7.558  8.826   1.00 0.00 ? 245 LYS A C    7  
ATOM 11531 O O    . LYS A 1 67  ? 9.585   -7.308  10