data_1WN7
# 
_entry.id   1WN7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1WN7         
RCSB  RCSB023769   
WWPDB D_1000023769 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1GCX 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WN7 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kuroita, T.'   1 
'Matsumura, H.' 2 
'Yokota, N.'    3 
'Hashimoto, H.' 4 
'Imanaka, T.'   5 
'Inoue, T.'     6 
'Kai, Y.'       7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural Mechanism for Coordination of Proofreading and Polymerase Activities in Archaeal DNA Polymerases' J.Mol.Biol. 
351 291 298 2005 JMOBAK UK 0022-2836 0070 ? 16019029 10.1016/j.jmb.2005.06.015 
1       'Crystal structure of DNA polymerase from hyperthermophilic archaeon Pyrococcus kodakaraensis KOD1'           J.Mol.Biol. 
306 469 477 2001 JMOBAK UK 0022-2836 0070 ? 11178906 10.1006/jmbi.2000.4403    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kuroita, T.'     1  
primary 'Matsumura, H.'   2  
primary 'Yokota, N.'      3  
primary 'Kitabayashi, M.' 4  
primary 'Hashimoto, H.'   5  
primary 'Inoue, T.'       6  
primary 'Imanaka, T.'     7  
primary 'Kai, Y.'         8  
1       'Hashimoto, H.'   9  
1       'Nishioka, M.'    10 
1       'Fujiwara, S.'    11 
1       'Takagi, M.'      12 
1       'Imanaka, T.'     13 
1       'Inoue, T.'       14 
1       'Kai, Y.'         15 
# 
_cell.entry_id           1WN7 
_cell.length_a           74.344 
_cell.length_b           111.131 
_cell.length_c           111.559 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1WN7 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Family B DNA Polymerase' 90153.406 1   2.7.7.7 ? ? ? 
2 non-polymer syn 'NICKEL (II) ION'         58.693    1   ?       ? ? ? 
3 non-polymer syn GLYCEROL                  92.094    1   ?       ? ? ? 
4 water       nat water                     18.015    277 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MILDTDYITEDGKPVIRIFKKENGEFKIEYDRTFEPYFYALLKDDSAIEEVKKITAERHGTVVTVKRVEKVQKKFLGRPV
EVWKLYFTHPQDVPAIRDKIREHPAVIDIYEYDIPFAKRYLIDKGLVPMEGDEELKMLAFDIETLYEEGEEFAEGPILMI
SYADEEGARVITWKNVDLPYVDVVSTEREMIKRFLRVVKEKDPDVLITYNGDNFDFAYLKKRCEKLGINFALGRDGSEPK
IQRMGDRFAVEVKGRIHFDLYPVIRRTINLPTYTLEAVYEAVFGQPKEKVYAEEITTAWETGENLERVARYSMEDAKVTY
ELGKEFLPMEAQLSRLIGQSLWDVSRSSTGNLVEWFLLRKAYERNELAPNKPDEKELARRRQSYEGGYVKEPERGLWENI
VYLDFRSLYPSIIITHNVSPDTLNREGCKEYDVAPQVGHRFCKDFPGFIPSLLGDLLEERQKIKKKMKATIDPIERKLLD
YRQRAIKILANSYYGYYGYARARWYCKECAESVTAWGREYITMTIKEIEEKYGFKVIYSDTDGFFATIPGADAETVKKKA
MEFLKYINAKLPGALELEYEGFYERGFFVTKKKYAVIDEEGKITTRGLEIVRRDWSEIAKETQARVLEALLKDGDVEKAV
RIVKEVTEKLSKYEVPPEKLVIHEQITRDLKDYKATGPHVAVAKRLAARGVKIRPGTVISYIVLKGSGRIGDRAIPFDEF
DPTKHKYDAEYYIENQVLPAVERILRAFGYRKEDLRYQKTRQVGLSAWLKPKGT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MILDTDYITEDGKPVIRIFKKENGEFKIEYDRTFEPYFYALLKDDSAIEEVKKITAERHGTVVTVKRVEKVQKKFLGRPV
EVWKLYFTHPQDVPAIRDKIREHPAVIDIYEYDIPFAKRYLIDKGLVPMEGDEELKMLAFDIETLYEEGEEFAEGPILMI
SYADEEGARVITWKNVDLPYVDVVSTEREMIKRFLRVVKEKDPDVLITYNGDNFDFAYLKKRCEKLGINFALGRDGSEPK
IQRMGDRFAVEVKGRIHFDLYPVIRRTINLPTYTLEAVYEAVFGQPKEKVYAEEITTAWETGENLERVARYSMEDAKVTY
ELGKEFLPMEAQLSRLIGQSLWDVSRSSTGNLVEWFLLRKAYERNELAPNKPDEKELARRRQSYEGGYVKEPERGLWENI
VYLDFRSLYPSIIITHNVSPDTLNREGCKEYDVAPQVGHRFCKDFPGFIPSLLGDLLEERQKIKKKMKATIDPIERKLLD
YRQRAIKILANSYYGYYGYARARWYCKECAESVTAWGREYITMTIKEIEEKYGFKVIYSDTDGFFATIPGADAETVKKKA
MEFLKYINAKLPGALELEYEGFYERGFFVTKKKYAVIDEEGKITTRGLEIVRRDWSEIAKETQARVLEALLKDGDVEKAV
RIVKEVTEKLSKYEVPPEKLVIHEQITRDLKDYKATGPHVAVAKRLAARGVKIRPGTVISYIVLKGSGRIGDRAIPFDEF
DPTKHKYDAEYYIENQVLPAVERILRAFGYRKEDLRYQKTRQVGLSAWLKPKGT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   LEU n 
1 4   ASP n 
1 5   THR n 
1 6   ASP n 
1 7   TYR n 
1 8   ILE n 
1 9   THR n 
1 10  GLU n 
1 11  ASP n 
1 12  GLY n 
1 13  LYS n 
1 14  PRO n 
1 15  VAL n 
1 16  ILE n 
1 17  ARG n 
1 18  ILE n 
1 19  PHE n 
1 20  LYS n 
1 21  LYS n 
1 22  GLU n 
1 23  ASN n 
1 24  GLY n 
1 25  GLU n 
1 26  PHE n 
1 27  LYS n 
1 28  ILE n 
1 29  GLU n 
1 30  TYR n 
1 31  ASP n 
1 32  ARG n 
1 33  THR n 
1 34  PHE n 
1 35  GLU n 
1 36  PRO n 
1 37  TYR n 
1 38  PHE n 
1 39  TYR n 
1 40  ALA n 
1 41  LEU n 
1 42  LEU n 
1 43  LYS n 
1 44  ASP n 
1 45  ASP n 
1 46  SER n 
1 47  ALA n 
1 48  ILE n 
1 49  GLU n 
1 50  GLU n 
1 51  VAL n 
1 52  LYS n 
1 53  LYS n 
1 54  ILE n 
1 55  THR n 
1 56  ALA n 
1 57  GLU n 
1 58  ARG n 
1 59  HIS n 
1 60  GLY n 
1 61  THR n 
1 62  VAL n 
1 63  VAL n 
1 64  THR n 
1 65  VAL n 
1 66  LYS n 
1 67  ARG n 
1 68  VAL n 
1 69  GLU n 
1 70  LYS n 
1 71  VAL n 
1 72  GLN n 
1 73  LYS n 
1 74  LYS n 
1 75  PHE n 
1 76  LEU n 
1 77  GLY n 
1 78  ARG n 
1 79  PRO n 
1 80  VAL n 
1 81  GLU n 
1 82  VAL n 
1 83  TRP n 
1 84  LYS n 
1 85  LEU n 
1 86  TYR n 
1 87  PHE n 
1 88  THR n 
1 89  HIS n 
1 90  PRO n 
1 91  GLN n 
1 92  ASP n 
1 93  VAL n 
1 94  PRO n 
1 95  ALA n 
1 96  ILE n 
1 97  ARG n 
1 98  ASP n 
1 99  LYS n 
1 100 ILE n 
1 101 ARG n 
1 102 GLU n 
1 103 HIS n 
1 104 PRO n 
1 105 ALA n 
1 106 VAL n 
1 107 ILE n 
1 108 ASP n 
1 109 ILE n 
1 110 TYR n 
1 111 GLU n 
1 112 TYR n 
1 113 ASP n 
1 114 ILE n 
1 115 PRO n 
1 116 PHE n 
1 117 ALA n 
1 118 LYS n 
1 119 ARG n 
1 120 TYR n 
1 121 LEU n 
1 122 ILE n 
1 123 ASP n 
1 124 LYS n 
1 125 GLY n 
1 126 LEU n 
1 127 VAL n 
1 128 PRO n 
1 129 MET n 
1 130 GLU n 
1 131 GLY n 
1 132 ASP n 
1 133 GLU n 
1 134 GLU n 
1 135 LEU n 
1 136 LYS n 
1 137 MET n 
1 138 LEU n 
1 139 ALA n 
1 140 PHE n 
1 141 ASP n 
1 142 ILE n 
1 143 GLU n 
1 144 THR n 
1 145 LEU n 
1 146 TYR n 
1 147 GLU n 
1 148 GLU n 
1 149 GLY n 
1 150 GLU n 
1 151 GLU n 
1 152 PHE n 
1 153 ALA n 
1 154 GLU n 
1 155 GLY n 
1 156 PRO n 
1 157 ILE n 
1 158 LEU n 
1 159 MET n 
1 160 ILE n 
1 161 SER n 
1 162 TYR n 
1 163 ALA n 
1 164 ASP n 
1 165 GLU n 
1 166 GLU n 
1 167 GLY n 
1 168 ALA n 
1 169 ARG n 
1 170 VAL n 
1 171 ILE n 
1 172 THR n 
1 173 TRP n 
1 174 LYS n 
1 175 ASN n 
1 176 VAL n 
1 177 ASP n 
1 178 LEU n 
1 179 PRO n 
1 180 TYR n 
1 181 VAL n 
1 182 ASP n 
1 183 VAL n 
1 184 VAL n 
1 185 SER n 
1 186 THR n 
1 187 GLU n 
1 188 ARG n 
1 189 GLU n 
1 190 MET n 
1 191 ILE n 
1 192 LYS n 
1 193 ARG n 
1 194 PHE n 
1 195 LEU n 
1 196 ARG n 
1 197 VAL n 
1 198 VAL n 
1 199 LYS n 
1 200 GLU n 
1 201 LYS n 
1 202 ASP n 
1 203 PRO n 
1 204 ASP n 
1 205 VAL n 
1 206 LEU n 
1 207 ILE n 
1 208 THR n 
1 209 TYR n 
1 210 ASN n 
1 211 GLY n 
1 212 ASP n 
1 213 ASN n 
1 214 PHE n 
1 215 ASP n 
1 216 PHE n 
1 217 ALA n 
1 218 TYR n 
1 219 LEU n 
1 220 LYS n 
1 221 LYS n 
1 222 ARG n 
1 223 CYS n 
1 224 GLU n 
1 225 LYS n 
1 226 LEU n 
1 227 GLY n 
1 228 ILE n 
1 229 ASN n 
1 230 PHE n 
1 231 ALA n 
1 232 LEU n 
1 233 GLY n 
1 234 ARG n 
1 235 ASP n 
1 236 GLY n 
1 237 SER n 
1 238 GLU n 
1 239 PRO n 
1 240 LYS n 
1 241 ILE n 
1 242 GLN n 
1 243 ARG n 
1 244 MET n 
1 245 GLY n 
1 246 ASP n 
1 247 ARG n 
1 248 PHE n 
1 249 ALA n 
1 250 VAL n 
1 251 GLU n 
1 252 VAL n 
1 253 LYS n 
1 254 GLY n 
1 255 ARG n 
1 256 ILE n 
1 257 HIS n 
1 258 PHE n 
1 259 ASP n 
1 260 LEU n 
1 261 TYR n 
1 262 PRO n 
1 263 VAL n 
1 264 ILE n 
1 265 ARG n 
1 266 ARG n 
1 267 THR n 
1 268 ILE n 
1 269 ASN n 
1 270 LEU n 
1 271 PRO n 
1 272 THR n 
1 273 TYR n 
1 274 THR n 
1 275 LEU n 
1 276 GLU n 
1 277 ALA n 
1 278 VAL n 
1 279 TYR n 
1 280 GLU n 
1 281 ALA n 
1 282 VAL n 
1 283 PHE n 
1 284 GLY n 
1 285 GLN n 
1 286 PRO n 
1 287 LYS n 
1 288 GLU n 
1 289 LYS n 
1 290 VAL n 
1 291 TYR n 
1 292 ALA n 
1 293 GLU n 
1 294 GLU n 
1 295 ILE n 
1 296 THR n 
1 297 THR n 
1 298 ALA n 
1 299 TRP n 
1 300 GLU n 
1 301 THR n 
1 302 GLY n 
1 303 GLU n 
1 304 ASN n 
1 305 LEU n 
1 306 GLU n 
1 307 ARG n 
1 308 VAL n 
1 309 ALA n 
1 310 ARG n 
1 311 TYR n 
1 312 SER n 
1 313 MET n 
1 314 GLU n 
1 315 ASP n 
1 316 ALA n 
1 317 LYS n 
1 318 VAL n 
1 319 THR n 
1 320 TYR n 
1 321 GLU n 
1 322 LEU n 
1 323 GLY n 
1 324 LYS n 
1 325 GLU n 
1 326 PHE n 
1 327 LEU n 
1 328 PRO n 
1 329 MET n 
1 330 GLU n 
1 331 ALA n 
1 332 GLN n 
1 333 LEU n 
1 334 SER n 
1 335 ARG n 
1 336 LEU n 
1 337 ILE n 
1 338 GLY n 
1 339 GLN n 
1 340 SER n 
1 341 LEU n 
1 342 TRP n 
1 343 ASP n 
1 344 VAL n 
1 345 SER n 
1 346 ARG n 
1 347 SER n 
1 348 SER n 
1 349 THR n 
1 350 GLY n 
1 351 ASN n 
1 352 LEU n 
1 353 VAL n 
1 354 GLU n 
1 355 TRP n 
1 356 PHE n 
1 357 LEU n 
1 358 LEU n 
1 359 ARG n 
1 360 LYS n 
1 361 ALA n 
1 362 TYR n 
1 363 GLU n 
1 364 ARG n 
1 365 ASN n 
1 366 GLU n 
1 367 LEU n 
1 368 ALA n 
1 369 PRO n 
1 370 ASN n 
1 371 LYS n 
1 372 PRO n 
1 373 ASP n 
1 374 GLU n 
1 375 LYS n 
1 376 GLU n 
1 377 LEU n 
1 378 ALA n 
1 379 ARG n 
1 380 ARG n 
1 381 ARG n 
1 382 GLN n 
1 383 SER n 
1 384 TYR n 
1 385 GLU n 
1 386 GLY n 
1 387 GLY n 
1 388 TYR n 
1 389 VAL n 
1 390 LYS n 
1 391 GLU n 
1 392 PRO n 
1 393 GLU n 
1 394 ARG n 
1 395 GLY n 
1 396 LEU n 
1 397 TRP n 
1 398 GLU n 
1 399 ASN n 
1 400 ILE n 
1 401 VAL n 
1 402 TYR n 
1 403 LEU n 
1 404 ASP n 
1 405 PHE n 
1 406 ARG n 
1 407 SER n 
1 408 LEU n 
1 409 TYR n 
1 410 PRO n 
1 411 SER n 
1 412 ILE n 
1 413 ILE n 
1 414 ILE n 
1 415 THR n 
1 416 HIS n 
1 417 ASN n 
1 418 VAL n 
1 419 SER n 
1 420 PRO n 
1 421 ASP n 
1 422 THR n 
1 423 LEU n 
1 424 ASN n 
1 425 ARG n 
1 426 GLU n 
1 427 GLY n 
1 428 CYS n 
1 429 LYS n 
1 430 GLU n 
1 431 TYR n 
1 432 ASP n 
1 433 VAL n 
1 434 ALA n 
1 435 PRO n 
1 436 GLN n 
1 437 VAL n 
1 438 GLY n 
1 439 HIS n 
1 440 ARG n 
1 441 PHE n 
1 442 CYS n 
1 443 LYS n 
1 444 ASP n 
1 445 PHE n 
1 446 PRO n 
1 447 GLY n 
1 448 PHE n 
1 449 ILE n 
1 450 PRO n 
1 451 SER n 
1 452 LEU n 
1 453 LEU n 
1 454 GLY n 
1 455 ASP n 
1 456 LEU n 
1 457 LEU n 
1 458 GLU n 
1 459 GLU n 
1 460 ARG n 
1 461 GLN n 
1 462 LYS n 
1 463 ILE n 
1 464 LYS n 
1 465 LYS n 
1 466 LYS n 
1 467 MET n 
1 468 LYS n 
1 469 ALA n 
1 470 THR n 
1 471 ILE n 
1 472 ASP n 
1 473 PRO n 
1 474 ILE n 
1 475 GLU n 
1 476 ARG n 
1 477 LYS n 
1 478 LEU n 
1 479 LEU n 
1 480 ASP n 
1 481 TYR n 
1 482 ARG n 
1 483 GLN n 
1 484 ARG n 
1 485 ALA n 
1 486 ILE n 
1 487 LYS n 
1 488 ILE n 
1 489 LEU n 
1 490 ALA n 
1 491 ASN n 
1 492 SER n 
1 493 TYR n 
1 494 TYR n 
1 495 GLY n 
1 496 TYR n 
1 497 TYR n 
1 498 GLY n 
1 499 TYR n 
1 500 ALA n 
1 501 ARG n 
1 502 ALA n 
1 503 ARG n 
1 504 TRP n 
1 505 TYR n 
1 506 CYS n 
1 507 LYS n 
1 508 GLU n 
1 509 CYS n 
1 510 ALA n 
1 511 GLU n 
1 512 SER n 
1 513 VAL n 
1 514 THR n 
1 515 ALA n 
1 516 TRP n 
1 517 GLY n 
1 518 ARG n 
1 519 GLU n 
1 520 TYR n 
1 521 ILE n 
1 522 THR n 
1 523 MET n 
1 524 THR n 
1 525 ILE n 
1 526 LYS n 
1 527 GLU n 
1 528 ILE n 
1 529 GLU n 
1 530 GLU n 
1 531 LYS n 
1 532 TYR n 
1 533 GLY n 
1 534 PHE n 
1 535 LYS n 
1 536 VAL n 
1 537 ILE n 
1 538 TYR n 
1 539 SER n 
1 540 ASP n 
1 541 THR n 
1 542 ASP n 
1 543 GLY n 
1 544 PHE n 
1 545 PHE n 
1 546 ALA n 
1 547 THR n 
1 548 ILE n 
1 549 PRO n 
1 550 GLY n 
1 551 ALA n 
1 552 ASP n 
1 553 ALA n 
1 554 GLU n 
1 555 THR n 
1 556 VAL n 
1 557 LYS n 
1 558 LYS n 
1 559 LYS n 
1 560 ALA n 
1 561 MET n 
1 562 GLU n 
1 563 PHE n 
1 564 LEU n 
1 565 LYS n 
1 566 TYR n 
1 567 ILE n 
1 568 ASN n 
1 569 ALA n 
1 570 LYS n 
1 571 LEU n 
1 572 PRO n 
1 573 GLY n 
1 574 ALA n 
1 575 LEU n 
1 576 GLU n 
1 577 LEU n 
1 578 GLU n 
1 579 TYR n 
1 580 GLU n 
1 581 GLY n 
1 582 PHE n 
1 583 TYR n 
1 584 GLU n 
1 585 ARG n 
1 586 GLY n 
1 587 PHE n 
1 588 PHE n 
1 589 VAL n 
1 590 THR n 
1 591 LYS n 
1 592 LYS n 
1 593 LYS n 
1 594 TYR n 
1 595 ALA n 
1 596 VAL n 
1 597 ILE n 
1 598 ASP n 
1 599 GLU n 
1 600 GLU n 
1 601 GLY n 
1 602 LYS n 
1 603 ILE n 
1 604 THR n 
1 605 THR n 
1 606 ARG n 
1 607 GLY n 
1 608 LEU n 
1 609 GLU n 
1 610 ILE n 
1 611 VAL n 
1 612 ARG n 
1 613 ARG n 
1 614 ASP n 
1 615 TRP n 
1 616 SER n 
1 617 GLU n 
1 618 ILE n 
1 619 ALA n 
1 620 LYS n 
1 621 GLU n 
1 622 THR n 
1 623 GLN n 
1 624 ALA n 
1 625 ARG n 
1 626 VAL n 
1 627 LEU n 
1 628 GLU n 
1 629 ALA n 
1 630 LEU n 
1 631 LEU n 
1 632 LYS n 
1 633 ASP n 
1 634 GLY n 
1 635 ASP n 
1 636 VAL n 
1 637 GLU n 
1 638 LYS n 
1 639 ALA n 
1 640 VAL n 
1 641 ARG n 
1 642 ILE n 
1 643 VAL n 
1 644 LYS n 
1 645 GLU n 
1 646 VAL n 
1 647 THR n 
1 648 GLU n 
1 649 LYS n 
1 650 LEU n 
1 651 SER n 
1 652 LYS n 
1 653 TYR n 
1 654 GLU n 
1 655 VAL n 
1 656 PRO n 
1 657 PRO n 
1 658 GLU n 
1 659 LYS n 
1 660 LEU n 
1 661 VAL n 
1 662 ILE n 
1 663 HIS n 
1 664 GLU n 
1 665 GLN n 
1 666 ILE n 
1 667 THR n 
1 668 ARG n 
1 669 ASP n 
1 670 LEU n 
1 671 LYS n 
1 672 ASP n 
1 673 TYR n 
1 674 LYS n 
1 675 ALA n 
1 676 THR n 
1 677 GLY n 
1 678 PRO n 
1 679 HIS n 
1 680 VAL n 
1 681 ALA n 
1 682 VAL n 
1 683 ALA n 
1 684 LYS n 
1 685 ARG n 
1 686 LEU n 
1 687 ALA n 
1 688 ALA n 
1 689 ARG n 
1 690 GLY n 
1 691 VAL n 
1 692 LYS n 
1 693 ILE n 
1 694 ARG n 
1 695 PRO n 
1 696 GLY n 
1 697 THR n 
1 698 VAL n 
1 699 ILE n 
1 700 SER n 
1 701 TYR n 
1 702 ILE n 
1 703 VAL n 
1 704 LEU n 
1 705 LYS n 
1 706 GLY n 
1 707 SER n 
1 708 GLY n 
1 709 ARG n 
1 710 ILE n 
1 711 GLY n 
1 712 ASP n 
1 713 ARG n 
1 714 ALA n 
1 715 ILE n 
1 716 PRO n 
1 717 PHE n 
1 718 ASP n 
1 719 GLU n 
1 720 PHE n 
1 721 ASP n 
1 722 PRO n 
1 723 THR n 
1 724 LYS n 
1 725 HIS n 
1 726 LYS n 
1 727 TYR n 
1 728 ASP n 
1 729 ALA n 
1 730 GLU n 
1 731 TYR n 
1 732 TYR n 
1 733 ILE n 
1 734 GLU n 
1 735 ASN n 
1 736 GLN n 
1 737 VAL n 
1 738 LEU n 
1 739 PRO n 
1 740 ALA n 
1 741 VAL n 
1 742 GLU n 
1 743 ARG n 
1 744 ILE n 
1 745 LEU n 
1 746 ARG n 
1 747 ALA n 
1 748 PHE n 
1 749 GLY n 
1 750 TYR n 
1 751 ARG n 
1 752 LYS n 
1 753 GLU n 
1 754 ASP n 
1 755 LEU n 
1 756 ARG n 
1 757 TYR n 
1 758 GLN n 
1 759 LYS n 
1 760 THR n 
1 761 ARG n 
1 762 GLN n 
1 763 VAL n 
1 764 GLY n 
1 765 LEU n 
1 766 SER n 
1 767 ALA n 
1 768 TRP n 
1 769 LEU n 
1 770 LYS n 
1 771 PRO n 
1 772 LYS n 
1 773 GLY n 
1 774 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermococcus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Thermococcus kodakarensis' 
_entity_src_gen.gene_src_strain                    KOD1 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermococcus kodakarensis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     69014 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-8C 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    1WN7 
_struct_ref.pdbx_db_accession          1WN7 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WN7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 774 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             1WN7 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  774 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       774 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL          'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE         ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                               'C5 H11 N O2 S'  149.211 
NI  non-polymer         . 'NICKEL (II) ION' ?                               'Ni 2'           58.693  
PHE 'L-peptide linking' y PHENYLALANINE     ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1WN7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_percent_sol   51.9 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'PEG 1450, NiCl2, glycerol, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-12-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL38B1' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL38B1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     1WN7 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.75 
_reflns.d_resolution_low             33.26 
_reflns.number_all                   ? 
_reflns.number_obs                   22320 
_reflns.percent_possible_obs         90.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.75 
_reflns_shell.d_res_low              2.92 
_reflns_shell.percent_possible_all   79.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1WN7 
_refine.ls_d_res_high                            2.75 
_refine.ls_d_res_low                             33.26 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     22320 
_refine.ls_number_reflns_obs                     21228 
_refine.ls_number_reflns_R_free                  1092 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.23 
_refine.ls_R_factor_obs                          0.226 
_refine.ls_R_factor_R_work                       0.226 
_refine.ls_R_factor_R_free                       0.306 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1GCX' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            16.68 
_refine.aniso_B[1][2]                            0 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][2]                            -2.99 
_refine.aniso_B[2][3]                            0 
_refine.aniso_B[3][3]                            -13.69 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1WN7 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             0.57 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5873 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             277 
_refine_hist.number_atoms_total               6157 
_refine_hist.d_res_high                       2.75 
_refine_hist.d_res_low                        33.26 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.75 
_refine_ls_shell.d_res_low                        2.92 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.34 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.404 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             144 
_refine_ls_shell.number_reflns_obs                3076 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1WN7 
_struct.title                     'Crystal structure of archaeal family B DNA polymerase mutant' 
_struct.pdbx_descriptor           'Family B DNA Polymerase(E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WN7 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            transferase 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 47  ? LYS A 52  ? ALA A 47  LYS A 52  1 ? 6  
HELX_P HELX_P2  2  ASP A 92  ? GLU A 102 ? ASP A 92  GLU A 102 1 ? 11 
HELX_P HELX_P3  3  PRO A 115 ? LYS A 124 ? PRO A 115 LYS A 124 1 ? 10 
HELX_P HELX_P4  4  THR A 186 ? ASP A 202 ? THR A 186 ASP A 202 1 ? 17 
HELX_P HELX_P5  5  PHE A 214 ? LEU A 226 ? PHE A 214 LEU A 226 1 ? 13 
HELX_P HELX_P6  6  LEU A 260 ? ILE A 268 ? LEU A 260 ILE A 268 1 ? 9  
HELX_P HELX_P7  7  THR A 274 ? GLY A 284 ? THR A 274 GLY A 284 1 ? 11 
HELX_P HELX_P8  8  TYR A 291 ? GLU A 300 ? TYR A 291 GLU A 300 1 ? 10 
HELX_P HELX_P9  9  ASN A 304 ? GLY A 338 ? ASN A 304 GLY A 338 1 ? 35 
HELX_P HELX_P10 10 SER A 340 ? ARG A 346 ? SER A 340 ARG A 346 1 ? 7  
HELX_P HELX_P11 11 SER A 348 ? ARG A 364 ? SER A 348 ARG A 364 1 ? 17 
HELX_P HELX_P12 12 ASP A 373 ? GLN A 382 ? ASP A 373 GLN A 382 1 ? 10 
HELX_P HELX_P13 13 SER A 407 ? HIS A 416 ? SER A 407 HIS A 416 1 ? 10 
HELX_P HELX_P14 14 GLY A 447 ? LYS A 468 ? GLY A 447 LYS A 468 1 ? 22 
HELX_P HELX_P15 15 ASP A 472 ? ASN A 491 ? ASP A 472 ASN A 491 1 ? 20 
HELX_P HELX_P16 16 SER A 492 ? TYR A 499 ? SER A 492 TYR A 499 1 ? 8  
HELX_P HELX_P17 17 CYS A 506 ? GLY A 533 ? CYS A 506 GLY A 533 1 ? 28 
HELX_P HELX_P18 18 ASP A 552 ? LEU A 571 ? ASP A 552 LEU A 571 1 ? 20 
HELX_P HELX_P19 19 ILE A 618 ? LEU A 631 ? ILE A 618 LEU A 631 1 ? 14 
HELX_P HELX_P20 20 ASP A 635 ? GLU A 648 ? ASP A 635 GLU A 648 1 ? 14 
HELX_P HELX_P21 21 PRO A 657 ? VAL A 661 ? PRO A 657 VAL A 661 5 ? 5  
HELX_P HELX_P22 22 VAL A 680 ? ARG A 685 ? VAL A 680 ARG A 685 1 ? 6  
HELX_P HELX_P23 23 GLN A 736 ? GLU A 742 ? GLN A 736 GLU A 742 1 ? 7  
HELX_P HELX_P24 24 GLY A 749 ? GLU A 753 ? GLY A 749 GLU A 753 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 428 SG ? ? ? 1_555 A CYS 442 SG  ? ? A CYS 428  A CYS 442  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2 disulf ? ? A CYS 506 SG ? ? ? 1_555 A CYS 509 SG  ? ? A CYS 506  A CYS 509  1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc1 metalc ? ? B NI  .   NI ? ? ? 1_555 D HOH .   O   ? ? A NI  1001 A HOH 2013 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc2 metalc ? ? B NI  .   NI ? ? ? 1_555 A ASP 141 OD1 ? ? A NI  1001 A ASP 141  1_555 ? ? ? ? ? ? ? 1.954 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 6 ? 
D ? 2 ? 
E ? 6 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 2   ? GLU A 10  ? ILE A 2   GLU A 10  
A 2 LYS A 13  ? LYS A 21  ? LYS A 13  LYS A 21  
A 3 PHE A 26  ? ASP A 31  ? PHE A 26  ASP A 31  
B 1 VAL A 68  ? PHE A 75  ? VAL A 68  PHE A 75  
B 2 ARG A 78  ? TYR A 86  ? ARG A 78  TYR A 86  
B 3 TYR A 37  ? LEU A 42  ? TYR A 37  LEU A 42  
B 4 VAL A 106 ? TYR A 110 ? VAL A 106 TYR A 110 
C 1 VAL A 181 ? ASP A 182 ? VAL A 181 ASP A 182 
C 2 GLY A 167 ? THR A 172 ? GLY A 167 THR A 172 
C 3 ILE A 157 ? ASP A 164 ? ILE A 157 ASP A 164 
C 4 MET A 137 ? THR A 144 ? MET A 137 THR A 144 
C 5 VAL A 205 ? THR A 208 ? VAL A 205 THR A 208 
C 6 ILE A 256 ? ASP A 259 ? ILE A 256 ASP A 259 
D 1 LYS A 240 ? MET A 244 ? LYS A 240 MET A 244 
D 2 ARG A 247 ? GLU A 251 ? ARG A 247 GLU A 251 
E 1 LYS A 535 ? ASP A 540 ? LYS A 535 ASP A 540 
E 2 GLY A 543 ? THR A 547 ? GLY A 543 THR A 547 
E 3 LEU A 396 ? PHE A 405 ? LEU A 396 PHE A 405 
E 4 LEU A 577 ? PHE A 588 ? LEU A 577 PHE A 588 
E 5 TYR A 594 ? ASP A 598 ? TYR A 594 ASP A 598 
E 6 GLY A 601 ? ILE A 603 ? GLY A 601 ILE A 603 
F 1 TYR A 431 ? VAL A 433 ? TYR A 431 VAL A 433 
F 2 ARG A 440 ? CYS A 442 ? ARG A 440 CYS A 442 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 3   ? N LEU A 3   O PHE A 19  ? O PHE A 19  
A 2 3 N ILE A 18  ? N ILE A 18  O GLU A 29  ? O GLU A 29  
B 1 2 N VAL A 71  ? N VAL A 71  O VAL A 82  ? O VAL A 82  
B 2 3 O LEU A 85  ? O LEU A 85  N PHE A 38  ? N PHE A 38  
B 3 4 N LEU A 41  ? N LEU A 41  O ASP A 108 ? O ASP A 108 
C 1 2 O ASP A 182 ? O ASP A 182 N VAL A 170 ? N VAL A 170 
C 2 3 O ARG A 169 ? O ARG A 169 N TYR A 162 ? N TYR A 162 
C 3 4 O ALA A 163 ? O ALA A 163 N ALA A 139 ? N ALA A 139 
C 4 5 N LEU A 138 ? N LEU A 138 O ILE A 207 ? O ILE A 207 
C 5 6 N LEU A 206 ? N LEU A 206 O ILE A 256 ? O ILE A 256 
D 1 2 N LYS A 240 ? N LYS A 240 O GLU A 251 ? O GLU A 251 
E 1 2 N LYS A 535 ? N LYS A 535 O THR A 547 ? O THR A 547 
E 2 3 O ALA A 546 ? O ALA A 546 N VAL A 401 ? N VAL A 401 
E 3 4 N ILE A 400 ? N ILE A 400 O TYR A 583 ? O TYR A 583 
E 4 5 N ARG A 585 ? N ARG A 585 O ILE A 597 ? O ILE A 597 
E 5 6 N ASP A 598 ? N ASP A 598 O LYS A 602 ? O LYS A 602 
F 1 2 N ASP A 432 ? N ASP A 432 O PHE A 441 ? O PHE A 441 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NI A 1001'  
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE GOL A 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 ASP A 141 ? ASP A 141  . ? 1_555 ? 
2 AC1 2 HOH D .   ? HOH A 2013 . ? 1_555 ? 
3 AC2 2 TYR A 409 ? TYR A 409  . ? 1_555 ? 
4 AC2 2 ASN A 491 ? ASN A 491  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1WN7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WN7 
_atom_sites.fract_transf_matrix[1][1]   0.013451 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008998 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008964 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NI 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 40.012 4.185   44.859 1.00 32.47  ? 1    MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 38.947 5.000   45.514 1.00 33.20  ? 1    MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 37.582 4.741   44.876 1.00 33.10  ? 1    MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 37.424 4.848   43.654 1.00 32.88  ? 1    MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 39.289 6.484   45.406 1.00 32.47  ? 1    MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 38.263 7.379   46.043 1.00 32.74  ? 1    MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 38.871 9.044   46.240 1.00 35.91  ? 1    MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 37.733 9.916   45.305 1.00 36.17  ? 1    MET A CE  1 
ATOM   9    N  N   . ILE A 1 2   ? 36.589 4.398   45.688 1.00 30.54  ? 2    ILE A N   1 
ATOM   10   C  CA  . ILE A 1 2   ? 35.270 4.136   45.123 1.00 30.01  ? 2    ILE A CA  1 
ATOM   11   C  C   . ILE A 1 2   ? 34.552 5.436   44.758 1.00 29.92  ? 2    ILE A C   1 
ATOM   12   O  O   . ILE A 1 2   ? 34.402 6.322   45.594 1.00 31.25  ? 2    ILE A O   1 
ATOM   13   C  CB  . ILE A 1 2   ? 34.382 3.304   46.091 1.00 25.74  ? 2    ILE A CB  1 
ATOM   14   C  CG1 . ILE A 1 2   ? 35.009 1.929   46.319 1.00 22.26  ? 2    ILE A CG1 1 
ATOM   15   C  CG2 . ILE A 1 2   ? 32.995 3.134   45.505 1.00 25.57  ? 2    ILE A CG2 1 
ATOM   16   C  CD1 . ILE A 1 2   ? 34.148 0.973   47.109 1.00 18.73  ? 2    ILE A CD1 1 
ATOM   17   N  N   . LEU A 1 3   ? 34.133 5.558   43.503 1.00 29.24  ? 3    LEU A N   1 
ATOM   18   C  CA  . LEU A 1 3   ? 33.424 6.751   43.066 1.00 29.21  ? 3    LEU A CA  1 
ATOM   19   C  C   . LEU A 1 3   ? 31.958 6.541   43.314 1.00 29.71  ? 3    LEU A C   1 
ATOM   20   O  O   . LEU A 1 3   ? 31.307 7.340   43.979 1.00 31.03  ? 3    LEU A O   1 
ATOM   21   C  CB  . LEU A 1 3   ? 33.634 7.020   41.581 1.00 28.88  ? 3    LEU A CB  1 
ATOM   22   C  CG  . LEU A 1 3   ? 35.019 7.524   41.192 1.00 29.82  ? 3    LEU A CG  1 
ATOM   23   C  CD1 . LEU A 1 3   ? 35.044 7.784   39.701 1.00 30.18  ? 3    LEU A CD1 1 
ATOM   24   C  CD2 . LEU A 1 3   ? 35.348 8.796   41.967 1.00 28.91  ? 3    LEU A CD2 1 
ATOM   25   N  N   . ASP A 1 4   ? 31.432 5.455   42.778 1.00 30.20  ? 4    ASP A N   1 
ATOM   26   C  CA  . ASP A 1 4   ? 30.026 5.172   42.966 1.00 30.52  ? 4    ASP A CA  1 
ATOM   27   C  C   . ASP A 1 4   ? 29.766 3.731   42.619 1.00 29.48  ? 4    ASP A C   1 
ATOM   28   O  O   . ASP A 1 4   ? 30.687 2.975   42.300 1.00 26.49  ? 4    ASP A O   1 
ATOM   29   C  CB  . ASP A 1 4   ? 29.165 6.065   42.068 1.00 33.22  ? 4    ASP A CB  1 
ATOM   30   C  CG  . ASP A 1 4   ? 27.820 6.388   42.689 1.00 34.29  ? 4    ASP A CG  1 
ATOM   31   O  OD1 . ASP A 1 4   ? 27.431 5.671   43.634 1.00 35.38  ? 4    ASP A OD1 1 
ATOM   32   O  OD2 . ASP A 1 4   ? 27.156 7.353   42.232 1.00 34.94  ? 4    ASP A OD2 1 
ATOM   33   N  N   . THR A 1 5   ? 28.493 3.365   42.692 1.00 28.45  ? 5    THR A N   1 
ATOM   34   C  CA  . THR A 1 5   ? 28.054 2.018   42.388 1.00 27.24  ? 5    THR A CA  1 
ATOM   35   C  C   . THR A 1 5   ? 26.696 2.106   41.727 1.00 27.97  ? 5    THR A C   1 
ATOM   36   O  O   . THR A 1 5   ? 25.912 3.018   42.015 1.00 29.40  ? 5    THR A O   1 
ATOM   37   C  CB  . THR A 1 5   ? 27.883 1.167   43.657 1.00 25.06  ? 5    THR A CB  1 
ATOM   38   O  OG1 . THR A 1 5   ? 26.722 1.606   44.369 1.00 24.21  ? 5    THR A OG1 1 
ATOM   39   C  CG2 . THR A 1 5   ? 29.092 1.291   44.552 1.00 24.94  ? 5    THR A CG2 1 
ATOM   40   N  N   . ASP A 1 6   ? 26.428 1.166   40.826 1.00 27.79  ? 6    ASP A N   1 
ATOM   41   C  CA  . ASP A 1 6   ? 25.135 1.091   40.156 1.00 28.60  ? 6    ASP A CA  1 
ATOM   42   C  C   . ASP A 1 6   ? 25.002 -0.350  39.710 1.00 28.45  ? 6    ASP A C   1 
ATOM   43   O  O   . ASP A 1 6   ? 25.891 -1.157  39.979 1.00 30.14  ? 6    ASP A O   1 
ATOM   44   C  CB  . ASP A 1 6   ? 25.058 2.079   38.981 1.00 27.46  ? 6    ASP A CB  1 
ATOM   45   C  CG  . ASP A 1 6   ? 25.716 1.568   37.720 1.00 28.02  ? 6    ASP A CG  1 
ATOM   46   O  OD1 . ASP A 1 6   ? 26.718 0.832   37.813 1.00 31.21  ? 6    ASP A OD1 1 
ATOM   47   O  OD2 . ASP A 1 6   ? 25.234 1.929   36.625 1.00 25.53  ? 6    ASP A OD2 1 
ATOM   48   N  N   . TYR A 1 7   ? 23.901 -0.701  39.065 1.00 27.58  ? 7    TYR A N   1 
ATOM   49   C  CA  . TYR A 1 7   ? 23.756 -2.074  38.623 1.00 26.40  ? 7    TYR A CA  1 
ATOM   50   C  C   . TYR A 1 7   ? 23.152 -2.190  37.238 1.00 27.56  ? 7    TYR A C   1 
ATOM   51   O  O   . TYR A 1 7   ? 22.258 -1.432  36.852 1.00 27.31  ? 7    TYR A O   1 
ATOM   52   C  CB  . TYR A 1 7   ? 22.908 -2.861  39.611 1.00 23.69  ? 7    TYR A CB  1 
ATOM   53   C  CG  . TYR A 1 7   ? 21.416 -2.710  39.409 1.00 22.94  ? 7    TYR A CG  1 
ATOM   54   C  CD1 . TYR A 1 7   ? 20.691 -3.690  38.740 1.00 23.54  ? 7    TYR A CD1 1 
ATOM   55   C  CD2 . TYR A 1 7   ? 20.725 -1.616  39.925 1.00 22.02  ? 7    TYR A CD2 1 
ATOM   56   C  CE1 . TYR A 1 7   ? 19.317 -3.598  38.598 1.00 23.24  ? 7    TYR A CE1 1 
ATOM   57   C  CE2 . TYR A 1 7   ? 19.349 -1.511  39.790 1.00 22.48  ? 7    TYR A CE2 1 
ATOM   58   C  CZ  . TYR A 1 7   ? 18.647 -2.512  39.129 1.00 23.73  ? 7    TYR A CZ  1 
ATOM   59   O  OH  . TYR A 1 7   ? 17.271 -2.467  39.043 1.00 22.82  ? 7    TYR A OH  1 
ATOM   60   N  N   . ILE A 1 8   ? 23.658 -3.170  36.504 1.00 29.04  ? 8    ILE A N   1 
ATOM   61   C  CA  . ILE A 1 8   ? 23.205 -3.465  35.158 1.00 28.69  ? 8    ILE A CA  1 
ATOM   62   C  C   . ILE A 1 8   ? 22.462 -4.790  35.224 1.00 27.96  ? 8    ILE A C   1 
ATOM   63   O  O   . ILE A 1 8   ? 22.632 -5.562  36.171 1.00 28.01  ? 8    ILE A O   1 
ATOM   64   C  CB  . ILE A 1 8   ? 24.413 -3.583  34.211 1.00 28.87  ? 8    ILE A CB  1 
ATOM   65   C  CG1 . ILE A 1 8   ? 25.111 -2.228  34.111 1.00 30.41  ? 8    ILE A CG1 1 
ATOM   66   C  CG2 . ILE A 1 8   ? 23.981 -4.047  32.859 1.00 31.64  ? 8    ILE A CG2 1 
ATOM   67   C  CD1 . ILE A 1 8   ? 24.176 -1.067  33.814 1.00 29.06  ? 8    ILE A CD1 1 
ATOM   68   N  N   . THR A 1 9   ? 21.633 -5.060  34.229 1.00 26.78  ? 9    THR A N   1 
ATOM   69   C  CA  . THR A 1 9   ? 20.886 -6.306  34.223 1.00 25.92  ? 9    THR A CA  1 
ATOM   70   C  C   . THR A 1 9   ? 21.347 -7.211  33.103 1.00 26.42  ? 9    THR A C   1 
ATOM   71   O  O   . THR A 1 9   ? 21.377 -6.785  31.960 1.00 28.87  ? 9    THR A O   1 
ATOM   72   C  CB  . THR A 1 9   ? 19.398 -6.041  34.045 1.00 24.67  ? 9    THR A CB  1 
ATOM   73   O  OG1 . THR A 1 9   ? 18.941 -5.172  35.096 1.00 23.37  ? 9    THR A OG1 1 
ATOM   74   C  CG2 . THR A 1 9   ? 18.630 -7.351  34.082 1.00 23.94  ? 9    THR A CG2 1 
ATOM   75   N  N   . GLU A 1 10  ? 21.716 -8.450  33.430 1.00 26.97  ? 10   GLU A N   1 
ATOM   76   C  CA  . GLU A 1 10  ? 22.166 -9.428  32.433 1.00 25.81  ? 10   GLU A CA  1 
ATOM   77   C  C   . GLU A 1 10  ? 21.461 -10.764 32.642 1.00 26.47  ? 10   GLU A C   1 
ATOM   78   O  O   . GLU A 1 10  ? 21.555 -11.371 33.710 1.00 26.84  ? 10   GLU A O   1 
ATOM   79   C  CB  . GLU A 1 10  ? 23.680 -9.653  32.506 1.00 24.59  ? 10   GLU A CB  1 
ATOM   80   C  CG  . GLU A 1 10  ? 24.512 -8.379  32.416 1.00 31.35  ? 10   GLU A CG  1 
ATOM   81   C  CD  . GLU A 1 10  ? 25.915 -8.604  31.833 1.00 35.53  ? 10   GLU A CD  1 
ATOM   82   O  OE1 . GLU A 1 10  ? 26.629 -9.544  32.267 1.00 35.97  ? 10   GLU A OE1 1 
ATOM   83   O  OE2 . GLU A 1 10  ? 26.306 -7.821  30.935 1.00 38.21  ? 10   GLU A OE2 1 
ATOM   84   N  N   . ASP A 1 11  ? 20.754 -11.222 31.615 1.00 26.26  ? 11   ASP A N   1 
ATOM   85   C  CA  . ASP A 1 11  ? 20.033 -12.487 31.687 1.00 25.19  ? 11   ASP A CA  1 
ATOM   86   C  C   . ASP A 1 11  ? 19.007 -12.475 32.807 1.00 23.63  ? 11   ASP A C   1 
ATOM   87   O  O   . ASP A 1 11  ? 18.700 -13.500 33.395 1.00 21.75  ? 11   ASP A O   1 
ATOM   88   C  CB  . ASP A 1 11  ? 21.009 -13.654 31.863 1.00 27.24  ? 11   ASP A CB  1 
ATOM   89   C  CG  . ASP A 1 11  ? 22.005 -13.761 30.707 1.00 31.36  ? 11   ASP A CG  1 
ATOM   90   O  OD1 . ASP A 1 11  ? 21.558 -13.712 29.537 1.00 32.35  ? 11   ASP A OD1 1 
ATOM   91   O  OD2 . ASP A 1 11  ? 23.229 -13.898 30.965 1.00 30.78  ? 11   ASP A OD2 1 
ATOM   92   N  N   . GLY A 1 12  ? 18.485 -11.289 33.095 1.00 25.20  ? 12   GLY A N   1 
ATOM   93   C  CA  . GLY A 1 12  ? 17.457 -11.147 34.107 1.00 26.60  ? 12   GLY A CA  1 
ATOM   94   C  C   . GLY A 1 12  ? 17.926 -10.967 35.528 1.00 26.82  ? 12   GLY A C   1 
ATOM   95   O  O   . GLY A 1 12  ? 17.146 -10.561 36.387 1.00 25.42  ? 12   GLY A O   1 
ATOM   96   N  N   . LYS A 1 13  ? 19.192 -11.287 35.772 1.00 27.12  ? 13   LYS A N   1 
ATOM   97   C  CA  . LYS A 1 13  ? 19.780 -11.146 37.092 1.00 27.51  ? 13   LYS A CA  1 
ATOM   98   C  C   . LYS A 1 13  ? 20.586 -9.836  37.170 1.00 28.50  ? 13   LYS A C   1 
ATOM   99   O  O   . LYS A 1 13  ? 21.194 -9.409  36.190 1.00 29.66  ? 13   LYS A O   1 
ATOM   100  C  CB  . LYS A 1 13  ? 20.691 -12.342 37.387 1.00 26.74  ? 13   LYS A CB  1 
ATOM   101  C  CG  . LYS A 1 13  ? 20.001 -13.676 37.357 1.00 28.65  ? 13   LYS A CG  1 
ATOM   102  C  CD  . LYS A 1 13  ? 20.954 -14.774 37.797 1.00 36.17  ? 13   LYS A CD  1 
ATOM   103  C  CE  . LYS A 1 13  ? 20.399 -16.176 37.488 1.00 41.06  ? 13   LYS A CE  1 
ATOM   104  N  NZ  . LYS A 1 13  ? 21.381 -17.278 37.775 1.00 41.66  ? 13   LYS A NZ  1 
ATOM   105  N  N   . PRO A 1 14  ? 20.592 -9.178  38.339 1.00 28.29  ? 14   PRO A N   1 
ATOM   106  C  CA  . PRO A 1 14  ? 21.336 -7.927  38.500 1.00 27.82  ? 14   PRO A CA  1 
ATOM   107  C  C   . PRO A 1 14  ? 22.834 -8.126  38.727 1.00 27.50  ? 14   PRO A C   1 
ATOM   108  O  O   . PRO A 1 14  ? 23.247 -9.056  39.420 1.00 27.28  ? 14   PRO A O   1 
ATOM   109  C  CB  . PRO A 1 14  ? 20.658 -7.288  39.706 1.00 28.40  ? 14   PRO A CB  1 
ATOM   110  C  CG  . PRO A 1 14  ? 20.302 -8.473  40.536 1.00 27.57  ? 14   PRO A CG  1 
ATOM   111  C  CD  . PRO A 1 14  ? 19.748 -9.439  39.519 1.00 27.50  ? 14   PRO A CD  1 
ATOM   112  N  N   . VAL A 1 15  ? 23.634 -7.249  38.123 1.00 27.05  ? 15   VAL A N   1 
ATOM   113  C  CA  . VAL A 1 15  ? 25.094 -7.267  38.254 1.00 25.36  ? 15   VAL A CA  1 
ATOM   114  C  C   . VAL A 1 15  ? 25.487 -5.882  38.740 1.00 25.11  ? 15   VAL A C   1 
ATOM   115  O  O   . VAL A 1 15  ? 25.209 -4.873  38.094 1.00 24.38  ? 15   VAL A O   1 
ATOM   116  C  CB  . VAL A 1 15  ? 25.814 -7.536  36.905 1.00 27.34  ? 15   VAL A CB  1 
ATOM   117  C  CG1 . VAL A 1 15  ? 27.236 -6.979  36.949 1.00 26.81  ? 15   VAL A CG1 1 
ATOM   118  C  CG2 . VAL A 1 15  ? 25.865 -9.028  36.627 1.00 25.88  ? 15   VAL A CG2 1 
ATOM   119  N  N   . ILE A 1 16  ? 26.143 -5.856  39.888 1.00 24.49  ? 16   ILE A N   1 
ATOM   120  C  CA  . ILE A 1 16  ? 26.569 -4.632  40.524 1.00 22.84  ? 16   ILE A CA  1 
ATOM   121  C  C   . ILE A 1 16  ? 27.861 -4.110  39.880 1.00 23.35  ? 16   ILE A C   1 
ATOM   122  O  O   . ILE A 1 16  ? 28.701 -4.884  39.419 1.00 24.87  ? 16   ILE A O   1 
ATOM   123  C  CB  . ILE A 1 16  ? 26.754 -4.912  42.040 1.00 22.40  ? 16   ILE A CB  1 
ATOM   124  C  CG1 . ILE A 1 16  ? 26.287 -3.728  42.870 1.00 22.03  ? 16   ILE A CG1 1 
ATOM   125  C  CG2 . ILE A 1 16  ? 28.186 -5.225  42.349 1.00 28.42  ? 16   ILE A CG2 1 
ATOM   126  C  CD1 . ILE A 1 16  ? 24.798 -3.685  43.045 1.00 21.26  ? 16   ILE A CD1 1 
ATOM   127  N  N   . ARG A 1 17  ? 28.013 -2.795  39.829 1.00 24.01  ? 17   ARG A N   1 
ATOM   128  C  CA  . ARG A 1 17  ? 29.211 -2.202  39.245 1.00 24.50  ? 17   ARG A CA  1 
ATOM   129  C  C   . ARG A 1 17  ? 29.855 -1.210  40.196 1.00 25.14  ? 17   ARG A C   1 
ATOM   130  O  O   . ARG A 1 17  ? 29.193 -0.302  40.680 1.00 24.39  ? 17   ARG A O   1 
ATOM   131  C  CB  . ARG A 1 17  ? 28.880 -1.485  37.942 1.00 23.11  ? 17   ARG A CB  1 
ATOM   132  C  CG  . ARG A 1 17  ? 28.351 -2.390  36.865 1.00 22.48  ? 17   ARG A CG  1 
ATOM   133  C  CD  . ARG A 1 17  ? 28.418 -1.717  35.501 1.00 22.74  ? 17   ARG A CD  1 
ATOM   134  N  NE  . ARG A 1 17  ? 27.498 -0.594  35.352 1.00 19.49  ? 17   ARG A NE  1 
ATOM   135  C  CZ  . ARG A 1 17  ? 27.426 0.145   34.253 1.00 18.63  ? 17   ARG A CZ  1 
ATOM   136  N  NH1 . ARG A 1 17  ? 28.218 -0.126  33.232 1.00 17.95  ? 17   ARG A NH1 1 
ATOM   137  N  NH2 . ARG A 1 17  ? 26.562 1.144   34.165 1.00 19.96  ? 17   ARG A NH2 1 
ATOM   138  N  N   . ILE A 1 18  ? 31.148 -1.387  40.454 1.00 26.43  ? 18   ILE A N   1 
ATOM   139  C  CA  . ILE A 1 18  ? 31.883 -0.501  41.348 1.00 27.08  ? 18   ILE A CA  1 
ATOM   140  C  C   . ILE A 1 18  ? 32.825 0.379   40.530 1.00 29.04  ? 18   ILE A C   1 
ATOM   141  O  O   . ILE A 1 18  ? 33.850 -0.088  40.038 1.00 29.51  ? 18   ILE A O   1 
ATOM   142  C  CB  . ILE A 1 18  ? 32.757 -1.286  42.339 1.00 27.79  ? 18   ILE A CB  1 
ATOM   143  C  CG1 . ILE A 1 18  ? 32.182 -2.692  42.587 1.00 29.53  ? 18   ILE A CG1 1 
ATOM   144  C  CG2 . ILE A 1 18  ? 32.905 -0.497  43.614 1.00 26.62  ? 18   ILE A CG2 1 
ATOM   145  C  CD1 . ILE A 1 18  ? 30.825 -2.740  43.227 1.00 31.64  ? 18   ILE A CD1 1 
ATOM   146  N  N   . PHE A 1 19  ? 32.473 1.648   40.376 1.00 29.83  ? 19   PHE A N   1 
ATOM   147  C  CA  . PHE A 1 19  ? 33.306 2.578   39.632 1.00 29.93  ? 19   PHE A CA  1 
ATOM   148  C  C   . PHE A 1 19  ? 34.361 3.099   40.597 1.00 31.99  ? 19   PHE A C   1 
ATOM   149  O  O   . PHE A 1 19  ? 34.036 3.604   41.671 1.00 33.69  ? 19   PHE A O   1 
ATOM   150  C  CB  . PHE A 1 19  ? 32.466 3.748   39.108 1.00 27.47  ? 19   PHE A CB  1 
ATOM   151  C  CG  . PHE A 1 19  ? 31.279 3.330   38.285 1.00 26.21  ? 19   PHE A CG  1 
ATOM   152  C  CD1 . PHE A 1 19  ? 31.447 2.570   37.131 1.00 26.93  ? 19   PHE A CD1 1 
ATOM   153  C  CD2 . PHE A 1 19  ? 29.990 3.698   38.662 1.00 25.94  ? 19   PHE A CD2 1 
ATOM   154  C  CE1 . PHE A 1 19  ? 30.352 2.178   36.360 1.00 25.59  ? 19   PHE A CE1 1 
ATOM   155  C  CE2 . PHE A 1 19  ? 28.895 3.312   37.903 1.00 25.39  ? 19   PHE A CE2 1 
ATOM   156  C  CZ  . PHE A 1 19  ? 29.076 2.549   36.747 1.00 25.59  ? 19   PHE A CZ  1 
ATOM   157  N  N   . LYS A 1 20  ? 35.625 2.972   40.233 1.00 33.00  ? 20   LYS A N   1 
ATOM   158  C  CA  . LYS A 1 20  ? 36.656 3.463   41.118 1.00 35.35  ? 20   LYS A CA  1 
ATOM   159  C  C   . LYS A 1 20  ? 37.858 3.993   40.367 1.00 36.76  ? 20   LYS A C   1 
ATOM   160  O  O   . LYS A 1 20  ? 37.872 4.049   39.148 1.00 37.29  ? 20   LYS A O   1 
ATOM   161  C  CB  . LYS A 1 20  ? 37.052 2.366   42.111 1.00 34.64  ? 20   LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 20  ? 37.246 1.013   41.463 1.00 34.28  ? 20   LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 20  ? 36.712 -0.133  42.322 1.00 31.93  ? 20   LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 20  ? 37.607 -0.423  43.503 1.00 31.82  ? 20   LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 20  ? 37.244 -1.716  44.148 1.00 30.28  ? 20   LYS A NZ  1 
ATOM   166  N  N   . LYS A 1 21  ? 38.856 4.429   41.112 1.00 39.40  ? 21   LYS A N   1 
ATOM   167  C  CA  . LYS A 1 21  ? 40.067 4.953   40.521 1.00 41.81  ? 21   LYS A CA  1 
ATOM   168  C  C   . LYS A 1 21  ? 41.077 4.593   41.569 1.00 44.38  ? 21   LYS A C   1 
ATOM   169  O  O   . LYS A 1 21  ? 41.101 5.197   42.639 1.00 45.53  ? 21   LYS A O   1 
ATOM   170  C  CB  . LYS A 1 21  ? 39.982 6.461   40.348 1.00 39.99  ? 21   LYS A CB  1 
ATOM   171  C  CG  . LYS A 1 21  ? 41.163 7.040   39.595 1.00 41.34  ? 21   LYS A CG  1 
ATOM   172  C  CD  . LYS A 1 21  ? 40.983 8.530   39.388 1.00 40.88  ? 21   LYS A CD  1 
ATOM   173  C  CE  . LYS A 1 21  ? 41.456 8.996   38.020 1.00 40.90  ? 21   LYS A CE  1 
ATOM   174  N  NZ  . LYS A 1 21  ? 40.756 8.270   36.900 1.00 40.07  ? 21   LYS A NZ  1 
ATOM   175  N  N   . GLU A 1 22  ? 41.900 3.599   41.261 1.00 46.40  ? 22   GLU A N   1 
ATOM   176  C  CA  . GLU A 1 22  ? 42.865 3.130   42.221 1.00 49.98  ? 22   GLU A CA  1 
ATOM   177  C  C   . GLU A 1 22  ? 44.164 3.885   42.164 1.00 52.07  ? 22   GLU A C   1 
ATOM   178  O  O   . GLU A 1 22  ? 44.188 5.061   42.476 1.00 52.79  ? 22   GLU A O   1 
ATOM   179  C  CB  . GLU A 1 22  ? 43.076 1.621   42.079 1.00 52.05  ? 22   GLU A CB  1 
ATOM   180  C  CG  . GLU A 1 22  ? 42.640 0.876   43.370 1.00 53.93  ? 22   GLU A CG  1 
ATOM   181  C  CD  . GLU A 1 22  ? 41.647 -0.253  43.149 1.00 55.04  ? 22   GLU A CD  1 
ATOM   182  O  OE1 . GLU A 1 22  ? 41.047 -0.321  42.073 1.00 55.89  ? 22   GLU A OE1 1 
ATOM   183  O  OE2 . GLU A 1 22  ? 41.443 -1.075  44.067 1.00 54.27  ? 22   GLU A OE2 1 
ATOM   184  N  N   . ASN A 1 23  ? 45.251 3.260   41.754 1.00 53.15  ? 23   ASN A N   1 
ATOM   185  C  CA  . ASN A 1 23  ? 46.476 4.032   41.746 1.00 55.06  ? 23   ASN A CA  1 
ATOM   186  C  C   . ASN A 1 23  ? 46.740 4.761   40.457 1.00 55.03  ? 23   ASN A C   1 
ATOM   187  O  O   . ASN A 1 23  ? 47.821 4.643   39.871 1.00 56.73  ? 23   ASN A O   1 
ATOM   188  C  CB  . ASN A 1 23  ? 47.681 3.168   42.121 1.00 57.02  ? 23   ASN A CB  1 
ATOM   189  C  CG  . ASN A 1 23  ? 48.018 3.277   43.603 1.00 58.83  ? 23   ASN A CG  1 
ATOM   190  O  OD1 . ASN A 1 23  ? 48.226 4.378   44.115 1.00 59.03  ? 23   ASN A OD1 1 
ATOM   191  N  ND2 . ASN A 1 23  ? 48.067 2.145   44.297 1.00 59.94  ? 23   ASN A ND2 1 
ATOM   192  N  N   . GLY A 1 24  ? 45.768 5.542   40.009 1.00 54.12  ? 24   GLY A N   1 
ATOM   193  C  CA  . GLY A 1 24  ? 45.986 6.271   38.778 1.00 53.81  ? 24   GLY A CA  1 
ATOM   194  C  C   . GLY A 1 24  ? 44.842 6.315   37.791 1.00 54.41  ? 24   GLY A C   1 
ATOM   195  O  O   . GLY A 1 24  ? 44.435 7.406   37.415 1.00 54.43  ? 24   GLY A O   1 
ATOM   196  N  N   . GLU A 1 25  ? 44.324 5.170   37.346 1.00 54.96  ? 25   GLU A N   1 
ATOM   197  C  CA  . GLU A 1 25  ? 43.237 5.225   36.373 1.00 55.93  ? 25   GLU A CA  1 
ATOM   198  C  C   . GLU A 1 25  ? 41.943 4.465   36.643 1.00 54.22  ? 25   GLU A C   1 
ATOM   199  O  O   . GLU A 1 25  ? 41.903 3.509   37.420 1.00 53.27  ? 25   GLU A O   1 
ATOM   200  C  CB  . GLU A 1 25  ? 43.741 4.836   34.985 1.00 58.97  ? 25   GLU A CB  1 
ATOM   201  C  CG  . GLU A 1 25  ? 42.803 5.300   33.866 1.00 63.41  ? 25   GLU A CG  1 
ATOM   202  C  CD  . GLU A 1 25  ? 43.491 5.372   32.519 1.00 67.06  ? 25   GLU A CD  1 
ATOM   203  O  OE1 . GLU A 1 25  ? 42.864 5.874   31.554 1.00 69.33  ? 25   GLU A OE1 1 
ATOM   204  O  OE2 . GLU A 1 25  ? 44.660 4.926   32.429 1.00 68.72  ? 25   GLU A OE2 1 
ATOM   205  N  N   . PHE A 1 26  ? 40.894 4.916   35.952 1.00 51.59  ? 26   PHE A N   1 
ATOM   206  C  CA  . PHE A 1 26  ? 39.544 4.378   36.041 1.00 49.38  ? 26   PHE A CA  1 
ATOM   207  C  C   . PHE A 1 26  ? 39.504 2.864   36.041 1.00 48.07  ? 26   PHE A C   1 
ATOM   208  O  O   . PHE A 1 26  ? 40.442 2.221   35.580 1.00 48.54  ? 26   PHE A O   1 
ATOM   209  C  CB  . PHE A 1 26  ? 38.708 4.925   34.889 1.00 50.46  ? 26   PHE A CB  1 
ATOM   210  C  CG  . PHE A 1 26  ? 37.259 4.587   34.991 1.00 50.78  ? 26   PHE A CG  1 
ATOM   211  C  CD1 . PHE A 1 26  ? 36.717 3.564   34.236 1.00 50.45  ? 26   PHE A CD1 1 
ATOM   212  C  CD2 . PHE A 1 26  ? 36.439 5.278   35.870 1.00 51.00  ? 26   PHE A CD2 1 
ATOM   213  C  CE1 . PHE A 1 26  ? 35.379 3.229   34.360 1.00 50.23  ? 26   PHE A CE1 1 
ATOM   214  C  CE2 . PHE A 1 26  ? 35.101 4.947   35.999 1.00 50.89  ? 26   PHE A CE2 1 
ATOM   215  C  CZ  . PHE A 1 26  ? 34.569 3.921   35.241 1.00 49.34  ? 26   PHE A CZ  1 
ATOM   216  N  N   . LYS A 1 27  ? 38.409 2.290   36.533 1.00 46.39  ? 27   LYS A N   1 
ATOM   217  C  CA  . LYS A 1 27  ? 38.317 0.835   36.614 1.00 45.76  ? 27   LYS A CA  1 
ATOM   218  C  C   . LYS A 1 27  ? 37.006 0.377   37.243 1.00 43.66  ? 27   LYS A C   1 
ATOM   219  O  O   . LYS A 1 27  ? 36.693 0.756   38.370 1.00 44.62  ? 27   LYS A O   1 
ATOM   220  C  CB  . LYS A 1 27  ? 39.482 0.328   37.460 1.00 46.97  ? 27   LYS A CB  1 
ATOM   221  C  CG  . LYS A 1 27  ? 39.702 -1.160  37.469 1.00 49.12  ? 27   LYS A CG  1 
ATOM   222  C  CD  . LYS A 1 27  ? 40.793 -1.481  38.480 1.00 52.80  ? 27   LYS A CD  1 
ATOM   223  C  CE  . LYS A 1 27  ? 42.031 -0.604  38.256 1.00 54.42  ? 27   LYS A CE  1 
ATOM   224  N  NZ  . LYS A 1 27  ? 43.084 -0.772  39.303 1.00 56.79  ? 27   LYS A NZ  1 
ATOM   225  N  N   . ILE A 1 28  ? 36.247 -0.450  36.534 1.00 40.66  ? 28   ILE A N   1 
ATOM   226  C  CA  . ILE A 1 28  ? 34.979 -0.929  37.076 1.00 38.12  ? 28   ILE A CA  1 
ATOM   227  C  C   . ILE A 1 28  ? 35.094 -2.348  37.580 1.00 38.03  ? 28   ILE A C   1 
ATOM   228  O  O   . ILE A 1 28  ? 35.613 -3.215  36.888 1.00 37.63  ? 28   ILE A O   1 
ATOM   229  C  CB  . ILE A 1 28  ? 33.851 -0.959  36.040 1.00 35.31  ? 28   ILE A CB  1 
ATOM   230  C  CG1 . ILE A 1 28  ? 33.764 0.361   35.293 1.00 32.43  ? 28   ILE A CG1 1 
ATOM   231  C  CG2 . ILE A 1 28  ? 32.532 -1.243  36.741 1.00 33.84  ? 28   ILE A CG2 1 
ATOM   232  C  CD1 . ILE A 1 28  ? 32.954 0.246   34.028 1.00 29.06  ? 28   ILE A CD1 1 
ATOM   233  N  N   . GLU A 1 29  ? 34.598 -2.584  38.787 1.00 38.01  ? 29   GLU A N   1 
ATOM   234  C  CA  . GLU A 1 29  ? 34.621 -3.916  39.350 1.00 36.96  ? 29   GLU A CA  1 
ATOM   235  C  C   . GLU A 1 29  ? 33.196 -4.431  39.267 1.00 34.38  ? 29   GLU A C   1 
ATOM   236  O  O   . GLU A 1 29  ? 32.252 -3.711  39.597 1.00 33.03  ? 29   GLU A O   1 
ATOM   237  C  CB  . GLU A 1 29  ? 35.115 -3.869  40.791 1.00 39.52  ? 29   GLU A CB  1 
ATOM   238  C  CG  . GLU A 1 29  ? 36.478 -4.505  40.956 1.00 46.78  ? 29   GLU A CG  1 
ATOM   239  C  CD  . GLU A 1 29  ? 37.145 -4.149  42.273 1.00 51.78  ? 29   GLU A CD  1 
ATOM   240  O  OE1 . GLU A 1 29  ? 36.509 -4.327  43.338 1.00 53.18  ? 29   GLU A OE1 1 
ATOM   241  O  OE2 . GLU A 1 29  ? 38.314 -3.695  42.238 1.00 54.96  ? 29   GLU A OE2 1 
ATOM   242  N  N   . TYR A 1 30  ? 33.036 -5.661  38.789 1.00 31.54  ? 30   TYR A N   1 
ATOM   243  C  CA  . TYR A 1 30  ? 31.708 -6.236  38.659 1.00 28.98  ? 30   TYR A CA  1 
ATOM   244  C  C   . TYR A 1 30  ? 31.533 -7.298  39.702 1.00 27.10  ? 30   TYR A C   1 
ATOM   245  O  O   . TYR A 1 30  ? 32.486 -7.965  40.073 1.00 26.79  ? 30   TYR A O   1 
ATOM   246  C  CB  . TYR A 1 30  ? 31.503 -6.843  37.269 1.00 27.52  ? 30   TYR A CB  1 
ATOM   247  C  CG  . TYR A 1 30  ? 31.780 -5.875  36.150 1.00 28.55  ? 30   TYR A CG  1 
ATOM   248  C  CD1 . TYR A 1 30  ? 33.082 -5.560  35.790 1.00 31.30  ? 30   TYR A CD1 1 
ATOM   249  C  CD2 . TYR A 1 30  ? 30.744 -5.241  35.472 1.00 31.19  ? 30   TYR A CD2 1 
ATOM   250  C  CE1 . TYR A 1 30  ? 33.353 -4.631  34.780 1.00 32.54  ? 30   TYR A CE1 1 
ATOM   251  C  CE2 . TYR A 1 30  ? 31.000 -4.305  34.455 1.00 31.42  ? 30   TYR A CE2 1 
ATOM   252  C  CZ  . TYR A 1 30  ? 32.311 -4.008  34.118 1.00 32.33  ? 30   TYR A CZ  1 
ATOM   253  O  OH  . TYR A 1 30  ? 32.593 -3.094  33.126 1.00 31.70  ? 30   TYR A OH  1 
ATOM   254  N  N   . ASP A 1 31  ? 30.313 -7.437  40.193 1.00 27.33  ? 31   ASP A N   1 
ATOM   255  C  CA  . ASP A 1 31  ? 30.018 -8.450  41.192 1.00 29.86  ? 31   ASP A CA  1 
ATOM   256  C  C   . ASP A 1 31  ? 28.589 -8.910  40.980 1.00 29.06  ? 31   ASP A C   1 
ATOM   257  O  O   . ASP A 1 31  ? 27.664 -8.111  41.111 1.00 28.16  ? 31   ASP A O   1 
ATOM   258  C  CB  . ASP A 1 31  ? 30.207 -7.881  42.611 1.00 31.16  ? 31   ASP A CB  1 
ATOM   259  C  CG  . ASP A 1 31  ? 29.600 -8.773  43.703 1.00 34.06  ? 31   ASP A CG  1 
ATOM   260  O  OD1 . ASP A 1 31  ? 29.361 -9.970  43.449 1.00 36.20  ? 31   ASP A OD1 1 
ATOM   261  O  OD2 . ASP A 1 31  ? 29.374 -8.280  44.829 1.00 33.39  ? 31   ASP A OD2 1 
ATOM   262  N  N   . ARG A 1 32  ? 28.406 -10.181 40.621 1.00 28.19  ? 32   ARG A N   1 
ATOM   263  C  CA  . ARG A 1 32  ? 27.053 -10.674 40.415 1.00 30.66  ? 32   ARG A CA  1 
ATOM   264  C  C   . ARG A 1 32  ? 26.601 -11.624 41.506 1.00 30.38  ? 32   ARG A C   1 
ATOM   265  O  O   . ARG A 1 32  ? 25.709 -12.445 41.322 1.00 30.43  ? 32   ARG A O   1 
ATOM   266  C  CB  . ARG A 1 32  ? 26.894 -11.296 39.017 1.00 33.78  ? 32   ARG A CB  1 
ATOM   267  C  CG  . ARG A 1 32  ? 27.940 -12.292 38.548 1.00 37.63  ? 32   ARG A CG  1 
ATOM   268  C  CD  . ARG A 1 32  ? 27.956 -12.338 36.999 1.00 40.20  ? 32   ARG A CD  1 
ATOM   269  N  NE  . ARG A 1 32  ? 28.913 -11.370 36.447 1.00 43.51  ? 32   ARG A NE  1 
ATOM   270  C  CZ  . ARG A 1 32  ? 28.876 -10.854 35.218 1.00 41.88  ? 32   ARG A CZ  1 
ATOM   271  N  NH1 . ARG A 1 32  ? 29.812 -9.990  34.840 1.00 40.28  ? 32   ARG A NH1 1 
ATOM   272  N  NH2 . ARG A 1 32  ? 27.904 -11.178 34.374 1.00 40.92  ? 32   ARG A NH2 1 
ATOM   273  N  N   . THR A 1 33  ? 27.211 -11.446 42.669 1.00 31.01  ? 33   THR A N   1 
ATOM   274  C  CA  . THR A 1 33  ? 26.945 -12.233 43.858 1.00 30.82  ? 33   THR A CA  1 
ATOM   275  C  C   . THR A 1 33  ? 25.794 -11.687 44.709 1.00 31.49  ? 33   THR A C   1 
ATOM   276  O  O   . THR A 1 33  ? 24.993 -12.457 45.239 1.00 30.39  ? 33   THR A O   1 
ATOM   277  C  CB  . THR A 1 33  ? 28.214 -12.285 44.736 1.00 30.59  ? 33   THR A CB  1 
ATOM   278  O  OG1 . THR A 1 33  ? 29.101 -13.285 44.229 1.00 29.96  ? 33   THR A OG1 1 
ATOM   279  C  CG2 . THR A 1 33  ? 27.871 -12.587 46.183 1.00 32.39  ? 33   THR A CG2 1 
ATOM   280  N  N   . PHE A 1 34  ? 25.718 -10.365 44.838 1.00 31.91  ? 34   PHE A N   1 
ATOM   281  C  CA  . PHE A 1 34  ? 24.697 -9.727  45.668 1.00 33.72  ? 34   PHE A CA  1 
ATOM   282  C  C   . PHE A 1 34  ? 23.229 -10.013 45.340 1.00 33.18  ? 34   PHE A C   1 
ATOM   283  O  O   . PHE A 1 34  ? 22.819 -9.933  44.192 1.00 33.95  ? 34   PHE A O   1 
ATOM   284  C  CB  . PHE A 1 34  ? 24.913 -8.215  45.693 1.00 36.03  ? 34   PHE A CB  1 
ATOM   285  C  CG  . PHE A 1 34  ? 24.405 -7.568  46.945 1.00 39.41  ? 34   PHE A CG  1 
ATOM   286  C  CD1 . PHE A 1 34  ? 25.015 -7.833  48.170 1.00 40.62  ? 34   PHE A CD1 1 
ATOM   287  C  CD2 . PHE A 1 34  ? 23.285 -6.748  46.916 1.00 40.63  ? 34   PHE A CD2 1 
ATOM   288  C  CE1 . PHE A 1 34  ? 24.513 -7.296  49.347 1.00 41.34  ? 34   PHE A CE1 1 
ATOM   289  C  CE2 . PHE A 1 34  ? 22.772 -6.204  48.089 1.00 41.55  ? 34   PHE A CE2 1 
ATOM   290  C  CZ  . PHE A 1 34  ? 23.387 -6.480  49.308 1.00 41.86  ? 34   PHE A CZ  1 
ATOM   291  N  N   . GLU A 1 35  ? 22.441 -10.318 46.371 1.00 32.91  ? 35   GLU A N   1 
ATOM   292  C  CA  . GLU A 1 35  ? 21.018 -10.634 46.212 1.00 32.44  ? 35   GLU A CA  1 
ATOM   293  C  C   . GLU A 1 35  ? 20.069 -9.613  46.854 1.00 31.66  ? 35   GLU A C   1 
ATOM   294  O  O   . GLU A 1 35  ? 20.287 -9.166  47.983 1.00 30.71  ? 35   GLU A O   1 
ATOM   295  C  CB  . GLU A 1 35  ? 20.731 -12.018 46.799 1.00 33.39  ? 35   GLU A CB  1 
ATOM   296  C  CG  . GLU A 1 35  ? 21.495 -13.138 46.129 1.00 35.72  ? 35   GLU A CG  1 
ATOM   297  C  CD  . GLU A 1 35  ? 21.199 -14.493 46.731 1.00 38.55  ? 35   GLU A CD  1 
ATOM   298  O  OE1 . GLU A 1 35  ? 20.017 -14.906 46.728 1.00 38.14  ? 35   GLU A OE1 1 
ATOM   299  O  OE2 . GLU A 1 35  ? 22.154 -15.149 47.203 1.00 40.76  ? 35   GLU A OE2 1 
ATOM   300  N  N   . PRO A 1 36  ? 18.993 -9.241  46.134 1.00 29.82  ? 36   PRO A N   1 
ATOM   301  C  CA  . PRO A 1 36  ? 17.991 -8.278  46.601 1.00 28.34  ? 36   PRO A CA  1 
ATOM   302  C  C   . PRO A 1 36  ? 17.183 -8.917  47.710 1.00 27.45  ? 36   PRO A C   1 
ATOM   303  O  O   . PRO A 1 36  ? 17.123 -10.140 47.802 1.00 28.00  ? 36   PRO A O   1 
ATOM   304  C  CB  . PRO A 1 36  ? 17.123 -8.043  45.366 1.00 28.11  ? 36   PRO A CB  1 
ATOM   305  C  CG  . PRO A 1 36  ? 17.982 -8.477  44.220 1.00 28.46  ? 36   PRO A CG  1 
ATOM   306  C  CD  . PRO A 1 36  ? 18.671 -9.685  44.771 1.00 29.03  ? 36   PRO A CD  1 
ATOM   307  N  N   . TYR A 1 37  ? 16.551 -8.102  48.541 1.00 25.39  ? 37   TYR A N   1 
ATOM   308  C  CA  . TYR A 1 37  ? 15.751 -8.650  49.614 1.00 25.38  ? 37   TYR A CA  1 
ATOM   309  C  C   . TYR A 1 37  ? 15.147 -7.547  50.446 1.00 26.42  ? 37   TYR A C   1 
ATOM   310  O  O   . TYR A 1 37  ? 15.463 -6.369  50.278 1.00 27.73  ? 37   TYR A O   1 
ATOM   311  C  CB  . TYR A 1 37  ? 16.618 -9.506  50.525 1.00 27.05  ? 37   TYR A CB  1 
ATOM   312  C  CG  . TYR A 1 37  ? 17.473 -8.674  51.447 1.00 29.11  ? 37   TYR A CG  1 
ATOM   313  C  CD1 . TYR A 1 37  ? 16.925 -8.082  52.592 1.00 30.95  ? 37   TYR A CD1 1 
ATOM   314  C  CD2 . TYR A 1 37  ? 18.804 -8.401  51.140 1.00 27.91  ? 37   TYR A CD2 1 
ATOM   315  C  CE1 . TYR A 1 37  ? 17.680 -7.240  53.394 1.00 29.47  ? 37   TYR A CE1 1 
ATOM   316  C  CE2 . TYR A 1 37  ? 19.565 -7.557  51.940 1.00 25.74  ? 37   TYR A CE2 1 
ATOM   317  C  CZ  . TYR A 1 37  ? 18.996 -6.986  53.060 1.00 26.91  ? 37   TYR A CZ  1 
ATOM   318  O  OH  . TYR A 1 37  ? 19.741 -6.175  53.868 1.00 26.32  ? 37   TYR A OH  1 
ATOM   319  N  N   . PHE A 1 38  ? 14.291 -7.953  51.372 1.00 26.51  ? 38   PHE A N   1 
ATOM   320  C  CA  . PHE A 1 38  ? 13.661 -7.029  52.287 1.00 26.18  ? 38   PHE A CA  1 
ATOM   321  C  C   . PHE A 1 38  ? 13.080 -7.874  53.419 1.00 26.27  ? 38   PHE A C   1 
ATOM   322  O  O   . PHE A 1 38  ? 13.111 -9.097  53.336 1.00 27.16  ? 38   PHE A O   1 
ATOM   323  C  CB  . PHE A 1 38  ? 12.630 -6.177  51.538 1.00 24.68  ? 38   PHE A CB  1 
ATOM   324  C  CG  . PHE A 1 38  ? 11.316 -6.831  51.321 1.00 24.88  ? 38   PHE A CG  1 
ATOM   325  C  CD1 . PHE A 1 38  ? 10.430 -7.013  52.380 1.00 26.18  ? 38   PHE A CD1 1 
ATOM   326  C  CD2 . PHE A 1 38  ? 10.904 -7.164  50.045 1.00 25.65  ? 38   PHE A CD2 1 
ATOM   327  C  CE1 . PHE A 1 38  ? 9.144  -7.501  52.169 1.00 25.82  ? 38   PHE A CE1 1 
ATOM   328  C  CE2 . PHE A 1 38  ? 9.615  -7.656  49.820 1.00 27.13  ? 38   PHE A CE2 1 
ATOM   329  C  CZ  . PHE A 1 38  ? 8.733  -7.822  50.889 1.00 25.64  ? 38   PHE A CZ  1 
ATOM   330  N  N   . TYR A 1 39  ? 12.576 -7.252  54.481 1.00 26.35  ? 39   TYR A N   1 
ATOM   331  C  CA  . TYR A 1 39  ? 12.069 -8.027  55.615 1.00 25.55  ? 39   TYR A CA  1 
ATOM   332  C  C   . TYR A 1 39  ? 10.569 -8.112  55.750 1.00 25.95  ? 39   TYR A C   1 
ATOM   333  O  O   . TYR A 1 39  ? 9.832  -7.347  55.144 1.00 26.15  ? 39   TYR A O   1 
ATOM   334  C  CB  . TYR A 1 39  ? 12.656 -7.482  56.924 1.00 22.77  ? 39   TYR A CB  1 
ATOM   335  C  CG  . TYR A 1 39  ? 14.169 -7.529  56.956 1.00 21.63  ? 39   TYR A CG  1 
ATOM   336  C  CD1 . TYR A 1 39  ? 14.932 -6.371  56.747 1.00 19.33  ? 39   TYR A CD1 1 
ATOM   337  C  CD2 . TYR A 1 39  ? 14.842 -8.746  57.113 1.00 18.38  ? 39   TYR A CD2 1 
ATOM   338  C  CE1 . TYR A 1 39  ? 16.314 -6.426  56.684 1.00 14.29  ? 39   TYR A CE1 1 
ATOM   339  C  CE2 . TYR A 1 39  ? 16.222 -8.809  57.052 1.00 16.41  ? 39   TYR A CE2 1 
ATOM   340  C  CZ  . TYR A 1 39  ? 16.952 -7.647  56.835 1.00 17.12  ? 39   TYR A CZ  1 
ATOM   341  O  OH  . TYR A 1 39  ? 18.328 -7.719  56.759 1.00 18.79  ? 39   TYR A OH  1 
ATOM   342  N  N   . ALA A 1 40  ? 10.128 -9.066  56.555 1.00 27.31  ? 40   ALA A N   1 
ATOM   343  C  CA  . ALA A 1 40  ? 8.710  -9.253  56.815 1.00 30.54  ? 40   ALA A CA  1 
ATOM   344  C  C   . ALA A 1 40  ? 8.510  -9.727  58.253 1.00 33.24  ? 40   ALA A C   1 
ATOM   345  O  O   . ALA A 1 40  ? 9.252  -10.582 58.751 1.00 33.45  ? 40   ALA A O   1 
ATOM   346  C  CB  . ALA A 1 40  ? 8.115  -10.266 55.838 1.00 29.62  ? 40   ALA A CB  1 
ATOM   347  N  N   . LEU A 1 41  ? 7.523  -9.142  58.925 1.00 35.71  ? 41   LEU A N   1 
ATOM   348  C  CA  . LEU A 1 41  ? 7.195  -9.515  60.293 1.00 36.78  ? 41   LEU A CA  1 
ATOM   349  C  C   . LEU A 1 41  ? 5.951  -10.382 60.215 1.00 38.53  ? 41   LEU A C   1 
ATOM   350  O  O   . LEU A 1 41  ? 4.863  -9.888  59.925 1.00 37.35  ? 41   LEU A O   1 
ATOM   351  C  CB  . LEU A 1 41  ? 6.913  -8.276  61.149 1.00 35.32  ? 41   LEU A CB  1 
ATOM   352  C  CG  . LEU A 1 41  ? 6.589  -8.547  62.629 1.00 32.62  ? 41   LEU A CG  1 
ATOM   353  C  CD1 . LEU A 1 41  ? 7.642  -9.463  63.251 1.00 30.46  ? 41   LEU A CD1 1 
ATOM   354  C  CD2 . LEU A 1 41  ? 6.522  -7.233  63.370 1.00 28.68  ? 41   LEU A CD2 1 
ATOM   355  N  N   . LEU A 1 42  ? 6.125  -11.676 60.467 1.00 41.05  ? 42   LEU A N   1 
ATOM   356  C  CA  . LEU A 1 42  ? 5.029  -12.632 60.404 1.00 43.60  ? 42   LEU A CA  1 
ATOM   357  C  C   . LEU A 1 42  ? 4.378  -12.968 61.741 1.00 46.29  ? 42   LEU A C   1 
ATOM   358  O  O   . LEU A 1 42  ? 5.045  -13.018 62.772 1.00 46.48  ? 42   LEU A O   1 
ATOM   359  C  CB  . LEU A 1 42  ? 5.525  -13.919 59.769 1.00 42.30  ? 42   LEU A CB  1 
ATOM   360  C  CG  . LEU A 1 42  ? 6.088  -13.768 58.367 1.00 41.85  ? 42   LEU A CG  1 
ATOM   361  C  CD1 . LEU A 1 42  ? 6.446  -15.147 57.867 1.00 43.44  ? 42   LEU A CD1 1 
ATOM   362  C  CD2 . LEU A 1 42  ? 5.068  -13.109 57.447 1.00 40.01  ? 42   LEU A CD2 1 
ATOM   363  N  N   . LYS A 1 43  ? 3.069  -13.213 61.709 1.00 49.19  ? 43   LYS A N   1 
ATOM   364  C  CA  . LYS A 1 43  ? 2.323  -13.569 62.913 1.00 52.03  ? 43   LYS A CA  1 
ATOM   365  C  C   . LYS A 1 43  ? 2.795  -14.902 63.470 1.00 53.30  ? 43   LYS A C   1 
ATOM   366  O  O   . LYS A 1 43  ? 2.858  -15.093 64.688 1.00 53.35  ? 43   LYS A O   1 
ATOM   367  C  CB  . LYS A 1 43  ? 0.824  -13.658 62.619 1.00 52.66  ? 43   LYS A CB  1 
ATOM   368  C  CG  . LYS A 1 43  ? 0.143  -12.316 62.455 1.00 53.08  ? 43   LYS A CG  1 
ATOM   369  C  CD  . LYS A 1 43  ? -1.328 -12.486 62.125 1.00 53.07  ? 43   LYS A CD  1 
ATOM   370  C  CE  . LYS A 1 43  ? -2.017 -11.136 61.917 1.00 55.38  ? 43   LYS A CE  1 
ATOM   371  N  NZ  . LYS A 1 43  ? -1.551 -10.389 60.703 1.00 55.69  ? 43   LYS A NZ  1 
ATOM   372  N  N   . ASP A 1 44  ? 3.126  -15.826 62.578 1.00 55.62  ? 44   ASP A N   1 
ATOM   373  C  CA  . ASP A 1 44  ? 3.590  -17.134 63.011 1.00 58.98  ? 44   ASP A CA  1 
ATOM   374  C  C   . ASP A 1 44  ? 4.549  -17.738 61.990 1.00 58.81  ? 44   ASP A C   1 
ATOM   375  O  O   . ASP A 1 44  ? 4.198  -17.892 60.825 1.00 58.53  ? 44   ASP A O   1 
ATOM   376  C  CB  . ASP A 1 44  ? 2.385  -18.054 63.236 1.00 61.12  ? 44   ASP A CB  1 
ATOM   377  C  CG  . ASP A 1 44  ? 2.654  -19.119 64.284 1.00 64.83  ? 44   ASP A CG  1 
ATOM   378  O  OD1 . ASP A 1 44  ? 3.337  -20.120 63.963 1.00 67.25  ? 44   ASP A OD1 1 
ATOM   379  O  OD2 . ASP A 1 44  ? 2.191  -18.947 65.437 1.00 64.54  ? 44   ASP A OD2 1 
ATOM   380  N  N   . ASP A 1 45  ? 5.759  -18.073 62.440 1.00 59.49  ? 45   ASP A N   1 
ATOM   381  C  CA  . ASP A 1 45  ? 6.794  -18.660 61.583 1.00 60.26  ? 45   ASP A CA  1 
ATOM   382  C  C   . ASP A 1 45  ? 6.283  -19.839 60.771 1.00 59.80  ? 45   ASP A C   1 
ATOM   383  O  O   . ASP A 1 45  ? 7.042  -20.483 60.044 1.00 59.41  ? 45   ASP A O   1 
ATOM   384  C  CB  . ASP A 1 45  ? 7.986  -19.115 62.427 1.00 61.82  ? 45   ASP A CB  1 
ATOM   385  C  CG  . ASP A 1 45  ? 8.661  -17.963 63.140 1.00 65.67  ? 45   ASP A CG  1 
ATOM   386  O  OD1 . ASP A 1 45  ? 7.971  -17.225 63.879 1.00 69.23  ? 45   ASP A OD1 1 
ATOM   387  O  OD2 . ASP A 1 45  ? 9.883  -17.794 62.963 1.00 66.93  ? 45   ASP A OD2 1 
ATOM   388  N  N   . SER A 1 46  ? 4.992  -20.119 60.908 1.00 59.52  ? 46   SER A N   1 
ATOM   389  C  CA  . SER A 1 46  ? 4.352  -21.212 60.197 1.00 58.88  ? 46   SER A CA  1 
ATOM   390  C  C   . SER A 1 46  ? 3.911  -20.743 58.825 1.00 57.56  ? 46   SER A C   1 
ATOM   391  O  O   . SER A 1 46  ? 4.243  -21.358 57.817 1.00 58.30  ? 46   SER A O   1 
ATOM   392  C  CB  . SER A 1 46  ? 3.137  -21.710 60.981 1.00 59.97  ? 46   SER A CB  1 
ATOM   393  O  OG  . SER A 1 46  ? 2.236  -20.649 61.257 1.00 61.94  ? 46   SER A OG  1 
ATOM   394  N  N   . ALA A 1 47  ? 3.175  -19.640 58.795 1.00 56.07  ? 47   ALA A N   1 
ATOM   395  C  CA  . ALA A 1 47  ? 2.666  -19.088 57.549 1.00 55.72  ? 47   ALA A CA  1 
ATOM   396  C  C   . ALA A 1 47  ? 3.745  -18.707 56.540 1.00 56.21  ? 47   ALA A C   1 
ATOM   397  O  O   . ALA A 1 47  ? 3.439  -18.240 55.444 1.00 55.90  ? 47   ALA A O   1 
ATOM   398  C  CB  . ALA A 1 47  ? 1.796  -17.904 57.845 1.00 54.32  ? 47   ALA A CB  1 
ATOM   399  N  N   . ILE A 1 48  ? 5.007  -18.903 56.907 1.00 57.19  ? 48   ILE A N   1 
ATOM   400  C  CA  . ILE A 1 48  ? 6.110  -18.597 56.002 1.00 57.35  ? 48   ILE A CA  1 
ATOM   401  C  C   . ILE A 1 48  ? 5.938  -19.451 54.742 1.00 58.72  ? 48   ILE A C   1 
ATOM   402  O  O   . ILE A 1 48  ? 6.374  -19.080 53.657 1.00 59.38  ? 48   ILE A O   1 
ATOM   403  C  CB  . ILE A 1 48  ? 7.478  -18.916 56.663 1.00 55.65  ? 48   ILE A CB  1 
ATOM   404  C  CG1 . ILE A 1 48  ? 8.622  -18.622 55.695 1.00 53.61  ? 48   ILE A CG1 1 
ATOM   405  C  CG2 . ILE A 1 48  ? 7.526  -20.365 57.076 1.00 55.08  ? 48   ILE A CG2 1 
ATOM   406  C  CD1 . ILE A 1 48  ? 8.728  -17.174 55.299 1.00 52.24  ? 48   ILE A CD1 1 
ATOM   407  N  N   . GLU A 1 49  ? 5.277  -20.592 54.894 1.00 60.79  ? 49   GLU A N   1 
ATOM   408  C  CA  . GLU A 1 49  ? 5.050  -21.499 53.774 1.00 61.99  ? 49   GLU A CA  1 
ATOM   409  C  C   . GLU A 1 49  ? 3.922  -20.994 52.876 1.00 61.49  ? 49   GLU A C   1 
ATOM   410  O  O   . GLU A 1 49  ? 3.914  -21.243 51.671 1.00 61.24  ? 49   GLU A O   1 
ATOM   411  C  CB  . GLU A 1 49  ? 4.715  -22.901 54.296 1.00 63.49  ? 49   GLU A CB  1 
ATOM   412  C  CG  . GLU A 1 49  ? 5.286  -24.027 53.439 1.00 65.47  ? 49   GLU A CG  1 
ATOM   413  C  CD  . GLU A 1 49  ? 6.807  -24.018 53.396 1.00 65.76  ? 49   GLU A CD  1 
ATOM   414  O  OE1 . GLU A 1 49  ? 7.433  -24.310 54.437 1.00 64.61  ? 49   GLU A OE1 1 
ATOM   415  O  OE2 . GLU A 1 49  ? 7.375  -23.712 52.322 1.00 67.23  ? 49   GLU A OE2 1 
ATOM   416  N  N   . GLU A 1 50  ? 2.967  -20.287 53.469 1.00 60.89  ? 50   GLU A N   1 
ATOM   417  C  CA  . GLU A 1 50  ? 1.849  -19.742 52.713 1.00 59.38  ? 50   GLU A CA  1 
ATOM   418  C  C   . GLU A 1 50  ? 2.364  -18.510 51.970 1.00 58.56  ? 50   GLU A C   1 
ATOM   419  O  O   . GLU A 1 50  ? 1.913  -18.203 50.873 1.00 58.06  ? 50   GLU A O   1 
ATOM   420  C  CB  . GLU A 1 50  ? 0.719  -19.347 53.670 1.00 59.51  ? 50   GLU A CB  1 
ATOM   421  C  CG  . GLU A 1 50  ? -0.692 -19.648 53.187 1.00 60.02  ? 50   GLU A CG  1 
ATOM   422  C  CD  . GLU A 1 50  ? -1.012 -19.025 51.838 1.00 61.43  ? 50   GLU A CD  1 
ATOM   423  O  OE1 . GLU A 1 50  ? -0.572 -19.579 50.806 1.00 62.46  ? 50   GLU A OE1 1 
ATOM   424  O  OE2 . GLU A 1 50  ? -1.699 -17.979 51.810 1.00 58.95  ? 50   GLU A OE2 1 
ATOM   425  N  N   . VAL A 1 51  ? 3.333  -17.823 52.575 1.00 58.83  ? 51   VAL A N   1 
ATOM   426  C  CA  . VAL A 1 51  ? 3.926  -16.608 52.005 1.00 58.93  ? 51   VAL A CA  1 
ATOM   427  C  C   . VAL A 1 51  ? 4.950  -16.835 50.886 1.00 58.84  ? 51   VAL A C   1 
ATOM   428  O  O   . VAL A 1 51  ? 4.886  -16.181 49.843 1.00 57.96  ? 51   VAL A O   1 
ATOM   429  C  CB  . VAL A 1 51  ? 4.594  -15.749 53.119 1.00 58.85  ? 51   VAL A CB  1 
ATOM   430  C  CG1 . VAL A 1 51  ? 5.304  -14.557 52.523 1.00 59.02  ? 51   VAL A CG1 1 
ATOM   431  C  CG2 . VAL A 1 51  ? 3.548  -15.273 54.094 1.00 59.01  ? 51   VAL A CG2 1 
ATOM   432  N  N   . LYS A 1 52  ? 5.888  -17.758 51.097 1.00 59.06  ? 52   LYS A N   1 
ATOM   433  C  CA  . LYS A 1 52  ? 6.919  -18.035 50.094 1.00 59.75  ? 52   LYS A CA  1 
ATOM   434  C  C   . LYS A 1 52  ? 6.335  -18.557 48.798 1.00 60.39  ? 52   LYS A C   1 
ATOM   435  O  O   . LYS A 1 52  ? 7.060  -19.068 47.954 1.00 61.22  ? 52   LYS A O   1 
ATOM   436  C  CB  . LYS A 1 52  ? 7.942  -19.061 50.607 1.00 58.87  ? 52   LYS A CB  1 
ATOM   437  C  CG  . LYS A 1 52  ? 7.563  -20.522 50.373 1.00 58.28  ? 52   LYS A CG  1 
ATOM   438  C  CD  . LYS A 1 52  ? 8.749  -21.458 50.588 1.00 58.15  ? 52   LYS A CD  1 
ATOM   439  C  CE  . LYS A 1 52  ? 9.298  -21.370 52.012 1.00 58.69  ? 52   LYS A CE  1 
ATOM   440  N  NZ  . LYS A 1 52  ? 10.413 -22.327 52.288 1.00 56.74  ? 52   LYS A NZ  1 
ATOM   441  N  N   . LYS A 1 53  ? 5.027  -18.435 48.636 1.00 61.34  ? 53   LYS A N   1 
ATOM   442  C  CA  . LYS A 1 53  ? 4.397  -18.927 47.429 1.00 63.61  ? 53   LYS A CA  1 
ATOM   443  C  C   . LYS A 1 53  ? 3.757  -17.781 46.673 1.00 64.67  ? 53   LYS A C   1 
ATOM   444  O  O   . LYS A 1 53  ? 3.421  -17.907 45.489 1.00 65.21  ? 53   LYS A O   1 
ATOM   445  C  CB  . LYS A 1 53  ? 3.339  -19.968 47.785 1.00 64.48  ? 53   LYS A CB  1 
ATOM   446  C  CG  . LYS A 1 53  ? 3.831  -21.080 48.704 1.00 67.09  ? 53   LYS A CG  1 
ATOM   447  C  CD  . LYS A 1 53  ? 4.915  -21.942 48.053 1.00 67.39  ? 53   LYS A CD  1 
ATOM   448  C  CE  . LYS A 1 53  ? 5.356  -23.079 48.984 1.00 67.42  ? 53   LYS A CE  1 
ATOM   449  N  NZ  . LYS A 1 53  ? 4.234  -23.983 49.388 1.00 65.65  ? 53   LYS A NZ  1 
ATOM   450  N  N   . ILE A 1 54  ? 3.590  -16.658 47.362 1.00 65.04  ? 54   ILE A N   1 
ATOM   451  C  CA  . ILE A 1 54  ? 2.972  -15.498 46.744 1.00 64.70  ? 54   ILE A CA  1 
ATOM   452  C  C   . ILE A 1 54  ? 3.853  -14.996 45.617 1.00 64.64  ? 54   ILE A C   1 
ATOM   453  O  O   . ILE A 1 54  ? 5.080  -15.045 45.705 1.00 64.71  ? 54   ILE A O   1 
ATOM   454  C  CB  . ILE A 1 54  ? 2.731  -14.380 47.771 1.00 64.26  ? 54   ILE A CB  1 
ATOM   455  C  CG1 . ILE A 1 54  ? 2.083  -13.178 47.077 1.00 64.54  ? 54   ILE A CG1 1 
ATOM   456  C  CG2 . ILE A 1 54  ? 4.030  -14.027 48.459 1.00 63.56  ? 54   ILE A CG2 1 
ATOM   457  C  CD1 . ILE A 1 54  ? 1.683  -12.055 48.009 1.00 64.20  ? 54   ILE A CD1 1 
ATOM   458  N  N   . THR A 1 55  ? 3.220  -14.521 44.551 1.00 65.52  ? 55   THR A N   1 
ATOM   459  C  CA  . THR A 1 55  ? 3.955  -14.039 43.391 1.00 66.52  ? 55   THR A CA  1 
ATOM   460  C  C   . THR A 1 55  ? 3.368  -12.770 42.776 1.00 66.94  ? 55   THR A C   1 
ATOM   461  O  O   . THR A 1 55  ? 2.234  -12.381 43.063 1.00 66.93  ? 55   THR A O   1 
ATOM   462  C  CB  . THR A 1 55  ? 4.003  -15.121 42.307 1.00 66.63  ? 55   THR A CB  1 
ATOM   463  O  OG1 . THR A 1 55  ? 2.674  -15.370 41.831 1.00 66.56  ? 55   THR A OG1 1 
ATOM   464  C  CG2 . THR A 1 55  ? 4.587  -16.418 42.874 1.00 66.75  ? 55   THR A CG2 1 
ATOM   465  N  N   . ALA A 1 56  ? 4.154  -12.130 41.918 1.00 67.38  ? 56   ALA A N   1 
ATOM   466  C  CA  . ALA A 1 56  ? 3.724  -10.909 41.261 1.00 68.64  ? 56   ALA A CA  1 
ATOM   467  C  C   . ALA A 1 56  ? 4.077  -10.953 39.781 1.00 69.48  ? 56   ALA A C   1 
ATOM   468  O  O   . ALA A 1 56  ? 4.722  -11.890 39.309 1.00 68.36  ? 56   ALA A O   1 
ATOM   469  C  CB  . ALA A 1 56  ? 4.381  -9.702  41.919 1.00 68.13  ? 56   ALA A CB  1 
ATOM   470  N  N   . GLU A 1 57  ? 3.649  -9.929  39.055 1.00 71.02  ? 57   GLU A N   1 
ATOM   471  C  CA  . GLU A 1 57  ? 3.918  -9.847  37.631 1.00 73.31  ? 57   GLU A CA  1 
ATOM   472  C  C   . GLU A 1 57  ? 4.454  -8.477  37.229 1.00 73.08  ? 57   GLU A C   1 
ATOM   473  O  O   . GLU A 1 57  ? 3.786  -7.455  37.377 1.00 72.79  ? 57   GLU A O   1 
ATOM   474  C  CB  . GLU A 1 57  ? 2.644  -10.167 36.836 1.00 75.02  ? 57   GLU A CB  1 
ATOM   475  C  CG  . GLU A 1 57  ? 2.775  -10.027 35.326 1.00 76.50  ? 57   GLU A CG  1 
ATOM   476  C  CD  . GLU A 1 57  ? 1.526  -10.479 34.588 1.00 78.71  ? 57   GLU A CD  1 
ATOM   477  O  OE1 . GLU A 1 57  ? 0.434  -9.933  34.859 1.00 79.91  ? 57   GLU A OE1 1 
ATOM   478  O  OE2 . GLU A 1 57  ? 1.634  -11.383 33.734 1.00 79.98  ? 57   GLU A OE2 1 
ATOM   479  N  N   . ARG A 1 58  ? 5.683  -8.478  36.733 1.00 73.41  ? 58   ARG A N   1 
ATOM   480  C  CA  . ARG A 1 58  ? 6.346  -7.273  36.264 1.00 73.70  ? 58   ARG A CA  1 
ATOM   481  C  C   . ARG A 1 58  ? 6.766  -7.585  34.830 1.00 76.06  ? 58   ARG A C   1 
ATOM   482  O  O   . ARG A 1 58  ? 7.129  -8.722  34.522 1.00 76.24  ? 58   ARG A O   1 
ATOM   483  C  CB  . ARG A 1 58  ? 7.581  -6.980  37.120 1.00 70.31  ? 58   ARG A CB  1 
ATOM   484  C  CG  . ARG A 1 58  ? 8.478  -5.885  36.566 1.00 66.16  ? 58   ARG A CG  1 
ATOM   485  C  CD  . ARG A 1 58  ? 9.870  -5.955  37.162 1.00 60.96  ? 58   ARG A CD  1 
ATOM   486  N  NE  . ARG A 1 58  ? 10.394 -7.316  37.127 1.00 57.69  ? 58   ARG A NE  1 
ATOM   487  C  CZ  . ARG A 1 58  ? 11.686 -7.621  37.159 1.00 56.76  ? 58   ARG A CZ  1 
ATOM   488  N  NH1 . ARG A 1 58  ? 12.592 -6.657  37.223 1.00 56.93  ? 58   ARG A NH1 1 
ATOM   489  N  NH2 . ARG A 1 58  ? 12.077 -8.889  37.127 1.00 54.28  ? 58   ARG A NH2 1 
ATOM   490  N  N   . HIS A 1 59  ? 6.707  -6.589  33.955 1.00 79.01  ? 59   HIS A N   1 
ATOM   491  C  CA  . HIS A 1 59  ? 7.095  -6.779  32.561 1.00 81.96  ? 59   HIS A CA  1 
ATOM   492  C  C   . HIS A 1 59  ? 6.502  -8.066  31.971 1.00 82.11  ? 59   HIS A C   1 
ATOM   493  O  O   . HIS A 1 59  ? 7.181  -8.797  31.245 1.00 82.33  ? 59   HIS A O   1 
ATOM   494  C  CB  . HIS A 1 59  ? 8.628  -6.806  32.437 1.00 84.98  ? 59   HIS A CB  1 
ATOM   495  C  CG  . HIS A 1 59  ? 9.284  -5.472  32.647 1.00 89.31  ? 59   HIS A CG  1 
ATOM   496  N  ND1 . HIS A 1 59  ? 10.636 -5.336  32.891 1.00 91.18  ? 59   HIS A ND1 1 
ATOM   497  C  CD2 . HIS A 1 59  ? 8.781  -4.213  32.621 1.00 90.26  ? 59   HIS A CD2 1 
ATOM   498  C  CE1 . HIS A 1 59  ? 10.936 -4.054  33.007 1.00 92.03  ? 59   HIS A CE1 1 
ATOM   499  N  NE2 . HIS A 1 59  ? 9.828  -3.352  32.847 1.00 91.93  ? 59   HIS A NE2 1 
ATOM   500  N  N   . GLY A 1 60  ? 5.241  -8.343  32.295 1.00 81.37  ? 60   GLY A N   1 
ATOM   501  C  CA  . GLY A 1 60  ? 4.584  -9.526  31.764 1.00 80.66  ? 60   GLY A CA  1 
ATOM   502  C  C   . GLY A 1 60  ? 5.255  -10.848 32.082 1.00 79.96  ? 60   GLY A C   1 
ATOM   503  O  O   . GLY A 1 60  ? 4.882  -11.893 31.543 1.00 79.13  ? 60   GLY A O   1 
ATOM   504  N  N   . THR A 1 61  ? 6.267  -10.799 32.940 1.00 79.90  ? 61   THR A N   1 
ATOM   505  C  CA  . THR A 1 61  ? 6.967  -12.005 33.361 1.00 80.19  ? 61   THR A CA  1 
ATOM   506  C  C   . THR A 1 61  ? 6.316  -12.343 34.691 1.00 79.77  ? 61   THR A C   1 
ATOM   507  O  O   . THR A 1 61  ? 5.153  -12.001 34.914 1.00 80.86  ? 61   THR A O   1 
ATOM   508  C  CB  . THR A 1 61  ? 8.472  -11.754 33.585 1.00 80.65  ? 61   THR A CB  1 
ATOM   509  O  OG1 . THR A 1 61  ? 9.033  -11.149 32.413 1.00 82.13  ? 61   THR A OG1 1 
ATOM   510  C  CG2 . THR A 1 61  ? 9.199  -13.068 33.856 1.00 80.30  ? 61   THR A CG2 1 
ATOM   511  N  N   . VAL A 1 62  ? 7.046  -12.996 35.586 1.00 78.07  ? 62   VAL A N   1 
ATOM   512  C  CA  . VAL A 1 62  ? 6.468  -13.333 36.879 1.00 75.26  ? 62   VAL A CA  1 
ATOM   513  C  C   . VAL A 1 62  ? 7.506  -13.231 37.997 1.00 72.95  ? 62   VAL A C   1 
ATOM   514  O  O   . VAL A 1 62  ? 8.568  -13.860 37.945 1.00 72.57  ? 62   VAL A O   1 
ATOM   515  C  CB  . VAL A 1 62  ? 5.824  -14.753 36.848 1.00 75.03  ? 62   VAL A CB  1 
ATOM   516  C  CG1 . VAL A 1 62  ? 6.892  -15.830 36.891 1.00 75.26  ? 62   VAL A CG1 1 
ATOM   517  C  CG2 . VAL A 1 62  ? 4.851  -14.904 37.996 1.00 74.74  ? 62   VAL A CG2 1 
ATOM   518  N  N   . VAL A 1 63  ? 7.196  -12.409 38.997 1.00 69.82  ? 63   VAL A N   1 
ATOM   519  C  CA  . VAL A 1 63  ? 8.090  -12.205 40.131 1.00 65.25  ? 63   VAL A CA  1 
ATOM   520  C  C   . VAL A 1 63  ? 7.729  -13.165 41.254 1.00 63.05  ? 63   VAL A C   1 
ATOM   521  O  O   . VAL A 1 63  ? 6.603  -13.148 41.758 1.00 62.37  ? 63   VAL A O   1 
ATOM   522  C  CB  . VAL A 1 63  ? 7.997  -10.766 40.665 1.00 63.39  ? 63   VAL A CB  1 
ATOM   523  C  CG1 . VAL A 1 63  ? 9.018  -10.554 41.758 1.00 62.78  ? 63   VAL A CG1 1 
ATOM   524  C  CG2 . VAL A 1 63  ? 8.218  -9.785  39.541 1.00 61.92  ? 63   VAL A CG2 1 
ATOM   525  N  N   . THR A 1 64  ? 8.691  -14.001 41.637 1.00 60.29  ? 64   THR A N   1 
ATOM   526  C  CA  . THR A 1 64  ? 8.494  -14.986 42.700 1.00 56.99  ? 64   THR A CA  1 
ATOM   527  C  C   . THR A 1 64  ? 9.439  -14.738 43.870 1.00 54.88  ? 64   THR A C   1 
ATOM   528  O  O   . THR A 1 64  ? 10.358 -13.923 43.779 1.00 55.66  ? 64   THR A O   1 
ATOM   529  C  CB  . THR A 1 64  ? 8.752  -16.418 42.186 1.00 56.31  ? 64   THR A CB  1 
ATOM   530  O  OG1 . THR A 1 64  ? 10.080 -16.509 41.651 1.00 54.00  ? 64   THR A OG1 1 
ATOM   531  C  CG2 . THR A 1 64  ? 7.746  -16.785 41.108 1.00 56.15  ? 64   THR A CG2 1 
ATOM   532  N  N   . VAL A 1 65  ? 9.204  -15.435 44.975 1.00 51.11  ? 65   VAL A N   1 
ATOM   533  C  CA  . VAL A 1 65  ? 10.069 -15.293 46.130 1.00 47.08  ? 65   VAL A CA  1 
ATOM   534  C  C   . VAL A 1 65  ? 11.148 -16.354 45.995 1.00 45.92  ? 65   VAL A C   1 
ATOM   535  O  O   . VAL A 1 65  ? 10.871 -17.549 46.064 1.00 45.71  ? 65   VAL A O   1 
ATOM   536  C  CB  . VAL A 1 65  ? 9.320  -15.527 47.457 1.00 46.79  ? 65   VAL A CB  1 
ATOM   537  C  CG1 . VAL A 1 65  ? 10.301 -15.446 48.605 1.00 45.77  ? 65   VAL A CG1 1 
ATOM   538  C  CG2 . VAL A 1 65  ? 8.212  -14.503 47.636 1.00 44.90  ? 65   VAL A CG2 1 
ATOM   539  N  N   . LYS A 1 66  ? 12.376 -15.908 45.786 1.00 44.29  ? 66   LYS A N   1 
ATOM   540  C  CA  . LYS A 1 66  ? 13.511 -16.804 45.639 1.00 43.39  ? 66   LYS A CA  1 
ATOM   541  C  C   . LYS A 1 66  ? 13.699 -17.623 46.930 1.00 42.25  ? 66   LYS A C   1 
ATOM   542  O  O   . LYS A 1 66  ? 12.973 -18.584 47.169 1.00 42.36  ? 66   LYS A O   1 
ATOM   543  C  CB  . LYS A 1 66  ? 14.752 -15.963 45.304 1.00 43.96  ? 66   LYS A CB  1 
ATOM   544  C  CG  . LYS A 1 66  ? 16.033 -16.729 44.985 1.00 45.25  ? 66   LYS A CG  1 
ATOM   545  C  CD  . LYS A 1 66  ? 17.140 -15.748 44.600 1.00 45.66  ? 66   LYS A CD  1 
ATOM   546  C  CE  . LYS A 1 66  ? 18.518 -16.394 44.558 1.00 44.90  ? 66   LYS A CE  1 
ATOM   547  N  NZ  . LYS A 1 66  ? 19.564 -15.376 44.239 1.00 44.06  ? 66   LYS A NZ  1 
ATOM   548  N  N   . ARG A 1 67  ? 14.662 -17.243 47.762 1.00 41.34  ? 67   ARG A N   1 
ATOM   549  C  CA  . ARG A 1 67  ? 14.908 -17.951 49.012 1.00 39.86  ? 67   ARG A CA  1 
ATOM   550  C  C   . ARG A 1 67  ? 14.366 -17.163 50.177 1.00 38.45  ? 67   ARG A C   1 
ATOM   551  O  O   . ARG A 1 67  ? 13.911 -16.035 50.014 1.00 38.29  ? 67   ARG A O   1 
ATOM   552  C  CB  . ARG A 1 67  ? 16.402 -18.208 49.210 1.00 41.84  ? 67   ARG A CB  1 
ATOM   553  C  CG  . ARG A 1 67  ? 17.289 -17.109 48.675 1.00 47.14  ? 67   ARG A CG  1 
ATOM   554  C  CD  . ARG A 1 67  ? 18.741 -17.547 48.610 1.00 50.59  ? 67   ARG A CD  1 
ATOM   555  N  NE  . ARG A 1 67  ? 19.342 -17.670 49.932 1.00 52.34  ? 67   ARG A NE  1 
ATOM   556  C  CZ  . ARG A 1 67  ? 20.498 -17.107 50.261 1.00 54.35  ? 67   ARG A CZ  1 
ATOM   557  N  NH1 . ARG A 1 67  ? 20.999 -17.253 51.484 1.00 55.58  ? 67   ARG A NH1 1 
ATOM   558  N  NH2 . ARG A 1 67  ? 21.153 -16.389 49.359 1.00 55.25  ? 67   ARG A NH2 1 
ATOM   559  N  N   . VAL A 1 68  ? 14.417 -17.769 51.357 1.00 37.48  ? 68   VAL A N   1 
ATOM   560  C  CA  . VAL A 1 68  ? 13.911 -17.149 52.571 1.00 36.13  ? 68   VAL A CA  1 
ATOM   561  C  C   . VAL A 1 68  ? 14.606 -17.733 53.778 1.00 36.57  ? 68   VAL A C   1 
ATOM   562  O  O   . VAL A 1 68  ? 14.810 -18.938 53.847 1.00 37.64  ? 68   VAL A O   1 
ATOM   563  C  CB  . VAL A 1 68  ? 12.408 -17.413 52.747 1.00 35.24  ? 68   VAL A CB  1 
ATOM   564  C  CG1 . VAL A 1 68  ? 11.975 -17.009 54.134 1.00 36.15  ? 68   VAL A CG1 1 
ATOM   565  C  CG2 . VAL A 1 68  ? 11.615 -16.642 51.714 1.00 35.61  ? 68   VAL A CG2 1 
ATOM   566  N  N   . GLU A 1 69  ? 14.968 -16.886 54.732 1.00 37.16  ? 69   GLU A N   1 
ATOM   567  C  CA  . GLU A 1 69  ? 15.604 -17.376 55.941 1.00 39.08  ? 69   GLU A CA  1 
ATOM   568  C  C   . GLU A 1 69  ? 15.219 -16.508 57.136 1.00 39.53  ? 69   GLU A C   1 
ATOM   569  O  O   . GLU A 1 69  ? 15.193 -15.282 57.048 1.00 41.14  ? 69   GLU A O   1 
ATOM   570  C  CB  . GLU A 1 69  ? 17.133 -17.447 55.770 1.00 39.23  ? 69   GLU A CB  1 
ATOM   571  C  CG  . GLU A 1 69  ? 17.820 -16.126 55.508 1.00 42.64  ? 69   GLU A CG  1 
ATOM   572  C  CD  . GLU A 1 69  ? 19.340 -16.211 55.639 1.00 44.47  ? 69   GLU A CD  1 
ATOM   573  O  OE1 . GLU A 1 69  ? 20.038 -16.309 54.596 1.00 45.46  ? 69   GLU A OE1 1 
ATOM   574  O  OE2 . GLU A 1 69  ? 19.831 -16.182 56.793 1.00 41.92  ? 69   GLU A OE2 1 
ATOM   575  N  N   . LYS A 1 70  ? 14.894 -17.159 58.248 1.00 39.88  ? 70   LYS A N   1 
ATOM   576  C  CA  . LYS A 1 70  ? 14.503 -16.463 59.462 1.00 38.58  ? 70   LYS A CA  1 
ATOM   577  C  C   . LYS A 1 70  ? 15.743 -15.918 60.166 1.00 39.67  ? 70   LYS A C   1 
ATOM   578  O  O   . LYS A 1 70  ? 16.800 -16.557 60.178 1.00 40.21  ? 70   LYS A O   1 
ATOM   579  C  CB  . LYS A 1 70  ? 13.758 -17.409 60.397 1.00 38.02  ? 70   LYS A CB  1 
ATOM   580  C  CG  . LYS A 1 70  ? 12.952 -16.684 61.445 1.00 40.44  ? 70   LYS A CG  1 
ATOM   581  C  CD  . LYS A 1 70  ? 12.607 -17.579 62.602 1.00 43.10  ? 70   LYS A CD  1 
ATOM   582  C  CE  . LYS A 1 70  ? 13.835 -17.943 63.419 1.00 45.72  ? 70   LYS A CE  1 
ATOM   583  N  NZ  . LYS A 1 70  ? 13.488 -18.927 64.496 1.00 48.44  ? 70   LYS A NZ  1 
ATOM   584  N  N   . VAL A 1 71  ? 15.607 -14.735 60.757 1.00 39.66  ? 71   VAL A N   1 
ATOM   585  C  CA  . VAL A 1 71  ? 16.716 -14.096 61.443 1.00 38.35  ? 71   VAL A CA  1 
ATOM   586  C  C   . VAL A 1 71  ? 16.280 -13.353 62.685 1.00 39.46  ? 71   VAL A C   1 
ATOM   587  O  O   . VAL A 1 71  ? 15.097 -13.050 62.875 1.00 38.55  ? 71   VAL A O   1 
ATOM   588  C  CB  . VAL A 1 71  ? 17.400 -13.081 60.544 1.00 37.36  ? 71   VAL A CB  1 
ATOM   589  C  CG1 . VAL A 1 71  ? 18.033 -13.776 59.368 1.00 40.46  ? 71   VAL A CG1 1 
ATOM   590  C  CG2 . VAL A 1 71  ? 16.387 -12.066 60.076 1.00 36.30  ? 71   VAL A CG2 1 
ATOM   591  N  N   . GLN A 1 72  ? 17.260 -13.048 63.524 1.00 39.47  ? 72   GLN A N   1 
ATOM   592  C  CA  . GLN A 1 72  ? 16.999 -12.323 64.744 1.00 40.10  ? 72   GLN A CA  1 
ATOM   593  C  C   . GLN A 1 72  ? 17.744 -11.000 64.682 1.00 39.34  ? 72   GLN A C   1 
ATOM   594  O  O   . GLN A 1 72  ? 18.935 -10.956 64.379 1.00 37.67  ? 72   GLN A O   1 
ATOM   595  C  CB  . GLN A 1 72  ? 17.450 -13.147 65.936 1.00 43.11  ? 72   GLN A CB  1 
ATOM   596  C  CG  . GLN A 1 72  ? 16.868 -14.548 65.944 1.00 46.35  ? 72   GLN A CG  1 
ATOM   597  C  CD  . GLN A 1 72  ? 16.344 -14.942 67.308 1.00 49.59  ? 72   GLN A CD  1 
ATOM   598  O  OE1 . GLN A 1 72  ? 17.008 -14.725 68.326 1.00 50.04  ? 72   GLN A OE1 1 
ATOM   599  N  NE2 . GLN A 1 72  ? 15.150 -15.531 67.340 1.00 51.30  ? 72   GLN A NE2 1 
ATOM   600  N  N   . LYS A 1 73  ? 17.011 -9.925  64.958 1.00 39.63  ? 73   LYS A N   1 
ATOM   601  C  CA  . LYS A 1 73  ? 17.542 -8.569  64.926 1.00 38.17  ? 73   LYS A CA  1 
ATOM   602  C  C   . LYS A 1 73  ? 17.071 -7.767  66.125 1.00 38.94  ? 73   LYS A C   1 
ATOM   603  O  O   . LYS A 1 73  ? 16.296 -8.249  66.955 1.00 38.45  ? 73   LYS A O   1 
ATOM   604  C  CB  . LYS A 1 73  ? 17.074 -7.834  63.669 1.00 37.07  ? 73   LYS A CB  1 
ATOM   605  C  CG  . LYS A 1 73  ? 17.553 -8.383  62.341 1.00 34.68  ? 73   LYS A CG  1 
ATOM   606  C  CD  . LYS A 1 73  ? 17.032 -7.504  61.221 1.00 31.01  ? 73   LYS A CD  1 
ATOM   607  C  CE  . LYS A 1 73  ? 17.876 -7.643  59.993 1.00 31.46  ? 73   LYS A CE  1 
ATOM   608  N  NZ  . LYS A 1 73  ? 19.267 -7.156  60.201 1.00 31.17  ? 73   LYS A NZ  1 
ATOM   609  N  N   . LYS A 1 74  ? 17.523 -6.518  66.171 1.00 39.45  ? 74   LYS A N   1 
ATOM   610  C  CA  . LYS A 1 74  ? 17.184 -5.601  67.248 1.00 40.79  ? 74   LYS A CA  1 
ATOM   611  C  C   . LYS A 1 74  ? 16.316 -4.423  66.775 1.00 39.62  ? 74   LYS A C   1 
ATOM   612  O  O   . LYS A 1 74  ? 16.827 -3.410  66.293 1.00 39.80  ? 74   LYS A O   1 
ATOM   613  C  CB  . LYS A 1 74  ? 18.469 -5.046  67.884 1.00 44.30  ? 74   LYS A CB  1 
ATOM   614  C  CG  . LYS A 1 74  ? 19.523 -6.090  68.262 1.00 47.76  ? 74   LYS A CG  1 
ATOM   615  C  CD  . LYS A 1 74  ? 19.033 -7.013  69.372 1.00 51.13  ? 74   LYS A CD  1 
ATOM   616  C  CE  . LYS A 1 74  ? 20.104 -8.005  69.783 1.00 51.21  ? 74   LYS A CE  1 
ATOM   617  N  NZ  . LYS A 1 74  ? 20.547 -8.842  68.632 1.00 54.00  ? 74   LYS A NZ  1 
ATOM   618  N  N   . PHE A 1 75  ? 15.002 -4.551  66.909 1.00 37.62  ? 75   PHE A N   1 
ATOM   619  C  CA  . PHE A 1 75  ? 14.119 -3.465  66.530 1.00 34.94  ? 75   PHE A CA  1 
ATOM   620  C  C   . PHE A 1 75  ? 13.887 -2.590  67.758 1.00 36.76  ? 75   PHE A C   1 
ATOM   621  O  O   . PHE A 1 75  ? 13.085 -2.927  68.630 1.00 37.87  ? 75   PHE A O   1 
ATOM   622  C  CB  . PHE A 1 75  ? 12.799 -4.004  66.032 1.00 30.14  ? 75   PHE A CB  1 
ATOM   623  C  CG  . PHE A 1 75  ? 11.977 -2.982  65.349 1.00 28.98  ? 75   PHE A CG  1 
ATOM   624  C  CD1 . PHE A 1 75  ? 12.500 -2.268  64.283 1.00 29.75  ? 75   PHE A CD1 1 
ATOM   625  C  CD2 . PHE A 1 75  ? 10.694 -2.712  65.767 1.00 27.71  ? 75   PHE A CD2 1 
ATOM   626  C  CE1 . PHE A 1 75  ? 11.751 -1.302  63.640 1.00 29.41  ? 75   PHE A CE1 1 
ATOM   627  C  CE2 . PHE A 1 75  ? 9.937  -1.746  65.129 1.00 28.81  ? 75   PHE A CE2 1 
ATOM   628  C  CZ  . PHE A 1 75  ? 10.466 -1.038  64.064 1.00 27.94  ? 75   PHE A CZ  1 
ATOM   629  N  N   . LEU A 1 76  ? 14.602 -1.471  67.821 1.00 37.77  ? 76   LEU A N   1 
ATOM   630  C  CA  . LEU A 1 76  ? 14.528 -0.538  68.943 1.00 39.37  ? 76   LEU A CA  1 
ATOM   631  C  C   . LEU A 1 76  ? 14.836 -1.219  70.272 1.00 41.47  ? 76   LEU A C   1 
ATOM   632  O  O   . LEU A 1 76  ? 14.080 -1.111  71.233 1.00 41.75  ? 76   LEU A O   1 
ATOM   633  C  CB  . LEU A 1 76  ? 13.158 0.153   69.001 1.00 37.34  ? 76   LEU A CB  1 
ATOM   634  C  CG  . LEU A 1 76  ? 11.858 -0.535  69.410 1.00 37.05  ? 76   LEU A CG  1 
ATOM   635  C  CD1 . LEU A 1 76  ? 11.531 -0.232  70.868 1.00 38.39  ? 76   LEU A CD1 1 
ATOM   636  C  CD2 . LEU A 1 76  ? 10.734 -0.009  68.538 1.00 37.74  ? 76   LEU A CD2 1 
ATOM   637  N  N   . GLY A 1 77  ? 15.965 -1.916  70.323 1.00 44.25  ? 77   GLY A N   1 
ATOM   638  C  CA  . GLY A 1 77  ? 16.353 -2.603  71.540 1.00 47.47  ? 77   GLY A CA  1 
ATOM   639  C  C   . GLY A 1 77  ? 15.618 -3.917  71.676 1.00 49.86  ? 77   GLY A C   1 
ATOM   640  O  O   . GLY A 1 77  ? 16.229 -4.981  71.815 1.00 50.39  ? 77   GLY A O   1 
ATOM   641  N  N   . ARG A 1 78  ? 14.293 -3.839  71.616 1.00 52.12  ? 78   ARG A N   1 
ATOM   642  C  CA  . ARG A 1 78  ? 13.439 -5.015  71.738 1.00 53.79  ? 78   ARG A CA  1 
ATOM   643  C  C   . ARG A 1 78  ? 13.704 -6.110  70.688 1.00 53.16  ? 78   ARG A C   1 
ATOM   644  O  O   . ARG A 1 78  ? 13.754 -5.838  69.487 1.00 51.54  ? 78   ARG A O   1 
ATOM   645  C  CB  . ARG A 1 78  ? 11.965 -4.587  71.706 1.00 55.56  ? 78   ARG A CB  1 
ATOM   646  C  CG  . ARG A 1 78  ? 11.473 -3.964  73.019 1.00 57.45  ? 78   ARG A CG  1 
ATOM   647  C  CD  . ARG A 1 78  ? 9.959  -3.804  73.015 1.00 58.70  ? 78   ARG A CD  1 
ATOM   648  N  NE  . ARG A 1 78  ? 9.541  -2.453  72.660 1.00 59.91  ? 78   ARG A NE  1 
ATOM   649  C  CZ  . ARG A 1 78  ? 9.540  -1.431  73.510 1.00 61.25  ? 78   ARG A CZ  1 
ATOM   650  N  NH1 . ARG A 1 78  ? 9.936  -1.617  74.761 1.00 62.61  ? 78   ARG A NH1 1 
ATOM   651  N  NH2 . ARG A 1 78  ? 9.139  -0.229  73.115 1.00 60.89  ? 78   ARG A NH2 1 
ATOM   652  N  N   . PRO A 1 79  ? 13.891 -7.368  71.147 1.00 52.36  ? 79   PRO A N   1 
ATOM   653  C  CA  . PRO A 1 79  ? 14.153 -8.537  70.305 1.00 49.60  ? 79   PRO A CA  1 
ATOM   654  C  C   . PRO A 1 79  ? 13.066 -8.788  69.282 1.00 47.26  ? 79   PRO A C   1 
ATOM   655  O  O   . PRO A 1 79  ? 11.870 -8.746  69.582 1.00 46.78  ? 79   PRO A O   1 
ATOM   656  C  CB  . PRO A 1 79  ? 14.249 -9.673  71.314 1.00 49.72  ? 79   PRO A CB  1 
ATOM   657  C  CG  . PRO A 1 79  ? 14.846 -9.007  72.485 1.00 51.42  ? 79   PRO A CG  1 
ATOM   658  C  CD  . PRO A 1 79  ? 14.020 -7.741  72.568 1.00 52.68  ? 79   PRO A CD  1 
ATOM   659  N  N   . VAL A 1 80  ? 13.504 -9.059  68.065 1.00 44.97  ? 80   VAL A N   1 
ATOM   660  C  CA  . VAL A 1 80  ? 12.592 -9.324  66.982 1.00 41.40  ? 80   VAL A CA  1 
ATOM   661  C  C   . VAL A 1 80  ? 13.084 -10.500 66.196 1.00 39.52  ? 80   VAL A C   1 
ATOM   662  O  O   . VAL A 1 80  ? 14.287 -10.738 66.083 1.00 37.91  ? 80   VAL A O   1 
ATOM   663  C  CB  . VAL A 1 80  ? 12.493 -8.143  66.015 1.00 41.71  ? 80   VAL A CB  1 
ATOM   664  C  CG1 . VAL A 1 80  ? 11.506 -7.111  66.534 1.00 42.43  ? 80   VAL A CG1 1 
ATOM   665  C  CG2 . VAL A 1 80  ? 13.866 -7.537  65.830 1.00 40.74  ? 80   VAL A CG2 1 
ATOM   666  N  N   . GLU A 1 81  ? 12.122 -11.231 65.655 1.00 38.03  ? 81   GLU A N   1 
ATOM   667  C  CA  . GLU A 1 81  ? 12.392 -12.379 64.827 1.00 36.83  ? 81   GLU A CA  1 
ATOM   668  C  C   . GLU A 1 81  ? 11.589 -12.163 63.561 1.00 36.79  ? 81   GLU A C   1 
ATOM   669  O  O   . GLU A 1 81  ? 10.366 -12.156 63.605 1.00 38.26  ? 81   GLU A O   1 
ATOM   670  C  CB  . GLU A 1 81  ? 11.933 -13.647 65.530 1.00 36.12  ? 81   GLU A CB  1 
ATOM   671  C  CG  . GLU A 1 81  ? 11.868 -14.848 64.630 1.00 35.84  ? 81   GLU A CG  1 
ATOM   672  C  CD  . GLU A 1 81  ? 12.111 -16.130 65.375 1.00 34.81  ? 81   GLU A CD  1 
ATOM   673  O  OE1 . GLU A 1 81  ? 13.212 -16.283 65.943 1.00 32.26  ? 81   GLU A OE1 1 
ATOM   674  O  OE2 . GLU A 1 81  ? 11.203 -16.984 65.386 1.00 37.07  ? 81   GLU A OE2 1 
ATOM   675  N  N   . VAL A 1 82  ? 12.275 -11.941 62.443 1.00 38.24  ? 82   VAL A N   1 
ATOM   676  C  CA  . VAL A 1 82  ? 11.608 -11.744 61.148 1.00 37.92  ? 82   VAL A CA  1 
ATOM   677  C  C   . VAL A 1 82  ? 12.242 -12.613 60.078 1.00 36.75  ? 82   VAL A C   1 
ATOM   678  O  O   . VAL A 1 82  ? 13.319 -13.179 60.272 1.00 36.30  ? 82   VAL A O   1 
ATOM   679  C  CB  . VAL A 1 82  ? 11.687 -10.286 60.627 1.00 38.57  ? 82   VAL A CB  1 
ATOM   680  C  CG1 . VAL A 1 82  ? 10.888 -9.358  61.519 1.00 41.41  ? 82   VAL A CG1 1 
ATOM   681  C  CG2 . VAL A 1 82  ? 13.142 -9.845  60.531 1.00 39.51  ? 82   VAL A CG2 1 
ATOM   682  N  N   . TRP A 1 83  ? 11.560 -12.693 58.941 1.00 36.18  ? 83   TRP A N   1 
ATOM   683  C  CA  . TRP A 1 83  ? 12.017 -13.478 57.809 1.00 33.27  ? 83   TRP A CA  1 
ATOM   684  C  C   . TRP A 1 83  ? 12.590 -12.571 56.758 1.00 30.35  ? 83   TRP A C   1 
ATOM   685  O  O   . TRP A 1 83  ? 11.959 -11.584 56.374 1.00 30.13  ? 83   TRP A O   1 
ATOM   686  C  CB  . TRP A 1 83  ? 10.863 -14.262 57.192 1.00 36.83  ? 83   TRP A CB  1 
ATOM   687  C  CG  . TRP A 1 83  ? 10.367 -15.371 58.051 1.00 42.33  ? 83   TRP A CG  1 
ATOM   688  C  CD1 . TRP A 1 83  ? 9.402  -15.302 59.020 1.00 43.36  ? 83   TRP A CD1 1 
ATOM   689  C  CD2 . TRP A 1 83  ? 10.851 -16.716 58.061 1.00 44.66  ? 83   TRP A CD2 1 
ATOM   690  N  NE1 . TRP A 1 83  ? 9.258  -16.525 59.630 1.00 44.95  ? 83   TRP A NE1 1 
ATOM   691  C  CE2 . TRP A 1 83  ? 10.136 -17.411 59.062 1.00 44.58  ? 83   TRP A CE2 1 
ATOM   692  C  CE3 . TRP A 1 83  ? 11.825 -17.405 57.320 1.00 45.42  ? 83   TRP A CE3 1 
ATOM   693  C  CZ2 . TRP A 1 83  ? 10.365 -18.759 59.344 1.00 45.05  ? 83   TRP A CZ2 1 
ATOM   694  C  CZ3 . TRP A 1 83  ? 12.051 -18.748 57.601 1.00 46.19  ? 83   TRP A CZ3 1 
ATOM   695  C  CH2 . TRP A 1 83  ? 11.322 -19.410 58.607 1.00 45.00  ? 83   TRP A CH2 1 
ATOM   696  N  N   . LYS A 1 84  ? 13.790 -12.911 56.302 1.00 27.05  ? 84   LYS A N   1 
ATOM   697  C  CA  . LYS A 1 84  ? 14.466 -12.159 55.256 1.00 24.21  ? 84   LYS A CA  1 
ATOM   698  C  C   . LYS A 1 84  ? 14.069 -12.798 53.952 1.00 22.10  ? 84   LYS A C   1 
ATOM   699  O  O   . LYS A 1 84  ? 14.336 -13.966 53.740 1.00 22.42  ? 84   LYS A O   1 
ATOM   700  C  CB  . LYS A 1 84  ? 15.970 -12.275 55.407 1.00 24.61  ? 84   LYS A CB  1 
ATOM   701  C  CG  . LYS A 1 84  ? 16.766 -11.413 54.458 1.00 24.24  ? 84   LYS A CG  1 
ATOM   702  C  CD  . LYS A 1 84  ? 18.245 -11.626 54.728 1.00 25.90  ? 84   LYS A CD  1 
ATOM   703  C  CE  . LYS A 1 84  ? 19.126 -10.588 54.058 1.00 24.05  ? 84   LYS A CE  1 
ATOM   704  N  NZ  . LYS A 1 84  ? 20.569 -10.892 54.291 1.00 20.94  ? 84   LYS A NZ  1 
ATOM   705  N  N   . LEU A 1 85  ? 13.428 -12.037 53.079 1.00 21.84  ? 85   LEU A N   1 
ATOM   706  C  CA  . LEU A 1 85  ? 13.004 -12.561 51.792 1.00 22.35  ? 85   LEU A CA  1 
ATOM   707  C  C   . LEU A 1 85  ? 13.920 -12.099 50.668 1.00 24.26  ? 85   LEU A C   1 
ATOM   708  O  O   . LEU A 1 85  ? 14.075 -10.899 50.450 1.00 25.93  ? 85   LEU A O   1 
ATOM   709  C  CB  . LEU A 1 85  ? 11.592 -12.097 51.481 1.00 20.94  ? 85   LEU A CB  1 
ATOM   710  C  CG  . LEU A 1 85  ? 10.579 -12.159 52.613 1.00 20.57  ? 85   LEU A CG  1 
ATOM   711  C  CD1 . LEU A 1 85  ? 9.237  -11.673 52.080 1.00 18.81  ? 85   LEU A CD1 1 
ATOM   712  C  CD2 . LEU A 1 85  ? 10.488 -13.571 53.165 1.00 20.44  ? 85   LEU A CD2 1 
ATOM   713  N  N   . TYR A 1 86  ? 14.504 -13.050 49.943 1.00 25.89  ? 86   TYR A N   1 
ATOM   714  C  CA  . TYR A 1 86  ? 15.397 -12.735 48.826 1.00 26.39  ? 86   TYR A CA  1 
ATOM   715  C  C   . TYR A 1 86  ? 14.714 -12.853 47.468 1.00 26.26  ? 86   TYR A C   1 
ATOM   716  O  O   . TYR A 1 86  ? 13.867 -13.715 47.258 1.00 26.86  ? 86   TYR A O   1 
ATOM   717  C  CB  . TYR A 1 86  ? 16.608 -13.665 48.811 1.00 26.32  ? 86   TYR A CB  1 
ATOM   718  C  CG  . TYR A 1 86  ? 17.479 -13.597 50.033 1.00 26.53  ? 86   TYR A CG  1 
ATOM   719  C  CD1 . TYR A 1 86  ? 17.273 -14.454 51.102 1.00 26.50  ? 86   TYR A CD1 1 
ATOM   720  C  CD2 . TYR A 1 86  ? 18.542 -12.703 50.100 1.00 26.06  ? 86   TYR A CD2 1 
ATOM   721  C  CE1 . TYR A 1 86  ? 18.113 -14.427 52.208 1.00 28.50  ? 86   TYR A CE1 1 
ATOM   722  C  CE2 . TYR A 1 86  ? 19.386 -12.674 51.200 1.00 26.65  ? 86   TYR A CE2 1 
ATOM   723  C  CZ  . TYR A 1 86  ? 19.168 -13.538 52.247 1.00 25.93  ? 86   TYR A CZ  1 
ATOM   724  O  OH  . TYR A 1 86  ? 20.012 -13.528 53.326 1.00 27.92  ? 86   TYR A OH  1 
ATOM   725  N  N   . PHE A 1 87  ? 15.104 -11.995 46.539 1.00 25.32  ? 87   PHE A N   1 
ATOM   726  C  CA  . PHE A 1 87  ? 14.532 -12.041 45.215 1.00 25.48  ? 87   PHE A CA  1 
ATOM   727  C  C   . PHE A 1 87  ? 15.650 -12.092 44.181 1.00 27.77  ? 87   PHE A C   1 
ATOM   728  O  O   . PHE A 1 87  ? 16.824 -12.077 44.538 1.00 29.25  ? 87   PHE A O   1 
ATOM   729  C  CB  . PHE A 1 87  ? 13.633 -10.833 44.990 1.00 23.04  ? 87   PHE A CB  1 
ATOM   730  C  CG  . PHE A 1 87  ? 12.458 -10.778 45.920 1.00 22.71  ? 87   PHE A CG  1 
ATOM   731  C  CD1 . PHE A 1 87  ? 12.603 -10.301 47.229 1.00 23.54  ? 87   PHE A CD1 1 
ATOM   732  C  CD2 . PHE A 1 87  ? 11.195 -11.176 45.488 1.00 20.50  ? 87   PHE A CD2 1 
ATOM   733  C  CE1 . PHE A 1 87  ? 11.499 -10.216 48.091 1.00 20.78  ? 87   PHE A CE1 1 
ATOM   734  C  CE2 . PHE A 1 87  ? 10.089 -11.096 46.334 1.00 19.07  ? 87   PHE A CE2 1 
ATOM   735  C  CZ  . PHE A 1 87  ? 10.241 -10.613 47.642 1.00 20.06  ? 87   PHE A CZ  1 
ATOM   736  N  N   . THR A 1 88  ? 15.285 -12.164 42.904 1.00 28.30  ? 88   THR A N   1 
ATOM   737  C  CA  . THR A 1 88  ? 16.271 -12.236 41.841 1.00 28.20  ? 88   THR A CA  1 
ATOM   738  C  C   . THR A 1 88  ? 16.659 -10.883 41.273 1.00 28.41  ? 88   THR A C   1 
ATOM   739  O  O   . THR A 1 88  ? 17.824 -10.660 40.945 1.00 27.54  ? 88   THR A O   1 
ATOM   740  C  CB  . THR A 1 88  ? 15.760 -13.059 40.688 1.00 29.93  ? 88   THR A CB  1 
ATOM   741  O  OG1 . THR A 1 88  ? 15.254 -14.301 41.182 1.00 32.73  ? 88   THR A OG1 1 
ATOM   742  C  CG2 . THR A 1 88  ? 16.878 -13.317 39.709 1.00 30.28  ? 88   THR A CG2 1 
ATOM   743  N  N   . HIS A 1 89  ? 15.683 -9.986  41.151 1.00 26.31  ? 89   HIS A N   1 
ATOM   744  C  CA  . HIS A 1 89  ? 15.949 -8.671  40.588 1.00 25.90  ? 89   HIS A CA  1 
ATOM   745  C  C   . HIS A 1 89  ? 15.362 -7.523  41.393 1.00 26.60  ? 89   HIS A C   1 
ATOM   746  O  O   . HIS A 1 89  ? 14.203 -7.553  41.779 1.00 27.33  ? 89   HIS A O   1 
ATOM   747  C  CB  . HIS A 1 89  ? 15.420 -8.619  39.156 1.00 22.79  ? 89   HIS A CB  1 
ATOM   748  C  CG  . HIS A 1 89  ? 15.872 -7.424  38.379 1.00 18.51  ? 89   HIS A CG  1 
ATOM   749  N  ND1 . HIS A 1 89  ? 15.481 -6.143  38.691 1.00 19.37  ? 89   HIS A ND1 1 
ATOM   750  C  CD2 . HIS A 1 89  ? 16.637 -7.324  37.266 1.00 20.09  ? 89   HIS A CD2 1 
ATOM   751  C  CE1 . HIS A 1 89  ? 15.977 -5.304  37.798 1.00 20.15  ? 89   HIS A CE1 1 
ATOM   752  N  NE2 . HIS A 1 89  ? 16.682 -5.995  36.921 1.00 19.05  ? 89   HIS A NE2 1 
ATOM   753  N  N   . PRO A 1 90  ? 16.160 -6.477  41.631 1.00 27.42  ? 90   PRO A N   1 
ATOM   754  C  CA  . PRO A 1 90  ? 15.743 -5.298  42.392 1.00 28.96  ? 90   PRO A CA  1 
ATOM   755  C  C   . PRO A 1 90  ? 14.364 -4.756  42.025 1.00 29.24  ? 90   PRO A C   1 
ATOM   756  O  O   . PRO A 1 90  ? 13.648 -4.224  42.881 1.00 28.87  ? 90   PRO A O   1 
ATOM   757  C  CB  . PRO A 1 90  ? 16.854 -4.293  42.100 1.00 28.16  ? 90   PRO A CB  1 
ATOM   758  C  CG  . PRO A 1 90  ? 18.034 -5.160  41.979 1.00 28.77  ? 90   PRO A CG  1 
ATOM   759  C  CD  . PRO A 1 90  ? 17.536 -6.308  41.138 1.00 27.98  ? 90   PRO A CD  1 
ATOM   760  N  N   . GLN A 1 91  ? 14.000 -4.875  40.755 1.00 29.13  ? 91   GLN A N   1 
ATOM   761  C  CA  . GLN A 1 91  ? 12.715 -4.375  40.323 1.00 31.14  ? 91   GLN A CA  1 
ATOM   762  C  C   . GLN A 1 91  ? 11.632 -5.388  40.638 1.00 31.81  ? 91   GLN A C   1 
ATOM   763  O  O   . GLN A 1 91  ? 10.466 -5.194  40.302 1.00 33.32  ? 91   GLN A O   1 
ATOM   764  C  CB  . GLN A 1 91  ? 12.744 -4.027  38.837 1.00 33.78  ? 91   GLN A CB  1 
ATOM   765  C  CG  . GLN A 1 91  ? 13.628 -2.828  38.529 1.00 40.24  ? 91   GLN A CG  1 
ATOM   766  C  CD  . GLN A 1 91  ? 13.594 -2.412  37.062 1.00 45.21  ? 91   GLN A CD  1 
ATOM   767  O  OE1 . GLN A 1 91  ? 13.769 -3.238  36.157 1.00 46.03  ? 91   GLN A OE1 1 
ATOM   768  N  NE2 . GLN A 1 91  ? 13.380 -1.118  36.822 1.00 48.50  ? 91   GLN A NE2 1 
ATOM   769  N  N   . ASP A 1 92  ? 12.025 -6.474  41.294 1.00 30.38  ? 92   ASP A N   1 
ATOM   770  C  CA  . ASP A 1 92  ? 11.071 -7.492  41.693 1.00 28.52  ? 92   ASP A CA  1 
ATOM   771  C  C   . ASP A 1 92  ? 10.406 -6.953  42.946 1.00 28.79  ? 92   ASP A C   1 
ATOM   772  O  O   . ASP A 1 92  ? 9.174  -6.866  43.033 1.00 29.48  ? 92   ASP A O   1 
ATOM   773  C  CB  . ASP A 1 92  ? 11.782 -8.803  42.035 1.00 27.02  ? 92   ASP A CB  1 
ATOM   774  C  CG  . ASP A 1 92  ? 12.091 -9.640  40.818 1.00 24.74  ? 92   ASP A CG  1 
ATOM   775  O  OD1 . ASP A 1 92  ? 11.916 -9.145  39.692 1.00 20.79  ? 92   ASP A OD1 1 
ATOM   776  O  OD2 . ASP A 1 92  ? 12.511 -10.800 40.997 1.00 26.91  ? 92   ASP A OD2 1 
ATOM   777  N  N   . VAL A 1 93  ? 11.253 -6.577  43.905 1.00 26.69  ? 93   VAL A N   1 
ATOM   778  C  CA  . VAL A 1 93  ? 10.818 -6.055  45.193 1.00 25.38  ? 93   VAL A CA  1 
ATOM   779  C  C   . VAL A 1 93  ? 9.657  -5.074  45.134 1.00 25.84  ? 93   VAL A C   1 
ATOM   780  O  O   . VAL A 1 93  ? 8.627  -5.295  45.764 1.00 27.65  ? 93   VAL A O   1 
ATOM   781  C  CB  . VAL A 1 93  ? 11.959 -5.344  45.945 1.00 24.56  ? 93   VAL A CB  1 
ATOM   782  C  CG1 . VAL A 1 93  ? 11.480 -4.949  47.314 1.00 25.53  ? 93   VAL A CG1 1 
ATOM   783  C  CG2 . VAL A 1 93  ? 13.176 -6.225  46.040 1.00 26.01  ? 93   VAL A CG2 1 
ATOM   784  N  N   . PRO A 1 94  ? 9.807  -3.973  44.380 1.00 24.71  ? 94   PRO A N   1 
ATOM   785  C  CA  . PRO A 1 94  ? 8.748  -2.967  44.272 1.00 26.84  ? 94   PRO A CA  1 
ATOM   786  C  C   . PRO A 1 94  ? 7.443  -3.445  43.641 1.00 30.45  ? 94   PRO A C   1 
ATOM   787  O  O   . PRO A 1 94  ? 6.426  -2.759  43.732 1.00 32.43  ? 94   PRO A O   1 
ATOM   788  C  CB  . PRO A 1 94  ? 9.397  -1.867  43.435 1.00 23.62  ? 94   PRO A CB  1 
ATOM   789  C  CG  . PRO A 1 94  ? 10.854 -2.071  43.643 1.00 24.04  ? 94   PRO A CG  1 
ATOM   790  C  CD  . PRO A 1 94  ? 10.982 -3.554  43.604 1.00 24.33  ? 94   PRO A CD  1 
ATOM   791  N  N   . ALA A 1 95  ? 7.474  -4.618  43.014 1.00 31.87  ? 95   ALA A N   1 
ATOM   792  C  CA  . ALA A 1 95  ? 6.308  -5.152  42.326 1.00 32.07  ? 95   ALA A CA  1 
ATOM   793  C  C   . ALA A 1 95  ? 5.572  -6.174  43.151 1.00 33.41  ? 95   ALA A C   1 
ATOM   794  O  O   . ALA A 1 95  ? 4.442  -6.553  42.826 1.00 33.73  ? 95   ALA A O   1 
ATOM   795  C  CB  . ALA A 1 95  ? 6.736  -5.782  41.003 1.00 31.30  ? 95   ALA A CB  1 
ATOM   796  N  N   . ILE A 1 96  ? 6.213  -6.615  44.224 1.00 34.29  ? 96   ILE A N   1 
ATOM   797  C  CA  . ILE A 1 96  ? 5.631  -7.633  45.082 1.00 34.65  ? 96   ILE A CA  1 
ATOM   798  C  C   . ILE A 1 96  ? 5.600  -7.198  46.557 1.00 37.17  ? 96   ILE A C   1 
ATOM   799  O  O   . ILE A 1 96  ? 4.945  -7.841  47.376 1.00 40.12  ? 96   ILE A O   1 
ATOM   800  C  CB  . ILE A 1 96  ? 6.425  -8.967  44.883 1.00 31.15  ? 96   ILE A CB  1 
ATOM   801  C  CG1 . ILE A 1 96  ? 5.708  -10.149 45.520 1.00 27.82  ? 96   ILE A CG1 1 
ATOM   802  C  CG2 . ILE A 1 96  ? 7.818  -8.828  45.440 1.00 32.14  ? 96   ILE A CG2 1 
ATOM   803  C  CD1 . ILE A 1 96  ? 6.438  -11.484 45.280 1.00 25.33  ? 96   ILE A CD1 1 
ATOM   804  N  N   . ARG A 1 97  ? 6.283  -6.100  46.893 1.00 38.14  ? 97   ARG A N   1 
ATOM   805  C  CA  . ARG A 1 97  ? 6.310  -5.610  48.279 1.00 38.42  ? 97   ARG A CA  1 
ATOM   806  C  C   . ARG A 1 97  ? 4.897  -5.541  48.884 1.00 38.87  ? 97   ARG A C   1 
ATOM   807  O  O   . ARG A 1 97  ? 4.593  -6.239  49.853 1.00 37.34  ? 97   ARG A O   1 
ATOM   808  C  CB  . ARG A 1 97  ? 6.992  -4.220  48.369 1.00 37.67  ? 97   ARG A CB  1 
ATOM   809  C  CG  . ARG A 1 97  ? 6.304  -3.112  47.568 1.00 37.66  ? 97   ARG A CG  1 
ATOM   810  C  CD  . ARG A 1 97  ? 6.800  -1.700  47.896 1.00 35.60  ? 97   ARG A CD  1 
ATOM   811  N  NE  . ARG A 1 97  ? 8.196  -1.485  47.533 1.00 36.54  ? 97   ARG A NE  1 
ATOM   812  C  CZ  . ARG A 1 97  ? 8.674  -0.351  47.024 1.00 37.86  ? 97   ARG A CZ  1 
ATOM   813  N  NH1 . ARG A 1 97  ? 7.863  0.679   46.809 1.00 36.19  ? 97   ARG A NH1 1 
ATOM   814  N  NH2 . ARG A 1 97  ? 9.970  -0.241  46.729 1.00 38.44  ? 97   ARG A NH2 1 
ATOM   815  N  N   . ASP A 1 98  ? 4.036  -4.711  48.301 1.00 39.84  ? 98   ASP A N   1 
ATOM   816  C  CA  . ASP A 1 98  ? 2.673  -4.559  48.793 1.00 41.50  ? 98   ASP A CA  1 
ATOM   817  C  C   . ASP A 1 98  ? 1.887  -5.857  48.804 1.00 42.16  ? 98   ASP A C   1 
ATOM   818  O  O   . ASP A 1 98  ? 1.067  -6.072  49.684 1.00 42.87  ? 98   ASP A O   1 
ATOM   819  C  CB  . ASP A 1 98  ? 1.911  -3.529  47.966 1.00 41.42  ? 98   ASP A CB  1 
ATOM   820  C  CG  . ASP A 1 98  ? 2.424  -2.133  48.174 1.00 42.13  ? 98   ASP A CG  1 
ATOM   821  O  OD1 . ASP A 1 98  ? 2.412  -1.657  49.330 1.00 42.92  ? 98   ASP A OD1 1 
ATOM   822  O  OD2 . ASP A 1 98  ? 2.843  -1.512  47.179 1.00 43.43  ? 98   ASP A OD2 1 
ATOM   823  N  N   . LYS A 1 99  ? 2.116  -6.722  47.827 1.00 43.39  ? 99   LYS A N   1 
ATOM   824  C  CA  . LYS A 1 99  ? 1.382  -7.975  47.809 1.00 44.74  ? 99   LYS A CA  1 
ATOM   825  C  C   . LYS A 1 99  ? 1.712  -8.780  49.050 1.00 44.57  ? 99   LYS A C   1 
ATOM   826  O  O   . LYS A 1 99  ? 0.817  -9.366  49.666 1.00 47.37  ? 99   LYS A O   1 
ATOM   827  C  CB  . LYS A 1 99  ? 1.689  -8.797  46.548 1.00 46.32  ? 99   LYS A CB  1 
ATOM   828  C  CG  . LYS A 1 99  ? 0.536  -8.794  45.543 1.00 46.59  ? 99   LYS A CG  1 
ATOM   829  C  CD  . LYS A 1 99  ? 0.607  -9.961  44.580 1.00 47.20  ? 99   LYS A CD  1 
ATOM   830  C  CE  . LYS A 1 99  ? -0.549 -9.913  43.606 1.00 47.25  ? 99   LYS A CE  1 
ATOM   831  N  NZ  . LYS A 1 99  ? -0.534 -8.640  42.827 1.00 48.07  ? 99   LYS A NZ  1 
ATOM   832  N  N   . ILE A 1 100 ? 2.989  -8.801  49.425 1.00 41.95  ? 100  ILE A N   1 
ATOM   833  C  CA  . ILE A 1 100 ? 3.407  -9.533  50.611 1.00 39.10  ? 100  ILE A CA  1 
ATOM   834  C  C   . ILE A 1 100 ? 2.934  -8.839  51.883 1.00 38.36  ? 100  ILE A C   1 
ATOM   835  O  O   . ILE A 1 100 ? 2.479  -9.492  52.811 1.00 35.62  ? 100  ILE A O   1 
ATOM   836  C  CB  . ILE A 1 100 ? 4.930  -9.706  50.647 1.00 37.46  ? 100  ILE A CB  1 
ATOM   837  C  CG1 . ILE A 1 100 ? 5.355  -10.587 49.475 1.00 37.09  ? 100  ILE A CG1 1 
ATOM   838  C  CG2 . ILE A 1 100 ? 5.361  -10.329 51.953 1.00 34.54  ? 100  ILE A CG2 1 
ATOM   839  C  CD1 . ILE A 1 100 ? 6.757  -11.150 49.588 1.00 37.82  ? 100  ILE A CD1 1 
ATOM   840  N  N   . ARG A 1 101 ? 3.028  -7.516  51.926 1.00 40.34  ? 101  ARG A N   1 
ATOM   841  C  CA  . ARG A 1 101 ? 2.576  -6.801  53.109 1.00 44.21  ? 101  ARG A CA  1 
ATOM   842  C  C   . ARG A 1 101 ? 1.073  -6.957  53.293 1.00 45.53  ? 101  ARG A C   1 
ATOM   843  O  O   . ARG A 1 101 ? 0.583  -6.879  54.418 1.00 47.88  ? 101  ARG A O   1 
ATOM   844  C  CB  . ARG A 1 101 ? 2.899  -5.302  53.036 1.00 45.59  ? 101  ARG A CB  1 
ATOM   845  C  CG  . ARG A 1 101 ? 2.264  -4.514  54.187 1.00 47.68  ? 101  ARG A CG  1 
ATOM   846  C  CD  . ARG A 1 101 ? 2.430  -3.010  54.051 1.00 51.62  ? 101  ARG A CD  1 
ATOM   847  N  NE  . ARG A 1 101 ? 3.718  -2.524  54.548 1.00 55.76  ? 101  ARG A NE  1 
ATOM   848  C  CZ  . ARG A 1 101 ? 3.855  -1.596  55.495 1.00 56.53  ? 101  ARG A CZ  1 
ATOM   849  N  NH1 . ARG A 1 101 ? 2.780  -1.051  56.056 1.00 57.93  ? 101  ARG A NH1 1 
ATOM   850  N  NH2 . ARG A 1 101 ? 5.064  -1.204  55.878 1.00 54.98  ? 101  ARG A NH2 1 
ATOM   851  N  N   . GLU A 1 102 ? 0.350  -7.177  52.194 1.00 45.48  ? 102  GLU A N   1 
ATOM   852  C  CA  . GLU A 1 102 ? -1.106 -7.323  52.227 1.00 44.92  ? 102  GLU A CA  1 
ATOM   853  C  C   . GLU A 1 102 ? -1.607 -8.689  52.673 1.00 44.87  ? 102  GLU A C   1 
ATOM   854  O  O   . GLU A 1 102 ? -2.797 -8.884  52.930 1.00 44.53  ? 102  GLU A O   1 
ATOM   855  C  CB  . GLU A 1 102 ? -1.689 -6.976  50.863 1.00 46.11  ? 102  GLU A CB  1 
ATOM   856  C  CG  . GLU A 1 102 ? -1.814 -5.478  50.646 1.00 50.35  ? 102  GLU A CG  1 
ATOM   857  C  CD  . GLU A 1 102 ? -2.396 -5.116  49.293 1.00 52.58  ? 102  GLU A CD  1 
ATOM   858  O  OE1 . GLU A 1 102 ? -3.251 -5.883  48.793 1.00 55.65  ? 102  GLU A OE1 1 
ATOM   859  O  OE2 . GLU A 1 102 ? -2.011 -4.059  48.743 1.00 52.31  ? 102  GLU A OE2 1 
ATOM   860  N  N   . HIS A 1 103 ? -0.687 -9.634  52.770 1.00 45.00  ? 103  HIS A N   1 
ATOM   861  C  CA  . HIS A 1 103 ? -1.021 -10.978 53.202 1.00 44.98  ? 103  HIS A CA  1 
ATOM   862  C  C   . HIS A 1 103 ? -1.449 -10.952 54.674 1.00 44.93  ? 103  HIS A C   1 
ATOM   863  O  O   . HIS A 1 103 ? -1.116 -10.017 55.412 1.00 44.73  ? 103  HIS A O   1 
ATOM   864  C  CB  . HIS A 1 103 ? 0.203  -11.869 53.038 1.00 45.60  ? 103  HIS A CB  1 
ATOM   865  C  CG  . HIS A 1 103 ? -0.031 -13.287 53.434 1.00 46.21  ? 103  HIS A CG  1 
ATOM   866  N  ND1 . HIS A 1 103 ? -0.528 -14.230 52.562 1.00 46.94  ? 103  HIS A ND1 1 
ATOM   867  C  CD2 . HIS A 1 103 ? 0.137  -13.919 54.617 1.00 45.74  ? 103  HIS A CD2 1 
ATOM   868  C  CE1 . HIS A 1 103 ? -0.654 -15.384 53.192 1.00 47.61  ? 103  HIS A CE1 1 
ATOM   869  N  NE2 . HIS A 1 103 ? -0.257 -15.222 54.441 1.00 46.31  ? 103  HIS A NE2 1 
ATOM   870  N  N   . PRO A 1 104 ? -2.218 -11.964 55.112 1.00 44.74  ? 104  PRO A N   1 
ATOM   871  C  CA  . PRO A 1 104 ? -2.685 -12.047 56.508 1.00 43.66  ? 104  PRO A CA  1 
ATOM   872  C  C   . PRO A 1 104 ? -1.624 -12.457 57.540 1.00 41.04  ? 104  PRO A C   1 
ATOM   873  O  O   . PRO A 1 104 ? -1.612 -11.964 58.660 1.00 38.57  ? 104  PRO A O   1 
ATOM   874  C  CB  . PRO A 1 104 ? -3.848 -13.042 56.431 1.00 44.44  ? 104  PRO A CB  1 
ATOM   875  C  CG  . PRO A 1 104 ? -3.523 -13.869 55.211 1.00 46.09  ? 104  PRO A CG  1 
ATOM   876  C  CD  . PRO A 1 104 ? -3.022 -12.841 54.241 1.00 44.42  ? 104  PRO A CD  1 
ATOM   877  N  N   . ALA A 1 105 ? -0.734 -13.356 57.157 1.00 40.65  ? 105  ALA A N   1 
ATOM   878  C  CA  . ALA A 1 105 ? 0.322  -13.804 58.052 1.00 41.74  ? 105  ALA A CA  1 
ATOM   879  C  C   . ALA A 1 105 ? 1.458  -12.782 58.149 1.00 43.28  ? 105  ALA A C   1 
ATOM   880  O  O   . ALA A 1 105 ? 2.526  -13.065 58.704 1.00 43.76  ? 105  ALA A O   1 
ATOM   881  C  CB  . ALA A 1 105 ? 0.863  -15.115 57.575 1.00 40.95  ? 105  ALA A CB  1 
ATOM   882  N  N   . VAL A 1 106 ? 1.219  -11.593 57.605 1.00 42.99  ? 106  VAL A N   1 
ATOM   883  C  CA  . VAL A 1 106 ? 2.208  -10.524 57.617 1.00 39.94  ? 106  VAL A CA  1 
ATOM   884  C  C   . VAL A 1 106 ? 1.703  -9.305  58.385 1.00 39.94  ? 106  VAL A C   1 
ATOM   885  O  O   . VAL A 1 106 ? 0.659  -8.732  58.056 1.00 41.42  ? 106  VAL A O   1 
ATOM   886  C  CB  . VAL A 1 106 ? 2.562  -10.096 56.183 1.00 38.39  ? 106  VAL A CB  1 
ATOM   887  C  CG1 . VAL A 1 106 ? 3.494  -8.900  56.215 1.00 38.06  ? 106  VAL A CG1 1 
ATOM   888  C  CG2 . VAL A 1 106 ? 3.190  -11.258 55.441 1.00 36.70  ? 106  VAL A CG2 1 
ATOM   889  N  N   . ILE A 1 107 ? 2.456  -8.918  59.411 1.00 37.98  ? 107  ILE A N   1 
ATOM   890  C  CA  . ILE A 1 107 ? 2.128  -7.769  60.253 1.00 33.87  ? 107  ILE A CA  1 
ATOM   891  C  C   . ILE A 1 107 ? 2.743  -6.510  59.649 1.00 32.58  ? 107  ILE A C   1 
ATOM   892  O  O   . ILE A 1 107 ? 2.161  -5.430  59.701 1.00 31.68  ? 107  ILE A O   1 
ATOM   893  C  CB  . ILE A 1 107 ? 2.701  -7.964  61.679 1.00 31.98  ? 107  ILE A CB  1 
ATOM   894  C  CG1 . ILE A 1 107 ? 2.050  -9.176  62.338 1.00 28.08  ? 107  ILE A CG1 1 
ATOM   895  C  CG2 . ILE A 1 107 ? 2.510  -6.699  62.504 1.00 32.26  ? 107  ILE A CG2 1 
ATOM   896  C  CD1 . ILE A 1 107 ? 2.693  -9.565  63.606 1.00 25.40  ? 107  ILE A CD1 1 
ATOM   897  N  N   . ASP A 1 108 ? 3.930  -6.673  59.079 1.00 31.19  ? 108  ASP A N   1 
ATOM   898  C  CA  . ASP A 1 108 ? 4.647  -5.570  58.478 1.00 30.85  ? 108  ASP A CA  1 
ATOM   899  C  C   . ASP A 1 108 ? 5.899  -6.070  57.761 1.00 29.88  ? 108  ASP A C   1 
ATOM   900  O  O   . ASP A 1 108 ? 6.367  -7.175  58.015 1.00 30.45  ? 108  ASP A O   1 
ATOM   901  C  CB  . ASP A 1 108 ? 5.049  -4.570  59.557 1.00 32.68  ? 108  ASP A CB  1 
ATOM   902  C  CG  . ASP A 1 108 ? 4.618  -3.159  59.225 1.00 36.13  ? 108  ASP A CG  1 
ATOM   903  O  OD1 . ASP A 1 108 ? 4.549  -2.842  58.008 1.00 34.43  ? 108  ASP A OD1 1 
ATOM   904  O  OD2 . ASP A 1 108 ? 4.360  -2.374  60.175 1.00 36.59  ? 108  ASP A OD2 1 
ATOM   905  N  N   . ILE A 1 109 ? 6.431  -5.248  56.861 1.00 27.74  ? 109  ILE A N   1 
ATOM   906  C  CA  . ILE A 1 109 ? 7.635  -5.585  56.112 1.00 24.84  ? 109  ILE A CA  1 
ATOM   907  C  C   . ILE A 1 109 ? 8.647  -4.445  56.314 1.00 25.82  ? 109  ILE A C   1 
ATOM   908  O  O   . ILE A 1 109 ? 8.263  -3.329  56.674 1.00 25.13  ? 109  ILE A O   1 
ATOM   909  C  CB  . ILE A 1 109 ? 7.305  -5.774  54.620 1.00 21.82  ? 109  ILE A CB  1 
ATOM   910  C  CG1 . ILE A 1 109 ? 6.786  -4.473  54.022 1.00 21.07  ? 109  ILE A CG1 1 
ATOM   911  C  CG2 . ILE A 1 109 ? 6.229  -6.808  54.465 1.00 16.05  ? 109  ILE A CG2 1 
ATOM   912  C  CD1 . ILE A 1 109 ? 6.765  -4.479  52.513 1.00 21.19  ? 109  ILE A CD1 1 
ATOM   913  N  N   . TYR A 1 110 ? 9.934  -4.702  56.104 1.00 26.06  ? 110  TYR A N   1 
ATOM   914  C  CA  . TYR A 1 110 ? 10.908 -3.640  56.334 1.00 27.18  ? 110  TYR A CA  1 
ATOM   915  C  C   . TYR A 1 110 ? 12.084 -3.591  55.383 1.00 27.83  ? 110  TYR A C   1 
ATOM   916  O  O   . TYR A 1 110 ? 12.500 -4.611  54.835 1.00 28.45  ? 110  TYR A O   1 
ATOM   917  C  CB  . TYR A 1 110 ? 11.477 -3.739  57.739 1.00 28.02  ? 110  TYR A CB  1 
ATOM   918  C  CG  . TYR A 1 110 ? 10.473 -4.029  58.815 1.00 28.13  ? 110  TYR A CG  1 
ATOM   919  C  CD1 . TYR A 1 110 ? 10.086 -5.332  59.101 1.00 28.27  ? 110  TYR A CD1 1 
ATOM   920  C  CD2 . TYR A 1 110 ? 9.948  -3.001  59.588 1.00 29.18  ? 110  TYR A CD2 1 
ATOM   921  C  CE1 . TYR A 1 110 ? 9.204  -5.604  60.146 1.00 30.04  ? 110  TYR A CE1 1 
ATOM   922  C  CE2 . TYR A 1 110 ? 9.069  -3.261  60.633 1.00 29.35  ? 110  TYR A CE2 1 
ATOM   923  C  CZ  . TYR A 1 110 ? 8.706  -4.559  60.911 1.00 29.28  ? 110  TYR A CZ  1 
ATOM   924  O  OH  . TYR A 1 110 ? 7.889  -4.807  61.984 1.00 28.34  ? 110  TYR A OH  1 
ATOM   925  N  N   . GLU A 1 111 ? 12.647 -2.395  55.229 1.00 26.39  ? 111  GLU A N   1 
ATOM   926  C  CA  . GLU A 1 111 ? 13.790 -2.215  54.352 1.00 23.65  ? 111  GLU A CA  1 
ATOM   927  C  C   . GLU A 1 111 ? 13.465 -2.822  53.007 1.00 22.81  ? 111  GLU A C   1 
ATOM   928  O  O   . GLU A 1 111 ? 14.062 -3.805  52.606 1.00 25.19  ? 111  GLU A O   1 
ATOM   929  C  CB  . GLU A 1 111 ? 15.009 -2.892  54.972 1.00 21.81  ? 111  GLU A CB  1 
ATOM   930  C  CG  . GLU A 1 111 ? 15.470 -2.183  56.245 1.00 22.12  ? 111  GLU A CG  1 
ATOM   931  C  CD  . GLU A 1 111 ? 16.653 -2.853  56.910 1.00 20.59  ? 111  GLU A CD  1 
ATOM   932  O  OE1 . GLU A 1 111 ? 17.409 -3.547  56.203 1.00 19.10  ? 111  GLU A OE1 1 
ATOM   933  O  OE2 . GLU A 1 111 ? 16.829 -2.671  58.135 1.00 18.09  ? 111  GLU A OE2 1 
ATOM   934  N  N   . TYR A 1 112 ? 12.508 -2.224  52.314 1.00 21.40  ? 112  TYR A N   1 
ATOM   935  C  CA  . TYR A 1 112 ? 12.059 -2.718  51.015 1.00 19.56  ? 112  TYR A CA  1 
ATOM   936  C  C   . TYR A 1 112 ? 12.109 -1.601  49.978 1.00 20.43  ? 112  TYR A C   1 
ATOM   937  O  O   . TYR A 1 112 ? 11.744 -1.807  48.816 1.00 20.76  ? 112  TYR A O   1 
ATOM   938  C  CB  . TYR A 1 112 ? 10.622 -3.190  51.155 1.00 17.76  ? 112  TYR A CB  1 
ATOM   939  C  CG  . TYR A 1 112 ? 9.784  -2.124  51.825 1.00 18.05  ? 112  TYR A CG  1 
ATOM   940  C  CD1 . TYR A 1 112 ? 9.429  -0.960  51.141 1.00 17.01  ? 112  TYR A CD1 1 
ATOM   941  C  CD2 . TYR A 1 112 ? 9.434  -2.225  53.169 1.00 18.16  ? 112  TYR A CD2 1 
ATOM   942  C  CE1 . TYR A 1 112 ? 8.756  0.074   51.773 1.00 16.03  ? 112  TYR A CE1 1 
ATOM   943  C  CE2 . TYR A 1 112 ? 8.758  -1.191  53.813 1.00 16.75  ? 112  TYR A CE2 1 
ATOM   944  C  CZ  . TYR A 1 112 ? 8.423  -0.044  53.106 1.00 17.13  ? 112  TYR A CZ  1 
ATOM   945  O  OH  . TYR A 1 112 ? 7.760  0.992   53.731 1.00 18.69  ? 112  TYR A OH  1 
ATOM   946  N  N   . ASP A 1 113 ? 12.534 -0.414  50.405 1.00 19.92  ? 113  ASP A N   1 
ATOM   947  C  CA  . ASP A 1 113 ? 12.597 0.722   49.503 1.00 19.46  ? 113  ASP A CA  1 
ATOM   948  C  C   . ASP A 1 113 ? 13.961 1.388   49.512 1.00 19.56  ? 113  ASP A C   1 
ATOM   949  O  O   . ASP A 1 113 ? 14.071 2.618   49.485 1.00 18.45  ? 113  ASP A O   1 
ATOM   950  C  CB  . ASP A 1 113 ? 11.524 1.736   49.875 1.00 20.45  ? 113  ASP A CB  1 
ATOM   951  C  CG  . ASP A 1 113 ? 11.864 2.496   51.126 1.00 21.61  ? 113  ASP A CG  1 
ATOM   952  O  OD1 . ASP A 1 113 ? 12.411 1.863   52.042 1.00 22.43  ? 113  ASP A OD1 1 
ATOM   953  O  OD2 . ASP A 1 113 ? 11.578 3.712   51.197 1.00 23.12  ? 113  ASP A OD2 1 
ATOM   954  N  N   . ILE A 1 114 ? 15.005 0.570   49.540 1.00 19.01  ? 114  ILE A N   1 
ATOM   955  C  CA  . ILE A 1 114 ? 16.356 1.098   49.538 1.00 18.39  ? 114  ILE A CA  1 
ATOM   956  C  C   . ILE A 1 114 ? 17.052 0.783   48.228 1.00 18.29  ? 114  ILE A C   1 
ATOM   957  O  O   . ILE A 1 114 ? 17.182 -0.375  47.851 1.00 21.34  ? 114  ILE A O   1 
ATOM   958  C  CB  . ILE A 1 114 ? 17.130 0.543   50.735 1.00 21.30  ? 114  ILE A CB  1 
ATOM   959  C  CG1 . ILE A 1 114 ? 16.545 1.186   52.008 1.00 22.43  ? 114  ILE A CG1 1 
ATOM   960  C  CG2 . ILE A 1 114 ? 18.627 0.827   50.590 1.00 19.23  ? 114  ILE A CG2 1 
ATOM   961  C  CD1 . ILE A 1 114 ? 16.853 0.490   53.299 1.00 19.26  ? 114  ILE A CD1 1 
ATOM   962  N  N   . PRO A 1 115 ? 17.491 1.824   47.501 1.00 17.24  ? 115  PRO A N   1 
ATOM   963  C  CA  . PRO A 1 115 ? 18.174 1.660   46.218 1.00 14.74  ? 115  PRO A CA  1 
ATOM   964  C  C   . PRO A 1 115 ? 19.200 0.525   46.259 1.00 16.85  ? 115  PRO A C   1 
ATOM   965  O  O   . PRO A 1 115 ? 20.256 0.649   46.887 1.00 15.04  ? 115  PRO A O   1 
ATOM   966  C  CB  . PRO A 1 115 ? 18.836 3.015   46.011 1.00 13.73  ? 115  PRO A CB  1 
ATOM   967  C  CG  . PRO A 1 115 ? 17.944 3.948   46.708 1.00 11.34  ? 115  PRO A CG  1 
ATOM   968  C  CD  . PRO A 1 115 ? 17.616 3.215   47.970 1.00 15.37  ? 115  PRO A CD  1 
ATOM   969  N  N   . PHE A 1 116 ? 18.859 -0.580  45.605 1.00 17.58  ? 116  PHE A N   1 
ATOM   970  C  CA  . PHE A 1 116 ? 19.714 -1.758  45.525 1.00 19.05  ? 116  PHE A CA  1 
ATOM   971  C  C   . PHE A 1 116 ? 21.185 -1.368  45.573 1.00 20.73  ? 116  PHE A C   1 
ATOM   972  O  O   . PHE A 1 116 ? 21.955 -1.898  46.367 1.00 19.95  ? 116  PHE A O   1 
ATOM   973  C  CB  . PHE A 1 116 ? 19.425 -2.508  44.219 1.00 18.65  ? 116  PHE A CB  1 
ATOM   974  C  CG  . PHE A 1 116 ? 20.258 -3.750  44.019 1.00 16.50  ? 116  PHE A CG  1 
ATOM   975  C  CD1 . PHE A 1 116 ? 20.079 -4.866  44.833 1.00 15.70  ? 116  PHE A CD1 1 
ATOM   976  C  CD2 . PHE A 1 116 ? 21.203 -3.813  42.991 1.00 14.02  ? 116  PHE A CD2 1 
ATOM   977  C  CE1 . PHE A 1 116 ? 20.830 -6.035  44.621 1.00 15.09  ? 116  PHE A CE1 1 
ATOM   978  C  CE2 . PHE A 1 116 ? 21.952 -4.965  42.774 1.00 11.44  ? 116  PHE A CE2 1 
ATOM   979  C  CZ  . PHE A 1 116 ? 21.766 -6.080  43.588 1.00 12.81  ? 116  PHE A CZ  1 
ATOM   980  N  N   . ALA A 1 117 ? 21.567 -0.429  44.716 1.00 23.90  ? 117  ALA A N   1 
ATOM   981  C  CA  . ALA A 1 117 ? 22.953 0.036   44.648 1.00 25.56  ? 117  ALA A CA  1 
ATOM   982  C  C   . ALA A 1 117 ? 23.460 0.475   46.024 1.00 25.67  ? 117  ALA A C   1 
ATOM   983  O  O   . ALA A 1 117 ? 24.503 0.010   46.480 1.00 28.04  ? 117  ALA A O   1 
ATOM   984  C  CB  . ALA A 1 117 ? 23.070 1.179   43.643 1.00 26.02  ? 117  ALA A CB  1 
ATOM   985  N  N   . LYS A 1 118 ? 22.723 1.368   46.679 1.00 24.07  ? 118  LYS A N   1 
ATOM   986  C  CA  . LYS A 1 118 ? 23.092 1.838   48.005 1.00 20.50  ? 118  LYS A CA  1 
ATOM   987  C  C   . LYS A 1 118 ? 23.144 0.666   48.979 1.00 19.38  ? 118  LYS A C   1 
ATOM   988  O  O   . LYS A 1 118 ? 24.055 0.581   49.786 1.00 19.08  ? 118  LYS A O   1 
ATOM   989  C  CB  . LYS A 1 118 ? 22.072 2.850   48.520 1.00 21.25  ? 118  LYS A CB  1 
ATOM   990  C  CG  . LYS A 1 118 ? 22.292 4.295   48.093 1.00 20.43  ? 118  LYS A CG  1 
ATOM   991  C  CD  . LYS A 1 118 ? 21.922 4.511   46.667 1.00 16.47  ? 118  LYS A CD  1 
ATOM   992  C  CE  . LYS A 1 118 ? 21.411 5.907   46.455 1.00 15.60  ? 118  LYS A CE  1 
ATOM   993  N  NZ  . LYS A 1 118 ? 20.785 5.986   45.099 1.00 16.41  ? 118  LYS A NZ  1 
ATOM   994  N  N   . ARG A 1 119 ? 22.161 -0.232  48.905 1.00 19.36  ? 119  ARG A N   1 
ATOM   995  C  CA  . ARG A 1 119 ? 22.111 -1.388  49.803 1.00 17.67  ? 119  ARG A CA  1 
ATOM   996  C  C   . ARG A 1 119 ? 23.440 -2.127  49.808 1.00 18.54  ? 119  ARG A C   1 
ATOM   997  O  O   . ARG A 1 119 ? 24.019 -2.398  50.867 1.00 18.71  ? 119  ARG A O   1 
ATOM   998  C  CB  . ARG A 1 119 ? 21.027 -2.373  49.380 1.00 16.45  ? 119  ARG A CB  1 
ATOM   999  C  CG  . ARG A 1 119 ? 20.703 -3.349  50.481 1.00 17.08  ? 119  ARG A CG  1 
ATOM   1000 C  CD  . ARG A 1 119 ? 20.200 -2.547  51.680 1.00 17.98  ? 119  ARG A CD  1 
ATOM   1001 N  NE  . ARG A 1 119 ? 20.348 -3.207  52.970 1.00 16.33  ? 119  ARG A NE  1 
ATOM   1002 C  CZ  . ARG A 1 119 ? 19.830 -2.728  54.097 1.00 20.55  ? 119  ARG A CZ  1 
ATOM   1003 N  NH1 . ARG A 1 119 ? 19.139 -1.604  54.073 1.00 21.04  ? 119  ARG A NH1 1 
ATOM   1004 N  NH2 . ARG A 1 119 ? 20.002 -3.355  55.254 1.00 22.87  ? 119  ARG A NH2 1 
ATOM   1005 N  N   . TYR A 1 120 ? 23.896 -2.458  48.603 1.00 16.59  ? 120  TYR A N   1 
ATOM   1006 C  CA  . TYR A 1 120 ? 25.152 -3.146  48.381 1.00 14.80  ? 120  TYR A CA  1 
ATOM   1007 C  C   . TYR A 1 120 ? 26.270 -2.443  49.153 1.00 14.98  ? 120  TYR A C   1 
ATOM   1008 O  O   . TYR A 1 120 ? 27.114 -3.081  49.770 1.00 13.76  ? 120  TYR A O   1 
ATOM   1009 C  CB  . TYR A 1 120 ? 25.478 -3.137  46.880 1.00 14.39  ? 120  TYR A CB  1 
ATOM   1010 C  CG  . TYR A 1 120 ? 26.756 -3.878  46.517 1.00 17.69  ? 120  TYR A CG  1 
ATOM   1011 C  CD1 . TYR A 1 120 ? 26.763 -5.274  46.390 1.00 15.81  ? 120  TYR A CD1 1 
ATOM   1012 C  CD2 . TYR A 1 120 ? 27.971 -3.187  46.341 1.00 15.07  ? 120  TYR A CD2 1 
ATOM   1013 C  CE1 . TYR A 1 120 ? 27.931 -5.955  46.105 1.00 16.21  ? 120  TYR A CE1 1 
ATOM   1014 C  CE2 . TYR A 1 120 ? 29.142 -3.863  46.053 1.00 14.50  ? 120  TYR A CE2 1 
ATOM   1015 C  CZ  . TYR A 1 120 ? 29.118 -5.250  45.938 1.00 17.48  ? 120  TYR A CZ  1 
ATOM   1016 O  OH  . TYR A 1 120 ? 30.282 -5.946  45.671 1.00 19.36  ? 120  TYR A OH  1 
ATOM   1017 N  N   . LEU A 1 121 ? 26.273 -1.122  49.108 1.00 14.38  ? 121  LEU A N   1 
ATOM   1018 C  CA  . LEU A 1 121 ? 27.297 -0.360  49.792 1.00 17.27  ? 121  LEU A CA  1 
ATOM   1019 C  C   . LEU A 1 121 ? 27.306 -0.562  51.303 1.00 19.95  ? 121  LEU A C   1 
ATOM   1020 O  O   . LEU A 1 121 ? 28.365 -0.702  51.927 1.00 21.62  ? 121  LEU A O   1 
ATOM   1021 C  CB  . LEU A 1 121 ? 27.117 1.126   49.496 1.00 16.73  ? 121  LEU A CB  1 
ATOM   1022 C  CG  . LEU A 1 121 ? 27.714 1.697   48.214 1.00 14.55  ? 121  LEU A CG  1 
ATOM   1023 C  CD1 . LEU A 1 121 ? 27.338 3.163   48.112 1.00 17.02  ? 121  LEU A CD1 1 
ATOM   1024 C  CD2 . LEU A 1 121 ? 29.227 1.532   48.224 1.00 15.34  ? 121  LEU A CD2 1 
ATOM   1025 N  N   . ILE A 1 122 ? 26.121 -0.562  51.893 1.00 20.47  ? 122  ILE A N   1 
ATOM   1026 C  CA  . ILE A 1 122 ? 26.007 -0.707  53.332 1.00 20.84  ? 122  ILE A CA  1 
ATOM   1027 C  C   . ILE A 1 122 ? 26.298 -2.124  53.793 1.00 21.63  ? 122  ILE A C   1 
ATOM   1028 O  O   . ILE A 1 122 ? 26.655 -2.337  54.944 1.00 24.75  ? 122  ILE A O   1 
ATOM   1029 C  CB  . ILE A 1 122 ? 24.595 -0.297  53.815 1.00 20.42  ? 122  ILE A CB  1 
ATOM   1030 C  CG1 . ILE A 1 122 ? 24.322 1.167   53.443 1.00 19.60  ? 122  ILE A CG1 1 
ATOM   1031 C  CG2 . ILE A 1 122 ? 24.472 -0.512  55.314 1.00 18.01  ? 122  ILE A CG2 1 
ATOM   1032 C  CD1 . ILE A 1 122 ? 22.880 1.601   53.638 1.00 17.27  ? 122  ILE A CD1 1 
ATOM   1033 N  N   . ASP A 1 123 ? 26.160 -3.088  52.897 1.00 19.80  ? 123  ASP A N   1 
ATOM   1034 C  CA  . ASP A 1 123 ? 26.377 -4.477  53.256 1.00 20.81  ? 123  ASP A CA  1 
ATOM   1035 C  C   . ASP A 1 123 ? 27.805 -4.934  53.131 1.00 22.44  ? 123  ASP A C   1 
ATOM   1036 O  O   . ASP A 1 123 ? 28.340 -5.581  54.016 1.00 25.82  ? 123  ASP A O   1 
ATOM   1037 C  CB  . ASP A 1 123 ? 25.503 -5.376  52.399 1.00 20.88  ? 123  ASP A CB  1 
ATOM   1038 C  CG  . ASP A 1 123 ? 24.060 -5.360  52.826 1.00 21.98  ? 123  ASP A CG  1 
ATOM   1039 O  OD1 . ASP A 1 123 ? 23.542 -4.288  53.213 1.00 19.39  ? 123  ASP A OD1 1 
ATOM   1040 O  OD2 . ASP A 1 123 ? 23.442 -6.439  52.756 1.00 23.55  ? 123  ASP A OD2 1 
ATOM   1041 N  N   . LYS A 1 124 ? 28.413 -4.633  52.005 1.00 23.92  ? 124  LYS A N   1 
ATOM   1042 C  CA  . LYS A 1 124 ? 29.787 -5.017  51.779 1.00 23.13  ? 124  LYS A CA  1 
ATOM   1043 C  C   . LYS A 1 124 ? 30.618 -4.056  52.596 1.00 22.73  ? 124  LYS A C   1 
ATOM   1044 O  O   . LYS A 1 124 ? 31.848 -4.152  52.649 1.00 23.03  ? 124  LYS A O   1 
ATOM   1045 C  CB  . LYS A 1 124 ? 30.102 -4.904  50.287 1.00 24.55  ? 124  LYS A CB  1 
ATOM   1046 C  CG  . LYS A 1 124 ? 29.181 -5.779  49.453 1.00 24.54  ? 124  LYS A CG  1 
ATOM   1047 C  CD  . LYS A 1 124 ? 29.302 -7.219  49.931 1.00 25.07  ? 124  LYS A CD  1 
ATOM   1048 C  CE  . LYS A 1 124 ? 28.412 -8.165  49.168 1.00 26.26  ? 124  LYS A CE  1 
ATOM   1049 N  NZ  . LYS A 1 124 ? 28.866 -9.566  49.396 1.00 28.14  ? 124  LYS A NZ  1 
ATOM   1050 N  N   . GLY A 1 125 ? 29.922 -3.126  53.240 1.00 20.53  ? 125  GLY A N   1 
ATOM   1051 C  CA  . GLY A 1 125 ? 30.598 -2.149  54.068 1.00 22.64  ? 125  GLY A CA  1 
ATOM   1052 C  C   . GLY A 1 125 ? 31.653 -1.320  53.363 1.00 22.02  ? 125  GLY A C   1 
ATOM   1053 O  O   . GLY A 1 125 ? 32.693 -1.001  53.949 1.00 21.68  ? 125  GLY A O   1 
ATOM   1054 N  N   . LEU A 1 126 ? 31.373 -0.976  52.108 1.00 21.26  ? 126  LEU A N   1 
ATOM   1055 C  CA  . LEU A 1 126 ? 32.263 -0.166  51.296 1.00 20.73  ? 126  LEU A CA  1 
ATOM   1056 C  C   . LEU A 1 126 ? 31.926 1.308   51.516 1.00 22.29  ? 126  LEU A C   1 
ATOM   1057 O  O   . LEU A 1 126 ? 30.762 1.673   51.695 1.00 22.21  ? 126  LEU A O   1 
ATOM   1058 C  CB  . LEU A 1 126 ? 32.104 -0.543  49.822 1.00 22.11  ? 126  LEU A CB  1 
ATOM   1059 C  CG  . LEU A 1 126 ? 32.923 -1.739  49.313 1.00 21.98  ? 126  LEU A CG  1 
ATOM   1060 C  CD1 . LEU A 1 126 ? 32.797 -2.907  50.236 1.00 23.61  ? 126  LEU A CD1 1 
ATOM   1061 C  CD2 . LEU A 1 126 ? 32.451 -2.128  47.944 1.00 23.29  ? 126  LEU A CD2 1 
ATOM   1062 N  N   . VAL A 1 127 ? 32.959 2.147   51.514 1.00 23.60  ? 127  VAL A N   1 
ATOM   1063 C  CA  . VAL A 1 127 ? 32.822 3.586   51.735 1.00 23.02  ? 127  VAL A CA  1 
ATOM   1064 C  C   . VAL A 1 127 ? 33.468 4.326   50.583 1.00 22.79  ? 127  VAL A C   1 
ATOM   1065 O  O   . VAL A 1 127 ? 34.669 4.188   50.357 1.00 24.43  ? 127  VAL A O   1 
ATOM   1066 C  CB  . VAL A 1 127 ? 33.556 4.022   53.024 1.00 23.87  ? 127  VAL A CB  1 
ATOM   1067 C  CG1 . VAL A 1 127 ? 33.341 5.525   53.279 1.00 24.00  ? 127  VAL A CG1 1 
ATOM   1068 C  CG2 . VAL A 1 127 ? 33.092 3.171   54.187 1.00 21.19  ? 127  VAL A CG2 1 
ATOM   1069 N  N   . PRO A 1 128 ? 32.684 5.118   49.831 1.00 23.56  ? 128  PRO A N   1 
ATOM   1070 C  CA  . PRO A 1 128 ? 33.231 5.871   48.698 1.00 23.64  ? 128  PRO A CA  1 
ATOM   1071 C  C   . PRO A 1 128 ? 34.187 6.980   49.116 1.00 25.43  ? 128  PRO A C   1 
ATOM   1072 O  O   . PRO A 1 128 ? 34.380 7.231   50.296 1.00 28.49  ? 128  PRO A O   1 
ATOM   1073 C  CB  . PRO A 1 128 ? 31.979 6.386   47.989 1.00 21.12  ? 128  PRO A CB  1 
ATOM   1074 C  CG  . PRO A 1 128 ? 30.960 6.463   49.075 1.00 21.46  ? 128  PRO A CG  1 
ATOM   1075 C  CD  . PRO A 1 128 ? 31.215 5.192   49.845 1.00 22.93  ? 128  PRO A CD  1 
ATOM   1076 N  N   . MET A 1 129 ? 34.806 7.613   48.132 1.00 28.65  ? 129  MET A N   1 
ATOM   1077 C  CA  . MET A 1 129 ? 35.758 8.697   48.349 1.00 31.76  ? 129  MET A CA  1 
ATOM   1078 C  C   . MET A 1 129 ? 36.813 8.440   49.434 1.00 34.00  ? 129  MET A C   1 
ATOM   1079 O  O   . MET A 1 129 ? 36.992 9.268   50.322 1.00 36.61  ? 129  MET A O   1 
ATOM   1080 C  CB  . MET A 1 129 ? 35.004 9.983   48.686 1.00 31.19  ? 129  MET A CB  1 
ATOM   1081 C  CG  . MET A 1 129 ? 33.969 10.409  47.655 1.00 32.92  ? 129  MET A CG  1 
ATOM   1082 S  SD  . MET A 1 129 ? 34.570 10.434  45.946 1.00 33.08  ? 129  MET A SD  1 
ATOM   1083 C  CE  . MET A 1 129 ? 35.272 12.068  45.873 1.00 31.80  ? 129  MET A CE  1 
ATOM   1084 N  N   . GLU A 1 130 ? 37.517 7.314   49.373 1.00 35.83  ? 130  GLU A N   1 
ATOM   1085 C  CA  . GLU A 1 130 ? 38.531 7.028   50.381 1.00 38.87  ? 130  GLU A CA  1 
ATOM   1086 C  C   . GLU A 1 130 ? 39.943 6.911   49.831 1.00 41.23  ? 130  GLU A C   1 
ATOM   1087 O  O   . GLU A 1 130 ? 40.149 6.816   48.623 1.00 41.25  ? 130  GLU A O   1 
ATOM   1088 C  CB  . GLU A 1 130 ? 38.202 5.747   51.124 1.00 38.97  ? 130  GLU A CB  1 
ATOM   1089 C  CG  . GLU A 1 130 ? 36.973 5.854   51.962 1.00 40.42  ? 130  GLU A CG  1 
ATOM   1090 C  CD  . GLU A 1 130 ? 37.055 4.992   53.191 1.00 41.51  ? 130  GLU A CD  1 
ATOM   1091 O  OE1 . GLU A 1 130 ? 37.215 3.758   53.047 1.00 41.76  ? 130  GLU A OE1 1 
ATOM   1092 O  OE2 . GLU A 1 130 ? 36.964 5.559   54.301 1.00 43.43  ? 130  GLU A OE2 1 
ATOM   1093 N  N   . GLY A 1 131 ? 40.916 6.913   50.739 1.00 44.07  ? 131  GLY A N   1 
ATOM   1094 C  CA  . GLY A 1 131 ? 42.314 6.809   50.353 1.00 47.83  ? 131  GLY A CA  1 
ATOM   1095 C  C   . GLY A 1 131 ? 42.867 8.118   49.822 1.00 50.46  ? 131  GLY A C   1 
ATOM   1096 O  O   . GLY A 1 131 ? 42.176 9.140   49.835 1.00 49.72  ? 131  GLY A O   1 
ATOM   1097 N  N   . ASP A 1 132 ? 44.118 8.103   49.371 1.00 53.53  ? 132  ASP A N   1 
ATOM   1098 C  CA  . ASP A 1 132 ? 44.718 9.317   48.824 1.00 58.23  ? 132  ASP A CA  1 
ATOM   1099 C  C   . ASP A 1 132 ? 44.633 9.285   47.290 1.00 59.11  ? 132  ASP A C   1 
ATOM   1100 O  O   . ASP A 1 132 ? 45.618 9.035   46.585 1.00 60.18  ? 132  ASP A O   1 
ATOM   1101 C  CB  . ASP A 1 132 ? 46.182 9.494   49.301 1.00 60.36  ? 132  ASP A CB  1 
ATOM   1102 C  CG  . ASP A 1 132 ? 47.147 8.458   48.714 1.00 61.86  ? 132  ASP A CG  1 
ATOM   1103 O  OD1 . ASP A 1 132 ? 48.376 8.706   48.766 1.00 62.26  ? 132  ASP A OD1 1 
ATOM   1104 O  OD2 . ASP A 1 132 ? 46.691 7.406   48.211 1.00 61.77  ? 132  ASP A OD2 1 
ATOM   1105 N  N   . GLU A 1 133 ? 43.436 9.543   46.778 1.00 58.36  ? 133  GLU A N   1 
ATOM   1106 C  CA  . GLU A 1 133 ? 43.230 9.514   45.349 1.00 57.07  ? 133  GLU A CA  1 
ATOM   1107 C  C   . GLU A 1 133 ? 42.820 10.882  44.821 1.00 56.28  ? 133  GLU A C   1 
ATOM   1108 O  O   . GLU A 1 133 ? 41.769 11.406  45.179 1.00 56.04  ? 133  GLU A O   1 
ATOM   1109 C  CB  . GLU A 1 133 ? 42.169 8.463   45.017 1.00 59.02  ? 133  GLU A CB  1 
ATOM   1110 C  CG  . GLU A 1 133 ? 42.159 8.028   43.562 1.00 61.15  ? 133  GLU A CG  1 
ATOM   1111 C  CD  . GLU A 1 133 ? 43.472 7.400   43.136 1.00 61.86  ? 133  GLU A CD  1 
ATOM   1112 O  OE1 . GLU A 1 133 ? 43.670 7.192   41.914 1.00 62.23  ? 133  GLU A OE1 1 
ATOM   1113 O  OE2 . GLU A 1 133 ? 44.301 7.109   44.027 1.00 61.20  ? 133  GLU A OE2 1 
ATOM   1114 N  N   . GLU A 1 134 ? 43.672 11.458  43.977 1.00 56.09  ? 134  GLU A N   1 
ATOM   1115 C  CA  . GLU A 1 134 ? 43.429 12.767  43.361 1.00 54.10  ? 134  GLU A CA  1 
ATOM   1116 C  C   . GLU A 1 134 ? 42.529 12.602  42.141 1.00 50.69  ? 134  GLU A C   1 
ATOM   1117 O  O   . GLU A 1 134 ? 42.906 11.961  41.163 1.00 49.70  ? 134  GLU A O   1 
ATOM   1118 C  CB  . GLU A 1 134 ? 44.757 13.398  42.929 1.00 56.94  ? 134  GLU A CB  1 
ATOM   1119 C  CG  . GLU A 1 134 ? 45.649 13.805  44.080 1.00 59.51  ? 134  GLU A CG  1 
ATOM   1120 C  CD  . GLU A 1 134 ? 45.012 14.887  44.916 1.00 62.40  ? 134  GLU A CD  1 
ATOM   1121 O  OE1 . GLU A 1 134 ? 44.726 15.968  44.353 1.00 64.45  ? 134  GLU A OE1 1 
ATOM   1122 O  OE2 . GLU A 1 134 ? 44.794 14.657  46.127 1.00 62.69  ? 134  GLU A OE2 1 
ATOM   1123 N  N   . LEU A 1 135 ? 41.340 13.182  42.195 1.00 47.38  ? 135  LEU A N   1 
ATOM   1124 C  CA  . LEU A 1 135 ? 40.424 13.048  41.084 1.00 44.45  ? 135  LEU A CA  1 
ATOM   1125 C  C   . LEU A 1 135 ? 40.573 14.203  40.139 1.00 43.54  ? 135  LEU A C   1 
ATOM   1126 O  O   . LEU A 1 135 ? 40.633 15.351  40.560 1.00 44.89  ? 135  LEU A O   1 
ATOM   1127 C  CB  . LEU A 1 135 ? 38.979 13.004  41.565 1.00 43.38  ? 135  LEU A CB  1 
ATOM   1128 C  CG  . LEU A 1 135 ? 38.647 12.234  42.832 1.00 42.70  ? 135  LEU A CG  1 
ATOM   1129 C  CD1 . LEU A 1 135 ? 38.874 13.128  44.032 1.00 43.87  ? 135  LEU A CD1 1 
ATOM   1130 C  CD2 . LEU A 1 135 ? 37.197 11.807  42.786 1.00 44.58  ? 135  LEU A CD2 1 
ATOM   1131 N  N   . LYS A 1 136 ? 40.625 13.897  38.854 1.00 42.97  ? 136  LYS A N   1 
ATOM   1132 C  CA  . LYS A 1 136 ? 40.740 14.930  37.848 1.00 42.21  ? 136  LYS A CA  1 
ATOM   1133 C  C   . LYS A 1 136 ? 39.374 15.582  37.687 1.00 39.54  ? 136  LYS A C   1 
ATOM   1134 O  O   . LYS A 1 136 ? 38.346 14.909  37.570 1.00 38.48  ? 136  LYS A O   1 
ATOM   1135 C  CB  . LYS A 1 136 ? 41.227 14.327  36.529 1.00 46.12  ? 136  LYS A CB  1 
ATOM   1136 C  CG  . LYS A 1 136 ? 42.618 13.721  36.651 1.00 50.79  ? 136  LYS A CG  1 
ATOM   1137 C  CD  . LYS A 1 136 ? 43.262 13.464  35.298 1.00 54.52  ? 136  LYS A CD  1 
ATOM   1138 C  CE  . LYS A 1 136 ? 44.752 13.143  35.457 1.00 55.76  ? 136  LYS A CE  1 
ATOM   1139 N  NZ  . LYS A 1 136 ? 45.447 13.053  34.141 1.00 55.70  ? 136  LYS A NZ  1 
ATOM   1140 N  N   . MET A 1 137 ? 39.369 16.905  37.705 1.00 36.88  ? 137  MET A N   1 
ATOM   1141 C  CA  . MET A 1 137 ? 38.133 17.644  37.583 1.00 34.64  ? 137  MET A CA  1 
ATOM   1142 C  C   . MET A 1 137 ? 38.101 18.497  36.336 1.00 32.54  ? 137  MET A C   1 
ATOM   1143 O  O   . MET A 1 137 ? 39.137 18.889  35.799 1.00 30.81  ? 137  MET A O   1 
ATOM   1144 C  CB  . MET A 1 137 ? 37.933 18.519  38.820 1.00 36.05  ? 137  MET A CB  1 
ATOM   1145 C  CG  . MET A 1 137 ? 37.683 17.713  40.090 1.00 39.91  ? 137  MET A CG  1 
ATOM   1146 S  SD  . MET A 1 137 ? 37.752 18.670  41.628 1.00 41.18  ? 137  MET A SD  1 
ATOM   1147 C  CE  . MET A 1 137 ? 38.953 17.685  42.603 1.00 41.17  ? 137  MET A CE  1 
ATOM   1148 N  N   . LEU A 1 138 ? 36.890 18.765  35.876 1.00 30.02  ? 138  LEU A N   1 
ATOM   1149 C  CA  . LEU A 1 138 ? 36.679 19.581  34.706 1.00 29.41  ? 138  LEU A CA  1 
ATOM   1150 C  C   . LEU A 1 138 ? 35.387 20.350  34.902 1.00 31.48  ? 138  LEU A C   1 
ATOM   1151 O  O   . LEU A 1 138 ? 34.368 19.783  35.302 1.00 32.63  ? 138  LEU A O   1 
ATOM   1152 C  CB  . LEU A 1 138 ? 36.557 18.717  33.455 1.00 28.21  ? 138  LEU A CB  1 
ATOM   1153 C  CG  . LEU A 1 138 ? 36.326 19.546  32.185 1.00 27.50  ? 138  LEU A CG  1 
ATOM   1154 C  CD1 . LEU A 1 138 ? 37.572 20.364  31.900 1.00 27.03  ? 138  LEU A CD1 1 
ATOM   1155 C  CD2 . LEU A 1 138 ? 36.011 18.656  31.016 1.00 24.74  ? 138  LEU A CD2 1 
ATOM   1156 N  N   . ALA A 1 139 ? 35.429 21.644  34.619 1.00 32.18  ? 139  ALA A N   1 
ATOM   1157 C  CA  . ALA A 1 139 ? 34.253 22.483  34.745 1.00 32.07  ? 139  ALA A CA  1 
ATOM   1158 C  C   . ALA A 1 139 ? 33.776 22.870  33.349 1.00 32.77  ? 139  ALA A C   1 
ATOM   1159 O  O   . ALA A 1 139 ? 34.591 23.134  32.464 1.00 32.95  ? 139  ALA A O   1 
ATOM   1160 C  CB  . ALA A 1 139 ? 34.594 23.733  35.542 1.00 31.87  ? 139  ALA A CB  1 
ATOM   1161 N  N   . PHE A 1 140 ? 32.461 22.887  33.148 1.00 32.09  ? 140  PHE A N   1 
ATOM   1162 C  CA  . PHE A 1 140 ? 31.908 23.283  31.861 1.00 31.02  ? 140  PHE A CA  1 
ATOM   1163 C  C   . PHE A 1 140 ? 30.597 24.047  32.078 1.00 32.18  ? 140  PHE A C   1 
ATOM   1164 O  O   . PHE A 1 140 ? 29.927 23.892  33.105 1.00 30.17  ? 140  PHE A O   1 
ATOM   1165 C  CB  . PHE A 1 140 ? 31.749 22.053  30.936 1.00 29.36  ? 140  PHE A CB  1 
ATOM   1166 C  CG  . PHE A 1 140 ? 30.394 21.379  30.991 1.00 29.40  ? 140  PHE A CG  1 
ATOM   1167 C  CD1 . PHE A 1 140 ? 29.321 21.871  30.255 1.00 28.19  ? 140  PHE A CD1 1 
ATOM   1168 C  CD2 . PHE A 1 140 ? 30.200 20.224  31.751 1.00 29.45  ? 140  PHE A CD2 1 
ATOM   1169 C  CE1 . PHE A 1 140 ? 28.076 21.214  30.276 1.00 28.11  ? 140  PHE A CE1 1 
ATOM   1170 C  CE2 . PHE A 1 140 ? 28.962 19.570  31.774 1.00 26.84  ? 140  PHE A CE2 1 
ATOM   1171 C  CZ  . PHE A 1 140 ? 27.903 20.065  31.036 1.00 25.37  ? 140  PHE A CZ  1 
ATOM   1172 N  N   . ASP A 1 141 ? 30.269 24.905  31.118 1.00 33.45  ? 141  ASP A N   1 
ATOM   1173 C  CA  . ASP A 1 141 ? 29.070 25.735  31.161 1.00 35.73  ? 141  ASP A CA  1 
ATOM   1174 C  C   . ASP A 1 141 ? 28.784 26.006  29.695 1.00 37.34  ? 141  ASP A C   1 
ATOM   1175 O  O   . ASP A 1 141 ? 29.591 25.659  28.837 1.00 36.49  ? 141  ASP A O   1 
ATOM   1176 C  CB  . ASP A 1 141 ? 29.361 27.059  31.898 1.00 35.34  ? 141  ASP A CB  1 
ATOM   1177 C  CG  . ASP A 1 141 ? 28.108 27.907  32.134 1.00 36.85  ? 141  ASP A CG  1 
ATOM   1178 O  OD1 . ASP A 1 141 ? 27.216 27.479  32.901 1.00 38.40  ? 141  ASP A OD1 1 
ATOM   1179 O  OD2 . ASP A 1 141 ? 28.015 29.012  31.555 1.00 36.39  ? 141  ASP A OD2 1 
ATOM   1180 N  N   . ILE A 1 142 ? 27.642 26.617  29.406 1.00 39.37  ? 142  ILE A N   1 
ATOM   1181 C  CA  . ILE A 1 142 ? 27.273 26.927  28.032 1.00 39.74  ? 142  ILE A CA  1 
ATOM   1182 C  C   . ILE A 1 142 ? 26.273 28.066  28.003 1.00 42.50  ? 142  ILE A C   1 
ATOM   1183 O  O   . ILE A 1 142 ? 25.390 28.143  28.859 1.00 42.28  ? 142  ILE A O   1 
ATOM   1184 C  CB  . ILE A 1 142 ? 26.580 25.741  27.328 1.00 37.85  ? 142  ILE A CB  1 
ATOM   1185 C  CG1 . ILE A 1 142 ? 25.278 25.402  28.061 1.00 38.37  ? 142  ILE A CG1 1 
ATOM   1186 C  CG2 . ILE A 1 142 ? 27.494 24.546  27.274 1.00 37.54  ? 142  ILE A CG2 1 
ATOM   1187 C  CD1 . ILE A 1 142 ? 24.312 24.523  27.286 1.00 34.98  ? 142  ILE A CD1 1 
ATOM   1188 N  N   . GLU A 1 143 ? 26.424 28.953  27.024 1.00 46.29  ? 143  GLU A N   1 
ATOM   1189 C  CA  . GLU A 1 143 ? 25.488 30.052  26.832 1.00 50.30  ? 143  GLU A CA  1 
ATOM   1190 C  C   . GLU A 1 143 ? 24.852 29.758  25.469 1.00 53.38  ? 143  GLU A C   1 
ATOM   1191 O  O   . GLU A 1 143 ? 25.540 29.377  24.512 1.00 53.25  ? 143  GLU A O   1 
ATOM   1192 C  CB  . GLU A 1 143 ? 26.193 31.414  26.835 1.00 49.61  ? 143  GLU A CB  1 
ATOM   1193 C  CG  . GLU A 1 143 ? 25.915 32.272  28.085 1.00 51.59  ? 143  GLU A CG  1 
ATOM   1194 C  CD  . GLU A 1 143 ? 26.819 31.938  29.279 1.00 54.09  ? 143  GLU A CD  1 
ATOM   1195 O  OE1 . GLU A 1 143 ? 26.300 31.570  30.364 1.00 55.36  ? 143  GLU A OE1 1 
ATOM   1196 O  OE2 . GLU A 1 143 ? 28.056 32.057  29.135 1.00 53.43  ? 143  GLU A OE2 1 
ATOM   1197 N  N   . THR A 1 144 ? 23.535 29.908  25.396 1.00 56.27  ? 144  THR A N   1 
ATOM   1198 C  CA  . THR A 1 144 ? 22.795 29.623  24.176 1.00 60.67  ? 144  THR A CA  1 
ATOM   1199 C  C   . THR A 1 144 ? 22.160 30.867  23.568 1.00 64.20  ? 144  THR A C   1 
ATOM   1200 O  O   . THR A 1 144 ? 22.277 31.963  24.114 1.00 66.37  ? 144  THR A O   1 
ATOM   1201 C  CB  . THR A 1 144 ? 21.686 28.602  24.469 1.00 60.34  ? 144  THR A CB  1 
ATOM   1202 O  OG1 . THR A 1 144 ? 20.732 29.176  25.374 1.00 59.32  ? 144  THR A OG1 1 
ATOM   1203 C  CG2 . THR A 1 144 ? 22.277 27.359  25.107 1.00 59.58  ? 144  THR A CG2 1 
ATOM   1204 N  N   . LEU A 1 145 ? 21.493 30.702  22.430 1.00 67.72  ? 145  LEU A N   1 
ATOM   1205 C  CA  . LEU A 1 145 ? 20.828 31.830  21.787 1.00 71.73  ? 145  LEU A CA  1 
ATOM   1206 C  C   . LEU A 1 145 ? 19.379 31.775  22.266 1.00 74.11  ? 145  LEU A C   1 
ATOM   1207 O  O   . LEU A 1 145 ? 18.644 30.846  21.938 1.00 74.08  ? 145  LEU A O   1 
ATOM   1208 C  CB  . LEU A 1 145 ? 20.906 31.700  20.258 1.00 71.34  ? 145  LEU A CB  1 
ATOM   1209 C  CG  . LEU A 1 145 ? 20.852 33.002  19.449 1.00 70.67  ? 145  LEU A CG  1 
ATOM   1210 C  CD1 . LEU A 1 145 ? 21.141 32.728  17.982 1.00 70.17  ? 145  LEU A CD1 1 
ATOM   1211 C  CD2 . LEU A 1 145 ? 19.494 33.644  19.613 1.00 71.28  ? 145  LEU A CD2 1 
ATOM   1212 N  N   . TYR A 1 146 ? 18.971 32.764  23.052 1.00 77.49  ? 146  TYR A N   1 
ATOM   1213 C  CA  . TYR A 1 146 ? 17.618 32.764  23.583 1.00 81.69  ? 146  TYR A CA  1 
ATOM   1214 C  C   . TYR A 1 146 ? 16.614 33.508  22.712 1.00 83.36  ? 146  TYR A C   1 
ATOM   1215 O  O   . TYR A 1 146 ? 16.983 34.219  21.783 1.00 83.71  ? 146  TYR A O   1 
ATOM   1216 C  CB  . TYR A 1 146 ? 17.611 33.347  25.000 1.00 84.68  ? 146  TYR A CB  1 
ATOM   1217 C  CG  . TYR A 1 146 ? 16.522 32.766  25.875 1.00 88.10  ? 146  TYR A CG  1 
ATOM   1218 C  CD1 . TYR A 1 146 ? 16.519 31.407  26.204 1.00 89.28  ? 146  TYR A CD1 1 
ATOM   1219 C  CD2 . TYR A 1 146 ? 15.471 33.560  26.337 1.00 89.66  ? 146  TYR A CD2 1 
ATOM   1220 C  CE1 . TYR A 1 146 ? 15.491 30.848  26.967 1.00 91.20  ? 146  TYR A CE1 1 
ATOM   1221 C  CE2 . TYR A 1 146 ? 14.434 33.012  27.102 1.00 91.74  ? 146  TYR A CE2 1 
ATOM   1222 C  CZ  . TYR A 1 146 ? 14.449 31.653  27.412 1.00 92.34  ? 146  TYR A CZ  1 
ATOM   1223 O  OH  . TYR A 1 146 ? 13.419 31.097  28.146 1.00 93.06  ? 146  TYR A OH  1 
ATOM   1224 N  N   . GLU A 1 147 ? 15.336 33.323  23.026 1.00 85.93  ? 147  GLU A N   1 
ATOM   1225 C  CA  . GLU A 1 147 ? 14.231 33.953  22.307 1.00 88.39  ? 147  GLU A CA  1 
ATOM   1226 C  C   . GLU A 1 147 ? 12.933 33.636  23.054 1.00 89.66  ? 147  GLU A C   1 
ATOM   1227 O  O   . GLU A 1 147 ? 12.501 32.485  23.102 1.00 89.67  ? 147  GLU A O   1 
ATOM   1228 C  CB  . GLU A 1 147 ? 14.171 33.436  20.860 1.00 89.76  ? 147  GLU A CB  1 
ATOM   1229 C  CG  . GLU A 1 147 ? 14.491 31.944  20.695 1.00 92.10  ? 147  GLU A CG  1 
ATOM   1230 C  CD  . GLU A 1 147 ? 14.394 31.461  19.248 1.00 92.93  ? 147  GLU A CD  1 
ATOM   1231 O  OE1 . GLU A 1 147 ? 13.265 31.361  18.722 1.00 93.87  ? 147  GLU A OE1 1 
ATOM   1232 O  OE2 . GLU A 1 147 ? 15.449 31.182  18.634 1.00 92.91  ? 147  GLU A OE2 1 
ATOM   1233 N  N   . GLU A 1 148 ? 12.324 34.664  23.639 1.00 91.21  ? 148  GLU A N   1 
ATOM   1234 C  CA  . GLU A 1 148 ? 11.093 34.522  24.422 1.00 92.95  ? 148  GLU A CA  1 
ATOM   1235 C  C   . GLU A 1 148 ? 10.045 33.573  23.836 1.00 93.36  ? 148  GLU A C   1 
ATOM   1236 O  O   . GLU A 1 148 ? 9.379  32.842  24.575 1.00 93.10  ? 148  GLU A O   1 
ATOM   1237 C  CB  . GLU A 1 148 ? 10.471 35.904  24.662 1.00 94.11  ? 148  GLU A CB  1 
ATOM   1238 C  CG  . GLU A 1 148 ? 9.371  35.942  25.722 1.00 95.58  ? 148  GLU A CG  1 
ATOM   1239 C  CD  . GLU A 1 148 ? 7.972  35.975  25.131 1.00 96.58  ? 148  GLU A CD  1 
ATOM   1240 O  OE1 . GLU A 1 148 ? 6.998  36.059  25.912 1.00 96.63  ? 148  GLU A OE1 1 
ATOM   1241 O  OE2 . GLU A 1 148 ? 7.844  35.919  23.888 1.00 97.39  ? 148  GLU A OE2 1 
ATOM   1242 N  N   . GLY A 1 149 ? 9.890  33.588  22.516 1.00 93.75  ? 149  GLY A N   1 
ATOM   1243 C  CA  . GLY A 1 149 ? 8.924  32.701  21.896 1.00 94.43  ? 149  GLY A CA  1 
ATOM   1244 C  C   . GLY A 1 149 ? 9.302  31.252  22.156 1.00 94.89  ? 149  GLY A C   1 
ATOM   1245 O  O   . GLY A 1 149 ? 8.520  30.485  22.728 1.00 94.30  ? 149  GLY A O   1 
ATOM   1246 N  N   . GLU A 1 150 ? 10.516 30.893  21.737 1.00 95.08  ? 150  GLU A N   1 
ATOM   1247 C  CA  . GLU A 1 150 ? 11.069 29.546  21.890 1.00 94.88  ? 150  GLU A CA  1 
ATOM   1248 C  C   . GLU A 1 150 ? 10.391 28.685  22.957 1.00 93.32  ? 150  GLU A C   1 
ATOM   1249 O  O   . GLU A 1 150 ? 10.171 29.124  24.088 1.00 92.85  ? 150  GLU A O   1 
ATOM   1250 C  CB  . GLU A 1 150 ? 12.579 29.633  22.176 1.00 96.47  ? 150  GLU A CB  1 
ATOM   1251 C  CG  . GLU A 1 150 ? 13.201 28.367  22.782 1.00 98.75  ? 150  GLU A CG  1 
ATOM   1252 C  CD  . GLU A 1 150 ? 14.707 28.482  23.021 1.00 99.40  ? 150  GLU A CD  1 
ATOM   1253 O  OE1 . GLU A 1 150 ? 15.252 27.650  23.781 1.00 99.80  ? 150  GLU A OE1 1 
ATOM   1254 O  OE2 . GLU A 1 150 ? 15.347 29.391  22.448 1.00 98.91  ? 150  GLU A OE2 1 
ATOM   1255 N  N   . GLU A 1 151 ? 10.058 27.455  22.576 1.00 91.41  ? 151  GLU A N   1 
ATOM   1256 C  CA  . GLU A 1 151 ? 9.427  26.512  23.485 1.00 88.90  ? 151  GLU A CA  1 
ATOM   1257 C  C   . GLU A 1 151 ? 10.487 26.066  24.481 1.00 86.74  ? 151  GLU A C   1 
ATOM   1258 O  O   . GLU A 1 151 ? 10.302 26.184  25.694 1.00 87.12  ? 151  GLU A O   1 
ATOM   1259 C  CB  . GLU A 1 151 ? 8.883  25.308  22.709 1.00 89.64  ? 151  GLU A CB  1 
ATOM   1260 C  CG  . GLU A 1 151 ? 9.493  25.124  21.327 1.00 90.82  ? 151  GLU A CG  1 
ATOM   1261 C  CD  . GLU A 1 151 ? 8.945  26.105  20.292 1.00 91.71  ? 151  GLU A CD  1 
ATOM   1262 O  OE1 . GLU A 1 151 ? 7.832  25.870  19.770 1.00 91.90  ? 151  GLU A OE1 1 
ATOM   1263 O  OE2 . GLU A 1 151 ? 9.625  27.116  20.003 1.00 91.55  ? 151  GLU A OE2 1 
ATOM   1264 N  N   . PHE A 1 152 ? 11.598 25.559  23.952 1.00 83.27  ? 152  PHE A N   1 
ATOM   1265 C  CA  . PHE A 1 152 ? 12.729 25.108  24.759 1.00 80.07  ? 152  PHE A CA  1 
ATOM   1266 C  C   . PHE A 1 152 ? 13.785 24.462  23.881 1.00 78.31  ? 152  PHE A C   1 
ATOM   1267 O  O   . PHE A 1 152 ? 13.474 23.631  23.033 1.00 78.39  ? 152  PHE A O   1 
ATOM   1268 C  CB  . PHE A 1 152 ? 12.306 24.092  25.824 1.00 79.24  ? 152  PHE A CB  1 
ATOM   1269 C  CG  . PHE A 1 152 ? 13.459 23.569  26.646 1.00 78.72  ? 152  PHE A CG  1 
ATOM   1270 C  CD1 . PHE A 1 152 ? 13.485 22.246  27.074 1.00 79.85  ? 152  PHE A CD1 1 
ATOM   1271 C  CD2 . PHE A 1 152 ? 14.534 24.395  26.974 1.00 78.27  ? 152  PHE A CD2 1 
ATOM   1272 C  CE1 . PHE A 1 152 ? 14.569 21.750  27.814 1.00 79.46  ? 152  PHE A CE1 1 
ATOM   1273 C  CE2 . PHE A 1 152 ? 15.618 23.912  27.711 1.00 77.32  ? 152  PHE A CE2 1 
ATOM   1274 C  CZ  . PHE A 1 152 ? 15.636 22.589  28.129 1.00 78.36  ? 152  PHE A CZ  1 
ATOM   1275 N  N   . ALA A 1 153 ? 15.037 24.845  24.097 1.00 76.41  ? 153  ALA A N   1 
ATOM   1276 C  CA  . ALA A 1 153 ? 16.146 24.298  23.333 1.00 73.83  ? 153  ALA A CA  1 
ATOM   1277 C  C   . ALA A 1 153 ? 15.945 24.501  21.837 1.00 73.00  ? 153  ALA A C   1 
ATOM   1278 O  O   . ALA A 1 153 ? 16.540 23.791  21.018 1.00 73.28  ? 153  ALA A O   1 
ATOM   1279 C  CB  . ALA A 1 153 ? 16.304 22.827  23.643 1.00 73.46  ? 153  ALA A CB  1 
ATOM   1280 N  N   . GLU A 1 154 ? 15.098 25.467  21.486 1.00 70.86  ? 154  GLU A N   1 
ATOM   1281 C  CA  . GLU A 1 154 ? 14.832 25.781  20.085 1.00 68.50  ? 154  GLU A CA  1 
ATOM   1282 C  C   . GLU A 1 154 ? 16.084 26.404  19.490 1.00 65.48  ? 154  GLU A C   1 
ATOM   1283 O  O   . GLU A 1 154 ? 16.611 25.931  18.483 1.00 65.22  ? 154  GLU A O   1 
ATOM   1284 C  CB  . GLU A 1 154 ? 13.664 26.762  19.969 1.00 70.23  ? 154  GLU A CB  1 
ATOM   1285 C  CG  . GLU A 1 154 ? 12.317 26.146  20.267 1.00 73.05  ? 154  GLU A CG  1 
ATOM   1286 C  CD  . GLU A 1 154 ? 11.823 25.237  19.144 1.00 75.71  ? 154  GLU A CD  1 
ATOM   1287 O  OE1 . GLU A 1 154 ? 11.467 25.762  18.065 1.00 76.33  ? 154  GLU A OE1 1 
ATOM   1288 O  OE2 . GLU A 1 154 ? 11.790 24.000  19.337 1.00 75.81  ? 154  GLU A OE2 1 
ATOM   1289 N  N   . GLY A 1 155 ? 16.560 27.468  20.128 1.00 61.64  ? 155  GLY A N   1 
ATOM   1290 C  CA  . GLY A 1 155 ? 17.754 28.131  19.649 1.00 57.36  ? 155  GLY A CA  1 
ATOM   1291 C  C   . GLY A 1 155 ? 18.947 27.203  19.714 1.00 53.69  ? 155  GLY A C   1 
ATOM   1292 O  O   . GLY A 1 155 ? 18.925 26.215  20.434 1.00 54.24  ? 155  GLY A O   1 
ATOM   1293 N  N   . PRO A 1 156 ? 20.010 27.494  18.966 1.00 51.70  ? 156  PRO A N   1 
ATOM   1294 C  CA  . PRO A 1 156 ? 21.200 26.643  18.977 1.00 50.46  ? 156  PRO A CA  1 
ATOM   1295 C  C   . PRO A 1 156 ? 22.145 27.003  20.113 1.00 49.41  ? 156  PRO A C   1 
ATOM   1296 O  O   . PRO A 1 156 ? 22.027 28.073  20.711 1.00 49.35  ? 156  PRO A O   1 
ATOM   1297 C  CB  . PRO A 1 156 ? 21.819 26.928  17.623 1.00 50.82  ? 156  PRO A CB  1 
ATOM   1298 C  CG  . PRO A 1 156 ? 21.555 28.398  17.481 1.00 50.76  ? 156  PRO A CG  1 
ATOM   1299 C  CD  . PRO A 1 156 ? 20.112 28.523  17.917 1.00 50.79  ? 156  PRO A CD  1 
ATOM   1300 N  N   . ILE A 1 157 ? 23.083 26.109  20.410 1.00 48.03  ? 157  ILE A N   1 
ATOM   1301 C  CA  . ILE A 1 157 ? 24.059 26.371  21.458 1.00 47.21  ? 157  ILE A CA  1 
ATOM   1302 C  C   . ILE A 1 157 ? 25.220 27.125  20.818 1.00 47.05  ? 157  ILE A C   1 
ATOM   1303 O  O   . ILE A 1 157 ? 25.854 26.636  19.883 1.00 46.46  ? 157  ILE A O   1 
ATOM   1304 C  CB  . ILE A 1 157 ? 24.546 25.057  22.111 1.00 46.90  ? 157  ILE A CB  1 
ATOM   1305 C  CG1 . ILE A 1 157 ? 23.408 24.471  22.954 1.00 44.40  ? 157  ILE A CG1 1 
ATOM   1306 C  CG2 . ILE A 1 157 ? 25.796 25.311  22.964 1.00 46.67  ? 157  ILE A CG2 1 
ATOM   1307 C  CD1 . ILE A 1 157 ? 23.730 23.164  23.598 1.00 43.00  ? 157  ILE A CD1 1 
ATOM   1308 N  N   . LEU A 1 158 ? 25.480 28.326  21.327 1.00 46.21  ? 158  LEU A N   1 
ATOM   1309 C  CA  . LEU A 1 158 ? 26.523 29.184  20.792 1.00 45.55  ? 158  LEU A CA  1 
ATOM   1310 C  C   . LEU A 1 158 ? 27.933 28.831  21.235 1.00 46.28  ? 158  LEU A C   1 
ATOM   1311 O  O   . LEU A 1 158 ? 28.864 28.872  20.428 1.00 44.42  ? 158  LEU A O   1 
ATOM   1312 C  CB  . LEU A 1 158 ? 26.204 30.632  21.149 1.00 45.46  ? 158  LEU A CB  1 
ATOM   1313 C  CG  . LEU A 1 158 ? 24.782 31.017  20.718 1.00 45.89  ? 158  LEU A CG  1 
ATOM   1314 C  CD1 . LEU A 1 158 ? 24.424 32.413  21.209 1.00 45.15  ? 158  LEU A CD1 1 
ATOM   1315 C  CD2 . LEU A 1 158 ? 24.681 30.935  19.204 1.00 45.73  ? 158  LEU A CD2 1 
ATOM   1316 N  N   . MET A 1 159 ? 28.090 28.479  22.512 1.00 47.42  ? 159  MET A N   1 
ATOM   1317 C  CA  . MET A 1 159 ? 29.408 28.126  23.046 1.00 46.84  ? 159  MET A CA  1 
ATOM   1318 C  C   . MET A 1 159 ? 29.380 27.075  24.153 1.00 45.18  ? 159  MET A C   1 
ATOM   1319 O  O   . MET A 1 159 ? 28.348 26.828  24.775 1.00 44.15  ? 159  MET A O   1 
ATOM   1320 C  CB  . MET A 1 159 ? 30.107 29.368  23.605 1.00 48.24  ? 159  MET A CB  1 
ATOM   1321 C  CG  . MET A 1 159 ? 30.124 30.575  22.692 1.00 50.41  ? 159  MET A CG  1 
ATOM   1322 S  SD  . MET A 1 159 ? 30.908 31.999  23.487 1.00 52.66  ? 159  MET A SD  1 
ATOM   1323 C  CE  . MET A 1 159 ? 32.503 32.006  22.698 1.00 50.58  ? 159  MET A CE  1 
ATOM   1324 N  N   . ILE A 1 160 ? 30.543 26.476  24.389 1.00 43.91  ? 160  ILE A N   1 
ATOM   1325 C  CA  . ILE A 1 160 ? 30.737 25.471  25.428 1.00 44.17  ? 160  ILE A CA  1 
ATOM   1326 C  C   . ILE A 1 160 ? 32.091 25.782  26.066 1.00 44.60  ? 160  ILE A C   1 
ATOM   1327 O  O   . ILE A 1 160 ? 33.131 25.451  25.502 1.00 45.97  ? 160  ILE A O   1 
ATOM   1328 C  CB  . ILE A 1 160 ? 30.775 24.013  24.851 1.00 43.19  ? 160  ILE A CB  1 
ATOM   1329 C  CG1 . ILE A 1 160 ? 29.360 23.494  24.573 1.00 43.41  ? 160  ILE A CG1 1 
ATOM   1330 C  CG2 . ILE A 1 160 ? 31.450 23.080  25.832 1.00 42.13  ? 160  ILE A CG2 1 
ATOM   1331 C  CD1 . ILE A 1 160 ? 29.308 22.010  24.192 1.00 41.07  ? 160  ILE A CD1 1 
ATOM   1332 N  N   . SER A 1 161 ? 32.084 26.421  27.233 1.00 44.44  ? 161  SER A N   1 
ATOM   1333 C  CA  . SER A 1 161 ? 33.332 26.770  27.909 1.00 44.06  ? 161  SER A CA  1 
ATOM   1334 C  C   . SER A 1 161 ? 33.767 25.708  28.907 1.00 44.63  ? 161  SER A C   1 
ATOM   1335 O  O   . SER A 1 161 ? 32.934 25.042  29.515 1.00 45.72  ? 161  SER A O   1 
ATOM   1336 C  CB  . SER A 1 161 ? 33.183 28.120  28.619 1.00 43.44  ? 161  SER A CB  1 
ATOM   1337 O  OG  . SER A 1 161 ? 32.098 28.119  29.531 1.00 41.92  ? 161  SER A OG  1 
ATOM   1338 N  N   . TYR A 1 162 ? 35.073 25.544  29.081 1.00 44.93  ? 162  TYR A N   1 
ATOM   1339 C  CA  . TYR A 1 162 ? 35.563 24.550  30.024 1.00 46.58  ? 162  TYR A CA  1 
ATOM   1340 C  C   . TYR A 1 162 ? 36.880 24.942  30.692 1.00 47.77  ? 162  TYR A C   1 
ATOM   1341 O  O   . TYR A 1 162 ? 37.874 25.227  30.022 1.00 49.25  ? 162  TYR A O   1 
ATOM   1342 C  CB  . TYR A 1 162 ? 35.691 23.186  29.330 1.00 46.82  ? 162  TYR A CB  1 
ATOM   1343 C  CG  . TYR A 1 162 ? 36.826 23.051  28.337 1.00 48.05  ? 162  TYR A CG  1 
ATOM   1344 C  CD1 . TYR A 1 162 ? 38.126 22.745  28.762 1.00 48.26  ? 162  TYR A CD1 1 
ATOM   1345 C  CD2 . TYR A 1 162 ? 36.601 23.222  26.972 1.00 48.77  ? 162  TYR A CD2 1 
ATOM   1346 C  CE1 . TYR A 1 162 ? 39.174 22.615  27.851 1.00 49.30  ? 162  TYR A CE1 1 
ATOM   1347 C  CE2 . TYR A 1 162 ? 37.641 23.096  26.050 1.00 50.32  ? 162  TYR A CE2 1 
ATOM   1348 C  CZ  . TYR A 1 162 ? 38.925 22.792  26.494 1.00 50.21  ? 162  TYR A CZ  1 
ATOM   1349 O  OH  . TYR A 1 162 ? 39.948 22.676  25.575 1.00 49.91  ? 162  TYR A OH  1 
ATOM   1350 N  N   . ALA A 1 163 ? 36.880 24.972  32.020 1.00 47.07  ? 163  ALA A N   1 
ATOM   1351 C  CA  . ALA A 1 163 ? 38.082 25.326  32.747 1.00 47.00  ? 163  ALA A CA  1 
ATOM   1352 C  C   . ALA A 1 163 ? 38.672 24.055  33.294 1.00 48.44  ? 163  ALA A C   1 
ATOM   1353 O  O   . ALA A 1 163 ? 37.968 23.068  33.518 1.00 46.53  ? 163  ALA A O   1 
ATOM   1354 C  CB  . ALA A 1 163 ? 37.770 26.290  33.871 1.00 47.08  ? 163  ALA A CB  1 
ATOM   1355 N  N   . ASP A 1 164 ? 39.974 24.090  33.519 1.00 50.72  ? 164  ASP A N   1 
ATOM   1356 C  CA  . ASP A 1 164 ? 40.680 22.927  34.008 1.00 52.70  ? 164  ASP A CA  1 
ATOM   1357 C  C   . ASP A 1 164 ? 41.797 23.400  34.905 1.00 53.36  ? 164  ASP A C   1 
ATOM   1358 O  O   . ASP A 1 164 ? 41.872 24.580  35.226 1.00 54.03  ? 164  ASP A O   1 
ATOM   1359 C  CB  . ASP A 1 164 ? 41.252 22.173  32.815 1.00 53.68  ? 164  ASP A CB  1 
ATOM   1360 C  CG  . ASP A 1 164 ? 41.344 20.706  33.062 1.00 54.88  ? 164  ASP A CG  1 
ATOM   1361 O  OD1 . ASP A 1 164 ? 41.617 19.958  32.101 1.00 54.81  ? 164  ASP A OD1 1 
ATOM   1362 O  OD2 . ASP A 1 164 ? 41.145 20.303  34.227 1.00 58.22  ? 164  ASP A OD2 1 
ATOM   1363 N  N   . GLU A 1 165 ? 42.666 22.486  35.312 1.00 54.67  ? 165  GLU A N   1 
ATOM   1364 C  CA  . GLU A 1 165 ? 43.789 22.862  36.160 1.00 56.83  ? 165  GLU A CA  1 
ATOM   1365 C  C   . GLU A 1 165 ? 44.845 23.459  35.225 1.00 58.53  ? 165  GLU A C   1 
ATOM   1366 O  O   . GLU A 1 165 ? 45.963 23.774  35.637 1.00 58.31  ? 165  GLU A O   1 
ATOM   1367 C  CB  . GLU A 1 165 ? 44.339 21.626  36.885 1.00 56.64  ? 165  GLU A CB  1 
ATOM   1368 C  CG  . GLU A 1 165 ? 45.214 21.915  38.109 1.00 55.52  ? 165  GLU A CG  1 
ATOM   1369 C  CD  . GLU A 1 165 ? 44.532 22.813  39.131 1.00 55.51  ? 165  GLU A CD  1 
ATOM   1370 O  OE1 . GLU A 1 165 ? 43.288 22.923  39.111 1.00 53.62  ? 165  GLU A OE1 1 
ATOM   1371 O  OE2 . GLU A 1 165 ? 45.243 23.405  39.967 1.00 56.87  ? 165  GLU A OE2 1 
ATOM   1372 N  N   . GLU A 1 166 ? 44.461 23.615  33.959 1.00 60.09  ? 166  GLU A N   1 
ATOM   1373 C  CA  . GLU A 1 166 ? 45.343 24.160  32.933 1.00 61.23  ? 166  GLU A CA  1 
ATOM   1374 C  C   . GLU A 1 166 ? 44.816 25.460  32.362 1.00 60.53  ? 166  GLU A C   1 
ATOM   1375 O  O   . GLU A 1 166 ? 45.523 26.154  31.637 1.00 61.17  ? 166  GLU A O   1 
ATOM   1376 C  CB  . GLU A 1 166 ? 45.505 23.154  31.797 1.00 63.89  ? 166  GLU A CB  1 
ATOM   1377 C  CG  . GLU A 1 166 ? 46.377 21.966  32.141 1.00 68.30  ? 166  GLU A CG  1 
ATOM   1378 C  CD  . GLU A 1 166 ? 46.144 20.800  31.214 1.00 70.75  ? 166  GLU A CD  1 
ATOM   1379 O  OE1 . GLU A 1 166 ? 46.050 21.032  29.987 1.00 72.18  ? 166  GLU A OE1 1 
ATOM   1380 O  OE2 . GLU A 1 166 ? 46.056 19.655  31.712 1.00 72.96  ? 166  GLU A OE2 1 
ATOM   1381 N  N   . GLY A 1 167 ? 43.566 25.780  32.672 1.00 59.68  ? 167  GLY A N   1 
ATOM   1382 C  CA  . GLY A 1 167 ? 42.983 27.010  32.174 1.00 58.00  ? 167  GLY A CA  1 
ATOM   1383 C  C   . GLY A 1 167 ? 41.602 26.828  31.582 1.00 56.95  ? 167  GLY A C   1 
ATOM   1384 O  O   . GLY A 1 167 ? 41.106 25.712  31.458 1.00 56.97  ? 167  GLY A O   1 
ATOM   1385 N  N   . ALA A 1 168 ? 40.971 27.939  31.229 1.00 56.15  ? 168  ALA A N   1 
ATOM   1386 C  CA  . ALA A 1 168 ? 39.651 27.893  30.639 1.00 56.70  ? 168  ALA A CA  1 
ATOM   1387 C  C   . ALA A 1 168 ? 39.851 27.951  29.141 1.00 58.17  ? 168  ALA A C   1 
ATOM   1388 O  O   . ALA A 1 168 ? 40.918 28.348  28.671 1.00 59.03  ? 168  ALA A O   1 
ATOM   1389 C  CB  . ALA A 1 168 ? 38.817 29.074  31.107 1.00 56.70  ? 168  ALA A CB  1 
ATOM   1390 N  N   . ARG A 1 169 ? 38.820 27.558  28.398 1.00 58.53  ? 169  ARG A N   1 
ATOM   1391 C  CA  . ARG A 1 169 ? 38.858 27.543  26.940 1.00 57.43  ? 169  ARG A CA  1 
ATOM   1392 C  C   . ARG A 1 169 ? 37.405 27.505  26.458 1.00 57.62  ? 169  ARG A C   1 
ATOM   1393 O  O   . ARG A 1 169 ? 36.569 26.831  27.064 1.00 58.82  ? 169  ARG A O   1 
ATOM   1394 C  CB  . ARG A 1 169 ? 39.617 26.296  26.469 1.00 56.55  ? 169  ARG A CB  1 
ATOM   1395 C  CG  . ARG A 1 169 ? 40.130 26.353  25.047 1.00 57.38  ? 169  ARG A CG  1 
ATOM   1396 C  CD  . ARG A 1 169 ? 40.946 27.616  24.822 1.00 59.76  ? 169  ARG A CD  1 
ATOM   1397 N  NE  . ARG A 1 169 ? 42.002 27.440  23.830 1.00 60.54  ? 169  ARG A NE  1 
ATOM   1398 C  CZ  . ARG A 1 169 ? 43.023 26.600  23.981 1.00 62.29  ? 169  ARG A CZ  1 
ATOM   1399 N  NH1 . ARG A 1 169 ? 43.120 25.863  25.081 1.00 61.59  ? 169  ARG A NH1 1 
ATOM   1400 N  NH2 . ARG A 1 169 ? 43.950 26.500  23.037 1.00 63.44  ? 169  ARG A NH2 1 
ATOM   1401 N  N   . VAL A 1 170 ? 37.093 28.233  25.388 1.00 56.09  ? 170  VAL A N   1 
ATOM   1402 C  CA  . VAL A 1 170 ? 35.727 28.247  24.867 1.00 53.99  ? 170  VAL A CA  1 
ATOM   1403 C  C   . VAL A 1 170 ? 35.665 27.660  23.466 1.00 54.46  ? 170  VAL A C   1 
ATOM   1404 O  O   . VAL A 1 170 ? 36.548 27.903  22.649 1.00 55.96  ? 170  VAL A O   1 
ATOM   1405 C  CB  . VAL A 1 170 ? 35.152 29.670  24.808 1.00 52.37  ? 170  VAL A CB  1 
ATOM   1406 C  CG1 . VAL A 1 170 ? 33.716 29.616  24.346 1.00 50.68  ? 170  VAL A CG1 1 
ATOM   1407 C  CG2 . VAL A 1 170 ? 35.244 30.329  26.165 1.00 50.94  ? 170  VAL A CG2 1 
ATOM   1408 N  N   . ILE A 1 171 ? 34.619 26.887  23.189 1.00 54.47  ? 171  ILE A N   1 
ATOM   1409 C  CA  . ILE A 1 171 ? 34.446 26.271  21.876 1.00 53.18  ? 171  ILE A CA  1 
ATOM   1410 C  C   . ILE A 1 171 ? 33.161 26.745  21.203 1.00 53.24  ? 171  ILE A C   1 
ATOM   1411 O  O   . ILE A 1 171 ? 32.057 26.399  21.617 1.00 52.17  ? 171  ILE A O   1 
ATOM   1412 C  CB  . ILE A 1 171 ? 34.440 24.729  21.978 1.00 51.95  ? 171  ILE A CB  1 
ATOM   1413 C  CG1 . ILE A 1 171 ? 35.843 24.242  22.356 1.00 51.84  ? 171  ILE A CG1 1 
ATOM   1414 C  CG2 . ILE A 1 171 ? 33.995 24.111  20.658 1.00 50.86  ? 171  ILE A CG2 1 
ATOM   1415 C  CD1 . ILE A 1 171 ? 35.957 22.744  22.539 1.00 51.42  ? 171  ILE A CD1 1 
ATOM   1416 N  N   . THR A 1 172 ? 33.327 27.556  20.163 1.00 54.10  ? 172  THR A N   1 
ATOM   1417 C  CA  . THR A 1 172 ? 32.202 28.091  19.410 1.00 54.86  ? 172  THR A CA  1 
ATOM   1418 C  C   . THR A 1 172 ? 32.505 28.098  17.919 1.00 55.47  ? 172  THR A C   1 
ATOM   1419 O  O   . THR A 1 172 ? 33.664 27.971  17.519 1.00 55.01  ? 172  THR A O   1 
ATOM   1420 C  CB  . THR A 1 172 ? 31.878 29.521  19.828 1.00 54.64  ? 172  THR A CB  1 
ATOM   1421 O  OG1 . THR A 1 172 ? 30.841 30.031  18.982 1.00 54.74  ? 172  THR A OG1 1 
ATOM   1422 C  CG2 . THR A 1 172 ? 33.116 30.403  19.717 1.00 53.29  ? 172  THR A CG2 1 
ATOM   1423 N  N   . TRP A 1 173 ? 31.463 28.254  17.106 1.00 56.36  ? 173  TRP A N   1 
ATOM   1424 C  CA  . TRP A 1 173 ? 31.613 28.275  15.654 1.00 59.68  ? 173  TRP A CA  1 
ATOM   1425 C  C   . TRP A 1 173 ? 31.987 29.653  15.077 1.00 61.05  ? 173  TRP A C   1 
ATOM   1426 O  O   . TRP A 1 173 ? 33.087 29.808  14.544 1.00 62.13  ? 173  TRP A O   1 
ATOM   1427 C  CB  . TRP A 1 173 ? 30.352 27.714  14.969 1.00 58.81  ? 173  TRP A CB  1 
ATOM   1428 C  CG  . TRP A 1 173 ? 29.090 27.767  15.796 1.00 59.81  ? 173  TRP A CG  1 
ATOM   1429 C  CD1 . TRP A 1 173 ? 28.965 27.490  17.130 1.00 60.20  ? 173  TRP A CD1 1 
ATOM   1430 C  CD2 . TRP A 1 173 ? 27.763 28.024  15.321 1.00 59.75  ? 173  TRP A CD2 1 
ATOM   1431 N  NE1 . TRP A 1 173 ? 27.648 27.554  17.512 1.00 60.28  ? 173  TRP A NE1 1 
ATOM   1432 C  CE2 . TRP A 1 173 ? 26.886 27.879  16.420 1.00 59.49  ? 173  TRP A CE2 1 
ATOM   1433 C  CE3 . TRP A 1 173 ? 27.227 28.358  14.072 1.00 59.67  ? 173  TRP A CE3 1 
ATOM   1434 C  CZ2 . TRP A 1 173 ? 25.505 28.054  16.310 1.00 59.35  ? 173  TRP A CZ2 1 
ATOM   1435 C  CZ3 . TRP A 1 173 ? 25.849 28.532  13.961 1.00 59.51  ? 173  TRP A CZ3 1 
ATOM   1436 C  CH2 . TRP A 1 173 ? 25.006 28.379  15.075 1.00 59.42  ? 173  TRP A CH2 1 
ATOM   1437 N  N   . LYS A 1 174 ? 31.106 30.650  15.175 1.00 61.31  ? 174  LYS A N   1 
ATOM   1438 C  CA  . LYS A 1 174 ? 31.440 31.974  14.644 1.00 61.38  ? 174  LYS A CA  1 
ATOM   1439 C  C   . LYS A 1 174 ? 32.843 32.364  15.082 1.00 61.04  ? 174  LYS A C   1 
ATOM   1440 O  O   . LYS A 1 174 ? 33.373 31.803  16.033 1.00 60.26  ? 174  LYS A O   1 
ATOM   1441 C  CB  . LYS A 1 174 ? 30.428 33.034  15.103 1.00 63.01  ? 174  LYS A CB  1 
ATOM   1442 C  CG  . LYS A 1 174 ? 29.303 33.291  14.094 1.00 65.47  ? 174  LYS A CG  1 
ATOM   1443 C  CD  . LYS A 1 174 ? 28.371 34.415  14.539 1.00 68.19  ? 174  LYS A CD  1 
ATOM   1444 C  CE  . LYS A 1 174 ? 27.313 34.762  13.472 1.00 70.22  ? 174  LYS A CE  1 
ATOM   1445 N  NZ  . LYS A 1 174 ? 27.843 35.550  12.306 1.00 70.45  ? 174  LYS A NZ  1 
ATOM   1446 N  N   . ASN A 1 175 ? 33.444 33.324  14.388 1.00 62.10  ? 175  ASN A N   1 
ATOM   1447 C  CA  . ASN A 1 175 ? 34.802 33.757  14.699 1.00 63.23  ? 175  ASN A CA  1 
ATOM   1448 C  C   . ASN A 1 175 ? 34.971 34.733  15.862 1.00 64.23  ? 175  ASN A C   1 
ATOM   1449 O  O   . ASN A 1 175 ? 34.084 35.534  16.164 1.00 65.16  ? 175  ASN A O   1 
ATOM   1450 C  CB  . ASN A 1 175 ? 35.451 34.353  13.452 1.00 63.40  ? 175  ASN A CB  1 
ATOM   1451 C  CG  . ASN A 1 175 ? 36.294 33.346  12.699 1.00 63.33  ? 175  ASN A CG  1 
ATOM   1452 O  OD1 . ASN A 1 175 ? 37.268 32.815  13.239 1.00 62.40  ? 175  ASN A OD1 1 
ATOM   1453 N  ND2 . ASN A 1 175 ? 35.929 33.079  11.445 1.00 63.14  ? 175  ASN A ND2 1 
ATOM   1454 N  N   . VAL A 1 176 ? 36.136 34.652  16.504 1.00 64.00  ? 176  VAL A N   1 
ATOM   1455 C  CA  . VAL A 1 176 ? 36.490 35.507  17.630 1.00 62.85  ? 176  VAL A CA  1 
ATOM   1456 C  C   . VAL A 1 176 ? 37.988 35.779  17.610 1.00 62.52  ? 176  VAL A C   1 
ATOM   1457 O  O   . VAL A 1 176 ? 38.424 36.931  17.571 1.00 61.90  ? 176  VAL A O   1 
ATOM   1458 C  CB  . VAL A 1 176 ? 36.124 34.840  18.967 1.00 62.77  ? 176  VAL A CB  1 
ATOM   1459 C  CG1 . VAL A 1 176 ? 36.848 35.528  20.112 1.00 62.90  ? 176  VAL A CG1 1 
ATOM   1460 C  CG2 . VAL A 1 176 ? 34.626 34.925  19.184 1.00 62.69  ? 176  VAL A CG2 1 
ATOM   1461 N  N   . ASP A 1 177 ? 38.762 34.700  17.635 1.00 62.36  ? 177  ASP A N   1 
ATOM   1462 C  CA  . ASP A 1 177 ? 40.222 34.754  17.623 1.00 63.65  ? 177  ASP A CA  1 
ATOM   1463 C  C   . ASP A 1 177 ? 40.866 35.303  18.890 1.00 64.33  ? 177  ASP A C   1 
ATOM   1464 O  O   . ASP A 1 177 ? 41.393 36.420  18.906 1.00 64.48  ? 177  ASP A O   1 
ATOM   1465 C  CB  . ASP A 1 177 ? 40.750 35.563  16.439 1.00 63.51  ? 177  ASP A CB  1 
ATOM   1466 C  CG  . ASP A 1 177 ? 42.272 35.660  16.444 1.00 63.83  ? 177  ASP A CG  1 
ATOM   1467 O  OD1 . ASP A 1 177 ? 42.941 34.657  16.110 1.00 64.51  ? 177  ASP A OD1 1 
ATOM   1468 O  OD2 . ASP A 1 177 ? 42.800 36.734  16.807 1.00 63.08  ? 177  ASP A OD2 1 
ATOM   1469 N  N   . LEU A 1 178 ? 40.823 34.501  19.946 1.00 64.11  ? 178  LEU A N   1 
ATOM   1470 C  CA  . LEU A 1 178 ? 41.428 34.845  21.221 1.00 64.06  ? 178  LEU A CA  1 
ATOM   1471 C  C   . LEU A 1 178 ? 42.220 33.598  21.605 1.00 64.46  ? 178  LEU A C   1 
ATOM   1472 O  O   . LEU A 1 178 ? 41.768 32.476  21.376 1.00 65.34  ? 178  LEU A O   1 
ATOM   1473 C  CB  . LEU A 1 178 ? 40.344 35.167  22.252 1.00 64.51  ? 178  LEU A CB  1 
ATOM   1474 C  CG  . LEU A 1 178 ? 39.639 36.518  22.046 1.00 64.66  ? 178  LEU A CG  1 
ATOM   1475 C  CD1 . LEU A 1 178 ? 38.331 36.574  22.818 1.00 63.85  ? 178  LEU A CD1 1 
ATOM   1476 C  CD2 . LEU A 1 178 ? 40.573 37.639  22.486 1.00 64.58  ? 178  LEU A CD2 1 
ATOM   1477 N  N   . PRO A 1 179 ? 43.419 33.772  22.174 1.00 64.38  ? 179  PRO A N   1 
ATOM   1478 C  CA  . PRO A 1 179 ? 44.242 32.621  22.561 1.00 64.31  ? 179  PRO A CA  1 
ATOM   1479 C  C   . PRO A 1 179 ? 43.460 31.498  23.246 1.00 63.97  ? 179  PRO A C   1 
ATOM   1480 O  O   . PRO A 1 179 ? 43.900 30.344  23.264 1.00 63.42  ? 179  PRO A O   1 
ATOM   1481 C  CB  . PRO A 1 179 ? 45.289 33.246  23.480 1.00 64.80  ? 179  PRO A CB  1 
ATOM   1482 C  CG  . PRO A 1 179 ? 45.455 34.617  22.893 1.00 65.27  ? 179  PRO A CG  1 
ATOM   1483 C  CD  . PRO A 1 179 ? 44.023 35.031  22.643 1.00 64.23  ? 179  PRO A CD  1 
ATOM   1484 N  N   . TYR A 1 180 ? 42.297 31.843  23.796 1.00 63.19  ? 180  TYR A N   1 
ATOM   1485 C  CA  . TYR A 1 180 ? 41.462 30.879  24.503 1.00 61.50  ? 180  TYR A CA  1 
ATOM   1486 C  C   . TYR A 1 180 ? 40.153 30.520  23.808 1.00 61.99  ? 180  TYR A C   1 
ATOM   1487 O  O   . TYR A 1 180 ? 39.166 30.205  24.469 1.00 63.31  ? 180  TYR A O   1 
ATOM   1488 C  CB  . TYR A 1 180 ? 41.173 31.378  25.929 1.00 57.81  ? 180  TYR A CB  1 
ATOM   1489 C  CG  . TYR A 1 180 ? 40.381 32.674  26.039 1.00 54.99  ? 180  TYR A CG  1 
ATOM   1490 C  CD1 . TYR A 1 180 ? 39.030 32.730  25.690 1.00 53.82  ? 180  TYR A CD1 1 
ATOM   1491 C  CD2 . TYR A 1 180 ? 40.973 33.836  26.541 1.00 54.03  ? 180  TYR A CD2 1 
ATOM   1492 C  CE1 . TYR A 1 180 ? 38.286 33.910  25.846 1.00 52.81  ? 180  TYR A CE1 1 
ATOM   1493 C  CE2 . TYR A 1 180 ? 40.238 35.020  26.698 1.00 52.13  ? 180  TYR A CE2 1 
ATOM   1494 C  CZ  . TYR A 1 180 ? 38.898 35.048  26.349 1.00 51.51  ? 180  TYR A CZ  1 
ATOM   1495 O  OH  . TYR A 1 180 ? 38.169 36.205  26.508 1.00 48.39  ? 180  TYR A OH  1 
ATOM   1496 N  N   . VAL A 1 181 ? 40.136 30.565  22.482 1.00 61.96  ? 181  VAL A N   1 
ATOM   1497 C  CA  . VAL A 1 181 ? 38.928 30.208  21.746 1.00 61.96  ? 181  VAL A CA  1 
ATOM   1498 C  C   . VAL A 1 181 ? 39.274 29.216  20.652 1.00 63.41  ? 181  VAL A C   1 
ATOM   1499 O  O   . VAL A 1 181 ? 40.045 29.519  19.743 1.00 62.86  ? 181  VAL A O   1 
ATOM   1500 C  CB  . VAL A 1 181 ? 38.245 31.432  21.125 1.00 60.39  ? 181  VAL A CB  1 
ATOM   1501 C  CG1 . VAL A 1 181 ? 37.085 30.982  20.259 1.00 60.19  ? 181  VAL A CG1 1 
ATOM   1502 C  CG2 . VAL A 1 181 ? 37.740 32.353  22.222 1.00 58.90  ? 181  VAL A CG2 1 
ATOM   1503 N  N   . ASP A 1 182 ? 38.690 28.025  20.757 1.00 65.69  ? 182  ASP A N   1 
ATOM   1504 C  CA  . ASP A 1 182 ? 38.940 26.949  19.815 1.00 67.57  ? 182  ASP A CA  1 
ATOM   1505 C  C   . ASP A 1 182 ? 38.112 26.944  18.542 1.00 69.45  ? 182  ASP A C   1 
ATOM   1506 O  O   . ASP A 1 182 ? 36.886 27.085  18.555 1.00 69.22  ? 182  ASP A O   1 
ATOM   1507 C  CB  . ASP A 1 182 ? 38.806 25.601  20.524 1.00 67.83  ? 182  ASP A CB  1 
ATOM   1508 C  CG  . ASP A 1 182 ? 40.038 25.253  21.341 1.00 68.65  ? 182  ASP A CG  1 
ATOM   1509 O  OD1 . ASP A 1 182 ? 40.070 24.170  21.963 1.00 69.75  ? 182  ASP A OD1 1 
ATOM   1510 O  OD2 . ASP A 1 182 ? 40.981 26.069  21.356 1.00 69.41  ? 182  ASP A OD2 1 
ATOM   1511 N  N   . VAL A 1 183 ? 38.833 26.762  17.442 1.00 71.86  ? 183  VAL A N   1 
ATOM   1512 C  CA  . VAL A 1 183 ? 38.293 26.714  16.092 1.00 74.19  ? 183  VAL A CA  1 
ATOM   1513 C  C   . VAL A 1 183 ? 37.475 25.451  15.845 1.00 76.07  ? 183  VAL A C   1 
ATOM   1514 O  O   . VAL A 1 183 ? 37.926 24.337  16.132 1.00 77.61  ? 183  VAL A O   1 
ATOM   1515 C  CB  . VAL A 1 183 ? 39.450 26.748  15.051 1.00 74.42  ? 183  VAL A CB  1 
ATOM   1516 C  CG1 . VAL A 1 183 ? 40.456 25.638  15.360 1.00 72.51  ? 183  VAL A CG1 1 
ATOM   1517 C  CG2 . VAL A 1 183 ? 38.902 26.577  13.637 1.00 74.23  ? 183  VAL A CG2 1 
ATOM   1518 N  N   . VAL A 1 184 ? 36.270 25.625  15.321 1.00 76.25  ? 184  VAL A N   1 
ATOM   1519 C  CA  . VAL A 1 184 ? 35.431 24.483  15.000 1.00 77.09  ? 184  VAL A CA  1 
ATOM   1520 C  C   . VAL A 1 184 ? 34.730 24.833  13.708 1.00 77.00  ? 184  VAL A C   1 
ATOM   1521 O  O   . VAL A 1 184 ? 34.949 25.912  13.161 1.00 77.60  ? 184  VAL A O   1 
ATOM   1522 C  CB  . VAL A 1 184 ? 34.375 24.191  16.089 1.00 77.84  ? 184  VAL A CB  1 
ATOM   1523 C  CG1 . VAL A 1 184 ? 35.059 23.956  17.428 1.00 79.38  ? 184  VAL A CG1 1 
ATOM   1524 C  CG2 . VAL A 1 184 ? 33.375 25.332  16.173 1.00 79.44  ? 184  VAL A CG2 1 
ATOM   1525 N  N   . SER A 1 185 ? 33.894 23.923  13.221 1.00 76.67  ? 185  SER A N   1 
ATOM   1526 C  CA  . SER A 1 185 ? 33.157 24.144  11.984 1.00 75.92  ? 185  SER A CA  1 
ATOM   1527 C  C   . SER A 1 185 ? 31.769 24.741  12.265 1.00 74.43  ? 185  SER A C   1 
ATOM   1528 O  O   . SER A 1 185 ? 31.577 25.957  12.204 1.00 73.63  ? 185  SER A O   1 
ATOM   1529 C  CB  . SER A 1 185 ? 33.023 22.820  11.224 1.00 77.10  ? 185  SER A CB  1 
ATOM   1530 O  OG  . SER A 1 185 ? 34.288 22.192  11.078 1.00 78.19  ? 185  SER A OG  1 
ATOM   1531 N  N   . THR A 1 186 ? 30.811 23.876  12.584 1.00 73.20  ? 186  THR A N   1 
ATOM   1532 C  CA  . THR A 1 186 ? 29.439 24.294  12.878 1.00 71.55  ? 186  THR A CA  1 
ATOM   1533 C  C   . THR A 1 186 ? 29.003 23.880  14.291 1.00 69.29  ? 186  THR A C   1 
ATOM   1534 O  O   . THR A 1 186 ? 29.752 23.215  15.012 1.00 69.49  ? 186  THR A O   1 
ATOM   1535 C  CB  . THR A 1 186 ? 28.451 23.680  11.848 1.00 72.74  ? 186  THR A CB  1 
ATOM   1536 O  OG1 . THR A 1 186 ? 27.107 24.048  12.190 1.00 74.65  ? 186  THR A OG1 1 
ATOM   1537 C  CG2 . THR A 1 186 ? 28.579 22.148  11.815 1.00 71.27  ? 186  THR A CG2 1 
ATOM   1538 N  N   . GLU A 1 187 ? 27.795 24.280  14.683 1.00 66.55  ? 187  GLU A N   1 
ATOM   1539 C  CA  . GLU A 1 187 ? 27.256 23.939  15.999 1.00 63.58  ? 187  GLU A CA  1 
ATOM   1540 C  C   . GLU A 1 187 ? 27.426 22.456  16.308 1.00 61.86  ? 187  GLU A C   1 
ATOM   1541 O  O   . GLU A 1 187 ? 27.904 22.086  17.372 1.00 62.64  ? 187  GLU A O   1 
ATOM   1542 C  CB  . GLU A 1 187 ? 25.781 24.312  16.064 1.00 62.93  ? 187  GLU A CB  1 
ATOM   1543 C  CG  . GLU A 1 187 ? 25.001 23.610  17.147 1.00 64.58  ? 187  GLU A CG  1 
ATOM   1544 C  CD  . GLU A 1 187 ? 23.598 24.165  17.282 1.00 65.78  ? 187  GLU A CD  1 
ATOM   1545 O  OE1 . GLU A 1 187 ? 22.898 24.264  16.254 1.00 66.69  ? 187  GLU A OE1 1 
ATOM   1546 O  OE2 . GLU A 1 187 ? 23.190 24.504  18.412 1.00 65.41  ? 187  GLU A OE2 1 
ATOM   1547 N  N   . ARG A 1 188 ? 27.028 21.610  15.369 1.00 59.44  ? 188  ARG A N   1 
ATOM   1548 C  CA  . ARG A 1 188 ? 27.152 20.174  15.535 1.00 56.77  ? 188  ARG A CA  1 
ATOM   1549 C  C   . ARG A 1 188 ? 28.599 19.824  15.838 1.00 54.84  ? 188  ARG A C   1 
ATOM   1550 O  O   . ARG A 1 188 ? 28.880 18.984  16.678 1.00 55.08  ? 188  ARG A O   1 
ATOM   1551 C  CB  . ARG A 1 188 ? 26.706 19.462  14.251 1.00 59.58  ? 188  ARG A CB  1 
ATOM   1552 C  CG  . ARG A 1 188 ? 26.753 17.929  14.292 1.00 61.23  ? 188  ARG A CG  1 
ATOM   1553 C  CD  . ARG A 1 188 ? 26.141 17.309  13.021 1.00 61.26  ? 188  ARG A CD  1 
ATOM   1554 N  NE  . ARG A 1 188 ? 25.834 15.887  13.189 1.00 60.57  ? 188  ARG A NE  1 
ATOM   1555 C  CZ  . ARG A 1 188 ? 26.724 14.900  13.114 1.00 60.38  ? 188  ARG A CZ  1 
ATOM   1556 N  NH1 . ARG A 1 188 ? 28.001 15.161  12.861 1.00 59.33  ? 188  ARG A NH1 1 
ATOM   1557 N  NH2 . ARG A 1 188 ? 26.336 13.646  13.318 1.00 58.69  ? 188  ARG A NH2 1 
ATOM   1558 N  N   . GLU A 1 189 ? 29.525 20.481  15.156 1.00 54.31  ? 189  GLU A N   1 
ATOM   1559 C  CA  . GLU A 1 189 ? 30.940 20.188  15.350 1.00 53.53  ? 189  GLU A CA  1 
ATOM   1560 C  C   . GLU A 1 189 ? 31.465 20.633  16.701 1.00 51.82  ? 189  GLU A C   1 
ATOM   1561 O  O   . GLU A 1 189 ? 32.355 19.990  17.262 1.00 51.81  ? 189  GLU A O   1 
ATOM   1562 C  CB  . GLU A 1 189 ? 31.767 20.812  14.218 1.00 55.28  ? 189  GLU A CB  1 
ATOM   1563 C  CG  . GLU A 1 189 ? 31.416 20.240  12.851 1.00 57.86  ? 189  GLU A CG  1 
ATOM   1564 C  CD  . GLU A 1 189 ? 31.625 18.732  12.783 1.00 59.35  ? 189  GLU A CD  1 
ATOM   1565 O  OE1 . GLU A 1 189 ? 30.996 18.069  11.919 1.00 60.77  ? 189  GLU A OE1 1 
ATOM   1566 O  OE2 . GLU A 1 189 ? 32.426 18.215  13.593 1.00 57.76  ? 189  GLU A OE2 1 
ATOM   1567 N  N   . MET A 1 190 ? 30.915 21.731  17.214 1.00 49.27  ? 190  MET A N   1 
ATOM   1568 C  CA  . MET A 1 190 ? 31.307 22.266  18.520 1.00 46.63  ? 190  MET A CA  1 
ATOM   1569 C  C   . MET A 1 190 ? 30.993 21.249  19.615 1.00 44.37  ? 190  MET A C   1 
ATOM   1570 O  O   . MET A 1 190 ? 31.880 20.825  20.364 1.00 42.71  ? 190  MET A O   1 
ATOM   1571 C  CB  . MET A 1 190 ? 30.548 23.558  18.800 1.00 46.69  ? 190  MET A CB  1 
ATOM   1572 C  CG  . MET A 1 190 ? 30.646 24.047  20.227 1.00 46.39  ? 190  MET A CG  1 
ATOM   1573 S  SD  . MET A 1 190 ? 29.519 25.423  20.505 1.00 49.32  ? 190  MET A SD  1 
ATOM   1574 C  CE  . MET A 1 190 ? 27.944 24.593  20.292 1.00 47.62  ? 190  MET A CE  1 
ATOM   1575 N  N   . ILE A 1 191 ? 29.718 20.874  19.699 1.00 41.77  ? 191  ILE A N   1 
ATOM   1576 C  CA  . ILE A 1 191 ? 29.262 19.896  20.670 1.00 39.18  ? 191  ILE A CA  1 
ATOM   1577 C  C   . ILE A 1 191 ? 30.136 18.668  20.544 1.00 40.03  ? 191  ILE A C   1 
ATOM   1578 O  O   . ILE A 1 191 ? 30.521 18.064  21.539 1.00 41.44  ? 191  ILE A O   1 
ATOM   1579 C  CB  . ILE A 1 191 ? 27.805 19.476  20.413 1.00 36.91  ? 191  ILE A CB  1 
ATOM   1580 C  CG1 . ILE A 1 191 ? 26.869 20.663  20.636 1.00 36.78  ? 191  ILE A CG1 1 
ATOM   1581 C  CG2 . ILE A 1 191 ? 27.427 18.325  21.323 1.00 36.48  ? 191  ILE A CG2 1 
ATOM   1582 C  CD1 . ILE A 1 191 ? 25.394 20.308  20.568 1.00 36.95  ? 191  ILE A CD1 1 
ATOM   1583 N  N   . LYS A 1 192 ? 30.452 18.303  19.308 1.00 41.63  ? 192  LYS A N   1 
ATOM   1584 C  CA  . LYS A 1 192 ? 31.286 17.137  19.053 1.00 42.45  ? 192  LYS A CA  1 
ATOM   1585 C  C   . LYS A 1 192 ? 32.674 17.345  19.654 1.00 42.04  ? 192  LYS A C   1 
ATOM   1586 O  O   . LYS A 1 192 ? 33.240 16.417  20.227 1.00 41.67  ? 192  LYS A O   1 
ATOM   1587 C  CB  . LYS A 1 192 ? 31.377 16.883  17.546 1.00 45.08  ? 192  LYS A CB  1 
ATOM   1588 C  CG  . LYS A 1 192 ? 31.660 15.429  17.159 1.00 49.08  ? 192  LYS A CG  1 
ATOM   1589 C  CD  . LYS A 1 192 ? 31.359 15.170  15.672 1.00 50.42  ? 192  LYS A CD  1 
ATOM   1590 C  CE  . LYS A 1 192 ? 31.599 13.700  15.289 1.00 53.10  ? 192  LYS A CE  1 
ATOM   1591 N  NZ  . LYS A 1 192 ? 31.166 13.345  13.896 1.00 51.56  ? 192  LYS A NZ  1 
ATOM   1592 N  N   . ARG A 1 193 ? 33.202 18.567  19.535 1.00 42.10  ? 193  ARG A N   1 
ATOM   1593 C  CA  . ARG A 1 193 ? 34.523 18.916  20.069 1.00 41.74  ? 193  ARG A CA  1 
ATOM   1594 C  C   . ARG A 1 193 ? 34.580 18.707  21.552 1.00 41.72  ? 193  ARG A C   1 
ATOM   1595 O  O   . ARG A 1 193 ? 35.443 17.997  22.073 1.00 41.55  ? 193  ARG A O   1 
ATOM   1596 C  CB  . ARG A 1 193 ? 34.860 20.381  19.813 1.00 41.56  ? 193  ARG A CB  1 
ATOM   1597 C  CG  . ARG A 1 193 ? 35.901 20.559  18.757 1.00 45.16  ? 193  ARG A CG  1 
ATOM   1598 C  CD  . ARG A 1 193 ? 37.033 19.564  18.948 1.00 46.42  ? 193  ARG A CD  1 
ATOM   1599 N  NE  . ARG A 1 193 ? 38.031 20.020  19.904 1.00 45.35  ? 193  ARG A NE  1 
ATOM   1600 C  CZ  . ARG A 1 193 ? 38.737 21.135  19.752 1.00 47.09  ? 193  ARG A CZ  1 
ATOM   1601 N  NH1 . ARG A 1 193 ? 38.540 21.904  18.685 1.00 46.80  ? 193  ARG A NH1 1 
ATOM   1602 N  NH2 . ARG A 1 193 ? 39.656 21.466  20.649 1.00 46.91  ? 193  ARG A NH2 1 
ATOM   1603 N  N   . PHE A 1 194 ? 33.662 19.376  22.228 1.00 41.74  ? 194  PHE A N   1 
ATOM   1604 C  CA  . PHE A 1 194 ? 33.560 19.293  23.662 1.00 42.73  ? 194  PHE A CA  1 
ATOM   1605 C  C   . PHE A 1 194 ? 33.635 17.834  24.063 1.00 42.18  ? 194  PHE A C   1 
ATOM   1606 O  O   . PHE A 1 194 ? 34.459 17.431  24.886 1.00 41.25  ? 194  PHE A O   1 
ATOM   1607 C  CB  . PHE A 1 194 ? 32.232 19.885  24.102 1.00 45.23  ? 194  PHE A CB  1 
ATOM   1608 C  CG  . PHE A 1 194 ? 31.958 19.708  25.554 1.00 48.32  ? 194  PHE A CG  1 
ATOM   1609 C  CD1 . PHE A 1 194 ? 32.869 20.166  26.504 1.00 48.25  ? 194  PHE A CD1 1 
ATOM   1610 C  CD2 . PHE A 1 194 ? 30.795 19.076  25.979 1.00 47.68  ? 194  PHE A CD2 1 
ATOM   1611 C  CE1 . PHE A 1 194 ? 32.625 19.995  27.850 1.00 48.52  ? 194  PHE A CE1 1 
ATOM   1612 C  CE2 . PHE A 1 194 ? 30.543 18.900  27.323 1.00 47.74  ? 194  PHE A CE2 1 
ATOM   1613 C  CZ  . PHE A 1 194 ? 31.458 19.360  28.264 1.00 48.73  ? 194  PHE A CZ  1 
ATOM   1614 N  N   . LEU A 1 195 ? 32.757 17.048  23.456 1.00 42.39  ? 195  LEU A N   1 
ATOM   1615 C  CA  . LEU A 1 195 ? 32.684 15.618  23.704 1.00 42.18  ? 195  LEU A CA  1 
ATOM   1616 C  C   . LEU A 1 195 ? 34.063 14.983  23.574 1.00 42.64  ? 195  LEU A C   1 
ATOM   1617 O  O   . LEU A 1 195 ? 34.466 14.166  24.405 1.00 41.96  ? 195  LEU A O   1 
ATOM   1618 C  CB  . LEU A 1 195 ? 31.718 14.985  22.707 1.00 40.07  ? 195  LEU A CB  1 
ATOM   1619 C  CG  . LEU A 1 195 ? 30.771 13.976  23.337 1.00 39.95  ? 195  LEU A CG  1 
ATOM   1620 C  CD1 . LEU A 1 195 ? 29.713 13.550  22.331 1.00 39.29  ? 195  LEU A CD1 1 
ATOM   1621 C  CD2 . LEU A 1 195 ? 31.583 12.798  23.853 1.00 39.81  ? 195  LEU A CD2 1 
ATOM   1622 N  N   . ARG A 1 196 ? 34.782 15.373  22.526 1.00 44.53  ? 196  ARG A N   1 
ATOM   1623 C  CA  . ARG A 1 196 ? 36.118 14.856  22.277 1.00 46.26  ? 196  ARG A CA  1 
ATOM   1624 C  C   . ARG A 1 196 ? 37.111 15.388  23.311 1.00 45.51  ? 196  ARG A C   1 
ATOM   1625 O  O   . ARG A 1 196 ? 38.174 14.815  23.525 1.00 43.84  ? 196  ARG A O   1 
ATOM   1626 C  CB  . ARG A 1 196 ? 36.576 15.227  20.864 1.00 48.72  ? 196  ARG A CB  1 
ATOM   1627 C  CG  . ARG A 1 196 ? 37.866 14.538  20.450 1.00 54.01  ? 196  ARG A CG  1 
ATOM   1628 C  CD  . ARG A 1 196 ? 38.305 14.955  19.053 1.00 58.86  ? 196  ARG A CD  1 
ATOM   1629 N  NE  . ARG A 1 196 ? 39.742 15.221  19.001 1.00 62.23  ? 196  ARG A NE  1 
ATOM   1630 C  CZ  . ARG A 1 196 ? 40.348 16.206  19.663 1.00 63.13  ? 196  ARG A CZ  1 
ATOM   1631 N  NH1 . ARG A 1 196 ? 39.645 17.028  20.433 1.00 63.85  ? 196  ARG A NH1 1 
ATOM   1632 N  NH2 . ARG A 1 196 ? 41.660 16.371  19.560 1.00 64.01  ? 196  ARG A NH2 1 
ATOM   1633 N  N   . VAL A 1 197 ? 36.771 16.493  23.956 1.00 45.13  ? 197  VAL A N   1 
ATOM   1634 C  CA  . VAL A 1 197 ? 37.660 17.034  24.967 1.00 44.65  ? 197  VAL A CA  1 
ATOM   1635 C  C   . VAL A 1 197 ? 37.475 16.228  26.245 1.00 44.46  ? 197  VAL A C   1 
ATOM   1636 O  O   . VAL A 1 197 ? 38.443 15.806  26.875 1.00 44.29  ? 197  VAL A O   1 
ATOM   1637 C  CB  . VAL A 1 197 ? 37.349 18.506  25.238 1.00 44.38  ? 197  VAL A CB  1 
ATOM   1638 C  CG1 . VAL A 1 197 ? 38.133 18.997  26.453 1.00 43.90  ? 197  VAL A CG1 1 
ATOM   1639 C  CG2 . VAL A 1 197 ? 37.697 19.322  24.009 1.00 43.60  ? 197  VAL A CG2 1 
ATOM   1640 N  N   . VAL A 1 198 ? 36.217 16.008  26.612 1.00 44.56  ? 198  VAL A N   1 
ATOM   1641 C  CA  . VAL A 1 198 ? 35.881 15.250  27.813 1.00 43.78  ? 198  VAL A CA  1 
ATOM   1642 C  C   . VAL A 1 198 ? 36.417 13.824  27.768 1.00 44.60  ? 198  VAL A C   1 
ATOM   1643 O  O   . VAL A 1 198 ? 37.057 13.370  28.708 1.00 43.76  ? 198  VAL A O   1 
ATOM   1644 C  CB  . VAL A 1 198 ? 34.354 15.201  28.024 1.00 41.48  ? 198  VAL A CB  1 
ATOM   1645 C  CG1 . VAL A 1 198 ? 34.016 14.302  29.193 1.00 40.15  ? 198  VAL A CG1 1 
ATOM   1646 C  CG2 . VAL A 1 198 ? 33.829 16.599  28.265 1.00 39.23  ? 198  VAL A CG2 1 
ATOM   1647 N  N   . LYS A 1 199 ? 36.156 13.117  26.674 1.00 47.82  ? 199  LYS A N   1 
ATOM   1648 C  CA  . LYS A 1 199 ? 36.623 11.741  26.551 1.00 50.51  ? 199  LYS A CA  1 
ATOM   1649 C  C   . LYS A 1 199 ? 38.142 11.749  26.578 1.00 49.63  ? 199  LYS A C   1 
ATOM   1650 O  O   . LYS A 1 199 ? 38.781 10.818  27.070 1.00 50.04  ? 199  LYS A O   1 
ATOM   1651 C  CB  . LYS A 1 199 ? 36.110 11.116  25.246 1.00 52.68  ? 199  LYS A CB  1 
ATOM   1652 C  CG  . LYS A 1 199 ? 36.000 9.590   25.300 1.00 57.27  ? 199  LYS A CG  1 
ATOM   1653 C  CD  . LYS A 1 199 ? 35.042 9.044   24.228 1.00 61.19  ? 199  LYS A CD  1 
ATOM   1654 C  CE  . LYS A 1 199 ? 34.698 7.559   24.445 1.00 62.68  ? 199  LYS A CE  1 
ATOM   1655 N  NZ  . LYS A 1 199 ? 33.952 7.285   25.720 1.00 63.59  ? 199  LYS A NZ  1 
ATOM   1656 N  N   . GLU A 1 200 ? 38.696 12.843  26.067 1.00 48.64  ? 200  GLU A N   1 
ATOM   1657 C  CA  . GLU A 1 200 ? 40.133 13.061  25.977 1.00 46.66  ? 200  GLU A CA  1 
ATOM   1658 C  C   . GLU A 1 200 ? 40.759 13.380  27.337 1.00 43.96  ? 200  GLU A C   1 
ATOM   1659 O  O   . GLU A 1 200 ? 41.709 12.717  27.742 1.00 43.06  ? 200  GLU A O   1 
ATOM   1660 C  CB  . GLU A 1 200 ? 40.378 14.202  24.997 1.00 49.34  ? 200  GLU A CB  1 
ATOM   1661 C  CG  . GLU A 1 200 ? 41.741 14.261  24.353 1.00 51.76  ? 200  GLU A CG  1 
ATOM   1662 C  CD  . GLU A 1 200 ? 41.738 15.232  23.186 1.00 54.22  ? 200  GLU A CD  1 
ATOM   1663 O  OE1 . GLU A 1 200 ? 41.314 16.397  23.386 1.00 56.18  ? 200  GLU A OE1 1 
ATOM   1664 O  OE2 . GLU A 1 200 ? 42.146 14.833  22.072 1.00 54.83  ? 200  GLU A OE2 1 
ATOM   1665 N  N   . LYS A 1 201 ? 40.246 14.389  28.039 1.00 40.37  ? 201  LYS A N   1 
ATOM   1666 C  CA  . LYS A 1 201 ? 40.796 14.722  29.350 1.00 38.83  ? 201  LYS A CA  1 
ATOM   1667 C  C   . LYS A 1 201 ? 40.427 13.682  30.418 1.00 38.07  ? 201  LYS A C   1 
ATOM   1668 O  O   . LYS A 1 201 ? 41.035 13.653  31.490 1.00 37.75  ? 201  LYS A O   1 
ATOM   1669 C  CB  . LYS A 1 201 ? 40.337 16.107  29.810 1.00 37.90  ? 201  LYS A CB  1 
ATOM   1670 C  CG  . LYS A 1 201 ? 41.003 17.269  29.091 1.00 38.05  ? 201  LYS A CG  1 
ATOM   1671 C  CD  . LYS A 1 201 ? 40.701 18.585  29.796 1.00 37.07  ? 201  LYS A CD  1 
ATOM   1672 C  CE  . LYS A 1 201 ? 40.904 19.804  28.893 1.00 37.85  ? 201  LYS A CE  1 
ATOM   1673 N  NZ  . LYS A 1 201 ? 42.308 20.027  28.449 1.00 38.95  ? 201  LYS A NZ  1 
ATOM   1674 N  N   . ASP A 1 202 ? 39.449 12.827  30.104 1.00 37.32  ? 202  ASP A N   1 
ATOM   1675 C  CA  . ASP A 1 202 ? 38.968 11.767  30.997 1.00 35.66  ? 202  ASP A CA  1 
ATOM   1676 C  C   . ASP A 1 202 ? 38.919 12.223  32.451 1.00 35.70  ? 202  ASP A C   1 
ATOM   1677 O  O   . ASP A 1 202 ? 39.655 11.720  33.302 1.00 35.65  ? 202  ASP A O   1 
ATOM   1678 C  CB  . ASP A 1 202 ? 39.852 10.522  30.876 1.00 36.43  ? 202  ASP A CB  1 
ATOM   1679 C  CG  . ASP A 1 202 ? 39.174 9.263   31.406 1.00 37.16  ? 202  ASP A CG  1 
ATOM   1680 O  OD1 . ASP A 1 202 ? 37.976 9.066   31.109 1.00 38.06  ? 202  ASP A OD1 1 
ATOM   1681 O  OD2 . ASP A 1 202 ? 39.838 8.459   32.097 1.00 35.93  ? 202  ASP A OD2 1 
ATOM   1682 N  N   . PRO A 1 203 ? 38.034 13.185  32.753 1.00 34.98  ? 203  PRO A N   1 
ATOM   1683 C  CA  . PRO A 1 203 ? 37.888 13.714  34.104 1.00 33.85  ? 203  PRO A CA  1 
ATOM   1684 C  C   . PRO A 1 203 ? 37.075 12.779  34.993 1.00 34.04  ? 203  PRO A C   1 
ATOM   1685 O  O   . PRO A 1 203 ? 36.255 12.004  34.502 1.00 33.39  ? 203  PRO A O   1 
ATOM   1686 C  CB  . PRO A 1 203 ? 37.181 15.037  33.857 1.00 34.12  ? 203  PRO A CB  1 
ATOM   1687 C  CG  . PRO A 1 203 ? 36.249 14.682  32.750 1.00 33.54  ? 203  PRO A CG  1 
ATOM   1688 C  CD  . PRO A 1 203 ? 37.131 13.890  31.821 1.00 34.02  ? 203  PRO A CD  1 
ATOM   1689 N  N   . ASP A 1 204 ? 37.311 12.856  36.301 1.00 33.50  ? 204  ASP A N   1 
ATOM   1690 C  CA  . ASP A 1 204 ? 36.583 12.039  37.254 1.00 32.43  ? 204  ASP A CA  1 
ATOM   1691 C  C   . ASP A 1 204 ? 35.332 12.789  37.700 1.00 32.75  ? 204  ASP A C   1 
ATOM   1692 O  O   . ASP A 1 204 ? 34.308 12.181  38.004 1.00 32.52  ? 204  ASP A O   1 
ATOM   1693 C  CB  . ASP A 1 204 ? 37.459 11.731  38.459 1.00 30.96  ? 204  ASP A CB  1 
ATOM   1694 C  CG  . ASP A 1 204 ? 38.630 10.871  38.105 1.00 31.44  ? 204  ASP A CG  1 
ATOM   1695 O  OD1 . ASP A 1 204 ? 38.409 9.737   37.646 1.00 33.14  ? 204  ASP A OD1 1 
ATOM   1696 O  OD2 . ASP A 1 204 ? 39.776 11.322  38.277 1.00 32.66  ? 204  ASP A OD2 1 
ATOM   1697 N  N   . VAL A 1 205 ? 35.415 14.114  37.722 1.00 32.14  ? 205  VAL A N   1 
ATOM   1698 C  CA  . VAL A 1 205 ? 34.287 14.928  38.144 1.00 32.42  ? 205  VAL A CA  1 
ATOM   1699 C  C   . VAL A 1 205 ? 33.981 16.007  37.125 1.00 32.36  ? 205  VAL A C   1 
ATOM   1700 O  O   . VAL A 1 205 ? 34.875 16.713  36.662 1.00 34.27  ? 205  VAL A O   1 
ATOM   1701 C  CB  . VAL A 1 205 ? 34.564 15.631  39.514 1.00 34.78  ? 205  VAL A CB  1 
ATOM   1702 C  CG1 . VAL A 1 205 ? 33.502 16.678  39.788 1.00 34.44  ? 205  VAL A CG1 1 
ATOM   1703 C  CG2 . VAL A 1 205 ? 34.588 14.605  40.651 1.00 34.28  ? 205  VAL A CG2 1 
ATOM   1704 N  N   . LEU A 1 206 ? 32.711 16.120  36.771 1.00 30.18  ? 206  LEU A N   1 
ATOM   1705 C  CA  . LEU A 1 206 ? 32.268 17.143  35.849 1.00 27.66  ? 206  LEU A CA  1 
ATOM   1706 C  C   . LEU A 1 206 ? 31.499 18.117  36.723 1.00 26.91  ? 206  LEU A C   1 
ATOM   1707 O  O   . LEU A 1 206 ? 30.495 17.767  37.333 1.00 26.49  ? 206  LEU A O   1 
ATOM   1708 C  CB  . LEU A 1 206 ? 31.354 16.557  34.772 1.00 27.87  ? 206  LEU A CB  1 
ATOM   1709 C  CG  . LEU A 1 206 ? 31.967 15.585  33.760 1.00 28.67  ? 206  LEU A CG  1 
ATOM   1710 C  CD1 . LEU A 1 206 ? 30.879 15.149  32.794 1.00 28.73  ? 206  LEU A CD1 1 
ATOM   1711 C  CD2 . LEU A 1 206 ? 33.126 16.240  33.001 1.00 29.28  ? 206  LEU A CD2 1 
ATOM   1712 N  N   . ILE A 1 207 ? 31.990 19.341  36.792 1.00 27.06  ? 207  ILE A N   1 
ATOM   1713 C  CA  . ILE A 1 207 ? 31.384 20.372  37.611 1.00 26.99  ? 207  ILE A CA  1 
ATOM   1714 C  C   . ILE A 1 207 ? 30.558 21.297  36.763 1.00 27.04  ? 207  ILE A C   1 
ATOM   1715 O  O   . ILE A 1 207 ? 30.995 21.705  35.691 1.00 29.13  ? 207  ILE A O   1 
ATOM   1716 C  CB  . ILE A 1 207 ? 32.461 21.225  38.263 1.00 28.90  ? 207  ILE A CB  1 
ATOM   1717 C  CG1 . ILE A 1 207 ? 33.432 20.332  39.028 1.00 31.91  ? 207  ILE A CG1 1 
ATOM   1718 C  CG2 . ILE A 1 207 ? 31.827 22.269  39.156 1.00 32.17  ? 207  ILE A CG2 1 
ATOM   1719 C  CD1 . ILE A 1 207 ? 34.712 21.040  39.447 1.00 34.35  ? 207  ILE A CD1 1 
ATOM   1720 N  N   . THR A 1 208 ? 29.372 21.644  37.240 1.00 26.81  ? 208  THR A N   1 
ATOM   1721 C  CA  . THR A 1 208 ? 28.515 22.571  36.514 1.00 28.04  ? 208  THR A CA  1 
ATOM   1722 C  C   . THR A 1 208 ? 27.846 23.449  37.547 1.00 29.46  ? 208  THR A C   1 
ATOM   1723 O  O   . THR A 1 208 ? 27.959 23.185  38.744 1.00 30.11  ? 208  THR A O   1 
ATOM   1724 C  CB  . THR A 1 208 ? 27.378 21.854  35.720 1.00 28.80  ? 208  THR A CB  1 
ATOM   1725 O  OG1 . THR A 1 208 ? 26.355 21.410  36.622 1.00 27.66  ? 208  THR A OG1 1 
ATOM   1726 C  CG2 . THR A 1 208 ? 27.919 20.666  34.950 1.00 30.81  ? 208  THR A CG2 1 
ATOM   1727 N  N   . TYR A 1 209 ? 27.166 24.497  37.086 1.00 29.99  ? 209  TYR A N   1 
ATOM   1728 C  CA  . TYR A 1 209 ? 26.413 25.373  37.977 1.00 29.73  ? 209  TYR A CA  1 
ATOM   1729 C  C   . TYR A 1 209 ? 24.966 25.332  37.488 1.00 29.98  ? 209  TYR A C   1 
ATOM   1730 O  O   . TYR A 1 209 ? 24.637 25.860  36.438 1.00 31.93  ? 209  TYR A O   1 
ATOM   1731 C  CB  . TYR A 1 209 ? 26.937 26.813  37.962 1.00 27.57  ? 209  TYR A CB  1 
ATOM   1732 C  CG  . TYR A 1 209 ? 26.347 27.609  39.101 1.00 29.05  ? 209  TYR A CG  1 
ATOM   1733 C  CD1 . TYR A 1 209 ? 26.605 27.248  40.435 1.00 29.58  ? 209  TYR A CD1 1 
ATOM   1734 C  CD2 . TYR A 1 209 ? 25.453 28.653  38.861 1.00 29.26  ? 209  TYR A CD2 1 
ATOM   1735 C  CE1 . TYR A 1 209 ? 25.975 27.904  41.507 1.00 30.39  ? 209  TYR A CE1 1 
ATOM   1736 C  CE2 . TYR A 1 209 ? 24.815 29.322  39.925 1.00 31.57  ? 209  TYR A CE2 1 
ATOM   1737 C  CZ  . TYR A 1 209 ? 25.080 28.943  41.245 1.00 31.78  ? 209  TYR A CZ  1 
ATOM   1738 O  OH  . TYR A 1 209 ? 24.462 29.608  42.289 1.00 29.14  ? 209  TYR A OH  1 
ATOM   1739 N  N   . ASN A 1 210 ? 24.099 24.698  38.257 1.00 31.41  ? 210  ASN A N   1 
ATOM   1740 C  CA  . ASN A 1 210 ? 22.707 24.553  37.859 1.00 33.92  ? 210  ASN A CA  1 
ATOM   1741 C  C   . ASN A 1 210 ? 22.643 23.749  36.572 1.00 34.05  ? 210  ASN A C   1 
ATOM   1742 O  O   . ASN A 1 210 ? 21.638 23.764  35.863 1.00 33.57  ? 210  ASN A O   1 
ATOM   1743 C  CB  . ASN A 1 210 ? 22.029 25.901  37.640 1.00 34.81  ? 210  ASN A CB  1 
ATOM   1744 C  CG  . ASN A 1 210 ? 20.552 25.751  37.285 1.00 37.85  ? 210  ASN A CG  1 
ATOM   1745 O  OD1 . ASN A 1 210 ? 19.891 24.798  37.707 1.00 37.96  ? 210  ASN A OD1 1 
ATOM   1746 N  ND2 . ASN A 1 210 ? 20.028 26.697  36.519 1.00 40.69  ? 210  ASN A ND2 1 
ATOM   1747 N  N   . GLY A 1 211 ? 23.725 23.040  36.276 1.00 34.11  ? 211  GLY A N   1 
ATOM   1748 C  CA  . GLY A 1 211 ? 23.748 22.231  35.078 1.00 35.88  ? 211  GLY A CA  1 
ATOM   1749 C  C   . GLY A 1 211 ? 22.862 21.018  35.260 1.00 36.49  ? 211  GLY A C   1 
ATOM   1750 O  O   . GLY A 1 211 ? 22.809 20.138  34.407 1.00 37.21  ? 211  GLY A O   1 
ATOM   1751 N  N   . ASP A 1 212 ? 22.170 20.972  36.389 1.00 36.93  ? 212  ASP A N   1 
ATOM   1752 C  CA  . ASP A 1 212 ? 21.280 19.864  36.700 1.00 36.79  ? 212  ASP A CA  1 
ATOM   1753 C  C   . ASP A 1 212 ? 19.922 20.143  36.097 1.00 36.81  ? 212  ASP A C   1 
ATOM   1754 O  O   . ASP A 1 212 ? 19.157 19.221  35.817 1.00 39.49  ? 212  ASP A O   1 
ATOM   1755 C  CB  . ASP A 1 212 ? 21.118 19.715  38.217 1.00 36.81  ? 212  ASP A CB  1 
ATOM   1756 C  CG  . ASP A 1 212 ? 21.635 18.395  38.733 1.00 35.17  ? 212  ASP A CG  1 
ATOM   1757 O  OD1 . ASP A 1 212 ? 22.011 17.540  37.905 1.00 34.31  ? 212  ASP A OD1 1 
ATOM   1758 O  OD2 . ASP A 1 212 ? 21.659 18.216  39.968 1.00 33.71  ? 212  ASP A OD2 1 
ATOM   1759 N  N   . ASN A 1 213 ? 19.622 21.421  35.902 1.00 36.17  ? 213  ASN A N   1 
ATOM   1760 C  CA  . ASN A 1 213 ? 18.333 21.819  35.354 1.00 36.33  ? 213  ASN A CA  1 
ATOM   1761 C  C   . ASN A 1 213 ? 18.397 22.517  33.995 1.00 35.60  ? 213  ASN A C   1 
ATOM   1762 O  O   . ASN A 1 213 ? 17.371 22.662  33.336 1.00 33.83  ? 213  ASN A O   1 
ATOM   1763 C  CB  . ASN A 1 213 ? 17.625 22.728  36.354 1.00 37.05  ? 213  ASN A CB  1 
ATOM   1764 C  CG  . ASN A 1 213 ? 17.440 22.068  37.709 1.00 39.80  ? 213  ASN A CG  1 
ATOM   1765 O  OD1 . ASN A 1 213 ? 16.733 21.073  37.831 1.00 39.95  ? 213  ASN A OD1 1 
ATOM   1766 N  ND2 . ASN A 1 213 ? 18.080 22.622  38.737 1.00 42.97  ? 213  ASN A ND2 1 
ATOM   1767 N  N   . PHE A 1 214 ? 19.599 22.925  33.579 1.00 34.88  ? 214  PHE A N   1 
ATOM   1768 C  CA  . PHE A 1 214 ? 19.783 23.641  32.321 1.00 32.71  ? 214  PHE A CA  1 
ATOM   1769 C  C   . PHE A 1 214 ? 20.764 23.066  31.292 1.00 32.46  ? 214  PHE A C   1 
ATOM   1770 O  O   . PHE A 1 214 ? 20.347 22.594  30.236 1.00 31.13  ? 214  PHE A O   1 
ATOM   1771 C  CB  . PHE A 1 214 ? 20.182 25.086  32.624 1.00 31.72  ? 214  PHE A CB  1 
ATOM   1772 C  CG  . PHE A 1 214 ? 20.359 25.947  31.392 1.00 31.00  ? 214  PHE A CG  1 
ATOM   1773 C  CD1 . PHE A 1 214 ? 19.246 26.425  30.691 1.00 26.97  ? 214  PHE A CD1 1 
ATOM   1774 C  CD2 . PHE A 1 214 ? 21.644 26.281  30.932 1.00 29.30  ? 214  PHE A CD2 1 
ATOM   1775 C  CE1 . PHE A 1 214 ? 19.405 27.221  29.553 1.00 25.71  ? 214  PHE A CE1 1 
ATOM   1776 C  CE2 . PHE A 1 214 ? 21.814 27.079  29.793 1.00 27.18  ? 214  PHE A CE2 1 
ATOM   1777 C  CZ  . PHE A 1 214 ? 20.688 27.550  29.103 1.00 25.72  ? 214  PHE A CZ  1 
ATOM   1778 N  N   . ASP A 1 215 ? 22.061 23.123  31.588 1.00 33.13  ? 215  ASP A N   1 
ATOM   1779 C  CA  . ASP A 1 215 ? 23.083 22.646  30.647 1.00 34.00  ? 215  ASP A CA  1 
ATOM   1780 C  C   . ASP A 1 215 ? 22.845 21.265  30.045 1.00 34.43  ? 215  ASP A C   1 
ATOM   1781 O  O   . ASP A 1 215 ? 22.850 21.103  28.822 1.00 35.66  ? 215  ASP A O   1 
ATOM   1782 C  CB  . ASP A 1 215 ? 24.471 22.672  31.290 1.00 32.24  ? 215  ASP A CB  1 
ATOM   1783 C  CG  . ASP A 1 215 ? 24.858 24.051  31.778 1.00 33.55  ? 215  ASP A CG  1 
ATOM   1784 O  OD1 . ASP A 1 215 ? 24.123 24.599  32.629 1.00 31.49  ? 215  ASP A OD1 1 
ATOM   1785 O  OD2 . ASP A 1 215 ? 25.894 24.584  31.318 1.00 33.48  ? 215  ASP A OD2 1 
ATOM   1786 N  N   . PHE A 1 216 ? 22.647 20.264  30.889 1.00 34.73  ? 216  PHE A N   1 
ATOM   1787 C  CA  . PHE A 1 216 ? 22.417 18.922  30.382 1.00 34.17  ? 216  PHE A CA  1 
ATOM   1788 C  C   . PHE A 1 216 ? 21.097 18.783  29.618 1.00 36.12  ? 216  PHE A C   1 
ATOM   1789 O  O   . PHE A 1 216 ? 21.072 18.223  28.520 1.00 37.84  ? 216  PHE A O   1 
ATOM   1790 C  CB  . PHE A 1 216 ? 22.477 17.916  31.522 1.00 31.35  ? 216  PHE A CB  1 
ATOM   1791 C  CG  . PHE A 1 216 ? 23.872 17.615  31.987 1.00 28.66  ? 216  PHE A CG  1 
ATOM   1792 C  CD1 . PHE A 1 216 ? 24.269 17.914  33.284 1.00 26.42  ? 216  PHE A CD1 1 
ATOM   1793 C  CD2 . PHE A 1 216 ? 24.779 16.986  31.138 1.00 27.75  ? 216  PHE A CD2 1 
ATOM   1794 C  CE1 . PHE A 1 216 ? 25.550 17.588  33.730 1.00 25.66  ? 216  PHE A CE1 1 
ATOM   1795 C  CE2 . PHE A 1 216 ? 26.064 16.653  31.576 1.00 25.92  ? 216  PHE A CE2 1 
ATOM   1796 C  CZ  . PHE A 1 216 ? 26.448 16.953  32.875 1.00 24.09  ? 216  PHE A CZ  1 
ATOM   1797 N  N   . ALA A 1 217 ? 20.003 19.290  30.178 1.00 36.96  ? 217  ALA A N   1 
ATOM   1798 C  CA  . ALA A 1 217 ? 18.713 19.198  29.503 1.00 36.67  ? 217  ALA A CA  1 
ATOM   1799 C  C   . ALA A 1 217 ? 18.811 19.778  28.096 1.00 37.86  ? 217  ALA A C   1 
ATOM   1800 O  O   . ALA A 1 217 ? 18.317 19.191  27.133 1.00 36.34  ? 217  ALA A O   1 
ATOM   1801 C  CB  . ALA A 1 217 ? 17.661 19.939  30.297 1.00 36.85  ? 217  ALA A CB  1 
ATOM   1802 N  N   . TYR A 1 218 ? 19.450 20.941  27.993 1.00 40.55  ? 218  TYR A N   1 
ATOM   1803 C  CA  . TYR A 1 218 ? 19.637 21.625  26.713 1.00 42.62  ? 218  TYR A CA  1 
ATOM   1804 C  C   . TYR A 1 218 ? 20.460 20.721  25.783 1.00 42.93  ? 218  TYR A C   1 
ATOM   1805 O  O   . TYR A 1 218 ? 19.938 20.183  24.799 1.00 43.95  ? 218  TYR A O   1 
ATOM   1806 C  CB  . TYR A 1 218 ? 20.370 22.959  26.926 1.00 44.42  ? 218  TYR A CB  1 
ATOM   1807 C  CG  . TYR A 1 218 ? 19.857 24.087  26.058 1.00 48.22  ? 218  TYR A CG  1 
ATOM   1808 C  CD1 . TYR A 1 218 ? 18.710 24.807  26.413 1.00 48.59  ? 218  TYR A CD1 1 
ATOM   1809 C  CD2 . TYR A 1 218 ? 20.481 24.399  24.844 1.00 51.28  ? 218  TYR A CD2 1 
ATOM   1810 C  CE1 . TYR A 1 218 ? 18.194 25.807  25.579 1.00 49.54  ? 218  TYR A CE1 1 
ATOM   1811 C  CE2 . TYR A 1 218 ? 19.969 25.396  23.997 1.00 51.25  ? 218  TYR A CE2 1 
ATOM   1812 C  CZ  . TYR A 1 218 ? 18.829 26.092  24.372 1.00 51.08  ? 218  TYR A CZ  1 
ATOM   1813 O  OH  . TYR A 1 218 ? 18.335 27.070  23.540 1.00 51.93  ? 218  TYR A OH  1 
ATOM   1814 N  N   . LEU A 1 219 ? 21.743 20.555  26.106 1.00 41.60  ? 219  LEU A N   1 
ATOM   1815 C  CA  . LEU A 1 219 ? 22.650 19.711  25.331 1.00 39.69  ? 219  LEU A CA  1 
ATOM   1816 C  C   . LEU A 1 219 ? 21.992 18.417  24.864 1.00 39.45  ? 219  LEU A C   1 
ATOM   1817 O  O   . LEU A 1 219 ? 22.457 17.774  23.926 1.00 38.37  ? 219  LEU A O   1 
ATOM   1818 C  CB  . LEU A 1 219 ? 23.878 19.378  26.170 1.00 38.50  ? 219  LEU A CB  1 
ATOM   1819 C  CG  . LEU A 1 219 ? 24.960 20.452  26.219 1.00 36.71  ? 219  LEU A CG  1 
ATOM   1820 C  CD1 . LEU A 1 219 ? 25.874 20.201  27.390 1.00 35.27  ? 219  LEU A CD1 1 
ATOM   1821 C  CD2 . LEU A 1 219 ? 25.740 20.443  24.905 1.00 34.90  ? 219  LEU A CD2 1 
ATOM   1822 N  N   . LYS A 1 220 ? 20.916 18.035  25.539 1.00 40.19  ? 220  LYS A N   1 
ATOM   1823 C  CA  . LYS A 1 220 ? 20.184 16.831  25.188 1.00 40.91  ? 220  LYS A CA  1 
ATOM   1824 C  C   . LYS A 1 220 ? 19.301 17.168  23.992 1.00 41.62  ? 220  LYS A C   1 
ATOM   1825 O  O   . LYS A 1 220 ? 19.484 16.626  22.901 1.00 42.98  ? 220  LYS A O   1 
ATOM   1826 C  CB  . LYS A 1 220 ? 19.322 16.369  26.363 1.00 38.95  ? 220  LYS A CB  1 
ATOM   1827 C  CG  . LYS A 1 220 ? 18.958 14.915  26.305 1.00 36.50  ? 220  LYS A CG  1 
ATOM   1828 C  CD  . LYS A 1 220 ? 17.941 14.546  27.360 1.00 38.70  ? 220  LYS A CD  1 
ATOM   1829 C  CE  . LYS A 1 220 ? 17.563 13.070  27.234 1.00 41.79  ? 220  LYS A CE  1 
ATOM   1830 N  NZ  . LYS A 1 220 ? 16.501 12.644  28.193 1.00 44.20  ? 220  LYS A NZ  1 
ATOM   1831 N  N   . LYS A 1 221 ? 18.350 18.073  24.199 1.00 41.38  ? 221  LYS A N   1 
ATOM   1832 C  CA  . LYS A 1 221 ? 17.455 18.477  23.128 1.00 41.30  ? 221  LYS A CA  1 
ATOM   1833 C  C   . LYS A 1 221 ? 18.209 18.896  21.875 1.00 41.53  ? 221  LYS A C   1 
ATOM   1834 O  O   . LYS A 1 221 ? 17.653 18.842  20.785 1.00 42.04  ? 221  LYS A O   1 
ATOM   1835 C  CB  . LYS A 1 221 ? 16.554 19.620  23.586 1.00 42.61  ? 221  LYS A CB  1 
ATOM   1836 C  CG  . LYS A 1 221 ? 15.295 19.179  24.320 1.00 46.52  ? 221  LYS A CG  1 
ATOM   1837 C  CD  . LYS A 1 221 ? 14.236 18.640  23.355 1.00 48.01  ? 221  LYS A CD  1 
ATOM   1838 C  CE  . LYS A 1 221 ? 13.006 18.098  24.091 1.00 47.84  ? 221  LYS A CE  1 
ATOM   1839 N  NZ  . LYS A 1 221 ? 12.329 19.117  24.944 1.00 47.36  ? 221  LYS A NZ  1 
ATOM   1840 N  N   . ARG A 1 222 ? 19.465 19.312  22.014 1.00 41.53  ? 222  ARG A N   1 
ATOM   1841 C  CA  . ARG A 1 222 ? 20.238 19.717  20.841 1.00 43.66  ? 222  ARG A CA  1 
ATOM   1842 C  C   . ARG A 1 222 ? 20.949 18.528  20.218 1.00 46.12  ? 222  ARG A C   1 
ATOM   1843 O  O   . ARG A 1 222 ? 21.083 18.437  18.994 1.00 47.30  ? 222  ARG A O   1 
ATOM   1844 C  CB  . ARG A 1 222 ? 21.264 20.793  21.193 1.00 41.68  ? 222  ARG A CB  1 
ATOM   1845 C  CG  . ARG A 1 222 ? 20.634 22.062  21.703 1.00 43.03  ? 222  ARG A CG  1 
ATOM   1846 C  CD  . ARG A 1 222 ? 19.614 22.606  20.720 1.00 43.35  ? 222  ARG A CD  1 
ATOM   1847 N  NE  . ARG A 1 222 ? 20.245 23.028  19.474 1.00 44.21  ? 222  ARG A NE  1 
ATOM   1848 C  CZ  . ARG A 1 222 ? 19.589 23.572  18.457 1.00 44.48  ? 222  ARG A CZ  1 
ATOM   1849 N  NH1 . ARG A 1 222 ? 18.278 23.759  18.542 1.00 44.81  ? 222  ARG A NH1 1 
ATOM   1850 N  NH2 . ARG A 1 222 ? 20.242 23.934  17.360 1.00 43.17  ? 222  ARG A NH2 1 
ATOM   1851 N  N   . CYS A 1 223 ? 21.410 17.615  21.063 1.00 47.83  ? 223  CYS A N   1 
ATOM   1852 C  CA  . CYS A 1 223 ? 22.082 16.431  20.567 1.00 48.08  ? 223  CYS A CA  1 
ATOM   1853 C  C   . CYS A 1 223 ? 21.095 15.560  19.802 1.00 49.00  ? 223  CYS A C   1 
ATOM   1854 O  O   . CYS A 1 223 ? 21.484 14.776  18.940 1.00 49.75  ? 223  CYS A O   1 
ATOM   1855 C  CB  . CYS A 1 223 ? 22.701 15.650  21.725 1.00 47.74  ? 223  CYS A CB  1 
ATOM   1856 S  SG  . CYS A 1 223 ? 24.343 16.226  22.184 1.00 48.01  ? 223  CYS A SG  1 
ATOM   1857 N  N   . GLU A 1 224 ? 19.811 15.700  20.110 1.00 50.50  ? 224  GLU A N   1 
ATOM   1858 C  CA  . GLU A 1 224 ? 18.793 14.915  19.423 1.00 52.28  ? 224  GLU A CA  1 
ATOM   1859 C  C   . GLU A 1 224 ? 18.550 15.454  18.015 1.00 53.14  ? 224  GLU A C   1 
ATOM   1860 O  O   . GLU A 1 224 ? 18.667 14.713  17.031 1.00 53.92  ? 224  GLU A O   1 
ATOM   1861 C  CB  . GLU A 1 224 ? 17.480 14.922  20.211 1.00 52.55  ? 224  GLU A CB  1 
ATOM   1862 C  CG  . GLU A 1 224 ? 17.556 14.247  21.579 1.00 53.52  ? 224  GLU A CG  1 
ATOM   1863 C  CD  . GLU A 1 224 ? 16.222 14.267  22.312 1.00 52.88  ? 224  GLU A CD  1 
ATOM   1864 O  OE1 . GLU A 1 224 ? 16.173 13.820  23.477 1.00 51.46  ? 224  GLU A OE1 1 
ATOM   1865 O  OE2 . GLU A 1 224 ? 15.222 14.730  21.720 1.00 52.58  ? 224  GLU A OE2 1 
ATOM   1866 N  N   . LYS A 1 225 ? 18.221 16.741  17.916 1.00 52.21  ? 225  LYS A N   1 
ATOM   1867 C  CA  . LYS A 1 225 ? 17.960 17.358  16.619 1.00 51.73  ? 225  LYS A CA  1 
ATOM   1868 C  C   . LYS A 1 225 ? 19.141 17.213  15.659 1.00 51.10  ? 225  LYS A C   1 
ATOM   1869 O  O   . LYS A 1 225 ? 18.956 16.936  14.467 1.00 49.14  ? 225  LYS A O   1 
ATOM   1870 C  CB  . LYS A 1 225 ? 17.620 18.845  16.792 1.00 52.37  ? 225  LYS A CB  1 
ATOM   1871 C  CG  . LYS A 1 225 ? 16.310 19.110  17.524 1.00 53.73  ? 225  LYS A CG  1 
ATOM   1872 C  CD  . LYS A 1 225 ? 16.036 20.606  17.671 1.00 54.53  ? 225  LYS A CD  1 
ATOM   1873 C  CE  . LYS A 1 225 ? 15.663 21.252  16.350 1.00 55.92  ? 225  LYS A CE  1 
ATOM   1874 N  NZ  . LYS A 1 225 ? 14.366 20.728  15.821 1.00 56.89  ? 225  LYS A NZ  1 
ATOM   1875 N  N   . LEU A 1 226 ? 20.352 17.394  16.186 1.00 50.19  ? 226  LEU A N   1 
ATOM   1876 C  CA  . LEU A 1 226 ? 21.559 17.306  15.375 1.00 49.55  ? 226  LEU A CA  1 
ATOM   1877 C  C   . LEU A 1 226 ? 22.036 15.879  15.140 1.00 49.06  ? 226  LEU A C   1 
ATOM   1878 O  O   . LEU A 1 226 ? 23.045 15.660  14.459 1.00 50.07  ? 226  LEU A O   1 
ATOM   1879 C  CB  . LEU A 1 226 ? 22.686 18.132  16.005 1.00 49.89  ? 226  LEU A CB  1 
ATOM   1880 C  CG  . LEU A 1 226 ? 22.433 19.625  16.250 1.00 49.82  ? 226  LEU A CG  1 
ATOM   1881 C  CD1 . LEU A 1 226 ? 23.784 20.335  16.364 1.00 49.27  ? 226  LEU A CD1 1 
ATOM   1882 C  CD2 . LEU A 1 226 ? 21.619 20.236  15.112 1.00 48.34  ? 226  LEU A CD2 1 
ATOM   1883 N  N   . GLY A 1 227 ? 21.309 14.916  15.702 1.00 47.36  ? 227  GLY A N   1 
ATOM   1884 C  CA  . GLY A 1 227 ? 21.654 13.513  15.531 1.00 46.00  ? 227  GLY A CA  1 
ATOM   1885 C  C   . GLY A 1 227 ? 23.010 13.104  16.072 1.00 44.58  ? 227  GLY A C   1 
ATOM   1886 O  O   . GLY A 1 227 ? 23.826 12.504  15.366 1.00 44.98  ? 227  GLY A O   1 
ATOM   1887 N  N   . ILE A 1 228 ? 23.255 13.416  17.337 1.00 43.56  ? 228  ILE A N   1 
ATOM   1888 C  CA  . ILE A 1 228 ? 24.528 13.078  17.942 1.00 42.81  ? 228  ILE A CA  1 
ATOM   1889 C  C   . ILE A 1 228 ? 24.373 12.274  19.237 1.00 42.57  ? 228  ILE A C   1 
ATOM   1890 O  O   . ILE A 1 228 ? 23.383 12.401  19.966 1.00 41.71  ? 228  ILE A O   1 
ATOM   1891 C  CB  . ILE A 1 228 ? 25.378 14.362  18.164 1.00 41.60  ? 228  ILE A CB  1 
ATOM   1892 C  CG1 . ILE A 1 228 ? 26.752 14.003  18.711 1.00 41.38  ? 228  ILE A CG1 1 
ATOM   1893 C  CG2 . ILE A 1 228 ? 24.677 15.301  19.098 1.00 40.62  ? 228  ILE A CG2 1 
ATOM   1894 C  CD1 . ILE A 1 228 ? 27.708 15.158  18.660 1.00 42.28  ? 228  ILE A CD1 1 
ATOM   1895 N  N   . ASN A 1 229 ? 25.358 11.416  19.478 1.00 42.51  ? 229  ASN A N   1 
ATOM   1896 C  CA  . ASN A 1 229 ? 25.393 10.545  20.636 1.00 41.86  ? 229  ASN A CA  1 
ATOM   1897 C  C   . ASN A 1 229 ? 26.210 11.229  21.708 1.00 42.20  ? 229  ASN A C   1 
ATOM   1898 O  O   . ASN A 1 229 ? 27.436 11.292  21.627 1.00 42.22  ? 229  ASN A O   1 
ATOM   1899 C  CB  . ASN A 1 229 ? 26.054 9.221   20.261 1.00 42.39  ? 229  ASN A CB  1 
ATOM   1900 C  CG  . ASN A 1 229 ? 25.902 8.172   21.335 1.00 44.57  ? 229  ASN A CG  1 
ATOM   1901 O  OD1 . ASN A 1 229 ? 26.656 7.197   21.380 1.00 44.55  ? 229  ASN A OD1 1 
ATOM   1902 N  ND2 . ASN A 1 229 ? 24.914 8.357   22.203 1.00 46.70  ? 229  ASN A ND2 1 
ATOM   1903 N  N   . PHE A 1 230 ? 25.533 11.757  22.712 1.00 41.85  ? 230  PHE A N   1 
ATOM   1904 C  CA  . PHE A 1 230 ? 26.231 12.435  23.783 1.00 41.95  ? 230  PHE A CA  1 
ATOM   1905 C  C   . PHE A 1 230 ? 26.795 11.358  24.700 1.00 41.39  ? 230  PHE A C   1 
ATOM   1906 O  O   . PHE A 1 230 ? 26.195 11.033  25.726 1.00 42.86  ? 230  PHE A O   1 
ATOM   1907 C  CB  . PHE A 1 230 ? 25.253 13.322  24.547 1.00 43.55  ? 230  PHE A CB  1 
ATOM   1908 C  CG  . PHE A 1 230 ? 25.883 14.534  25.137 1.00 44.19  ? 230  PHE A CG  1 
ATOM   1909 C  CD1 . PHE A 1 230 ? 25.229 15.258  26.117 1.00 45.99  ? 230  PHE A CD1 1 
ATOM   1910 C  CD2 . PHE A 1 230 ? 27.132 14.961  24.701 1.00 45.41  ? 230  PHE A CD2 1 
ATOM   1911 C  CE1 . PHE A 1 230 ? 25.807 16.395  26.662 1.00 47.37  ? 230  PHE A CE1 1 
ATOM   1912 C  CE2 . PHE A 1 230 ? 27.721 16.092  25.232 1.00 45.13  ? 230  PHE A CE2 1 
ATOM   1913 C  CZ  . PHE A 1 230 ? 27.058 16.814  26.216 1.00 46.63  ? 230  PHE A CZ  1 
ATOM   1914 N  N   . ALA A 1 231 ? 27.951 10.809  24.335 1.00 39.11  ? 231  ALA A N   1 
ATOM   1915 C  CA  . ALA A 1 231 ? 28.559 9.731   25.113 1.00 37.15  ? 231  ALA A CA  1 
ATOM   1916 C  C   . ALA A 1 231 ? 29.540 10.129  26.207 1.00 36.38  ? 231  ALA A C   1 
ATOM   1917 O  O   . ALA A 1 231 ? 30.690 9.671   26.214 1.00 38.44  ? 231  ALA A O   1 
ATOM   1918 C  CB  . ALA A 1 231 ? 29.227 8.742   24.181 1.00 38.21  ? 231  ALA A CB  1 
ATOM   1919 N  N   . LEU A 1 232 ? 29.084 10.950  27.148 1.00 31.95  ? 232  LEU A N   1 
ATOM   1920 C  CA  . LEU A 1 232 ? 29.937 11.381  28.246 1.00 27.72  ? 232  LEU A CA  1 
ATOM   1921 C  C   . LEU A 1 232 ? 30.212 10.243  29.207 1.00 27.83  ? 232  LEU A C   1 
ATOM   1922 O  O   . LEU A 1 232 ? 31.195 10.275  29.940 1.00 28.17  ? 232  LEU A O   1 
ATOM   1923 C  CB  . LEU A 1 232 ? 29.280 12.528  28.997 1.00 23.10  ? 232  LEU A CB  1 
ATOM   1924 C  CG  . LEU A 1 232 ? 29.164 13.796  28.173 1.00 19.07  ? 232  LEU A CG  1 
ATOM   1925 C  CD1 . LEU A 1 232 ? 28.068 14.654  28.746 1.00 22.06  ? 232  LEU A CD1 1 
ATOM   1926 C  CD2 . LEU A 1 232 ? 30.485 14.517  28.143 1.00 16.29  ? 232  LEU A CD2 1 
ATOM   1927 N  N   . GLY A 1 233 ? 29.335 9.243   29.204 1.00 28.19  ? 233  GLY A N   1 
ATOM   1928 C  CA  . GLY A 1 233 ? 29.504 8.104   30.087 1.00 29.25  ? 233  GLY A CA  1 
ATOM   1929 C  C   . GLY A 1 233 ? 30.870 7.463   29.966 1.00 30.45  ? 233  GLY A C   1 
ATOM   1930 O  O   . GLY A 1 233 ? 31.387 7.281   28.863 1.00 32.70  ? 233  GLY A O   1 
ATOM   1931 N  N   . ARG A 1 234 ? 31.464 7.126   31.102 1.00 31.75  ? 234  ARG A N   1 
ATOM   1932 C  CA  . ARG A 1 234 ? 32.778 6.493   31.122 1.00 34.42  ? 234  ARG A CA  1 
ATOM   1933 C  C   . ARG A 1 234 ? 32.599 5.129   30.468 1.00 34.94  ? 234  ARG A C   1 
ATOM   1934 O  O   . ARG A 1 234 ? 33.557 4.481   30.063 1.00 34.83  ? 234  ARG A O   1 
ATOM   1935 C  CB  . ARG A 1 234 ? 33.253 6.318   32.570 1.00 37.52  ? 234  ARG A CB  1 
ATOM   1936 C  CG  . ARG A 1 234 ? 34.737 6.016   32.737 1.00 38.77  ? 234  ARG A CG  1 
ATOM   1937 C  CD  . ARG A 1 234 ? 35.602 7.279   32.817 1.00 40.34  ? 234  ARG A CD  1 
ATOM   1938 N  NE  . ARG A 1 234 ? 35.522 7.946   34.115 1.00 38.46  ? 234  ARG A NE  1 
ATOM   1939 C  CZ  . ARG A 1 234 ? 36.568 8.462   34.754 1.00 39.36  ? 234  ARG A CZ  1 
ATOM   1940 N  NH1 . ARG A 1 234 ? 36.405 9.052   35.923 1.00 42.21  ? 234  ARG A NH1 1 
ATOM   1941 N  NH2 . ARG A 1 234 ? 37.783 8.379   34.239 1.00 39.97  ? 234  ARG A NH2 1 
ATOM   1942 N  N   . ASP A 1 235 ? 31.347 4.701   30.380 1.00 34.88  ? 235  ASP A N   1 
ATOM   1943 C  CA  . ASP A 1 235 ? 31.017 3.430   29.766 1.00 33.93  ? 235  ASP A CA  1 
ATOM   1944 C  C   . ASP A 1 235 ? 30.497 3.646   28.348 1.00 35.27  ? 235  ASP A C   1 
ATOM   1945 O  O   . ASP A 1 235 ? 30.374 2.700   27.572 1.00 38.31  ? 235  ASP A O   1 
ATOM   1946 C  CB  . ASP A 1 235 ? 29.959 2.714   30.594 1.00 31.76  ? 235  ASP A CB  1 
ATOM   1947 C  CG  . ASP A 1 235 ? 28.742 3.565   30.837 1.00 29.12  ? 235  ASP A CG  1 
ATOM   1948 O  OD1 . ASP A 1 235 ? 27.759 3.026   31.376 1.00 29.94  ? 235  ASP A OD1 1 
ATOM   1949 O  OD2 . ASP A 1 235 ? 28.768 4.766   30.500 1.00 26.29  ? 235  ASP A OD2 1 
ATOM   1950 N  N   . GLY A 1 236 ? 30.186 4.892   28.010 1.00 35.28  ? 236  GLY A N   1 
ATOM   1951 C  CA  . GLY A 1 236 ? 29.694 5.186   26.679 1.00 34.29  ? 236  GLY A CA  1 
ATOM   1952 C  C   . GLY A 1 236 ? 28.229 5.556   26.669 1.00 32.93  ? 236  GLY A C   1 
ATOM   1953 O  O   . GLY A 1 236 ? 27.641 5.816   25.623 1.00 33.86  ? 236  GLY A O   1 
ATOM   1954 N  N   . SER A 1 237 ? 27.636 5.574   27.848 1.00 32.45  ? 237  SER A N   1 
ATOM   1955 C  CA  . SER A 1 237 ? 26.235 5.924   27.978 1.00 33.17  ? 237  SER A CA  1 
ATOM   1956 C  C   . SER A 1 237 ? 26.089 7.434   27.864 1.00 33.55  ? 237  SER A C   1 
ATOM   1957 O  O   . SER A 1 237 ? 27.072 8.151   27.729 1.00 33.97  ? 237  SER A O   1 
ATOM   1958 C  CB  . SER A 1 237 ? 25.719 5.465   29.339 1.00 32.61  ? 237  SER A CB  1 
ATOM   1959 O  OG  . SER A 1 237 ? 26.503 6.023   30.383 1.00 32.31  ? 237  SER A OG  1 
ATOM   1960 N  N   . GLU A 1 238 ? 24.854 7.909   27.903 1.00 34.61  ? 238  GLU A N   1 
ATOM   1961 C  CA  . GLU A 1 238 ? 24.592 9.335   27.852 1.00 36.19  ? 238  GLU A CA  1 
ATOM   1962 C  C   . GLU A 1 238 ? 24.080 9.693   29.246 1.00 36.66  ? 238  GLU A C   1 
ATOM   1963 O  O   . GLU A 1 238 ? 23.503 8.851   29.938 1.00 37.78  ? 238  GLU A O   1 
ATOM   1964 C  CB  . GLU A 1 238 ? 23.530 9.645   26.808 1.00 37.51  ? 238  GLU A CB  1 
ATOM   1965 C  CG  . GLU A 1 238 ? 23.800 9.003   25.476 1.00 40.13  ? 238  GLU A CG  1 
ATOM   1966 C  CD  . GLU A 1 238 ? 22.828 9.457   24.413 1.00 42.67  ? 238  GLU A CD  1 
ATOM   1967 O  OE1 . GLU A 1 238 ? 22.973 10.599  23.904 1.00 43.34  ? 238  GLU A OE1 1 
ATOM   1968 O  OE2 . GLU A 1 238 ? 21.914 8.666   24.094 1.00 43.83  ? 238  GLU A OE2 1 
ATOM   1969 N  N   . PRO A 1 239 ? 24.285 10.942  29.681 1.00 35.61  ? 239  PRO A N   1 
ATOM   1970 C  CA  . PRO A 1 239 ? 23.816 11.322  31.011 1.00 35.57  ? 239  PRO A CA  1 
ATOM   1971 C  C   . PRO A 1 239 ? 22.436 10.752  31.289 1.00 36.05  ? 239  PRO A C   1 
ATOM   1972 O  O   . PRO A 1 239 ? 21.583 10.735  30.399 1.00 35.83  ? 239  PRO A O   1 
ATOM   1973 C  CB  . PRO A 1 239 ? 23.801 12.847  30.946 1.00 34.83  ? 239  PRO A CB  1 
ATOM   1974 C  CG  . PRO A 1 239 ? 24.928 13.144  30.020 1.00 35.31  ? 239  PRO A CG  1 
ATOM   1975 C  CD  . PRO A 1 239 ? 24.742 12.122  28.929 1.00 35.91  ? 239  PRO A CD  1 
ATOM   1976 N  N   . LYS A 1 240 ? 22.226 10.263  32.507 1.00 36.02  ? 240  LYS A N   1 
ATOM   1977 C  CA  . LYS A 1 240 ? 20.924 9.738   32.875 1.00 37.35  ? 240  LYS A CA  1 
ATOM   1978 C  C   . LYS A 1 240 ? 20.238 10.809  33.730 1.00 38.61  ? 240  LYS A C   1 
ATOM   1979 O  O   . LYS A 1 240 ? 20.820 11.325  34.684 1.00 39.08  ? 240  LYS A O   1 
ATOM   1980 C  CB  . LYS A 1 240 ? 21.054 8.422   33.654 1.00 37.85  ? 240  LYS A CB  1 
ATOM   1981 C  CG  . LYS A 1 240 ? 19.702 7.794   34.005 1.00 39.88  ? 240  LYS A CG  1 
ATOM   1982 C  CD  . LYS A 1 240 ? 19.786 6.664   35.046 1.00 42.61  ? 240  LYS A CD  1 
ATOM   1983 C  CE  . LYS A 1 240 ? 20.283 5.333   34.463 1.00 42.66  ? 240  LYS A CE  1 
ATOM   1984 N  NZ  . LYS A 1 240 ? 20.141 4.217   35.449 1.00 40.23  ? 240  LYS A NZ  1 
ATOM   1985 N  N   . ILE A 1 241 ? 19.008 11.155  33.366 1.00 39.93  ? 241  ILE A N   1 
ATOM   1986 C  CA  . ILE A 1 241 ? 18.242 12.161  34.086 1.00 41.99  ? 241  ILE A CA  1 
ATOM   1987 C  C   . ILE A 1 241 ? 17.451 11.515  35.218 1.00 44.77  ? 241  ILE A C   1 
ATOM   1988 O  O   . ILE A 1 241 ? 17.010 10.369  35.107 1.00 45.60  ? 241  ILE A O   1 
ATOM   1989 C  CB  . ILE A 1 241 ? 17.269 12.864  33.154 1.00 41.88  ? 241  ILE A CB  1 
ATOM   1990 C  CG1 . ILE A 1 241 ? 17.961 13.136  31.817 1.00 45.97  ? 241  ILE A CG1 1 
ATOM   1991 C  CG2 . ILE A 1 241 ? 16.816 14.168  33.771 1.00 40.17  ? 241  ILE A CG2 1 
ATOM   1992 C  CD1 . ILE A 1 241 ? 17.039 13.697  30.739 1.00 47.78  ? 241  ILE A CD1 1 
ATOM   1993 N  N   . GLN A 1 242 ? 17.261 12.259  36.304 1.00 47.42  ? 242  GLN A N   1 
ATOM   1994 C  CA  . GLN A 1 242 ? 16.544 11.741  37.459 1.00 49.21  ? 242  GLN A CA  1 
ATOM   1995 C  C   . GLN A 1 242 ? 15.633 12.736  38.144 1.00 50.84  ? 242  GLN A C   1 
ATOM   1996 O  O   . GLN A 1 242 ? 15.764 13.950  37.996 1.00 49.72  ? 242  GLN A O   1 
ATOM   1997 C  CB  . GLN A 1 242 ? 17.533 11.214  38.498 1.00 50.18  ? 242  GLN A CB  1 
ATOM   1998 C  CG  . GLN A 1 242 ? 18.185 9.899   38.145 1.00 52.40  ? 242  GLN A CG  1 
ATOM   1999 C  CD  . GLN A 1 242 ? 19.247 9.505   39.149 1.00 54.64  ? 242  GLN A CD  1 
ATOM   2000 O  OE1 . GLN A 1 242 ? 19.073 9.684   40.362 1.00 54.82  ? 242  GLN A OE1 1 
ATOM   2001 N  NE2 . GLN A 1 242 ? 20.355 8.955   38.652 1.00 55.02  ? 242  GLN A NE2 1 
ATOM   2002 N  N   . ARG A 1 243 ? 14.715 12.186  38.925 1.00 54.13  ? 243  ARG A N   1 
ATOM   2003 C  CA  . ARG A 1 243 ? 13.763 12.974  39.674 1.00 57.23  ? 243  ARG A CA  1 
ATOM   2004 C  C   . ARG A 1 243 ? 14.402 13.510  40.946 1.00 57.25  ? 243  ARG A C   1 
ATOM   2005 O  O   . ARG A 1 243 ? 15.252 12.859  41.560 1.00 57.17  ? 243  ARG A O   1 
ATOM   2006 C  CB  . ARG A 1 243 ? 12.534 12.115  40.002 1.00 61.99  ? 243  ARG A CB  1 
ATOM   2007 C  CG  . ARG A 1 243 ? 12.845 10.682  40.492 1.00 68.51  ? 243  ARG A CG  1 
ATOM   2008 C  CD  . ARG A 1 243 ? 13.394 10.655  41.919 1.00 72.68  ? 243  ARG A CD  1 
ATOM   2009 N  NE  . ARG A 1 243 ? 13.723 9.305   42.379 1.00 76.07  ? 243  ARG A NE  1 
ATOM   2010 C  CZ  . ARG A 1 243 ? 14.221 9.022   43.585 1.00 77.76  ? 243  ARG A CZ  1 
ATOM   2011 N  NH1 . ARG A 1 243 ? 14.452 9.993   44.463 1.00 77.84  ? 243  ARG A NH1 1 
ATOM   2012 N  NH2 . ARG A 1 243 ? 14.493 7.765   43.916 1.00 77.62  ? 243  ARG A NH2 1 
ATOM   2013 N  N   . MET A 1 244 ? 13.990 14.711  41.325 1.00 58.35  ? 244  MET A N   1 
ATOM   2014 C  CA  . MET A 1 244 ? 14.486 15.376  42.525 1.00 60.10  ? 244  MET A CA  1 
ATOM   2015 C  C   . MET A 1 244 ? 13.416 16.345  42.978 1.00 61.33  ? 244  MET A C   1 
ATOM   2016 O  O   . MET A 1 244 ? 13.656 17.545  43.085 1.00 61.32  ? 244  MET A O   1 
ATOM   2017 C  CB  . MET A 1 244 ? 15.770 16.142  42.221 1.00 59.40  ? 244  MET A CB  1 
ATOM   2018 C  CG  . MET A 1 244 ? 17.016 15.283  42.169 1.00 58.37  ? 244  MET A CG  1 
ATOM   2019 S  SD  . MET A 1 244 ? 17.804 15.229  43.768 1.00 56.36  ? 244  MET A SD  1 
ATOM   2020 C  CE  . MET A 1 244 ? 18.394 16.971  43.902 1.00 55.73  ? 244  MET A CE  1 
ATOM   2021 N  N   . GLY A 1 245 ? 12.230 15.810  43.242 1.00 63.15  ? 245  GLY A N   1 
ATOM   2022 C  CA  . GLY A 1 245 ? 11.128 16.647  43.661 1.00 64.40  ? 245  GLY A CA  1 
ATOM   2023 C  C   . GLY A 1 245 ? 10.622 17.429  42.468 1.00 65.32  ? 245  GLY A C   1 
ATOM   2024 O  O   . GLY A 1 245 ? 10.315 16.854  41.420 1.00 65.08  ? 245  GLY A O   1 
ATOM   2025 N  N   . ASP A 1 246 ? 10.549 18.746  42.627 1.00 66.15  ? 246  ASP A N   1 
ATOM   2026 C  CA  . ASP A 1 246 ? 10.076 19.636  41.568 1.00 66.54  ? 246  ASP A CA  1 
ATOM   2027 C  C   . ASP A 1 246 ? 11.106 19.866  40.461 1.00 65.02  ? 246  ASP A C   1 
ATOM   2028 O  O   . ASP A 1 246 ? 10.749 20.284  39.356 1.00 65.68  ? 246  ASP A O   1 
ATOM   2029 C  CB  . ASP A 1 246 ? 9.682  20.988  42.165 1.00 69.31  ? 246  ASP A CB  1 
ATOM   2030 C  CG  . ASP A 1 246 ? 10.773 21.579  43.045 1.00 70.92  ? 246  ASP A CG  1 
ATOM   2031 O  OD1 . ASP A 1 246 ? 10.723 22.799  43.314 1.00 73.04  ? 246  ASP A OD1 1 
ATOM   2032 O  OD2 . ASP A 1 246 ? 11.674 20.825  43.477 1.00 70.18  ? 246  ASP A OD2 1 
ATOM   2033 N  N   . ARG A 1 247 ? 12.374 19.590  40.771 1.00 62.29  ? 247  ARG A N   1 
ATOM   2034 C  CA  . ARG A 1 247 ? 13.491 19.775  39.839 1.00 58.23  ? 247  ARG A CA  1 
ATOM   2035 C  C   . ARG A 1 247 ? 13.994 18.444  39.278 1.00 53.69  ? 247  ARG A C   1 
ATOM   2036 O  O   . ARG A 1 247 ? 13.297 17.435  39.336 1.00 53.79  ? 247  ARG A O   1 
ATOM   2037 C  CB  . ARG A 1 247 ? 14.635 20.497  40.565 1.00 61.47  ? 247  ARG A CB  1 
ATOM   2038 C  CG  . ARG A 1 247 ? 15.139 19.757  41.824 1.00 65.30  ? 247  ARG A CG  1 
ATOM   2039 C  CD  . ARG A 1 247 ? 15.976 20.653  42.744 1.00 67.92  ? 247  ARG A CD  1 
ATOM   2040 N  NE  . ARG A 1 247 ? 15.169 21.694  43.388 1.00 70.51  ? 247  ARG A NE  1 
ATOM   2041 C  CZ  . ARG A 1 247 ? 14.515 21.548  44.539 1.00 71.49  ? 247  ARG A CZ  1 
ATOM   2042 N  NH1 . ARG A 1 247 ? 14.564 20.398  45.204 1.00 71.67  ? 247  ARG A NH1 1 
ATOM   2043 N  NH2 . ARG A 1 247 ? 13.799 22.559  45.022 1.00 71.52  ? 247  ARG A NH2 1 
ATOM   2044 N  N   . PHE A 1 248 ? 15.208 18.448  38.736 1.00 48.48  ? 248  PHE A N   1 
ATOM   2045 C  CA  . PHE A 1 248 ? 15.805 17.244  38.176 1.00 42.48  ? 248  PHE A CA  1 
ATOM   2046 C  C   . PHE A 1 248 ? 17.296 17.149  38.516 1.00 39.01  ? 248  PHE A C   1 
ATOM   2047 O  O   . PHE A 1 248 ? 17.905 18.120  38.945 1.00 38.56  ? 248  PHE A O   1 
ATOM   2048 C  CB  . PHE A 1 248 ? 15.614 17.220  36.660 1.00 42.98  ? 248  PHE A CB  1 
ATOM   2049 C  CG  . PHE A 1 248 ? 14.166 17.223  36.222 1.00 43.71  ? 248  PHE A CG  1 
ATOM   2050 C  CD1 . PHE A 1 248 ? 13.490 18.426  35.989 1.00 43.47  ? 248  PHE A CD1 1 
ATOM   2051 C  CD2 . PHE A 1 248 ? 13.473 16.023  36.049 1.00 42.02  ? 248  PHE A CD2 1 
ATOM   2052 C  CE1 . PHE A 1 248 ? 12.147 18.430  35.591 1.00 41.46  ? 248  PHE A CE1 1 
ATOM   2053 C  CE2 . PHE A 1 248 ? 12.133 16.019  35.654 1.00 40.91  ? 248  PHE A CE2 1 
ATOM   2054 C  CZ  . PHE A 1 248 ? 11.471 17.223  35.425 1.00 41.46  ? 248  PHE A CZ  1 
ATOM   2055 N  N   . ALA A 1 249 ? 17.873 15.970  38.329 1.00 35.27  ? 249  ALA A N   1 
ATOM   2056 C  CA  . ALA A 1 249 ? 19.282 15.746  38.616 1.00 31.78  ? 249  ALA A CA  1 
ATOM   2057 C  C   . ALA A 1 249 ? 19.869 14.889  37.500 1.00 30.58  ? 249  ALA A C   1 
ATOM   2058 O  O   . ALA A 1 249 ? 19.218 13.970  37.010 1.00 29.00  ? 249  ALA A O   1 
ATOM   2059 C  CB  . ALA A 1 249 ? 19.438 15.045  39.966 1.00 31.50  ? 249  ALA A CB  1 
ATOM   2060 N  N   . VAL A 1 250 ? 21.109 15.178  37.118 1.00 29.44  ? 250  VAL A N   1 
ATOM   2061 C  CA  . VAL A 1 250 ? 21.768 14.464  36.028 1.00 27.71  ? 250  VAL A CA  1 
ATOM   2062 C  C   . VAL A 1 250 ? 23.050 13.723  36.424 1.00 28.83  ? 250  VAL A C   1 
ATOM   2063 O  O   . VAL A 1 250 ? 23.916 14.277  37.101 1.00 29.46  ? 250  VAL A O   1 
ATOM   2064 C  CB  . VAL A 1 250 ? 22.102 15.463  34.870 1.00 25.43  ? 250  VAL A CB  1 
ATOM   2065 C  CG1 . VAL A 1 250 ? 22.849 14.758  33.753 1.00 24.88  ? 250  VAL A CG1 1 
ATOM   2066 C  CG2 . VAL A 1 250 ? 20.828 16.102  34.344 1.00 21.05  ? 250  VAL A CG2 1 
ATOM   2067 N  N   . GLU A 1 251 ? 23.167 12.473  35.981 1.00 29.67  ? 251  GLU A N   1 
ATOM   2068 C  CA  . GLU A 1 251 ? 24.346 11.655  36.257 1.00 29.78  ? 251  GLU A CA  1 
ATOM   2069 C  C   . GLU A 1 251 ? 25.191 11.488  35.010 1.00 30.20  ? 251  GLU A C   1 
ATOM   2070 O  O   . GLU A 1 251 ? 24.786 11.857  33.906 1.00 32.14  ? 251  GLU A O   1 
ATOM   2071 C  CB  . GLU A 1 251 ? 23.956 10.259  36.727 1.00 31.23  ? 251  GLU A CB  1 
ATOM   2072 C  CG  . GLU A 1 251 ? 23.547 10.147  38.177 1.00 35.66  ? 251  GLU A CG  1 
ATOM   2073 C  CD  . GLU A 1 251 ? 23.464 8.698   38.636 1.00 37.90  ? 251  GLU A CD  1 
ATOM   2074 O  OE1 . GLU A 1 251 ? 22.575 7.961   38.155 1.00 39.35  ? 251  GLU A OE1 1 
ATOM   2075 O  OE2 . GLU A 1 251 ? 24.298 8.295   39.476 1.00 40.81  ? 251  GLU A OE2 1 
ATOM   2076 N  N   . VAL A 1 252 ? 26.372 10.916  35.202 1.00 28.09  ? 252  VAL A N   1 
ATOM   2077 C  CA  . VAL A 1 252 ? 27.308 10.637  34.123 1.00 27.21  ? 252  VAL A CA  1 
ATOM   2078 C  C   . VAL A 1 252 ? 28.097 9.450   34.647 1.00 29.61  ? 252  VAL A C   1 
ATOM   2079 O  O   . VAL A 1 252 ? 29.149 9.615   35.270 1.00 31.42  ? 252  VAL A O   1 
ATOM   2080 C  CB  . VAL A 1 252 ? 28.234 11.829  33.873 1.00 25.99  ? 252  VAL A CB  1 
ATOM   2081 C  CG1 . VAL A 1 252 ? 29.358 11.442  32.941 1.00 24.58  ? 252  VAL A CG1 1 
ATOM   2082 C  CG2 . VAL A 1 252 ? 27.436 12.966  33.281 1.00 24.82  ? 252  VAL A CG2 1 
ATOM   2083 N  N   . LYS A 1 253 ? 27.557 8.254   34.412 1.00 29.50  ? 253  LYS A N   1 
ATOM   2084 C  CA  . LYS A 1 253 ? 28.155 7.017   34.892 1.00 29.83  ? 253  LYS A CA  1 
ATOM   2085 C  C   . LYS A 1 253 ? 29.677 6.997   34.784 1.00 29.20  ? 253  LYS A C   1 
ATOM   2086 O  O   . LYS A 1 253 ? 30.257 7.414   33.780 1.00 25.98  ? 253  LYS A O   1 
ATOM   2087 C  CB  . LYS A 1 253 ? 27.563 5.822   34.145 1.00 31.79  ? 253  LYS A CB  1 
ATOM   2088 C  CG  . LYS A 1 253 ? 26.050 5.719   34.217 1.00 33.38  ? 253  LYS A CG  1 
ATOM   2089 C  CD  . LYS A 1 253 ? 25.537 4.978   35.454 1.00 34.93  ? 253  LYS A CD  1 
ATOM   2090 C  CE  . LYS A 1 253 ? 24.003 4.837   35.380 1.00 36.79  ? 253  LYS A CE  1 
ATOM   2091 N  NZ  . LYS A 1 253 ? 23.356 4.012   36.448 1.00 35.91  ? 253  LYS A NZ  1 
ATOM   2092 N  N   . GLY A 1 254 ? 30.318 6.512   35.840 1.00 29.22  ? 254  GLY A N   1 
ATOM   2093 C  CA  . GLY A 1 254 ? 31.765 6.442   35.843 1.00 27.50  ? 254  GLY A CA  1 
ATOM   2094 C  C   . GLY A 1 254 ? 32.383 7.732   36.323 1.00 25.62  ? 254  GLY A C   1 
ATOM   2095 O  O   . GLY A 1 254 ? 33.508 7.741   36.812 1.00 23.59  ? 254  GLY A O   1 
ATOM   2096 N  N   . ARG A 1 255 ? 31.648 8.829   36.184 1.00 24.94  ? 255  ARG A N   1 
ATOM   2097 C  CA  . ARG A 1 255 ? 32.158 10.120  36.629 1.00 24.95  ? 255  ARG A CA  1 
ATOM   2098 C  C   . ARG A 1 255 ? 31.305 10.615  37.794 1.00 22.78  ? 255  ARG A C   1 
ATOM   2099 O  O   . ARG A 1 255 ? 30.562 9.855   38.395 1.00 20.03  ? 255  ARG A O   1 
ATOM   2100 C  CB  . ARG A 1 255 ? 32.123 11.160  35.492 1.00 26.51  ? 255  ARG A CB  1 
ATOM   2101 C  CG  . ARG A 1 255 ? 32.718 10.721  34.150 1.00 27.20  ? 255  ARG A CG  1 
ATOM   2102 C  CD  . ARG A 1 255 ? 32.746 11.895  33.176 1.00 26.90  ? 255  ARG A CD  1 
ATOM   2103 N  NE  . ARG A 1 255 ? 32.942 11.510  31.776 1.00 28.97  ? 255  ARG A NE  1 
ATOM   2104 C  CZ  . ARG A 1 255 ? 34.013 10.883  31.292 1.00 28.95  ? 255  ARG A CZ  1 
ATOM   2105 N  NH1 . ARG A 1 255 ? 35.018 10.548  32.083 1.00 28.79  ? 255  ARG A NH1 1 
ATOM   2106 N  NH2 . ARG A 1 255 ? 34.079 10.596  30.001 1.00 28.66  ? 255  ARG A NH2 1 
ATOM   2107 N  N   . ILE A 1 256 ? 31.437 11.896  38.111 1.00 22.42  ? 256  ILE A N   1 
ATOM   2108 C  CA  . ILE A 1 256 ? 30.673 12.494  39.179 1.00 21.05  ? 256  ILE A CA  1 
ATOM   2109 C  C   . ILE A 1 256 ? 30.209 13.866  38.754 1.00 21.79  ? 256  ILE A C   1 
ATOM   2110 O  O   . ILE A 1 256 ? 31.010 14.797  38.678 1.00 20.83  ? 256  ILE A O   1 
ATOM   2111 C  CB  . ILE A 1 256 ? 31.502 12.671  40.455 1.00 21.65  ? 256  ILE A CB  1 
ATOM   2112 C  CG1 . ILE A 1 256 ? 32.117 11.340  40.866 1.00 23.50  ? 256  ILE A CG1 1 
ATOM   2113 C  CG2 . ILE A 1 256 ? 30.618 13.195  41.586 1.00 18.89  ? 256  ILE A CG2 1 
ATOM   2114 C  CD1 . ILE A 1 256 ? 32.850 11.399  42.191 1.00 24.72  ? 256  ILE A CD1 1 
ATOM   2115 N  N   . HIS A 1 257 ? 28.922 13.993  38.450 1.00 22.26  ? 257  HIS A N   1 
ATOM   2116 C  CA  . HIS A 1 257 ? 28.406 15.300  38.100 1.00 21.94  ? 257  HIS A CA  1 
ATOM   2117 C  C   . HIS A 1 257 ? 28.236 16.063  39.405 1.00 23.31  ? 257  HIS A C   1 
ATOM   2118 O  O   . HIS A 1 257 ? 27.256 15.875  40.132 1.00 21.61  ? 257  HIS A O   1 
ATOM   2119 C  CB  . HIS A 1 257 ? 27.043 15.247  37.427 1.00 19.08  ? 257  HIS A CB  1 
ATOM   2120 C  CG  . HIS A 1 257 ? 26.482 16.608  37.155 1.00 16.80  ? 257  HIS A CG  1 
ATOM   2121 N  ND1 . HIS A 1 257 ? 25.139 16.900  37.255 1.00 16.35  ? 257  HIS A ND1 1 
ATOM   2122 C  CD2 . HIS A 1 257 ? 27.094 17.761  36.791 1.00 13.94  ? 257  HIS A CD2 1 
ATOM   2123 C  CE1 . HIS A 1 257 ? 24.948 18.176  36.965 1.00 17.64  ? 257  HIS A CE1 1 
ATOM   2124 N  NE2 . HIS A 1 257 ? 26.119 18.720  36.680 1.00 16.99  ? 257  HIS A NE2 1 
ATOM   2125 N  N   . PHE A 1 258 ? 29.207 16.912  39.703 1.00 23.95  ? 258  PHE A N   1 
ATOM   2126 C  CA  . PHE A 1 258 ? 29.160 17.712  40.908 1.00 24.34  ? 258  PHE A CA  1 
ATOM   2127 C  C   . PHE A 1 258 ? 28.558 19.062  40.535 1.00 22.93  ? 258  PHE A C   1 
ATOM   2128 O  O   . PHE A 1 258 ? 29.277 19.984  40.155 1.00 21.79  ? 258  PHE A O   1 
ATOM   2129 C  CB  . PHE A 1 258 ? 30.583 17.887  41.469 1.00 26.60  ? 258  PHE A CB  1 
ATOM   2130 C  CG  . PHE A 1 258 ? 30.644 18.658  42.768 1.00 27.28  ? 258  PHE A CG  1 
ATOM   2131 C  CD1 . PHE A 1 258 ? 30.268 18.065  43.963 1.00 26.72  ? 258  PHE A CD1 1 
ATOM   2132 C  CD2 . PHE A 1 258 ? 31.061 19.985  42.786 1.00 27.32  ? 258  PHE A CD2 1 
ATOM   2133 C  CE1 . PHE A 1 258 ? 30.308 18.778  45.148 1.00 26.59  ? 258  PHE A CE1 1 
ATOM   2134 C  CE2 . PHE A 1 258 ? 31.102 20.700  43.967 1.00 25.52  ? 258  PHE A CE2 1 
ATOM   2135 C  CZ  . PHE A 1 258 ? 30.724 20.098  45.148 1.00 26.23  ? 258  PHE A CZ  1 
ATOM   2136 N  N   . ASP A 1 259 ? 27.234 19.165  40.599 1.00 23.57  ? 259  ASP A N   1 
ATOM   2137 C  CA  . ASP A 1 259 ? 26.570 20.428  40.292 1.00 23.10  ? 259  ASP A CA  1 
ATOM   2138 C  C   . ASP A 1 259 ? 26.680 21.285  41.553 1.00 22.61  ? 259  ASP A C   1 
ATOM   2139 O  O   . ASP A 1 259 ? 26.301 20.857  42.638 1.00 23.11  ? 259  ASP A O   1 
ATOM   2140 C  CB  . ASP A 1 259 ? 25.111 20.186  39.913 1.00 24.02  ? 259  ASP A CB  1 
ATOM   2141 C  CG  . ASP A 1 259 ? 24.345 21.474  39.712 1.00 26.22  ? 259  ASP A CG  1 
ATOM   2142 O  OD1 . ASP A 1 259 ? 23.184 21.408  39.258 1.00 27.42  ? 259  ASP A OD1 1 
ATOM   2143 O  OD2 . ASP A 1 259 ? 24.893 22.556  40.016 1.00 26.50  ? 259  ASP A OD2 1 
ATOM   2144 N  N   . LEU A 1 260 ? 27.204 22.491  41.386 1.00 22.36  ? 260  LEU A N   1 
ATOM   2145 C  CA  . LEU A 1 260 ? 27.454 23.431  42.471 1.00 23.65  ? 260  LEU A CA  1 
ATOM   2146 C  C   . LEU A 1 260 ? 26.288 24.210  43.061 1.00 25.73  ? 260  LEU A C   1 
ATOM   2147 O  O   . LEU A 1 260 ? 26.393 24.763  44.157 1.00 24.26  ? 260  LEU A O   1 
ATOM   2148 C  CB  . LEU A 1 260 ? 28.505 24.437  42.005 1.00 25.66  ? 260  LEU A CB  1 
ATOM   2149 C  CG  . LEU A 1 260 ? 29.983 24.056  42.084 1.00 26.26  ? 260  LEU A CG  1 
ATOM   2150 C  CD1 . LEU A 1 260 ? 30.782 24.806  41.013 1.00 24.24  ? 260  LEU A CD1 1 
ATOM   2151 C  CD2 . LEU A 1 260 ? 30.484 24.365  43.497 1.00 23.75  ? 260  LEU A CD2 1 
ATOM   2152 N  N   . TYR A 1 261 ? 25.181 24.271  42.345 1.00 28.84  ? 261  TYR A N   1 
ATOM   2153 C  CA  . TYR A 1 261 ? 24.050 25.041  42.829 1.00 31.55  ? 261  TYR A CA  1 
ATOM   2154 C  C   . TYR A 1 261 ? 23.451 24.481  44.116 1.00 31.11  ? 261  TYR A C   1 
ATOM   2155 O  O   . TYR A 1 261 ? 23.560 25.107  45.165 1.00 31.38  ? 261  TYR A O   1 
ATOM   2156 C  CB  . TYR A 1 261 ? 22.991 25.152  41.724 1.00 35.91  ? 261  TYR A CB  1 
ATOM   2157 C  CG  . TYR A 1 261 ? 21.862 26.090  42.045 1.00 37.48  ? 261  TYR A CG  1 
ATOM   2158 C  CD1 . TYR A 1 261 ? 22.070 27.462  42.122 1.00 38.56  ? 261  TYR A CD1 1 
ATOM   2159 C  CD2 . TYR A 1 261 ? 20.589 25.597  42.311 1.00 40.91  ? 261  TYR A CD2 1 
ATOM   2160 C  CE1 . TYR A 1 261 ? 21.031 28.330  42.465 1.00 41.43  ? 261  TYR A CE1 1 
ATOM   2161 C  CE2 . TYR A 1 261 ? 19.543 26.446  42.655 1.00 43.13  ? 261  TYR A CE2 1 
ATOM   2162 C  CZ  . TYR A 1 261 ? 19.768 27.811  42.734 1.00 42.73  ? 261  TYR A CZ  1 
ATOM   2163 O  OH  . TYR A 1 261 ? 18.727 28.637  43.096 1.00 42.98  ? 261  TYR A OH  1 
ATOM   2164 N  N   . PRO A 1 262 ? 22.852 23.279  44.070 1.00 31.48  ? 262  PRO A N   1 
ATOM   2165 C  CA  . PRO A 1 262 ? 22.263 22.730  45.299 1.00 31.66  ? 262  PRO A CA  1 
ATOM   2166 C  C   . PRO A 1 262 ? 23.208 22.763  46.511 1.00 33.95  ? 262  PRO A C   1 
ATOM   2167 O  O   . PRO A 1 262 ? 22.759 22.921  47.655 1.00 33.25  ? 262  PRO A O   1 
ATOM   2168 C  CB  . PRO A 1 262 ? 21.886 21.313  44.891 1.00 29.87  ? 262  PRO A CB  1 
ATOM   2169 C  CG  . PRO A 1 262 ? 22.953 20.964  43.903 1.00 30.35  ? 262  PRO A CG  1 
ATOM   2170 C  CD  . PRO A 1 262 ? 23.027 22.216  43.063 1.00 30.47  ? 262  PRO A CD  1 
ATOM   2171 N  N   . VAL A 1 263 ? 24.510 22.621  46.251 1.00 34.17  ? 263  VAL A N   1 
ATOM   2172 C  CA  . VAL A 1 263 ? 25.521 22.630  47.309 1.00 34.57  ? 263  VAL A CA  1 
ATOM   2173 C  C   . VAL A 1 263 ? 25.757 24.050  47.817 1.00 36.27  ? 263  VAL A C   1 
ATOM   2174 O  O   . VAL A 1 263 ? 25.917 24.276  49.020 1.00 36.45  ? 263  VAL A O   1 
ATOM   2175 C  CB  . VAL A 1 263 ? 26.871 22.058  46.810 1.00 32.94  ? 263  VAL A CB  1 
ATOM   2176 C  CG1 . VAL A 1 263 ? 27.847 21.945  47.960 1.00 30.28  ? 263  VAL A CG1 1 
ATOM   2177 C  CG2 . VAL A 1 263 ? 26.663 20.705  46.180 1.00 33.02  ? 263  VAL A CG2 1 
ATOM   2178 N  N   . ILE A 1 264 ? 25.789 25.001  46.890 1.00 36.82  ? 264  ILE A N   1 
ATOM   2179 C  CA  . ILE A 1 264 ? 25.996 26.398  47.239 1.00 37.01  ? 264  ILE A CA  1 
ATOM   2180 C  C   . ILE A 1 264 ? 24.751 26.941  47.924 1.00 38.30  ? 264  ILE A C   1 
ATOM   2181 O  O   . ILE A 1 264 ? 24.846 27.754  48.834 1.00 38.66  ? 264  ILE A O   1 
ATOM   2182 C  CB  . ILE A 1 264 ? 26.287 27.247  45.979 1.00 37.71  ? 264  ILE A CB  1 
ATOM   2183 C  CG1 . ILE A 1 264 ? 27.765 27.125  45.590 1.00 36.94  ? 264  ILE A CG1 1 
ATOM   2184 C  CG2 . ILE A 1 264 ? 25.872 28.707  46.210 1.00 37.58  ? 264  ILE A CG2 1 
ATOM   2185 C  CD1 . ILE A 1 264 ? 28.673 28.128  46.264 1.00 33.70  ? 264  ILE A CD1 1 
ATOM   2186 N  N   . ARG A 1 265 ? 23.578 26.492  47.492 1.00 40.21  ? 265  ARG A N   1 
ATOM   2187 C  CA  . ARG A 1 265 ? 22.338 26.974  48.092 1.00 42.28  ? 265  ARG A CA  1 
ATOM   2188 C  C   . ARG A 1 265 ? 22.197 26.489  49.542 1.00 42.23  ? 265  ARG A C   1 
ATOM   2189 O  O   . ARG A 1 265 ? 21.573 27.158  50.362 1.00 42.67  ? 265  ARG A O   1 
ATOM   2190 C  CB  . ARG A 1 265 ? 21.133 26.527  47.254 1.00 44.86  ? 265  ARG A CB  1 
ATOM   2191 C  CG  . ARG A 1 265 ? 19.789 26.995  47.788 1.00 49.98  ? 265  ARG A CG  1 
ATOM   2192 C  CD  . ARG A 1 265 ? 19.590 28.496  47.622 1.00 54.14  ? 265  ARG A CD  1 
ATOM   2193 N  NE  . ARG A 1 265 ? 18.829 28.819  46.414 1.00 58.22  ? 265  ARG A NE  1 
ATOM   2194 C  CZ  . ARG A 1 265 ? 17.505 28.705  46.303 1.00 59.06  ? 265  ARG A CZ  1 
ATOM   2195 N  NH1 . ARG A 1 265 ? 16.783 28.276  47.333 1.00 59.06  ? 265  ARG A NH1 1 
ATOM   2196 N  NH2 . ARG A 1 265 ? 16.901 29.011  45.157 1.00 58.72  ? 265  ARG A NH2 1 
ATOM   2197 N  N   . ARG A 1 266 ? 22.785 25.336  49.859 1.00 42.06  ? 266  ARG A N   1 
ATOM   2198 C  CA  . ARG A 1 266 ? 22.724 24.795  51.218 1.00 41.24  ? 266  ARG A CA  1 
ATOM   2199 C  C   . ARG A 1 266 ? 23.796 25.379  52.127 1.00 39.89  ? 266  ARG A C   1 
ATOM   2200 O  O   . ARG A 1 266 ? 23.644 25.389  53.345 1.00 39.97  ? 266  ARG A O   1 
ATOM   2201 C  CB  . ARG A 1 266 ? 22.857 23.257  51.217 1.00 42.68  ? 266  ARG A CB  1 
ATOM   2202 C  CG  . ARG A 1 266 ? 21.562 22.534  50.912 1.00 45.71  ? 266  ARG A CG  1 
ATOM   2203 C  CD  . ARG A 1 266 ? 21.664 21.024  50.985 1.00 46.95  ? 266  ARG A CD  1 
ATOM   2204 N  NE  . ARG A 1 266 ? 20.341 20.404  50.822 1.00 51.63  ? 266  ARG A NE  1 
ATOM   2205 C  CZ  . ARG A 1 266 ? 19.586 20.471  49.719 1.00 50.98  ? 266  ARG A CZ  1 
ATOM   2206 N  NH1 . ARG A 1 266 ? 20.016 21.135  48.645 1.00 48.31  ? 266  ARG A NH1 1 
ATOM   2207 N  NH2 . ARG A 1 266 ? 18.392 19.880  49.693 1.00 47.08  ? 266  ARG A NH2 1 
ATOM   2208 N  N   . THR A 1 267 ? 24.876 25.876  51.539 1.00 38.61  ? 267  THR A N   1 
ATOM   2209 C  CA  . THR A 1 267 ? 25.967 26.420  52.324 1.00 38.10  ? 267  THR A CA  1 
ATOM   2210 C  C   . THR A 1 267 ? 25.909 27.933  52.552 1.00 39.45  ? 267  THR A C   1 
ATOM   2211 O  O   . THR A 1 267 ? 25.649 28.381  53.660 1.00 40.20  ? 267  THR A O   1 
ATOM   2212 C  CB  . THR A 1 267 ? 27.300 26.027  51.680 1.00 38.32  ? 267  THR A CB  1 
ATOM   2213 O  OG1 . THR A 1 267 ? 27.329 24.603  51.501 1.00 37.28  ? 267  THR A OG1 1 
ATOM   2214 C  CG2 . THR A 1 267 ? 28.468 26.440  52.553 1.00 37.81  ? 267  THR A CG2 1 
ATOM   2215 N  N   . ILE A 1 268 ? 26.143 28.726  51.516 1.00 41.33  ? 268  ILE A N   1 
ATOM   2216 C  CA  . ILE A 1 268 ? 26.118 30.183  51.651 1.00 43.54  ? 268  ILE A CA  1 
ATOM   2217 C  C   . ILE A 1 268 ? 24.709 30.766  51.742 1.00 44.69  ? 268  ILE A C   1 
ATOM   2218 O  O   . ILE A 1 268 ? 23.755 30.199  51.220 1.00 45.03  ? 268  ILE A O   1 
ATOM   2219 C  CB  . ILE A 1 268 ? 26.849 30.848  50.465 1.00 43.79  ? 268  ILE A CB  1 
ATOM   2220 C  CG1 . ILE A 1 268 ? 28.285 30.348  50.417 1.00 44.42  ? 268  ILE A CG1 1 
ATOM   2221 C  CG2 . ILE A 1 268 ? 26.855 32.364  50.607 1.00 43.53  ? 268  ILE A CG2 1 
ATOM   2222 C  CD1 . ILE A 1 268 ? 28.974 30.672  49.117 1.00 45.80  ? 268  ILE A CD1 1 
ATOM   2223 N  N   . ASN A 1 269 ? 24.598 31.915  52.401 1.00 46.99  ? 269  ASN A N   1 
ATOM   2224 C  CA  . ASN A 1 269 ? 23.323 32.600  52.572 1.00 49.22  ? 269  ASN A CA  1 
ATOM   2225 C  C   . ASN A 1 269 ? 23.318 33.903  51.771 1.00 49.13  ? 269  ASN A C   1 
ATOM   2226 O  O   . ASN A 1 269 ? 24.154 34.775  51.982 1.00 49.29  ? 269  ASN A O   1 
ATOM   2227 C  CB  . ASN A 1 269 ? 23.095 32.897  54.058 1.00 50.70  ? 269  ASN A CB  1 
ATOM   2228 C  CG  . ASN A 1 269 ? 21.627 32.986  54.416 1.00 51.99  ? 269  ASN A CG  1 
ATOM   2229 O  OD1 . ASN A 1 269 ? 20.908 33.877  53.951 1.00 52.68  ? 269  ASN A OD1 1 
ATOM   2230 N  ND2 . ASN A 1 269 ? 21.168 32.052  55.245 1.00 52.73  ? 269  ASN A ND2 1 
ATOM   2231 N  N   . LEU A 1 270 ? 22.369 34.029  50.854 1.00 50.24  ? 270  LEU A N   1 
ATOM   2232 C  CA  . LEU A 1 270 ? 22.267 35.217  50.014 1.00 51.55  ? 270  LEU A CA  1 
ATOM   2233 C  C   . LEU A 1 270 ? 20.819 35.352  49.572 1.00 53.34  ? 270  LEU A C   1 
ATOM   2234 O  O   . LEU A 1 270 ? 20.024 34.429  49.740 1.00 52.98  ? 270  LEU A O   1 
ATOM   2235 C  CB  . LEU A 1 270 ? 23.138 35.066  48.765 1.00 50.28  ? 270  LEU A CB  1 
ATOM   2236 C  CG  . LEU A 1 270 ? 24.540 34.479  48.936 1.00 49.58  ? 270  LEU A CG  1 
ATOM   2237 C  CD1 . LEU A 1 270 ? 25.030 33.944  47.606 1.00 45.77  ? 270  LEU A CD1 1 
ATOM   2238 C  CD2 . LEU A 1 270 ? 25.479 35.532  49.504 1.00 49.76  ? 270  LEU A CD2 1 
ATOM   2239 N  N   . PRO A 1 271 ? 20.458 36.512  49.005 1.00 55.12  ? 271  PRO A N   1 
ATOM   2240 C  CA  . PRO A 1 271 ? 19.098 36.780  48.526 1.00 55.11  ? 271  PRO A CA  1 
ATOM   2241 C  C   . PRO A 1 271 ? 19.003 36.521  47.026 1.00 56.20  ? 271  PRO A C   1 
ATOM   2242 O  O   . PRO A 1 271 ? 17.908 36.360  46.487 1.00 58.94  ? 271  PRO A O   1 
ATOM   2243 C  CB  . PRO A 1 271 ? 18.917 38.248  48.853 1.00 55.18  ? 271  PRO A CB  1 
ATOM   2244 C  CG  . PRO A 1 271 ? 20.274 38.800  48.508 1.00 54.96  ? 271  PRO A CG  1 
ATOM   2245 C  CD  . PRO A 1 271 ? 21.235 37.765  49.096 1.00 55.06  ? 271  PRO A CD  1 
ATOM   2246 N  N   . THR A 1 272 ? 20.164 36.510  46.364 1.00 55.12  ? 272  THR A N   1 
ATOM   2247 C  CA  . THR A 1 272 ? 20.280 36.270  44.918 1.00 52.27  ? 272  THR A CA  1 
ATOM   2248 C  C   . THR A 1 272 ? 21.334 35.194  44.726 1.00 49.57  ? 272  THR A C   1 
ATOM   2249 O  O   . THR A 1 272 ? 22.372 35.229  45.382 1.00 50.57  ? 272  THR A O   1 
ATOM   2250 C  CB  . THR A 1 272 ? 20.780 37.508  44.167 1.00 52.93  ? 272  THR A CB  1 
ATOM   2251 O  OG1 . THR A 1 272 ? 19.927 38.623  44.450 1.00 56.86  ? 272  THR A OG1 1 
ATOM   2252 C  CG2 . THR A 1 272 ? 20.787 37.246  42.675 1.00 53.26  ? 272  THR A CG2 1 
ATOM   2253 N  N   . TYR A 1 273 ? 21.093 34.251  43.824 1.00 45.71  ? 273  TYR A N   1 
ATOM   2254 C  CA  . TYR A 1 273 ? 22.066 33.195  43.621 1.00 41.58  ? 273  TYR A CA  1 
ATOM   2255 C  C   . TYR A 1 273 ? 22.692 33.091  42.242 1.00 39.36  ? 273  TYR A C   1 
ATOM   2256 O  O   . TYR A 1 273 ? 23.049 31.996  41.795 1.00 39.16  ? 273  TYR A O   1 
ATOM   2257 C  CB  . TYR A 1 273 ? 21.465 31.849  44.031 1.00 41.82  ? 273  TYR A CB  1 
ATOM   2258 C  CG  . TYR A 1 273 ? 21.504 31.637  45.523 1.00 41.23  ? 273  TYR A CG  1 
ATOM   2259 C  CD1 . TYR A 1 273 ? 20.630 32.317  46.364 1.00 41.83  ? 273  TYR A CD1 1 
ATOM   2260 C  CD2 . TYR A 1 273 ? 22.468 30.813  46.102 1.00 41.70  ? 273  TYR A CD2 1 
ATOM   2261 C  CE1 . TYR A 1 273 ? 20.713 32.187  47.754 1.00 42.14  ? 273  TYR A CE1 1 
ATOM   2262 C  CE2 . TYR A 1 273 ? 22.563 30.676  47.485 1.00 42.47  ? 273  TYR A CE2 1 
ATOM   2263 C  CZ  . TYR A 1 273 ? 21.681 31.367  48.311 1.00 42.27  ? 273  TYR A CZ  1 
ATOM   2264 O  OH  . TYR A 1 273 ? 21.765 31.239  49.686 1.00 39.97  ? 273  TYR A OH  1 
ATOM   2265 N  N   . THR A 1 274 ? 22.846 34.226  41.571 1.00 36.50  ? 274  THR A N   1 
ATOM   2266 C  CA  . THR A 1 274 ? 23.465 34.220  40.252 1.00 35.67  ? 274  THR A CA  1 
ATOM   2267 C  C   . THR A 1 274 ? 24.926 33.833  40.426 1.00 34.74  ? 274  THR A C   1 
ATOM   2268 O  O   . THR A 1 274 ? 25.516 34.080  41.476 1.00 34.21  ? 274  THR A O   1 
ATOM   2269 C  CB  . THR A 1 274 ? 23.405 35.615  39.577 1.00 35.10  ? 274  THR A CB  1 
ATOM   2270 O  OG1 . THR A 1 274 ? 24.348 36.497  40.195 1.00 34.68  ? 274  THR A OG1 1 
ATOM   2271 C  CG2 . THR A 1 274 ? 22.011 36.207  39.713 1.00 34.68  ? 274  THR A CG2 1 
ATOM   2272 N  N   . LEU A 1 275 ? 25.515 33.221  39.408 1.00 33.90  ? 275  LEU A N   1 
ATOM   2273 C  CA  . LEU A 1 275 ? 26.915 32.850  39.511 1.00 33.33  ? 275  LEU A CA  1 
ATOM   2274 C  C   . LEU A 1 275 ? 27.741 34.081  39.915 1.00 33.23  ? 275  LEU A C   1 
ATOM   2275 O  O   . LEU A 1 275 ? 28.598 33.995  40.782 1.00 33.14  ? 275  LEU A O   1 
ATOM   2276 C  CB  . LEU A 1 275 ? 27.429 32.307  38.180 1.00 32.81  ? 275  LEU A CB  1 
ATOM   2277 C  CG  . LEU A 1 275 ? 28.389 31.117  38.272 1.00 32.85  ? 275  LEU A CG  1 
ATOM   2278 C  CD1 . LEU A 1 275 ? 29.232 31.072  37.012 1.00 32.41  ? 275  LEU A CD1 1 
ATOM   2279 C  CD2 . LEU A 1 275 ? 29.277 31.226  39.504 1.00 32.59  ? 275  LEU A CD2 1 
ATOM   2280 N  N   . GLU A 1 276 ? 27.483 35.229  39.294 1.00 34.28  ? 276  GLU A N   1 
ATOM   2281 C  CA  . GLU A 1 276 ? 28.235 36.434  39.633 1.00 35.12  ? 276  GLU A CA  1 
ATOM   2282 C  C   . GLU A 1 276 ? 28.021 36.797  41.100 1.00 36.51  ? 276  GLU A C   1 
ATOM   2283 O  O   . GLU A 1 276 ? 28.967 37.135  41.812 1.00 36.47  ? 276  GLU A O   1 
ATOM   2284 C  CB  . GLU A 1 276 ? 27.824 37.620  38.748 1.00 34.65  ? 276  GLU A CB  1 
ATOM   2285 C  CG  . GLU A 1 276 ? 28.229 37.512  37.287 1.00 33.73  ? 276  GLU A CG  1 
ATOM   2286 C  CD  . GLU A 1 276 ? 27.446 36.445  36.567 1.00 36.25  ? 276  GLU A CD  1 
ATOM   2287 O  OE1 . GLU A 1 276 ? 26.219 36.393  36.794 1.00 38.07  ? 276  GLU A OE1 1 
ATOM   2288 O  OE2 . GLU A 1 276 ? 28.036 35.668  35.780 1.00 34.38  ? 276  GLU A OE2 1 
ATOM   2289 N  N   . ALA A 1 277 ? 26.775 36.732  41.554 1.00 37.55  ? 277  ALA A N   1 
ATOM   2290 C  CA  . ALA A 1 277 ? 26.476 37.058  42.940 1.00 37.05  ? 277  ALA A CA  1 
ATOM   2291 C  C   . ALA A 1 277 ? 27.304 36.143  43.820 1.00 36.72  ? 277  ALA A C   1 
ATOM   2292 O  O   . ALA A 1 277 ? 27.985 36.597  44.735 1.00 37.97  ? 277  ALA A O   1 
ATOM   2293 C  CB  . ALA A 1 277 ? 24.992 36.868  43.224 1.00 37.18  ? 277  ALA A CB  1 
ATOM   2294 N  N   . VAL A 1 278 ? 27.256 34.852  43.516 1.00 36.19  ? 278  VAL A N   1 
ATOM   2295 C  CA  . VAL A 1 278 ? 27.995 33.848  44.271 1.00 35.34  ? 278  VAL A CA  1 
ATOM   2296 C  C   . VAL A 1 278 ? 29.507 34.081  44.294 1.00 35.60  ? 278  VAL A C   1 
ATOM   2297 O  O   . VAL A 1 278 ? 30.099 34.249  45.365 1.00 34.33  ? 278  VAL A O   1 
ATOM   2298 C  CB  . VAL A 1 278 ? 27.704 32.437  43.717 1.00 34.26  ? 278  VAL A CB  1 
ATOM   2299 C  CG1 . VAL A 1 278 ? 28.508 31.393  44.474 1.00 34.14  ? 278  VAL A CG1 1 
ATOM   2300 C  CG2 . VAL A 1 278 ? 26.219 32.145  43.832 1.00 34.63  ? 278  VAL A CG2 1 
ATOM   2301 N  N   . TYR A 1 279 ? 30.126 34.091  43.116 1.00 36.18  ? 279  TYR A N   1 
ATOM   2302 C  CA  . TYR A 1 279 ? 31.567 34.291  43.016 1.00 38.55  ? 279  TYR A CA  1 
ATOM   2303 C  C   . TYR A 1 279 ? 32.001 35.410  43.961 1.00 40.40  ? 279  TYR A C   1 
ATOM   2304 O  O   . TYR A 1 279 ? 32.938 35.255  44.748 1.00 41.80  ? 279  TYR A O   1 
ATOM   2305 C  CB  . TYR A 1 279 ? 31.971 34.644  41.578 1.00 36.94  ? 279  TYR A CB  1 
ATOM   2306 C  CG  . TYR A 1 279 ? 33.467 34.638  41.375 1.00 35.57  ? 279  TYR A CG  1 
ATOM   2307 C  CD1 . TYR A 1 279 ? 34.199 33.464  41.527 1.00 35.67  ? 279  TYR A CD1 1 
ATOM   2308 C  CD2 . TYR A 1 279 ? 34.161 35.811  41.092 1.00 34.26  ? 279  TYR A CD2 1 
ATOM   2309 C  CE1 . TYR A 1 279 ? 35.588 33.458  41.405 1.00 35.68  ? 279  TYR A CE1 1 
ATOM   2310 C  CE2 . TYR A 1 279 ? 35.550 35.815  40.971 1.00 33.85  ? 279  TYR A CE2 1 
ATOM   2311 C  CZ  . TYR A 1 279 ? 36.257 34.634  41.130 1.00 34.60  ? 279  TYR A CZ  1 
ATOM   2312 O  OH  . TYR A 1 279 ? 37.629 34.613  41.017 1.00 34.38  ? 279  TYR A OH  1 
ATOM   2313 N  N   . GLU A 1 280 ? 31.298 36.530  43.875 1.00 41.35  ? 280  GLU A N   1 
ATOM   2314 C  CA  . GLU A 1 280 ? 31.559 37.698  44.704 1.00 42.61  ? 280  GLU A CA  1 
ATOM   2315 C  C   . GLU A 1 280 ? 31.520 37.328  46.190 1.00 43.14  ? 280  GLU A C   1 
ATOM   2316 O  O   . GLU A 1 280 ? 32.488 37.531  46.930 1.00 42.82  ? 280  GLU A O   1 
ATOM   2317 C  CB  . GLU A 1 280 ? 30.488 38.754  44.416 1.00 44.20  ? 280  GLU A CB  1 
ATOM   2318 C  CG  . GLU A 1 280 ? 30.649 40.046  45.165 1.00 44.63  ? 280  GLU A CG  1 
ATOM   2319 C  CD  . GLU A 1 280 ? 31.636 40.955  44.500 1.00 44.47  ? 280  GLU A CD  1 
ATOM   2320 O  OE1 . GLU A 1 280 ? 31.328 41.446  43.397 1.00 44.63  ? 280  GLU A OE1 1 
ATOM   2321 O  OE2 . GLU A 1 280 ? 32.719 41.172  45.073 1.00 45.87  ? 280  GLU A OE2 1 
ATOM   2322 N  N   . ALA A 1 281 ? 30.384 36.780  46.613 1.00 42.90  ? 281  ALA A N   1 
ATOM   2323 C  CA  . ALA A 1 281 ? 30.176 36.400  48.000 1.00 42.18  ? 281  ALA A CA  1 
ATOM   2324 C  C   . ALA A 1 281 ? 31.149 35.353  48.481 1.00 41.78  ? 281  ALA A C   1 
ATOM   2325 O  O   . ALA A 1 281 ? 31.213 35.082  49.670 1.00 43.64  ? 281  ALA A O   1 
ATOM   2326 C  CB  . ALA A 1 281 ? 28.755 35.900  48.198 1.00 40.95  ? 281  ALA A CB  1 
ATOM   2327 N  N   . VAL A 1 282 ? 31.920 34.767  47.576 1.00 42.59  ? 282  VAL A N   1 
ATOM   2328 C  CA  . VAL A 1 282 ? 32.862 33.728  47.987 1.00 42.86  ? 282  VAL A CA  1 
ATOM   2329 C  C   . VAL A 1 282 ? 34.332 34.117  48.001 1.00 43.00  ? 282  VAL A C   1 
ATOM   2330 O  O   . VAL A 1 282 ? 35.076 33.706  48.894 1.00 43.43  ? 282  VAL A O   1 
ATOM   2331 C  CB  . VAL A 1 282 ? 32.721 32.473  47.111 1.00 41.78  ? 282  VAL A CB  1 
ATOM   2332 C  CG1 . VAL A 1 282 ? 33.718 31.415  47.541 1.00 39.97  ? 282  VAL A CG1 1 
ATOM   2333 C  CG2 . VAL A 1 282 ? 31.320 31.940  47.219 1.00 42.91  ? 282  VAL A CG2 1 
ATOM   2334 N  N   . PHE A 1 283 ? 34.764 34.896  47.020 1.00 42.58  ? 283  PHE A N   1 
ATOM   2335 C  CA  . PHE A 1 283 ? 36.166 35.273  46.982 1.00 42.32  ? 283  PHE A CA  1 
ATOM   2336 C  C   . PHE A 1 283 ? 36.371 36.773  47.041 1.00 42.20  ? 283  PHE A C   1 
ATOM   2337 O  O   . PHE A 1 283 ? 37.507 37.248  47.008 1.00 42.34  ? 283  PHE A O   1 
ATOM   2338 C  CB  . PHE A 1 283 ? 36.840 34.696  45.733 1.00 40.92  ? 283  PHE A CB  1 
ATOM   2339 C  CG  . PHE A 1 283 ? 36.715 33.191  45.596 1.00 37.75  ? 283  PHE A CG  1 
ATOM   2340 C  CD1 . PHE A 1 283 ? 35.646 32.625  44.910 1.00 37.11  ? 283  PHE A CD1 1 
ATOM   2341 C  CD2 . PHE A 1 283 ? 37.696 32.348  46.097 1.00 35.94  ? 283  PHE A CD2 1 
ATOM   2342 C  CE1 . PHE A 1 283 ? 35.568 31.243  44.717 1.00 34.00  ? 283  PHE A CE1 1 
ATOM   2343 C  CE2 . PHE A 1 283 ? 37.622 30.974  45.909 1.00 34.71  ? 283  PHE A CE2 1 
ATOM   2344 C  CZ  . PHE A 1 283 ? 36.556 30.424  45.216 1.00 33.42  ? 283  PHE A CZ  1 
ATOM   2345 N  N   . GLY A 1 284 ? 35.268 37.510  47.126 1.00 42.13  ? 284  GLY A N   1 
ATOM   2346 C  CA  . GLY A 1 284 ? 35.338 38.959  47.214 1.00 44.39  ? 284  GLY A CA  1 
ATOM   2347 C  C   . GLY A 1 284 ? 35.758 39.722  45.969 1.00 45.84  ? 284  GLY A C   1 
ATOM   2348 O  O   . GLY A 1 284 ? 36.120 40.891  46.057 1.00 46.24  ? 284  GLY A O   1 
ATOM   2349 N  N   . GLN A 1 285 ? 35.715 39.068  44.814 1.00 47.66  ? 285  GLN A N   1 
ATOM   2350 C  CA  . GLN A 1 285 ? 36.071 39.688  43.537 1.00 48.38  ? 285  GLN A CA  1 
ATOM   2351 C  C   . GLN A 1 285 ? 34.810 39.904  42.706 1.00 48.58  ? 285  GLN A C   1 
ATOM   2352 O  O   . GLN A 1 285 ? 33.857 39.135  42.808 1.00 49.46  ? 285  GLN A O   1 
ATOM   2353 C  CB  . GLN A 1 285 ? 37.016 38.775  42.749 1.00 49.48  ? 285  GLN A CB  1 
ATOM   2354 C  CG  . GLN A 1 285 ? 38.420 38.663  43.316 1.00 52.52  ? 285  GLN A CG  1 
ATOM   2355 C  CD  . GLN A 1 285 ? 39.374 39.680  42.719 1.00 52.70  ? 285  GLN A CD  1 
ATOM   2356 O  OE1 . GLN A 1 285 ? 39.096 40.885  42.710 1.00 52.27  ? 285  GLN A OE1 1 
ATOM   2357 N  NE2 . GLN A 1 285 ? 40.511 39.198  42.216 1.00 51.58  ? 285  GLN A NE2 1 
ATOM   2358 N  N   . PRO A 1 286 ? 34.778 40.966  41.886 1.00 48.67  ? 286  PRO A N   1 
ATOM   2359 C  CA  . PRO A 1 286 ? 33.604 41.229  41.051 1.00 48.23  ? 286  PRO A CA  1 
ATOM   2360 C  C   . PRO A 1 286 ? 33.565 40.292  39.849 1.00 48.97  ? 286  PRO A C   1 
ATOM   2361 O  O   . PRO A 1 286 ? 34.605 39.855  39.357 1.00 48.46  ? 286  PRO A O   1 
ATOM   2362 C  CB  . PRO A 1 286 ? 33.799 42.679  40.629 1.00 47.73  ? 286  PRO A CB  1 
ATOM   2363 C  CG  . PRO A 1 286 ? 34.560 43.259  41.769 1.00 48.50  ? 286  PRO A CG  1 
ATOM   2364 C  CD  . PRO A 1 286 ? 35.581 42.189  42.037 1.00 49.13  ? 286  PRO A CD  1 
ATOM   2365 N  N   . LYS A 1 287 ? 32.359 39.996  39.375 1.00 50.66  ? 287  LYS A N   1 
ATOM   2366 C  CA  . LYS A 1 287 ? 32.160 39.114  38.227 1.00 51.34  ? 287  LYS A CA  1 
ATOM   2367 C  C   . LYS A 1 287 ? 31.349 39.882  37.189 1.00 53.67  ? 287  LYS A C   1 
ATOM   2368 O  O   . LYS A 1 287 ? 30.353 40.525  37.524 1.00 55.00  ? 287  LYS A O   1 
ATOM   2369 C  CB  . LYS A 1 287 ? 31.389 37.877  38.675 1.00 49.63  ? 287  LYS A CB  1 
ATOM   2370 C  CG  . LYS A 1 287 ? 31.824 36.572  38.051 1.00 47.78  ? 287  LYS A CG  1 
ATOM   2371 C  CD  . LYS A 1 287 ? 31.269 36.383  36.664 1.00 44.45  ? 287  LYS A CD  1 
ATOM   2372 C  CE  . LYS A 1 287 ? 31.459 34.955  36.209 1.00 40.70  ? 287  LYS A CE  1 
ATOM   2373 N  NZ  . LYS A 1 287 ? 31.136 34.837  34.775 1.00 42.01  ? 287  LYS A NZ  1 
ATOM   2374 N  N   . GLU A 1 288 ? 31.772 39.833  35.934 1.00 55.74  ? 288  GLU A N   1 
ATOM   2375 C  CA  . GLU A 1 288 ? 31.044 40.536  34.892 1.00 59.48  ? 288  GLU A CA  1 
ATOM   2376 C  C   . GLU A 1 288 ? 29.958 39.670  34.272 1.00 60.36  ? 288  GLU A C   1 
ATOM   2377 O  O   . GLU A 1 288 ? 30.222 38.594  33.742 1.00 60.19  ? 288  GLU A O   1 
ATOM   2378 C  CB  . GLU A 1 288 ? 32.011 41.034  33.814 1.00 63.02  ? 288  GLU A CB  1 
ATOM   2379 C  CG  . GLU A 1 288 ? 32.385 42.499  33.987 1.00 67.81  ? 288  GLU A CG  1 
ATOM   2380 C  CD  . GLU A 1 288 ? 32.620 42.867  35.449 1.00 70.57  ? 288  GLU A CD  1 
ATOM   2381 O  OE1 . GLU A 1 288 ? 33.607 42.371  36.036 1.00 71.49  ? 288  GLU A OE1 1 
ATOM   2382 O  OE2 . GLU A 1 288 ? 31.812 43.643  36.014 1.00 70.89  ? 288  GLU A OE2 1 
ATOM   2383 N  N   . LYS A 1 289 ? 28.725 40.143  34.352 1.00 61.65  ? 289  LYS A N   1 
ATOM   2384 C  CA  . LYS A 1 289 ? 27.613 39.406  33.787 1.00 63.15  ? 289  LYS A CA  1 
ATOM   2385 C  C   . LYS A 1 289 ? 27.158 40.018  32.476 1.00 64.49  ? 289  LYS A C   1 
ATOM   2386 O  O   . LYS A 1 289 ? 26.962 41.230  32.366 1.00 64.17  ? 289  LYS A O   1 
ATOM   2387 C  CB  . LYS A 1 289 ? 26.436 39.365  34.762 1.00 63.31  ? 289  LYS A CB  1 
ATOM   2388 C  CG  . LYS A 1 289 ? 25.116 38.935  34.130 1.00 64.43  ? 289  LYS A CG  1 
ATOM   2389 C  CD  . LYS A 1 289 ? 25.226 37.574  33.449 1.00 66.94  ? 289  LYS A CD  1 
ATOM   2390 C  CE  . LYS A 1 289 ? 23.905 37.141  32.802 1.00 67.19  ? 289  LYS A CE  1 
ATOM   2391 N  NZ  . LYS A 1 289 ? 24.011 35.799  32.146 1.00 65.37  ? 289  LYS A NZ  1 
ATOM   2392 N  N   . VAL A 1 290 ? 27.007 39.159  31.480 1.00 65.81  ? 290  VAL A N   1 
ATOM   2393 C  CA  . VAL A 1 290 ? 26.546 39.568  30.172 1.00 66.78  ? 290  VAL A CA  1 
ATOM   2394 C  C   . VAL A 1 290 ? 25.232 38.837  30.011 1.00 67.79  ? 290  VAL A C   1 
ATOM   2395 O  O   . VAL A 1 290 ? 25.181 37.618  30.140 1.00 68.13  ? 290  VAL A O   1 
ATOM   2396 C  CB  . VAL A 1 290 ? 27.515 39.128  29.080 1.00 66.80  ? 290  VAL A CB  1 
ATOM   2397 C  CG1 . VAL A 1 290 ? 26.951 39.499  27.716 1.00 66.60  ? 290  VAL A CG1 1 
ATOM   2398 C  CG2 . VAL A 1 290 ? 28.879 39.776  29.312 1.00 66.32  ? 290  VAL A CG2 1 
ATOM   2399 N  N   . TYR A 1 291 ? 24.170 39.584  29.738 1.00 69.61  ? 291  TYR A N   1 
ATOM   2400 C  CA  . TYR A 1 291 ? 22.843 39.001  29.601 1.00 71.00  ? 291  TYR A CA  1 
ATOM   2401 C  C   . TYR A 1 291 ? 22.471 38.560  28.192 1.00 72.02  ? 291  TYR A C   1 
ATOM   2402 O  O   . TYR A 1 291 ? 22.966 39.099  27.203 1.00 71.98  ? 291  TYR A O   1 
ATOM   2403 C  CB  . TYR A 1 291 ? 21.801 39.988  30.119 1.00 71.06  ? 291  TYR A CB  1 
ATOM   2404 C  CG  . TYR A 1 291 ? 22.157 40.581  31.461 1.00 71.11  ? 291  TYR A CG  1 
ATOM   2405 C  CD1 . TYR A 1 291 ? 23.138 41.568  31.570 1.00 70.77  ? 291  TYR A CD1 1 
ATOM   2406 C  CD2 . TYR A 1 291 ? 21.515 40.155  32.622 1.00 70.57  ? 291  TYR A CD2 1 
ATOM   2407 C  CE1 . TYR A 1 291 ? 23.467 42.115  32.797 1.00 71.79  ? 291  TYR A CE1 1 
ATOM   2408 C  CE2 . TYR A 1 291 ? 21.835 40.692  33.855 1.00 71.56  ? 291  TYR A CE2 1 
ATOM   2409 C  CZ  . TYR A 1 291 ? 22.810 41.676  33.940 1.00 72.97  ? 291  TYR A CZ  1 
ATOM   2410 O  OH  . TYR A 1 291 ? 23.112 42.237  35.166 1.00 73.86  ? 291  TYR A OH  1 
ATOM   2411 N  N   . ALA A 1 292 ? 21.585 37.572  28.119 1.00 73.67  ? 292  ALA A N   1 
ATOM   2412 C  CA  . ALA A 1 292 ? 21.122 37.031  26.850 1.00 75.00  ? 292  ALA A CA  1 
ATOM   2413 C  C   . ALA A 1 292 ? 20.726 38.167  25.917 1.00 76.04  ? 292  ALA A C   1 
ATOM   2414 O  O   . ALA A 1 292 ? 21.287 38.318  24.832 1.00 76.26  ? 292  ALA A O   1 
ATOM   2415 C  CB  . ALA A 1 292 ? 19.935 36.098  27.084 1.00 74.49  ? 292  ALA A CB  1 
ATOM   2416 N  N   . GLU A 1 293 ? 19.755 38.963  26.353 1.00 76.95  ? 293  GLU A N   1 
ATOM   2417 C  CA  . GLU A 1 293 ? 19.271 40.097  25.578 1.00 77.96  ? 293  GLU A CA  1 
ATOM   2418 C  C   . GLU A 1 293 ? 20.417 40.720  24.792 1.00 78.39  ? 293  GLU A C   1 
ATOM   2419 O  O   . GLU A 1 293 ? 20.275 41.058  23.618 1.00 78.03  ? 293  GLU A O   1 
ATOM   2420 C  CB  . GLU A 1 293 ? 18.677 41.146  26.520 1.00 79.74  ? 293  GLU A CB  1 
ATOM   2421 C  CG  . GLU A 1 293 ? 17.580 40.621  27.430 1.00 81.32  ? 293  GLU A CG  1 
ATOM   2422 C  CD  . GLU A 1 293 ? 16.341 40.199  26.664 1.00 82.86  ? 293  GLU A CD  1 
ATOM   2423 O  OE1 . GLU A 1 293 ? 15.369 39.751  27.310 1.00 84.01  ? 293  GLU A OE1 1 
ATOM   2424 O  OE2 . GLU A 1 293 ? 16.336 40.317  25.418 1.00 83.13  ? 293  GLU A OE2 1 
ATOM   2425 N  N   . GLU A 1 294 ? 21.555 40.855  25.466 1.00 79.17  ? 294  GLU A N   1 
ATOM   2426 C  CA  . GLU A 1 294 ? 22.764 41.443  24.898 1.00 79.38  ? 294  GLU A CA  1 
ATOM   2427 C  C   . GLU A 1 294 ? 23.504 40.445  24.028 1.00 79.46  ? 294  GLU A C   1 
ATOM   2428 O  O   . GLU A 1 294 ? 24.056 40.801  22.990 1.00 79.02  ? 294  GLU A O   1 
ATOM   2429 C  CB  . GLU A 1 294 ? 23.681 41.894  26.031 1.00 80.00  ? 294  GLU A CB  1 
ATOM   2430 C  CG  . GLU A 1 294 ? 24.887 42.703  25.611 1.00 79.74  ? 294  GLU A CG  1 
ATOM   2431 C  CD  . GLU A 1 294 ? 25.739 43.100  26.806 1.00 80.32  ? 294  GLU A CD  1 
ATOM   2432 O  OE1 . GLU A 1 294 ? 25.161 43.433  27.866 1.00 79.79  ? 294  GLU A OE1 1 
ATOM   2433 O  OE2 . GLU A 1 294 ? 26.983 43.089  26.683 1.00 80.02  ? 294  GLU A OE2 1 
ATOM   2434 N  N   . ILE A 1 295 ? 23.520 39.195  24.471 1.00 79.85  ? 295  ILE A N   1 
ATOM   2435 C  CA  . ILE A 1 295 ? 24.195 38.131  23.746 1.00 80.57  ? 295  ILE A CA  1 
ATOM   2436 C  C   . ILE A 1 295 ? 23.564 37.916  22.383 1.00 81.05  ? 295  ILE A C   1 
ATOM   2437 O  O   . ILE A 1 295 ? 24.250 37.946  21.363 1.00 81.61  ? 295  ILE A O   1 
ATOM   2438 C  CB  . ILE A 1 295 ? 24.125 36.794  24.506 1.00 80.66  ? 295  ILE A CB  1 
ATOM   2439 C  CG1 . ILE A 1 295 ? 24.602 36.977  25.951 1.00 79.32  ? 295  ILE A CG1 1 
ATOM   2440 C  CG2 . ILE A 1 295 ? 24.968 35.751  23.775 1.00 80.36  ? 295  ILE A CG2 1 
ATOM   2441 C  CD1 . ILE A 1 295 ? 24.427 35.743  26.809 1.00 77.35  ? 295  ILE A CD1 1 
ATOM   2442 N  N   . THR A 1 296 ? 22.255 37.685  22.373 1.00 81.29  ? 296  THR A N   1 
ATOM   2443 C  CA  . THR A 1 296 ? 21.530 37.455  21.131 1.00 81.79  ? 296  THR A CA  1 
ATOM   2444 C  C   . THR A 1 296 ? 21.942 38.487  20.088 1.00 82.55  ? 296  THR A C   1 
ATOM   2445 O  O   . THR A 1 296 ? 22.542 38.152  19.062 1.00 81.67  ? 296  THR A O   1 
ATOM   2446 C  CB  . THR A 1 296 ? 19.989 37.513  21.362 1.00 81.69  ? 296  THR A CB  1 
ATOM   2447 O  OG1 . THR A 1 296 ? 19.307 37.448  20.105 1.00 81.15  ? 296  THR A OG1 1 
ATOM   2448 C  CG2 . THR A 1 296 ? 19.592 38.790  22.077 1.00 82.42  ? 296  THR A CG2 1 
ATOM   2449 N  N   . THR A 1 297 ? 21.640 39.746  20.376 1.00 83.92  ? 297  THR A N   1 
ATOM   2450 C  CA  . THR A 1 297 ? 21.956 40.851  19.482 1.00 85.00  ? 297  THR A CA  1 
ATOM   2451 C  C   . THR A 1 297 ? 23.423 41.262  19.549 1.00 84.95  ? 297  THR A C   1 
ATOM   2452 O  O   . THR A 1 297 ? 23.748 42.445  19.540 1.00 83.99  ? 297  THR A O   1 
ATOM   2453 C  CB  . THR A 1 297 ? 21.061 42.067  19.803 1.00 85.75  ? 297  THR A CB  1 
ATOM   2454 O  OG1 . THR A 1 297 ? 20.710 42.048  21.194 1.00 86.59  ? 297  THR A OG1 1 
ATOM   2455 C  CG2 . THR A 1 297 ? 19.792 42.030  18.969 1.00 86.48  ? 297  THR A CG2 1 
ATOM   2456 N  N   . ALA A 1 298 ? 24.304 40.271  19.613 1.00 86.49  ? 298  ALA A N   1 
ATOM   2457 C  CA  . ALA A 1 298 ? 25.740 40.516  19.675 1.00 88.63  ? 298  ALA A CA  1 
ATOM   2458 C  C   . ALA A 1 298 ? 26.436 39.495  18.797 1.00 89.88  ? 298  ALA A C   1 
ATOM   2459 O  O   . ALA A 1 298 ? 27.458 39.783  18.180 1.00 90.27  ? 298  ALA A O   1 
ATOM   2460 C  CB  . ALA A 1 298 ? 26.239 40.391  21.106 1.00 89.18  ? 298  ALA A CB  1 
ATOM   2461 N  N   . TRP A 1 299 ? 25.866 38.297  18.752 1.00 91.48  ? 299  TRP A N   1 
ATOM   2462 C  CA  . TRP A 1 299 ? 26.408 37.213  17.944 1.00 93.26  ? 299  TRP A CA  1 
ATOM   2463 C  C   . TRP A 1 299 ? 25.850 37.319  16.529 1.00 95.32  ? 299  TRP A C   1 
ATOM   2464 O  O   . TRP A 1 299 ? 26.356 36.693  15.594 1.00 94.75  ? 299  TRP A O   1 
ATOM   2465 C  CB  . TRP A 1 299 ? 26.062 35.860  18.595 1.00 91.96  ? 299  TRP A CB  1 
ATOM   2466 C  CG  . TRP A 1 299 ? 25.348 34.838  17.730 1.00 90.32  ? 299  TRP A CG  1 
ATOM   2467 C  CD1 . TRP A 1 299 ? 24.041 34.868  17.322 1.00 90.34  ? 299  TRP A CD1 1 
ATOM   2468 C  CD2 . TRP A 1 299 ? 25.900 33.623  17.206 1.00 88.79  ? 299  TRP A CD2 1 
ATOM   2469 N  NE1 . TRP A 1 299 ? 23.749 33.747  16.579 1.00 88.68  ? 299  TRP A NE1 1 
ATOM   2470 C  CE2 . TRP A 1 299 ? 24.876 32.967  16.493 1.00 88.37  ? 299  TRP A CE2 1 
ATOM   2471 C  CE3 . TRP A 1 299 ? 27.165 33.023  17.270 1.00 87.54  ? 299  TRP A CE3 1 
ATOM   2472 C  CZ2 . TRP A 1 299 ? 25.075 31.748  15.850 1.00 87.91  ? 299  TRP A CZ2 1 
ATOM   2473 C  CZ3 . TRP A 1 299 ? 27.362 31.810  16.631 1.00 86.55  ? 299  TRP A CZ3 1 
ATOM   2474 C  CH2 . TRP A 1 299 ? 26.325 31.188  15.932 1.00 87.27  ? 299  TRP A CH2 1 
ATOM   2475 N  N   . GLU A 1 300 ? 24.812 38.138  16.384 1.00 98.09  ? 300  GLU A N   1 
ATOM   2476 C  CA  . GLU A 1 300 ? 24.164 38.351  15.094 1.00 100.57 ? 300  GLU A CA  1 
ATOM   2477 C  C   . GLU A 1 300 ? 24.806 39.536  14.372 1.00 100.92 ? 300  GLU A C   1 
ATOM   2478 O  O   . GLU A 1 300 ? 25.376 39.380  13.288 1.00 101.22 ? 300  GLU A O   1 
ATOM   2479 C  CB  . GLU A 1 300 ? 22.665 38.600  15.302 1.00 101.87 ? 300  GLU A CB  1 
ATOM   2480 C  CG  . GLU A 1 300 ? 21.996 37.540  16.179 1.00 104.34 ? 300  GLU A CG  1 
ATOM   2481 C  CD  . GLU A 1 300 ? 20.480 37.663  16.239 1.00 105.94 ? 300  GLU A CD  1 
ATOM   2482 O  OE1 . GLU A 1 300 ? 19.976 38.728  16.660 1.00 106.93 ? 300  GLU A OE1 1 
ATOM   2483 O  OE2 . GLU A 1 300 ? 19.790 36.685  15.871 1.00 106.76 ? 300  GLU A OE2 1 
ATOM   2484 N  N   . THR A 1 301 ? 24.710 40.713  14.985 1.00 101.09 ? 301  THR A N   1 
ATOM   2485 C  CA  . THR A 1 301 ? 25.277 41.932  14.424 1.00 101.18 ? 301  THR A CA  1 
ATOM   2486 C  C   . THR A 1 301 ? 26.618 41.639  13.781 1.00 100.59 ? 301  THR A C   1 
ATOM   2487 O  O   . THR A 1 301 ? 26.770 41.707  12.561 1.00 100.41 ? 301  THR A O   1 
ATOM   2488 C  CB  . THR A 1 301 ? 25.485 43.000  15.519 1.00 101.91 ? 301  THR A CB  1 
ATOM   2489 O  OG1 . THR A 1 301 ? 24.212 43.386  16.050 1.00 102.56 ? 301  THR A OG1 1 
ATOM   2490 C  CG2 . THR A 1 301 ? 26.200 44.233  14.954 1.00 102.19 ? 301  THR A CG2 1 
ATOM   2491 N  N   . GLY A 1 302 ? 27.588 41.306  14.620 1.00 99.83  ? 302  GLY A N   1 
ATOM   2492 C  CA  . GLY A 1 302 ? 28.917 41.010  14.138 1.00 99.54  ? 302  GLY A CA  1 
ATOM   2493 C  C   . GLY A 1 302 ? 29.758 40.708  15.348 1.00 98.95  ? 302  GLY A C   1 
ATOM   2494 O  O   . GLY A 1 302 ? 29.715 39.597  15.857 1.00 98.87  ? 302  GLY A O   1 
ATOM   2495 N  N   . GLU A 1 303 ? 30.520 41.684  15.824 1.00 99.26  ? 303  GLU A N   1 
ATOM   2496 C  CA  . GLU A 1 303 ? 31.326 41.431  17.002 1.00 99.43  ? 303  GLU A CA  1 
ATOM   2497 C  C   . GLU A 1 303 ? 30.812 42.086  18.274 1.00 98.90  ? 303  GLU A C   1 
ATOM   2498 O  O   . GLU A 1 303 ? 30.206 43.157  18.274 1.00 98.47  ? 303  GLU A O   1 
ATOM   2499 C  CB  . GLU A 1 303 ? 32.797 41.796  16.778 1.00 100.96 ? 303  GLU A CB  1 
ATOM   2500 C  CG  . GLU A 1 303 ? 33.687 40.575  16.471 1.00 102.92 ? 303  GLU A CG  1 
ATOM   2501 C  CD  . GLU A 1 303 ? 35.170 40.873  16.633 1.00 104.42 ? 303  GLU A CD  1 
ATOM   2502 O  OE1 . GLU A 1 303 ? 35.550 42.055  16.475 1.00 105.47 ? 303  GLU A OE1 1 
ATOM   2503 O  OE2 . GLU A 1 303 ? 35.954 39.932  16.905 1.00 104.77 ? 303  GLU A OE2 1 
ATOM   2504 N  N   . ASN A 1 304 ? 31.074 41.373  19.357 1.00 98.82  ? 304  ASN A N   1 
ATOM   2505 C  CA  . ASN A 1 304 ? 30.697 41.699  20.723 1.00 97.88  ? 304  ASN A CA  1 
ATOM   2506 C  C   . ASN A 1 304 ? 30.946 40.314  21.310 1.00 97.25  ? 304  ASN A C   1 
ATOM   2507 O  O   . ASN A 1 304 ? 30.787 40.068  22.508 1.00 98.06  ? 304  ASN A O   1 
ATOM   2508 C  CB  . ASN A 1 304 ? 29.209 42.055  20.811 1.00 97.34  ? 304  ASN A CB  1 
ATOM   2509 C  CG  . ASN A 1 304 ? 28.966 43.548  20.924 1.00 96.37  ? 304  ASN A CG  1 
ATOM   2510 O  OD1 . ASN A 1 304 ? 29.461 44.198  21.842 1.00 96.32  ? 304  ASN A OD1 1 
ATOM   2511 N  ND2 . ASN A 1 304 ? 28.194 44.097  19.994 1.00 95.69  ? 304  ASN A ND2 1 
ATOM   2512 N  N   . LEU A 1 305 ? 31.340 39.417  20.404 1.00 95.78  ? 305  LEU A N   1 
ATOM   2513 C  CA  . LEU A 1 305 ? 31.648 38.025  20.700 1.00 93.91  ? 305  LEU A CA  1 
ATOM   2514 C  C   . LEU A 1 305 ? 32.914 37.913  21.524 1.00 93.11  ? 305  LEU A C   1 
ATOM   2515 O  O   . LEU A 1 305 ? 33.103 36.939  22.253 1.00 94.59  ? 305  LEU A O   1 
ATOM   2516 C  CB  . LEU A 1 305 ? 31.812 37.231  19.398 1.00 92.08  ? 305  LEU A CB  1 
ATOM   2517 C  CG  . LEU A 1 305 ? 30.526 36.718  18.746 1.00 90.56  ? 305  LEU A CG  1 
ATOM   2518 C  CD1 . LEU A 1 305 ? 29.532 37.851  18.590 1.00 89.34  ? 305  LEU A CD1 1 
ATOM   2519 C  CD2 . LEU A 1 305 ? 30.852 36.085  17.403 1.00 90.91  ? 305  LEU A CD2 1 
ATOM   2520 N  N   . GLU A 1 306 ? 33.789 38.903  21.398 1.00 90.57  ? 306  GLU A N   1 
ATOM   2521 C  CA  . GLU A 1 306 ? 35.021 38.901  22.169 1.00 87.70  ? 306  GLU A CA  1 
ATOM   2522 C  C   . GLU A 1 306 ? 34.606 39.118  23.632 1.00 84.95  ? 306  GLU A C   1 
ATOM   2523 O  O   . GLU A 1 306 ? 35.329 38.756  24.560 1.00 85.00  ? 306  GLU A O   1 
ATOM   2524 C  CB  . GLU A 1 306 ? 35.939 40.022  21.673 1.00 88.93  ? 306  GLU A CB  1 
ATOM   2525 C  CG  . GLU A 1 306 ? 36.135 40.010  20.157 1.00 90.91  ? 306  GLU A CG  1 
ATOM   2526 C  CD  . GLU A 1 306 ? 36.958 41.184  19.647 1.00 91.91  ? 306  GLU A CD  1 
ATOM   2527 O  OE1 . GLU A 1 306 ? 36.573 42.343  19.910 1.00 92.91  ? 306  GLU A OE1 1 
ATOM   2528 O  OE2 . GLU A 1 306 ? 37.988 40.948  18.977 1.00 92.33  ? 306  GLU A OE2 1 
ATOM   2529 N  N   . ARG A 1 307 ? 33.418 39.697  23.814 1.00 80.73  ? 307  ARG A N   1 
ATOM   2530 C  CA  . ARG A 1 307 ? 32.853 39.967  25.133 1.00 76.01  ? 307  ARG A CA  1 
ATOM   2531 C  C   . ARG A 1 307 ? 32.118 38.736  25.633 1.00 74.30  ? 307  ARG A C   1 
ATOM   2532 O  O   . ARG A 1 307 ? 32.346 38.278  26.753 1.00 73.90  ? 307  ARG A O   1 
ATOM   2533 C  CB  . ARG A 1 307 ? 31.879 41.144  25.059 1.00 75.16  ? 307  ARG A CB  1 
ATOM   2534 C  CG  . ARG A 1 307 ? 32.472 42.484  25.467 1.00 73.79  ? 307  ARG A CG  1 
ATOM   2535 C  CD  . ARG A 1 307 ? 32.132 42.815  26.913 1.00 71.63  ? 307  ARG A CD  1 
ATOM   2536 N  NE  . ARG A 1 307 ? 30.698 43.024  27.090 1.00 70.03  ? 307  ARG A NE  1 
ATOM   2537 C  CZ  . ARG A 1 307 ? 30.116 43.323  28.247 1.00 70.74  ? 307  ARG A CZ  1 
ATOM   2538 N  NH1 . ARG A 1 307 ? 30.839 43.451  29.354 1.00 71.40  ? 307  ARG A NH1 1 
ATOM   2539 N  NH2 . ARG A 1 307 ? 28.805 43.499  28.297 1.00 69.76  ? 307  ARG A NH2 1 
ATOM   2540 N  N   . VAL A 1 308 ? 31.233 38.204  24.792 1.00 71.94  ? 308  VAL A N   1 
ATOM   2541 C  CA  . VAL A 1 308 ? 30.464 37.012  25.136 1.00 69.77  ? 308  VAL A CA  1 
ATOM   2542 C  C   . VAL A 1 308 ? 31.403 35.836  25.378 1.00 67.63  ? 308  VAL A C   1 
ATOM   2543 O  O   . VAL A 1 308 ? 31.135 34.976  26.215 1.00 66.99  ? 308  VAL A O   1 
ATOM   2544 C  CB  . VAL A 1 308 ? 29.474 36.640  24.015 1.00 70.00  ? 308  VAL A CB  1 
ATOM   2545 C  CG1 . VAL A 1 308 ? 28.721 35.374  24.388 1.00 70.56  ? 308  VAL A CG1 1 
ATOM   2546 C  CG2 . VAL A 1 308 ? 28.493 37.781  23.787 1.00 70.25  ? 308  VAL A CG2 1 
ATOM   2547 N  N   . ALA A 1 309 ? 32.504 35.806  24.639 1.00 65.56  ? 309  ALA A N   1 
ATOM   2548 C  CA  . ALA A 1 309 ? 33.492 34.752  24.790 1.00 64.88  ? 309  ALA A CA  1 
ATOM   2549 C  C   . ALA A 1 309 ? 34.166 34.876  26.153 1.00 65.01  ? 309  ALA A C   1 
ATOM   2550 O  O   . ALA A 1 309 ? 34.329 33.890  26.862 1.00 64.94  ? 309  ALA A O   1 
ATOM   2551 C  CB  . ALA A 1 309 ? 34.531 34.846  23.684 1.00 64.67  ? 309  ALA A CB  1 
ATOM   2552 N  N   . ARG A 1 310 ? 34.562 36.093  26.513 1.00 65.73  ? 310  ARG A N   1 
ATOM   2553 C  CA  . ARG A 1 310 ? 35.207 36.331  27.799 1.00 65.79  ? 310  ARG A CA  1 
ATOM   2554 C  C   . ARG A 1 310 ? 34.248 35.877  28.890 1.00 64.68  ? 310  ARG A C   1 
ATOM   2555 O  O   . ARG A 1 310 ? 34.602 35.047  29.726 1.00 64.79  ? 310  ARG A O   1 
ATOM   2556 C  CB  . ARG A 1 310 ? 35.531 37.819  27.974 1.00 68.22  ? 310  ARG A CB  1 
ATOM   2557 C  CG  . ARG A 1 310 ? 36.316 38.161  29.241 1.00 70.65  ? 310  ARG A CG  1 
ATOM   2558 C  CD  . ARG A 1 310 ? 36.410 39.673  29.431 1.00 73.89  ? 310  ARG A CD  1 
ATOM   2559 N  NE  . ARG A 1 310 ? 35.112 40.302  29.709 1.00 76.55  ? 310  ARG A NE  1 
ATOM   2560 C  CZ  . ARG A 1 310 ? 34.474 40.249  30.881 1.00 78.22  ? 310  ARG A CZ  1 
ATOM   2561 N  NH1 . ARG A 1 310 ? 35.005 39.594  31.907 1.00 78.73  ? 310  ARG A NH1 1 
ATOM   2562 N  NH2 . ARG A 1 310 ? 33.302 40.860  31.035 1.00 78.71  ? 310  ARG A NH2 1 
ATOM   2563 N  N   . TYR A 1 311 ? 33.032 36.422  28.871 1.00 63.15  ? 311  TYR A N   1 
ATOM   2564 C  CA  . TYR A 1 311 ? 32.009 36.059  29.850 1.00 61.80  ? 311  TYR A CA  1 
ATOM   2565 C  C   . TYR A 1 311 ? 31.863 34.542  29.910 1.00 61.44  ? 311  TYR A C   1 
ATOM   2566 O  O   . TYR A 1 311 ? 31.697 33.963  30.984 1.00 62.70  ? 311  TYR A O   1 
ATOM   2567 C  CB  . TYR A 1 311 ? 30.660 36.689  29.483 1.00 60.99  ? 311  TYR A CB  1 
ATOM   2568 C  CG  . TYR A 1 311 ? 29.487 36.064  30.201 1.00 59.94  ? 311  TYR A CG  1 
ATOM   2569 C  CD1 . TYR A 1 311 ? 29.430 36.033  31.593 1.00 61.11  ? 311  TYR A CD1 1 
ATOM   2570 C  CD2 . TYR A 1 311 ? 28.447 35.477  29.489 1.00 60.22  ? 311  TYR A CD2 1 
ATOM   2571 C  CE1 . TYR A 1 311 ? 28.365 35.425  32.261 1.00 62.03  ? 311  TYR A CE1 1 
ATOM   2572 C  CE2 . TYR A 1 311 ? 27.374 34.868  30.144 1.00 60.98  ? 311  TYR A CE2 1 
ATOM   2573 C  CZ  . TYR A 1 311 ? 27.339 34.841  31.530 1.00 62.52  ? 311  TYR A CZ  1 
ATOM   2574 O  OH  . TYR A 1 311 ? 26.292 34.218  32.185 1.00 62.53  ? 311  TYR A OH  1 
ATOM   2575 N  N   . SER A 1 312 ? 31.921 33.899  28.751 1.00 59.65  ? 312  SER A N   1 
ATOM   2576 C  CA  . SER A 1 312 ? 31.811 32.453  28.695 1.00 57.90  ? 312  SER A CA  1 
ATOM   2577 C  C   . SER A 1 312 ? 33.020 31.827  29.381 1.00 57.42  ? 312  SER A C   1 
ATOM   2578 O  O   . SER A 1 312 ? 32.880 31.088  30.354 1.00 58.00  ? 312  SER A O   1 
ATOM   2579 C  CB  . SER A 1 312 ? 31.746 31.984  27.244 1.00 57.86  ? 312  SER A CB  1 
ATOM   2580 O  OG  . SER A 1 312 ? 31.695 30.569  27.169 1.00 57.35  ? 312  SER A OG  1 
ATOM   2581 N  N   . MET A 1 313 ? 34.207 32.132  28.866 1.00 56.40  ? 313  MET A N   1 
ATOM   2582 C  CA  . MET A 1 313 ? 35.454 31.602  29.411 1.00 54.41  ? 313  MET A CA  1 
ATOM   2583 C  C   . MET A 1 313 ? 35.483 31.695  30.924 1.00 53.97  ? 313  MET A C   1 
ATOM   2584 O  O   . MET A 1 313 ? 35.828 30.728  31.603 1.00 54.18  ? 313  MET A O   1 
ATOM   2585 C  CB  . MET A 1 313 ? 36.647 32.354  28.818 1.00 53.97  ? 313  MET A CB  1 
ATOM   2586 C  CG  . MET A 1 313 ? 37.998 31.935  29.365 1.00 53.01  ? 313  MET A CG  1 
ATOM   2587 S  SD  . MET A 1 313 ? 38.464 32.874  30.814 1.00 53.80  ? 313  MET A SD  1 
ATOM   2588 C  CE  . MET A 1 313 ? 38.819 34.457  30.072 1.00 52.93  ? 313  MET A CE  1 
ATOM   2589 N  N   . GLU A 1 314 ? 35.116 32.860  31.447 1.00 52.66  ? 314  GLU A N   1 
ATOM   2590 C  CA  . GLU A 1 314 ? 35.093 33.071  32.888 1.00 52.15  ? 314  GLU A CA  1 
ATOM   2591 C  C   . GLU A 1 314 ? 34.062 32.162  33.571 1.00 51.00  ? 314  GLU A C   1 
ATOM   2592 O  O   . GLU A 1 314 ? 34.383 31.471  34.541 1.00 49.40  ? 314  GLU A O   1 
ATOM   2593 C  CB  . GLU A 1 314 ? 34.805 34.546  33.201 1.00 53.25  ? 314  GLU A CB  1 
ATOM   2594 C  CG  . GLU A 1 314 ? 35.904 35.500  32.725 1.00 56.20  ? 314  GLU A CG  1 
ATOM   2595 C  CD  . GLU A 1 314 ? 35.751 36.912  33.268 1.00 57.25  ? 314  GLU A CD  1 
ATOM   2596 O  OE1 . GLU A 1 314 ? 36.585 37.776  32.926 1.00 58.85  ? 314  GLU A OE1 1 
ATOM   2597 O  OE2 . GLU A 1 314 ? 34.803 37.159  34.040 1.00 59.24  ? 314  GLU A OE2 1 
ATOM   2598 N  N   . ASP A 1 315 ? 32.829 32.164  33.063 1.00 49.43  ? 315  ASP A N   1 
ATOM   2599 C  CA  . ASP A 1 315 ? 31.766 31.326  33.619 1.00 46.19  ? 315  ASP A CA  1 
ATOM   2600 C  C   . ASP A 1 315 ? 32.365 30.000  34.048 1.00 43.91  ? 315  ASP A C   1 
ATOM   2601 O  O   . ASP A 1 315 ? 32.148 29.546  35.165 1.00 44.18  ? 315  ASP A O   1 
ATOM   2602 C  CB  . ASP A 1 315 ? 30.677 31.073  32.570 1.00 46.25  ? 315  ASP A CB  1 
ATOM   2603 C  CG  . ASP A 1 315 ? 29.409 31.862  32.834 1.00 46.37  ? 315  ASP A CG  1 
ATOM   2604 O  OD1 . ASP A 1 315 ? 29.508 32.990  33.346 1.00 46.30  ? 315  ASP A OD1 1 
ATOM   2605 O  OD2 . ASP A 1 315 ? 28.309 31.362  32.512 1.00 48.47  ? 315  ASP A OD2 1 
ATOM   2606 N  N   . ALA A 1 316 ? 33.142 29.396  33.156 1.00 42.22  ? 316  ALA A N   1 
ATOM   2607 C  CA  . ALA A 1 316 ? 33.768 28.111  33.428 1.00 40.90  ? 316  ALA A CA  1 
ATOM   2608 C  C   . ALA A 1 316 ? 35.004 28.199  34.319 1.00 39.98  ? 316  ALA A C   1 
ATOM   2609 O  O   . ALA A 1 316 ? 35.317 27.249  35.031 1.00 40.02  ? 316  ALA A O   1 
ATOM   2610 C  CB  . ALA A 1 316 ? 34.116 27.422  32.123 1.00 39.91  ? 316  ALA A CB  1 
ATOM   2611 N  N   . LYS A 1 317 ? 35.705 29.328  34.284 1.00 39.09  ? 317  LYS A N   1 
ATOM   2612 C  CA  . LYS A 1 317 ? 36.897 29.501  35.113 1.00 39.33  ? 317  LYS A CA  1 
ATOM   2613 C  C   . LYS A 1 317 ? 36.452 29.714  36.572 1.00 39.48  ? 317  LYS A C   1 
ATOM   2614 O  O   . LYS A 1 317 ? 37.121 29.298  37.522 1.00 38.42  ? 317  LYS A O   1 
ATOM   2615 C  CB  . LYS A 1 317 ? 37.703 30.699  34.608 1.00 39.00  ? 317  LYS A CB  1 
ATOM   2616 C  CG  . LYS A 1 317 ? 39.212 30.566  34.762 1.00 40.36  ? 317  LYS A CG  1 
ATOM   2617 C  CD  . LYS A 1 317 ? 39.706 31.125  36.090 1.00 43.75  ? 317  LYS A CD  1 
ATOM   2618 C  CE  . LYS A 1 317 ? 39.537 32.642  36.191 1.00 43.56  ? 317  LYS A CE  1 
ATOM   2619 N  NZ  . LYS A 1 317 ? 39.918 33.166  37.546 1.00 44.15  ? 317  LYS A NZ  1 
ATOM   2620 N  N   . VAL A 1 318 ? 35.303 30.363  36.727 1.00 39.82  ? 318  VAL A N   1 
ATOM   2621 C  CA  . VAL A 1 318 ? 34.707 30.636  38.031 1.00 37.74  ? 318  VAL A CA  1 
ATOM   2622 C  C   . VAL A 1 318 ? 34.188 29.323  38.609 1.00 35.69  ? 318  VAL A C   1 
ATOM   2623 O  O   . VAL A 1 318 ? 34.498 28.957  39.745 1.00 36.80  ? 318  VAL A O   1 
ATOM   2624 C  CB  . VAL A 1 318 ? 33.520 31.614  37.881 1.00 39.31  ? 318  VAL A CB  1 
ATOM   2625 C  CG1 . VAL A 1 318 ? 32.709 31.653  39.147 1.00 41.84  ? 318  VAL A CG1 1 
ATOM   2626 C  CG2 . VAL A 1 318 ? 34.032 32.999  37.551 1.00 41.43  ? 318  VAL A CG2 1 
ATOM   2627 N  N   . THR A 1 319 ? 33.392 28.622  37.809 1.00 32.22  ? 319  THR A N   1 
ATOM   2628 C  CA  . THR A 1 319 ? 32.818 27.352  38.202 1.00 27.46  ? 319  THR A CA  1 
ATOM   2629 C  C   . THR A 1 319 ? 33.882 26.392  38.675 1.00 27.44  ? 319  THR A C   1 
ATOM   2630 O  O   . THR A 1 319 ? 33.702 25.730  39.690 1.00 28.94  ? 319  THR A O   1 
ATOM   2631 C  CB  . THR A 1 319 ? 32.063 26.724  37.045 1.00 25.99  ? 319  THR A CB  1 
ATOM   2632 O  OG1 . THR A 1 319 ? 30.988 27.594  36.667 1.00 24.00  ? 319  THR A OG1 1 
ATOM   2633 C  CG2 . THR A 1 319 ? 31.504 25.362  37.448 1.00 24.96  ? 319  THR A CG2 1 
ATOM   2634 N  N   . TYR A 1 320 ? 34.992 26.315  37.948 1.00 27.34  ? 320  TYR A N   1 
ATOM   2635 C  CA  . TYR A 1 320 ? 36.081 25.422  38.337 1.00 26.57  ? 320  TYR A CA  1 
ATOM   2636 C  C   . TYR A 1 320 ? 36.631 25.787  39.708 1.00 27.00  ? 320  TYR A C   1 
ATOM   2637 O  O   . TYR A 1 320 ? 36.791 24.925  40.574 1.00 27.40  ? 320  TYR A O   1 
ATOM   2638 C  CB  . TYR A 1 320 ? 37.228 25.464  37.330 1.00 24.29  ? 320  TYR A CB  1 
ATOM   2639 C  CG  . TYR A 1 320 ? 38.282 24.433  37.643 1.00 23.50  ? 320  TYR A CG  1 
ATOM   2640 C  CD1 . TYR A 1 320 ? 39.571 24.802  38.015 1.00 23.31  ? 320  TYR A CD1 1 
ATOM   2641 C  CD2 . TYR A 1 320 ? 37.977 23.080  37.595 1.00 23.65  ? 320  TYR A CD2 1 
ATOM   2642 C  CE1 . TYR A 1 320 ? 40.531 23.841  38.330 1.00 23.20  ? 320  TYR A CE1 1 
ATOM   2643 C  CE2 . TYR A 1 320 ? 38.917 22.116  37.904 1.00 23.56  ? 320  TYR A CE2 1 
ATOM   2644 C  CZ  . TYR A 1 320 ? 40.195 22.494  38.268 1.00 24.75  ? 320  TYR A CZ  1 
ATOM   2645 O  OH  . TYR A 1 320 ? 41.126 21.509  38.542 1.00 23.61  ? 320  TYR A OH  1 
ATOM   2646 N  N   . GLU A 1 321 ? 36.933 27.067  39.900 1.00 28.50  ? 321  GLU A N   1 
ATOM   2647 C  CA  . GLU A 1 321 ? 37.456 27.527  41.183 1.00 30.67  ? 321  GLU A CA  1 
ATOM   2648 C  C   . GLU A 1 321 ? 36.461 27.162  42.292 1.00 29.44  ? 321  GLU A C   1 
ATOM   2649 O  O   . GLU A 1 321 ? 36.851 26.510  43.263 1.00 30.51  ? 321  GLU A O   1 
ATOM   2650 C  CB  . GLU A 1 321 ? 37.709 29.046  41.163 1.00 33.86  ? 321  GLU A CB  1 
ATOM   2651 C  CG  . GLU A 1 321 ? 38.588 29.530  40.002 1.00 37.89  ? 321  GLU A CG  1 
ATOM   2652 C  CD  . GLU A 1 321 ? 38.893 31.030  40.053 1.00 42.40  ? 321  GLU A CD  1 
ATOM   2653 O  OE1 . GLU A 1 321 ? 38.044 31.798  40.563 1.00 44.24  ? 321  GLU A OE1 1 
ATOM   2654 O  OE2 . GLU A 1 321 ? 39.977 31.445  39.565 1.00 43.47  ? 321  GLU A OE2 1 
ATOM   2655 N  N   . LEU A 1 322 ? 35.190 27.561  42.148 1.00 25.92  ? 322  LEU A N   1 
ATOM   2656 C  CA  . LEU A 1 322 ? 34.153 27.232  43.148 1.00 22.81  ? 322  LEU A CA  1 
ATOM   2657 C  C   . LEU A 1 322 ? 34.129 25.725  43.377 1.00 22.76  ? 322  LEU A C   1 
ATOM   2658 O  O   . LEU A 1 322 ? 33.891 25.248  44.488 1.00 21.22  ? 322  LEU A O   1 
ATOM   2659 C  CB  . LEU A 1 322 ? 32.768 27.690  42.680 1.00 17.93  ? 322  LEU A CB  1 
ATOM   2660 C  CG  . LEU A 1 322 ? 32.496 29.199  42.684 1.00 14.72  ? 322  LEU A CG  1 
ATOM   2661 C  CD1 . LEU A 1 322 ? 31.472 29.590  41.598 1.00 7.71   ? 322  LEU A CD1 1 
ATOM   2662 C  CD2 . LEU A 1 322 ? 32.039 29.594  44.068 1.00 7.27   ? 322  LEU A CD2 1 
ATOM   2663 N  N   . GLY A 1 323 ? 34.382 24.981  42.309 1.00 23.20  ? 323  GLY A N   1 
ATOM   2664 C  CA  . GLY A 1 323 ? 34.412 23.541  42.420 1.00 26.71  ? 323  GLY A CA  1 
ATOM   2665 C  C   . GLY A 1 323 ? 35.404 23.110  43.485 1.00 29.88  ? 323  GLY A C   1 
ATOM   2666 O  O   . GLY A 1 323 ? 35.056 22.376  44.415 1.00 31.31  ? 323  GLY A O   1 
ATOM   2667 N  N   . LYS A 1 324 ? 36.641 23.575  43.370 1.00 31.33  ? 324  LYS A N   1 
ATOM   2668 C  CA  . LYS A 1 324 ? 37.671 23.208  44.336 1.00 33.37  ? 324  LYS A CA  1 
ATOM   2669 C  C   . LYS A 1 324 ? 37.397 23.711  45.764 1.00 34.34  ? 324  LYS A C   1 
ATOM   2670 O  O   . LYS A 1 324 ? 37.921 23.157  46.732 1.00 35.00  ? 324  LYS A O   1 
ATOM   2671 C  CB  . LYS A 1 324 ? 39.019 23.709  43.838 1.00 35.44  ? 324  LYS A CB  1 
ATOM   2672 C  CG  . LYS A 1 324 ? 39.400 23.145  42.472 1.00 35.96  ? 324  LYS A CG  1 
ATOM   2673 C  CD  . LYS A 1 324 ? 40.726 23.714  41.996 1.00 38.95  ? 324  LYS A CD  1 
ATOM   2674 C  CE  . LYS A 1 324 ? 41.851 23.487  43.016 1.00 38.19  ? 324  LYS A CE  1 
ATOM   2675 N  NZ  . LYS A 1 324 ? 43.128 24.112  42.567 1.00 39.12  ? 324  LYS A NZ  1 
ATOM   2676 N  N   . GLU A 1 325 ? 36.576 24.753  45.887 1.00 33.99  ? 325  GLU A N   1 
ATOM   2677 C  CA  . GLU A 1 325 ? 36.206 25.322  47.183 1.00 33.16  ? 325  GLU A CA  1 
ATOM   2678 C  C   . GLU A 1 325 ? 35.198 24.437  47.896 1.00 31.97  ? 325  GLU A C   1 
ATOM   2679 O  O   . GLU A 1 325 ? 35.379 24.095  49.060 1.00 32.40  ? 325  GLU A O   1 
ATOM   2680 C  CB  . GLU A 1 325 ? 35.550 26.697  47.015 1.00 34.49  ? 325  GLU A CB  1 
ATOM   2681 C  CG  . GLU A 1 325 ? 36.308 27.868  47.611 1.00 39.07  ? 325  GLU A CG  1 
ATOM   2682 C  CD  . GLU A 1 325 ? 36.622 27.694  49.084 1.00 43.25  ? 325  GLU A CD  1 
ATOM   2683 O  OE1 . GLU A 1 325 ? 35.674 27.523  49.884 1.00 45.93  ? 325  GLU A OE1 1 
ATOM   2684 O  OE2 . GLU A 1 325 ? 37.821 27.730  49.443 1.00 44.08  ? 325  GLU A OE2 1 
ATOM   2685 N  N   . PHE A 1 326 ? 34.135 24.061  47.191 1.00 30.70  ? 326  PHE A N   1 
ATOM   2686 C  CA  . PHE A 1 326 ? 33.079 23.267  47.808 1.00 30.07  ? 326  PHE A CA  1 
ATOM   2687 C  C   . PHE A 1 326 ? 33.070 21.751  47.680 1.00 29.39  ? 326  PHE A C   1 
ATOM   2688 O  O   . PHE A 1 326 ? 32.324 21.063  48.381 1.00 28.17  ? 326  PHE A O   1 
ATOM   2689 C  CB  . PHE A 1 326 ? 31.728 23.800  47.357 1.00 28.63  ? 326  PHE A CB  1 
ATOM   2690 C  CG  . PHE A 1 326 ? 31.510 25.233  47.700 1.00 27.15  ? 326  PHE A CG  1 
ATOM   2691 C  CD1 . PHE A 1 326 ? 31.950 26.236  46.851 1.00 25.70  ? 326  PHE A CD1 1 
ATOM   2692 C  CD2 . PHE A 1 326 ? 30.882 25.585  48.891 1.00 27.48  ? 326  PHE A CD2 1 
ATOM   2693 C  CE1 . PHE A 1 326 ? 31.769 27.574  47.181 1.00 26.17  ? 326  PHE A CE1 1 
ATOM   2694 C  CE2 . PHE A 1 326 ? 30.699 26.919  49.233 1.00 27.05  ? 326  PHE A CE2 1 
ATOM   2695 C  CZ  . PHE A 1 326 ? 31.144 27.918  48.373 1.00 26.79  ? 326  PHE A CZ  1 
ATOM   2696 N  N   . LEU A 1 327 ? 33.877 21.208  46.795 1.00 29.50  ? 327  LEU A N   1 
ATOM   2697 C  CA  . LEU A 1 327 ? 33.866 19.767  46.662 1.00 31.52  ? 327  LEU A CA  1 
ATOM   2698 C  C   . LEU A 1 327 ? 34.567 19.072  47.842 1.00 32.47  ? 327  LEU A C   1 
ATOM   2699 O  O   . LEU A 1 327 ? 34.081 18.068  48.359 1.00 32.01  ? 327  LEU A O   1 
ATOM   2700 C  CB  . LEU A 1 327 ? 34.506 19.375  45.328 1.00 29.85  ? 327  LEU A CB  1 
ATOM   2701 C  CG  . LEU A 1 327 ? 34.094 18.010  44.797 1.00 28.95  ? 327  LEU A CG  1 
ATOM   2702 C  CD1 . LEU A 1 327 ? 34.194 17.999  43.286 1.00 29.59  ? 327  LEU A CD1 1 
ATOM   2703 C  CD2 . LEU A 1 327 ? 34.960 16.939  45.421 1.00 29.86  ? 327  LEU A CD2 1 
ATOM   2704 N  N   . PRO A 1 328 ? 35.710 19.612  48.294 1.00 33.07  ? 328  PRO A N   1 
ATOM   2705 C  CA  . PRO A 1 328 ? 36.452 19.020  49.408 1.00 32.77  ? 328  PRO A CA  1 
ATOM   2706 C  C   . PRO A 1 328 ? 35.622 18.644  50.642 1.00 32.51  ? 328  PRO A C   1 
ATOM   2707 O  O   . PRO A 1 328 ? 35.782 17.564  51.209 1.00 31.09  ? 328  PRO A O   1 
ATOM   2708 C  CB  . PRO A 1 328 ? 37.505 20.082  49.698 1.00 33.39  ? 328  PRO A CB  1 
ATOM   2709 C  CG  . PRO A 1 328 ? 37.821 20.580  48.327 1.00 33.01  ? 328  PRO A CG  1 
ATOM   2710 C  CD  . PRO A 1 328 ? 36.439 20.777  47.757 1.00 32.87  ? 328  PRO A CD  1 
ATOM   2711 N  N   . MET A 1 329 ? 34.745 19.542  51.063 1.00 33.45  ? 329  MET A N   1 
ATOM   2712 C  CA  . MET A 1 329 ? 33.904 19.284  52.224 1.00 33.55  ? 329  MET A CA  1 
ATOM   2713 C  C   . MET A 1 329 ? 32.854 18.217  51.905 1.00 33.93  ? 329  MET A C   1 
ATOM   2714 O  O   . MET A 1 329 ? 32.729 17.218  52.630 1.00 35.25  ? 329  MET A O   1 
ATOM   2715 C  CB  . MET A 1 329 ? 33.211 20.573  52.656 1.00 34.45  ? 329  MET A CB  1 
ATOM   2716 C  CG  . MET A 1 329 ? 32.316 20.410  53.853 1.00 36.55  ? 329  MET A CG  1 
ATOM   2717 S  SD  . MET A 1 329 ? 33.258 19.879  55.271 1.00 39.93  ? 329  MET A SD  1 
ATOM   2718 C  CE  . MET A 1 329 ? 33.919 21.432  55.780 1.00 38.86  ? 329  MET A CE  1 
ATOM   2719 N  N   . GLU A 1 330 ? 32.105 18.431  50.821 1.00 31.28  ? 330  GLU A N   1 
ATOM   2720 C  CA  . GLU A 1 330 ? 31.062 17.495  50.391 1.00 28.42  ? 330  GLU A CA  1 
ATOM   2721 C  C   . GLU A 1 330 ? 31.636 16.109  50.109 1.00 25.02  ? 330  GLU A C   1 
ATOM   2722 O  O   . GLU A 1 330 ? 30.936 15.102  50.154 1.00 22.46  ? 330  GLU A O   1 
ATOM   2723 C  CB  . GLU A 1 330 ? 30.365 18.043  49.147 1.00 30.00  ? 330  GLU A CB  1 
ATOM   2724 C  CG  . GLU A 1 330 ? 29.571 19.305  49.414 1.00 31.88  ? 330  GLU A CG  1 
ATOM   2725 C  CD  . GLU A 1 330 ? 28.316 19.032  50.217 1.00 33.23  ? 330  GLU A CD  1 
ATOM   2726 O  OE1 . GLU A 1 330 ? 27.722 19.989  50.751 1.00 36.10  ? 330  GLU A OE1 1 
ATOM   2727 O  OE2 . GLU A 1 330 ? 27.916 17.854  50.311 1.00 33.92  ? 330  GLU A OE2 1 
ATOM   2728 N  N   . ALA A 1 331 ? 32.926 16.079  49.821 1.00 23.83  ? 331  ALA A N   1 
ATOM   2729 C  CA  . ALA A 1 331 ? 33.617 14.845  49.542 1.00 23.19  ? 331  ALA A CA  1 
ATOM   2730 C  C   . ALA A 1 331 ? 33.933 14.171  50.855 1.00 22.83  ? 331  ALA A C   1 
ATOM   2731 O  O   . ALA A 1 331 ? 34.007 12.956  50.917 1.00 24.90  ? 331  ALA A O   1 
ATOM   2732 C  CB  . ALA A 1 331 ? 34.894 15.118  48.768 1.00 23.69  ? 331  ALA A CB  1 
ATOM   2733 N  N   . GLN A 1 332 ? 34.133 14.945  51.915 1.00 23.19  ? 332  GLN A N   1 
ATOM   2734 C  CA  . GLN A 1 332 ? 34.416 14.321  53.205 1.00 23.95  ? 332  GLN A CA  1 
ATOM   2735 C  C   . GLN A 1 332 ? 33.099 13.928  53.830 1.00 23.30  ? 332  GLN A C   1 
ATOM   2736 O  O   . GLN A 1 332 ? 33.028 12.953  54.583 1.00 22.43  ? 332  GLN A O   1 
ATOM   2737 C  CB  . GLN A 1 332 ? 35.197 15.258  54.133 1.00 25.38  ? 332  GLN A CB  1 
ATOM   2738 C  CG  . GLN A 1 332 ? 36.588 15.616  53.600 1.00 30.69  ? 332  GLN A CG  1 
ATOM   2739 C  CD  . GLN A 1 332 ? 37.336 14.419  52.995 1.00 31.57  ? 332  GLN A CD  1 
ATOM   2740 O  OE1 . GLN A 1 332 ? 38.070 14.561  51.998 1.00 30.36  ? 332  GLN A OE1 1 
ATOM   2741 N  NE2 . GLN A 1 332 ? 37.160 13.243  53.597 1.00 27.59  ? 332  GLN A NE2 1 
ATOM   2742 N  N   . LEU A 1 333 ? 32.050 14.685  53.507 1.00 23.02  ? 333  LEU A N   1 
ATOM   2743 C  CA  . LEU A 1 333 ? 30.730 14.360  54.013 1.00 23.53  ? 333  LEU A CA  1 
ATOM   2744 C  C   . LEU A 1 333 ? 30.411 12.966  53.498 1.00 25.64  ? 333  LEU A C   1 
ATOM   2745 O  O   . LEU A 1 333 ? 29.873 12.129  54.222 1.00 25.31  ? 333  LEU A O   1 
ATOM   2746 C  CB  . LEU A 1 333 ? 29.693 15.367  53.526 1.00 19.62  ? 333  LEU A CB  1 
ATOM   2747 C  CG  . LEU A 1 333 ? 29.553 16.527  54.512 1.00 21.20  ? 333  LEU A CG  1 
ATOM   2748 C  CD1 . LEU A 1 333 ? 28.708 17.633  53.933 1.00 21.81  ? 333  LEU A CD1 1 
ATOM   2749 C  CD2 . LEU A 1 333 ? 28.945 16.012  55.818 1.00 21.19  ? 333  LEU A CD2 1 
ATOM   2750 N  N   . SER A 1 334 ? 30.772 12.723  52.242 1.00 27.88  ? 334  SER A N   1 
ATOM   2751 C  CA  . SER A 1 334 ? 30.561 11.428  51.615 1.00 28.65  ? 334  SER A CA  1 
ATOM   2752 C  C   . SER A 1 334 ? 31.221 10.396  52.496 1.00 28.73  ? 334  SER A C   1 
ATOM   2753 O  O   . SER A 1 334 ? 30.543 9.735   53.274 1.00 31.51  ? 334  SER A O   1 
ATOM   2754 C  CB  . SER A 1 334 ? 31.191 11.411  50.237 1.00 28.38  ? 334  SER A CB  1 
ATOM   2755 O  OG  . SER A 1 334 ? 30.780 12.569  49.534 1.00 33.69  ? 334  SER A OG  1 
ATOM   2756 N  N   . ARG A 1 335 ? 32.543 10.283  52.391 1.00 28.37  ? 335  ARG A N   1 
ATOM   2757 C  CA  . ARG A 1 335 ? 33.327 9.334   53.189 1.00 26.97  ? 335  ARG A CA  1 
ATOM   2758 C  C   . ARG A 1 335 ? 32.807 9.124   54.640 1.00 24.01  ? 335  ARG A C   1 
ATOM   2759 O  O   . ARG A 1 335 ? 32.976 8.048   55.216 1.00 22.11  ? 335  ARG A O   1 
ATOM   2760 C  CB  . ARG A 1 335 ? 34.797 9.777   53.217 1.00 28.47  ? 335  ARG A CB  1 
ATOM   2761 C  CG  . ARG A 1 335 ? 35.702 8.737   53.847 1.00 35.20  ? 335  ARG A CG  1 
ATOM   2762 C  CD  . ARG A 1 335 ? 36.940 9.335   54.482 1.00 40.31  ? 335  ARG A CD  1 
ATOM   2763 N  NE  . ARG A 1 335 ? 37.277 8.648   55.729 1.00 44.79  ? 335  ARG A NE  1 
ATOM   2764 C  CZ  . ARG A 1 335 ? 36.530 8.691   56.831 1.00 47.95  ? 335  ARG A CZ  1 
ATOM   2765 N  NH1 . ARG A 1 335 ? 36.909 8.035   57.919 1.00 49.03  ? 335  ARG A NH1 1 
ATOM   2766 N  NH2 . ARG A 1 335 ? 35.404 9.399   56.853 1.00 49.52  ? 335  ARG A NH2 1 
ATOM   2767 N  N   . LEU A 1 336 ? 32.177 10.145  55.220 1.00 20.08  ? 336  LEU A N   1 
ATOM   2768 C  CA  . LEU A 1 336 ? 31.614 10.047  56.571 1.00 17.94  ? 336  LEU A CA  1 
ATOM   2769 C  C   . LEU A 1 336 ? 30.261 9.293   56.580 1.00 17.45  ? 336  LEU A C   1 
ATOM   2770 O  O   . LEU A 1 336 ? 29.996 8.478   57.460 1.00 17.51  ? 336  LEU A O   1 
ATOM   2771 C  CB  . LEU A 1 336 ? 31.394 11.457  57.145 1.00 16.84  ? 336  LEU A CB  1 
ATOM   2772 C  CG  . LEU A 1 336 ? 31.503 11.703  58.655 1.00 13.12  ? 336  LEU A CG  1 
ATOM   2773 C  CD1 . LEU A 1 336 ? 30.897 13.045  59.011 1.00 13.08  ? 336  LEU A CD1 1 
ATOM   2774 C  CD2 . LEU A 1 336 ? 30.791 10.639  59.393 1.00 12.84  ? 336  LEU A CD2 1 
ATOM   2775 N  N   . ILE A 1 337 ? 29.420 9.572   55.585 1.00 18.02  ? 337  ILE A N   1 
ATOM   2776 C  CA  . ILE A 1 337 ? 28.087 8.983   55.459 1.00 16.87  ? 337  ILE A CA  1 
ATOM   2777 C  C   . ILE A 1 337 ? 28.029 7.614   54.798 1.00 17.65  ? 337  ILE A C   1 
ATOM   2778 O  O   . ILE A 1 337 ? 27.100 6.843   55.059 1.00 16.90  ? 337  ILE A O   1 
ATOM   2779 C  CB  . ILE A 1 337 ? 27.163 9.915   54.664 1.00 17.76  ? 337  ILE A CB  1 
ATOM   2780 C  CG1 . ILE A 1 337 ? 27.187 11.319  55.272 1.00 18.86  ? 337  ILE A CG1 1 
ATOM   2781 C  CG2 . ILE A 1 337 ? 25.765 9.372   54.650 1.00 19.30  ? 337  ILE A CG2 1 
ATOM   2782 C  CD1 . ILE A 1 337 ? 27.009 11.349  56.752 1.00 14.57  ? 337  ILE A CD1 1 
ATOM   2783 N  N   . GLY A 1 338 ? 29.000 7.323   53.931 1.00 17.79  ? 338  GLY A N   1 
ATOM   2784 C  CA  . GLY A 1 338 ? 29.040 6.037   53.248 1.00 17.93  ? 338  GLY A CA  1 
ATOM   2785 C  C   . GLY A 1 338 ? 28.282 5.936   51.925 1.00 19.24  ? 338  GLY A C   1 
ATOM   2786 O  O   . GLY A 1 338 ? 27.955 4.831   51.493 1.00 18.77  ? 338  GLY A O   1 
ATOM   2787 N  N   . GLN A 1 339 ? 28.002 7.074   51.288 1.00 18.76  ? 339  GLN A N   1 
ATOM   2788 C  CA  . GLN A 1 339 ? 27.290 7.132   50.010 1.00 20.85  ? 339  GLN A CA  1 
ATOM   2789 C  C   . GLN A 1 339 ? 28.037 7.963   48.974 1.00 24.07  ? 339  GLN A C   1 
ATOM   2790 O  O   . GLN A 1 339 ? 28.981 8.679   49.300 1.00 26.91  ? 339  GLN A O   1 
ATOM   2791 C  CB  . GLN A 1 339 ? 25.893 7.725   50.190 1.00 17.98  ? 339  GLN A CB  1 
ATOM   2792 C  CG  . GLN A 1 339 ? 24.969 6.869   51.033 1.00 16.91  ? 339  GLN A CG  1 
ATOM   2793 C  CD  . GLN A 1 339 ? 24.776 5.486   50.452 1.00 15.11  ? 339  GLN A CD  1 
ATOM   2794 O  OE1 . GLN A 1 339 ? 24.461 4.548   51.168 1.00 15.75  ? 339  GLN A OE1 1 
ATOM   2795 N  NE2 . GLN A 1 339 ? 24.962 5.357   49.145 1.00 14.54  ? 339  GLN A NE2 1 
ATOM   2796 N  N   . SER A 1 340 ? 27.593 7.879   47.721 1.00 24.82  ? 340  SER A N   1 
ATOM   2797 C  CA  . SER A 1 340 ? 28.219 8.603   46.617 1.00 22.96  ? 340  SER A CA  1 
ATOM   2798 C  C   . SER A 1 340 ? 28.287 10.100  46.849 1.00 23.82  ? 340  SER A C   1 
ATOM   2799 O  O   . SER A 1 340 ? 27.451 10.676  47.548 1.00 25.18  ? 340  SER A O   1 
ATOM   2800 C  CB  . SER A 1 340 ? 27.447 8.347   45.329 1.00 23.78  ? 340  SER A CB  1 
ATOM   2801 O  OG  . SER A 1 340 ? 26.174 8.968   45.378 1.00 25.62  ? 340  SER A OG  1 
ATOM   2802 N  N   . LEU A 1 341 ? 29.279 10.740  46.248 1.00 23.43  ? 341  LEU A N   1 
ATOM   2803 C  CA  . LEU A 1 341 ? 29.403 12.179  46.400 1.00 23.92  ? 341  LEU A CA  1 
ATOM   2804 C  C   . LEU A 1 341 ? 28.290 12.856  45.621 1.00 23.17  ? 341  LEU A C   1 
ATOM   2805 O  O   . LEU A 1 341 ? 27.875 13.962  45.947 1.00 22.32  ? 341  LEU A O   1 
ATOM   2806 C  CB  . LEU A 1 341 ? 30.771 12.647  45.902 1.00 24.61  ? 341  LEU A CB  1 
ATOM   2807 C  CG  . LEU A 1 341 ? 30.914 14.126  45.538 1.00 24.59  ? 341  LEU A CG  1 
ATOM   2808 C  CD1 . LEU A 1 341 ? 30.458 15.036  46.675 1.00 22.54  ? 341  LEU A CD1 1 
ATOM   2809 C  CD2 . LEU A 1 341 ? 32.371 14.361  45.178 1.00 24.15  ? 341  LEU A CD2 1 
ATOM   2810 N  N   . TRP A 1 342 ? 27.818 12.166  44.586 1.00 25.86  ? 342  TRP A N   1 
ATOM   2811 C  CA  . TRP A 1 342 ? 26.733 12.644  43.725 1.00 26.84  ? 342  TRP A CA  1 
ATOM   2812 C  C   . TRP A 1 342 ? 25.503 12.824  44.602 1.00 27.38  ? 342  TRP A C   1 
ATOM   2813 O  O   . TRP A 1 342 ? 24.803 13.829  44.529 1.00 24.99  ? 342  TRP A O   1 
ATOM   2814 C  CB  . TRP A 1 342 ? 26.424 11.598  42.636 1.00 27.38  ? 342  TRP A CB  1 
ATOM   2815 C  CG  . TRP A 1 342 ? 25.401 12.053  41.616 1.00 28.40  ? 342  TRP A CG  1 
ATOM   2816 C  CD1 . TRP A 1 342 ? 25.655 12.649  40.416 1.00 28.91  ? 342  TRP A CD1 1 
ATOM   2817 C  CD2 . TRP A 1 342 ? 23.970 12.012  41.747 1.00 28.46  ? 342  TRP A CD2 1 
ATOM   2818 N  NE1 . TRP A 1 342 ? 24.478 12.987  39.794 1.00 28.74  ? 342  TRP A NE1 1 
ATOM   2819 C  CE2 . TRP A 1 342 ? 23.429 12.611  40.584 1.00 28.16  ? 342  TRP A CE2 1 
ATOM   2820 C  CE3 . TRP A 1 342 ? 23.096 11.533  42.735 1.00 26.91  ? 342  TRP A CE3 1 
ATOM   2821 C  CZ2 . TRP A 1 342 ? 22.050 12.741  40.378 1.00 27.86  ? 342  TRP A CZ2 1 
ATOM   2822 C  CZ3 . TRP A 1 342 ? 21.724 11.663  42.532 1.00 27.98  ? 342  TRP A CZ3 1 
ATOM   2823 C  CH2 . TRP A 1 342 ? 21.215 12.265  41.359 1.00 28.66  ? 342  TRP A CH2 1 
ATOM   2824 N  N   . ASP A 1 343 ? 25.269 11.813  45.432 1.00 29.66  ? 343  ASP A N   1 
ATOM   2825 C  CA  . ASP A 1 343 ? 24.149 11.761  46.351 1.00 30.43  ? 343  ASP A CA  1 
ATOM   2826 C  C   . ASP A 1 343 ? 24.288 12.810  47.424 1.00 29.09  ? 343  ASP A C   1 
ATOM   2827 O  O   . ASP A 1 343 ? 23.530 13.769  47.473 1.00 30.62  ? 343  ASP A O   1 
ATOM   2828 C  CB  . ASP A 1 343 ? 24.099 10.383  46.993 1.00 34.46  ? 343  ASP A CB  1 
ATOM   2829 C  CG  . ASP A 1 343 ? 22.741 9.735   46.862 1.00 40.55  ? 343  ASP A CG  1 
ATOM   2830 O  OD1 . ASP A 1 343 ? 21.788 10.245  47.502 1.00 42.36  ? 343  ASP A OD1 1 
ATOM   2831 O  OD2 . ASP A 1 343 ? 22.631 8.727   46.112 1.00 41.39  ? 343  ASP A OD2 1 
ATOM   2832 N  N   . VAL A 1 344 ? 25.274 12.617  48.284 1.00 28.14  ? 344  VAL A N   1 
ATOM   2833 C  CA  . VAL A 1 344 ? 25.531 13.533  49.381 1.00 25.54  ? 344  VAL A CA  1 
ATOM   2834 C  C   . VAL A 1 344 ? 25.489 14.987  48.924 1.00 24.87  ? 344  VAL A C   1 
ATOM   2835 O  O   . VAL A 1 344 ? 24.922 15.834  49.602 1.00 25.71  ? 344  VAL A O   1 
ATOM   2836 C  CB  . VAL A 1 344 ? 26.917 13.259  50.015 1.00 25.47  ? 344  VAL A CB  1 
ATOM   2837 C  CG1 . VAL A 1 344 ? 27.229 14.310  51.056 1.00 27.43  ? 344  VAL A CG1 1 
ATOM   2838 C  CG2 . VAL A 1 344 ? 26.951 11.886  50.634 1.00 21.46  ? 344  VAL A CG2 1 
ATOM   2839 N  N   . SER A 1 345 ? 26.090 15.281  47.778 1.00 22.68  ? 345  SER A N   1 
ATOM   2840 C  CA  . SER A 1 345 ? 26.111 16.652  47.304 1.00 22.75  ? 345  SER A CA  1 
ATOM   2841 C  C   . SER A 1 345 ? 24.721 17.204  47.060 1.00 22.81  ? 345  SER A C   1 
ATOM   2842 O  O   . SER A 1 345 ? 24.482 18.391  47.232 1.00 24.86  ? 345  SER A O   1 
ATOM   2843 C  CB  . SER A 1 345 ? 26.944 16.774  46.027 1.00 23.36  ? 345  SER A CB  1 
ATOM   2844 O  OG  . SER A 1 345 ? 26.377 16.046  44.949 1.00 26.48  ? 345  SER A OG  1 
ATOM   2845 N  N   . ARG A 1 346 ? 23.790 16.349  46.672 1.00 22.19  ? 346  ARG A N   1 
ATOM   2846 C  CA  . ARG A 1 346 ? 22.442 16.818  46.398 1.00 22.36  ? 346  ARG A CA  1 
ATOM   2847 C  C   . ARG A 1 346 ? 21.515 16.481  47.533 1.00 23.18  ? 346  ARG A C   1 
ATOM   2848 O  O   . ARG A 1 346 ? 20.302 16.452  47.350 1.00 26.16  ? 346  ARG A O   1 
ATOM   2849 C  CB  . ARG A 1 346 ? 21.903 16.175  45.116 1.00 22.03  ? 346  ARG A CB  1 
ATOM   2850 C  CG  . ARG A 1 346 ? 22.689 16.513  43.868 1.00 21.46  ? 346  ARG A CG  1 
ATOM   2851 C  CD  . ARG A 1 346 ? 22.092 15.883  42.623 1.00 19.85  ? 346  ARG A CD  1 
ATOM   2852 N  NE  . ARG A 1 346 ? 22.823 16.337  41.453 1.00 19.26  ? 346  ARG A NE  1 
ATOM   2853 C  CZ  . ARG A 1 346 ? 24.118 16.127  41.271 1.00 20.55  ? 346  ARG A CZ  1 
ATOM   2854 N  NH1 . ARG A 1 346 ? 24.810 15.454  42.177 1.00 19.39  ? 346  ARG A NH1 1 
ATOM   2855 N  NH2 . ARG A 1 346 ? 24.735 16.637  40.212 1.00 22.94  ? 346  ARG A NH2 1 
ATOM   2856 N  N   . SER A 1 347 ? 22.069 16.247  48.714 1.00 23.22  ? 347  SER A N   1 
ATOM   2857 C  CA  . SER A 1 347 ? 21.238 15.857  49.846 1.00 22.68  ? 347  SER A CA  1 
ATOM   2858 C  C   . SER A 1 347 ? 21.131 16.849  50.988 1.00 22.51  ? 347  SER A C   1 
ATOM   2859 O  O   . SER A 1 347 ? 22.036 17.649  51.228 1.00 22.01  ? 347  SER A O   1 
ATOM   2860 C  CB  . SER A 1 347 ? 21.726 14.520  50.397 1.00 21.31  ? 347  SER A CB  1 
ATOM   2861 O  OG  . SER A 1 347 ? 20.842 14.060  51.390 1.00 24.36  ? 347  SER A OG  1 
ATOM   2862 N  N   . SER A 1 348 ? 20.000 16.797  51.685 1.00 22.39  ? 348  SER A N   1 
ATOM   2863 C  CA  . SER A 1 348 ? 19.784 17.662  52.834 1.00 22.56  ? 348  SER A CA  1 
ATOM   2864 C  C   . SER A 1 348 ? 20.351 16.885  54.015 1.00 23.25  ? 348  SER A C   1 
ATOM   2865 O  O   . SER A 1 348 ? 20.545 15.661  53.922 1.00 23.64  ? 348  SER A O   1 
ATOM   2866 C  CB  . SER A 1 348 ? 18.297 17.920  53.066 1.00 23.57  ? 348  SER A CB  1 
ATOM   2867 O  OG  . SER A 1 348 ? 17.665 16.814  53.698 1.00 25.04  ? 348  SER A OG  1 
ATOM   2868 N  N   . THR A 1 349 ? 20.603 17.581  55.121 1.00 21.41  ? 349  THR A N   1 
ATOM   2869 C  CA  . THR A 1 349 ? 21.168 16.941  56.297 1.00 21.22  ? 349  THR A CA  1 
ATOM   2870 C  C   . THR A 1 349 ? 20.352 15.785  56.833 1.00 22.63  ? 349  THR A C   1 
ATOM   2871 O  O   . THR A 1 349 ? 20.924 14.777  57.259 1.00 24.11  ? 349  THR A O   1 
ATOM   2872 C  CB  . THR A 1 349 ? 21.396 17.936  57.418 1.00 20.81  ? 349  THR A CB  1 
ATOM   2873 O  OG1 . THR A 1 349 ? 20.275 18.825  57.504 1.00 23.49  ? 349  THR A OG1 1 
ATOM   2874 C  CG2 . THR A 1 349 ? 22.689 18.711  57.171 1.00 18.68  ? 349  THR A CG2 1 
ATOM   2875 N  N   . GLY A 1 350 ? 19.026 15.916  56.804 1.00 22.75  ? 350  GLY A N   1 
ATOM   2876 C  CA  . GLY A 1 350 ? 18.165 14.849  57.287 1.00 19.98  ? 350  GLY A CA  1 
ATOM   2877 C  C   . GLY A 1 350 ? 18.512 13.528  56.632 1.00 20.95  ? 350  GLY A C   1 
ATOM   2878 O  O   . GLY A 1 350 ? 18.615 12.501  57.309 1.00 19.44  ? 350  GLY A O   1 
ATOM   2879 N  N   . ASN A 1 351 ? 18.701 13.547  55.312 1.00 21.29  ? 351  ASN A N   1 
ATOM   2880 C  CA  . ASN A 1 351 ? 19.047 12.332  54.591 1.00 22.11  ? 351  ASN A CA  1 
ATOM   2881 C  C   . ASN A 1 351 ? 20.476 11.934  54.857 1.00 21.42  ? 351  ASN A C   1 
ATOM   2882 O  O   . ASN A 1 351 ? 20.785 10.747  54.905 1.00 21.21  ? 351  ASN A O   1 
ATOM   2883 C  CB  . ASN A 1 351 ? 18.818 12.498  53.091 1.00 25.81  ? 351  ASN A CB  1 
ATOM   2884 C  CG  . ASN A 1 351 ? 17.359 12.700  52.761 1.00 30.09  ? 351  ASN A CG  1 
ATOM   2885 O  OD1 . ASN A 1 351 ? 16.492 12.001  53.299 1.00 32.28  ? 351  ASN A OD1 1 
ATOM   2886 N  ND2 . ASN A 1 351 ? 17.071 13.660  51.881 1.00 32.65  ? 351  ASN A ND2 1 
ATOM   2887 N  N   . LEU A 1 352 ? 21.357 12.913  55.024 1.00 20.54  ? 352  LEU A N   1 
ATOM   2888 C  CA  . LEU A 1 352 ? 22.741 12.589  55.329 1.00 20.54  ? 352  LEU A CA  1 
ATOM   2889 C  C   . LEU A 1 352 ? 22.761 11.802  56.619 1.00 21.09  ? 352  LEU A C   1 
ATOM   2890 O  O   . LEU A 1 352 ? 23.621 10.946  56.813 1.00 22.21  ? 352  LEU A O   1 
ATOM   2891 C  CB  . LEU A 1 352 ? 23.578 13.843  55.533 1.00 21.71  ? 352  LEU A CB  1 
ATOM   2892 C  CG  . LEU A 1 352 ? 23.879 14.718  54.331 1.00 20.54  ? 352  LEU A CG  1 
ATOM   2893 C  CD1 . LEU A 1 352 ? 25.232 15.365  54.545 1.00 18.36  ? 352  LEU A CD1 1 
ATOM   2894 C  CD2 . LEU A 1 352 ? 23.882 13.877  53.066 1.00 21.33  ? 352  LEU A CD2 1 
ATOM   2895 N  N   . VAL A 1 353 ? 21.818 12.110  57.507 1.00 21.08  ? 353  VAL A N   1 
ATOM   2896 C  CA  . VAL A 1 353 ? 21.713 11.430  58.801 1.00 21.68  ? 353  VAL A CA  1 
ATOM   2897 C  C   . VAL A 1 353 ? 21.017 10.086  58.618 1.00 22.90  ? 353  VAL A C   1 
ATOM   2898 O  O   . VAL A 1 353 ? 21.333 9.106   59.300 1.00 24.17  ? 353  VAL A O   1 
ATOM   2899 C  CB  . VAL A 1 353 ? 20.891 12.269  59.841 1.00 19.93  ? 353  VAL A CB  1 
ATOM   2900 C  CG1 . VAL A 1 353 ? 20.669 11.463  61.097 1.00 19.80  ? 353  VAL A CG1 1 
ATOM   2901 C  CG2 . VAL A 1 353 ? 21.610 13.553  60.188 1.00 16.27  ? 353  VAL A CG2 1 
ATOM   2902 N  N   . GLU A 1 354 ? 20.066 10.057  57.690 1.00 23.53  ? 354  GLU A N   1 
ATOM   2903 C  CA  . GLU A 1 354 ? 19.293 8.856   57.394 1.00 23.76  ? 354  GLU A CA  1 
ATOM   2904 C  C   . GLU A 1 354 ? 20.164 7.785   56.762 1.00 22.98  ? 354  GLU A C   1 
ATOM   2905 O  O   . GLU A 1 354 ? 19.884 6.601   56.892 1.00 21.71  ? 354  GLU A O   1 
ATOM   2906 C  CB  . GLU A 1 354 ? 18.158 9.196   56.431 1.00 27.07  ? 354  GLU A CB  1 
ATOM   2907 C  CG  . GLU A 1 354 ? 17.174 8.078   56.234 1.00 28.46  ? 354  GLU A CG  1 
ATOM   2908 C  CD  . GLU A 1 354 ? 16.201 8.012   57.365 1.00 30.65  ? 354  GLU A CD  1 
ATOM   2909 O  OE1 . GLU A 1 354 ? 15.124 8.632   57.276 1.00 33.10  ? 354  GLU A OE1 1 
ATOM   2910 O  OE2 . GLU A 1 354 ? 16.524 7.354   58.364 1.00 34.71  ? 354  GLU A OE2 1 
ATOM   2911 N  N   . TRP A 1 355 ? 21.209 8.205   56.054 1.00 23.87  ? 355  TRP A N   1 
ATOM   2912 C  CA  . TRP A 1 355 ? 22.104 7.253   55.404 1.00 25.11  ? 355  TRP A CA  1 
ATOM   2913 C  C   . TRP A 1 355 ? 23.109 6.714   56.394 1.00 23.63  ? 355  TRP A C   1 
ATOM   2914 O  O   . TRP A 1 355 ? 23.601 5.592   56.254 1.00 23.10  ? 355  TRP A O   1 
ATOM   2915 C  CB  . TRP A 1 355 ? 22.843 7.898   54.227 1.00 26.07  ? 355  TRP A CB  1 
ATOM   2916 C  CG  . TRP A 1 355 ? 22.022 8.008   52.982 1.00 27.58  ? 355  TRP A CG  1 
ATOM   2917 C  CD1 . TRP A 1 355 ? 21.682 9.148   52.336 1.00 28.62  ? 355  TRP A CD1 1 
ATOM   2918 C  CD2 . TRP A 1 355 ? 21.465 6.933   52.222 1.00 28.94  ? 355  TRP A CD2 1 
ATOM   2919 N  NE1 . TRP A 1 355 ? 20.950 8.858   51.216 1.00 31.22  ? 355  TRP A NE1 1 
ATOM   2920 C  CE2 . TRP A 1 355 ? 20.803 7.500   51.122 1.00 31.15  ? 355  TRP A CE2 1 
ATOM   2921 C  CE3 . TRP A 1 355 ? 21.466 5.540   52.361 1.00 31.94  ? 355  TRP A CE3 1 
ATOM   2922 C  CZ2 . TRP A 1 355 ? 20.143 6.727   50.161 1.00 33.79  ? 355  TRP A CZ2 1 
ATOM   2923 C  CZ3 . TRP A 1 355 ? 20.809 4.768   51.404 1.00 31.67  ? 355  TRP A CZ3 1 
ATOM   2924 C  CH2 . TRP A 1 355 ? 20.159 5.366   50.322 1.00 32.80  ? 355  TRP A CH2 1 
ATOM   2925 N  N   . PHE A 1 356 ? 23.402 7.529   57.395 1.00 21.80  ? 356  PHE A N   1 
ATOM   2926 C  CA  . PHE A 1 356 ? 24.341 7.158   58.428 1.00 21.95  ? 356  PHE A CA  1 
ATOM   2927 C  C   . PHE A 1 356 ? 23.691 6.058   59.252 1.00 24.04  ? 356  PHE A C   1 
ATOM   2928 O  O   . PHE A 1 356 ? 24.226 4.948   59.390 1.00 25.89  ? 356  PHE A O   1 
ATOM   2929 C  CB  . PHE A 1 356 ? 24.613 8.362   59.308 1.00 21.16  ? 356  PHE A CB  1 
ATOM   2930 C  CG  . PHE A 1 356 ? 25.797 8.204   60.203 1.00 22.33  ? 356  PHE A CG  1 
ATOM   2931 C  CD1 . PHE A 1 356 ? 27.088 8.328   59.695 1.00 21.30  ? 356  PHE A CD1 1 
ATOM   2932 C  CD2 . PHE A 1 356 ? 25.629 7.972   61.569 1.00 22.20  ? 356  PHE A CD2 1 
ATOM   2933 C  CE1 . PHE A 1 356 ? 28.198 8.232   60.530 1.00 20.42  ? 356  PHE A CE1 1 
ATOM   2934 C  CE2 . PHE A 1 356 ? 26.734 7.870   62.415 1.00 22.18  ? 356  PHE A CE2 1 
ATOM   2935 C  CZ  . PHE A 1 356 ? 28.023 8.003   61.896 1.00 21.17  ? 356  PHE A CZ  1 
ATOM   2936 N  N   . LEU A 1 357 ? 22.516 6.378   59.788 1.00 23.28  ? 357  LEU A N   1 
ATOM   2937 C  CA  . LEU A 1 357 ? 21.753 5.456   60.623 1.00 19.82  ? 357  LEU A CA  1 
ATOM   2938 C  C   . LEU A 1 357 ? 21.394 4.147   59.922 1.00 19.45  ? 357  LEU A C   1 
ATOM   2939 O  O   . LEU A 1 357 ? 21.287 3.105   60.566 1.00 21.04  ? 357  LEU A O   1 
ATOM   2940 C  CB  . LEU A 1 357 ? 20.488 6.159   61.116 1.00 17.68  ? 357  LEU A CB  1 
ATOM   2941 C  CG  . LEU A 1 357 ? 20.759 7.508   61.786 1.00 14.53  ? 357  LEU A CG  1 
ATOM   2942 C  CD1 . LEU A 1 357 ? 19.465 8.195   62.107 1.00 14.39  ? 357  LEU A CD1 1 
ATOM   2943 C  CD2 . LEU A 1 357 ? 21.561 7.299   63.043 1.00 13.58  ? 357  LEU A CD2 1 
ATOM   2944 N  N   . LEU A 1 358 ? 21.200 4.195   58.609 1.00 18.76  ? 358  LEU A N   1 
ATOM   2945 C  CA  . LEU A 1 358 ? 20.871 2.991   57.864 1.00 17.65  ? 358  LEU A CA  1 
ATOM   2946 C  C   . LEU A 1 358 ? 22.069 2.081   57.790 1.00 16.92  ? 358  LEU A C   1 
ATOM   2947 O  O   . LEU A 1 358 ? 21.933 0.863   57.863 1.00 15.42  ? 358  LEU A O   1 
ATOM   2948 C  CB  . LEU A 1 358 ? 20.418 3.335   56.456 1.00 19.84  ? 358  LEU A CB  1 
ATOM   2949 C  CG  . LEU A 1 358 ? 18.914 3.519   56.348 1.00 20.75  ? 358  LEU A CG  1 
ATOM   2950 C  CD1 . LEU A 1 358 ? 18.521 3.648   54.891 1.00 21.19  ? 358  LEU A CD1 1 
ATOM   2951 C  CD2 . LEU A 1 358 ? 18.234 2.313   56.972 1.00 22.18  ? 358  LEU A CD2 1 
ATOM   2952 N  N   . ARG A 1 359 ? 23.243 2.689   57.645 1.00 16.38  ? 359  ARG A N   1 
ATOM   2953 C  CA  . ARG A 1 359 ? 24.490 1.951   57.568 1.00 15.88  ? 359  ARG A CA  1 
ATOM   2954 C  C   . ARG A 1 359 ? 24.849 1.422   58.939 1.00 16.90  ? 359  ARG A C   1 
ATOM   2955 O  O   . ARG A 1 359 ? 25.215 0.257   59.104 1.00 17.84  ? 359  ARG A O   1 
ATOM   2956 C  CB  . ARG A 1 359 ? 25.590 2.860   57.059 1.00 15.85  ? 359  ARG A CB  1 
ATOM   2957 C  CG  . ARG A 1 359 ? 26.964 2.259   57.112 1.00 19.33  ? 359  ARG A CG  1 
ATOM   2958 C  CD  . ARG A 1 359 ? 27.987 3.241   56.560 1.00 25.54  ? 359  ARG A CD  1 
ATOM   2959 N  NE  . ARG A 1 359 ? 27.942 3.365   55.101 1.00 28.12  ? 359  ARG A NE  1 
ATOM   2960 C  CZ  . ARG A 1 359 ? 28.403 2.445   54.254 1.00 30.86  ? 359  ARG A CZ  1 
ATOM   2961 N  NH1 . ARG A 1 359 ? 28.947 1.321   54.710 1.00 31.70  ? 359  ARG A NH1 1 
ATOM   2962 N  NH2 . ARG A 1 359 ? 28.337 2.652   52.947 1.00 31.79  ? 359  ARG A NH2 1 
ATOM   2963 N  N   . LYS A 1 360 ? 24.734 2.280   59.940 1.00 18.46  ? 360  LYS A N   1 
ATOM   2964 C  CA  . LYS A 1 360 ? 25.054 1.873   61.298 1.00 18.22  ? 360  LYS A CA  1 
ATOM   2965 C  C   . LYS A 1 360 ? 24.098 0.790   61.776 1.00 17.52  ? 360  LYS A C   1 
ATOM   2966 O  O   . LYS A 1 360 ? 24.449 -0.032  62.620 1.00 18.80  ? 360  LYS A O   1 
ATOM   2967 C  CB  . LYS A 1 360 ? 25.014 3.089   62.225 1.00 18.84  ? 360  LYS A CB  1 
ATOM   2968 C  CG  . LYS A 1 360 ? 26.266 3.954   62.133 1.00 20.71  ? 360  LYS A CG  1 
ATOM   2969 C  CD  . LYS A 1 360 ? 27.454 3.230   62.749 1.00 21.66  ? 360  LYS A CD  1 
ATOM   2970 C  CE  . LYS A 1 360 ? 28.751 4.001   62.559 1.00 21.14  ? 360  LYS A CE  1 
ATOM   2971 N  NZ  . LYS A 1 360 ? 29.143 4.023   61.132 1.00 22.96  ? 360  LYS A NZ  1 
ATOM   2972 N  N   . ALA A 1 361 ? 22.891 0.786   61.227 1.00 17.01  ? 361  ALA A N   1 
ATOM   2973 C  CA  . ALA A 1 361 ? 21.896 -0.207  61.593 1.00 16.94  ? 361  ALA A CA  1 
ATOM   2974 C  C   . ALA A 1 361 ? 22.355 -1.584  61.119 1.00 18.19  ? 361  ALA A C   1 
ATOM   2975 O  O   . ALA A 1 361 ? 22.287 -2.563  61.856 1.00 17.78  ? 361  ALA A O   1 
ATOM   2976 C  CB  . ALA A 1 361 ? 20.558 0.148   60.964 1.00 16.56  ? 361  ALA A CB  1 
ATOM   2977 N  N   . TYR A 1 362 ? 22.831 -1.649  59.881 1.00 20.27  ? 362  TYR A N   1 
ATOM   2978 C  CA  . TYR A 1 362 ? 23.298 -2.901  59.306 1.00 21.75  ? 362  TYR A CA  1 
ATOM   2979 C  C   . TYR A 1 362 ? 24.394 -3.480  60.178 1.00 23.46  ? 362  TYR A C   1 
ATOM   2980 O  O   . TYR A 1 362 ? 24.354 -4.654  60.536 1.00 22.62  ? 362  TYR A O   1 
ATOM   2981 C  CB  . TYR A 1 362 ? 23.835 -2.679  57.885 1.00 22.12  ? 362  TYR A CB  1 
ATOM   2982 C  CG  . TYR A 1 362 ? 24.251 -3.961  57.209 1.00 21.31  ? 362  TYR A CG  1 
ATOM   2983 C  CD1 . TYR A 1 362 ? 23.293 -4.884  56.772 1.00 20.10  ? 362  TYR A CD1 1 
ATOM   2984 C  CD2 . TYR A 1 362 ? 25.605 -4.300  57.096 1.00 22.13  ? 362  TYR A CD2 1 
ATOM   2985 C  CE1 . TYR A 1 362 ? 23.670 -6.119  56.252 1.00 21.35  ? 362  TYR A CE1 1 
ATOM   2986 C  CE2 . TYR A 1 362 ? 25.998 -5.535  56.577 1.00 21.54  ? 362  TYR A CE2 1 
ATOM   2987 C  CZ  . TYR A 1 362 ? 25.028 -6.442  56.162 1.00 22.67  ? 362  TYR A CZ  1 
ATOM   2988 O  OH  . TYR A 1 362 ? 25.418 -7.678  55.699 1.00 23.91  ? 362  TYR A OH  1 
ATOM   2989 N  N   . GLU A 1 363 ? 25.379 -2.648  60.510 1.00 26.44  ? 363  GLU A N   1 
ATOM   2990 C  CA  . GLU A 1 363 ? 26.487 -3.073  61.356 1.00 28.22  ? 363  GLU A CA  1 
ATOM   2991 C  C   . GLU A 1 363 ? 25.948 -3.619  62.669 1.00 28.52  ? 363  GLU A C   1 
ATOM   2992 O  O   . GLU A 1 363 ? 26.183 -4.773  63.017 1.00 29.68  ? 363  GLU A O   1 
ATOM   2993 C  CB  . GLU A 1 363 ? 27.414 -1.898  61.654 1.00 29.89  ? 363  GLU A CB  1 
ATOM   2994 C  CG  . GLU A 1 363 ? 27.899 -1.158  60.426 1.00 34.55  ? 363  GLU A CG  1 
ATOM   2995 C  CD  . GLU A 1 363 ? 28.905 -0.076  60.765 1.00 37.45  ? 363  GLU A CD  1 
ATOM   2996 O  OE1 . GLU A 1 363 ? 29.426 0.561   59.829 1.00 40.02  ? 363  GLU A OE1 1 
ATOM   2997 O  OE2 . GLU A 1 363 ? 29.173 0.137   61.968 1.00 39.58  ? 363  GLU A OE2 1 
ATOM   2998 N  N   . ARG A 1 364 ? 25.212 -2.780  63.390 1.00 29.33  ? 364  ARG A N   1 
ATOM   2999 C  CA  . ARG A 1 364 ? 24.637 -3.153  64.681 1.00 29.34  ? 364  ARG A CA  1 
ATOM   3000 C  C   . ARG A 1 364 ? 23.459 -4.131  64.628 1.00 25.98  ? 364  ARG A C   1 
ATOM   3001 O  O   . ARG A 1 364 ? 22.847 -4.402  65.650 1.00 29.33  ? 364  ARG A O   1 
ATOM   3002 C  CB  . ARG A 1 364 ? 24.200 -1.892  65.426 1.00 33.64  ? 364  ARG A CB  1 
ATOM   3003 C  CG  . ARG A 1 364 ? 25.343 -1.011  65.928 1.00 39.26  ? 364  ARG A CG  1 
ATOM   3004 C  CD  . ARG A 1 364 ? 24.823 0.382   66.300 1.00 43.51  ? 364  ARG A CD  1 
ATOM   3005 N  NE  . ARG A 1 364 ? 25.544 1.009   67.407 1.00 45.33  ? 364  ARG A NE  1 
ATOM   3006 C  CZ  . ARG A 1 364 ? 26.860 1.193   67.446 1.00 48.17  ? 364  ARG A CZ  1 
ATOM   3007 N  NH1 . ARG A 1 364 ? 27.624 0.794   66.431 1.00 49.38  ? 364  ARG A NH1 1 
ATOM   3008 N  NH2 . ARG A 1 364 ? 27.413 1.784   68.503 1.00 48.84  ? 364  ARG A NH2 1 
ATOM   3009 N  N   . ASN A 1 365 ? 23.148 -4.657  63.453 1.00 21.34  ? 365  ASN A N   1 
ATOM   3010 C  CA  . ASN A 1 365 ? 22.040 -5.595  63.277 1.00 18.43  ? 365  ASN A CA  1 
ATOM   3011 C  C   . ASN A 1 365 ? 20.684 -5.087  63.778 1.00 18.51  ? 365  ASN A C   1 
ATOM   3012 O  O   . ASN A 1 365 ? 19.857 -5.856  64.250 1.00 19.54  ? 365  ASN A O   1 
ATOM   3013 C  CB  . ASN A 1 365 ? 22.375 -6.943  63.924 1.00 14.55  ? 365  ASN A CB  1 
ATOM   3014 C  CG  . ASN A 1 365 ? 21.335 -8.023  63.619 1.00 11.02  ? 365  ASN A CG  1 
ATOM   3015 O  OD1 . ASN A 1 365 ? 20.773 -8.056  62.547 1.00 11.69  ? 365  ASN A OD1 1 
ATOM   3016 N  ND2 . ASN A 1 365 ? 21.101 -8.918  64.568 1.00 14.38  ? 365  ASN A ND2 1 
ATOM   3017 N  N   . GLU A 1 366 ? 20.464 -3.785  63.674 1.00 17.59  ? 366  GLU A N   1 
ATOM   3018 C  CA  . GLU A 1 366 ? 19.198 -3.196  64.076 1.00 18.00  ? 366  GLU A CA  1 
ATOM   3019 C  C   . GLU A 1 366 ? 18.280 -3.135  62.855 1.00 17.21  ? 366  GLU A C   1 
ATOM   3020 O  O   . GLU A 1 366 ? 18.668 -2.618  61.805 1.00 17.11  ? 366  GLU A O   1 
ATOM   3021 C  CB  . GLU A 1 366 ? 19.406 -1.773  64.586 1.00 20.39  ? 366  GLU A CB  1 
ATOM   3022 C  CG  . GLU A 1 366 ? 19.809 -1.638  66.035 1.00 26.59  ? 366  GLU A CG  1 
ATOM   3023 C  CD  . GLU A 1 366 ? 18.614 -1.432  66.953 1.00 29.65  ? 366  GLU A CD  1 
ATOM   3024 O  OE1 . GLU A 1 366 ? 17.643 -0.771  66.528 1.00 31.49  ? 366  GLU A OE1 1 
ATOM   3025 O  OE2 . GLU A 1 366 ? 18.651 -1.916  68.105 1.00 30.84  ? 366  GLU A OE2 1 
ATOM   3026 N  N   . LEU A 1 367 ? 17.069 -3.664  62.984 1.00 16.17  ? 367  LEU A N   1 
ATOM   3027 C  CA  . LEU A 1 367 ? 16.114 -3.609  61.890 1.00 15.13  ? 367  LEU A CA  1 
ATOM   3028 C  C   . LEU A 1 367 ? 15.704 -2.151  61.787 1.00 15.23  ? 367  LEU A C   1 
ATOM   3029 O  O   . LEU A 1 367 ? 15.369 -1.537  62.796 1.00 14.95  ? 367  LEU A O   1 
ATOM   3030 C  CB  . LEU A 1 367 ? 14.885 -4.461  62.204 1.00 14.65  ? 367  LEU A CB  1 
ATOM   3031 C  CG  . LEU A 1 367 ? 13.787 -4.547  61.134 1.00 17.21  ? 367  LEU A CG  1 
ATOM   3032 C  CD1 . LEU A 1 367 ? 14.335 -5.127  59.814 1.00 15.54  ? 367  LEU A CD1 1 
ATOM   3033 C  CD2 . LEU A 1 367 ? 12.661 -5.411  61.671 1.00 14.91  ? 367  LEU A CD2 1 
ATOM   3034 N  N   . ALA A 1 368 ? 15.733 -1.583  60.586 1.00 15.88  ? 368  ALA A N   1 
ATOM   3035 C  CA  . ALA A 1 368 ? 15.342 -0.180  60.435 1.00 17.87  ? 368  ALA A CA  1 
ATOM   3036 C  C   . ALA A 1 368 ? 13.832 -0.015  60.338 1.00 18.61  ? 368  ALA A C   1 
ATOM   3037 O  O   . ALA A 1 368 ? 13.133 -0.798  59.690 1.00 18.67  ? 368  ALA A O   1 
ATOM   3038 C  CB  . ALA A 1 368 ? 16.006 0.443   59.208 1.00 15.62  ? 368  ALA A CB  1 
ATOM   3039 N  N   . PRO A 1 369 ? 13.300 1.001   61.011 1.00 19.13  ? 369  PRO A N   1 
ATOM   3040 C  CA  . PRO A 1 369 ? 11.858 1.184   60.920 1.00 19.33  ? 369  PRO A CA  1 
ATOM   3041 C  C   . PRO A 1 369 ? 11.576 1.707   59.520 1.00 21.52  ? 369  PRO A C   1 
ATOM   3042 O  O   . PRO A 1 369 ? 12.503 1.982   58.755 1.00 22.70  ? 369  PRO A O   1 
ATOM   3043 C  CB  . PRO A 1 369 ? 11.574 2.202   62.011 1.00 19.46  ? 369  PRO A CB  1 
ATOM   3044 C  CG  . PRO A 1 369 ? 12.839 2.995   62.086 1.00 20.45  ? 369  PRO A CG  1 
ATOM   3045 C  CD  . PRO A 1 369 ? 13.918 1.964   61.936 1.00 20.43  ? 369  PRO A CD  1 
ATOM   3046 N  N   . ASN A 1 370 ? 10.310 1.848   59.165 1.00 22.76  ? 370  ASN A N   1 
ATOM   3047 C  CA  . ASN A 1 370 ? 10.008 2.325   57.836 1.00 22.75  ? 370  ASN A CA  1 
ATOM   3048 C  C   . ASN A 1 370 ? 9.731  3.811   57.750 1.00 23.57  ? 370  ASN A C   1 
ATOM   3049 O  O   . ASN A 1 370 ? 9.563  4.491   58.765 1.00 22.84  ? 370  ASN A O   1 
ATOM   3050 C  CB  . ASN A 1 370 ? 8.829  1.559   57.264 1.00 23.41  ? 370  ASN A CB  1 
ATOM   3051 C  CG  . ASN A 1 370 ? 9.154  0.120   57.023 1.00 27.34  ? 370  ASN A CG  1 
ATOM   3052 O  OD1 . ASN A 1 370 ? 10.250 -0.205  56.552 1.00 30.37  ? 370  ASN A OD1 1 
ATOM   3053 N  ND2 . ASN A 1 370 ? 8.208  -0.767  57.334 1.00 28.17  ? 370  ASN A ND2 1 
ATOM   3054 N  N   . LYS A 1 371 ? 9.718  4.307   56.518 1.00 22.76  ? 371  LYS A N   1 
ATOM   3055 C  CA  . LYS A 1 371 ? 9.415  5.696   56.257 1.00 23.09  ? 371  LYS A CA  1 
ATOM   3056 C  C   . LYS A 1 371 ? 7.921  5.849   56.550 1.00 21.94  ? 371  LYS A C   1 
ATOM   3057 O  O   . LYS A 1 371 ? 7.162  4.876   56.519 1.00 22.18  ? 371  LYS A O   1 
ATOM   3058 C  CB  . LYS A 1 371 ? 9.705  6.033   54.790 1.00 25.60  ? 371  LYS A CB  1 
ATOM   3059 C  CG  . LYS A 1 371 ? 11.174 6.294   54.482 1.00 27.84  ? 371  LYS A CG  1 
ATOM   3060 C  CD  . LYS A 1 371 ? 11.415 6.560   53.000 1.00 28.07  ? 371  LYS A CD  1 
ATOM   3061 C  CE  . LYS A 1 371 ? 12.889 6.843   52.742 1.00 28.92  ? 371  LYS A CE  1 
ATOM   3062 N  NZ  . LYS A 1 371 ? 13.213 6.688   51.302 1.00 30.89  ? 371  LYS A NZ  1 
ATOM   3063 N  N   . PRO A 1 372 ? 7.479  7.071   56.841 1.00 20.65  ? 372  PRO A N   1 
ATOM   3064 C  CA  . PRO A 1 372 ? 6.070  7.348   57.145 1.00 23.33  ? 372  PRO A CA  1 
ATOM   3065 C  C   . PRO A 1 372 ? 5.129  7.303   55.939 1.00 25.88  ? 372  PRO A C   1 
ATOM   3066 O  O   . PRO A 1 372 ? 5.529  7.651   54.829 1.00 27.92  ? 372  PRO A O   1 
ATOM   3067 C  CB  . PRO A 1 372 ? 6.138  8.733   57.748 1.00 21.15  ? 372  PRO A CB  1 
ATOM   3068 C  CG  . PRO A 1 372 ? 7.238  9.360   56.950 1.00 19.59  ? 372  PRO A CG  1 
ATOM   3069 C  CD  . PRO A 1 372 ? 8.288  8.292   56.945 1.00 18.23  ? 372  PRO A CD  1 
ATOM   3070 N  N   . ASP A 1 373 ? 3.885  6.877   56.146 1.00 27.90  ? 373  ASP A N   1 
ATOM   3071 C  CA  . ASP A 1 373 ? 2.919  6.847   55.040 1.00 30.96  ? 373  ASP A CA  1 
ATOM   3072 C  C   . ASP A 1 373 ? 2.246  8.217   54.980 1.00 32.58  ? 373  ASP A C   1 
ATOM   3073 O  O   . ASP A 1 373 ? 1.973  8.827   56.020 1.00 33.09  ? 373  ASP A O   1 
ATOM   3074 C  CB  . ASP A 1 373 ? 1.864  5.757   55.243 1.00 31.84  ? 373  ASP A CB  1 
ATOM   3075 C  CG  . ASP A 1 373 ? 0.949  6.041   56.411 1.00 34.41  ? 373  ASP A CG  1 
ATOM   3076 O  OD1 . ASP A 1 373 ? 0.331  7.126   56.443 1.00 36.52  ? 373  ASP A OD1 1 
ATOM   3077 O  OD2 . ASP A 1 373 ? 0.841  5.176   57.298 1.00 35.46  ? 373  ASP A OD2 1 
ATOM   3078 N  N   . GLU A 1 374 ? 1.977  8.696   53.768 1.00 34.28  ? 374  GLU A N   1 
ATOM   3079 C  CA  . GLU A 1 374 ? 1.377  10.023  53.571 1.00 33.89  ? 374  GLU A CA  1 
ATOM   3080 C  C   . GLU A 1 374 ? 0.512  10.540  54.727 1.00 31.42  ? 374  GLU A C   1 
ATOM   3081 O  O   . GLU A 1 374 ? 0.736  11.645  55.209 1.00 28.95  ? 374  GLU A O   1 
ATOM   3082 C  CB  . GLU A 1 374 ? 0.575  10.068  52.258 1.00 34.73  ? 374  GLU A CB  1 
ATOM   3083 C  CG  . GLU A 1 374 ? 1.402  9.803   51.003 1.00 36.80  ? 374  GLU A CG  1 
ATOM   3084 C  CD  . GLU A 1 374 ? 2.583  10.753  50.827 1.00 38.39  ? 374  GLU A CD  1 
ATOM   3085 O  OE1 . GLU A 1 374 ? 2.372  11.980  50.764 1.00 39.27  ? 374  GLU A OE1 1 
ATOM   3086 O  OE2 . GLU A 1 374 ? 3.730  10.265  50.742 1.00 39.45  ? 374  GLU A OE2 1 
ATOM   3087 N  N   . LYS A 1 375 ? -0.460 9.755   55.179 1.00 30.03  ? 375  LYS A N   1 
ATOM   3088 C  CA  . LYS A 1 375 ? -1.314 10.214  56.266 1.00 31.14  ? 375  LYS A CA  1 
ATOM   3089 C  C   . LYS A 1 375 ? -0.450 10.719  57.413 1.00 31.45  ? 375  LYS A C   1 
ATOM   3090 O  O   . LYS A 1 375 ? -0.622 11.853  57.885 1.00 30.68  ? 375  LYS A O   1 
ATOM   3091 C  CB  . LYS A 1 375 ? -2.226 9.091   56.758 1.00 31.81  ? 375  LYS A CB  1 
ATOM   3092 C  CG  . LYS A 1 375 ? -3.232 9.527   57.808 1.00 32.83  ? 375  LYS A CG  1 
ATOM   3093 C  CD  . LYS A 1 375 ? -4.120 8.376   58.251 1.00 36.15  ? 375  LYS A CD  1 
ATOM   3094 C  CE  . LYS A 1 375 ? -4.989 7.873   57.107 1.00 41.28  ? 375  LYS A CE  1 
ATOM   3095 N  NZ  . LYS A 1 375 ? -5.871 6.720   57.494 1.00 43.80  ? 375  LYS A NZ  1 
ATOM   3096 N  N   . GLU A 1 376 ? 0.487  9.876   57.844 1.00 31.77  ? 376  GLU A N   1 
ATOM   3097 C  CA  . GLU A 1 376 ? 1.398  10.225  58.930 1.00 32.05  ? 376  GLU A CA  1 
ATOM   3098 C  C   . GLU A 1 376 ? 2.333  11.352  58.509 1.00 32.58  ? 376  GLU A C   1 
ATOM   3099 O  O   . GLU A 1 376 ? 2.451  12.352  59.217 1.00 32.68  ? 376  GLU A O   1 
ATOM   3100 C  CB  . GLU A 1 376 ? 2.211  8.997   59.365 1.00 31.43  ? 376  GLU A CB  1 
ATOM   3101 C  CG  . GLU A 1 376 ? 3.430  9.293   60.251 1.00 30.26  ? 376  GLU A CG  1 
ATOM   3102 C  CD  . GLU A 1 376 ? 3.080  9.955   61.578 1.00 31.17  ? 376  GLU A CD  1 
ATOM   3103 O  OE1 . GLU A 1 376 ? 2.386  10.991  61.561 1.00 33.77  ? 376  GLU A OE1 1 
ATOM   3104 O  OE2 . GLU A 1 376 ? 3.511  9.456   62.639 1.00 28.40  ? 376  GLU A OE2 1 
ATOM   3105 N  N   . LEU A 1 377 ? 2.980  11.199  57.354 1.00 33.38  ? 377  LEU A N   1 
ATOM   3106 C  CA  . LEU A 1 377 ? 3.908  12.218  56.854 1.00 34.78  ? 377  LEU A CA  1 
ATOM   3107 C  C   . LEU A 1 377 ? 3.315  13.611  57.056 1.00 36.24  ? 377  LEU A C   1 
ATOM   3108 O  O   . LEU A 1 377 ? 3.956  14.501  57.621 1.00 38.56  ? 377  LEU A O   1 
ATOM   3109 C  CB  . LEU A 1 377 ? 4.204  12.011  55.359 1.00 33.86  ? 377  LEU A CB  1 
ATOM   3110 C  CG  . LEU A 1 377 ? 5.502  12.607  54.772 1.00 33.03  ? 377  LEU A CG  1 
ATOM   3111 C  CD1 . LEU A 1 377 ? 5.401  12.637  53.252 1.00 31.54  ? 377  LEU A CD1 1 
ATOM   3112 C  CD2 . LEU A 1 377 ? 5.743  14.008  55.279 1.00 33.05  ? 377  LEU A CD2 1 
ATOM   3113 N  N   . ALA A 1 378 ? 2.087  13.794  56.587 1.00 36.12  ? 378  ALA A N   1 
ATOM   3114 C  CA  . ALA A 1 378 ? 1.419  15.075  56.717 1.00 34.75  ? 378  ALA A CA  1 
ATOM   3115 C  C   . ALA A 1 378 ? 1.236  15.431  58.187 1.00 34.60  ? 378  ALA A C   1 
ATOM   3116 O  O   . ALA A 1 378 ? 1.580  16.535  58.600 1.00 36.03  ? 378  ALA A O   1 
ATOM   3117 C  CB  . ALA A 1 378 ? 0.074  15.029  56.016 1.00 35.25  ? 378  ALA A CB  1 
ATOM   3118 N  N   . ARG A 1 379 ? 0.700  14.494  58.969 1.00 33.06  ? 379  ARG A N   1 
ATOM   3119 C  CA  . ARG A 1 379 ? 0.457  14.716  60.388 1.00 30.77  ? 379  ARG A CA  1 
ATOM   3120 C  C   . ARG A 1 379 ? 1.673  15.276  61.106 1.00 31.33  ? 379  ARG A C   1 
ATOM   3121 O  O   . ARG A 1 379 ? 1.557  16.111  61.994 1.00 32.16  ? 379  ARG A O   1 
ATOM   3122 C  CB  . ARG A 1 379 ? 0.045  13.415  61.065 1.00 31.56  ? 379  ARG A CB  1 
ATOM   3123 C  CG  . ARG A 1 379 ? -0.181 13.582  62.563 1.00 33.47  ? 379  ARG A CG  1 
ATOM   3124 C  CD  . ARG A 1 379 ? -0.567 12.284  63.271 1.00 31.37  ? 379  ARG A CD  1 
ATOM   3125 N  NE  . ARG A 1 379 ? 0.559  11.374  63.490 1.00 31.55  ? 379  ARG A NE  1 
ATOM   3126 C  CZ  . ARG A 1 379 ? 1.661  11.669  64.181 1.00 29.55  ? 379  ARG A CZ  1 
ATOM   3127 N  NH1 . ARG A 1 379 ? 1.810  12.866  64.731 1.00 27.42  ? 379  ARG A NH1 1 
ATOM   3128 N  NH2 . ARG A 1 379 ? 2.611  10.754  64.340 1.00 27.82  ? 379  ARG A NH2 1 
ATOM   3129 N  N   . ARG A 1 380 ? 2.848  14.810  60.725 1.00 32.06  ? 380  ARG A N   1 
ATOM   3130 C  CA  . ARG A 1 380 ? 4.065  15.279  61.356 1.00 32.57  ? 380  ARG A CA  1 
ATOM   3131 C  C   . ARG A 1 380 ? 4.399  16.719  60.985 1.00 34.40  ? 380  ARG A C   1 
ATOM   3132 O  O   . ARG A 1 380 ? 4.910  17.480  61.811 1.00 36.94  ? 380  ARG A O   1 
ATOM   3133 C  CB  . ARG A 1 380 ? 5.225  14.356  60.987 1.00 29.89  ? 380  ARG A CB  1 
ATOM   3134 C  CG  . ARG A 1 380 ? 5.104  12.979  61.592 1.00 26.06  ? 380  ARG A CG  1 
ATOM   3135 C  CD  . ARG A 1 380 ? 6.149  12.056  61.020 1.00 24.74  ? 380  ARG A CD  1 
ATOM   3136 N  NE  . ARG A 1 380 ? 6.019  10.705  61.544 1.00 22.07  ? 380  ARG A NE  1 
ATOM   3137 C  CZ  . ARG A 1 380 ? 6.908  9.746   61.337 1.00 22.12  ? 380  ARG A CZ  1 
ATOM   3138 N  NH1 . ARG A 1 380 ? 7.991  9.995   60.611 1.00 22.23  ? 380  ARG A NH1 1 
ATOM   3139 N  NH2 . ARG A 1 380 ? 6.724  8.547   61.873 1.00 22.35  ? 380  ARG A NH2 1 
ATOM   3140 N  N   . ARG A 1 381 ? 4.114  17.096  59.747 1.00 35.52  ? 381  ARG A N   1 
ATOM   3141 C  CA  . ARG A 1 381 ? 4.397  18.452  59.292 1.00 37.43  ? 381  ARG A CA  1 
ATOM   3142 C  C   . ARG A 1 381 ? 3.548  19.524  60.003 1.00 37.38  ? 381  ARG A C   1 
ATOM   3143 O  O   . ARG A 1 381 ? 3.934  20.697  60.070 1.00 35.84  ? 381  ARG A O   1 
ATOM   3144 C  CB  . ARG A 1 381 ? 4.192  18.524  57.777 1.00 38.54  ? 381  ARG A CB  1 
ATOM   3145 C  CG  . ARG A 1 381 ? 5.198  17.702  56.996 1.00 42.77  ? 381  ARG A CG  1 
ATOM   3146 C  CD  . ARG A 1 381 ? 4.883  17.686  55.508 1.00 47.27  ? 381  ARG A CD  1 
ATOM   3147 N  NE  . ARG A 1 381 ? 5.963  17.098  54.711 1.00 50.96  ? 381  ARG A NE  1 
ATOM   3148 C  CZ  . ARG A 1 381 ? 5.828  16.700  53.447 1.00 53.18  ? 381  ARG A CZ  1 
ATOM   3149 N  NH1 . ARG A 1 381 ? 4.658  16.821  52.831 1.00 54.28  ? 381  ARG A NH1 1 
ATOM   3150 N  NH2 . ARG A 1 381 ? 6.860  16.182  52.793 1.00 53.47  ? 381  ARG A NH2 1 
ATOM   3151 N  N   . GLN A 1 382 ? 2.408  19.105  60.551 1.00 37.88  ? 382  GLN A N   1 
ATOM   3152 C  CA  . GLN A 1 382 ? 1.486  20.008  61.237 1.00 37.83  ? 382  GLN A CA  1 
ATOM   3153 C  C   . GLN A 1 382 ? 2.001  20.555  62.570 1.00 38.71  ? 382  GLN A C   1 
ATOM   3154 O  O   . GLN A 1 382 ? 1.461  21.523  63.085 1.00 37.91  ? 382  GLN A O   1 
ATOM   3155 C  CB  . GLN A 1 382 ? 0.144  19.304  61.458 1.00 36.85  ? 382  GLN A CB  1 
ATOM   3156 C  CG  . GLN A 1 382 ? -0.446 18.647  60.214 1.00 33.79  ? 382  GLN A CG  1 
ATOM   3157 C  CD  . GLN A 1 382 ? -1.896 18.212  60.410 1.00 35.74  ? 382  GLN A CD  1 
ATOM   3158 O  OE1 . GLN A 1 382 ? -2.799 19.043  60.449 1.00 36.89  ? 382  GLN A OE1 1 
ATOM   3159 N  NE2 . GLN A 1 382 ? -2.120 16.907  60.542 1.00 36.73  ? 382  GLN A NE2 1 
ATOM   3160 N  N   . SER A 1 383 ? 3.042  19.931  63.116 1.00 41.24  ? 383  SER A N   1 
ATOM   3161 C  CA  . SER A 1 383 ? 3.650  20.339  64.386 1.00 41.99  ? 383  SER A CA  1 
ATOM   3162 C  C   . SER A 1 383 ? 3.828  21.848  64.511 1.00 45.13  ? 383  SER A C   1 
ATOM   3163 O  O   . SER A 1 383 ? 3.801  22.570  63.510 1.00 45.16  ? 383  SER A O   1 
ATOM   3164 C  CB  . SER A 1 383 ? 5.017  19.674  64.554 1.00 40.30  ? 383  SER A CB  1 
ATOM   3165 O  OG  . SER A 1 383 ? 4.911  18.264  64.559 1.00 38.08  ? 383  SER A OG  1 
ATOM   3166 N  N   . TYR A 1 384 ? 4.028  22.306  65.749 1.00 47.93  ? 384  TYR A N   1 
ATOM   3167 C  CA  . TYR A 1 384 ? 4.207  23.728  66.061 1.00 49.88  ? 384  TYR A CA  1 
ATOM   3168 C  C   . TYR A 1 384 ? 5.631  24.113  66.442 1.00 52.08  ? 384  TYR A C   1 
ATOM   3169 O  O   . TYR A 1 384 ? 6.233  23.511  67.333 1.00 51.80  ? 384  TYR A O   1 
ATOM   3170 C  CB  . TYR A 1 384 ? 3.272  24.142  67.204 1.00 48.53  ? 384  TYR A CB  1 
ATOM   3171 C  CG  . TYR A 1 384 ? 3.675  25.435  67.888 1.00 48.43  ? 384  TYR A CG  1 
ATOM   3172 C  CD1 . TYR A 1 384 ? 3.703  26.647  67.191 1.00 48.30  ? 384  TYR A CD1 1 
ATOM   3173 C  CD2 . TYR A 1 384 ? 4.052  25.446  69.231 1.00 48.42  ? 384  TYR A CD2 1 
ATOM   3174 C  CE1 . TYR A 1 384 ? 4.098  27.837  67.818 1.00 47.20  ? 384  TYR A CE1 1 
ATOM   3175 C  CE2 . TYR A 1 384 ? 4.448  26.630  69.863 1.00 47.25  ? 384  TYR A CE2 1 
ATOM   3176 C  CZ  . TYR A 1 384 ? 4.469  27.814  69.153 1.00 46.19  ? 384  TYR A CZ  1 
ATOM   3177 O  OH  . TYR A 1 384 ? 4.882  28.964  69.776 1.00 45.61  ? 384  TYR A OH  1 
ATOM   3178 N  N   . GLU A 1 385 ? 6.154  25.136  65.774 1.00 55.55  ? 385  GLU A N   1 
ATOM   3179 C  CA  . GLU A 1 385 ? 7.498  25.623  66.050 1.00 59.39  ? 385  GLU A CA  1 
ATOM   3180 C  C   . GLU A 1 385 ? 7.384  26.931  66.801 1.00 61.59  ? 385  GLU A C   1 
ATOM   3181 O  O   . GLU A 1 385 ? 6.796  27.890  66.301 1.00 61.53  ? 385  GLU A O   1 
ATOM   3182 C  CB  . GLU A 1 385 ? 8.263  25.844  64.750 1.00 60.23  ? 385  GLU A CB  1 
ATOM   3183 C  CG  . GLU A 1 385 ? 8.625  24.566  64.020 1.00 62.87  ? 385  GLU A CG  1 
ATOM   3184 C  CD  . GLU A 1 385 ? 8.728  24.766  62.514 1.00 65.13  ? 385  GLU A CD  1 
ATOM   3185 O  OE1 . GLU A 1 385 ? 7.689  25.077  61.880 1.00 66.06  ? 385  GLU A OE1 1 
ATOM   3186 O  OE2 . GLU A 1 385 ? 9.843  24.615  61.966 1.00 64.81  ? 385  GLU A OE2 1 
ATOM   3187 N  N   . GLY A 1 386 ? 7.940  26.959  68.006 1.00 64.97  ? 386  GLY A N   1 
ATOM   3188 C  CA  . GLY A 1 386 ? 7.895  28.161  68.819 1.00 69.69  ? 386  GLY A CA  1 
ATOM   3189 C  C   . GLY A 1 386 ? 9.254  28.515  69.391 1.00 72.77  ? 386  GLY A C   1 
ATOM   3190 O  O   . GLY A 1 386 ? 9.563  28.167  70.534 1.00 73.46  ? 386  GLY A O   1 
ATOM   3191 N  N   . GLY A 1 387 ? 10.065 29.205  68.590 1.00 75.42  ? 387  GLY A N   1 
ATOM   3192 C  CA  . GLY A 1 387 ? 11.395 29.608  69.020 1.00 77.77  ? 387  GLY A CA  1 
ATOM   3193 C  C   . GLY A 1 387 ? 11.362 30.370  70.330 1.00 79.31  ? 387  GLY A C   1 
ATOM   3194 O  O   . GLY A 1 387 ? 10.340 30.957  70.690 1.00 80.24  ? 387  GLY A O   1 
ATOM   3195 N  N   . TYR A 1 388 ? 12.482 30.376  71.043 1.00 80.37  ? 388  TYR A N   1 
ATOM   3196 C  CA  . TYR A 1 388 ? 12.549 31.058  72.331 1.00 81.69  ? 388  TYR A CA  1 
ATOM   3197 C  C   . TYR A 1 388 ? 13.841 31.873  72.466 1.00 81.87  ? 388  TYR A C   1 
ATOM   3198 O  O   . TYR A 1 388 ? 14.911 31.329  72.753 1.00 81.63  ? 388  TYR A O   1 
ATOM   3199 C  CB  . TYR A 1 388 ? 12.444 30.012  73.448 1.00 82.07  ? 388  TYR A CB  1 
ATOM   3200 C  CG  . TYR A 1 388 ? 12.128 30.538  74.835 1.00 83.13  ? 388  TYR A CG  1 
ATOM   3201 C  CD1 . TYR A 1 388 ? 11.655 29.672  75.825 1.00 84.13  ? 388  TYR A CD1 1 
ATOM   3202 C  CD2 . TYR A 1 388 ? 12.313 31.881  75.168 1.00 82.84  ? 388  TYR A CD2 1 
ATOM   3203 C  CE1 . TYR A 1 388 ? 11.372 30.122  77.106 1.00 84.75  ? 388  TYR A CE1 1 
ATOM   3204 C  CE2 . TYR A 1 388 ? 12.034 32.345  76.452 1.00 84.42  ? 388  TYR A CE2 1 
ATOM   3205 C  CZ  . TYR A 1 388 ? 11.564 31.457  77.414 1.00 85.81  ? 388  TYR A CZ  1 
ATOM   3206 O  OH  . TYR A 1 388 ? 11.291 31.892  78.690 1.00 87.90  ? 388  TYR A OH  1 
ATOM   3207 N  N   . VAL A 1 389 ? 13.727 33.182  72.254 1.00 81.51  ? 389  VAL A N   1 
ATOM   3208 C  CA  . VAL A 1 389 ? 14.871 34.085  72.351 1.00 81.26  ? 389  VAL A CA  1 
ATOM   3209 C  C   . VAL A 1 389 ? 14.538 35.256  73.281 1.00 80.88  ? 389  VAL A C   1 
ATOM   3210 O  O   . VAL A 1 389 ? 13.841 36.191  72.882 1.00 80.91  ? 389  VAL A O   1 
ATOM   3211 C  CB  . VAL A 1 389 ? 15.254 34.642  70.958 1.00 81.27  ? 389  VAL A CB  1 
ATOM   3212 C  CG1 . VAL A 1 389 ? 16.550 35.435  71.049 1.00 81.88  ? 389  VAL A CG1 1 
ATOM   3213 C  CG2 . VAL A 1 389 ? 15.399 33.502  69.962 1.00 80.89  ? 389  VAL A CG2 1 
ATOM   3214 N  N   . LYS A 1 390 ? 15.035 35.207  74.516 1.00 80.39  ? 390  LYS A N   1 
ATOM   3215 C  CA  . LYS A 1 390 ? 14.756 36.271  75.472 1.00 79.89  ? 390  LYS A CA  1 
ATOM   3216 C  C   . LYS A 1 390 ? 15.060 37.616  74.831 1.00 79.40  ? 390  LYS A C   1 
ATOM   3217 O  O   . LYS A 1 390 ? 15.934 37.718  73.975 1.00 79.21  ? 390  LYS A O   1 
ATOM   3218 C  CB  . LYS A 1 390 ? 15.578 36.091  76.750 1.00 80.59  ? 390  LYS A CB  1 
ATOM   3219 C  CG  . LYS A 1 390 ? 15.147 37.030  77.871 1.00 81.65  ? 390  LYS A CG  1 
ATOM   3220 C  CD  . LYS A 1 390 ? 15.706 36.610  79.226 1.00 83.20  ? 390  LYS A CD  1 
ATOM   3221 C  CE  . LYS A 1 390 ? 15.096 35.294  79.702 1.00 83.80  ? 390  LYS A CE  1 
ATOM   3222 N  NZ  . LYS A 1 390 ? 15.616 34.869  81.037 1.00 83.67  ? 390  LYS A NZ  1 
ATOM   3223 N  N   . GLU A 1 391 ? 14.331 38.645  75.245 1.00 78.84  ? 391  GLU A N   1 
ATOM   3224 C  CA  . GLU A 1 391 ? 14.502 39.976  74.681 1.00 77.09  ? 391  GLU A CA  1 
ATOM   3225 C  C   . GLU A 1 391 ? 15.796 40.688  75.036 1.00 76.02  ? 391  GLU A C   1 
ATOM   3226 O  O   . GLU A 1 391 ? 16.240 40.677  76.185 1.00 75.15  ? 391  GLU A O   1 
ATOM   3227 C  CB  . GLU A 1 391 ? 13.309 40.856  75.058 1.00 77.78  ? 391  GLU A CB  1 
ATOM   3228 C  CG  . GLU A 1 391 ? 12.045 40.491  74.310 1.00 78.00  ? 391  GLU A CG  1 
ATOM   3229 C  CD  . GLU A 1 391 ? 12.174 40.718  72.812 1.00 78.82  ? 391  GLU A CD  1 
ATOM   3230 O  OE1 . GLU A 1 391 ? 11.318 40.206  72.063 1.00 79.83  ? 391  GLU A OE1 1 
ATOM   3231 O  OE2 . GLU A 1 391 ? 13.121 41.414  72.383 1.00 77.65  ? 391  GLU A OE2 1 
ATOM   3232 N  N   . PRO A 1 392 ? 16.422 41.320  74.032 1.00 75.34  ? 392  PRO A N   1 
ATOM   3233 C  CA  . PRO A 1 392 ? 17.671 42.057  74.191 1.00 74.70  ? 392  PRO A CA  1 
ATOM   3234 C  C   . PRO A 1 392 ? 17.597 43.129  75.270 1.00 74.96  ? 392  PRO A C   1 
ATOM   3235 O  O   . PRO A 1 392 ? 16.574 43.788  75.449 1.00 75.04  ? 392  PRO A O   1 
ATOM   3236 C  CB  . PRO A 1 392 ? 17.898 42.639  72.802 1.00 74.70  ? 392  PRO A CB  1 
ATOM   3237 C  CG  . PRO A 1 392 ? 17.358 41.578  71.923 1.00 74.63  ? 392  PRO A CG  1 
ATOM   3238 C  CD  . PRO A 1 392 ? 16.054 41.244  72.607 1.00 75.77  ? 392  PRO A CD  1 
ATOM   3239 N  N   . GLU A 1 393 ? 18.697 43.290  75.992 1.00 75.20  ? 393  GLU A N   1 
ATOM   3240 C  CA  . GLU A 1 393 ? 18.791 44.283  77.050 1.00 75.30  ? 393  GLU A CA  1 
ATOM   3241 C  C   . GLU A 1 393 ? 19.153 45.602  76.369 1.00 76.53  ? 393  GLU A C   1 
ATOM   3242 O  O   . GLU A 1 393 ? 20.309 46.021  76.411 1.00 77.84  ? 393  GLU A O   1 
ATOM   3243 C  CB  . GLU A 1 393 ? 19.892 43.864  78.027 1.00 73.23  ? 393  GLU A CB  1 
ATOM   3244 C  CG  . GLU A 1 393 ? 19.863 44.561  79.362 1.00 71.05  ? 393  GLU A CG  1 
ATOM   3245 C  CD  . GLU A 1 393 ? 18.521 44.441  80.041 1.00 70.29  ? 393  GLU A CD  1 
ATOM   3246 O  OE1 . GLU A 1 393 ? 17.584 45.147  79.619 1.00 69.35  ? 393  GLU A OE1 1 
ATOM   3247 O  OE2 . GLU A 1 393 ? 18.402 43.635  80.987 1.00 69.26  ? 393  GLU A OE2 1 
ATOM   3248 N  N   . ARG A 1 394 ? 18.166 46.247  75.742 1.00 77.22  ? 394  ARG A N   1 
ATOM   3249 C  CA  . ARG A 1 394 ? 18.388 47.502  75.017 1.00 77.45  ? 394  ARG A CA  1 
ATOM   3250 C  C   . ARG A 1 394 ? 19.449 48.394  75.654 1.00 76.62  ? 394  ARG A C   1 
ATOM   3251 O  O   . ARG A 1 394 ? 19.543 48.490  76.877 1.00 76.42  ? 394  ARG A O   1 
ATOM   3252 C  CB  . ARG A 1 394 ? 17.078 48.290  74.867 1.00 79.47  ? 394  ARG A CB  1 
ATOM   3253 C  CG  . ARG A 1 394 ? 17.198 49.472  73.898 1.00 82.36  ? 394  ARG A CG  1 
ATOM   3254 C  CD  . ARG A 1 394 ? 15.891 50.249  73.693 1.00 84.92  ? 394  ARG A CD  1 
ATOM   3255 N  NE  . ARG A 1 394 ? 14.878 49.490  72.960 1.00 87.41  ? 394  ARG A NE  1 
ATOM   3256 C  CZ  . ARG A 1 394 ? 13.837 50.036  72.331 1.00 88.01  ? 394  ARG A CZ  1 
ATOM   3257 N  NH1 . ARG A 1 394 ? 13.667 51.352  72.339 1.00 87.95  ? 394  ARG A NH1 1 
ATOM   3258 N  NH2 . ARG A 1 394 ? 12.964 49.265  71.693 1.00 88.11  ? 394  ARG A NH2 1 
ATOM   3259 N  N   . GLY A 1 395 ? 20.253 49.035  74.808 1.00 75.91  ? 395  GLY A N   1 
ATOM   3260 C  CA  . GLY A 1 395 ? 21.311 49.907  75.288 1.00 74.62  ? 395  GLY A CA  1 
ATOM   3261 C  C   . GLY A 1 395 ? 22.679 49.481  74.784 1.00 73.84  ? 395  GLY A C   1 
ATOM   3262 O  O   . GLY A 1 395 ? 22.830 48.389  74.232 1.00 73.64  ? 395  GLY A O   1 
ATOM   3263 N  N   . LEU A 1 396 ? 23.676 50.343  74.969 1.00 72.92  ? 396  LEU A N   1 
ATOM   3264 C  CA  . LEU A 1 396 ? 25.040 50.053  74.533 1.00 72.08  ? 396  LEU A CA  1 
ATOM   3265 C  C   . LEU A 1 396 ? 25.860 49.524  75.705 1.00 71.54  ? 396  LEU A C   1 
ATOM   3266 O  O   . LEU A 1 396 ? 25.811 50.075  76.806 1.00 71.14  ? 396  LEU A O   1 
ATOM   3267 C  CB  . LEU A 1 396 ? 25.684 51.310  73.963 1.00 71.98  ? 396  LEU A CB  1 
ATOM   3268 N  N   . TRP A 1 397 ? 26.609 48.450  75.466 1.00 71.08  ? 397  TRP A N   1 
ATOM   3269 C  CA  . TRP A 1 397 ? 27.430 47.843  76.512 1.00 71.22  ? 397  TRP A CA  1 
ATOM   3270 C  C   . TRP A 1 397 ? 28.900 47.756  76.100 1.00 71.45  ? 397  TRP A C   1 
ATOM   3271 O  O   . TRP A 1 397 ? 29.219 47.796  74.916 1.00 71.43  ? 397  TRP A O   1 
ATOM   3272 C  CB  . TRP A 1 397 ? 26.908 46.434  76.854 1.00 69.91  ? 397  TRP A CB  1 
ATOM   3273 C  CG  . TRP A 1 397 ? 25.494 46.403  77.379 1.00 68.33  ? 397  TRP A CG  1 
ATOM   3274 C  CD1 . TRP A 1 397 ? 24.345 46.450  76.645 1.00 68.10  ? 397  TRP A CD1 1 
ATOM   3275 C  CD2 . TRP A 1 397 ? 25.089 46.378  78.756 1.00 67.66  ? 397  TRP A CD2 1 
ATOM   3276 N  NE1 . TRP A 1 397 ? 23.252 46.460  77.476 1.00 67.70  ? 397  TRP A NE1 1 
ATOM   3277 C  CE2 . TRP A 1 397 ? 23.679 46.416  78.775 1.00 67.16  ? 397  TRP A CE2 1 
ATOM   3278 C  CE3 . TRP A 1 397 ? 25.780 46.328  79.971 1.00 68.53  ? 397  TRP A CE3 1 
ATOM   3279 C  CZ2 . TRP A 1 397 ? 22.947 46.412  79.967 1.00 67.46  ? 397  TRP A CZ2 1 
ATOM   3280 C  CZ3 . TRP A 1 397 ? 25.048 46.323  81.160 1.00 69.50  ? 397  TRP A CZ3 1 
ATOM   3281 C  CH2 . TRP A 1 397 ? 23.645 46.364  81.145 1.00 68.00  ? 397  TRP A CH2 1 
ATOM   3282 N  N   . GLU A 1 398 ? 29.791 47.639  77.083 1.00 72.41  ? 398  GLU A N   1 
ATOM   3283 C  CA  . GLU A 1 398 ? 31.225 47.537  76.810 1.00 73.18  ? 398  GLU A CA  1 
ATOM   3284 C  C   . GLU A 1 398 ? 31.872 46.370  77.555 1.00 72.84  ? 398  GLU A C   1 
ATOM   3285 O  O   . GLU A 1 398 ? 31.400 45.953  78.620 1.00 73.06  ? 398  GLU A O   1 
ATOM   3286 C  CB  . GLU A 1 398 ? 31.947 48.830  77.193 1.00 74.54  ? 398  GLU A CB  1 
ATOM   3287 C  CG  . GLU A 1 398 ? 31.514 50.058  76.415 1.00 76.36  ? 398  GLU A CG  1 
ATOM   3288 C  CD  . GLU A 1 398 ? 32.255 51.300  76.861 1.00 77.19  ? 398  GLU A CD  1 
ATOM   3289 O  OE1 . GLU A 1 398 ? 32.241 51.589  78.079 1.00 77.70  ? 398  GLU A OE1 1 
ATOM   3290 O  OE2 . GLU A 1 398 ? 32.847 51.985  75.998 1.00 77.60  ? 398  GLU A OE2 1 
ATOM   3291 N  N   . ASN A 1 399 ? 32.963 45.863  76.989 1.00 71.90  ? 399  ASN A N   1 
ATOM   3292 C  CA  . ASN A 1 399 ? 33.689 44.740  77.561 1.00 70.58  ? 399  ASN A CA  1 
ATOM   3293 C  C   . ASN A 1 399 ? 32.786 43.526  77.658 1.00 69.10  ? 399  ASN A C   1 
ATOM   3294 O  O   . ASN A 1 399 ? 32.686 42.891  78.704 1.00 68.47  ? 399  ASN A O   1 
ATOM   3295 C  CB  . ASN A 1 399 ? 34.236 45.112  78.938 1.00 72.68  ? 399  ASN A CB  1 
ATOM   3296 C  CG  . ASN A 1 399 ? 35.259 46.227  78.866 1.00 73.81  ? 399  ASN A CG  1 
ATOM   3297 O  OD1 . ASN A 1 399 ? 35.897 46.575  79.862 1.00 74.63  ? 399  ASN A OD1 1 
ATOM   3298 N  ND2 . ASN A 1 399 ? 35.420 46.797  77.678 1.00 74.63  ? 399  ASN A ND2 1 
ATOM   3299 N  N   . ILE A 1 400 ? 32.136 43.219  76.539 1.00 68.60  ? 400  ILE A N   1 
ATOM   3300 C  CA  . ILE A 1 400 ? 31.215 42.094  76.423 1.00 67.90  ? 400  ILE A CA  1 
ATOM   3301 C  C   . ILE A 1 400 ? 31.922 40.817  75.992 1.00 66.94  ? 400  ILE A C   1 
ATOM   3302 O  O   . ILE A 1 400 ? 32.830 40.842  75.158 1.00 66.28  ? 400  ILE A O   1 
ATOM   3303 C  CB  . ILE A 1 400 ? 30.124 42.355  75.356 1.00 68.92  ? 400  ILE A CB  1 
ATOM   3304 C  CG1 . ILE A 1 400 ? 29.378 43.657  75.651 1.00 69.46  ? 400  ILE A CG1 1 
ATOM   3305 C  CG2 . ILE A 1 400 ? 29.149 41.179  75.312 1.00 69.33  ? 400  ILE A CG2 1 
ATOM   3306 C  CD1 . ILE A 1 400 ? 28.363 44.027  74.574 1.00 69.14  ? 400  ILE A CD1 1 
ATOM   3307 N  N   . VAL A 1 401 ? 31.483 39.699  76.556 1.00 65.92  ? 401  VAL A N   1 
ATOM   3308 C  CA  . VAL A 1 401 ? 32.033 38.397  76.206 1.00 65.00  ? 401  VAL A CA  1 
ATOM   3309 C  C   . VAL A 1 401 ? 30.900 37.516  75.675 1.00 63.71  ? 401  VAL A C   1 
ATOM   3310 O  O   . VAL A 1 401 ? 29.727 37.773  75.942 1.00 63.79  ? 401  VAL A O   1 
ATOM   3311 C  CB  . VAL A 1 401 ? 32.689 37.707  77.425 1.00 64.56  ? 401  VAL A CB  1 
ATOM   3312 C  CG1 . VAL A 1 401 ? 33.989 38.406  77.787 1.00 65.11  ? 401  VAL A CG1 1 
ATOM   3313 C  CG2 . VAL A 1 401 ? 31.739 37.727  78.601 1.00 64.84  ? 401  VAL A CG2 1 
ATOM   3314 N  N   . TYR A 1 402 ? 31.251 36.496  74.902 1.00 62.44  ? 402  TYR A N   1 
ATOM   3315 C  CA  . TYR A 1 402 ? 30.258 35.585  74.360 1.00 61.32  ? 402  TYR A CA  1 
ATOM   3316 C  C   . TYR A 1 402 ? 30.666 34.174  74.742 1.00 61.80  ? 402  TYR A C   1 
ATOM   3317 O  O   . TYR A 1 402 ? 31.842 33.812  74.660 1.00 61.05  ? 402  TYR A O   1 
ATOM   3318 C  CB  . TYR A 1 402 ? 30.179 35.704  72.834 1.00 60.48  ? 402  TYR A CB  1 
ATOM   3319 C  CG  . TYR A 1 402 ? 29.072 34.876  72.209 1.00 60.44  ? 402  TYR A CG  1 
ATOM   3320 C  CD1 . TYR A 1 402 ? 27.735 35.217  72.392 1.00 60.90  ? 402  TYR A CD1 1 
ATOM   3321 C  CD2 . TYR A 1 402 ? 29.360 33.737  71.455 1.00 59.33  ? 402  TYR A CD2 1 
ATOM   3322 C  CE1 . TYR A 1 402 ? 26.708 34.441  71.840 1.00 61.04  ? 402  TYR A CE1 1 
ATOM   3323 C  CE2 . TYR A 1 402 ? 28.347 32.955  70.901 1.00 59.03  ? 402  TYR A CE2 1 
ATOM   3324 C  CZ  . TYR A 1 402 ? 27.021 33.309  71.097 1.00 60.27  ? 402  TYR A CZ  1 
ATOM   3325 O  OH  . TYR A 1 402 ? 26.006 32.534  70.566 1.00 58.05  ? 402  TYR A OH  1 
ATOM   3326 N  N   . LEU A 1 403 ? 29.686 33.387  75.176 1.00 62.77  ? 403  LEU A N   1 
ATOM   3327 C  CA  . LEU A 1 403 ? 29.912 31.999  75.569 1.00 62.44  ? 403  LEU A CA  1 
ATOM   3328 C  C   . LEU A 1 403 ? 28.816 31.153  74.935 1.00 61.04  ? 403  LEU A C   1 
ATOM   3329 O  O   . LEU A 1 403 ? 27.650 31.538  74.944 1.00 60.69  ? 403  LEU A O   1 
ATOM   3330 C  CB  . LEU A 1 403 ? 29.858 31.867  77.091 1.00 64.19  ? 403  LEU A CB  1 
ATOM   3331 C  CG  . LEU A 1 403 ? 30.745 32.827  77.895 1.00 65.21  ? 403  LEU A CG  1 
ATOM   3332 C  CD1 . LEU A 1 403 ? 30.358 32.763  79.371 1.00 63.88  ? 403  LEU A CD1 1 
ATOM   3333 C  CD2 . LEU A 1 403 ? 32.215 32.478  77.690 1.00 64.90  ? 403  LEU A CD2 1 
ATOM   3334 N  N   . ASP A 1 404 ? 29.196 30.007  74.380 1.00 60.15  ? 404  ASP A N   1 
ATOM   3335 C  CA  . ASP A 1 404 ? 28.245 29.114  73.723 1.00 59.01  ? 404  ASP A CA  1 
ATOM   3336 C  C   . ASP A 1 404 ? 28.610 27.679  74.047 1.00 57.86  ? 404  ASP A C   1 
ATOM   3337 O  O   . ASP A 1 404 ? 29.795 27.339  74.097 1.00 58.73  ? 404  ASP A O   1 
ATOM   3338 C  CB  . ASP A 1 404 ? 28.300 29.322  72.206 1.00 60.01  ? 404  ASP A CB  1 
ATOM   3339 C  CG  . ASP A 1 404 ? 29.648 28.934  71.612 1.00 60.52  ? 404  ASP A CG  1 
ATOM   3340 O  OD1 . ASP A 1 404 ? 30.687 29.298  72.207 1.00 59.30  ? 404  ASP A OD1 1 
ATOM   3341 O  OD2 . ASP A 1 404 ? 29.670 28.273  70.549 1.00 61.13  ? 404  ASP A OD2 1 
ATOM   3342 N  N   . PHE A 1 405 ? 27.604 26.836  74.263 1.00 56.07  ? 405  PHE A N   1 
ATOM   3343 C  CA  . PHE A 1 405 ? 27.860 25.434  74.579 1.00 54.49  ? 405  PHE A CA  1 
ATOM   3344 C  C   . PHE A 1 405 ? 28.527 24.698  73.414 1.00 53.23  ? 405  PHE A C   1 
ATOM   3345 O  O   . PHE A 1 405 ? 28.157 24.859  72.247 1.00 52.59  ? 405  PHE A O   1 
ATOM   3346 C  CB  . PHE A 1 405 ? 26.568 24.696  74.960 1.00 53.97  ? 405  PHE A CB  1 
ATOM   3347 C  CG  . PHE A 1 405 ? 25.942 25.166  76.250 1.00 53.58  ? 405  PHE A CG  1 
ATOM   3348 C  CD1 . PHE A 1 405 ? 25.192 26.340  76.294 1.00 53.19  ? 405  PHE A CD1 1 
ATOM   3349 C  CD2 . PHE A 1 405 ? 26.067 24.411  77.415 1.00 53.12  ? 405  PHE A CD2 1 
ATOM   3350 C  CE1 . PHE A 1 405 ? 24.571 26.751  77.479 1.00 51.63  ? 405  PHE A CE1 1 
ATOM   3351 C  CE2 . PHE A 1 405 ? 25.451 24.815  78.604 1.00 51.66  ? 405  PHE A CE2 1 
ATOM   3352 C  CZ  . PHE A 1 405 ? 24.701 25.986  78.634 1.00 50.73  ? 405  PHE A CZ  1 
ATOM   3353 N  N   . ARG A 1 406 ? 29.523 23.894  73.759 1.00 51.62  ? 406  ARG A N   1 
ATOM   3354 C  CA  . ARG A 1 406 ? 30.270 23.098  72.801 1.00 49.49  ? 406  ARG A CA  1 
ATOM   3355 C  C   . ARG A 1 406 ? 29.324 21.948  72.483 1.00 45.91  ? 406  ARG A C   1 
ATOM   3356 O  O   . ARG A 1 406 ? 29.193 21.021  73.278 1.00 48.87  ? 406  ARG A O   1 
ATOM   3357 C  CB  . ARG A 1 406 ? 31.549 22.571  73.478 1.00 52.31  ? 406  ARG A CB  1 
ATOM   3358 C  CG  . ARG A 1 406 ? 32.857 22.646  72.679 1.00 55.90  ? 406  ARG A CG  1 
ATOM   3359 C  CD  . ARG A 1 406 ? 33.067 21.458  71.729 1.00 59.31  ? 406  ARG A CD  1 
ATOM   3360 N  NE  . ARG A 1 406 ? 32.483 21.680  70.407 1.00 61.82  ? 406  ARG A NE  1 
ATOM   3361 C  CZ  . ARG A 1 406 ? 33.009 22.461  69.466 1.00 62.37  ? 406  ARG A CZ  1 
ATOM   3362 N  NH1 . ARG A 1 406 ? 34.148 23.107  69.684 1.00 61.92  ? 406  ARG A NH1 1 
ATOM   3363 N  NH2 . ARG A 1 406 ? 32.383 22.605  68.305 1.00 63.61  ? 406  ARG A NH2 1 
ATOM   3364 N  N   . SER A 1 407 ? 28.635 22.023  71.351 1.00 40.67  ? 407  SER A N   1 
ATOM   3365 C  CA  . SER A 1 407 ? 27.710 20.963  70.953 1.00 36.34  ? 407  SER A CA  1 
ATOM   3366 C  C   . SER A 1 407 ? 26.569 20.768  71.945 1.00 33.36  ? 407  SER A C   1 
ATOM   3367 O  O   . SER A 1 407 ? 26.366 19.668  72.450 1.00 30.66  ? 407  SER A O   1 
ATOM   3368 C  CB  . SER A 1 407 ? 28.467 19.639  70.798 1.00 36.77  ? 407  SER A CB  1 
ATOM   3369 O  OG  . SER A 1 407 ? 29.475 19.733  69.806 1.00 39.99  ? 407  SER A OG  1 
ATOM   3370 N  N   . LEU A 1 408 ? 25.810 21.826  72.208 1.00 31.58  ? 408  LEU A N   1 
ATOM   3371 C  CA  . LEU A 1 408 ? 24.703 21.741  73.160 1.00 30.25  ? 408  LEU A CA  1 
ATOM   3372 C  C   . LEU A 1 408 ? 23.751 20.588  72.892 1.00 28.84  ? 408  LEU A C   1 
ATOM   3373 O  O   . LEU A 1 408 ? 23.707 19.614  73.639 1.00 27.49  ? 408  LEU A O   1 
ATOM   3374 C  CB  . LEU A 1 408 ? 23.909 23.052  73.185 1.00 29.90  ? 408  LEU A CB  1 
ATOM   3375 C  CG  . LEU A 1 408 ? 22.742 23.149  74.182 1.00 28.41  ? 408  LEU A CG  1 
ATOM   3376 C  CD1 . LEU A 1 408 ? 23.231 22.773  75.565 1.00 26.07  ? 408  LEU A CD1 1 
ATOM   3377 C  CD2 . LEU A 1 408 ? 22.165 24.564  74.194 1.00 24.74  ? 408  LEU A CD2 1 
ATOM   3378 N  N   . TYR A 1 409 ? 22.990 20.702  71.815 1.00 29.76  ? 409  TYR A N   1 
ATOM   3379 C  CA  . TYR A 1 409 ? 22.018 19.677  71.457 1.00 29.79  ? 409  TYR A CA  1 
ATOM   3380 C  C   . TYR A 1 409 ? 22.533 18.245  71.371 1.00 28.72  ? 409  TYR A C   1 
ATOM   3381 O  O   . TYR A 1 409 ? 21.818 17.311  71.708 1.00 31.04  ? 409  TYR A O   1 
ATOM   3382 C  CB  . TYR A 1 409 ? 21.326 20.073  70.164 1.00 31.21  ? 409  TYR A CB  1 
ATOM   3383 C  CG  . TYR A 1 409 ? 20.291 21.154  70.355 1.00 32.61  ? 409  TYR A CG  1 
ATOM   3384 C  CD1 . TYR A 1 409 ? 20.172 21.836  71.568 1.00 32.27  ? 409  TYR A CD1 1 
ATOM   3385 C  CD2 . TYR A 1 409 ? 19.419 21.486  69.324 1.00 33.72  ? 409  TYR A CD2 1 
ATOM   3386 C  CE1 . TYR A 1 409 ? 19.205 22.822  71.745 1.00 32.84  ? 409  TYR A CE1 1 
ATOM   3387 C  CE2 . TYR A 1 409 ? 18.449 22.462  69.487 1.00 33.36  ? 409  TYR A CE2 1 
ATOM   3388 C  CZ  . TYR A 1 409 ? 18.346 23.125  70.694 1.00 33.59  ? 409  TYR A CZ  1 
ATOM   3389 O  OH  . TYR A 1 409 ? 17.370 24.078  70.837 1.00 33.58  ? 409  TYR A OH  1 
ATOM   3390 N  N   . PRO A 1 410 ? 23.761 18.040  70.889 1.00 27.43  ? 410  PRO A N   1 
ATOM   3391 C  CA  . PRO A 1 410 ? 24.222 16.648  70.836 1.00 26.82  ? 410  PRO A CA  1 
ATOM   3392 C  C   . PRO A 1 410 ? 24.623 16.177  72.236 1.00 26.07  ? 410  PRO A C   1 
ATOM   3393 O  O   . PRO A 1 410 ? 24.523 15.003  72.557 1.00 25.29  ? 410  PRO A O   1 
ATOM   3394 C  CB  . PRO A 1 410 ? 25.421 16.716  69.903 1.00 26.07  ? 410  PRO A CB  1 
ATOM   3395 C  CG  . PRO A 1 410 ? 25.084 17.833  69.028 1.00 26.31  ? 410  PRO A CG  1 
ATOM   3396 C  CD  . PRO A 1 410 ? 24.542 18.871  69.967 1.00 25.47  ? 410  PRO A CD  1 
ATOM   3397 N  N   . SER A 1 411 ? 25.084 17.113  73.058 1.00 26.51  ? 411  SER A N   1 
ATOM   3398 C  CA  . SER A 1 411 ? 25.497 16.803  74.420 1.00 26.93  ? 411  SER A CA  1 
ATOM   3399 C  C   . SER A 1 411 ? 24.317 16.283  75.224 1.00 26.52  ? 411  SER A C   1 
ATOM   3400 O  O   . SER A 1 411 ? 24.441 15.323  75.992 1.00 28.86  ? 411  SER A O   1 
ATOM   3401 C  CB  . SER A 1 411 ? 26.078 18.043  75.095 1.00 27.96  ? 411  SER A CB  1 
ATOM   3402 O  OG  . SER A 1 411 ? 27.337 18.375  74.536 1.00 31.22  ? 411  SER A OG  1 
ATOM   3403 N  N   . ILE A 1 412 ? 23.171 16.921  75.050 1.00 24.05  ? 412  ILE A N   1 
ATOM   3404 C  CA  . ILE A 1 412 ? 21.962 16.503  75.738 1.00 20.62  ? 412  ILE A CA  1 
ATOM   3405 C  C   . ILE A 1 412 ? 21.595 15.076  75.306 1.00 22.26  ? 412  ILE A C   1 
ATOM   3406 O  O   . ILE A 1 412 ? 21.444 14.187  76.145 1.00 21.44  ? 412  ILE A O   1 
ATOM   3407 C  CB  . ILE A 1 412 ? 20.830 17.476  75.414 1.00 17.21  ? 412  ILE A CB  1 
ATOM   3408 C  CG1 . ILE A 1 412 ? 21.214 18.864  75.948 1.00 14.40  ? 412  ILE A CG1 1 
ATOM   3409 C  CG2 . ILE A 1 412 ? 19.523 16.958  75.961 1.00 13.81  ? 412  ILE A CG2 1 
ATOM   3410 C  CD1 . ILE A 1 412 ? 20.353 20.025  75.452 1.00 10.69  ? 412  ILE A CD1 1 
ATOM   3411 N  N   . ILE A 1 413 ? 21.482 14.851  73.996 1.00 23.80  ? 413  ILE A N   1 
ATOM   3412 C  CA  . ILE A 1 413 ? 21.141 13.529  73.465 1.00 25.09  ? 413  ILE A CA  1 
ATOM   3413 C  C   . ILE A 1 413 ? 21.970 12.458  74.168 1.00 26.57  ? 413  ILE A C   1 
ATOM   3414 O  O   . ILE A 1 413 ? 21.445 11.426  74.565 1.00 27.92  ? 413  ILE A O   1 
ATOM   3415 C  CB  . ILE A 1 413 ? 21.426 13.421  71.940 1.00 27.37  ? 413  ILE A CB  1 
ATOM   3416 C  CG1 . ILE A 1 413 ? 20.787 14.588  71.173 1.00 28.78  ? 413  ILE A CG1 1 
ATOM   3417 C  CG2 . ILE A 1 413 ? 20.880 12.096  71.396 1.00 27.17  ? 413  ILE A CG2 1 
ATOM   3418 C  CD1 . ILE A 1 413 ? 19.280 14.522  71.059 1.00 27.33  ? 413  ILE A CD1 1 
ATOM   3419 N  N   . ILE A 1 414 ? 23.268 12.714  74.312 1.00 28.11  ? 414  ILE A N   1 
ATOM   3420 C  CA  . ILE A 1 414 ? 24.200 11.786  74.968 1.00 29.93  ? 414  ILE A CA  1 
ATOM   3421 C  C   . ILE A 1 414 ? 23.956 11.725  76.478 1.00 28.83  ? 414  ILE A C   1 
ATOM   3422 O  O   . ILE A 1 414 ? 23.535 10.707  77.026 1.00 28.33  ? 414  ILE A O   1 
ATOM   3423 C  CB  . ILE A 1 414 ? 25.682 12.212  74.716 1.00 30.81  ? 414  ILE A CB  1 
ATOM   3424 C  CG1 . ILE A 1 414 ? 26.010 12.078  73.232 1.00 32.05  ? 414  ILE A CG1 1 
ATOM   3425 C  CG2 . ILE A 1 414 ? 26.640 11.347  75.531 1.00 31.07  ? 414  ILE A CG2 1 
ATOM   3426 C  CD1 . ILE A 1 414 ? 27.448 12.339  72.902 1.00 34.45  ? 414  ILE A CD1 1 
ATOM   3427 N  N   . THR A 1 415 ? 24.249 12.829  77.140 1.00 27.80  ? 415  THR A N   1 
ATOM   3428 C  CA  . THR A 1 415 ? 24.047 12.941  78.569 1.00 28.10  ? 415  THR A CA  1 
ATOM   3429 C  C   . THR A 1 415 ? 22.760 12.270  79.033 1.00 26.88  ? 415  THR A C   1 
ATOM   3430 O  O   . THR A 1 415 ? 22.792 11.416  79.920 1.00 27.59  ? 415  THR A O   1 
ATOM   3431 C  CB  . THR A 1 415 ? 24.010 14.414  78.957 1.00 29.93  ? 415  THR A CB  1 
ATOM   3432 O  OG1 . THR A 1 415 ? 25.345 14.934  78.899 1.00 34.05  ? 415  THR A OG1 1 
ATOM   3433 C  CG2 . THR A 1 415 ? 23.390 14.609  80.336 1.00 28.81  ? 415  THR A CG2 1 
ATOM   3434 N  N   . HIS A 1 416 ? 21.632 12.654  78.438 1.00 25.36  ? 416  HIS A N   1 
ATOM   3435 C  CA  . HIS A 1 416 ? 20.344 12.075  78.826 1.00 24.96  ? 416  HIS A CA  1 
ATOM   3436 C  C   . HIS A 1 416 ? 19.917 10.898  77.963 1.00 24.90  ? 416  HIS A C   1 
ATOM   3437 O  O   . HIS A 1 416 ? 18.736 10.553  77.938 1.00 24.96  ? 416  HIS A O   1 
ATOM   3438 C  CB  . HIS A 1 416 ? 19.226 13.138  78.824 1.00 22.33  ? 416  HIS A CB  1 
ATOM   3439 C  CG  . HIS A 1 416 ? 19.449 14.250  79.800 1.00 19.97  ? 416  HIS A CG  1 
ATOM   3440 N  ND1 . HIS A 1 416 ? 19.614 15.562  79.412 1.00 20.67  ? 416  HIS A ND1 1 
ATOM   3441 C  CD2 . HIS A 1 416 ? 19.596 14.240  81.146 1.00 18.40  ? 416  HIS A CD2 1 
ATOM   3442 C  CE1 . HIS A 1 416 ? 19.858 16.310  80.474 1.00 17.67  ? 416  HIS A CE1 1 
ATOM   3443 N  NE2 . HIS A 1 416 ? 19.852 15.531  81.538 1.00 16.63  ? 416  HIS A NE2 1 
ATOM   3444 N  N   . ASN A 1 417 ? 20.869 10.287  77.259 1.00 24.67  ? 417  ASN A N   1 
ATOM   3445 C  CA  . ASN A 1 417 ? 20.575 9.128   76.415 1.00 25.23  ? 417  ASN A CA  1 
ATOM   3446 C  C   . ASN A 1 417 ? 19.171 9.226   75.779 1.00 24.75  ? 417  ASN A C   1 
ATOM   3447 O  O   . ASN A 1 417 ? 18.342 8.333   75.923 1.00 22.12  ? 417  ASN A O   1 
ATOM   3448 C  CB  . ASN A 1 417 ? 20.684 7.865   77.269 1.00 26.72  ? 417  ASN A CB  1 
ATOM   3449 C  CG  . ASN A 1 417 ? 20.663 6.598   76.448 1.00 29.58  ? 417  ASN A CG  1 
ATOM   3450 O  OD1 . ASN A 1 417 ? 19.833 5.719   76.678 1.00 31.14  ? 417  ASN A OD1 1 
ATOM   3451 N  ND2 . ASN A 1 417 ? 21.587 6.485   75.489 1.00 29.04  ? 417  ASN A ND2 1 
ATOM   3452 N  N   . VAL A 1 418 ? 18.924 10.329  75.078 1.00 25.65  ? 418  VAL A N   1 
ATOM   3453 C  CA  . VAL A 1 418 ? 17.643 10.593  74.433 1.00 25.66  ? 418  VAL A CA  1 
ATOM   3454 C  C   . VAL A 1 418 ? 17.573 9.900   73.089 1.00 27.30  ? 418  VAL A C   1 
ATOM   3455 O  O   . VAL A 1 418 ? 18.423 10.134  72.236 1.00 28.55  ? 418  VAL A O   1 
ATOM   3456 C  CB  . VAL A 1 418 ? 17.471 12.094  74.199 1.00 24.93  ? 418  VAL A CB  1 
ATOM   3457 C  CG1 . VAL A 1 418 ? 16.135 12.386  73.568 1.00 24.39  ? 418  VAL A CG1 1 
ATOM   3458 C  CG2 . VAL A 1 418 ? 17.624 12.823  75.501 1.00 24.81  ? 418  VAL A CG2 1 
ATOM   3459 N  N   . SER A 1 419 ? 16.560 9.060   72.897 1.00 27.55  ? 419  SER A N   1 
ATOM   3460 C  CA  . SER A 1 419 ? 16.400 8.334   71.637 1.00 27.77  ? 419  SER A CA  1 
ATOM   3461 C  C   . SER A 1 419 ? 15.051 7.634   71.564 1.00 25.94  ? 419  SER A C   1 
ATOM   3462 O  O   . SER A 1 419 ? 14.417 7.409   72.582 1.00 28.08  ? 419  SER A O   1 
ATOM   3463 C  CB  . SER A 1 419 ? 17.514 7.296   71.482 1.00 28.36  ? 419  SER A CB  1 
ATOM   3464 O  OG  . SER A 1 419 ? 17.324 6.523   70.307 1.00 33.09  ? 419  SER A OG  1 
ATOM   3465 N  N   . PRO A 1 420 ? 14.583 7.294   70.352 1.00 24.75  ? 420  PRO A N   1 
ATOM   3466 C  CA  . PRO A 1 420 ? 13.282 6.613   70.296 1.00 22.81  ? 420  PRO A CA  1 
ATOM   3467 C  C   . PRO A 1 420 ? 13.271 5.231   70.949 1.00 22.85  ? 420  PRO A C   1 
ATOM   3468 O  O   . PRO A 1 420 ? 12.223 4.753   71.386 1.00 23.96  ? 420  PRO A O   1 
ATOM   3469 C  CB  . PRO A 1 420 ? 12.968 6.564   68.794 1.00 18.89  ? 420  PRO A CB  1 
ATOM   3470 C  CG  . PRO A 1 420 ? 14.285 6.749   68.132 1.00 20.26  ? 420  PRO A CG  1 
ATOM   3471 C  CD  . PRO A 1 420 ? 14.999 7.738   69.010 1.00 22.30  ? 420  PRO A CD  1 
ATOM   3472 N  N   . ASP A 1 421 ? 14.432 4.594   71.031 1.00 21.73  ? 421  ASP A N   1 
ATOM   3473 C  CA  . ASP A 1 421 ? 14.493 3.273   71.624 1.00 20.74  ? 421  ASP A CA  1 
ATOM   3474 C  C   . ASP A 1 421 ? 14.789 3.317   73.127 1.00 20.71  ? 421  ASP A C   1 
ATOM   3475 O  O   . ASP A 1 421 ? 15.261 2.348   73.719 1.00 21.34  ? 421  ASP A O   1 
ATOM   3476 C  CB  . ASP A 1 421 ? 15.518 2.417   70.878 1.00 21.33  ? 421  ASP A CB  1 
ATOM   3477 C  CG  . ASP A 1 421 ? 16.904 3.002   70.922 1.00 22.71  ? 421  ASP A CG  1 
ATOM   3478 O  OD1 . ASP A 1 421 ? 17.051 4.206   70.634 1.00 23.15  ? 421  ASP A OD1 1 
ATOM   3479 O  OD2 . ASP A 1 421 ? 17.847 2.254   71.238 1.00 23.02  ? 421  ASP A OD2 1 
ATOM   3480 N  N   . THR A 1 422 ? 14.506 4.451   73.748 1.00 18.72  ? 422  THR A N   1 
ATOM   3481 C  CA  . THR A 1 422 ? 14.703 4.579   75.179 1.00 17.11  ? 422  THR A CA  1 
ATOM   3482 C  C   . THR A 1 422 ? 13.492 5.313   75.761 1.00 18.98  ? 422  THR A C   1 
ATOM   3483 O  O   . THR A 1 422 ? 13.225 5.255   76.966 1.00 20.33  ? 422  THR A O   1 
ATOM   3484 C  CB  . THR A 1 422 ? 16.022 5.341   75.525 1.00 13.63  ? 422  THR A CB  1 
ATOM   3485 O  OG1 . THR A 1 422 ? 15.985 6.660   74.979 1.00 11.64  ? 422  THR A OG1 1 
ATOM   3486 C  CG2 . THR A 1 422 ? 17.206 4.613   74.984 1.00 7.27   ? 422  THR A CG2 1 
ATOM   3487 N  N   . LEU A 1 423 ? 12.751 5.986   74.886 1.00 20.23  ? 423  LEU A N   1 
ATOM   3488 C  CA  . LEU A 1 423 ? 11.557 6.731   75.272 1.00 21.84  ? 423  LEU A CA  1 
ATOM   3489 C  C   . LEU A 1 423 ? 10.466 5.763   75.726 1.00 23.66  ? 423  LEU A C   1 
ATOM   3490 O  O   . LEU A 1 423 ? 10.079 4.855   74.988 1.00 21.52  ? 423  LEU A O   1 
ATOM   3491 C  CB  . LEU A 1 423 ? 11.082 7.572   74.086 1.00 22.59  ? 423  LEU A CB  1 
ATOM   3492 C  CG  . LEU A 1 423 ? 9.804  8.416   74.132 1.00 23.56  ? 423  LEU A CG  1 
ATOM   3493 C  CD1 . LEU A 1 423 ? 8.610  7.501   73.946 1.00 22.93  ? 423  LEU A CD1 1 
ATOM   3494 C  CD2 . LEU A 1 423 ? 9.730  9.223   75.435 1.00 23.11  ? 423  LEU A CD2 1 
ATOM   3495 N  N   . ASN A 1 424 ? 10.004 5.960   76.964 1.00 27.42  ? 424  ASN A N   1 
ATOM   3496 C  CA  . ASN A 1 424 ? 8.968  5.134   77.595 1.00 28.93  ? 424  ASN A CA  1 
ATOM   3497 C  C   . ASN A 1 424 ? 9.319  3.666   77.687 1.00 29.45  ? 424  ASN A C   1 
ATOM   3498 O  O   . ASN A 1 424 ? 8.475  2.810   77.437 1.00 27.60  ? 424  ASN A O   1 
ATOM   3499 C  CB  . ASN A 1 424 ? 7.640  5.271   76.858 1.00 30.71  ? 424  ASN A CB  1 
ATOM   3500 C  CG  . ASN A 1 424 ? 7.104  6.680   76.899 1.00 32.35  ? 424  ASN A CG  1 
ATOM   3501 O  OD1 . ASN A 1 424 ? 7.161  7.347   77.939 1.00 31.08  ? 424  ASN A OD1 1 
ATOM   3502 N  ND2 . ASN A 1 424 ? 6.571  7.145   75.771 1.00 33.52  ? 424  ASN A ND2 1 
ATOM   3503 N  N   . ARG A 1 425 ? 10.567 3.383   78.041 1.00 31.01  ? 425  ARG A N   1 
ATOM   3504 C  CA  . ARG A 1 425 ? 11.033 2.017   78.170 1.00 34.06  ? 425  ARG A CA  1 
ATOM   3505 C  C   . ARG A 1 425 ? 10.593 1.538   79.538 1.00 35.69  ? 425  ARG A C   1 
ATOM   3506 O  O   . ARG A 1 425 ? 11.117 1.990   80.548 1.00 35.37  ? 425  ARG A O   1 
ATOM   3507 C  CB  . ARG A 1 425 ? 12.552 1.979   78.066 1.00 36.94  ? 425  ARG A CB  1 
ATOM   3508 C  CG  . ARG A 1 425 ? 13.154 0.592   78.024 1.00 43.78  ? 425  ARG A CG  1 
ATOM   3509 C  CD  . ARG A 1 425 ? 12.612 -0.172  76.832 1.00 50.63  ? 425  ARG A CD  1 
ATOM   3510 N  NE  . ARG A 1 425 ? 13.655 -0.887  76.100 1.00 56.61  ? 425  ARG A NE  1 
ATOM   3511 C  CZ  . ARG A 1 425 ? 13.804 -0.832  74.775 1.00 60.68  ? 425  ARG A CZ  1 
ATOM   3512 N  NH1 . ARG A 1 425 ? 12.972 -0.089  74.036 1.00 59.55  ? 425  ARG A NH1 1 
ATOM   3513 N  NH2 . ARG A 1 425 ? 14.785 -1.519  74.184 1.00 61.38  ? 425  ARG A NH2 1 
ATOM   3514 N  N   . GLU A 1 426 ? 9.623  0.633   79.578 1.00 38.18  ? 426  GLU A N   1 
ATOM   3515 C  CA  . GLU A 1 426 ? 9.135  0.128   80.855 1.00 40.86  ? 426  GLU A CA  1 
ATOM   3516 C  C   . GLU A 1 426 ? 10.055 -0.940  81.410 1.00 39.86  ? 426  GLU A C   1 
ATOM   3517 O  O   . GLU A 1 426 ? 10.700 -1.669  80.652 1.00 37.66  ? 426  GLU A O   1 
ATOM   3518 C  CB  . GLU A 1 426 ? 7.718  -0.431  80.712 1.00 43.96  ? 426  GLU A CB  1 
ATOM   3519 C  CG  . GLU A 1 426 ? 7.553  -1.435  79.595 1.00 48.75  ? 426  GLU A CG  1 
ATOM   3520 C  CD  . GLU A 1 426 ? 6.118  -1.911  79.450 1.00 52.53  ? 426  GLU A CD  1 
ATOM   3521 O  OE1 . GLU A 1 426 ? 5.829  -2.616  78.456 1.00 55.55  ? 426  GLU A OE1 1 
ATOM   3522 O  OE2 . GLU A 1 426 ? 5.281  -1.589  80.325 1.00 52.65  ? 426  GLU A OE2 1 
ATOM   3523 N  N   . GLY A 1 427 ? 10.115 -1.012  82.738 1.00 38.53  ? 427  GLY A N   1 
ATOM   3524 C  CA  . GLY A 1 427 ? 10.964 -1.989  83.388 1.00 40.15  ? 427  GLY A CA  1 
ATOM   3525 C  C   . GLY A 1 427 ? 12.409 -1.548  83.590 1.00 41.19  ? 427  GLY A C   1 
ATOM   3526 O  O   . GLY A 1 427 ? 13.299 -2.385  83.771 1.00 42.89  ? 427  GLY A O   1 
ATOM   3527 N  N   . CYS A 1 428 ? 12.659 -0.243  83.550 1.00 40.02  ? 428  CYS A N   1 
ATOM   3528 C  CA  . CYS A 1 428 ? 14.007 0.265   83.747 1.00 38.78  ? 428  CYS A CA  1 
ATOM   3529 C  C   . CYS A 1 428 ? 14.156 0.688   85.195 1.00 39.45  ? 428  CYS A C   1 
ATOM   3530 O  O   . CYS A 1 428 ? 13.176 1.024   85.853 1.00 39.41  ? 428  CYS A O   1 
ATOM   3531 C  CB  . CYS A 1 428 ? 14.280 1.458   82.835 1.00 39.22  ? 428  CYS A CB  1 
ATOM   3532 S  SG  . CYS A 1 428 ? 14.534 1.046   81.080 1.00 41.76  ? 428  CYS A SG  1 
ATOM   3533 N  N   . LYS A 1 429 ? 15.382 0.657   85.696 1.00 39.35  ? 429  LYS A N   1 
ATOM   3534 C  CA  . LYS A 1 429 ? 15.628 1.045   87.067 1.00 38.87  ? 429  LYS A CA  1 
ATOM   3535 C  C   . LYS A 1 429 ? 16.042 2.500   87.124 1.00 38.04  ? 429  LYS A C   1 
ATOM   3536 O  O   . LYS A 1 429 ? 15.991 3.117   88.187 1.00 40.07  ? 429  LYS A O   1 
ATOM   3537 C  CB  . LYS A 1 429 ? 16.704 0.153   87.685 1.00 41.32  ? 429  LYS A CB  1 
ATOM   3538 C  CG  . LYS A 1 429 ? 18.006 0.102   86.909 1.00 43.88  ? 429  LYS A CG  1 
ATOM   3539 C  CD  . LYS A 1 429 ? 18.837 -1.096  87.347 1.00 44.82  ? 429  LYS A CD  1 
ATOM   3540 C  CE  . LYS A 1 429 ? 19.991 -1.355  86.385 1.00 46.64  ? 429  LYS A CE  1 
ATOM   3541 N  NZ  . LYS A 1 429 ? 20.706 -2.628  86.701 1.00 45.89  ? 429  LYS A NZ  1 
ATOM   3542 N  N   . GLU A 1 430 ? 16.451 3.050   85.983 1.00 35.87  ? 430  GLU A N   1 
ATOM   3543 C  CA  . GLU A 1 430 ? 16.853 4.453   85.927 1.00 34.25  ? 430  GLU A CA  1 
ATOM   3544 C  C   . GLU A 1 430 ? 16.285 5.235   84.726 1.00 34.09  ? 430  GLU A C   1 
ATOM   3545 O  O   . GLU A 1 430 ? 16.165 4.704   83.616 1.00 34.00  ? 430  GLU A O   1 
ATOM   3546 C  CB  . GLU A 1 430 ? 18.373 4.570   85.959 1.00 32.58  ? 430  GLU A CB  1 
ATOM   3547 C  CG  . GLU A 1 430 ? 18.842 6.003   85.884 1.00 33.80  ? 430  GLU A CG  1 
ATOM   3548 C  CD  . GLU A 1 430 ? 20.328 6.143   86.089 1.00 35.30  ? 430  GLU A CD  1 
ATOM   3549 O  OE1 . GLU A 1 430 ? 20.856 7.237   85.786 1.00 34.60  ? 430  GLU A OE1 1 
ATOM   3550 O  OE2 . GLU A 1 430 ? 20.959 5.168   86.559 1.00 33.94  ? 430  GLU A OE2 1 
ATOM   3551 N  N   . TYR A 1 431 ? 15.937 6.499   84.973 1.00 33.08  ? 431  TYR A N   1 
ATOM   3552 C  CA  . TYR A 1 431 ? 15.353 7.386   83.965 1.00 31.81  ? 431  TYR A CA  1 
ATOM   3553 C  C   . TYR A 1 431 ? 15.708 8.864   84.137 1.00 29.04  ? 431  TYR A C   1 
ATOM   3554 O  O   . TYR A 1 431 ? 16.016 9.318   85.231 1.00 29.33  ? 431  TYR A O   1 
ATOM   3555 C  CB  . TYR A 1 431 ? 13.822 7.301   83.999 1.00 34.31  ? 431  TYR A CB  1 
ATOM   3556 C  CG  . TYR A 1 431 ? 13.243 5.937   83.741 1.00 37.40  ? 431  TYR A CG  1 
ATOM   3557 C  CD1 . TYR A 1 431 ? 13.220 4.972   84.739 1.00 38.53  ? 431  TYR A CD1 1 
ATOM   3558 C  CD2 . TYR A 1 431 ? 12.680 5.621   82.503 1.00 38.55  ? 431  TYR A CD2 1 
ATOM   3559 C  CE1 . TYR A 1 431 ? 12.645 3.724   84.516 1.00 40.60  ? 431  TYR A CE1 1 
ATOM   3560 C  CE2 . TYR A 1 431 ? 12.104 4.379   82.269 1.00 38.79  ? 431  TYR A CE2 1 
ATOM   3561 C  CZ  . TYR A 1 431 ? 12.087 3.434   83.280 1.00 40.19  ? 431  TYR A CZ  1 
ATOM   3562 O  OH  . TYR A 1 431 ? 11.516 2.194   83.067 1.00 40.18  ? 431  TYR A OH  1 
ATOM   3563 N  N   . ASP A 1 432 ? 15.633 9.608   83.041 1.00 26.61  ? 432  ASP A N   1 
ATOM   3564 C  CA  . ASP A 1 432 ? 15.876 11.045  83.039 1.00 25.15  ? 432  ASP A CA  1 
ATOM   3565 C  C   . ASP A 1 432 ? 14.562 11.633  82.526 1.00 24.58  ? 432  ASP A C   1 
ATOM   3566 O  O   . ASP A 1 432 ? 13.981 11.100  81.585 1.00 22.76  ? 432  ASP A O   1 
ATOM   3567 C  CB  . ASP A 1 432 ? 17.024 11.403  82.093 1.00 25.41  ? 432  ASP A CB  1 
ATOM   3568 C  CG  . ASP A 1 432 ? 18.398 11.171  82.709 1.00 25.38  ? 432  ASP A CG  1 
ATOM   3569 O  OD1 . ASP A 1 432 ? 19.403 11.433  82.018 1.00 28.50  ? 432  ASP A OD1 1 
ATOM   3570 O  OD2 . ASP A 1 432 ? 18.490 10.734  83.871 1.00 23.82  ? 432  ASP A OD2 1 
ATOM   3571 N  N   . VAL A 1 433 ? 14.077 12.714  83.134 1.00 24.09  ? 433  VAL A N   1 
ATOM   3572 C  CA  . VAL A 1 433 ? 12.795 13.272  82.696 1.00 25.10  ? 433  VAL A CA  1 
ATOM   3573 C  C   . VAL A 1 433 ? 12.838 14.698  82.164 1.00 25.46  ? 433  VAL A C   1 
ATOM   3574 O  O   . VAL A 1 433 ? 12.755 15.651  82.930 1.00 28.60  ? 433  VAL A O   1 
ATOM   3575 C  CB  . VAL A 1 433 ? 11.725 13.206  83.823 1.00 22.59  ? 433  VAL A CB  1 
ATOM   3576 C  CG1 . VAL A 1 433 ? 10.447 13.882  83.361 1.00 23.55  ? 433  VAL A CG1 1 
ATOM   3577 C  CG2 . VAL A 1 433 ? 11.422 11.765  84.172 1.00 20.85  ? 433  VAL A CG2 1 
ATOM   3578 N  N   . ALA A 1 434 ? 12.928 14.826  80.842 1.00 22.67  ? 434  ALA A N   1 
ATOM   3579 C  CA  . ALA A 1 434 ? 12.999 16.114  80.197 1.00 20.74  ? 434  ALA A CA  1 
ATOM   3580 C  C   . ALA A 1 434 ? 12.149 17.147  80.913 1.00 22.75  ? 434  ALA A C   1 
ATOM   3581 O  O   . ALA A 1 434 ? 11.007 16.874  81.290 1.00 21.78  ? 434  ALA A O   1 
ATOM   3582 C  CB  . ALA A 1 434 ? 12.570 15.978  78.762 1.00 21.14  ? 434  ALA A CB  1 
ATOM   3583 N  N   . PRO A 1 435 ? 12.710 18.354  81.133 1.00 24.72  ? 435  PRO A N   1 
ATOM   3584 C  CA  . PRO A 1 435 ? 11.984 19.435  81.814 1.00 24.69  ? 435  PRO A CA  1 
ATOM   3585 C  C   . PRO A 1 435 ? 10.751 19.786  81.020 1.00 23.84  ? 435  PRO A C   1 
ATOM   3586 O  O   . PRO A 1 435 ? 10.641 19.404  79.868 1.00 22.77  ? 435  PRO A O   1 
ATOM   3587 C  CB  . PRO A 1 435 ? 12.995 20.581  81.836 1.00 24.38  ? 435  PRO A CB  1 
ATOM   3588 C  CG  . PRO A 1 435 ? 14.313 19.866  81.836 1.00 24.55  ? 435  PRO A CG  1 
ATOM   3589 C  CD  . PRO A 1 435 ? 14.093 18.767  80.832 1.00 24.10  ? 435  PRO A CD  1 
ATOM   3590 N  N   . GLN A 1 436 ? 9.832  20.511  81.646 1.00 26.57  ? 436  GLN A N   1 
ATOM   3591 C  CA  . GLN A 1 436 ? 8.590  20.927  81.008 1.00 30.08  ? 436  GLN A CA  1 
ATOM   3592 C  C   . GLN A 1 436 ? 7.803  19.739  80.467 1.00 30.56  ? 436  GLN A C   1 
ATOM   3593 O  O   . GLN A 1 436 ? 6.942  19.188  81.147 1.00 30.73  ? 436  GLN A O   1 
ATOM   3594 C  CB  . GLN A 1 436 ? 8.879  21.897  79.856 1.00 35.04  ? 436  GLN A CB  1 
ATOM   3595 C  CG  . GLN A 1 436 ? 9.830  23.043  80.204 1.00 39.66  ? 436  GLN A CG  1 
ATOM   3596 C  CD  . GLN A 1 436 ? 9.512  23.669  81.553 1.00 41.97  ? 436  GLN A CD  1 
ATOM   3597 O  OE1 . GLN A 1 436 ? 10.051 23.262  82.585 1.00 42.54  ? 436  GLN A OE1 1 
ATOM   3598 N  NE2 . GLN A 1 436 ? 8.619  24.653  81.551 1.00 44.38  ? 436  GLN A NE2 1 
ATOM   3599 N  N   . VAL A 1 437 ? 8.115  19.359  79.232 1.00 31.00  ? 437  VAL A N   1 
ATOM   3600 C  CA  . VAL A 1 437 ? 7.462  18.251  78.530 1.00 31.14  ? 437  VAL A CA  1 
ATOM   3601 C  C   . VAL A 1 437 ? 7.406  16.942  79.323 1.00 30.86  ? 437  VAL A C   1 
ATOM   3602 O  O   . VAL A 1 437 ? 6.475  16.137  79.168 1.00 27.37  ? 437  VAL A O   1 
ATOM   3603 C  CB  . VAL A 1 437 ? 8.175  18.004  77.191 1.00 31.66  ? 437  VAL A CB  1 
ATOM   3604 C  CG1 . VAL A 1 437 ? 8.132  19.276  76.340 1.00 31.07  ? 437  VAL A CG1 1 
ATOM   3605 C  CG2 . VAL A 1 437 ? 9.617  17.595  77.445 1.00 31.38  ? 437  VAL A CG2 1 
ATOM   3606 N  N   . GLY A 1 438 ? 8.426  16.739  80.153 1.00 32.04  ? 438  GLY A N   1 
ATOM   3607 C  CA  . GLY A 1 438 ? 8.511  15.555  80.991 1.00 33.99  ? 438  GLY A CA  1 
ATOM   3608 C  C   . GLY A 1 438 ? 8.466  14.195  80.314 1.00 33.24  ? 438  GLY A C   1 
ATOM   3609 O  O   . GLY A 1 438 ? 7.542  13.418  80.546 1.00 34.48  ? 438  GLY A O   1 
ATOM   3610 N  N   . HIS A 1 439 ? 9.459  13.893  79.487 1.00 31.50  ? 439  HIS A N   1 
ATOM   3611 C  CA  . HIS A 1 439 ? 9.491  12.605  78.813 1.00 32.27  ? 439  HIS A CA  1 
ATOM   3612 C  C   . HIS A 1 439 ? 10.453 11.742  79.570 1.00 32.65  ? 439  HIS A C   1 
ATOM   3613 O  O   . HIS A 1 439 ? 11.513 12.204  79.971 1.00 33.78  ? 439  HIS A O   1 
ATOM   3614 C  CB  . HIS A 1 439 ? 9.956  12.746  77.363 1.00 31.99  ? 439  HIS A CB  1 
ATOM   3615 C  CG  . HIS A 1 439 ? 8.958  13.420  76.478 1.00 30.38  ? 439  HIS A CG  1 
ATOM   3616 N  ND1 . HIS A 1 439 ? 7.776  12.820  76.101 1.00 29.79  ? 439  HIS A ND1 1 
ATOM   3617 C  CD2 . HIS A 1 439 ? 8.951  14.654  75.923 1.00 28.53  ? 439  HIS A CD2 1 
ATOM   3618 C  CE1 . HIS A 1 439 ? 7.083  13.657  75.350 1.00 28.59  ? 439  HIS A CE1 1 
ATOM   3619 N  NE2 . HIS A 1 439 ? 7.773  14.776  75.227 1.00 29.04  ? 439  HIS A NE2 1 
ATOM   3620 N  N   . ARG A 1 440 ? 10.075 10.486  79.768 1.00 33.38  ? 440  ARG A N   1 
ATOM   3621 C  CA  . ARG A 1 440 ? 10.901 9.545   80.503 1.00 32.53  ? 440  ARG A CA  1 
ATOM   3622 C  C   . ARG A 1 440 ? 11.854 8.837   79.538 1.00 31.41  ? 440  ARG A C   1 
ATOM   3623 O  O   . ARG A 1 440 ? 11.412 8.158   78.610 1.00 30.19  ? 440  ARG A O   1 
ATOM   3624 C  CB  . ARG A 1 440 ? 10.009 8.515   81.210 1.00 33.82  ? 440  ARG A CB  1 
ATOM   3625 C  CG  . ARG A 1 440 ? 8.822  9.098   81.989 1.00 35.09  ? 440  ARG A CG  1 
ATOM   3626 C  CD  . ARG A 1 440 ? 9.189  9.454   83.418 1.00 38.69  ? 440  ARG A CD  1 
ATOM   3627 N  NE  . ARG A 1 440 ? 8.662  8.515   84.412 1.00 39.36  ? 440  ARG A NE  1 
ATOM   3628 C  CZ  . ARG A 1 440 ? 9.045  7.246   84.547 1.00 42.88  ? 440  ARG A CZ  1 
ATOM   3629 N  NH1 . ARG A 1 440 ? 9.972  6.722   83.752 1.00 43.12  ? 440  ARG A NH1 1 
ATOM   3630 N  NH2 . ARG A 1 440 ? 8.500  6.494   85.493 1.00 45.55  ? 440  ARG A NH2 1 
ATOM   3631 N  N   . PHE A 1 441 ? 13.158 9.013   79.758 1.00 29.99  ? 441  PHE A N   1 
ATOM   3632 C  CA  . PHE A 1 441 ? 14.179 8.379   78.931 1.00 29.25  ? 441  PHE A CA  1 
ATOM   3633 C  C   . PHE A 1 441 ? 15.078 7.448   79.743 1.00 30.30  ? 441  PHE A C   1 
ATOM   3634 O  O   . PHE A 1 441 ? 15.981 7.901   80.442 1.00 29.49  ? 441  PHE A O   1 
ATOM   3635 C  CB  . PHE A 1 441 ? 15.042 9.427   78.222 1.00 27.00  ? 441  PHE A CB  1 
ATOM   3636 C  CG  . PHE A 1 441 ? 14.380 10.050  77.040 1.00 24.91  ? 441  PHE A CG  1 
ATOM   3637 C  CD1 . PHE A 1 441 ? 13.768 11.289  77.140 1.00 25.23  ? 441  PHE A CD1 1 
ATOM   3638 C  CD2 . PHE A 1 441 ? 14.289 9.355   75.842 1.00 24.71  ? 441  PHE A CD2 1 
ATOM   3639 C  CE1 . PHE A 1 441 ? 13.059 11.826  76.056 1.00 24.66  ? 441  PHE A CE1 1 
ATOM   3640 C  CE2 . PHE A 1 441 ? 13.587 9.880   74.763 1.00 23.56  ? 441  PHE A CE2 1 
ATOM   3641 C  CZ  . PHE A 1 441 ? 12.969 11.118  74.870 1.00 22.54  ? 441  PHE A CZ  1 
ATOM   3642 N  N   . CYS A 1 442 ? 14.815 6.145   79.631 1.00 31.31  ? 442  CYS A N   1 
ATOM   3643 C  CA  . CYS A 1 442 ? 15.569 5.106   80.325 1.00 32.53  ? 442  CYS A CA  1 
ATOM   3644 C  C   . CYS A 1 442 ? 17.062 5.236   80.057 1.00 31.05  ? 442  CYS A C   1 
ATOM   3645 O  O   . CYS A 1 442 ? 17.478 5.383   78.912 1.00 31.75  ? 442  CYS A O   1 
ATOM   3646 C  CB  . CYS A 1 442 ? 15.088 3.742   79.857 1.00 36.10  ? 442  CYS A CB  1 
ATOM   3647 S  SG  . CYS A 1 442 ? 16.015 2.311   80.497 1.00 44.81  ? 442  CYS A SG  1 
ATOM   3648 N  N   . LYS A 1 443 ? 17.862 5.165   81.113 1.00 28.96  ? 443  LYS A N   1 
ATOM   3649 C  CA  . LYS A 1 443 ? 19.306 5.310   80.995 1.00 28.33  ? 443  LYS A CA  1 
ATOM   3650 C  C   . LYS A 1 443 ? 19.987 3.965   81.173 1.00 29.67  ? 443  LYS A C   1 
ATOM   3651 O  O   . LYS A 1 443 ? 21.208 3.847   81.022 1.00 29.21  ? 443  LYS A O   1 
ATOM   3652 C  CB  . LYS A 1 443 ? 19.825 6.269   82.064 1.00 27.14  ? 443  LYS A CB  1 
ATOM   3653 C  CG  . LYS A 1 443 ? 19.136 7.620   82.112 1.00 28.50  ? 443  LYS A CG  1 
ATOM   3654 C  CD  . LYS A 1 443 ? 19.529 8.466   80.924 1.00 30.26  ? 443  LYS A CD  1 
ATOM   3655 C  CE  . LYS A 1 443 ? 21.036 8.730   80.883 1.00 31.97  ? 443  LYS A CE  1 
ATOM   3656 N  NZ  . LYS A 1 443 ? 21.524 9.673   81.929 1.00 31.40  ? 443  LYS A NZ  1 
ATOM   3657 N  N   . ASP A 1 444 ? 19.195 2.953   81.500 1.00 30.42  ? 444  ASP A N   1 
ATOM   3658 C  CA  . ASP A 1 444 ? 19.733 1.623   81.712 1.00 31.60  ? 444  ASP A CA  1 
ATOM   3659 C  C   . ASP A 1 444 ? 20.776 1.279   80.655 1.00 33.51  ? 444  ASP A C   1 
ATOM   3660 O  O   . ASP A 1 444 ? 21.973 1.233   80.938 1.00 34.57  ? 444  ASP A O   1 
ATOM   3661 C  CB  . ASP A 1 444 ? 18.598 0.594   81.707 1.00 29.97  ? 444  ASP A CB  1 
ATOM   3662 C  CG  . ASP A 1 444 ? 17.794 0.604   83.002 1.00 28.17  ? 444  ASP A CG  1 
ATOM   3663 O  OD1 . ASP A 1 444 ? 18.212 1.269   83.966 1.00 23.51  ? 444  ASP A OD1 1 
ATOM   3664 O  OD2 . ASP A 1 444 ? 16.745 -0.065  83.059 1.00 29.01  ? 444  ASP A OD2 1 
ATOM   3665 N  N   . PHE A 1 445 ? 20.319 1.054   79.431 1.00 35.59  ? 445  PHE A N   1 
ATOM   3666 C  CA  . PHE A 1 445 ? 21.214 0.715   78.332 1.00 36.19  ? 445  PHE A CA  1 
ATOM   3667 C  C   . PHE A 1 445 ? 21.329 1.920   77.392 1.00 35.22  ? 445  PHE A C   1 
ATOM   3668 O  O   . PHE A 1 445 ? 20.367 2.678   77.217 1.00 34.03  ? 445  PHE A O   1 
ATOM   3669 C  CB  . PHE A 1 445 ? 20.650 -0.492  77.581 1.00 37.88  ? 445  PHE A CB  1 
ATOM   3670 C  CG  . PHE A 1 445 ? 19.346 -0.214  76.891 1.00 44.63  ? 445  PHE A CG  1 
ATOM   3671 C  CD1 . PHE A 1 445 ? 19.318 0.130   75.529 1.00 48.43  ? 445  PHE A CD1 1 
ATOM   3672 C  CD2 . PHE A 1 445 ? 18.144 -0.238  77.605 1.00 47.40  ? 445  PHE A CD2 1 
ATOM   3673 C  CE1 . PHE A 1 445 ? 18.103 0.450   74.882 1.00 49.79  ? 445  PHE A CE1 1 
ATOM   3674 C  CE2 . PHE A 1 445 ? 16.916 0.081   76.977 1.00 49.28  ? 445  PHE A CE2 1 
ATOM   3675 C  CZ  . PHE A 1 445 ? 16.899 0.426   75.612 1.00 50.73  ? 445  PHE A CZ  1 
ATOM   3676 N  N   . PRO A 1 446 ? 22.509 2.119   76.774 1.00 34.16  ? 446  PRO A N   1 
ATOM   3677 C  CA  . PRO A 1 446 ? 22.660 3.257   75.866 1.00 31.81  ? 446  PRO A CA  1 
ATOM   3678 C  C   . PRO A 1 446 ? 21.779 3.059   74.642 1.00 31.04  ? 446  PRO A C   1 
ATOM   3679 O  O   . PRO A 1 446 ? 21.773 1.974   74.060 1.00 29.86  ? 446  PRO A O   1 
ATOM   3680 C  CB  . PRO A 1 446 ? 24.142 3.221   75.531 1.00 29.97  ? 446  PRO A CB  1 
ATOM   3681 C  CG  . PRO A 1 446 ? 24.427 1.770   75.522 1.00 28.84  ? 446  PRO A CG  1 
ATOM   3682 C  CD  . PRO A 1 446 ? 23.736 1.306   76.781 1.00 32.84  ? 446  PRO A CD  1 
ATOM   3683 N  N   . GLY A 1 447 ? 21.031 4.104   74.275 1.00 31.04  ? 447  GLY A N   1 
ATOM   3684 C  CA  . GLY A 1 447 ? 20.151 4.053   73.113 1.00 30.38  ? 447  GLY A CA  1 
ATOM   3685 C  C   . GLY A 1 447 ? 20.899 4.145   71.787 1.00 29.92  ? 447  GLY A C   1 
ATOM   3686 O  O   . GLY A 1 447 ? 22.012 4.682   71.726 1.00 30.73  ? 447  GLY A O   1 
ATOM   3687 N  N   . PHE A 1 448 ? 20.288 3.638   70.720 1.00 28.13  ? 448  PHE A N   1 
ATOM   3688 C  CA  . PHE A 1 448 ? 20.918 3.637   69.397 1.00 27.54  ? 448  PHE A CA  1 
ATOM   3689 C  C   . PHE A 1 448 ? 21.561 4.976   68.986 1.00 26.53  ? 448  PHE A C   1 
ATOM   3690 O  O   . PHE A 1 448 ? 22.790 5.116   69.010 1.00 25.17  ? 448  PHE A O   1 
ATOM   3691 C  CB  . PHE A 1 448 ? 19.898 3.184   68.344 1.00 29.01  ? 448  PHE A CB  1 
ATOM   3692 C  CG  . PHE A 1 448 ? 20.488 2.959   66.981 1.00 29.62  ? 448  PHE A CG  1 
ATOM   3693 C  CD1 . PHE A 1 448 ? 21.564 2.102   66.808 1.00 29.83  ? 448  PHE A CD1 1 
ATOM   3694 C  CD2 . PHE A 1 448 ? 19.973 3.617   65.867 1.00 30.90  ? 448  PHE A CD2 1 
ATOM   3695 C  CE1 . PHE A 1 448 ? 22.120 1.906   65.544 1.00 28.26  ? 448  PHE A CE1 1 
ATOM   3696 C  CE2 . PHE A 1 448 ? 20.525 3.422   64.599 1.00 28.15  ? 448  PHE A CE2 1 
ATOM   3697 C  CZ  . PHE A 1 448 ? 21.596 2.569   64.442 1.00 26.95  ? 448  PHE A CZ  1 
ATOM   3698 N  N   . ILE A 1 449 ? 20.730 5.949   68.615 1.00 24.39  ? 449  ILE A N   1 
ATOM   3699 C  CA  . ILE A 1 449 ? 21.209 7.266   68.204 1.00 23.05  ? 449  ILE A CA  1 
ATOM   3700 C  C   . ILE A 1 449 ? 22.286 7.839   69.133 1.00 22.40  ? 449  ILE A C   1 
ATOM   3701 O  O   . ILE A 1 449 ? 23.377 8.175   68.693 1.00 21.83  ? 449  ILE A O   1 
ATOM   3702 C  CB  . ILE A 1 449 ? 20.039 8.297   68.141 1.00 23.66  ? 449  ILE A CB  1 
ATOM   3703 C  CG1 . ILE A 1 449 ? 18.919 7.777   67.237 1.00 24.60  ? 449  ILE A CG1 1 
ATOM   3704 C  CG2 . ILE A 1 449 ? 20.550 9.650   67.655 1.00 19.54  ? 449  ILE A CG2 1 
ATOM   3705 C  CD1 . ILE A 1 449 ? 19.317 7.556   65.787 1.00 24.11  ? 449  ILE A CD1 1 
ATOM   3706 N  N   . PRO A 1 450 ? 21.988 7.955   70.437 1.00 22.67  ? 450  PRO A N   1 
ATOM   3707 C  CA  . PRO A 1 450 ? 22.949 8.502   71.395 1.00 22.95  ? 450  PRO A CA  1 
ATOM   3708 C  C   . PRO A 1 450 ? 24.287 7.790   71.355 1.00 24.32  ? 450  PRO A C   1 
ATOM   3709 O  O   . PRO A 1 450 ? 25.343 8.421   71.434 1.00 22.71  ? 450  PRO A O   1 
ATOM   3710 C  CB  . PRO A 1 450 ? 22.241 8.326   72.730 1.00 23.42  ? 450  PRO A CB  1 
ATOM   3711 C  CG  . PRO A 1 450 ? 20.798 8.355   72.361 1.00 24.19  ? 450  PRO A CG  1 
ATOM   3712 C  CD  . PRO A 1 450 ? 20.777 7.501   71.138 1.00 23.62  ? 450  PRO A CD  1 
ATOM   3713 N  N   . SER A 1 451 ? 24.240 6.469   71.246 1.00 25.57  ? 451  SER A N   1 
ATOM   3714 C  CA  . SER A 1 451 ? 25.464 5.692   71.184 1.00 26.91  ? 451  SER A CA  1 
ATOM   3715 C  C   . SER A 1 451 ? 26.315 6.192   70.034 1.00 26.81  ? 451  SER A C   1 
ATOM   3716 O  O   . SER A 1 451 ? 27.513 6.417   70.175 1.00 28.41  ? 451  SER A O   1 
ATOM   3717 C  CB  . SER A 1 451 ? 25.156 4.225   70.955 1.00 27.25  ? 451  SER A CB  1 
ATOM   3718 O  OG  . SER A 1 451 ? 26.344 3.553   70.586 1.00 31.74  ? 451  SER A OG  1 
ATOM   3719 N  N   . LEU A 1 452 ? 25.681 6.361   68.887 1.00 26.12  ? 452  LEU A N   1 
ATOM   3720 C  CA  . LEU A 1 452 ? 26.390 6.830   67.717 1.00 26.68  ? 452  LEU A CA  1 
ATOM   3721 C  C   . LEU A 1 452 ? 26.945 8.225   67.957 1.00 26.68  ? 452  LEU A C   1 
ATOM   3722 O  O   . LEU A 1 452 ? 28.132 8.465   67.766 1.00 27.95  ? 452  LEU A O   1 
ATOM   3723 C  CB  . LEU A 1 452 ? 25.460 6.787   66.488 1.00 24.76  ? 452  LEU A CB  1 
ATOM   3724 C  CG  . LEU A 1 452 ? 25.125 5.348   66.048 1.00 23.78  ? 452  LEU A CG  1 
ATOM   3725 C  CD1 . LEU A 1 452 ? 24.053 5.312   64.987 1.00 19.99  ? 452  LEU A CD1 1 
ATOM   3726 C  CD2 . LEU A 1 452 ? 26.396 4.691   65.541 1.00 23.57  ? 452  LEU A CD2 1 
ATOM   3727 N  N   . LEU A 1 453 ? 26.098 9.143   68.396 1.00 27.13  ? 453  LEU A N   1 
ATOM   3728 C  CA  . LEU A 1 453 ? 26.553 10.506  68.651 1.00 28.60  ? 453  LEU A CA  1 
ATOM   3729 C  C   . LEU A 1 453 ? 27.827 10.561  69.502 1.00 28.24  ? 453  LEU A C   1 
ATOM   3730 O  O   . LEU A 1 453 ? 28.754 11.307  69.197 1.00 25.49  ? 453  LEU A O   1 
ATOM   3731 C  CB  . LEU A 1 453 ? 25.445 11.307  69.338 1.00 29.83  ? 453  LEU A CB  1 
ATOM   3732 C  CG  . LEU A 1 453 ? 24.530 12.122  68.441 1.00 28.89  ? 453  LEU A CG  1 
ATOM   3733 C  CD1 . LEU A 1 453 ? 23.607 12.961  69.302 1.00 30.25  ? 453  LEU A CD1 1 
ATOM   3734 C  CD2 . LEU A 1 453 ? 25.376 13.018  67.561 1.00 28.88  ? 453  LEU A CD2 1 
ATOM   3735 N  N   . GLY A 1 454 ? 27.847 9.777   70.577 1.00 28.80  ? 454  GLY A N   1 
ATOM   3736 C  CA  . GLY A 1 454 ? 28.996 9.737   71.452 1.00 30.79  ? 454  GLY A CA  1 
ATOM   3737 C  C   . GLY A 1 454 ? 30.264 9.453   70.678 1.00 33.50  ? 454  GLY A C   1 
ATOM   3738 O  O   . GLY A 1 454 ? 31.233 10.195  70.790 1.00 35.04  ? 454  GLY A O   1 
ATOM   3739 N  N   . ASP A 1 455 ? 30.270 8.383   69.890 1.00 35.38  ? 455  ASP A N   1 
ATOM   3740 C  CA  . ASP A 1 455 ? 31.447 8.041   69.108 1.00 36.15  ? 455  ASP A CA  1 
ATOM   3741 C  C   . ASP A 1 455 ? 31.846 9.206   68.222 1.00 37.32  ? 455  ASP A C   1 
ATOM   3742 O  O   . ASP A 1 455 ? 33.009 9.615   68.203 1.00 38.65  ? 455  ASP A O   1 
ATOM   3743 C  CB  . ASP A 1 455 ? 31.171 6.818   68.252 1.00 37.05  ? 455  ASP A CB  1 
ATOM   3744 C  CG  . ASP A 1 455 ? 30.924 5.584   69.079 1.00 40.94  ? 455  ASP A CG  1 
ATOM   3745 O  OD1 . ASP A 1 455 ? 31.840 5.196   69.833 1.00 44.50  ? 455  ASP A OD1 1 
ATOM   3746 O  OD2 . ASP A 1 455 ? 29.822 5.000   68.984 1.00 42.36  ? 455  ASP A OD2 1 
ATOM   3747 N  N   . LEU A 1 456 ? 30.875 9.751   67.498 1.00 37.46  ? 456  LEU A N   1 
ATOM   3748 C  CA  . LEU A 1 456 ? 31.123 10.876  66.603 1.00 37.90  ? 456  LEU A CA  1 
ATOM   3749 C  C   . LEU A 1 456 ? 31.784 12.058  67.300 1.00 39.34  ? 456  LEU A C   1 
ATOM   3750 O  O   . LEU A 1 456 ? 32.800 12.574  66.832 1.00 39.46  ? 456  LEU A O   1 
ATOM   3751 C  CB  . LEU A 1 456 ? 29.814 11.321  65.948 1.00 35.79  ? 456  LEU A CB  1 
ATOM   3752 C  CG  . LEU A 1 456 ? 29.367 10.486  64.739 1.00 36.05  ? 456  LEU A CG  1 
ATOM   3753 C  CD1 . LEU A 1 456 ? 27.863 10.601  64.538 1.00 35.58  ? 456  LEU A CD1 1 
ATOM   3754 C  CD2 . LEU A 1 456 ? 30.115 10.946  63.499 1.00 32.74  ? 456  LEU A CD2 1 
ATOM   3755 N  N   . LEU A 1 457 ? 31.206 12.491  68.415 1.00 42.42  ? 457  LEU A N   1 
ATOM   3756 C  CA  . LEU A 1 457 ? 31.755 13.618  69.165 1.00 44.46  ? 457  LEU A CA  1 
ATOM   3757 C  C   . LEU A 1 457 ? 33.143 13.280  69.687 1.00 47.19  ? 457  LEU A C   1 
ATOM   3758 O  O   . LEU A 1 457 ? 34.045 14.117  69.695 1.00 48.03  ? 457  LEU A O   1 
ATOM   3759 C  CB  . LEU A 1 457 ? 30.830 13.977  70.323 1.00 40.76  ? 457  LEU A CB  1 
ATOM   3760 C  CG  . LEU A 1 457 ? 29.445 14.446  69.886 1.00 39.20  ? 457  LEU A CG  1 
ATOM   3761 C  CD1 . LEU A 1 457 ? 28.682 15.026  71.075 1.00 40.62  ? 457  LEU A CD1 1 
ATOM   3762 C  CD2 . LEU A 1 457 ? 29.602 15.497  68.815 1.00 37.66  ? 457  LEU A CD2 1 
ATOM   3763 N  N   . GLU A 1 458 ? 33.303 12.035  70.112 1.00 51.02  ? 458  GLU A N   1 
ATOM   3764 C  CA  . GLU A 1 458 ? 34.572 11.549  70.625 1.00 55.11  ? 458  GLU A CA  1 
ATOM   3765 C  C   . GLU A 1 458 ? 35.649 11.671  69.556 1.00 55.17  ? 458  GLU A C   1 
ATOM   3766 O  O   . GLU A 1 458 ? 36.693 12.292  69.776 1.00 54.60  ? 458  GLU A O   1 
ATOM   3767 C  CB  . GLU A 1 458 ? 34.428 10.084  71.058 1.00 58.25  ? 458  GLU A CB  1 
ATOM   3768 C  CG  . GLU A 1 458 ? 35.719 9.418   71.527 1.00 63.24  ? 458  GLU A CG  1 
ATOM   3769 C  CD  . GLU A 1 458 ? 35.484 8.030   72.118 1.00 66.72  ? 458  GLU A CD  1 
ATOM   3770 O  OE1 . GLU A 1 458 ? 34.779 7.928   73.149 1.00 68.79  ? 458  GLU A OE1 1 
ATOM   3771 O  OE2 . GLU A 1 458 ? 36.005 7.041   71.553 1.00 67.57  ? 458  GLU A OE2 1 
ATOM   3772 N  N   . GLU A 1 459 ? 35.389 11.085  68.394 1.00 55.03  ? 459  GLU A N   1 
ATOM   3773 C  CA  . GLU A 1 459 ? 36.364 11.134  67.326 1.00 56.94  ? 459  GLU A CA  1 
ATOM   3774 C  C   . GLU A 1 459 ? 36.687 12.561  66.899 1.00 57.71  ? 459  GLU A C   1 
ATOM   3775 O  O   . GLU A 1 459 ? 37.851 12.895  66.680 1.00 58.22  ? 459  GLU A O   1 
ATOM   3776 C  CB  . GLU A 1 459 ? 35.890 10.343  66.104 1.00 57.28  ? 459  GLU A CB  1 
ATOM   3777 C  CG  . GLU A 1 459 ? 37.045 9.924   65.186 1.00 58.82  ? 459  GLU A CG  1 
ATOM   3778 C  CD  . GLU A 1 459 ? 36.691 9.935   63.702 1.00 61.46  ? 459  GLU A CD  1 
ATOM   3779 O  OE1 . GLU A 1 459 ? 35.667 9.327   63.300 1.00 62.04  ? 459  GLU A OE1 1 
ATOM   3780 O  OE2 . GLU A 1 459 ? 37.457 10.553  62.930 1.00 63.37  ? 459  GLU A OE2 1 
ATOM   3781 N  N   . ARG A 1 460 ? 35.679 13.416  66.778 1.00 57.91  ? 460  ARG A N   1 
ATOM   3782 C  CA  . ARG A 1 460 ? 35.989 14.761  66.345 1.00 59.25  ? 460  ARG A CA  1 
ATOM   3783 C  C   . ARG A 1 460 ? 36.849 15.424  67.395 1.00 61.52  ? 460  ARG A C   1 
ATOM   3784 O  O   . ARG A 1 460 ? 37.545 16.395  67.110 1.00 63.12  ? 460  ARG A O   1 
ATOM   3785 C  CB  . ARG A 1 460 ? 34.724 15.575  66.050 1.00 58.28  ? 460  ARG A CB  1 
ATOM   3786 C  CG  . ARG A 1 460 ? 34.222 16.449  67.155 1.00 57.42  ? 460  ARG A CG  1 
ATOM   3787 C  CD  . ARG A 1 460 ? 33.281 17.525  66.594 1.00 57.18  ? 460  ARG A CD  1 
ATOM   3788 N  NE  . ARG A 1 460 ? 33.976 18.697  66.055 1.00 54.46  ? 460  ARG A NE  1 
ATOM   3789 C  CZ  . ARG A 1 460 ? 33.537 19.947  66.204 1.00 53.96  ? 460  ARG A CZ  1 
ATOM   3790 N  NH1 . ARG A 1 460 ? 32.411 20.178  66.867 1.00 52.70  ? 460  ARG A NH1 1 
ATOM   3791 N  NH2 . ARG A 1 460 ? 34.228 20.969  65.716 1.00 52.97  ? 460  ARG A NH2 1 
ATOM   3792 N  N   . GLN A 1 461 ? 36.813 14.903  68.616 1.00 63.42  ? 461  GLN A N   1 
ATOM   3793 C  CA  . GLN A 1 461 ? 37.669 15.455  69.655 1.00 64.93  ? 461  GLN A CA  1 
ATOM   3794 C  C   . GLN A 1 461 ? 39.065 14.944  69.331 1.00 64.68  ? 461  GLN A C   1 
ATOM   3795 O  O   . GLN A 1 461 ? 40.024 15.713  69.279 1.00 64.45  ? 461  GLN A O   1 
ATOM   3796 C  CB  . GLN A 1 461 ? 37.234 14.993  71.046 1.00 66.38  ? 461  GLN A CB  1 
ATOM   3797 C  CG  . GLN A 1 461 ? 36.036 15.757  71.591 1.00 70.14  ? 461  GLN A CG  1 
ATOM   3798 C  CD  . GLN A 1 461 ? 36.172 17.265  71.414 1.00 72.35  ? 461  GLN A CD  1 
ATOM   3799 O  OE1 . GLN A 1 461 ? 36.145 17.775  70.290 1.00 73.07  ? 461  GLN A OE1 1 
ATOM   3800 N  NE2 . GLN A 1 461 ? 36.323 17.985  72.526 1.00 73.09  ? 461  GLN A NE2 1 
ATOM   3801 N  N   . LYS A 1 462 ? 39.168 13.640  69.099 1.00 64.49  ? 462  LYS A N   1 
ATOM   3802 C  CA  . LYS A 1 462 ? 40.442 13.046  68.739 1.00 64.91  ? 462  LYS A CA  1 
ATOM   3803 C  C   . LYS A 1 462 ? 41.075 13.913  67.657 1.00 65.68  ? 462  LYS A C   1 
ATOM   3804 O  O   . LYS A 1 462 ? 42.210 14.362  67.783 1.00 65.86  ? 462  LYS A O   1 
ATOM   3805 C  CB  . LYS A 1 462 ? 40.238 11.643  68.178 1.00 64.43  ? 462  LYS A CB  1 
ATOM   3806 C  CG  . LYS A 1 462 ? 40.492 10.515  69.147 1.00 66.54  ? 462  LYS A CG  1 
ATOM   3807 C  CD  . LYS A 1 462 ? 39.345 10.303  70.108 1.00 68.18  ? 462  LYS A CD  1 
ATOM   3808 C  CE  . LYS A 1 462 ? 39.089 8.803   70.289 1.00 69.38  ? 462  LYS A CE  1 
ATOM   3809 N  NZ  . LYS A 1 462 ? 40.335 8.034   70.608 1.00 69.27  ? 462  LYS A NZ  1 
ATOM   3810 N  N   . ILE A 1 463 ? 40.312 14.145  66.594 1.00 66.88  ? 463  ILE A N   1 
ATOM   3811 C  CA  . ILE A 1 463 ? 40.759 14.938  65.456 1.00 67.42  ? 463  ILE A CA  1 
ATOM   3812 C  C   . ILE A 1 463 ? 41.259 16.326  65.854 1.00 68.68  ? 463  ILE A C   1 
ATOM   3813 O  O   . ILE A 1 463 ? 42.406 16.668  65.590 1.00 68.32  ? 463  ILE A O   1 
ATOM   3814 C  CB  . ILE A 1 463 ? 39.622 15.109  64.425 1.00 67.12  ? 463  ILE A CB  1 
ATOM   3815 C  CG1 . ILE A 1 463 ? 39.002 13.749  64.083 1.00 66.68  ? 463  ILE A CG1 1 
ATOM   3816 C  CG2 . ILE A 1 463 ? 40.163 15.759  63.164 1.00 67.23  ? 463  ILE A CG2 1 
ATOM   3817 C  CD1 . ILE A 1 463 ? 39.894 12.839  63.263 1.00 67.63  ? 463  ILE A CD1 1 
ATOM   3818 N  N   . LYS A 1 464 ? 40.398 17.125  66.479 1.00 71.29  ? 464  LYS A N   1 
ATOM   3819 C  CA  . LYS A 1 464 ? 40.771 18.477  66.899 1.00 73.60  ? 464  LYS A CA  1 
ATOM   3820 C  C   . LYS A 1 464 ? 42.050 18.459  67.730 1.00 75.34  ? 464  LYS A C   1 
ATOM   3821 O  O   . LYS A 1 464 ? 42.815 19.428  67.741 1.00 74.72  ? 464  LYS A O   1 
ATOM   3822 C  CB  . LYS A 1 464 ? 39.646 19.130  67.717 1.00 73.22  ? 464  LYS A CB  1 
ATOM   3823 C  CG  . LYS A 1 464 ? 38.390 19.477  66.935 1.00 72.33  ? 464  LYS A CG  1 
ATOM   3824 C  CD  . LYS A 1 464 ? 37.378 20.199  67.825 1.00 73.24  ? 464  LYS A CD  1 
ATOM   3825 C  CE  . LYS A 1 464 ? 37.723 21.677  68.045 1.00 72.59  ? 464  LYS A CE  1 
ATOM   3826 N  NZ  . LYS A 1 464 ? 37.420 22.531  66.852 1.00 71.08  ? 464  LYS A NZ  1 
ATOM   3827 N  N   . LYS A 1 465 ? 42.269 17.353  68.435 1.00 77.22  ? 465  LYS A N   1 
ATOM   3828 C  CA  . LYS A 1 465 ? 43.458 17.199  69.262 1.00 79.13  ? 465  LYS A CA  1 
ATOM   3829 C  C   . LYS A 1 465 ? 44.657 17.038  68.318 1.00 80.36  ? 465  LYS A C   1 
ATOM   3830 O  O   . LYS A 1 465 ? 45.613 17.815  68.376 1.00 80.08  ? 465  LYS A O   1 
ATOM   3831 C  CB  . LYS A 1 465 ? 43.302 15.967  70.169 1.00 79.43  ? 465  LYS A CB  1 
ATOM   3832 C  CG  . LYS A 1 465 ? 44.262 15.887  71.368 1.00 79.66  ? 465  LYS A CG  1 
ATOM   3833 C  CD  . LYS A 1 465 ? 43.908 14.693  72.273 1.00 78.82  ? 465  LYS A CD  1 
ATOM   3834 C  CE  . LYS A 1 465 ? 44.765 14.638  73.532 1.00 77.99  ? 465  LYS A CE  1 
ATOM   3835 N  NZ  . LYS A 1 465 ? 44.339 13.549  74.456 1.00 77.17  ? 465  LYS A NZ  1 
ATOM   3836 N  N   . LYS A 1 466 ? 44.584 16.045  67.432 1.00 81.87  ? 466  LYS A N   1 
ATOM   3837 C  CA  . LYS A 1 466 ? 45.653 15.775  66.472 1.00 82.71  ? 466  LYS A CA  1 
ATOM   3838 C  C   . LYS A 1 466 ? 45.776 16.906  65.446 1.00 83.90  ? 466  LYS A C   1 
ATOM   3839 O  O   . LYS A 1 466 ? 46.745 16.968  64.689 1.00 83.53  ? 466  LYS A O   1 
ATOM   3840 C  CB  . LYS A 1 466 ? 45.391 14.436  65.764 1.00 81.47  ? 466  LYS A CB  1 
ATOM   3841 C  CG  . LYS A 1 466 ? 46.573 13.881  64.960 1.00 80.65  ? 466  LYS A CG  1 
ATOM   3842 C  CD  . LYS A 1 466 ? 46.653 14.458  63.554 1.00 78.73  ? 466  LYS A CD  1 
ATOM   3843 C  CE  . LYS A 1 466 ? 47.955 14.082  62.850 1.00 77.98  ? 466  LYS A CE  1 
ATOM   3844 N  NZ  . LYS A 1 466 ? 49.163 14.732  63.444 1.00 76.07  ? 466  LYS A NZ  1 
ATOM   3845 N  N   . MET A 1 467 ? 44.798 17.808  65.439 1.00 86.00  ? 467  MET A N   1 
ATOM   3846 C  CA  . MET A 1 467 ? 44.796 18.932  64.503 1.00 87.64  ? 467  MET A CA  1 
ATOM   3847 C  C   . MET A 1 467 ? 45.541 20.160  65.028 1.00 89.75  ? 467  MET A C   1 
ATOM   3848 O  O   . MET A 1 467 ? 45.927 21.035  64.251 1.00 90.09  ? 467  MET A O   1 
ATOM   3849 C  CB  . MET A 1 467 ? 43.363 19.326  64.148 1.00 85.55  ? 467  MET A CB  1 
ATOM   3850 C  CG  . MET A 1 467 ? 43.284 20.439  63.135 1.00 83.38  ? 467  MET A CG  1 
ATOM   3851 S  SD  . MET A 1 467 ? 41.600 20.930  62.833 1.00 83.08  ? 467  MET A SD  1 
ATOM   3852 C  CE  . MET A 1 467 ? 41.456 22.315  63.937 1.00 83.50  ? 467  MET A CE  1 
ATOM   3853 N  N   . LYS A 1 468 ? 45.727 20.235  66.344 1.00 91.88  ? 468  LYS A N   1 
ATOM   3854 C  CA  . LYS A 1 468 ? 46.449 21.354  66.946 1.00 93.63  ? 468  LYS A CA  1 
ATOM   3855 C  C   . LYS A 1 468 ? 47.915 20.944  67.096 1.00 94.67  ? 468  LYS A C   1 
ATOM   3856 O  O   . LYS A 1 468 ? 48.657 21.515  67.902 1.00 94.81  ? 468  LYS A O   1 
ATOM   3857 C  CB  . LYS A 1 468 ? 45.864 21.714  68.322 1.00 93.75  ? 468  LYS A CB  1 
ATOM   3858 C  CG  . LYS A 1 468 ? 44.429 22.250  68.303 1.00 93.31  ? 468  LYS A CG  1 
ATOM   3859 C  CD  . LYS A 1 468 ? 43.932 22.532  69.721 1.00 92.20  ? 468  LYS A CD  1 
ATOM   3860 C  CE  . LYS A 1 468 ? 42.458 22.894  69.742 1.00 91.14  ? 468  LYS A CE  1 
ATOM   3861 N  NZ  . LYS A 1 468 ? 41.958 23.031  71.135 1.00 89.91  ? 468  LYS A NZ  1 
ATOM   3862 N  N   . ALA A 1 469 ? 48.315 19.945  66.310 1.00 95.42  ? 469  ALA A N   1 
ATOM   3863 C  CA  . ALA A 1 469 ? 49.680 19.430  66.325 1.00 95.98  ? 469  ALA A CA  1 
ATOM   3864 C  C   . ALA A 1 469 ? 49.980 18.580  65.083 1.00 96.60  ? 469  ALA A C   1 
ATOM   3865 O  O   . ALA A 1 469 ? 49.814 17.360  65.098 1.00 97.35  ? 469  ALA A O   1 
ATOM   3866 C  CB  . ALA A 1 469 ? 49.906 18.609  67.585 1.00 94.78  ? 469  ALA A CB  1 
ATOM   3867 N  N   . THR A 1 470 ? 50.425 19.228  64.010 1.00 96.74  ? 470  THR A N   1 
ATOM   3868 C  CA  . THR A 1 470 ? 50.751 18.520  62.776 1.00 96.50  ? 470  THR A CA  1 
ATOM   3869 C  C   . THR A 1 470 ? 51.691 19.365  61.909 1.00 96.71  ? 470  THR A C   1 
ATOM   3870 O  O   . THR A 1 470 ? 52.660 18.852  61.337 1.00 96.37  ? 470  THR A O   1 
ATOM   3871 C  CB  . THR A 1 470 ? 49.474 18.201  61.969 1.00 96.26  ? 470  THR A CB  1 
ATOM   3872 O  OG1 . THR A 1 470 ? 48.438 17.777  62.862 1.00 95.05  ? 470  THR A OG1 1 
ATOM   3873 C  CG2 . THR A 1 470 ? 49.742 17.084  60.960 1.00 96.39  ? 470  THR A CG2 1 
ATOM   3874 N  N   . ILE A 1 471 ? 51.390 20.663  61.834 1.00 96.43  ? 471  ILE A N   1 
ATOM   3875 C  CA  . ILE A 1 471 ? 52.163 21.633  61.054 1.00 95.37  ? 471  ILE A CA  1 
ATOM   3876 C  C   . ILE A 1 471 ? 51.826 21.559  59.572 1.00 94.48  ? 471  ILE A C   1 
ATOM   3877 O  O   . ILE A 1 471 ? 51.255 22.498  59.017 1.00 94.18  ? 471  ILE A O   1 
ATOM   3878 C  CB  . ILE A 1 471 ? 53.689 21.431  61.237 1.00 96.05  ? 471  ILE A CB  1 
ATOM   3879 C  CG1 . ILE A 1 471 ? 54.120 21.939  62.618 1.00 95.52  ? 471  ILE A CG1 1 
ATOM   3880 C  CG2 . ILE A 1 471 ? 54.454 22.161  60.130 1.00 95.84  ? 471  ILE A CG2 1 
ATOM   3881 C  CD1 . ILE A 1 471 ? 53.479 21.221  63.782 1.00 94.38  ? 471  ILE A CD1 1 
ATOM   3882 N  N   . ASP A 1 472 ? 52.190 20.441  58.947 1.00 93.39  ? 472  ASP A N   1 
ATOM   3883 C  CA  . ASP A 1 472 ? 51.934 20.197  57.527 1.00 92.42  ? 472  ASP A CA  1 
ATOM   3884 C  C   . ASP A 1 472 ? 50.478 20.496  57.157 1.00 92.71  ? 472  ASP A C   1 
ATOM   3885 O  O   . ASP A 1 472 ? 49.595 19.660  57.348 1.00 93.52  ? 472  ASP A O   1 
ATOM   3886 C  CB  . ASP A 1 472 ? 52.284 18.739  57.194 1.00 90.33  ? 472  ASP A CB  1 
ATOM   3887 C  CG  . ASP A 1 472 ? 51.787 18.307  55.829 1.00 88.24  ? 472  ASP A CG  1 
ATOM   3888 O  OD1 . ASP A 1 472 ? 51.843 19.121  54.887 1.00 87.19  ? 472  ASP A OD1 1 
ATOM   3889 O  OD2 . ASP A 1 472 ? 51.356 17.142  55.694 1.00 86.36  ? 472  ASP A OD2 1 
ATOM   3890 N  N   . PRO A 1 473 ? 50.213 21.697  56.613 1.00 92.47  ? 473  PRO A N   1 
ATOM   3891 C  CA  . PRO A 1 473 ? 48.861 22.109  56.220 1.00 92.24  ? 473  PRO A CA  1 
ATOM   3892 C  C   . PRO A 1 473 ? 48.016 21.086  55.441 1.00 92.10  ? 473  PRO A C   1 
ATOM   3893 O  O   . PRO A 1 473 ? 46.810 20.989  55.667 1.00 91.85  ? 473  PRO A O   1 
ATOM   3894 C  CB  . PRO A 1 473 ? 49.117 23.390  55.431 1.00 92.26  ? 473  PRO A CB  1 
ATOM   3895 C  CG  . PRO A 1 473 ? 50.301 23.973  56.150 1.00 91.45  ? 473  PRO A CG  1 
ATOM   3896 C  CD  . PRO A 1 473 ? 51.188 22.763  56.310 1.00 91.65  ? 473  PRO A CD  1 
ATOM   3897 N  N   . ILE A 1 474 ? 48.626 20.328  54.531 1.00 91.90  ? 474  ILE A N   1 
ATOM   3898 C  CA  . ILE A 1 474 ? 47.862 19.340  53.768 1.00 92.13  ? 474  ILE A CA  1 
ATOM   3899 C  C   . ILE A 1 474 ? 47.428 18.197  54.670 1.00 92.19  ? 474  ILE A C   1 
ATOM   3900 O  O   . ILE A 1 474 ? 46.445 17.510  54.392 1.00 92.97  ? 474  ILE A O   1 
ATOM   3901 C  CB  . ILE A 1 474 ? 48.669 18.748  52.574 1.00 91.85  ? 474  ILE A CB  1 
ATOM   3902 C  CG1 . ILE A 1 474 ? 47.842 17.667  51.867 1.00 91.38  ? 474  ILE A CG1 1 
ATOM   3903 C  CG2 . ILE A 1 474 ? 49.960 18.120  53.062 1.00 92.09  ? 474  ILE A CG2 1 
ATOM   3904 C  CD1 . ILE A 1 474 ? 46.465 18.124  51.418 1.00 91.11  ? 474  ILE A CD1 1 
ATOM   3905 N  N   . GLU A 1 475 ? 48.165 17.997  55.755 1.00 91.61  ? 475  GLU A N   1 
ATOM   3906 C  CA  . GLU A 1 475 ? 47.846 16.936  56.694 1.00 91.53  ? 475  GLU A CA  1 
ATOM   3907 C  C   . GLU A 1 475 ? 46.995 17.523  57.807 1.00 90.78  ? 475  GLU A C   1 
ATOM   3908 O  O   . GLU A 1 475 ? 46.545 16.812  58.705 1.00 91.31  ? 475  GLU A O   1 
ATOM   3909 C  CB  . GLU A 1 475 ? 49.127 16.344  57.281 1.00 92.53  ? 475  GLU A CB  1 
ATOM   3910 C  CG  . GLU A 1 475 ? 49.038 14.859  57.580 1.00 93.39  ? 475  GLU A CG  1 
ATOM   3911 C  CD  . GLU A 1 475 ? 48.792 14.037  56.327 1.00 93.12  ? 475  GLU A CD  1 
ATOM   3912 O  OE1 . GLU A 1 475 ? 47.705 14.182  55.726 1.00 92.36  ? 475  GLU A OE1 1 
ATOM   3913 O  OE2 . GLU A 1 475 ? 49.687 13.253  55.940 1.00 92.54  ? 475  GLU A OE2 1 
ATOM   3914 N  N   . ARG A 1 476 ? 46.785 18.833  57.741 1.00 89.42  ? 476  ARG A N   1 
ATOM   3915 C  CA  . ARG A 1 476 ? 45.985 19.527  58.738 1.00 88.13  ? 476  ARG A CA  1 
ATOM   3916 C  C   . ARG A 1 476 ? 44.627 19.905  58.157 1.00 86.88  ? 476  ARG A C   1 
ATOM   3917 O  O   . ARG A 1 476 ? 43.594 19.538  58.712 1.00 86.47  ? 476  ARG A O   1 
ATOM   3918 C  CB  . ARG A 1 476 ? 46.720 20.777  59.238 1.00 88.50  ? 476  ARG A CB  1 
ATOM   3919 C  CG  . ARG A 1 476 ? 45.911 21.607  60.221 1.00 88.83  ? 476  ARG A CG  1 
ATOM   3920 C  CD  . ARG A 1 476 ? 46.772 22.597  60.993 1.00 89.72  ? 476  ARG A CD  1 
ATOM   3921 N  NE  . ARG A 1 476 ? 47.775 21.928  61.819 1.00 90.51  ? 476  ARG A NE  1 
ATOM   3922 C  CZ  . ARG A 1 476 ? 48.354 22.478  62.883 1.00 90.94  ? 476  ARG A CZ  1 
ATOM   3923 N  NH1 . ARG A 1 476 ? 49.258 21.799  63.577 1.00 90.40  ? 476  ARG A NH1 1 
ATOM   3924 N  NH2 . ARG A 1 476 ? 48.019 23.705  63.261 1.00 91.08  ? 476  ARG A NH2 1 
ATOM   3925 N  N   . LYS A 1 477 ? 44.629 20.632  57.042 1.00 85.53  ? 477  LYS A N   1 
ATOM   3926 C  CA  . LYS A 1 477 ? 43.380 21.029  56.399 1.00 84.12  ? 477  LYS A CA  1 
ATOM   3927 C  C   . LYS A 1 477 ? 42.623 19.748  56.087 1.00 82.88  ? 477  LYS A C   1 
ATOM   3928 O  O   . LYS A 1 477 ? 41.392 19.725  56.045 1.00 82.32  ? 477  LYS A O   1 
ATOM   3929 C  CB  . LYS A 1 477 ? 43.653 21.796  55.101 1.00 85.05  ? 477  LYS A CB  1 
ATOM   3930 C  CG  . LYS A 1 477 ? 42.415 22.463  54.497 1.00 86.37  ? 477  LYS A CG  1 
ATOM   3931 C  CD  . LYS A 1 477 ? 41.838 23.526  55.442 1.00 87.36  ? 477  LYS A CD  1 
ATOM   3932 C  CE  . LYS A 1 477 ? 40.539 24.142  54.914 1.00 87.21  ? 477  LYS A CE  1 
ATOM   3933 N  NZ  . LYS A 1 477 ? 40.710 24.877  53.629 1.00 86.33  ? 477  LYS A NZ  1 
ATOM   3934 N  N   . LEU A 1 478 ? 43.385 18.678  55.874 1.00 81.87  ? 478  LEU A N   1 
ATOM   3935 C  CA  . LEU A 1 478 ? 42.823 17.365  55.581 1.00 79.71  ? 478  LEU A CA  1 
ATOM   3936 C  C   . LEU A 1 478 ? 41.930 17.012  56.761 1.00 78.38  ? 478  LEU A C   1 
ATOM   3937 O  O   . LEU A 1 478 ? 40.729 16.779  56.609 1.00 79.31  ? 478  LEU A O   1 
ATOM   3938 C  CB  . LEU A 1 478 ? 43.949 16.334  55.446 1.00 78.11  ? 478  LEU A CB  1 
ATOM   3939 C  CG  . LEU A 1 478 ? 43.624 14.955  54.874 1.00 76.79  ? 478  LEU A CG  1 
ATOM   3940 C  CD1 . LEU A 1 478 ? 43.074 15.080  53.466 1.00 76.20  ? 478  LEU A CD1 1 
ATOM   3941 C  CD2 . LEU A 1 478 ? 44.888 14.120  54.866 1.00 76.79  ? 478  LEU A CD2 1 
ATOM   3942 N  N   . LEU A 1 479 ? 42.531 16.998  57.944 1.00 75.87  ? 479  LEU A N   1 
ATOM   3943 C  CA  . LEU A 1 479 ? 41.811 16.691  59.170 1.00 73.29  ? 479  LEU A CA  1 
ATOM   3944 C  C   . LEU A 1 479 ? 40.720 17.730  59.409 1.00 70.04  ? 479  LEU A C   1 
ATOM   3945 O  O   . LEU A 1 479 ? 39.586 17.389  59.745 1.00 69.79  ? 479  LEU A O   1 
ATOM   3946 C  CB  . LEU A 1 479 ? 42.784 16.690  60.350 1.00 75.16  ? 479  LEU A CB  1 
ATOM   3947 C  CG  . LEU A 1 479 ? 44.025 15.799  60.213 1.00 76.82  ? 479  LEU A CG  1 
ATOM   3948 C  CD1 . LEU A 1 479 ? 44.974 16.085  61.363 1.00 76.96  ? 479  LEU A CD1 1 
ATOM   3949 C  CD2 . LEU A 1 479 ? 43.622 14.326  60.188 1.00 77.41  ? 479  LEU A CD2 1 
ATOM   3950 N  N   . ASP A 1 480 ? 41.081 18.998  59.226 1.00 66.53  ? 480  ASP A N   1 
ATOM   3951 C  CA  . ASP A 1 480 ? 40.164 20.111  59.428 1.00 62.10  ? 480  ASP A CA  1 
ATOM   3952 C  C   . ASP A 1 480 ? 38.800 19.803  58.838 1.00 59.01  ? 480  ASP A C   1 
ATOM   3953 O  O   . ASP A 1 480 ? 37.779 20.105  59.455 1.00 58.49  ? 480  ASP A O   1 
ATOM   3954 C  CB  . ASP A 1 480 ? 40.740 21.394  58.808 1.00 63.89  ? 480  ASP A CB  1 
ATOM   3955 C  CG  . ASP A 1 480 ? 39.826 22.609  58.988 1.00 65.60  ? 480  ASP A CG  1 
ATOM   3956 O  OD1 . ASP A 1 480 ? 39.455 22.912  60.141 1.00 65.58  ? 480  ASP A OD1 1 
ATOM   3957 O  OD2 . ASP A 1 480 ? 39.486 23.270  57.975 1.00 66.40  ? 480  ASP A OD2 1 
ATOM   3958 N  N   . TYR A 1 481 ? 38.768 19.199  57.653 1.00 54.99  ? 481  TYR A N   1 
ATOM   3959 C  CA  . TYR A 1 481 ? 37.480 18.876  57.049 1.00 52.41  ? 481  TYR A CA  1 
ATOM   3960 C  C   . TYR A 1 481 ? 36.789 17.774  57.842 1.00 51.63  ? 481  TYR A C   1 
ATOM   3961 O  O   . TYR A 1 481 ? 35.622 17.905  58.211 1.00 52.52  ? 481  TYR A O   1 
ATOM   3962 C  CB  . TYR A 1 481 ? 37.639 18.439  55.590 1.00 49.53  ? 481  TYR A CB  1 
ATOM   3963 C  CG  . TYR A 1 481 ? 37.972 19.564  54.644 1.00 46.34  ? 481  TYR A CG  1 
ATOM   3964 C  CD1 . TYR A 1 481 ? 39.230 19.655  54.060 1.00 45.71  ? 481  TYR A CD1 1 
ATOM   3965 C  CD2 . TYR A 1 481 ? 37.036 20.551  54.345 1.00 45.13  ? 481  TYR A CD2 1 
ATOM   3966 C  CE1 . TYR A 1 481 ? 39.549 20.700  53.202 1.00 43.52  ? 481  TYR A CE1 1 
ATOM   3967 C  CE2 . TYR A 1 481 ? 37.348 21.603  53.491 1.00 42.59  ? 481  TYR A CE2 1 
ATOM   3968 C  CZ  . TYR A 1 481 ? 38.607 21.666  52.926 1.00 42.53  ? 481  TYR A CZ  1 
ATOM   3969 O  OH  . TYR A 1 481 ? 38.939 22.696  52.086 1.00 44.85  ? 481  TYR A OH  1 
ATOM   3970 N  N   . ARG A 1 482 ? 37.515 16.696  58.120 1.00 49.23  ? 482  ARG A N   1 
ATOM   3971 C  CA  . ARG A 1 482 ? 36.941 15.593  58.862 1.00 46.98  ? 482  ARG A CA  1 
ATOM   3972 C  C   . ARG A 1 482 ? 36.138 16.039  60.058 1.00 44.03  ? 482  ARG A C   1 
ATOM   3973 O  O   . ARG A 1 482 ? 34.970 15.698  60.179 1.00 44.32  ? 482  ARG A O   1 
ATOM   3974 C  CB  . ARG A 1 482 ? 38.025 14.632  59.322 1.00 50.43  ? 482  ARG A CB  1 
ATOM   3975 C  CG  . ARG A 1 482 ? 38.520 13.707  58.229 1.00 56.11  ? 482  ARG A CG  1 
ATOM   3976 C  CD  . ARG A 1 482 ? 38.928 12.359  58.814 1.00 60.46  ? 482  ARG A CD  1 
ATOM   3977 N  NE  . ARG A 1 482 ? 37.783 11.616  59.346 1.00 62.44  ? 482  ARG A NE  1 
ATOM   3978 C  CZ  . ARG A 1 482 ? 37.892 10.510  60.076 1.00 64.54  ? 482  ARG A CZ  1 
ATOM   3979 N  NH1 . ARG A 1 482 ? 36.807 9.887   60.519 1.00 63.69  ? 482  ARG A NH1 1 
ATOM   3980 N  NH2 . ARG A 1 482 ? 39.095 10.030  60.374 1.00 66.71  ? 482  ARG A NH2 1 
ATOM   3981 N  N   . GLN A 1 483 ? 36.757 16.811  60.939 1.00 42.09  ? 483  GLN A N   1 
ATOM   3982 C  CA  . GLN A 1 483 ? 36.067 17.264  62.137 1.00 40.38  ? 483  GLN A CA  1 
ATOM   3983 C  C   . GLN A 1 483 ? 34.942 18.261  61.876 1.00 38.98  ? 483  GLN A C   1 
ATOM   3984 O  O   . GLN A 1 483 ? 34.109 18.500  62.752 1.00 40.22  ? 483  GLN A O   1 
ATOM   3985 C  CB  . GLN A 1 483 ? 37.078 17.819  63.158 1.00 40.42  ? 483  GLN A CB  1 
ATOM   3986 C  CG  . GLN A 1 483 ? 37.831 19.079  62.765 1.00 42.72  ? 483  GLN A CG  1 
ATOM   3987 C  CD  . GLN A 1 483 ? 37.103 20.357  63.159 1.00 45.38  ? 483  GLN A CD  1 
ATOM   3988 O  OE1 . GLN A 1 483 ? 36.513 20.448  64.241 1.00 46.83  ? 483  GLN A OE1 1 
ATOM   3989 N  NE2 . GLN A 1 483 ? 37.163 21.360  62.291 1.00 47.13  ? 483  GLN A NE2 1 
ATOM   3990 N  N   . ARG A 1 484 ? 34.902 18.830  60.675 1.00 36.82  ? 484  ARG A N   1 
ATOM   3991 C  CA  . ARG A 1 484 ? 33.843 19.776  60.335 1.00 34.07  ? 484  ARG A CA  1 
ATOM   3992 C  C   . ARG A 1 484 ? 32.650 18.999  59.816 1.00 32.13  ? 484  ARG A C   1 
ATOM   3993 O  O   . ARG A 1 484 ? 31.509 19.418  59.971 1.00 32.57  ? 484  ARG A O   1 
ATOM   3994 C  CB  . ARG A 1 484 ? 34.314 20.766  59.280 1.00 35.23  ? 484  ARG A CB  1 
ATOM   3995 C  CG  . ARG A 1 484 ? 35.353 21.745  59.784 1.00 38.47  ? 484  ARG A CG  1 
ATOM   3996 C  CD  . ARG A 1 484 ? 35.875 22.616  58.661 1.00 40.39  ? 484  ARG A CD  1 
ATOM   3997 N  NE  . ARG A 1 484 ? 34.816 23.380  58.008 1.00 40.01  ? 484  ARG A NE  1 
ATOM   3998 C  CZ  . ARG A 1 484 ? 34.972 24.003  56.847 1.00 40.04  ? 484  ARG A CZ  1 
ATOM   3999 N  NH1 . ARG A 1 484 ? 36.141 23.946  56.219 1.00 38.78  ? 484  ARG A NH1 1 
ATOM   4000 N  NH2 . ARG A 1 484 ? 33.963 24.673  56.312 1.00 40.66  ? 484  ARG A NH2 1 
ATOM   4001 N  N   . ALA A 1 485 ? 32.915 17.859  59.196 1.00 30.26  ? 485  ALA A N   1 
ATOM   4002 C  CA  . ALA A 1 485 ? 31.836 17.028  58.694 1.00 29.78  ? 485  ALA A CA  1 
ATOM   4003 C  C   . ALA A 1 485 ? 31.187 16.417  59.928 1.00 29.54  ? 485  ALA A C   1 
ATOM   4004 O  O   . ALA A 1 485 ? 29.962 16.417  60.082 1.00 28.92  ? 485  ALA A O   1 
ATOM   4005 C  CB  . ALA A 1 485 ? 32.384 15.940  57.790 1.00 28.21  ? 485  ALA A CB  1 
ATOM   4006 N  N   . ILE A 1 486 ? 32.022 15.900  60.818 1.00 29.33  ? 486  ILE A N   1 
ATOM   4007 C  CA  . ILE A 1 486 ? 31.507 15.314  62.033 1.00 28.85  ? 486  ILE A CA  1 
ATOM   4008 C  C   . ILE A 1 486 ? 30.665 16.370  62.719 1.00 28.85  ? 486  ILE A C   1 
ATOM   4009 O  O   . ILE A 1 486 ? 29.516 16.110  63.038 1.00 30.61  ? 486  ILE A O   1 
ATOM   4010 C  CB  . ILE A 1 486 ? 32.627 14.845  62.957 1.00 27.20  ? 486  ILE A CB  1 
ATOM   4011 C  CG1 . ILE A 1 486 ? 33.483 13.813  62.222 1.00 27.63  ? 486  ILE A CG1 1 
ATOM   4012 C  CG2 . ILE A 1 486 ? 32.038 14.231  64.212 1.00 25.22  ? 486  ILE A CG2 1 
ATOM   4013 C  CD1 . ILE A 1 486 ? 34.553 13.176  63.065 1.00 27.04  ? 486  ILE A CD1 1 
ATOM   4014 N  N   . LYS A 1 487 ? 31.204 17.566  62.937 1.00 28.16  ? 487  LYS A N   1 
ATOM   4015 C  CA  . LYS A 1 487 ? 30.374 18.592  63.568 1.00 28.75  ? 487  LYS A CA  1 
ATOM   4016 C  C   . LYS A 1 487 ? 29.047 18.763  62.802 1.00 28.84  ? 487  LYS A C   1 
ATOM   4017 O  O   . LYS A 1 487 ? 27.977 18.805  63.415 1.00 28.27  ? 487  LYS A O   1 
ATOM   4018 C  CB  . LYS A 1 487 ? 31.076 19.960  63.642 1.00 27.17  ? 487  LYS A CB  1 
ATOM   4019 C  CG  . LYS A 1 487 ? 30.050 21.102  63.793 1.00 27.44  ? 487  LYS A CG  1 
ATOM   4020 C  CD  . LYS A 1 487 ? 30.641 22.461  64.126 1.00 31.32  ? 487  LYS A CD  1 
ATOM   4021 C  CE  . LYS A 1 487 ? 31.120 22.539  65.584 1.00 36.48  ? 487  LYS A CE  1 
ATOM   4022 N  NZ  . LYS A 1 487 ? 30.058 22.282  66.623 1.00 37.91  ? 487  LYS A NZ  1 
ATOM   4023 N  N   . ILE A 1 488 ? 29.123 18.860  61.471 1.00 28.33  ? 488  ILE A N   1 
ATOM   4024 C  CA  . ILE A 1 488 ? 27.929 19.039  60.647 1.00 27.25  ? 488  ILE A CA  1 
ATOM   4025 C  C   . ILE A 1 488 ? 26.956 17.879  60.794 1.00 28.46  ? 488  ILE A C   1 
ATOM   4026 O  O   . ILE A 1 488 ? 25.741 18.057  60.829 1.00 28.72  ? 488  ILE A O   1 
ATOM   4027 C  CB  . ILE A 1 488 ? 28.281 19.158  59.165 1.00 25.22  ? 488  ILE A CB  1 
ATOM   4028 C  CG1 . ILE A 1 488 ? 29.100 20.419  58.921 1.00 23.08  ? 488  ILE A CG1 1 
ATOM   4029 C  CG2 . ILE A 1 488 ? 27.008 19.207  58.341 1.00 25.81  ? 488  ILE A CG2 1 
ATOM   4030 C  CD1 . ILE A 1 488 ? 29.506 20.607  57.482 1.00 17.42  ? 488  ILE A CD1 1 
ATOM   4031 N  N   . LEU A 1 489 ? 27.501 16.679  60.869 1.00 28.87  ? 489  LEU A N   1 
ATOM   4032 C  CA  . LEU A 1 489 ? 26.672 15.506  61.010 1.00 28.42  ? 489  LEU A CA  1 
ATOM   4033 C  C   . LEU A 1 489 ? 25.938 15.577  62.351 1.00 28.15  ? 489  LEU A C   1 
ATOM   4034 O  O   . LEU A 1 489 ? 24.725 15.410  62.410 1.00 28.17  ? 489  LEU A O   1 
ATOM   4035 C  CB  . LEU A 1 489 ? 27.555 14.252  60.948 1.00 27.35  ? 489  LEU A CB  1 
ATOM   4036 C  CG  . LEU A 1 489 ? 26.960 12.917  60.487 1.00 25.03  ? 489  LEU A CG  1 
ATOM   4037 C  CD1 . LEU A 1 489 ? 27.990 11.849  60.721 1.00 25.03  ? 489  LEU A CD1 1 
ATOM   4038 C  CD2 . LEU A 1 489 ? 25.685 12.581  61.226 1.00 25.82  ? 489  LEU A CD2 1 
ATOM   4039 N  N   . ALA A 1 490 ? 26.689 15.842  63.416 1.00 27.72  ? 490  ALA A N   1 
ATOM   4040 C  CA  . ALA A 1 490 ? 26.149 15.901  64.770 1.00 28.71  ? 490  ALA A CA  1 
ATOM   4041 C  C   . ALA A 1 490 ? 25.033 16.918  65.007 1.00 29.90  ? 490  ALA A C   1 
ATOM   4042 O  O   . ALA A 1 490 ? 23.956 16.564  65.523 1.00 29.35  ? 490  ALA A O   1 
ATOM   4043 C  CB  . ALA A 1 490 ? 27.273 16.140  65.759 1.00 26.02  ? 490  ALA A CB  1 
ATOM   4044 N  N   . ASN A 1 491 ? 25.274 18.175  64.650 1.00 29.14  ? 491  ASN A N   1 
ATOM   4045 C  CA  . ASN A 1 491 ? 24.253 19.188  64.877 1.00 30.61  ? 491  ASN A CA  1 
ATOM   4046 C  C   . ASN A 1 491 ? 23.025 18.922  64.029 1.00 29.60  ? 491  ASN A C   1 
ATOM   4047 O  O   . ASN A 1 491 ? 22.030 19.640  64.123 1.00 28.34  ? 491  ASN A O   1 
ATOM   4048 C  CB  . ASN A 1 491 ? 24.796 20.582  64.573 1.00 32.27  ? 491  ASN A CB  1 
ATOM   4049 C  CG  . ASN A 1 491 ? 26.065 20.895  65.347 1.00 36.97  ? 491  ASN A CG  1 
ATOM   4050 O  OD1 . ASN A 1 491 ? 26.139 20.701  66.570 1.00 35.40  ? 491  ASN A OD1 1 
ATOM   4051 N  ND2 . ASN A 1 491 ? 27.076 21.400  64.636 1.00 39.31  ? 491  ASN A ND2 1 
ATOM   4052 N  N   . SER A 1 492 ? 23.094 17.870  63.220 1.00 29.04  ? 492  SER A N   1 
ATOM   4053 C  CA  . SER A 1 492 ? 21.999 17.515  62.330 1.00 30.25  ? 492  SER A CA  1 
ATOM   4054 C  C   . SER A 1 492 ? 20.985 16.540  62.906 1.00 30.63  ? 492  SER A C   1 
ATOM   4055 O  O   . SER A 1 492 ? 19.893 16.381  62.359 1.00 33.09  ? 492  SER A O   1 
ATOM   4056 C  CB  . SER A 1 492 ? 22.558 16.968  61.017 1.00 29.35  ? 492  SER A CB  1 
ATOM   4057 O  OG  . SER A 1 492 ? 23.258 17.988  60.326 1.00 29.92  ? 492  SER A OG  1 
ATOM   4058 N  N   . TYR A 1 493 ? 21.336 15.896  64.012 1.00 29.94  ? 493  TYR A N   1 
ATOM   4059 C  CA  . TYR A 1 493 ? 20.443 14.939  64.649 1.00 28.84  ? 493  TYR A CA  1 
ATOM   4060 C  C   . TYR A 1 493 ? 19.188 15.557  65.279 1.00 28.21  ? 493  TYR A C   1 
ATOM   4061 O  O   . TYR A 1 493 ? 18.101 14.978  65.227 1.00 27.26  ? 493  TYR A O   1 
ATOM   4062 C  CB  . TYR A 1 493 ? 21.210 14.153  65.705 1.00 29.41  ? 493  TYR A CB  1 
ATOM   4063 C  CG  . TYR A 1 493 ? 22.092 13.079  65.125 1.00 31.67  ? 493  TYR A CG  1 
ATOM   4064 C  CD1 . TYR A 1 493 ? 23.352 13.371  64.614 1.00 34.22  ? 493  TYR A CD1 1 
ATOM   4065 C  CD2 . TYR A 1 493 ? 21.667 11.760  65.095 1.00 32.58  ? 493  TYR A CD2 1 
ATOM   4066 C  CE1 . TYR A 1 493 ? 24.163 12.361  64.094 1.00 33.56  ? 493  TYR A CE1 1 
ATOM   4067 C  CE2 . TYR A 1 493 ? 22.464 10.755  64.583 1.00 31.13  ? 493  TYR A CE2 1 
ATOM   4068 C  CZ  . TYR A 1 493 ? 23.703 11.054  64.088 1.00 30.97  ? 493  TYR A CZ  1 
ATOM   4069 O  OH  . TYR A 1 493 ? 24.475 10.029  63.606 1.00 31.48  ? 493  TYR A OH  1 
ATOM   4070 N  N   . TYR A 1 494 ? 19.332 16.728  65.883 1.00 27.22  ? 494  TYR A N   1 
ATOM   4071 C  CA  . TYR A 1 494 ? 18.189 17.367  66.496 1.00 26.88  ? 494  TYR A CA  1 
ATOM   4072 C  C   . TYR A 1 494 ? 17.080 17.544  65.457 1.00 27.67  ? 494  TYR A C   1 
ATOM   4073 O  O   . TYR A 1 494 ? 15.966 17.022  65.622 1.00 27.92  ? 494  TYR A O   1 
ATOM   4074 C  CB  . TYR A 1 494 ? 18.613 18.701  67.098 1.00 28.14  ? 494  TYR A CB  1 
ATOM   4075 C  CG  . TYR A 1 494 ? 17.461 19.577  67.511 1.00 32.65  ? 494  TYR A CG  1 
ATOM   4076 C  CD1 . TYR A 1 494 ? 16.934 20.513  66.628 1.00 34.58  ? 494  TYR A CD1 1 
ATOM   4077 C  CD2 . TYR A 1 494 ? 16.869 19.452  68.764 1.00 35.10  ? 494  TYR A CD2 1 
ATOM   4078 C  CE1 . TYR A 1 494 ? 15.849 21.298  66.970 1.00 34.96  ? 494  TYR A CE1 1 
ATOM   4079 C  CE2 . TYR A 1 494 ? 15.775 20.242  69.119 1.00 37.50  ? 494  TYR A CE2 1 
ATOM   4080 C  CZ  . TYR A 1 494 ? 15.275 21.161  68.205 1.00 36.81  ? 494  TYR A CZ  1 
ATOM   4081 O  OH  . TYR A 1 494 ? 14.188 21.938  68.505 1.00 40.69  ? 494  TYR A OH  1 
ATOM   4082 N  N   . GLY A 1 495 ? 17.399 18.257  64.375 1.00 26.43  ? 495  GLY A N   1 
ATOM   4083 C  CA  . GLY A 1 495 ? 16.432 18.486  63.315 1.00 22.33  ? 495  GLY A CA  1 
ATOM   4084 C  C   . GLY A 1 495 ? 15.915 17.182  62.749 1.00 21.91  ? 495  GLY A C   1 
ATOM   4085 O  O   . GLY A 1 495 ? 14.723 17.026  62.486 1.00 22.80  ? 495  GLY A O   1 
ATOM   4086 N  N   . TYR A 1 496 ? 16.819 16.234  62.552 1.00 20.43  ? 496  TYR A N   1 
ATOM   4087 C  CA  . TYR A 1 496 ? 16.438 14.935  62.035 1.00 19.73  ? 496  TYR A CA  1 
ATOM   4088 C  C   . TYR A 1 496 ? 15.262 14.338  62.847 1.00 21.34  ? 496  TYR A C   1 
ATOM   4089 O  O   . TYR A 1 496 ? 14.329 13.778  62.267 1.00 20.26  ? 496  TYR A O   1 
ATOM   4090 C  CB  . TYR A 1 496 ? 17.644 13.999  62.078 1.00 15.58  ? 496  TYR A CB  1 
ATOM   4091 C  CG  . TYR A 1 496 ? 17.314 12.596  61.669 1.00 14.02  ? 496  TYR A CG  1 
ATOM   4092 C  CD1 . TYR A 1 496 ? 17.211 12.255  60.338 1.00 13.99  ? 496  TYR A CD1 1 
ATOM   4093 C  CD2 . TYR A 1 496 ? 17.011 11.627  62.622 1.00 15.60  ? 496  TYR A CD2 1 
ATOM   4094 C  CE1 . TYR A 1 496 ? 16.801 10.987  59.952 1.00 15.35  ? 496  TYR A CE1 1 
ATOM   4095 C  CE2 . TYR A 1 496 ? 16.597 10.349  62.248 1.00 15.16  ? 496  TYR A CE2 1 
ATOM   4096 C  CZ  . TYR A 1 496 ? 16.488 10.039  60.909 1.00 15.12  ? 496  TYR A CZ  1 
ATOM   4097 O  OH  . TYR A 1 496 ? 16.012 8.806   60.517 1.00 13.38  ? 496  TYR A OH  1 
ATOM   4098 N  N   . TYR A 1 497 ? 15.302 14.465  64.177 1.00 21.75  ? 497  TYR A N   1 
ATOM   4099 C  CA  . TYR A 1 497 ? 14.234 13.918  65.019 1.00 23.22  ? 497  TYR A CA  1 
ATOM   4100 C  C   . TYR A 1 497 ? 12.880 14.500  64.670 1.00 24.21  ? 497  TYR A C   1 
ATOM   4101 O  O   . TYR A 1 497 ? 11.853 13.891  64.924 1.00 24.36  ? 497  TYR A O   1 
ATOM   4102 C  CB  . TYR A 1 497 ? 14.495 14.165  66.519 1.00 24.04  ? 497  TYR A CB  1 
ATOM   4103 C  CG  . TYR A 1 497 ? 15.333 13.107  67.231 1.00 23.09  ? 497  TYR A CG  1 
ATOM   4104 C  CD1 . TYR A 1 497 ? 15.162 11.751  66.965 1.00 23.01  ? 497  TYR A CD1 1 
ATOM   4105 C  CD2 . TYR A 1 497 ? 16.311 13.471  68.147 1.00 21.94  ? 497  TYR A CD2 1 
ATOM   4106 C  CE1 . TYR A 1 497 ? 15.952 10.791  67.583 1.00 22.39  ? 497  TYR A CE1 1 
ATOM   4107 C  CE2 . TYR A 1 497 ? 17.104 12.516  68.769 1.00 21.53  ? 497  TYR A CE2 1 
ATOM   4108 C  CZ  . TYR A 1 497 ? 16.927 11.180  68.479 1.00 21.63  ? 497  TYR A CZ  1 
ATOM   4109 O  OH  . TYR A 1 497 ? 17.767 10.235  69.040 1.00 21.49  ? 497  TYR A OH  1 
ATOM   4110 N  N   . GLY A 1 498 ? 12.880 15.695  64.103 1.00 26.34  ? 498  GLY A N   1 
ATOM   4111 C  CA  . GLY A 1 498 ? 11.629 16.316  63.723 1.00 27.59  ? 498  GLY A CA  1 
ATOM   4112 C  C   . GLY A 1 498 ? 11.413 16.265  62.220 1.00 28.80  ? 498  GLY A C   1 
ATOM   4113 O  O   . GLY A 1 498 ? 10.325 16.586  61.751 1.00 29.32  ? 498  GLY A O   1 
ATOM   4114 N  N   . TYR A 1 499 ? 12.445 15.878  61.466 1.00 28.56  ? 499  TYR A N   1 
ATOM   4115 C  CA  . TYR A 1 499 ? 12.344 15.785  60.008 1.00 28.95  ? 499  TYR A CA  1 
ATOM   4116 C  C   . TYR A 1 499 ? 11.228 14.802  59.719 1.00 28.23  ? 499  TYR A C   1 
ATOM   4117 O  O   . TYR A 1 499 ? 11.374 13.606  59.940 1.00 28.98  ? 499  TYR A O   1 
ATOM   4118 C  CB  . TYR A 1 499 ? 13.680 15.309  59.421 1.00 31.42  ? 499  TYR A CB  1 
ATOM   4119 C  CG  . TYR A 1 499 ? 13.656 14.864  57.959 1.00 32.41  ? 499  TYR A CG  1 
ATOM   4120 C  CD1 . TYR A 1 499 ? 12.909 15.550  56.999 1.00 32.29  ? 499  TYR A CD1 1 
ATOM   4121 C  CD2 . TYR A 1 499 ? 14.419 13.775  57.535 1.00 31.52  ? 499  TYR A CD2 1 
ATOM   4122 C  CE1 . TYR A 1 499 ? 12.929 15.161  55.655 1.00 30.95  ? 499  TYR A CE1 1 
ATOM   4123 C  CE2 . TYR A 1 499 ? 14.443 13.384  56.200 1.00 32.78  ? 499  TYR A CE2 1 
ATOM   4124 C  CZ  . TYR A 1 499 ? 13.697 14.082  55.267 1.00 31.95  ? 499  TYR A CZ  1 
ATOM   4125 O  OH  . TYR A 1 499 ? 13.735 13.702  53.948 1.00 32.66  ? 499  TYR A OH  1 
ATOM   4126 N  N   . ALA A 1 500 ? 10.111 15.325  59.222 1.00 28.47  ? 500  ALA A N   1 
ATOM   4127 C  CA  . ALA A 1 500 ? 8.903  14.539  58.952 1.00 26.98  ? 500  ALA A CA  1 
ATOM   4128 C  C   . ALA A 1 500 ? 8.999  13.233  58.162 1.00 27.15  ? 500  ALA A C   1 
ATOM   4129 O  O   . ALA A 1 500 ? 8.069  12.432  58.196 1.00 27.26  ? 500  ALA A O   1 
ATOM   4130 C  CB  . ALA A 1 500 ? 7.842  15.445  58.330 1.00 24.44  ? 500  ALA A CB  1 
ATOM   4131 N  N   . ARG A 1 501 ? 10.105 12.998  57.463 1.00 28.15  ? 501  ARG A N   1 
ATOM   4132 C  CA  . ARG A 1 501 ? 10.251 11.766  56.680 1.00 29.02  ? 501  ARG A CA  1 
ATOM   4133 C  C   . ARG A 1 501 ? 11.279 10.814  57.272 1.00 28.40  ? 501  ARG A C   1 
ATOM   4134 O  O   . ARG A 1 501 ? 11.615 9.791   56.671 1.00 26.68  ? 501  ARG A O   1 
ATOM   4135 C  CB  . ARG A 1 501 ? 10.647 12.099  55.235 1.00 33.33  ? 501  ARG A CB  1 
ATOM   4136 C  CG  . ARG A 1 501 ? 9.501  12.653  54.395 1.00 38.87  ? 501  ARG A CG  1 
ATOM   4137 C  CD  . ARG A 1 501 ? 9.826  12.705  52.898 1.00 43.05  ? 501  ARG A CD  1 
ATOM   4138 N  NE  . ARG A 1 501 ? 10.615 13.885  52.561 1.00 47.50  ? 501  ARG A NE  1 
ATOM   4139 C  CZ  . ARG A 1 501 ? 10.762 14.358  51.328 1.00 49.34  ? 501  ARG A CZ  1 
ATOM   4140 N  NH1 . ARG A 1 501 ? 10.169 13.746  50.308 1.00 50.06  ? 501  ARG A NH1 1 
ATOM   4141 N  NH2 . ARG A 1 501 ? 11.489 15.452  51.122 1.00 50.32  ? 501  ARG A NH2 1 
ATOM   4142 N  N   . ALA A 1 502 ? 11.761 11.156  58.463 1.00 27.68  ? 502  ALA A N   1 
ATOM   4143 C  CA  . ALA A 1 502 ? 12.778 10.374  59.150 1.00 25.38  ? 502  ALA A CA  1 
ATOM   4144 C  C   . ALA A 1 502 ? 12.320 9.011   59.635 1.00 25.31  ? 502  ALA A C   1 
ATOM   4145 O  O   . ALA A 1 502 ? 11.329 8.892   60.376 1.00 25.46  ? 502  ALA A O   1 
ATOM   4146 C  CB  . ALA A 1 502 ? 13.333 11.178  60.319 1.00 24.45  ? 502  ALA A CB  1 
ATOM   4147 N  N   . ARG A 1 503 ? 13.050 7.977   59.221 1.00 24.04  ? 503  ARG A N   1 
ATOM   4148 C  CA  . ARG A 1 503 ? 12.727 6.617   59.654 1.00 23.62  ? 503  ARG A CA  1 
ATOM   4149 C  C   . ARG A 1 503 ? 12.712 6.569   61.183 1.00 22.49  ? 503  ARG A C   1 
ATOM   4150 O  O   . ARG A 1 503 ? 11.831 5.972   61.793 1.00 22.59  ? 503  ARG A O   1 
ATOM   4151 C  CB  . ARG A 1 503 ? 13.755 5.613   59.114 1.00 20.85  ? 503  ARG A CB  1 
ATOM   4152 C  CG  . ARG A 1 503 ? 13.506 5.163   57.686 1.00 19.92  ? 503  ARG A CG  1 
ATOM   4153 C  CD  . ARG A 1 503 ? 14.708 4.420   57.159 1.00 22.19  ? 503  ARG A CD  1 
ATOM   4154 N  NE  . ARG A 1 503 ? 14.572 4.112   55.745 1.00 25.44  ? 503  ARG A NE  1 
ATOM   4155 C  CZ  . ARG A 1 503 ? 13.665 3.277   55.255 1.00 26.29  ? 503  ARG A CZ  1 
ATOM   4156 N  NH1 . ARG A 1 503 ? 12.820 2.669   56.077 1.00 28.73  ? 503  ARG A NH1 1 
ATOM   4157 N  NH2 . ARG A 1 503 ? 13.599 3.055   53.952 1.00 23.71  ? 503  ARG A NH2 1 
ATOM   4158 N  N   . TRP A 1 504 ? 13.698 7.221   61.786 1.00 22.44  ? 504  TRP A N   1 
ATOM   4159 C  CA  . TRP A 1 504 ? 13.837 7.279   63.229 1.00 21.26  ? 504  TRP A CA  1 
ATOM   4160 C  C   . TRP A 1 504 ? 13.239 8.570   63.794 1.00 21.33  ? 504  TRP A C   1 
ATOM   4161 O  O   . TRP A 1 504 ? 13.849 9.269   64.611 1.00 18.67  ? 504  TRP A O   1 
ATOM   4162 C  CB  . TRP A 1 504 ? 15.315 7.162   63.579 1.00 20.02  ? 504  TRP A CB  1 
ATOM   4163 C  CG  . TRP A 1 504 ? 15.823 5.752   63.581 1.00 18.07  ? 504  TRP A CG  1 
ATOM   4164 C  CD1 . TRP A 1 504 ? 15.813 4.878   64.631 1.00 18.39  ? 504  TRP A CD1 1 
ATOM   4165 C  CD2 . TRP A 1 504 ? 16.474 5.072   62.503 1.00 16.14  ? 504  TRP A CD2 1 
ATOM   4166 N  NE1 . TRP A 1 504 ? 16.428 3.701   64.276 1.00 15.61  ? 504  TRP A NE1 1 
ATOM   4167 C  CE2 . TRP A 1 504 ? 16.839 3.795   62.978 1.00 14.45  ? 504  TRP A CE2 1 
ATOM   4168 C  CE3 . TRP A 1 504 ? 16.781 5.420   61.186 1.00 15.52  ? 504  TRP A CE3 1 
ATOM   4169 C  CZ2 . TRP A 1 504 ? 17.502 2.872   62.181 1.00 13.91  ? 504  TRP A CZ2 1 
ATOM   4170 C  CZ3 . TRP A 1 504 ? 17.437 4.502   60.397 1.00 14.22  ? 504  TRP A CZ3 1 
ATOM   4171 C  CH2 . TRP A 1 504 ? 17.791 3.237   60.899 1.00 14.95  ? 504  TRP A CH2 1 
ATOM   4172 N  N   . TYR A 1 505 ? 12.029 8.878   63.348 1.00 22.01  ? 505  TYR A N   1 
ATOM   4173 C  CA  . TYR A 1 505 ? 11.346 10.072  63.803 1.00 23.20  ? 505  TYR A CA  1 
ATOM   4174 C  C   . TYR A 1 505 ? 11.082 9.970   65.287 1.00 24.26  ? 505  TYR A C   1 
ATOM   4175 O  O   . TYR A 1 505 ? 10.796 8.893   65.808 1.00 24.37  ? 505  TYR A O   1 
ATOM   4176 C  CB  . TYR A 1 505 ? 10.023 10.227  63.070 1.00 23.70  ? 505  TYR A CB  1 
ATOM   4177 C  CG  . TYR A 1 505 ? 9.284  11.500  63.393 1.00 24.24  ? 505  TYR A CG  1 
ATOM   4178 C  CD1 . TYR A 1 505 ? 9.778  12.736  62.996 1.00 25.14  ? 505  TYR A CD1 1 
ATOM   4179 C  CD2 . TYR A 1 505 ? 8.067  11.462  64.058 1.00 26.29  ? 505  TYR A CD2 1 
ATOM   4180 C  CE1 . TYR A 1 505 ? 9.072  13.907  63.247 1.00 27.32  ? 505  TYR A CE1 1 
ATOM   4181 C  CE2 . TYR A 1 505 ? 7.350  12.622  64.318 1.00 28.73  ? 505  TYR A CE2 1 
ATOM   4182 C  CZ  . TYR A 1 505 ? 7.853  13.843  63.910 1.00 29.09  ? 505  TYR A CZ  1 
ATOM   4183 O  OH  . TYR A 1 505 ? 7.124  14.993  64.159 1.00 30.70  ? 505  TYR A OH  1 
ATOM   4184 N  N   . CYS A 1 506 ? 11.174 11.101  65.967 1.00 25.67  ? 506  CYS A N   1 
ATOM   4185 C  CA  . CYS A 1 506 ? 10.925 11.134  67.391 1.00 27.92  ? 506  CYS A CA  1 
ATOM   4186 C  C   . CYS A 1 506 ? 10.617 12.564  67.870 1.00 29.72  ? 506  CYS A C   1 
ATOM   4187 O  O   . CYS A 1 506 ? 11.513 13.324  68.245 1.00 29.72  ? 506  CYS A O   1 
ATOM   4188 C  CB  . CYS A 1 506 ? 12.119 10.535  68.136 1.00 27.18  ? 506  CYS A CB  1 
ATOM   4189 S  SG  . CYS A 1 506 ? 11.872 10.458  69.932 1.00 28.73  ? 506  CYS A SG  1 
ATOM   4190 N  N   . LYS A 1 507 ? 9.331  12.915  67.841 1.00 29.57  ? 507  LYS A N   1 
ATOM   4191 C  CA  . LYS A 1 507 ? 8.860  14.237  68.249 1.00 29.88  ? 507  LYS A CA  1 
ATOM   4192 C  C   . LYS A 1 507 ? 9.174  14.460  69.714 1.00 29.69  ? 507  LYS A C   1 
ATOM   4193 O  O   . LYS A 1 507 ? 9.532  15.571  70.122 1.00 28.73  ? 507  LYS A O   1 
ATOM   4194 C  CB  . LYS A 1 507 ? 7.344  14.336  68.020 1.00 32.26  ? 507  LYS A CB  1 
ATOM   4195 C  CG  . LYS A 1 507 ? 6.658  15.615  68.524 1.00 33.92  ? 507  LYS A CG  1 
ATOM   4196 C  CD  . LYS A 1 507 ? 6.501  16.674  67.430 1.00 33.95  ? 507  LYS A CD  1 
ATOM   4197 C  CE  . LYS A 1 507 ? 7.766  17.490  67.215 1.00 34.79  ? 507  LYS A CE  1 
ATOM   4198 N  NZ  . LYS A 1 507 ? 8.065  18.402  68.373 1.00 36.14  ? 507  LYS A NZ  1 
ATOM   4199 N  N   . GLU A 1 508 ? 9.034  13.387  70.495 1.00 30.69  ? 508  GLU A N   1 
ATOM   4200 C  CA  . GLU A 1 508 ? 9.280  13.417  71.936 1.00 29.20  ? 508  GLU A CA  1 
ATOM   4201 C  C   . GLU A 1 508 ? 10.720 13.764  72.242 1.00 27.50  ? 508  GLU A C   1 
ATOM   4202 O  O   . GLU A 1 508 ? 10.998 14.522  73.163 1.00 24.26  ? 508  GLU A O   1 
ATOM   4203 C  CB  . GLU A 1 508 ? 8.941  12.067  72.568 1.00 30.53  ? 508  GLU A CB  1 
ATOM   4204 C  CG  . GLU A 1 508 ? 7.451  11.731  72.606 1.00 33.02  ? 508  GLU A CG  1 
ATOM   4205 C  CD  . GLU A 1 508 ? 6.958  11.000  71.366 1.00 35.95  ? 508  GLU A CD  1 
ATOM   4206 O  OE1 . GLU A 1 508 ? 5.747  10.666  71.305 1.00 35.13  ? 508  GLU A OE1 1 
ATOM   4207 O  OE2 . GLU A 1 508 ? 7.784  10.759  70.455 1.00 38.49  ? 508  GLU A OE2 1 
ATOM   4208 N  N   . CYS A 1 509 ? 11.634 13.208  71.455 1.00 28.07  ? 509  CYS A N   1 
ATOM   4209 C  CA  . CYS A 1 509 ? 13.057 13.471  71.644 1.00 30.26  ? 509  CYS A CA  1 
ATOM   4210 C  C   . CYS A 1 509 ? 13.323 14.954  71.381 1.00 30.73  ? 509  CYS A C   1 
ATOM   4211 O  O   . CYS A 1 509 ? 13.918 15.654  72.202 1.00 30.96  ? 509  CYS A O   1 
ATOM   4212 C  CB  . CYS A 1 509 ? 13.899 12.636  70.677 1.00 29.86  ? 509  CYS A CB  1 
ATOM   4213 S  SG  . CYS A 1 509 ? 13.733 10.817  70.712 1.00 31.42  ? 509  CYS A SG  1 
ATOM   4214 N  N   . ALA A 1 510 ? 12.871 15.418  70.223 1.00 32.27  ? 510  ALA A N   1 
ATOM   4215 C  CA  . ALA A 1 510 ? 13.032 16.809  69.816 1.00 33.59  ? 510  ALA A CA  1 
ATOM   4216 C  C   . ALA A 1 510 ? 12.528 17.751  70.893 1.00 34.38  ? 510  ALA A C   1 
ATOM   4217 O  O   . ALA A 1 510 ? 13.243 18.663  71.313 1.00 33.69  ? 510  ALA A O   1 
ATOM   4218 C  CB  . ALA A 1 510 ? 12.279 17.059  68.537 1.00 32.78  ? 510  ALA A CB  1 
ATOM   4219 N  N   . GLU A 1 511 ? 11.286 17.538  71.322 1.00 35.17  ? 511  GLU A N   1 
ATOM   4220 C  CA  . GLU A 1 511 ? 10.704 18.369  72.365 1.00 35.31  ? 511  GLU A CA  1 
ATOM   4221 C  C   . GLU A 1 511 ? 11.642 18.385  73.567 1.00 35.05  ? 511  GLU A C   1 
ATOM   4222 O  O   . GLU A 1 511 ? 11.979 19.451  74.094 1.00 34.84  ? 511  GLU A O   1 
ATOM   4223 C  CB  . GLU A 1 511 ? 9.331  17.828  72.770 1.00 34.77  ? 511  GLU A CB  1 
ATOM   4224 C  CG  . GLU A 1 511 ? 8.210  18.300  71.866 1.00 37.57  ? 511  GLU A CG  1 
ATOM   4225 C  CD  . GLU A 1 511 ? 6.863  17.694  72.233 1.00 38.31  ? 511  GLU A CD  1 
ATOM   4226 O  OE1 . GLU A 1 511 ? 6.690  17.334  73.417 1.00 36.61  ? 511  GLU A OE1 1 
ATOM   4227 O  OE2 . GLU A 1 511 ? 5.978  17.590  71.345 1.00 36.89  ? 511  GLU A OE2 1 
ATOM   4228 N  N   . SER A 1 512 ? 12.082 17.198  73.975 1.00 33.86  ? 512  SER A N   1 
ATOM   4229 C  CA  . SER A 1 512 ? 12.973 17.066  75.113 1.00 33.81  ? 512  SER A CA  1 
ATOM   4230 C  C   . SER A 1 512 ? 14.274 17.859  74.973 1.00 34.51  ? 512  SER A C   1 
ATOM   4231 O  O   . SER A 1 512 ? 14.597 18.702  75.815 1.00 34.20  ? 512  SER A O   1 
ATOM   4232 C  CB  . SER A 1 512 ? 13.273 15.594  75.349 1.00 32.85  ? 512  SER A CB  1 
ATOM   4233 O  OG  . SER A 1 512 ? 12.088 14.913  75.715 1.00 32.64  ? 512  SER A OG  1 
ATOM   4234 N  N   . VAL A 1 513 ? 15.018 17.592  73.907 1.00 34.92  ? 513  VAL A N   1 
ATOM   4235 C  CA  . VAL A 1 513 ? 16.273 18.288  73.672 1.00 34.10  ? 513  VAL A CA  1 
ATOM   4236 C  C   . VAL A 1 513 ? 16.079 19.795  73.733 1.00 33.70  ? 513  VAL A C   1 
ATOM   4237 O  O   . VAL A 1 513 ? 16.982 20.513  74.141 1.00 35.06  ? 513  VAL A O   1 
ATOM   4238 C  CB  . VAL A 1 513 ? 16.862 17.913  72.309 1.00 33.82  ? 513  VAL A CB  1 
ATOM   4239 C  CG1 . VAL A 1 513 ? 18.245 18.510  72.155 1.00 34.93  ? 513  VAL A CG1 1 
ATOM   4240 C  CG2 . VAL A 1 513 ? 16.924 16.412  72.185 1.00 34.36  ? 513  VAL A CG2 1 
ATOM   4241 N  N   . THR A 1 514 ? 14.903 20.277  73.339 1.00 33.01  ? 514  THR A N   1 
ATOM   4242 C  CA  . THR A 1 514 ? 14.623 21.716  73.371 1.00 33.53  ? 514  THR A CA  1 
ATOM   4243 C  C   . THR A 1 514 ? 14.463 22.184  74.815 1.00 33.27  ? 514  THR A C   1 
ATOM   4244 O  O   . THR A 1 514 ? 15.107 23.140  75.261 1.00 32.39  ? 514  THR A O   1 
ATOM   4245 C  CB  . THR A 1 514 ? 13.321 22.068  72.623 1.00 33.68  ? 514  THR A CB  1 
ATOM   4246 O  OG1 . THR A 1 514 ? 13.291 21.393  71.361 1.00 36.98  ? 514  THR A OG1 1 
ATOM   4247 C  CG2 . THR A 1 514 ? 13.251 23.564  72.366 1.00 33.99  ? 514  THR A CG2 1 
ATOM   4248 N  N   . ALA A 1 515 ? 13.590 21.495  75.538 1.00 31.81  ? 515  ALA A N   1 
ATOM   4249 C  CA  . ALA A 1 515 ? 13.329 21.819  76.922 1.00 28.76  ? 515  ALA A CA  1 
ATOM   4250 C  C   . ALA A 1 515 ? 14.625 21.757  77.740 1.00 27.47  ? 515  ALA A C   1 
ATOM   4251 O  O   . ALA A 1 515 ? 14.887 22.640  78.561 1.00 29.18  ? 515  ALA A O   1 
ATOM   4252 C  CB  . ALA A 1 515 ? 12.276 20.860  77.486 1.00 28.11  ? 515  ALA A CB  1 
ATOM   4253 N  N   . TRP A 1 516 ? 15.435 20.721  77.537 1.00 23.44  ? 516  TRP A N   1 
ATOM   4254 C  CA  . TRP A 1 516 ? 16.688 20.630  78.282 1.00 19.59  ? 516  TRP A CA  1 
ATOM   4255 C  C   . TRP A 1 516 ? 17.565 21.800  77.915 1.00 20.16  ? 516  TRP A C   1 
ATOM   4256 O  O   . TRP A 1 516 ? 18.154 22.433  78.777 1.00 16.96  ? 516  TRP A O   1 
ATOM   4257 C  CB  . TRP A 1 516 ? 17.424 19.328  77.985 1.00 13.41  ? 516  TRP A CB  1 
ATOM   4258 C  CG  . TRP A 1 516 ? 17.283 18.390  79.100 1.00 9.81   ? 516  TRP A CG  1 
ATOM   4259 C  CD1 . TRP A 1 516 ? 17.593 18.627  80.418 1.00 6.06   ? 516  TRP A CD1 1 
ATOM   4260 C  CD2 . TRP A 1 516 ? 16.739 17.066  79.042 1.00 8.63   ? 516  TRP A CD2 1 
ATOM   4261 N  NE1 . TRP A 1 516 ? 17.268 17.536  81.176 1.00 6.29   ? 516  TRP A NE1 1 
ATOM   4262 C  CE2 . TRP A 1 516 ? 16.738 16.564  80.365 1.00 7.57   ? 516  TRP A CE2 1 
ATOM   4263 C  CE3 . TRP A 1 516 ? 16.241 16.258  78.002 1.00 7.18   ? 516  TRP A CE3 1 
ATOM   4264 C  CZ2 . TRP A 1 516 ? 16.273 15.279  80.672 1.00 2.03   ? 516  TRP A CZ2 1 
ATOM   4265 C  CZ3 . TRP A 1 516 ? 15.782 14.983  78.309 1.00 2.92   ? 516  TRP A CZ3 1 
ATOM   4266 C  CH2 . TRP A 1 516 ? 15.799 14.510  79.636 1.00 3.67   ? 516  TRP A CH2 1 
ATOM   4267 N  N   . GLY A 1 517 ? 17.640 22.078  76.619 1.00 22.49  ? 517  GLY A N   1 
ATOM   4268 C  CA  . GLY A 1 517 ? 18.430 23.192  76.156 1.00 26.62  ? 517  GLY A CA  1 
ATOM   4269 C  C   . GLY A 1 517 ? 18.103 24.390  77.017 1.00 29.87  ? 517  GLY A C   1 
ATOM   4270 O  O   . GLY A 1 517 ? 18.974 24.901  77.717 1.00 31.57  ? 517  GLY A O   1 
ATOM   4271 N  N   . ARG A 1 518 ? 16.848 24.834  76.978 1.00 33.05  ? 518  ARG A N   1 
ATOM   4272 C  CA  . ARG A 1 518 ? 16.429 25.975  77.779 1.00 34.95  ? 518  ARG A CA  1 
ATOM   4273 C  C   . ARG A 1 518 ? 16.961 25.806  79.192 1.00 37.59  ? 518  ARG A C   1 
ATOM   4274 O  O   . ARG A 1 518 ? 17.826 26.561  79.623 1.00 39.14  ? 518  ARG A O   1 
ATOM   4275 C  CB  . ARG A 1 518 ? 14.906 26.084  77.823 1.00 35.60  ? 518  ARG A CB  1 
ATOM   4276 C  CG  . ARG A 1 518 ? 14.269 26.733  76.612 1.00 39.32  ? 518  ARG A CG  1 
ATOM   4277 C  CD  . ARG A 1 518 ? 12.737 26.709  76.722 1.00 44.10  ? 518  ARG A CD  1 
ATOM   4278 N  NE  . ARG A 1 518 ? 12.196 25.365  76.493 1.00 48.00  ? 518  ARG A NE  1 
ATOM   4279 C  CZ  . ARG A 1 518 ? 11.722 24.922  75.327 1.00 47.71  ? 518  ARG A CZ  1 
ATOM   4280 N  NH1 . ARG A 1 518 ? 11.702 25.718  74.260 1.00 49.46  ? 518  ARG A NH1 1 
ATOM   4281 N  NH2 . ARG A 1 518 ? 11.283 23.673  75.221 1.00 47.27  ? 518  ARG A NH2 1 
ATOM   4282 N  N   . GLU A 1 519 ? 16.463 24.805  79.912 1.00 40.15  ? 519  GLU A N   1 
ATOM   4283 C  CA  . GLU A 1 519 ? 16.916 24.584  81.281 1.00 42.20  ? 519  GLU A CA  1 
ATOM   4284 C  C   . GLU A 1 519 ? 18.416 24.835  81.444 1.00 40.90  ? 519  GLU A C   1 
ATOM   4285 O  O   . GLU A 1 519 ? 18.809 25.727  82.181 1.00 41.19  ? 519  GLU A O   1 
ATOM   4286 C  CB  . GLU A 1 519 ? 16.559 23.163  81.762 1.00 45.16  ? 519  GLU A CB  1 
ATOM   4287 C  CG  . GLU A 1 519 ? 17.167 22.806  83.132 1.00 49.83  ? 519  GLU A CG  1 
ATOM   4288 C  CD  . GLU A 1 519 ? 16.639 21.506  83.736 1.00 53.52  ? 519  GLU A CD  1 
ATOM   4289 O  OE1 . GLU A 1 519 ? 15.442 21.452  84.106 1.00 56.33  ? 519  GLU A OE1 1 
ATOM   4290 O  OE2 . GLU A 1 519 ? 17.428 20.540  83.849 1.00 55.38  ? 519  GLU A OE2 1 
ATOM   4291 N  N   . TYR A 1 520 ? 19.252 24.076  80.747 1.00 41.59  ? 520  TYR A N   1 
ATOM   4292 C  CA  . TYR A 1 520 ? 20.698 24.249  80.875 1.00 43.48  ? 520  TYR A CA  1 
ATOM   4293 C  C   . TYR A 1 520 ? 21.192 25.676  80.654 1.00 42.63  ? 520  TYR A C   1 
ATOM   4294 O  O   . TYR A 1 520 ? 21.924 26.218  81.485 1.00 42.03  ? 520  TYR A O   1 
ATOM   4295 C  CB  . TYR A 1 520 ? 21.444 23.280  79.955 1.00 45.98  ? 520  TYR A CB  1 
ATOM   4296 C  CG  . TYR A 1 520 ? 21.497 21.868  80.504 1.00 50.41  ? 520  TYR A CG  1 
ATOM   4297 C  CD1 . TYR A 1 520 ? 20.526 20.922  80.172 1.00 50.92  ? 520  TYR A CD1 1 
ATOM   4298 C  CD2 . TYR A 1 520 ? 22.518 21.481  81.376 1.00 54.22  ? 520  TYR A CD2 1 
ATOM   4299 C  CE1 . TYR A 1 520 ? 20.575 19.628  80.691 1.00 52.28  ? 520  TYR A CE1 1 
ATOM   4300 C  CE2 . TYR A 1 520 ? 22.573 20.189  81.902 1.00 54.43  ? 520  TYR A CE2 1 
ATOM   4301 C  CZ  . TYR A 1 520 ? 21.601 19.272  81.550 1.00 54.29  ? 520  TYR A CZ  1 
ATOM   4302 O  OH  . TYR A 1 520 ? 21.679 17.994  82.043 1.00 57.35  ? 520  TYR A OH  1 
ATOM   4303 N  N   . ILE A 1 521 ? 20.801 26.290  79.548 1.00 41.57  ? 521  ILE A N   1 
ATOM   4304 C  CA  . ILE A 1 521 ? 21.218 27.661  79.300 1.00 41.51  ? 521  ILE A CA  1 
ATOM   4305 C  C   . ILE A 1 521 ? 20.806 28.486  80.520 1.00 41.43  ? 521  ILE A C   1 
ATOM   4306 O  O   . ILE A 1 521 ? 21.649 28.953  81.276 1.00 42.54  ? 521  ILE A O   1 
ATOM   4307 C  CB  . ILE A 1 521 ? 20.529 28.228  78.060 1.00 42.11  ? 521  ILE A CB  1 
ATOM   4308 C  CG1 . ILE A 1 521 ? 20.531 27.174  76.951 1.00 43.71  ? 521  ILE A CG1 1 
ATOM   4309 C  CG2 . ILE A 1 521 ? 21.258 29.476  77.590 1.00 39.98  ? 521  ILE A CG2 1 
ATOM   4310 C  CD1 . ILE A 1 521 ? 19.565 27.465  75.816 1.00 46.20  ? 521  ILE A CD1 1 
ATOM   4311 N  N   . THR A 1 522 ? 19.499 28.639  80.713 1.00 41.06  ? 522  THR A N   1 
ATOM   4312 C  CA  . THR A 1 522 ? 18.942 29.391  81.835 1.00 39.40  ? 522  THR A CA  1 
ATOM   4313 C  C   . THR A 1 522 ? 19.683 29.184  83.164 1.00 40.92  ? 522  THR A C   1 
ATOM   4314 O  O   . THR A 1 522 ? 19.911 30.135  83.915 1.00 40.59  ? 522  THR A O   1 
ATOM   4315 C  CB  . THR A 1 522 ? 17.455 29.032  82.030 1.00 36.34  ? 522  THR A CB  1 
ATOM   4316 O  OG1 . THR A 1 522 ? 16.691 29.572  80.948 1.00 33.07  ? 522  THR A OG1 1 
ATOM   4317 C  CG2 . THR A 1 522 ? 16.933 29.584  83.336 1.00 35.10  ? 522  THR A CG2 1 
ATOM   4318 N  N   . MET A 1 523 ? 20.054 27.944  83.455 1.00 42.91  ? 523  MET A N   1 
ATOM   4319 C  CA  . MET A 1 523 ? 20.755 27.642  84.696 1.00 44.97  ? 523  MET A CA  1 
ATOM   4320 C  C   . MET A 1 523 ? 22.131 28.298  84.698 1.00 47.12  ? 523  MET A C   1 
ATOM   4321 O  O   . MET A 1 523 ? 22.672 28.621  85.755 1.00 47.21  ? 523  MET A O   1 
ATOM   4322 C  CB  . MET A 1 523 ? 20.881 26.122  84.877 1.00 44.03  ? 523  MET A CB  1 
ATOM   4323 C  CG  . MET A 1 523 ? 21.731 25.687  86.062 1.00 43.16  ? 523  MET A CG  1 
ATOM   4324 S  SD  . MET A 1 523 ? 23.495 25.641  85.688 1.00 44.06  ? 523  MET A SD  1 
ATOM   4325 C  CE  . MET A 1 523 ? 23.827 23.929  85.920 1.00 44.88  ? 523  MET A CE  1 
ATOM   4326 N  N   . THR A 1 524 ? 22.694 28.495  83.508 1.00 48.40  ? 524  THR A N   1 
ATOM   4327 C  CA  . THR A 1 524 ? 24.003 29.124  83.370 1.00 50.18  ? 524  THR A CA  1 
ATOM   4328 C  C   . THR A 1 524 ? 23.847 30.637  83.443 1.00 51.48  ? 524  THR A C   1 
ATOM   4329 O  O   . THR A 1 524 ? 24.567 31.311  84.180 1.00 51.63  ? 524  THR A O   1 
ATOM   4330 C  CB  . THR A 1 524 ? 24.665 28.751  82.021 1.00 51.17  ? 524  THR A CB  1 
ATOM   4331 O  OG1 . THR A 1 524 ? 25.048 27.372  82.042 1.00 52.15  ? 524  THR A OG1 1 
ATOM   4332 C  CG2 . THR A 1 524 ? 25.896 29.612  81.761 1.00 52.54  ? 524  THR A CG2 1 
ATOM   4333 N  N   . ILE A 1 525 ? 22.907 31.163  82.665 1.00 52.99  ? 525  ILE A N   1 
ATOM   4334 C  CA  . ILE A 1 525 ? 22.639 32.592  82.645 1.00 54.74  ? 525  ILE A CA  1 
ATOM   4335 C  C   . ILE A 1 525 ? 22.440 33.095  84.065 1.00 56.97  ? 525  ILE A C   1 
ATOM   4336 O  O   . ILE A 1 525 ? 22.795 34.225  84.384 1.00 58.54  ? 525  ILE A O   1 
ATOM   4337 C  CB  . ILE A 1 525 ? 21.377 32.905  81.827 1.00 54.69  ? 525  ILE A CB  1 
ATOM   4338 C  CG1 . ILE A 1 525 ? 21.701 32.826  80.336 1.00 54.32  ? 525  ILE A CG1 1 
ATOM   4339 C  CG2 . ILE A 1 525 ? 20.820 34.269  82.216 1.00 54.76  ? 525  ILE A CG2 1 
ATOM   4340 C  CD1 . ILE A 1 525 ? 20.540 33.204  79.437 1.00 54.39  ? 525  ILE A CD1 1 
ATOM   4341 N  N   . LYS A 1 526 ? 21.873 32.244  84.913 1.00 58.94  ? 526  LYS A N   1 
ATOM   4342 C  CA  . LYS A 1 526 ? 21.628 32.591  86.308 1.00 60.02  ? 526  LYS A CA  1 
ATOM   4343 C  C   . LYS A 1 526 ? 22.864 32.404  87.184 1.00 60.31  ? 526  LYS A C   1 
ATOM   4344 O  O   . LYS A 1 526 ? 23.211 33.268  87.983 1.00 59.56  ? 526  LYS A O   1 
ATOM   4345 C  CB  . LYS A 1 526 ? 20.492 31.734  86.865 1.00 61.15  ? 526  LYS A CB  1 
ATOM   4346 C  CG  . LYS A 1 526 ? 20.451 31.699  88.383 1.00 61.79  ? 526  LYS A CG  1 
ATOM   4347 C  CD  . LYS A 1 526 ? 19.367 30.778  88.898 1.00 62.62  ? 526  LYS A CD  1 
ATOM   4348 C  CE  . LYS A 1 526 ? 19.533 30.566  90.386 1.00 64.06  ? 526  LYS A CE  1 
ATOM   4349 N  NZ  . LYS A 1 526 ? 20.907 30.055  90.675 1.00 65.21  ? 526  LYS A NZ  1 
ATOM   4350 N  N   . GLU A 1 527 ? 23.518 31.262  87.026 1.00 62.57  ? 527  GLU A N   1 
ATOM   4351 C  CA  . GLU A 1 527 ? 24.699 30.927  87.806 1.00 64.86  ? 527  GLU A CA  1 
ATOM   4352 C  C   . GLU A 1 527 ? 25.863 31.881  87.579 1.00 65.89  ? 527  GLU A C   1 
ATOM   4353 O  O   . GLU A 1 527 ? 26.723 32.037  88.444 1.00 65.75  ? 527  GLU A O   1 
ATOM   4354 C  CB  . GLU A 1 527 ? 25.148 29.501  87.483 1.00 66.31  ? 527  GLU A CB  1 
ATOM   4355 C  CG  . GLU A 1 527 ? 25.584 28.708  88.700 1.00 68.47  ? 527  GLU A CG  1 
ATOM   4356 C  CD  . GLU A 1 527 ? 24.432 28.439  89.649 1.00 69.86  ? 527  GLU A CD  1 
ATOM   4357 O  OE1 . GLU A 1 527 ? 23.793 29.419  90.101 1.00 70.48  ? 527  GLU A OE1 1 
ATOM   4358 O  OE2 . GLU A 1 527 ? 24.164 27.250  89.939 1.00 69.38  ? 527  GLU A OE2 1 
ATOM   4359 N  N   . ILE A 1 528 ? 25.904 32.509  86.411 1.00 67.37  ? 528  ILE A N   1 
ATOM   4360 C  CA  . ILE A 1 528 ? 26.986 33.437  86.117 1.00 69.19  ? 528  ILE A CA  1 
ATOM   4361 C  C   . ILE A 1 528 ? 26.703 34.760  86.812 1.00 71.98  ? 528  ILE A C   1 
ATOM   4362 O  O   . ILE A 1 528 ? 27.618 35.426  87.307 1.00 73.71  ? 528  ILE A O   1 
ATOM   4363 C  CB  . ILE A 1 528 ? 27.120 33.701  84.605 1.00 67.55  ? 528  ILE A CB  1 
ATOM   4364 C  CG1 . ILE A 1 528 ? 28.410 34.473  84.333 1.00 64.22  ? 528  ILE A CG1 1 
ATOM   4365 C  CG2 . ILE A 1 528 ? 25.908 34.490  84.098 1.00 66.11  ? 528  ILE A CG2 1 
ATOM   4366 C  CD1 . ILE A 1 528 ? 28.703 34.648  82.878 1.00 63.01  ? 528  ILE A CD1 1 
ATOM   4367 N  N   . GLU A 1 529 ? 25.427 35.132  86.853 1.00 73.16  ? 529  GLU A N   1 
ATOM   4368 C  CA  . GLU A 1 529 ? 25.026 36.383  87.480 1.00 72.95  ? 529  GLU A CA  1 
ATOM   4369 C  C   . GLU A 1 529 ? 25.193 36.392  88.998 1.00 72.42  ? 529  GLU A C   1 
ATOM   4370 O  O   . GLU A 1 529 ? 26.123 37.014  89.520 1.00 72.40  ? 529  GLU A O   1 
ATOM   4371 C  CB  . GLU A 1 529 ? 23.573 36.713  87.142 1.00 72.64  ? 529  GLU A CB  1 
ATOM   4372 C  CG  . GLU A 1 529 ? 23.283 36.879  85.670 1.00 71.43  ? 529  GLU A CG  1 
ATOM   4373 C  CD  . GLU A 1 529 ? 21.939 37.536  85.441 1.00 72.25  ? 529  GLU A CD  1 
ATOM   4374 O  OE1 . GLU A 1 529 ? 20.956 37.103  86.085 1.00 71.94  ? 529  GLU A OE1 1 
ATOM   4375 O  OE2 . GLU A 1 529 ? 21.866 38.480  84.623 1.00 71.95  ? 529  GLU A OE2 1 
ATOM   4376 N  N   . GLU A 1 530 ? 24.307 35.698  89.706 1.00 70.62  ? 530  GLU A N   1 
ATOM   4377 C  CA  . GLU A 1 530 ? 24.375 35.708  91.154 1.00 70.52  ? 530  GLU A CA  1 
ATOM   4378 C  C   . GLU A 1 530 ? 25.687 35.269  91.790 1.00 69.49  ? 530  GLU A C   1 
ATOM   4379 O  O   . GLU A 1 530 ? 25.932 35.567  92.960 1.00 69.96  ? 530  GLU A O   1 
ATOM   4380 C  CB  . GLU A 1 530 ? 23.192 34.938  91.754 1.00 72.15  ? 530  GLU A CB  1 
ATOM   4381 C  CG  . GLU A 1 530 ? 22.803 33.638  91.085 1.00 73.74  ? 530  GLU A CG  1 
ATOM   4382 C  CD  . GLU A 1 530 ? 21.432 33.152  91.559 1.00 74.83  ? 530  GLU A CD  1 
ATOM   4383 O  OE1 . GLU A 1 530 ? 20.406 33.761  91.171 1.00 73.93  ? 530  GLU A OE1 1 
ATOM   4384 O  OE2 . GLU A 1 530 ? 21.384 32.168  92.330 1.00 75.33  ? 530  GLU A OE2 1 
ATOM   4385 N  N   . LYS A 1 531 ? 26.551 34.604  91.032 1.00 67.83  ? 531  LYS A N   1 
ATOM   4386 C  CA  . LYS A 1 531 ? 27.821 34.170  91.596 1.00 65.86  ? 531  LYS A CA  1 
ATOM   4387 C  C   . LYS A 1 531 ? 29.063 34.787  90.969 1.00 64.65  ? 531  LYS A C   1 
ATOM   4388 O  O   . LYS A 1 531 ? 30.169 34.581  91.463 1.00 63.94  ? 531  LYS A O   1 
ATOM   4389 C  CB  . LYS A 1 531 ? 27.915 32.646  91.559 1.00 66.48  ? 531  LYS A CB  1 
ATOM   4390 C  CG  . LYS A 1 531 ? 27.000 31.962  92.572 1.00 67.68  ? 531  LYS A CG  1 
ATOM   4391 C  CD  . LYS A 1 531 ? 27.075 30.446  92.472 1.00 68.07  ? 531  LYS A CD  1 
ATOM   4392 C  CE  . LYS A 1 531 ? 26.185 29.785  93.511 1.00 68.63  ? 531  LYS A CE  1 
ATOM   4393 N  NZ  . LYS A 1 531 ? 24.757 30.208  93.382 1.00 68.22  ? 531  LYS A NZ  1 
ATOM   4394 N  N   . TYR A 1 532 ? 28.892 35.543  89.889 1.00 63.59  ? 532  TYR A N   1 
ATOM   4395 C  CA  . TYR A 1 532 ? 30.034 36.175  89.237 1.00 63.24  ? 532  TYR A CA  1 
ATOM   4396 C  C   . TYR A 1 532 ? 29.763 37.588  88.747 1.00 63.10  ? 532  TYR A C   1 
ATOM   4397 O  O   . TYR A 1 532 ? 30.424 38.082  87.832 1.00 63.92  ? 532  TYR A O   1 
ATOM   4398 C  CB  . TYR A 1 532 ? 30.540 35.324  88.072 1.00 63.60  ? 532  TYR A CB  1 
ATOM   4399 C  CG  . TYR A 1 532 ? 31.307 34.104  88.512 1.00 64.58  ? 532  TYR A CG  1 
ATOM   4400 C  CD1 . TYR A 1 532 ? 30.645 32.986  89.011 1.00 63.65  ? 532  TYR A CD1 1 
ATOM   4401 C  CD2 . TYR A 1 532 ? 32.702 34.071  88.444 1.00 64.83  ? 532  TYR A CD2 1 
ATOM   4402 C  CE1 . TYR A 1 532 ? 31.345 31.867  89.427 1.00 63.69  ? 532  TYR A CE1 1 
ATOM   4403 C  CE2 . TYR A 1 532 ? 33.414 32.951  88.859 1.00 64.62  ? 532  TYR A CE2 1 
ATOM   4404 C  CZ  . TYR A 1 532 ? 32.724 31.852  89.348 1.00 64.09  ? 532  TYR A CZ  1 
ATOM   4405 O  OH  . TYR A 1 532 ? 33.405 30.728  89.748 1.00 65.15  ? 532  TYR A OH  1 
ATOM   4406 N  N   . GLY A 1 533 ? 28.786 38.238  89.362 1.00 62.12  ? 533  GLY A N   1 
ATOM   4407 C  CA  . GLY A 1 533 ? 28.462 39.604  88.999 1.00 60.13  ? 533  GLY A CA  1 
ATOM   4408 C  C   . GLY A 1 533 ? 28.360 39.951  87.525 1.00 58.87  ? 533  GLY A C   1 
ATOM   4409 O  O   . GLY A 1 533 ? 28.705 41.067  87.128 1.00 59.33  ? 533  GLY A O   1 
ATOM   4410 N  N   . PHE A 1 534 ? 27.897 39.019  86.703 1.00 56.87  ? 534  PHE A N   1 
ATOM   4411 C  CA  . PHE A 1 534 ? 27.741 39.328  85.291 1.00 55.37  ? 534  PHE A CA  1 
ATOM   4412 C  C   . PHE A 1 534 ? 26.296 39.710  84.998 1.00 54.08  ? 534  PHE A C   1 
ATOM   4413 O  O   . PHE A 1 534 ? 25.375 39.284  85.694 1.00 53.38  ? 534  PHE A O   1 
ATOM   4414 C  CB  . PHE A 1 534 ? 28.131 38.143  84.413 1.00 55.46  ? 534  PHE A CB  1 
ATOM   4415 C  CG  . PHE A 1 534 ? 29.603 38.021  84.163 1.00 54.21  ? 534  PHE A CG  1 
ATOM   4416 C  CD1 . PHE A 1 534 ? 30.409 37.278  85.015 1.00 54.69  ? 534  PHE A CD1 1 
ATOM   4417 C  CD2 . PHE A 1 534 ? 30.176 38.617  83.048 1.00 53.71  ? 534  PHE A CD2 1 
ATOM   4418 C  CE1 . PHE A 1 534 ? 31.767 37.116  84.750 1.00 54.79  ? 534  PHE A CE1 1 
ATOM   4419 C  CE2 . PHE A 1 534 ? 31.527 38.464  82.773 1.00 53.78  ? 534  PHE A CE2 1 
ATOM   4420 C  CZ  . PHE A 1 534 ? 32.327 37.713  83.626 1.00 54.36  ? 534  PHE A CZ  1 
ATOM   4421 N  N   . LYS A 1 535 ? 26.115 40.526  83.967 1.00 52.12  ? 535  LYS A N   1 
ATOM   4422 C  CA  . LYS A 1 535 ? 24.797 40.969  83.543 1.00 50.86  ? 535  LYS A CA  1 
ATOM   4423 C  C   . LYS A 1 535 ? 24.566 40.441  82.129 1.00 52.39  ? 535  LYS A C   1 
ATOM   4424 O  O   . LYS A 1 535 ? 25.046 41.023  81.151 1.00 53.30  ? 535  LYS A O   1 
ATOM   4425 C  CB  . LYS A 1 535 ? 24.739 42.496  83.555 1.00 50.06  ? 535  LYS A CB  1 
ATOM   4426 C  CG  . LYS A 1 535 ? 23.580 43.103  82.781 1.00 51.17  ? 535  LYS A CG  1 
ATOM   4427 C  CD  . LYS A 1 535 ? 22.231 42.675  83.335 1.00 52.24  ? 535  LYS A CD  1 
ATOM   4428 C  CE  . LYS A 1 535 ? 21.082 43.214  82.484 1.00 53.04  ? 535  LYS A CE  1 
ATOM   4429 N  NZ  . LYS A 1 535 ? 19.753 42.674  82.901 1.00 52.63  ? 535  LYS A NZ  1 
ATOM   4430 N  N   . VAL A 1 536 ? 23.848 39.327  82.017 1.00 51.33  ? 536  VAL A N   1 
ATOM   4431 C  CA  . VAL A 1 536 ? 23.581 38.744  80.713 1.00 50.51  ? 536  VAL A CA  1 
ATOM   4432 C  C   . VAL A 1 536 ? 22.993 39.783  79.781 1.00 52.01  ? 536  VAL A C   1 
ATOM   4433 O  O   . VAL A 1 536 ? 21.896 40.283  80.008 1.00 51.11  ? 536  VAL A O   1 
ATOM   4434 C  CB  . VAL A 1 536 ? 22.609 37.564  80.814 1.00 48.84  ? 536  VAL A CB  1 
ATOM   4435 C  CG1 . VAL A 1 536 ? 22.349 36.972  79.430 1.00 46.47  ? 536  VAL A CG1 1 
ATOM   4436 C  CG2 . VAL A 1 536 ? 23.190 36.521  81.734 1.00 48.41  ? 536  VAL A CG2 1 
ATOM   4437 N  N   . ILE A 1 537 ? 23.738 40.111  78.731 1.00 54.76  ? 537  ILE A N   1 
ATOM   4438 C  CA  . ILE A 1 537 ? 23.280 41.096  77.763 1.00 57.08  ? 537  ILE A CA  1 
ATOM   4439 C  C   . ILE A 1 537 ? 22.195 40.465  76.909 1.00 57.44  ? 537  ILE A C   1 
ATOM   4440 O  O   . ILE A 1 537 ? 21.014 40.582  77.212 1.00 58.88  ? 537  ILE A O   1 
ATOM   4441 C  CB  . ILE A 1 537 ? 24.421 41.572  76.818 1.00 58.51  ? 537  ILE A CB  1 
ATOM   4442 C  CG1 . ILE A 1 537 ? 25.701 41.859  77.613 1.00 59.54  ? 537  ILE A CG1 1 
ATOM   4443 C  CG2 . ILE A 1 537 ? 23.977 42.818  76.069 1.00 56.89  ? 537  ILE A CG2 1 
ATOM   4444 C  CD1 . ILE A 1 537 ? 25.515 42.828  78.757 1.00 62.32  ? 537  ILE A CD1 1 
ATOM   4445 N  N   . TYR A 1 538 ? 22.615 39.784  75.849 1.00 57.76  ? 538  TYR A N   1 
ATOM   4446 C  CA  . TYR A 1 538 ? 21.704 39.134  74.920 1.00 57.28  ? 538  TYR A CA  1 
ATOM   4447 C  C   . TYR A 1 538 ? 21.837 37.628  75.018 1.00 56.01  ? 538  TYR A C   1 
ATOM   4448 O  O   . TYR A 1 538 ? 22.839 37.117  75.505 1.00 56.00  ? 538  TYR A O   1 
ATOM   4449 C  CB  . TYR A 1 538 ? 22.022 39.599  73.502 1.00 60.24  ? 538  TYR A CB  1 
ATOM   4450 C  CG  . TYR A 1 538 ? 21.355 38.818  72.393 1.00 64.32  ? 538  TYR A CG  1 
ATOM   4451 C  CD1 . TYR A 1 538 ? 19.975 38.614  72.381 1.00 65.66  ? 538  TYR A CD1 1 
ATOM   4452 C  CD2 . TYR A 1 538 ? 22.103 38.331  71.319 1.00 66.09  ? 538  TYR A CD2 1 
ATOM   4453 C  CE1 . TYR A 1 538 ? 19.358 37.946  71.321 1.00 67.41  ? 538  TYR A CE1 1 
ATOM   4454 C  CE2 . TYR A 1 538 ? 21.497 37.669  70.257 1.00 67.00  ? 538  TYR A CE2 1 
ATOM   4455 C  CZ  . TYR A 1 538 ? 20.129 37.480  70.262 1.00 67.72  ? 538  TYR A CZ  1 
ATOM   4456 O  OH  . TYR A 1 538 ? 19.534 36.835  69.203 1.00 69.23  ? 538  TYR A OH  1 
ATOM   4457 N  N   . SER A 1 539 ? 20.821 36.915  74.555 1.00 55.13  ? 539  SER A N   1 
ATOM   4458 C  CA  . SER A 1 539 ? 20.863 35.468  74.605 1.00 54.93  ? 539  SER A CA  1 
ATOM   4459 C  C   . SER A 1 539 ? 19.945 34.794  73.595 1.00 54.83  ? 539  SER A C   1 
ATOM   4460 O  O   . SER A 1 539 ? 18.870 35.288  73.263 1.00 54.70  ? 539  SER A O   1 
ATOM   4461 C  CB  . SER A 1 539 ? 20.525 34.987  76.011 1.00 55.29  ? 539  SER A CB  1 
ATOM   4462 O  OG  . SER A 1 539 ? 20.753 33.597  76.120 1.00 55.62  ? 539  SER A OG  1 
ATOM   4463 N  N   . ASP A 1 540 ? 20.398 33.649  73.113 1.00 55.29  ? 540  ASP A N   1 
ATOM   4464 C  CA  . ASP A 1 540 ? 19.673 32.863  72.133 1.00 55.81  ? 540  ASP A CA  1 
ATOM   4465 C  C   . ASP A 1 540 ? 20.241 31.459  72.319 1.00 56.64  ? 540  ASP A C   1 
ATOM   4466 O  O   . ASP A 1 540 ? 21.383 31.309  72.763 1.00 57.64  ? 540  ASP A O   1 
ATOM   4467 C  CB  . ASP A 1 540 ? 19.978 33.400  70.729 1.00 56.27  ? 540  ASP A CB  1 
ATOM   4468 C  CG  . ASP A 1 540 ? 19.081 32.810  69.650 1.00 57.17  ? 540  ASP A CG  1 
ATOM   4469 O  OD1 . ASP A 1 540 ? 19.183 33.260  68.488 1.00 56.94  ? 540  ASP A OD1 1 
ATOM   4470 O  OD2 . ASP A 1 540 ? 18.280 31.901  69.948 1.00 58.91  ? 540  ASP A OD2 1 
ATOM   4471 N  N   . THR A 1 541 ? 19.440 30.442  72.016 1.00 56.05  ? 541  THR A N   1 
ATOM   4472 C  CA  . THR A 1 541 ? 19.858 29.049  72.148 1.00 55.27  ? 541  THR A CA  1 
ATOM   4473 C  C   . THR A 1 541 ? 21.331 28.963  71.755 1.00 56.04  ? 541  THR A C   1 
ATOM   4474 O  O   . THR A 1 541 ? 21.780 29.737  70.909 1.00 58.18  ? 541  THR A O   1 
ATOM   4475 C  CB  . THR A 1 541 ? 19.019 28.142  71.211 1.00 54.85  ? 541  THR A CB  1 
ATOM   4476 O  OG1 . THR A 1 541 ? 19.681 27.990  69.950 1.00 55.15  ? 541  THR A OG1 1 
ATOM   4477 C  CG2 . THR A 1 541 ? 17.656 28.777  70.947 1.00 54.17  ? 541  THR A CG2 1 
ATOM   4478 N  N   . ASP A 1 542 ? 22.081 28.050  72.369 1.00 54.60  ? 542  ASP A N   1 
ATOM   4479 C  CA  . ASP A 1 542 ? 23.503 27.882  72.060 1.00 54.03  ? 542  ASP A CA  1 
ATOM   4480 C  C   . ASP A 1 542 ? 24.402 28.699  72.992 1.00 52.55  ? 542  ASP A C   1 
ATOM   4481 O  O   . ASP A 1 542 ? 25.151 28.135  73.787 1.00 52.60  ? 542  ASP A O   1 
ATOM   4482 C  CB  . ASP A 1 542 ? 23.777 28.251  70.585 1.00 55.94  ? 542  ASP A CB  1 
ATOM   4483 C  CG  . ASP A 1 542 ? 25.267 28.296  70.236 1.00 60.32  ? 542  ASP A CG  1 
ATOM   4484 O  OD1 . ASP A 1 542 ? 25.906 27.218  70.163 1.00 61.28  ? 542  ASP A OD1 1 
ATOM   4485 O  OD2 . ASP A 1 542 ? 25.798 29.419  70.027 1.00 60.96  ? 542  ASP A OD2 1 
ATOM   4486 N  N   . GLY A 1 543 ? 24.327 30.021  72.907 1.00 51.62  ? 543  GLY A N   1 
ATOM   4487 C  CA  . GLY A 1 543 ? 25.170 30.845  73.755 1.00 50.28  ? 543  GLY A CA  1 
ATOM   4488 C  C   . GLY A 1 543 ? 24.560 32.167  74.176 1.00 49.79  ? 543  GLY A C   1 
ATOM   4489 O  O   . GLY A 1 543 ? 23.339 32.323  74.181 1.00 49.50  ? 543  GLY A O   1 
ATOM   4490 N  N   . PHE A 1 544 ? 25.411 33.126  74.532 1.00 48.97  ? 544  PHE A N   1 
ATOM   4491 C  CA  . PHE A 1 544 ? 24.927 34.430  74.956 1.00 48.90  ? 544  PHE A CA  1 
ATOM   4492 C  C   . PHE A 1 544 ? 26.041 35.447  75.206 1.00 49.55  ? 544  PHE A C   1 
ATOM   4493 O  O   . PHE A 1 544 ? 27.221 35.097  75.278 1.00 48.27  ? 544  PHE A O   1 
ATOM   4494 C  CB  . PHE A 1 544 ? 24.081 34.266  76.219 1.00 47.99  ? 544  PHE A CB  1 
ATOM   4495 C  CG  . PHE A 1 544 ? 24.858 33.801  77.422 1.00 48.05  ? 544  PHE A CG  1 
ATOM   4496 C  CD1 . PHE A 1 544 ? 25.470 34.722  78.277 1.00 49.05  ? 544  PHE A CD1 1 
ATOM   4497 C  CD2 . PHE A 1 544 ? 24.956 32.449  77.724 1.00 47.05  ? 544  PHE A CD2 1 
ATOM   4498 C  CE1 . PHE A 1 544 ? 26.167 34.301  79.423 1.00 48.18  ? 544  PHE A CE1 1 
ATOM   4499 C  CE2 . PHE A 1 544 ? 25.649 32.017  78.866 1.00 47.92  ? 544  PHE A CE2 1 
ATOM   4500 C  CZ  . PHE A 1 544 ? 26.253 32.947  79.717 1.00 48.82  ? 544  PHE A CZ  1 
ATOM   4501 N  N   . PHE A 1 545 ? 25.648 36.713  75.329 1.00 50.80  ? 545  PHE A N   1 
ATOM   4502 C  CA  . PHE A 1 545 ? 26.584 37.799  75.593 1.00 51.84  ? 545  PHE A CA  1 
ATOM   4503 C  C   . PHE A 1 545 ? 26.432 38.258  77.042 1.00 52.93  ? 545  PHE A C   1 
ATOM   4504 O  O   . PHE A 1 545 ? 25.348 38.164  77.619 1.00 52.27  ? 545  PHE A O   1 
ATOM   4505 C  CB  . PHE A 1 545 ? 26.312 38.983  74.671 1.00 51.74  ? 545  PHE A CB  1 
ATOM   4506 C  CG  . PHE A 1 545 ? 26.391 38.652  73.218 1.00 53.20  ? 545  PHE A CG  1 
ATOM   4507 C  CD1 . PHE A 1 545 ? 25.316 38.059  72.567 1.00 54.44  ? 545  PHE A CD1 1 
ATOM   4508 C  CD2 . PHE A 1 545 ? 27.539 38.950  72.488 1.00 54.41  ? 545  PHE A CD2 1 
ATOM   4509 C  CE1 . PHE A 1 545 ? 25.379 37.769  71.198 1.00 55.93  ? 545  PHE A CE1 1 
ATOM   4510 C  CE2 . PHE A 1 545 ? 27.617 38.666  71.120 1.00 55.76  ? 545  PHE A CE2 1 
ATOM   4511 C  CZ  . PHE A 1 545 ? 26.534 38.074  70.471 1.00 56.11  ? 545  PHE A CZ  1 
ATOM   4512 N  N   . ALA A 1 546 ? 27.517 38.758  77.625 1.00 54.19  ? 546  ALA A N   1 
ATOM   4513 C  CA  . ALA A 1 546 ? 27.486 39.230  79.002 1.00 55.98  ? 546  ALA A CA  1 
ATOM   4514 C  C   . ALA A 1 546 ? 28.719 40.058  79.367 1.00 57.90  ? 546  ALA A C   1 
ATOM   4515 O  O   . ALA A 1 546 ? 29.714 40.063  78.641 1.00 58.85  ? 546  ALA A O   1 
ATOM   4516 C  CB  . ALA A 1 546 ? 27.359 38.049  79.939 1.00 55.41  ? 546  ALA A CB  1 
ATOM   4517 N  N   . THR A 1 547 ? 28.636 40.764  80.494 1.00 59.44  ? 547  THR A N   1 
ATOM   4518 C  CA  . THR A 1 547 ? 29.731 41.599  80.996 1.00 60.40  ? 547  THR A CA  1 
ATOM   4519 C  C   . THR A 1 547 ? 29.446 42.039  82.436 1.00 61.74  ? 547  THR A C   1 
ATOM   4520 O  O   . THR A 1 547 ? 28.341 41.844  82.952 1.00 61.78  ? 547  THR A O   1 
ATOM   4521 C  CB  . THR A 1 547 ? 29.941 42.869  80.121 1.00 59.73  ? 547  THR A CB  1 
ATOM   4522 O  OG1 . THR A 1 547 ? 31.047 43.626  80.632 1.00 59.70  ? 547  THR A OG1 1 
ATOM   4523 C  CG2 . THR A 1 547 ? 28.698 43.744  80.127 1.00 58.40  ? 547  THR A CG2 1 
ATOM   4524 N  N   . ILE A 1 548 ? 30.450 42.617  83.085 1.00 62.42  ? 548  ILE A N   1 
ATOM   4525 C  CA  . ILE A 1 548 ? 30.297 43.092  84.452 1.00 63.24  ? 548  ILE A CA  1 
ATOM   4526 C  C   . ILE A 1 548 ? 30.342 44.610  84.394 1.00 65.69  ? 548  ILE A C   1 
ATOM   4527 O  O   . ILE A 1 548 ? 31.414 45.200  84.314 1.00 66.16  ? 548  ILE A O   1 
ATOM   4528 C  CB  . ILE A 1 548 ? 31.436 42.593  85.341 1.00 61.24  ? 548  ILE A CB  1 
ATOM   4529 C  CG1 . ILE A 1 548 ? 31.589 41.086  85.174 1.00 59.50  ? 548  ILE A CG1 1 
ATOM   4530 C  CG2 . ILE A 1 548 ? 31.145 42.931  86.789 1.00 60.80  ? 548  ILE A CG2 1 
ATOM   4531 C  CD1 . ILE A 1 548 ? 32.785 40.533  85.868 1.00 58.97  ? 548  ILE A CD1 1 
ATOM   4532 N  N   . PRO A 1 549 ? 29.170 45.262  84.434 1.00 68.35  ? 549  PRO A N   1 
ATOM   4533 C  CA  . PRO A 1 549 ? 29.066 46.724  84.379 1.00 69.86  ? 549  PRO A CA  1 
ATOM   4534 C  C   . PRO A 1 549 ? 30.249 47.444  85.020 1.00 70.64  ? 549  PRO A C   1 
ATOM   4535 O  O   . PRO A 1 549 ? 30.565 47.224  86.191 1.00 70.49  ? 549  PRO A O   1 
ATOM   4536 C  CB  . PRO A 1 549 ? 27.749 46.995  85.098 1.00 70.05  ? 549  PRO A CB  1 
ATOM   4537 C  CG  . PRO A 1 549 ? 26.918 45.835  84.664 1.00 69.64  ? 549  PRO A CG  1 
ATOM   4538 C  CD  . PRO A 1 549 ? 27.881 44.670  84.835 1.00 69.31  ? 549  PRO A CD  1 
ATOM   4539 N  N   . GLY A 1 550 ? 30.898 48.302  84.242 1.00 71.03  ? 550  GLY A N   1 
ATOM   4540 C  CA  . GLY A 1 550 ? 32.041 49.024  84.754 1.00 73.32  ? 550  GLY A CA  1 
ATOM   4541 C  C   . GLY A 1 550 ? 33.105 48.049  85.213 1.00 75.66  ? 550  GLY A C   1 
ATOM   4542 O  O   . GLY A 1 550 ? 33.130 47.631  86.371 1.00 75.30  ? 550  GLY A O   1 
ATOM   4543 N  N   . ALA A 1 551 ? 33.985 47.672  84.296 1.00 77.78  ? 551  ALA A N   1 
ATOM   4544 C  CA  . ALA A 1 551 ? 35.055 46.744  84.619 1.00 80.16  ? 551  ALA A CA  1 
ATOM   4545 C  C   . ALA A 1 551 ? 36.018 46.695  83.454 1.00 81.91  ? 551  ALA A C   1 
ATOM   4546 O  O   . ALA A 1 551 ? 35.606 46.531  82.309 1.00 81.55  ? 551  ALA A O   1 
ATOM   4547 C  CB  . ALA A 1 551 ? 34.487 45.363  84.887 1.00 80.64  ? 551  ALA A CB  1 
ATOM   4548 N  N   . ASP A 1 552 ? 37.302 46.842  83.755 1.00 84.22  ? 552  ASP A N   1 
ATOM   4549 C  CA  . ASP A 1 552 ? 38.329 46.824  82.727 1.00 86.74  ? 552  ASP A CA  1 
ATOM   4550 C  C   . ASP A 1 552 ? 38.187 45.587  81.860 1.00 87.25  ? 552  ASP A C   1 
ATOM   4551 O  O   . ASP A 1 552 ? 37.753 44.534  82.331 1.00 86.47  ? 552  ASP A O   1 
ATOM   4552 C  CB  . ASP A 1 552 ? 39.719 46.844  83.362 1.00 88.53  ? 552  ASP A CB  1 
ATOM   4553 C  CG  . ASP A 1 552 ? 39.887 47.976  84.354 1.00 90.44  ? 552  ASP A CG  1 
ATOM   4554 O  OD1 . ASP A 1 552 ? 39.664 49.146  83.964 1.00 90.78  ? 552  ASP A OD1 1 
ATOM   4555 O  OD2 . ASP A 1 552 ? 40.244 47.694  85.522 1.00 91.30  ? 552  ASP A OD2 1 
ATOM   4556 N  N   . ALA A 1 553 ? 38.559 45.724  80.592 1.00 88.31  ? 553  ALA A N   1 
ATOM   4557 C  CA  . ALA A 1 553 ? 38.484 44.624  79.644 1.00 89.02  ? 553  ALA A CA  1 
ATOM   4558 C  C   . ALA A 1 553 ? 39.287 43.423  80.136 1.00 89.75  ? 553  ALA A C   1 
ATOM   4559 O  O   . ALA A 1 553 ? 39.263 42.360  79.517 1.00 90.41  ? 553  ALA A O   1 
ATOM   4560 C  CB  . ALA A 1 553 ? 38.998 45.074  78.285 1.00 88.62  ? 553  ALA A CB  1 
ATOM   4561 N  N   . GLU A 1 554 ? 39.995 43.595  81.249 1.00 89.69  ? 554  GLU A N   1 
ATOM   4562 C  CA  . GLU A 1 554 ? 40.799 42.518  81.808 1.00 89.33  ? 554  GLU A CA  1 
ATOM   4563 C  C   . GLU A 1 554 ? 40.019 41.821  82.914 1.00 88.85  ? 554  GLU A C   1 
ATOM   4564 O  O   . GLU A 1 554 ? 39.928 40.594  82.942 1.00 88.71  ? 554  GLU A O   1 
ATOM   4565 C  CB  . GLU A 1 554 ? 42.117 43.069  82.367 1.00 90.33  ? 554  GLU A CB  1 
ATOM   4566 C  CG  . GLU A 1 554 ? 43.222 42.017  82.493 1.00 91.68  ? 554  GLU A CG  1 
ATOM   4567 C  CD  . GLU A 1 554 ? 44.497 42.551  83.131 1.00 91.93  ? 554  GLU A CD  1 
ATOM   4568 O  OE1 . GLU A 1 554 ? 44.997 43.611  82.691 1.00 92.41  ? 554  GLU A OE1 1 
ATOM   4569 O  OE2 . GLU A 1 554 ? 45.006 41.899  84.069 1.00 91.74  ? 554  GLU A OE2 1 
ATOM   4570 N  N   . THR A 1 555 ? 39.458 42.618  83.820 1.00 88.22  ? 555  THR A N   1 
ATOM   4571 C  CA  . THR A 1 555 ? 38.682 42.096  84.942 1.00 87.13  ? 555  THR A CA  1 
ATOM   4572 C  C   . THR A 1 555 ? 37.563 41.198  84.441 1.00 86.66  ? 555  THR A C   1 
ATOM   4573 O  O   . THR A 1 555 ? 37.318 40.115  84.981 1.00 86.29  ? 555  THR A O   1 
ATOM   4574 C  CB  . THR A 1 555 ? 38.063 43.236  85.755 1.00 86.66  ? 555  THR A CB  1 
ATOM   4575 O  OG1 . THR A 1 555 ? 39.087 44.169  86.117 1.00 88.03  ? 555  THR A OG1 1 
ATOM   4576 C  CG2 . THR A 1 555 ? 37.415 42.694  87.012 1.00 86.79  ? 555  THR A CG2 1 
ATOM   4577 N  N   . VAL A 1 556 ? 36.881 41.662  83.402 1.00 85.97  ? 556  VAL A N   1 
ATOM   4578 C  CA  . VAL A 1 556 ? 35.795 40.903  82.816 1.00 84.48  ? 556  VAL A CA  1 
ATOM   4579 C  C   . VAL A 1 556 ? 36.363 39.566  82.343 1.00 83.96  ? 556  VAL A C   1 
ATOM   4580 O  O   . VAL A 1 556 ? 35.884 38.508  82.747 1.00 84.46  ? 556  VAL A O   1 
ATOM   4581 C  CB  . VAL A 1 556 ? 35.159 41.680  81.631 1.00 84.14  ? 556  VAL A CB  1 
ATOM   4582 C  CG1 . VAL A 1 556 ? 36.180 41.899  80.534 1.00 83.96  ? 556  VAL A CG1 1 
ATOM   4583 C  CG2 . VAL A 1 556 ? 33.955 40.935  81.102 1.00 84.36  ? 556  VAL A CG2 1 
ATOM   4584 N  N   . LYS A 1 557 ? 37.408 39.620  81.519 1.00 82.68  ? 557  LYS A N   1 
ATOM   4585 C  CA  . LYS A 1 557 ? 38.039 38.412  80.987 1.00 80.72  ? 557  LYS A CA  1 
ATOM   4586 C  C   . LYS A 1 557 ? 38.562 37.502  82.088 1.00 79.23  ? 557  LYS A C   1 
ATOM   4587 O  O   . LYS A 1 557 ? 38.358 36.292  82.048 1.00 78.99  ? 557  LYS A O   1 
ATOM   4588 C  CB  . LYS A 1 557 ? 39.195 38.776  80.051 1.00 80.36  ? 557  LYS A CB  1 
ATOM   4589 C  CG  . LYS A 1 557 ? 38.799 39.559  78.809 1.00 79.40  ? 557  LYS A CG  1 
ATOM   4590 C  CD  . LYS A 1 557 ? 40.040 39.920  78.008 1.00 79.79  ? 557  LYS A CD  1 
ATOM   4591 C  CE  . LYS A 1 557 ? 39.744 40.955  76.941 1.00 79.48  ? 557  LYS A CE  1 
ATOM   4592 N  NZ  . LYS A 1 557 ? 40.997 41.436  76.296 1.00 79.45  ? 557  LYS A NZ  1 
ATOM   4593 N  N   . LYS A 1 558 ? 39.245 38.087  83.065 1.00 77.83  ? 558  LYS A N   1 
ATOM   4594 C  CA  . LYS A 1 558 ? 39.793 37.320  84.174 1.00 76.80  ? 558  LYS A CA  1 
ATOM   4595 C  C   . LYS A 1 558 ? 38.667 36.620  84.923 1.00 76.07  ? 558  LYS A C   1 
ATOM   4596 O  O   . LYS A 1 558 ? 38.776 35.443  85.270 1.00 75.61  ? 558  LYS A O   1 
ATOM   4597 C  CB  . LYS A 1 558 ? 40.562 38.242  85.118 1.00 76.83  ? 558  LYS A CB  1 
ATOM   4598 N  N   . LYS A 1 559 ? 37.583 37.355  85.160 1.00 75.28  ? 559  LYS A N   1 
ATOM   4599 C  CA  . LYS A 1 559 ? 36.421 36.829  85.865 1.00 74.83  ? 559  LYS A CA  1 
ATOM   4600 C  C   . LYS A 1 559 ? 35.663 35.829  84.994 1.00 74.86  ? 559  LYS A C   1 
ATOM   4601 O  O   . LYS A 1 559 ? 34.998 34.922  85.495 1.00 73.92  ? 559  LYS A O   1 
ATOM   4602 C  CB  . LYS A 1 559 ? 35.509 37.974  86.265 1.00 73.84  ? 559  LYS A CB  1 
ATOM   4603 N  N   . ALA A 1 560 ? 35.776 36.004  83.683 1.00 76.01  ? 560  ALA A N   1 
ATOM   4604 C  CA  . ALA A 1 560 ? 35.113 35.136  82.717 1.00 76.62  ? 560  ALA A CA  1 
ATOM   4605 C  C   . ALA A 1 560 ? 35.655 33.716  82.783 1.00 77.16  ? 560  ALA A C   1 
ATOM   4606 O  O   . ALA A 1 560 ? 34.973 32.805  83.242 1.00 76.92  ? 560  ALA A O   1 
ATOM   4607 C  CB  . ALA A 1 560 ? 35.294 35.694  81.312 1.00 76.69  ? 560  ALA A CB  1 
ATOM   4608 N  N   . MET A 1 561 ? 36.884 33.536  82.312 1.00 79.13  ? 561  MET A N   1 
ATOM   4609 C  CA  . MET A 1 561 ? 37.531 32.229  82.315 1.00 81.11  ? 561  MET A CA  1 
ATOM   4610 C  C   . MET A 1 561 ? 37.288 31.483  83.625 1.00 82.75  ? 561  MET A C   1 
ATOM   4611 O  O   . MET A 1 561 ? 37.304 30.248  83.662 1.00 83.44  ? 561  MET A O   1 
ATOM   4612 C  CB  . MET A 1 561 ? 39.036 32.384  82.083 1.00 80.99  ? 561  MET A CB  1 
ATOM   4613 C  CG  . MET A 1 561 ? 39.388 32.868  80.692 1.00 81.53  ? 561  MET A CG  1 
ATOM   4614 S  SD  . MET A 1 561 ? 38.768 31.733  79.446 1.00 81.17  ? 561  MET A SD  1 
ATOM   4615 C  CE  . MET A 1 561 ? 40.213 30.662  79.216 1.00 81.47  ? 561  MET A CE  1 
ATOM   4616 N  N   . GLU A 1 562 ? 37.067 32.236  84.701 1.00 83.24  ? 562  GLU A N   1 
ATOM   4617 C  CA  . GLU A 1 562 ? 36.809 31.631  85.999 1.00 83.15  ? 562  GLU A CA  1 
ATOM   4618 C  C   . GLU A 1 562 ? 35.483 30.886  85.953 1.00 81.37  ? 562  GLU A C   1 
ATOM   4619 O  O   . GLU A 1 562 ? 35.435 29.681  86.199 1.00 82.43  ? 562  GLU A O   1 
ATOM   4620 C  CB  . GLU A 1 562 ? 36.774 32.703  87.092 1.00 85.63  ? 562  GLU A CB  1 
ATOM   4621 C  CG  . GLU A 1 562 ? 38.117 33.377  87.329 1.00 88.74  ? 562  GLU A CG  1 
ATOM   4622 C  CD  . GLU A 1 562 ? 38.086 34.350  88.492 1.00 90.39  ? 562  GLU A CD  1 
ATOM   4623 O  OE1 . GLU A 1 562 ? 37.351 35.359  88.413 1.00 91.42  ? 562  GLU A OE1 1 
ATOM   4624 O  OE2 . GLU A 1 562 ? 38.796 34.102  89.489 1.00 91.90  ? 562  GLU A OE2 1 
ATOM   4625 N  N   . PHE A 1 563 ? 34.413 31.606  85.626 1.00 78.48  ? 563  PHE A N   1 
ATOM   4626 C  CA  . PHE A 1 563 ? 33.087 31.007  85.544 1.00 75.52  ? 563  PHE A CA  1 
ATOM   4627 C  C   . PHE A 1 563 ? 33.129 29.697  84.771 1.00 74.17  ? 563  PHE A C   1 
ATOM   4628 O  O   . PHE A 1 563 ? 32.611 28.685  85.235 1.00 74.35  ? 563  PHE A O   1 
ATOM   4629 C  CB  . PHE A 1 563 ? 32.107 31.968  84.868 1.00 74.28  ? 563  PHE A CB  1 
ATOM   4630 C  CG  . PHE A 1 563 ? 30.724 31.401  84.684 1.00 72.36  ? 563  PHE A CG  1 
ATOM   4631 C  CD1 . PHE A 1 563 ? 29.950 31.051  85.781 1.00 71.59  ? 563  PHE A CD1 1 
ATOM   4632 C  CD2 . PHE A 1 563 ? 30.193 31.229  83.412 1.00 71.32  ? 563  PHE A CD2 1 
ATOM   4633 C  CE1 . PHE A 1 563 ? 28.669 30.538  85.613 1.00 71.45  ? 563  PHE A CE1 1 
ATOM   4634 C  CE2 . PHE A 1 563 ? 28.914 30.718  83.235 1.00 70.33  ? 563  PHE A CE2 1 
ATOM   4635 C  CZ  . PHE A 1 563 ? 28.150 30.373  84.336 1.00 70.31  ? 563  PHE A CZ  1 
ATOM   4636 N  N   . LEU A 1 564 ? 33.747 29.712  83.595 1.00 72.55  ? 564  LEU A N   1 
ATOM   4637 C  CA  . LEU A 1 564 ? 33.831 28.502  82.793 1.00 72.48  ? 564  LEU A CA  1 
ATOM   4638 C  C   . LEU A 1 564 ? 34.187 27.303  83.657 1.00 71.88  ? 564  LEU A C   1 
ATOM   4639 O  O   . LEU A 1 564 ? 33.400 26.370  83.793 1.00 72.56  ? 564  LEU A O   1 
ATOM   4640 C  CB  . LEU A 1 564 ? 34.870 28.654  81.679 1.00 73.33  ? 564  LEU A CB  1 
ATOM   4641 C  CG  . LEU A 1 564 ? 34.492 29.496  80.453 1.00 74.42  ? 564  LEU A CG  1 
ATOM   4642 C  CD1 . LEU A 1 564 ? 35.642 29.498  79.456 1.00 74.85  ? 564  LEU A CD1 1 
ATOM   4643 C  CD2 . LEU A 1 564 ? 33.247 28.927  79.798 1.00 75.42  ? 564  LEU A CD2 1 
ATOM   4644 N  N   . LYS A 1 565 ? 35.371 27.333  84.255 1.00 71.43  ? 565  LYS A N   1 
ATOM   4645 C  CA  . LYS A 1 565 ? 35.810 26.232  85.098 1.00 70.34  ? 565  LYS A CA  1 
ATOM   4646 C  C   . LYS A 1 565 ? 34.735 25.872  86.115 1.00 68.96  ? 565  LYS A C   1 
ATOM   4647 O  O   . LYS A 1 565 ? 34.536 24.699  86.424 1.00 68.51  ? 565  LYS A O   1 
ATOM   4648 C  CB  . LYS A 1 565 ? 37.123 26.604  85.786 1.00 70.64  ? 565  LYS A CB  1 
ATOM   4649 C  CG  . LYS A 1 565 ? 38.224 26.942  84.780 1.00 72.67  ? 565  LYS A CG  1 
ATOM   4650 C  CD  . LYS A 1 565 ? 39.475 27.511  85.442 1.00 75.13  ? 565  LYS A CD  1 
ATOM   4651 C  CE  . LYS A 1 565 ? 40.493 27.998  84.407 1.00 74.66  ? 565  LYS A CE  1 
ATOM   4652 N  NZ  . LYS A 1 565 ? 41.697 28.623  85.036 1.00 74.87  ? 565  LYS A NZ  1 
ATOM   4653 N  N   . TYR A 1 566 ? 34.024 26.879  86.611 1.00 68.06  ? 566  TYR A N   1 
ATOM   4654 C  CA  . TYR A 1 566 ? 32.965 26.641  87.580 1.00 68.18  ? 566  TYR A CA  1 
ATOM   4655 C  C   . TYR A 1 566 ? 31.877 25.726  87.025 1.00 68.23  ? 566  TYR A C   1 
ATOM   4656 O  O   . TYR A 1 566 ? 31.919 24.523  87.254 1.00 69.24  ? 566  TYR A O   1 
ATOM   4657 C  CB  . TYR A 1 566 ? 32.351 27.961  88.050 1.00 68.17  ? 566  TYR A CB  1 
ATOM   4658 C  CG  . TYR A 1 566 ? 31.066 27.788  88.824 1.00 68.73  ? 566  TYR A CG  1 
ATOM   4659 C  CD1 . TYR A 1 566 ? 30.931 26.777  89.776 1.00 69.47  ? 566  TYR A CD1 1 
ATOM   4660 C  CD2 . TYR A 1 566 ? 29.978 28.630  88.598 1.00 69.40  ? 566  TYR A CD2 1 
ATOM   4661 C  CE1 . TYR A 1 566 ? 29.739 26.604  90.481 1.00 70.46  ? 566  TYR A CE1 1 
ATOM   4662 C  CE2 . TYR A 1 566 ? 28.782 28.473  89.299 1.00 70.04  ? 566  TYR A CE2 1 
ATOM   4663 C  CZ  . TYR A 1 566 ? 28.667 27.455  90.237 1.00 70.78  ? 566  TYR A CZ  1 
ATOM   4664 O  OH  . TYR A 1 566 ? 27.479 27.273  90.910 1.00 69.54  ? 566  TYR A OH  1 
ATOM   4665 N  N   . ILE A 1 567 ? 30.911 26.281  86.296 1.00 68.24  ? 567  ILE A N   1 
ATOM   4666 C  CA  . ILE A 1 567 ? 29.827 25.465  85.739 1.00 68.52  ? 567  ILE A CA  1 
ATOM   4667 C  C   . ILE A 1 567 ? 30.284 24.249  84.931 1.00 69.71  ? 567  ILE A C   1 
ATOM   4668 O  O   . ILE A 1 567 ? 29.533 23.288  84.793 1.00 70.52  ? 567  ILE A O   1 
ATOM   4669 C  CB  . ILE A 1 567 ? 28.852 26.291  84.845 1.00 66.66  ? 567  ILE A CB  1 
ATOM   4670 C  CG1 . ILE A 1 567 ? 29.615 27.370  84.082 1.00 65.71  ? 567  ILE A CG1 1 
ATOM   4671 C  CG2 . ILE A 1 567 ? 27.739 26.879  85.684 1.00 65.50  ? 567  ILE A CG2 1 
ATOM   4672 C  CD1 . ILE A 1 567 ? 30.581 26.830  83.062 1.00 64.98  ? 567  ILE A CD1 1 
ATOM   4673 N  N   . ASN A 1 568 ? 31.499 24.278  84.392 1.00 70.83  ? 568  ASN A N   1 
ATOM   4674 C  CA  . ASN A 1 568 ? 31.982 23.138  83.618 1.00 72.11  ? 568  ASN A CA  1 
ATOM   4675 C  C   . ASN A 1 568 ? 32.180 21.928  84.523 1.00 73.54  ? 568  ASN A C   1 
ATOM   4676 O  O   . ASN A 1 568 ? 31.710 20.828  84.219 1.00 74.60  ? 568  ASN A O   1 
ATOM   4677 C  CB  . ASN A 1 568 ? 33.284 23.491  82.901 1.00 71.59  ? 568  ASN A CB  1 
ATOM   4678 C  CG  . ASN A 1 568 ? 33.042 24.099  81.535 1.00 71.42  ? 568  ASN A CG  1 
ATOM   4679 O  OD1 . ASN A 1 568 ? 32.127 24.898  81.356 1.00 70.80  ? 568  ASN A OD1 1 
ATOM   4680 N  ND2 . ASN A 1 568 ? 33.868 23.728  80.564 1.00 72.50  ? 568  ASN A ND2 1 
ATOM   4681 N  N   . ALA A 1 569 ? 32.870 22.131  85.639 1.00 74.27  ? 569  ALA A N   1 
ATOM   4682 C  CA  . ALA A 1 569 ? 33.090 21.046  86.586 1.00 74.78  ? 569  ALA A CA  1 
ATOM   4683 C  C   . ALA A 1 569 ? 31.759 20.767  87.280 1.00 73.88  ? 569  ALA A C   1 
ATOM   4684 O  O   . ALA A 1 569 ? 31.627 19.824  88.057 1.00 74.06  ? 569  ALA A O   1 
ATOM   4685 C  CB  . ALA A 1 569 ? 34.145 21.446  87.609 1.00 75.09  ? 569  ALA A CB  1 
ATOM   4686 N  N   . LYS A 1 570 ? 30.776 21.605  86.976 1.00 73.20  ? 570  LYS A N   1 
ATOM   4687 C  CA  . LYS A 1 570 ? 29.442 21.504  87.545 1.00 73.51  ? 570  LYS A CA  1 
ATOM   4688 C  C   . LYS A 1 570 ? 28.570 20.629  86.649 1.00 74.19  ? 570  LYS A C   1 
ATOM   4689 O  O   . LYS A 1 570 ? 28.204 19.509  87.012 1.00 74.81  ? 570  LYS A O   1 
ATOM   4690 C  CB  . LYS A 1 570 ? 28.838 22.906  87.645 1.00 73.16  ? 570  LYS A CB  1 
ATOM   4691 C  CG  . LYS A 1 570 ? 27.451 22.971  88.236 1.00 74.12  ? 570  LYS A CG  1 
ATOM   4692 C  CD  . LYS A 1 570 ? 26.866 24.363  88.083 1.00 74.57  ? 570  LYS A CD  1 
ATOM   4693 C  CE  . LYS A 1 570 ? 25.648 24.552  88.975 1.00 75.97  ? 570  LYS A CE  1 
ATOM   4694 N  NZ  . LYS A 1 570 ? 26.014 24.534  90.427 1.00 75.94  ? 570  LYS A NZ  1 
ATOM   4695 N  N   . LEU A 1 571 ? 28.247 21.165  85.477 1.00 74.16  ? 571  LEU A N   1 
ATOM   4696 C  CA  . LEU A 1 571 ? 27.422 20.494  84.480 1.00 73.51  ? 571  LEU A CA  1 
ATOM   4697 C  C   . LEU A 1 571 ? 27.965 19.121  84.108 1.00 73.31  ? 571  LEU A C   1 
ATOM   4698 O  O   . LEU A 1 571 ? 29.126 18.807  84.382 1.00 73.17  ? 571  LEU A O   1 
ATOM   4699 C  CB  . LEU A 1 571 ? 27.347 21.349  83.210 1.00 74.42  ? 571  LEU A CB  1 
ATOM   4700 C  CG  . LEU A 1 571 ? 26.684 22.728  83.254 1.00 74.30  ? 571  LEU A CG  1 
ATOM   4701 C  CD1 . LEU A 1 571 ? 26.855 23.405  81.910 1.00 74.38  ? 571  LEU A CD1 1 
ATOM   4702 C  CD2 . LEU A 1 571 ? 25.214 22.586  83.586 1.00 74.58  ? 571  LEU A CD2 1 
ATOM   4703 N  N   . PRO A 1 572 ? 27.123 18.287  83.467 1.00 73.24  ? 572  PRO A N   1 
ATOM   4704 C  CA  . PRO A 1 572 ? 27.450 16.930  83.018 1.00 73.68  ? 572  PRO A CA  1 
ATOM   4705 C  C   . PRO A 1 572 ? 28.799 16.769  82.317 1.00 74.15  ? 572  PRO A C   1 
ATOM   4706 O  O   . PRO A 1 572 ? 29.608 17.702  82.253 1.00 75.12  ? 572  PRO A O   1 
ATOM   4707 C  CB  . PRO A 1 572 ? 26.280 16.593  82.108 1.00 72.44  ? 572  PRO A CB  1 
ATOM   4708 C  CG  . PRO A 1 572 ? 25.141 17.196  82.861 1.00 72.70  ? 572  PRO A CG  1 
ATOM   4709 C  CD  . PRO A 1 572 ? 25.685 18.555  83.267 1.00 72.87  ? 572  PRO A CD  1 
ATOM   4710 N  N   . GLY A 1 573 ? 29.035 15.571  81.795 1.00 73.77  ? 573  GLY A N   1 
ATOM   4711 C  CA  . GLY A 1 573 ? 30.287 15.297  81.116 1.00 73.76  ? 573  GLY A CA  1 
ATOM   4712 C  C   . GLY A 1 573 ? 30.341 15.941  79.749 1.00 73.31  ? 573  GLY A C   1 
ATOM   4713 O  O   . GLY A 1 573 ? 31.248 16.726  79.463 1.00 73.94  ? 573  GLY A O   1 
ATOM   4714 N  N   . ALA A 1 574 ? 29.366 15.609  78.907 1.00 72.12  ? 574  ALA A N   1 
ATOM   4715 C  CA  . ALA A 1 574 ? 29.297 16.150  77.555 1.00 70.74  ? 574  ALA A CA  1 
ATOM   4716 C  C   . ALA A 1 574 ? 29.146 17.668  77.592 1.00 69.76  ? 574  ALA A C   1 
ATOM   4717 O  O   . ALA A 1 574 ? 29.945 18.391  76.991 1.00 70.52  ? 574  ALA A O   1 
ATOM   4718 C  CB  . ALA A 1 574 ? 28.132 15.525  76.808 1.00 71.38  ? 574  ALA A CB  1 
ATOM   4719 N  N   . LEU A 1 575 ? 28.121 18.144  78.297 1.00 67.88  ? 575  LEU A N   1 
ATOM   4720 C  CA  . LEU A 1 575 ? 27.873 19.576  78.425 1.00 65.51  ? 575  LEU A CA  1 
ATOM   4721 C  C   . LEU A 1 575 ? 29.079 20.278  79.044 1.00 64.99  ? 575  LEU A C   1 
ATOM   4722 O  O   . LEU A 1 575 ? 29.456 20.034  80.191 1.00 64.78  ? 575  LEU A O   1 
ATOM   4723 C  CB  . LEU A 1 575 ? 26.626 19.835  79.274 1.00 64.91  ? 575  LEU A CB  1 
ATOM   4724 C  CG  . LEU A 1 575 ? 25.254 19.556  78.647 1.00 63.77  ? 575  LEU A CG  1 
ATOM   4725 C  CD1 . LEU A 1 575 ? 24.448 18.630  79.545 1.00 62.76  ? 575  LEU A CD1 1 
ATOM   4726 C  CD2 . LEU A 1 575 ? 24.512 20.870  78.446 1.00 62.86  ? 575  LEU A CD2 1 
ATOM   4727 N  N   . GLU A 1 576 ? 29.674 21.156  78.252 1.00 64.33  ? 576  GLU A N   1 
ATOM   4728 C  CA  . GLU A 1 576 ? 30.845 21.919  78.642 1.00 64.75  ? 576  GLU A CA  1 
ATOM   4729 C  C   . GLU A 1 576 ? 30.644 23.340  78.110 1.00 64.85  ? 576  GLU A C   1 
ATOM   4730 O  O   . GLU A 1 576 ? 29.834 23.555  77.210 1.00 65.78  ? 576  GLU A O   1 
ATOM   4731 C  CB  . GLU A 1 576 ? 32.072 21.265  78.016 1.00 65.75  ? 576  GLU A CB  1 
ATOM   4732 C  CG  . GLU A 1 576 ? 33.357 22.041  78.113 1.00 67.45  ? 576  GLU A CG  1 
ATOM   4733 C  CD  . GLU A 1 576 ? 34.445 21.399  77.279 1.00 70.12  ? 576  GLU A CD  1 
ATOM   4734 O  OE1 . GLU A 1 576 ? 34.728 20.201  77.507 1.00 70.98  ? 576  GLU A OE1 1 
ATOM   4735 O  OE2 . GLU A 1 576 ? 35.009 22.085  76.394 1.00 70.84  ? 576  GLU A OE2 1 
ATOM   4736 N  N   . LEU A 1 577 ? 31.359 24.317  78.659 1.00 64.40  ? 577  LEU A N   1 
ATOM   4737 C  CA  . LEU A 1 577 ? 31.193 25.685  78.183 1.00 63.39  ? 577  LEU A CA  1 
ATOM   4738 C  C   . LEU A 1 577 ? 32.525 26.319  77.836 1.00 63.21  ? 577  LEU A C   1 
ATOM   4739 O  O   . LEU A 1 577 ? 33.504 26.163  78.558 1.00 62.70  ? 577  LEU A O   1 
ATOM   4740 C  CB  . LEU A 1 577 ? 30.468 26.524  79.230 1.00 62.76  ? 577  LEU A CB  1 
ATOM   4741 C  CG  . LEU A 1 577 ? 29.834 27.790  78.663 1.00 61.70  ? 577  LEU A CG  1 
ATOM   4742 C  CD1 . LEU A 1 577 ? 28.930 27.416  77.499 1.00 61.82  ? 577  LEU A CD1 1 
ATOM   4743 C  CD2 . LEU A 1 577 ? 29.050 28.504  79.749 1.00 60.55  ? 577  LEU A CD2 1 
ATOM   4744 N  N   . GLU A 1 578 ? 32.554 27.044  76.727 1.00 64.99  ? 578  GLU A N   1 
ATOM   4745 C  CA  . GLU A 1 578 ? 33.786 27.671  76.270 1.00 67.28  ? 578  GLU A CA  1 
ATOM   4746 C  C   . GLU A 1 578 ? 33.710 29.167  75.972 1.00 68.36  ? 578  GLU A C   1 
ATOM   4747 O  O   . GLU A 1 578 ? 32.641 29.714  75.689 1.00 68.62  ? 578  GLU A O   1 
ATOM   4748 C  CB  . GLU A 1 578 ? 34.285 26.938  75.030 1.00 67.11  ? 578  GLU A CB  1 
ATOM   4749 C  CG  . GLU A 1 578 ? 33.186 26.617  74.043 1.00 68.55  ? 578  GLU A CG  1 
ATOM   4750 C  CD  . GLU A 1 578 ? 33.722 25.981  72.784 1.00 70.88  ? 578  GLU A CD  1 
ATOM   4751 O  OE1 . GLU A 1 578 ? 34.514 25.018  72.898 1.00 71.83  ? 578  GLU A OE1 1 
ATOM   4752 O  OE2 . GLU A 1 578 ? 33.353 26.440  71.680 1.00 71.84  ? 578  GLU A OE2 1 
ATOM   4753 N  N   . TYR A 1 579 ? 34.871 29.814  76.036 1.00 69.01  ? 579  TYR A N   1 
ATOM   4754 C  CA  . TYR A 1 579 ? 34.997 31.238  75.770 1.00 70.22  ? 579  TYR A CA  1 
ATOM   4755 C  C   . TYR A 1 579 ? 34.945 31.470  74.274 1.00 72.22  ? 579  TYR A C   1 
ATOM   4756 O  O   . TYR A 1 579 ? 35.768 30.936  73.537 1.00 72.88  ? 579  TYR A O   1 
ATOM   4757 C  CB  . TYR A 1 579 ? 36.333 31.754  76.299 1.00 68.80  ? 579  TYR A CB  1 
ATOM   4758 C  CG  . TYR A 1 579 ? 36.599 33.222  76.021 1.00 67.87  ? 579  TYR A CG  1 
ATOM   4759 C  CD1 . TYR A 1 579 ? 35.917 34.223  76.716 1.00 67.68  ? 579  TYR A CD1 1 
ATOM   4760 C  CD2 . TYR A 1 579 ? 37.557 33.610  75.091 1.00 67.44  ? 579  TYR A CD2 1 
ATOM   4761 C  CE1 . TYR A 1 579 ? 36.192 35.570  76.497 1.00 65.92  ? 579  TYR A CE1 1 
ATOM   4762 C  CE2 . TYR A 1 579 ? 37.836 34.954  74.866 1.00 67.21  ? 579  TYR A CE2 1 
ATOM   4763 C  CZ  . TYR A 1 579 ? 37.152 35.923  75.574 1.00 66.26  ? 579  TYR A CZ  1 
ATOM   4764 O  OH  . TYR A 1 579 ? 37.446 37.246  75.368 1.00 67.31  ? 579  TYR A OH  1 
ATOM   4765 N  N   . GLU A 1 580 ? 33.982 32.258  73.817 1.00 75.11  ? 580  GLU A N   1 
ATOM   4766 C  CA  . GLU A 1 580 ? 33.894 32.535  72.393 1.00 78.08  ? 580  GLU A CA  1 
ATOM   4767 C  C   . GLU A 1 580 ? 34.834 33.665  72.004 1.00 78.64  ? 580  GLU A C   1 
ATOM   4768 O  O   . GLU A 1 580 ? 35.799 33.461  71.267 1.00 78.86  ? 580  GLU A O   1 
ATOM   4769 C  CB  . GLU A 1 580 ? 32.470 32.908  71.992 1.00 80.43  ? 580  GLU A CB  1 
ATOM   4770 C  CG  . GLU A 1 580 ? 32.405 33.752  70.724 1.00 85.13  ? 580  GLU A CG  1 
ATOM   4771 C  CD  . GLU A 1 580 ? 33.225 33.176  69.574 1.00 88.81  ? 580  GLU A CD  1 
ATOM   4772 O  OE1 . GLU A 1 580 ? 33.336 33.862  68.530 1.00 90.99  ? 580  GLU A OE1 1 
ATOM   4773 O  OE2 . GLU A 1 580 ? 33.756 32.046  69.708 1.00 89.59  ? 580  GLU A OE2 1 
ATOM   4774 N  N   . GLY A 1 581 ? 34.541 34.862  72.499 1.00 79.05  ? 581  GLY A N   1 
ATOM   4775 C  CA  . GLY A 1 581 ? 35.370 36.003  72.181 1.00 79.07  ? 581  GLY A CA  1 
ATOM   4776 C  C   . GLY A 1 581 ? 35.106 37.189  73.078 1.00 79.20  ? 581  GLY A C   1 
ATOM   4777 O  O   . GLY A 1 581 ? 34.489 37.061  74.135 1.00 78.75  ? 581  GLY A O   1 
ATOM   4778 N  N   . PHE A 1 582 ? 35.572 38.351  72.638 1.00 80.14  ? 582  PHE A N   1 
ATOM   4779 C  CA  . PHE A 1 582 ? 35.421 39.591  73.386 1.00 80.93  ? 582  PHE A CA  1 
ATOM   4780 C  C   . PHE A 1 582 ? 35.119 40.734  72.418 1.00 80.68  ? 582  PHE A C   1 
ATOM   4781 O  O   . PHE A 1 582 ? 35.815 40.896  71.418 1.00 80.88  ? 582  PHE A O   1 
ATOM   4782 C  CB  . PHE A 1 582 ? 36.720 39.881  74.143 1.00 81.27  ? 582  PHE A CB  1 
ATOM   4783 C  CG  . PHE A 1 582 ? 36.609 40.993  75.138 1.00 82.53  ? 582  PHE A CG  1 
ATOM   4784 C  CD1 . PHE A 1 582 ? 35.808 40.857  76.264 1.00 82.85  ? 582  PHE A CD1 1 
ATOM   4785 C  CD2 . PHE A 1 582 ? 37.311 42.178  74.954 1.00 83.25  ? 582  PHE A CD2 1 
ATOM   4786 C  CE1 . PHE A 1 582 ? 35.707 41.884  77.195 1.00 83.22  ? 582  PHE A CE1 1 
ATOM   4787 C  CE2 . PHE A 1 582 ? 37.217 43.211  75.880 1.00 83.66  ? 582  PHE A CE2 1 
ATOM   4788 C  CZ  . PHE A 1 582 ? 36.413 43.063  77.001 1.00 83.64  ? 582  PHE A CZ  1 
ATOM   4789 N  N   . TYR A 1 583 ? 34.081 41.515  72.710 1.00 80.69  ? 583  TYR A N   1 
ATOM   4790 C  CA  . TYR A 1 583 ? 33.711 42.649  71.860 1.00 81.18  ? 583  TYR A CA  1 
ATOM   4791 C  C   . TYR A 1 583 ? 33.672 43.919  72.711 1.00 81.54  ? 583  TYR A C   1 
ATOM   4792 O  O   . TYR A 1 583 ? 32.747 44.116  73.495 1.00 82.16  ? 583  TYR A O   1 
ATOM   4793 C  CB  . TYR A 1 583 ? 32.342 42.412  71.211 1.00 80.31  ? 583  TYR A CB  1 
ATOM   4794 C  CG  . TYR A 1 583 ? 32.218 41.093  70.474 1.00 80.48  ? 583  TYR A CG  1 
ATOM   4795 C  CD1 . TYR A 1 583 ? 32.199 39.882  71.168 1.00 81.33  ? 583  TYR A CD1 1 
ATOM   4796 C  CD2 . TYR A 1 583 ? 32.102 41.054  69.085 1.00 80.70  ? 583  TYR A CD2 1 
ATOM   4797 C  CE1 . TYR A 1 583 ? 32.064 38.662  70.496 1.00 81.24  ? 583  TYR A CE1 1 
ATOM   4798 C  CE2 . TYR A 1 583 ? 31.966 39.839  68.402 1.00 80.92  ? 583  TYR A CE2 1 
ATOM   4799 C  CZ  . TYR A 1 583 ? 31.947 38.647  69.114 1.00 81.07  ? 583  TYR A CZ  1 
ATOM   4800 O  OH  . TYR A 1 583 ? 31.805 37.444  68.451 1.00 80.27  ? 583  TYR A OH  1 
ATOM   4801 N  N   . GLU A 1 584 ? 34.676 44.777  72.543 1.00 82.03  ? 584  GLU A N   1 
ATOM   4802 C  CA  . GLU A 1 584 ? 34.795 46.016  73.314 1.00 82.97  ? 584  GLU A CA  1 
ATOM   4803 C  C   . GLU A 1 584 ? 33.503 46.813  73.473 1.00 82.87  ? 584  GLU A C   1 
ATOM   4804 O  O   . GLU A 1 584 ? 33.299 47.458  74.502 1.00 82.43  ? 584  GLU A O   1 
ATOM   4805 C  CB  . GLU A 1 584 ? 35.879 46.915  72.699 1.00 84.76  ? 584  GLU A CB  1 
ATOM   4806 C  CG  . GLU A 1 584 ? 36.652 47.798  73.706 1.00 87.69  ? 584  GLU A CG  1 
ATOM   4807 C  CD  . GLU A 1 584 ? 36.066 49.201  73.901 1.00 89.13  ? 584  GLU A CD  1 
ATOM   4808 O  OE1 . GLU A 1 584 ? 35.933 49.950  72.908 1.00 90.33  ? 584  GLU A OE1 1 
ATOM   4809 O  OE2 . GLU A 1 584 ? 35.752 49.566  75.053 1.00 89.95  ? 584  GLU A OE2 1 
ATOM   4810 N  N   . ARG A 1 585 ? 32.629 46.771  72.468 1.00 82.99  ? 585  ARG A N   1 
ATOM   4811 C  CA  . ARG A 1 585 ? 31.373 47.520  72.535 1.00 82.45  ? 585  ARG A CA  1 
ATOM   4812 C  C   . ARG A 1 585 ? 30.338 46.989  71.545 1.00 81.50  ? 585  ARG A C   1 
ATOM   4813 O  O   . ARG A 1 585 ? 30.689 46.403  70.522 1.00 82.06  ? 585  ARG A O   1 
ATOM   4814 C  CB  . ARG A 1 585 ? 31.650 49.001  72.253 1.00 83.27  ? 585  ARG A CB  1 
ATOM   4815 C  CG  . ARG A 1 585 ? 30.643 49.984  72.836 1.00 84.78  ? 585  ARG A CG  1 
ATOM   4816 C  CD  . ARG A 1 585 ? 31.167 51.418  72.714 1.00 87.02  ? 585  ARG A CD  1 
ATOM   4817 N  NE  . ARG A 1 585 ? 32.434 51.598  73.427 1.00 88.66  ? 585  ARG A NE  1 
ATOM   4818 C  CZ  . ARG A 1 585 ? 33.300 52.586  73.203 1.00 89.59  ? 585  ARG A CZ  1 
ATOM   4819 N  NH1 . ARG A 1 585 ? 33.049 53.505  72.277 1.00 88.88  ? 585  ARG A NH1 1 
ATOM   4820 N  NH2 . ARG A 1 585 ? 34.427 52.650  73.903 1.00 90.33  ? 585  ARG A NH2 1 
ATOM   4821 N  N   . GLY A 1 586 ? 29.063 47.197  71.861 1.00 80.46  ? 586  GLY A N   1 
ATOM   4822 C  CA  . GLY A 1 586 ? 27.990 46.745  70.992 1.00 78.24  ? 586  GLY A CA  1 
ATOM   4823 C  C   . GLY A 1 586 ? 26.611 46.961  71.593 1.00 77.26  ? 586  GLY A C   1 
ATOM   4824 O  O   . GLY A 1 586 ? 26.464 47.105  72.807 1.00 76.87  ? 586  GLY A O   1 
ATOM   4825 N  N   . PHE A 1 587 ? 25.595 46.997  70.738 1.00 76.51  ? 587  PHE A N   1 
ATOM   4826 C  CA  . PHE A 1 587 ? 24.221 47.174  71.192 1.00 76.27  ? 587  PHE A CA  1 
ATOM   4827 C  C   . PHE A 1 587 ? 23.345 46.125  70.520 1.00 74.95  ? 587  PHE A C   1 
ATOM   4828 O  O   . PHE A 1 587 ? 23.714 45.578  69.480 1.00 74.23  ? 587  PHE A O   1 
ATOM   4829 C  CB  . PHE A 1 587 ? 23.730 48.581  70.860 1.00 77.63  ? 587  PHE A CB  1 
ATOM   4830 C  CG  . PHE A 1 587 ? 23.811 48.918  69.409 1.00 79.35  ? 587  PHE A CG  1 
ATOM   4831 C  CD1 . PHE A 1 587 ? 22.886 48.402  68.507 1.00 80.24  ? 587  PHE A CD1 1 
ATOM   4832 C  CD2 . PHE A 1 587 ? 24.823 49.746  68.936 1.00 80.66  ? 587  PHE A CD2 1 
ATOM   4833 C  CE1 . PHE A 1 587 ? 22.966 48.706  67.150 1.00 81.37  ? 587  PHE A CE1 1 
ATOM   4834 C  CE2 . PHE A 1 587 ? 24.916 50.059  67.581 1.00 81.53  ? 587  PHE A CE2 1 
ATOM   4835 C  CZ  . PHE A 1 587 ? 23.985 49.538  66.685 1.00 81.68  ? 587  PHE A CZ  1 
ATOM   4836 N  N   . PHE A 1 588 ? 22.184 45.851  71.108 1.00 73.89  ? 588  PHE A N   1 
ATOM   4837 C  CA  . PHE A 1 588 ? 21.287 44.833  70.574 1.00 73.04  ? 588  PHE A CA  1 
ATOM   4838 C  C   . PHE A 1 588 ? 19.855 45.327  70.363 1.00 73.38  ? 588  PHE A C   1 
ATOM   4839 O  O   . PHE A 1 588 ? 19.304 46.036  71.204 1.00 73.24  ? 588  PHE A O   1 
ATOM   4840 C  CB  . PHE A 1 588 ? 21.308 43.614  71.508 1.00 70.99  ? 588  PHE A CB  1 
ATOM   4841 C  CG  . PHE A 1 588 ? 22.703 43.120  71.828 1.00 68.62  ? 588  PHE A CG  1 
ATOM   4842 C  CD1 . PHE A 1 588 ? 23.532 43.837  72.687 1.00 67.34  ? 588  PHE A CD1 1 
ATOM   4843 C  CD2 . PHE A 1 588 ? 23.201 41.960  71.236 1.00 66.82  ? 588  PHE A CD2 1 
ATOM   4844 C  CE1 . PHE A 1 588 ? 24.832 43.406  72.946 1.00 67.01  ? 588  PHE A CE1 1 
ATOM   4845 C  CE2 . PHE A 1 588 ? 24.498 41.523  71.488 1.00 65.27  ? 588  PHE A CE2 1 
ATOM   4846 C  CZ  . PHE A 1 588 ? 25.314 42.246  72.344 1.00 66.10  ? 588  PHE A CZ  1 
ATOM   4847 N  N   . VAL A 1 589 ? 19.260 44.929  69.239 1.00 74.30  ? 589  VAL A N   1 
ATOM   4848 C  CA  . VAL A 1 589 ? 17.899 45.340  68.878 1.00 75.00  ? 589  VAL A CA  1 
ATOM   4849 C  C   . VAL A 1 589 ? 16.973 44.188  68.464 1.00 76.10  ? 589  VAL A C   1 
ATOM   4850 O  O   . VAL A 1 589 ? 16.866 43.880  67.276 1.00 75.56  ? 589  VAL A O   1 
ATOM   4851 C  CB  . VAL A 1 589 ? 17.930 46.329  67.695 1.00 74.28  ? 589  VAL A CB  1 
ATOM   4852 C  CG1 . VAL A 1 589 ? 16.555 46.930  67.485 1.00 74.95  ? 589  VAL A CG1 1 
ATOM   4853 C  CG2 . VAL A 1 589 ? 18.974 47.398  67.933 1.00 73.89  ? 589  VAL A CG2 1 
ATOM   4854 N  N   . THR A 1 590 ? 16.298 43.567  69.429 1.00 77.47  ? 590  THR A N   1 
ATOM   4855 C  CA  . THR A 1 590 ? 15.370 42.465  69.142 1.00 78.91  ? 590  THR A CA  1 
ATOM   4856 C  C   . THR A 1 590 ? 16.093 41.162  68.769 1.00 79.41  ? 590  THR A C   1 
ATOM   4857 O  O   . THR A 1 590 ? 17.303 41.040  68.951 1.00 80.51  ? 590  THR A O   1 
ATOM   4858 C  CB  . THR A 1 590 ? 14.373 42.866  68.007 1.00 79.23  ? 590  THR A CB  1 
ATOM   4859 O  OG1 . THR A 1 590 ? 13.728 44.095  68.363 1.00 79.15  ? 590  THR A OG1 1 
ATOM   4860 C  CG2 . THR A 1 590 ? 13.293 41.800  67.800 1.00 79.32  ? 590  THR A CG2 1 
ATOM   4861 N  N   . LYS A 1 591 ? 15.343 40.193  68.256 1.00 79.35  ? 591  LYS A N   1 
ATOM   4862 C  CA  . LYS A 1 591 ? 15.882 38.890  67.873 1.00 79.37  ? 591  LYS A CA  1 
ATOM   4863 C  C   . LYS A 1 591 ? 16.930 39.004  66.770 1.00 77.61  ? 591  LYS A C   1 
ATOM   4864 O  O   . LYS A 1 591 ? 16.842 39.890  65.924 1.00 77.59  ? 591  LYS A O   1 
ATOM   4865 C  CB  . LYS A 1 591 ? 14.744 37.976  67.394 1.00 81.67  ? 591  LYS A CB  1 
ATOM   4866 C  CG  . LYS A 1 591 ? 13.398 38.242  68.068 1.00 84.22  ? 591  LYS A CG  1 
ATOM   4867 C  CD  . LYS A 1 591 ? 12.291 37.348  67.515 1.00 85.73  ? 591  LYS A CD  1 
ATOM   4868 C  CE  . LYS A 1 591 ? 10.899 37.886  67.868 1.00 86.96  ? 591  LYS A CE  1 
ATOM   4869 N  NZ  . LYS A 1 591 ? 10.667 38.033  69.337 1.00 87.82  ? 591  LYS A NZ  1 
ATOM   4870 N  N   . LYS A 1 592 ? 17.901 38.088  66.785 1.00 75.77  ? 592  LYS A N   1 
ATOM   4871 C  CA  . LYS A 1 592 ? 18.996 38.032  65.809 1.00 73.30  ? 592  LYS A CA  1 
ATOM   4872 C  C   . LYS A 1 592 ? 19.254 39.345  65.068 1.00 71.91  ? 592  LYS A C   1 
ATOM   4873 O  O   . LYS A 1 592 ? 19.473 39.358  63.853 1.00 70.94  ? 592  LYS A O   1 
ATOM   4874 C  CB  . LYS A 1 592 ? 18.748 36.895  64.802 1.00 72.71  ? 592  LYS A CB  1 
ATOM   4875 C  CG  . LYS A 1 592 ? 19.063 35.494  65.345 1.00 70.81  ? 592  LYS A CG  1 
ATOM   4876 C  CD  . LYS A 1 592 ? 20.570 35.211  65.377 1.00 68.48  ? 592  LYS A CD  1 
ATOM   4877 C  CE  . LYS A 1 592 ? 21.033 34.450  64.137 1.00 67.35  ? 592  LYS A CE  1 
ATOM   4878 N  NZ  . LYS A 1 592 ? 20.634 35.106  62.862 1.00 63.88  ? 592  LYS A NZ  1 
ATOM   4879 N  N   . LYS A 1 593 ? 19.232 40.445  65.820 1.00 71.00  ? 593  LYS A N   1 
ATOM   4880 C  CA  . LYS A 1 593 ? 19.465 41.783  65.278 1.00 68.90  ? 593  LYS A CA  1 
ATOM   4881 C  C   . LYS A 1 593 ? 20.311 42.575  66.265 1.00 67.42  ? 593  LYS A C   1 
ATOM   4882 O  O   . LYS A 1 593 ? 19.854 42.926  67.350 1.00 66.11  ? 593  LYS A O   1 
ATOM   4883 C  CB  . LYS A 1 593 ? 18.137 42.500  65.020 1.00 68.51  ? 593  LYS A CB  1 
ATOM   4884 N  N   . TYR A 1 594 ? 21.556 42.840  65.889 1.00 66.92  ? 594  TYR A N   1 
ATOM   4885 C  CA  . TYR A 1 594 ? 22.455 43.586  66.753 1.00 66.35  ? 594  TYR A CA  1 
ATOM   4886 C  C   . TYR A 1 594 ? 23.753 43.958  66.055 1.00 66.28  ? 594  TYR A C   1 
ATOM   4887 O  O   . TYR A 1 594 ? 23.860 43.903  64.824 1.00 66.70  ? 594  TYR A O   1 
ATOM   4888 C  CB  . TYR A 1 594 ? 22.763 42.778  68.007 1.00 65.52  ? 594  TYR A CB  1 
ATOM   4889 C  CG  . TYR A 1 594 ? 23.365 41.430  67.718 1.00 64.64  ? 594  TYR A CG  1 
ATOM   4890 C  CD1 . TYR A 1 594 ? 24.685 41.314  67.299 1.00 64.37  ? 594  TYR A CD1 1 
ATOM   4891 C  CD2 . TYR A 1 594 ? 22.602 40.268  67.835 1.00 64.01  ? 594  TYR A CD2 1 
ATOM   4892 C  CE1 . TYR A 1 594 ? 25.234 40.072  67.001 1.00 64.49  ? 594  TYR A CE1 1 
ATOM   4893 C  CE2 . TYR A 1 594 ? 23.138 39.025  67.540 1.00 64.02  ? 594  TYR A CE2 1 
ATOM   4894 C  CZ  . TYR A 1 594 ? 24.454 38.933  67.123 1.00 64.18  ? 594  TYR A CZ  1 
ATOM   4895 O  OH  . TYR A 1 594 ? 24.990 37.704  66.821 1.00 64.62  ? 594  TYR A OH  1 
ATOM   4896 N  N   . ALA A 1 595 ? 24.748 44.323  66.854 1.00 65.39  ? 595  ALA A N   1 
ATOM   4897 C  CA  . ALA A 1 595 ? 26.023 44.731  66.297 1.00 65.06  ? 595  ALA A CA  1 
ATOM   4898 C  C   . ALA A 1 595 ? 27.096 44.858  67.358 1.00 64.67  ? 595  ALA A C   1 
ATOM   4899 O  O   . ALA A 1 595 ? 26.842 45.326  68.463 1.00 64.50  ? 595  ALA A O   1 
ATOM   4900 C  CB  . ALA A 1 595 ? 25.855 46.050  65.578 1.00 64.37  ? 595  ALA A CB  1 
ATOM   4901 N  N   . VAL A 1 596 ? 28.304 44.441  67.012 1.00 66.00  ? 596  VAL A N   1 
ATOM   4902 C  CA  . VAL A 1 596 ? 29.422 44.513  67.941 1.00 68.09  ? 596  VAL A CA  1 
ATOM   4903 C  C   . VAL A 1 596 ? 30.730 44.912  67.266 1.00 69.14  ? 596  VAL A C   1 
ATOM   4904 O  O   . VAL A 1 596 ? 30.830 44.954  66.036 1.00 69.72  ? 596  VAL A O   1 
ATOM   4905 C  CB  . VAL A 1 596 ? 29.638 43.167  68.666 1.00 67.94  ? 596  VAL A CB  1 
ATOM   4906 C  CG1 . VAL A 1 596 ? 28.779 43.105  69.909 1.00 67.50  ? 596  VAL A CG1 1 
ATOM   4907 C  CG2 . VAL A 1 596 ? 29.293 42.015  67.736 1.00 66.87  ? 596  VAL A CG2 1 
ATOM   4908 N  N   . ILE A 1 597 ? 31.734 45.201  68.086 1.00 69.97  ? 597  ILE A N   1 
ATOM   4909 C  CA  . ILE A 1 597 ? 33.037 45.601  67.585 1.00 71.35  ? 597  ILE A CA  1 
ATOM   4910 C  C   . ILE A 1 597 ? 34.132 45.057  68.503 1.00 72.64  ? 597  ILE A C   1 
ATOM   4911 O  O   . ILE A 1 597 ? 34.086 45.238  69.724 1.00 72.47  ? 597  ILE A O   1 
ATOM   4912 C  CB  . ILE A 1 597 ? 33.132 47.145  67.498 1.00 71.06  ? 597  ILE A CB  1 
ATOM   4913 C  CG1 . ILE A 1 597 ? 34.352 47.547  66.669 1.00 70.26  ? 597  ILE A CG1 1 
ATOM   4914 C  CG2 . ILE A 1 597 ? 33.189 47.755  68.903 1.00 70.38  ? 597  ILE A CG2 1 
ATOM   4915 C  CD1 . ILE A 1 597 ? 34.478 49.032  66.468 1.00 68.12  ? 597  ILE A CD1 1 
ATOM   4916 N  N   . ASP A 1 598 ? 35.109 44.380  67.907 1.00 74.52  ? 598  ASP A N   1 
ATOM   4917 C  CA  . ASP A 1 598 ? 36.208 43.803  68.673 1.00 77.00  ? 598  ASP A CA  1 
ATOM   4918 C  C   . ASP A 1 598 ? 37.302 44.816  68.984 1.00 78.11  ? 598  ASP A C   1 
ATOM   4919 O  O   . ASP A 1 598 ? 37.222 45.974  68.579 1.00 77.51  ? 598  ASP A O   1 
ATOM   4920 C  CB  . ASP A 1 598 ? 36.796 42.583  67.941 1.00 78.96  ? 598  ASP A CB  1 
ATOM   4921 C  CG  . ASP A 1 598 ? 37.314 42.912  66.543 1.00 81.16  ? 598  ASP A CG  1 
ATOM   4922 O  OD1 . ASP A 1 598 ? 38.283 43.684  66.425 1.00 83.21  ? 598  ASP A OD1 1 
ATOM   4923 O  OD2 . ASP A 1 598 ? 36.757 42.388  65.554 1.00 81.87  ? 598  ASP A OD2 1 
ATOM   4924 N  N   . GLU A 1 599 ? 38.324 44.359  69.701 1.00 79.69  ? 599  GLU A N   1 
ATOM   4925 C  CA  . GLU A 1 599 ? 39.450 45.187  70.118 1.00 81.61  ? 599  GLU A CA  1 
ATOM   4926 C  C   . GLU A 1 599 ? 40.380 45.683  68.995 1.00 82.90  ? 599  GLU A C   1 
ATOM   4927 O  O   . GLU A 1 599 ? 41.183 46.592  69.223 1.00 83.17  ? 599  GLU A O   1 
ATOM   4928 C  CB  . GLU A 1 599 ? 40.273 44.420  71.163 1.00 81.35  ? 599  GLU A CB  1 
ATOM   4929 C  CG  . GLU A 1 599 ? 39.505 44.029  72.413 1.00 81.56  ? 599  GLU A CG  1 
ATOM   4930 C  CD  . GLU A 1 599 ? 40.173 42.891  73.167 1.00 82.08  ? 599  GLU A CD  1 
ATOM   4931 O  OE1 . GLU A 1 599 ? 40.108 41.739  72.686 1.00 82.84  ? 599  GLU A OE1 1 
ATOM   4932 O  OE2 . GLU A 1 599 ? 40.767 43.140  74.237 1.00 81.27  ? 599  GLU A OE2 1 
ATOM   4933 N  N   . GLU A 1 600 ? 40.282 45.090  67.804 1.00 84.03  ? 600  GLU A N   1 
ATOM   4934 C  CA  . GLU A 1 600 ? 41.123 45.468  66.662 1.00 85.28  ? 600  GLU A CA  1 
ATOM   4935 C  C   . GLU A 1 600 ? 40.292 46.091  65.539 1.00 85.63  ? 600  GLU A C   1 
ATOM   4936 O  O   . GLU A 1 600 ? 40.668 45.976  64.355 1.00 85.73  ? 600  GLU A O   1 
ATOM   4937 C  CB  . GLU A 1 600 ? 41.811 44.223  66.090 1.00 86.85  ? 600  GLU A CB  1 
ATOM   4938 C  CG  . GLU A 1 600 ? 40.816 43.169  65.626 1.00 90.05  ? 600  GLU A CG  1 
ATOM   4939 C  CD  . GLU A 1 600 ? 41.409 42.162  64.661 1.00 92.94  ? 600  GLU A CD  1 
ATOM   4940 O  OE1 . GLU A 1 600 ? 41.534 42.470  63.451 1.00 94.45  ? 600  GLU A OE1 1 
ATOM   4941 O  OE2 . GLU A 1 600 ? 41.755 41.056  65.120 1.00 94.54  ? 600  GLU A OE2 1 
ATOM   4942 N  N   . GLY A 1 601 ? 39.187 46.746  65.899 1.00 85.82  ? 601  GLY A N   1 
ATOM   4943 C  CA  . GLY A 1 601 ? 38.314 47.319  64.893 1.00 85.92  ? 601  GLY A CA  1 
ATOM   4944 C  C   . GLY A 1 601 ? 37.340 46.265  64.415 1.00 86.21  ? 601  GLY A C   1 
ATOM   4945 O  O   . GLY A 1 601 ? 36.907 45.383  65.184 1.00 86.34  ? 601  GLY A O   1 
ATOM   4946 N  N   . LYS A 1 602 ? 37.027 46.329  63.130 1.00 86.12  ? 602  LYS A N   1 
ATOM   4947 C  CA  . LYS A 1 602 ? 36.118 45.356  62.566 1.00 86.35  ? 602  LYS A CA  1 
ATOM   4948 C  C   . LYS A 1 602 ? 34.802 45.293  63.315 1.00 87.21  ? 602  LYS A C   1 
ATOM   4949 O  O   . LYS A 1 602 ? 34.717 45.047  64.529 1.00 87.19  ? 602  LYS A O   1 
ATOM   4950 C  CB  . LYS A 1 602 ? 36.728 43.943  62.527 1.00 85.07  ? 602  LYS A CB  1 
ATOM   4951 C  CG  . LYS A 1 602 ? 35.775 42.892  62.023 1.00 83.99  ? 602  LYS A CG  1 
ATOM   4952 C  CD  . LYS A 1 602 ? 36.437 41.548  61.862 1.00 83.61  ? 602  LYS A CD  1 
ATOM   4953 C  CE  . LYS A 1 602 ? 35.413 40.425  61.595 1.00 84.07  ? 602  LYS A CE  1 
ATOM   4954 N  NZ  . LYS A 1 602 ? 34.676 40.595  60.286 1.00 84.06  ? 602  LYS A NZ  1 
ATOM   4955 N  N   . ILE A 1 603 ? 33.761 45.534  62.537 1.00 87.98  ? 603  ILE A N   1 
ATOM   4956 C  CA  . ILE A 1 603 ? 32.382 45.549  63.018 1.00 89.15  ? 603  ILE A CA  1 
ATOM   4957 C  C   . ILE A 1 603 ? 31.777 44.249  62.560 1.00 90.62  ? 603  ILE A C   1 
ATOM   4958 O  O   . ILE A 1 603 ? 31.560 44.053  61.379 1.00 92.00  ? 603  ILE A O   1 
ATOM   4959 C  CB  . ILE A 1 603 ? 31.559 46.664  62.334 1.00 88.84  ? 603  ILE A CB  1 
ATOM   4960 C  CG1 . ILE A 1 603 ? 31.930 46.740  60.839 1.00 89.38  ? 603  ILE A CG1 1 
ATOM   4961 C  CG2 . ILE A 1 603 ? 31.766 47.995  63.031 1.00 87.14  ? 603  ILE A CG2 1 
ATOM   4962 C  CD1 . ILE A 1 603 ? 30.866 47.396  59.920 1.00 88.53  ? 603  ILE A CD1 1 
ATOM   4963 N  N   . THR A 1 604 ? 31.502 43.330  63.455 1.00 91.39  ? 604  THR A N   1 
ATOM   4964 C  CA  . THR A 1 604 ? 30.937 42.106  62.945 1.00 92.47  ? 604  THR A CA  1 
ATOM   4965 C  C   . THR A 1 604 ? 29.502 42.393  62.563 1.00 92.97  ? 604  THR A C   1 
ATOM   4966 O  O   . THR A 1 604 ? 29.172 42.741  61.404 1.00 93.05  ? 604  THR A O   1 
ATOM   4967 C  CB  . THR A 1 604 ? 31.025 41.014  63.980 1.00 92.73  ? 604  THR A CB  1 
ATOM   4968 O  OG1 . THR A 1 604 ? 30.611 41.511  65.261 1.00 95.13  ? 604  THR A OG1 1 
ATOM   4969 C  CG2 . THR A 1 604 ? 32.441 40.493  64.046 1.00 92.06  ? 604  THR A CG2 1 
ATOM   4970 N  N   . THR A 1 605 ? 28.644 42.252  63.551 1.00 93.63  ? 605  THR A N   1 
ATOM   4971 C  CA  . THR A 1 605 ? 27.261 42.552  63.348 1.00 94.31  ? 605  THR A CA  1 
ATOM   4972 C  C   . THR A 1 605 ? 26.636 41.656  62.323 1.00 95.55  ? 605  THR A C   1 
ATOM   4973 O  O   . THR A 1 605 ? 27.245 41.256  61.330 1.00 95.33  ? 605  THR A O   1 
ATOM   4974 C  CB  . THR A 1 605 ? 27.112 43.967  62.868 1.00 94.06  ? 605  THR A CB  1 
ATOM   4975 O  OG1 . THR A 1 605 ? 27.764 44.814  63.815 1.00 95.01  ? 605  THR A OG1 1 
ATOM   4976 C  CG2 . THR A 1 605 ? 25.652 44.332  62.652 1.00 92.94  ? 605  THR A CG2 1 
ATOM   4977 N  N   . ARG A 1 606 ? 25.378 41.348  62.524 1.00 97.19  ? 606  ARG A N   1 
ATOM   4978 C  CA  . ARG A 1 606 ? 24.748 40.503  61.550 1.00 99.22  ? 606  ARG A CA  1 
ATOM   4979 C  C   . ARG A 1 606 ? 23.287 40.765  61.769 1.00 99.42  ? 606  ARG A C   1 
ATOM   4980 O  O   . ARG A 1 606 ? 22.429 40.437  60.948 1.00 100.14 ? 606  ARG A O   1 
ATOM   4981 C  CB  . ARG A 1 606 ? 25.091 39.036  61.860 1.00 100.34 ? 606  ARG A CB  1 
ATOM   4982 C  CG  . ARG A 1 606 ? 26.519 38.542  61.549 1.00 102.06 ? 606  ARG A CG  1 
ATOM   4983 C  CD  . ARG A 1 606 ? 26.657 37.004  61.658 1.00 104.72 ? 606  ARG A CD  1 
ATOM   4984 N  NE  . ARG A 1 606 ? 26.747 36.364  60.341 1.00 107.51 ? 606  ARG A NE  1 
ATOM   4985 C  CZ  . ARG A 1 606 ? 26.632 35.054  60.116 1.00 109.06 ? 606  ARG A CZ  1 
ATOM   4986 N  NH1 . ARG A 1 606 ? 26.411 34.211  61.119 1.00 109.62 ? 606  ARG A NH1 1 
ATOM   4987 N  NH2 . ARG A 1 606 ? 26.756 34.581  58.880 1.00 109.20 ? 606  ARG A NH2 1 
ATOM   4988 N  N   . GLY A 1 607 ? 23.027 41.382  62.910 1.00 99.20  ? 607  GLY A N   1 
ATOM   4989 C  CA  . GLY A 1 607 ? 21.669 41.646  63.295 1.00 99.43  ? 607  GLY A CA  1 
ATOM   4990 C  C   . GLY A 1 607 ? 20.708 42.147  62.239 1.00 100.60 ? 607  GLY A C   1 
ATOM   4991 O  O   . GLY A 1 607 ? 19.753 41.460  61.884 1.00 100.42 ? 607  GLY A O   1 
ATOM   4992 N  N   . LEU A 1 608 ? 20.973 43.347  61.729 1.00 101.82 ? 608  LEU A N   1 
ATOM   4993 C  CA  . LEU A 1 608 ? 20.081 44.011  60.781 1.00 102.92 ? 608  LEU A CA  1 
ATOM   4994 C  C   . LEU A 1 608 ? 20.737 44.557  59.525 1.00 104.21 ? 608  LEU A C   1 
ATOM   4995 O  O   . LEU A 1 608 ? 20.983 45.756  59.407 1.00 104.11 ? 608  LEU A O   1 
ATOM   4996 C  CB  . LEU A 1 608 ? 19.345 45.139  61.531 1.00 101.94 ? 608  LEU A CB  1 
ATOM   4997 C  CG  . LEU A 1 608 ? 20.090 46.320  62.197 1.00 100.96 ? 608  LEU A CG  1 
ATOM   4998 C  CD1 . LEU A 1 608 ? 21.525 45.948  62.584 1.00 99.32  ? 608  LEU A CD1 1 
ATOM   4999 C  CD2 . LEU A 1 608 ? 20.065 47.492  61.242 1.00 100.88 ? 608  LEU A CD2 1 
ATOM   5000 N  N   . GLU A 1 609 ? 21.029 43.664  58.592 1.00 106.14 ? 609  GLU A N   1 
ATOM   5001 C  CA  . GLU A 1 609 ? 21.650 44.063  57.341 1.00 108.10 ? 609  GLU A CA  1 
ATOM   5002 C  C   . GLU A 1 609 ? 20.587 44.695  56.448 1.00 108.78 ? 609  GLU A C   1 
ATOM   5003 O  O   . GLU A 1 609 ? 20.310 45.891  56.550 1.00 108.21 ? 609  GLU A O   1 
ATOM   5004 C  CB  . GLU A 1 609 ? 22.261 42.843  56.647 1.00 108.75 ? 609  GLU A CB  1 
ATOM   5005 C  CG  . GLU A 1 609 ? 23.352 42.156  57.459 1.00 109.19 ? 609  GLU A CG  1 
ATOM   5006 C  CD  . GLU A 1 609 ? 23.681 40.770  56.940 1.00 109.80 ? 609  GLU A CD  1 
ATOM   5007 O  OE1 . GLU A 1 609 ? 22.812 39.875  57.043 1.00 109.27 ? 609  GLU A OE1 1 
ATOM   5008 O  OE2 . GLU A 1 609 ? 24.803 40.577  56.425 1.00 110.36 ? 609  GLU A OE2 1 
ATOM   5009 N  N   . ILE A 1 610 ? 19.986 43.875  55.588 1.00 110.19 ? 610  ILE A N   1 
ATOM   5010 C  CA  . ILE A 1 610 ? 18.934 44.314  54.671 1.00 111.21 ? 610  ILE A CA  1 
ATOM   5011 C  C   . ILE A 1 610 ? 19.416 45.369  53.667 1.00 111.55 ? 610  ILE A C   1 
ATOM   5012 O  O   . ILE A 1 610 ? 18.856 46.465  53.581 1.00 111.67 ? 610  ILE A O   1 
ATOM   5013 C  CB  . ILE A 1 610 ? 17.737 44.843  55.474 1.00 111.00 ? 610  ILE A CB  1 
ATOM   5014 N  N   . VAL A 1 611 ? 20.450 45.026  52.903 1.00 111.63 ? 611  VAL A N   1 
ATOM   5015 C  CA  . VAL A 1 611 ? 21.009 45.930  51.899 1.00 111.69 ? 611  VAL A CA  1 
ATOM   5016 C  C   . VAL A 1 611 ? 19.938 46.260  50.843 1.00 112.65 ? 611  VAL A C   1 
ATOM   5017 O  O   . VAL A 1 611 ? 18.751 45.980  51.039 1.00 112.62 ? 611  VAL A O   1 
ATOM   5018 C  CB  . VAL A 1 611 ? 22.248 45.283  51.211 1.00 110.77 ? 611  VAL A CB  1 
ATOM   5019 C  CG1 . VAL A 1 611 ? 23.029 46.320  50.414 1.00 109.79 ? 611  VAL A CG1 1 
ATOM   5020 C  CG2 . VAL A 1 611 ? 23.141 44.644  52.261 1.00 110.25 ? 611  VAL A CG2 1 
ATOM   5021 N  N   . ARG A 1 612 ? 20.363 46.865  49.735 1.00 113.32 ? 612  ARG A N   1 
ATOM   5022 C  CA  . ARG A 1 612 ? 19.469 47.239  48.634 1.00 113.31 ? 612  ARG A CA  1 
ATOM   5023 C  C   . ARG A 1 612 ? 20.164 46.826  47.340 1.00 113.48 ? 612  ARG A C   1 
ATOM   5024 O  O   . ARG A 1 612 ? 20.197 47.589  46.370 1.00 113.42 ? 612  ARG A O   1 
ATOM   5025 C  CB  . ARG A 1 612 ? 19.241 48.759  48.625 1.00 112.80 ? 612  ARG A CB  1 
ATOM   5026 C  CG  . ARG A 1 612 ? 18.685 49.329  49.928 1.00 112.25 ? 612  ARG A CG  1 
ATOM   5027 C  CD  . ARG A 1 612 ? 17.162 49.263  49.990 1.00 110.92 ? 612  ARG A CD  1 
ATOM   5028 N  NE  . ARG A 1 612 ? 16.537 50.493  49.505 1.00 109.33 ? 612  ARG A NE  1 
ATOM   5029 C  CZ  . ARG A 1 612 ? 16.626 51.671  50.117 1.00 108.29 ? 612  ARG A CZ  1 
ATOM   5030 N  NH1 . ARG A 1 612 ? 17.315 51.792  51.244 1.00 107.62 ? 612  ARG A NH1 1 
ATOM   5031 N  NH2 . ARG A 1 612 ? 16.019 52.731  49.603 1.00 107.72 ? 612  ARG A NH2 1 
ATOM   5032 N  N   . ARG A 1 613 ? 20.717 45.615  47.338 1.00 113.48 ? 613  ARG A N   1 
ATOM   5033 C  CA  . ARG A 1 613 ? 21.453 45.098  46.188 1.00 113.12 ? 613  ARG A CA  1 
ATOM   5034 C  C   . ARG A 1 613 ? 22.712 45.952  46.053 1.00 112.41 ? 613  ARG A C   1 
ATOM   5035 O  O   . ARG A 1 613 ? 23.779 45.592  46.558 1.00 111.98 ? 613  ARG A O   1 
ATOM   5036 C  CB  . ARG A 1 613 ? 20.602 45.187  44.919 1.00 113.28 ? 613  ARG A CB  1 
ATOM   5037 N  N   . ASP A 1 614 ? 22.578 47.091  45.380 1.00 111.62 ? 614  ASP A N   1 
ATOM   5038 C  CA  . ASP A 1 614 ? 23.696 48.010  45.204 1.00 110.84 ? 614  ASP A CA  1 
ATOM   5039 C  C   . ASP A 1 614 ? 23.816 48.833  46.482 1.00 109.87 ? 614  ASP A C   1 
ATOM   5040 O  O   . ASP A 1 614 ? 23.058 48.624  47.432 1.00 109.86 ? 614  ASP A O   1 
ATOM   5041 C  CB  . ASP A 1 614 ? 23.443 48.922  44.015 1.00 110.74 ? 614  ASP A CB  1 
ATOM   5042 N  N   . TRP A 1 615 ? 24.757 49.769  46.516 1.00 108.63 ? 615  TRP A N   1 
ATOM   5043 C  CA  . TRP A 1 615 ? 24.930 50.588  47.709 1.00 107.64 ? 615  TRP A CA  1 
ATOM   5044 C  C   . TRP A 1 615 ? 23.752 51.518  47.992 1.00 106.28 ? 615  TRP A C   1 
ATOM   5045 O  O   . TRP A 1 615 ? 23.874 52.437  48.801 1.00 106.93 ? 615  TRP A O   1 
ATOM   5046 C  CB  . TRP A 1 615 ? 26.228 51.403  47.616 1.00 107.57 ? 615  TRP A CB  1 
ATOM   5047 C  CG  . TRP A 1 615 ? 27.403 50.741  48.296 1.00 108.06 ? 615  TRP A CG  1 
ATOM   5048 C  CD1 . TRP A 1 615 ? 27.453 49.466  48.802 1.00 107.96 ? 615  TRP A CD1 1 
ATOM   5049 C  CD2 . TRP A 1 615 ? 28.709 51.305  48.506 1.00 108.36 ? 615  TRP A CD2 1 
ATOM   5050 N  NE1 . TRP A 1 615 ? 28.705 49.205  49.307 1.00 108.03 ? 615  TRP A NE1 1 
ATOM   5051 C  CE2 . TRP A 1 615 ? 29.493 50.312  49.140 1.00 108.18 ? 615  TRP A CE2 1 
ATOM   5052 C  CE3 . TRP A 1 615 ? 29.290 52.550  48.221 1.00 107.74 ? 615  TRP A CE3 1 
ATOM   5053 C  CZ2 . TRP A 1 615 ? 30.836 50.529  49.488 1.00 107.28 ? 615  TRP A CZ2 1 
ATOM   5054 C  CZ3 . TRP A 1 615 ? 30.625 52.763  48.570 1.00 106.51 ? 615  TRP A CZ3 1 
ATOM   5055 C  CH2 . TRP A 1 615 ? 31.379 51.756  49.197 1.00 106.52 ? 615  TRP A CH2 1 
ATOM   5056 N  N   . SER A 1 616 ? 22.616 51.269  47.343 1.00 103.97 ? 616  SER A N   1 
ATOM   5057 C  CA  . SER A 1 616 ? 21.418 52.092  47.519 1.00 101.38 ? 616  SER A CA  1 
ATOM   5058 C  C   . SER A 1 616 ? 21.677 53.555  47.153 1.00 99.73  ? 616  SER A C   1 
ATOM   5059 O  O   . SER A 1 616 ? 20.959 54.128  46.332 1.00 98.68  ? 616  SER A O   1 
ATOM   5060 C  CB  . SER A 1 616 ? 20.923 52.008  48.964 1.00 101.31 ? 616  SER A CB  1 
ATOM   5061 O  OG  . SER A 1 616 ? 19.777 52.814  49.141 1.00 100.42 ? 616  SER A OG  1 
ATOM   5062 N  N   . GLU A 1 617 ? 22.704 54.134  47.784 1.00 98.83  ? 617  GLU A N   1 
ATOM   5063 C  CA  . GLU A 1 617 ? 23.157 55.517  47.585 1.00 97.40  ? 617  GLU A CA  1 
ATOM   5064 C  C   . GLU A 1 617 ? 23.833 56.101  48.841 1.00 96.00  ? 617  GLU A C   1 
ATOM   5065 O  O   . GLU A 1 617 ? 24.963 55.736  49.188 1.00 95.47  ? 617  GLU A O   1 
ATOM   5066 C  CB  . GLU A 1 617 ? 21.986 56.416  47.157 1.00 98.14  ? 617  GLU A CB  1 
ATOM   5067 N  N   . ILE A 1 618 ? 23.125 57.013  49.505 1.00 94.29  ? 618  ILE A N   1 
ATOM   5068 C  CA  . ILE A 1 618 ? 23.602 57.681  50.714 1.00 92.60  ? 618  ILE A CA  1 
ATOM   5069 C  C   . ILE A 1 618 ? 23.339 56.816  51.936 1.00 92.20  ? 618  ILE A C   1 
ATOM   5070 O  O   . ILE A 1 618 ? 24.100 56.848  52.901 1.00 91.94  ? 618  ILE A O   1 
ATOM   5071 C  CB  . ILE A 1 618 ? 22.880 59.035  50.931 1.00 92.38  ? 618  ILE A CB  1 
ATOM   5072 C  CG1 . ILE A 1 618 ? 23.135 59.962  49.744 1.00 91.77  ? 618  ILE A CG1 1 
ATOM   5073 C  CG2 . ILE A 1 618 ? 23.343 59.683  52.235 1.00 91.32  ? 618  ILE A CG2 1 
ATOM   5074 C  CD1 . ILE A 1 618 ? 22.440 61.303  49.851 1.00 91.14  ? 618  ILE A CD1 1 
ATOM   5075 N  N   . ALA A 1 619 ? 22.251 56.055  51.897 1.00 92.04  ? 619  ALA A N   1 
ATOM   5076 C  CA  . ALA A 1 619 ? 21.904 55.188  53.013 1.00 92.05  ? 619  ALA A CA  1 
ATOM   5077 C  C   . ALA A 1 619 ? 23.053 54.233  53.339 1.00 92.25  ? 619  ALA A C   1 
ATOM   5078 O  O   . ALA A 1 619 ? 23.501 54.159  54.484 1.00 92.13  ? 619  ALA A O   1 
ATOM   5079 C  CB  . ALA A 1 619 ? 20.638 54.400  52.688 1.00 92.82  ? 619  ALA A CB  1 
ATOM   5080 N  N   . LYS A 1 620 ? 23.532 53.507  52.331 1.00 91.74  ? 620  LYS A N   1 
ATOM   5081 C  CA  . LYS A 1 620 ? 24.620 52.558  52.534 1.00 90.76  ? 620  LYS A CA  1 
ATOM   5082 C  C   . LYS A 1 620 ? 25.909 53.229  52.970 1.00 90.36  ? 620  LYS A C   1 
ATOM   5083 O  O   . LYS A 1 620 ? 26.908 52.554  53.215 1.00 91.29  ? 620  LYS A O   1 
ATOM   5084 C  CB  . LYS A 1 620 ? 24.872 51.748  51.262 1.00 90.62  ? 620  LYS A CB  1 
ATOM   5085 C  CG  . LYS A 1 620 ? 23.825 50.676  50.981 1.00 91.24  ? 620  LYS A CG  1 
ATOM   5086 C  CD  . LYS A 1 620 ? 24.176 49.319  51.601 1.00 91.85  ? 620  LYS A CD  1 
ATOM   5087 C  CE  . LYS A 1 620 ? 24.286 49.370  53.121 1.00 91.71  ? 620  LYS A CE  1 
ATOM   5088 N  NZ  . LYS A 1 620 ? 24.191 48.011  53.731 1.00 91.36  ? 620  LYS A NZ  1 
ATOM   5089 N  N   . GLU A 1 621 ? 25.893 54.554  53.066 1.00 89.24  ? 621  GLU A N   1 
ATOM   5090 C  CA  . GLU A 1 621 ? 27.079 55.289  53.490 1.00 88.26  ? 621  GLU A CA  1 
ATOM   5091 C  C   . GLU A 1 621 ? 26.870 55.906  54.871 1.00 87.18  ? 621  GLU A C   1 
ATOM   5092 O  O   . GLU A 1 621 ? 27.716 55.755  55.754 1.00 87.74  ? 621  GLU A O   1 
ATOM   5093 C  CB  . GLU A 1 621 ? 27.442 56.370  52.463 1.00 89.15  ? 621  GLU A CB  1 
ATOM   5094 C  CG  . GLU A 1 621 ? 27.670 55.820  51.048 1.00 90.68  ? 621  GLU A CG  1 
ATOM   5095 C  CD  . GLU A 1 621 ? 28.634 56.661  50.218 1.00 90.70  ? 621  GLU A CD  1 
ATOM   5096 O  OE1 . GLU A 1 621 ? 28.418 57.887  50.095 1.00 90.26  ? 621  GLU A OE1 1 
ATOM   5097 O  OE2 . GLU A 1 621 ? 29.608 56.087  49.683 1.00 90.57  ? 621  GLU A OE2 1 
ATOM   5098 N  N   . THR A 1 622 ? 25.744 56.590  55.062 1.00 85.14  ? 622  THR A N   1 
ATOM   5099 C  CA  . THR A 1 622 ? 25.439 57.198  56.355 1.00 82.68  ? 622  THR A CA  1 
ATOM   5100 C  C   . THR A 1 622 ? 25.094 56.117  57.374 1.00 81.28  ? 622  THR A C   1 
ATOM   5101 O  O   . THR A 1 622 ? 25.121 56.354  58.583 1.00 81.02  ? 622  THR A O   1 
ATOM   5102 C  CB  . THR A 1 622 ? 24.273 58.196  56.251 1.00 82.86  ? 622  THR A CB  1 
ATOM   5103 O  OG1 . THR A 1 622 ? 23.285 57.685  55.347 1.00 83.18  ? 622  THR A OG1 1 
ATOM   5104 C  CG2 . THR A 1 622 ? 24.774 59.546  55.757 1.00 83.16  ? 622  THR A CG2 1 
ATOM   5105 N  N   . GLN A 1 623 ? 24.765 54.929  56.871 1.00 80.09  ? 623  GLN A N   1 
ATOM   5106 C  CA  . GLN A 1 623 ? 24.445 53.783  57.719 1.00 78.58  ? 623  GLN A CA  1 
ATOM   5107 C  C   . GLN A 1 623 ? 25.690 53.512  58.551 1.00 78.02  ? 623  GLN A C   1 
ATOM   5108 O  O   . GLN A 1 623 ? 25.627 53.364  59.773 1.00 76.65  ? 623  GLN A O   1 
ATOM   5109 C  CB  . GLN A 1 623 ? 24.136 52.555  56.852 1.00 77.79  ? 623  GLN A CB  1 
ATOM   5110 C  CG  . GLN A 1 623 ? 23.990 51.238  57.616 1.00 76.27  ? 623  GLN A CG  1 
ATOM   5111 C  CD  . GLN A 1 623 ? 22.622 51.061  58.254 1.00 74.49  ? 623  GLN A CD  1 
ATOM   5112 O  OE1 . GLN A 1 623 ? 22.207 51.851  59.100 1.00 73.22  ? 623  GLN A OE1 1 
ATOM   5113 N  NE2 . GLN A 1 623 ? 21.916 50.012  57.849 1.00 73.98  ? 623  GLN A NE2 1 
ATOM   5114 N  N   . ALA A 1 624 ? 26.823 53.457  57.853 1.00 77.96  ? 624  ALA A N   1 
ATOM   5115 C  CA  . ALA A 1 624 ? 28.128 53.211  58.460 1.00 76.63  ? 624  ALA A CA  1 
ATOM   5116 C  C   . ALA A 1 624 ? 28.480 54.356  59.397 1.00 74.89  ? 624  ALA A C   1 
ATOM   5117 O  O   . ALA A 1 624 ? 28.950 54.142  60.516 1.00 74.17  ? 624  ALA A O   1 
ATOM   5118 C  CB  . ALA A 1 624 ? 29.195 53.075  57.365 1.00 76.06  ? 624  ALA A CB  1 
ATOM   5119 N  N   . ARG A 1 625 ? 28.251 55.573  58.922 1.00 73.75  ? 625  ARG A N   1 
ATOM   5120 C  CA  . ARG A 1 625 ? 28.532 56.766  59.703 1.00 72.83  ? 625  ARG A CA  1 
ATOM   5121 C  C   . ARG A 1 625 ? 27.979 56.543  61.105 1.00 71.07  ? 625  ARG A C   1 
ATOM   5122 O  O   . ARG A 1 625 ? 28.707 56.606  62.102 1.00 70.72  ? 625  ARG A O   1 
ATOM   5123 C  CB  . ARG A 1 625 ? 27.857 57.975  59.053 1.00 74.34  ? 625  ARG A CB  1 
ATOM   5124 C  CG  . ARG A 1 625 ? 28.182 58.144  57.570 1.00 75.36  ? 625  ARG A CG  1 
ATOM   5125 C  CD  . ARG A 1 625 ? 29.402 59.016  57.336 1.00 76.97  ? 625  ARG A CD  1 
ATOM   5126 N  NE  . ARG A 1 625 ? 29.142 60.426  57.632 1.00 79.03  ? 625  ARG A NE  1 
ATOM   5127 C  CZ  . ARG A 1 625 ? 28.321 61.209  56.936 1.00 79.18  ? 625  ARG A CZ  1 
ATOM   5128 N  NH1 . ARG A 1 625 ? 27.664 60.734  55.885 1.00 79.45  ? 625  ARG A NH1 1 
ATOM   5129 N  NH2 . ARG A 1 625 ? 28.159 62.475  57.295 1.00 79.51  ? 625  ARG A NH2 1 
ATOM   5130 N  N   . VAL A 1 626 ? 26.685 56.261  61.164 1.00 68.74  ? 626  VAL A N   1 
ATOM   5131 C  CA  . VAL A 1 626 ? 26.014 56.015  62.425 1.00 67.49  ? 626  VAL A CA  1 
ATOM   5132 C  C   . VAL A 1 626 ? 26.683 54.900  63.217 1.00 66.33  ? 626  VAL A C   1 
ATOM   5133 O  O   . VAL A 1 626 ? 27.264 55.142  64.271 1.00 67.45  ? 626  VAL A O   1 
ATOM   5134 C  CB  . VAL A 1 626 ? 24.563 55.630  62.188 1.00 68.02  ? 626  VAL A CB  1 
ATOM   5135 C  CG1 . VAL A 1 626 ? 23.875 55.372  63.520 1.00 68.27  ? 626  VAL A CG1 1 
ATOM   5136 C  CG2 . VAL A 1 626 ? 23.866 56.735  61.404 1.00 68.70  ? 626  VAL A CG2 1 
ATOM   5137 N  N   . LEU A 1 627 ? 26.592 53.677  62.707 1.00 65.07  ? 627  LEU A N   1 
ATOM   5138 C  CA  . LEU A 1 627 ? 27.183 52.513  63.366 1.00 63.47  ? 627  LEU A CA  1 
ATOM   5139 C  C   . LEU A 1 627 ? 28.571 52.804  63.927 1.00 63.34  ? 627  LEU A C   1 
ATOM   5140 O  O   . LEU A 1 627 ? 28.848 52.546  65.103 1.00 62.45  ? 627  LEU A O   1 
ATOM   5141 C  CB  . LEU A 1 627 ? 27.263 51.347  62.379 1.00 62.28  ? 627  LEU A CB  1 
ATOM   5142 C  CG  . LEU A 1 627 ? 25.919 50.852  61.846 1.00 61.63  ? 627  LEU A CG  1 
ATOM   5143 C  CD1 . LEU A 1 627 ? 26.128 49.969  60.630 1.00 60.65  ? 627  LEU A CD1 1 
ATOM   5144 C  CD2 . LEU A 1 627 ? 25.190 50.111  62.951 1.00 60.60  ? 627  LEU A CD2 1 
ATOM   5145 N  N   . GLU A 1 628 ? 29.443 53.347  63.085 1.00 63.37  ? 628  GLU A N   1 
ATOM   5146 C  CA  . GLU A 1 628 ? 30.797 53.661  63.507 1.00 63.61  ? 628  GLU A CA  1 
ATOM   5147 C  C   . GLU A 1 628 ? 30.779 54.640  64.678 1.00 63.15  ? 628  GLU A C   1 
ATOM   5148 O  O   . GLU A 1 628 ? 31.579 54.525  65.613 1.00 62.08  ? 628  GLU A O   1 
ATOM   5149 C  CB  . GLU A 1 628 ? 31.587 54.252  62.344 1.00 64.63  ? 628  GLU A CB  1 
ATOM   5150 C  CG  . GLU A 1 628 ? 32.901 53.545  62.080 1.00 67.24  ? 628  GLU A CG  1 
ATOM   5151 C  CD  . GLU A 1 628 ? 33.825 54.355  61.193 1.00 70.70  ? 628  GLU A CD  1 
ATOM   5152 O  OE1 . GLU A 1 628 ? 33.385 54.780  60.097 1.00 72.14  ? 628  GLU A OE1 1 
ATOM   5153 O  OE2 . GLU A 1 628 ? 34.994 54.565  61.591 1.00 72.57  ? 628  GLU A OE2 1 
ATOM   5154 N  N   . ALA A 1 629 ? 29.861 55.601  64.623 1.00 62.64  ? 629  ALA A N   1 
ATOM   5155 C  CA  . ALA A 1 629 ? 29.731 56.596  65.682 1.00 62.15  ? 629  ALA A CA  1 
ATOM   5156 C  C   . ALA A 1 629 ? 29.178 55.969  66.959 1.00 61.78  ? 629  ALA A C   1 
ATOM   5157 O  O   . ALA A 1 629 ? 29.510 56.396  68.068 1.00 61.46  ? 629  ALA A O   1 
ATOM   5158 C  CB  . ALA A 1 629 ? 28.828 57.731  65.222 1.00 61.54  ? 629  ALA A CB  1 
ATOM   5159 N  N   . LEU A 1 630 ? 28.342 54.949  66.796 1.00 61.23  ? 630  LEU A N   1 
ATOM   5160 C  CA  . LEU A 1 630 ? 27.736 54.263  67.930 1.00 62.38  ? 630  LEU A CA  1 
ATOM   5161 C  C   . LEU A 1 630 ? 28.688 53.290  68.602 1.00 63.76  ? 630  LEU A C   1 
ATOM   5162 O  O   . LEU A 1 630 ? 28.806 53.264  69.828 1.00 62.48  ? 630  LEU A O   1 
ATOM   5163 C  CB  . LEU A 1 630 ? 26.479 53.513  67.484 1.00 60.55  ? 630  LEU A CB  1 
ATOM   5164 C  CG  . LEU A 1 630 ? 25.152 54.265  67.580 1.00 58.04  ? 630  LEU A CG  1 
ATOM   5165 C  CD1 . LEU A 1 630 ? 24.058 53.465  66.891 1.00 56.10  ? 630  LEU A CD1 1 
ATOM   5166 C  CD2 . LEU A 1 630 ? 24.816 54.511  69.049 1.00 55.63  ? 630  LEU A CD2 1 
ATOM   5167 N  N   . LEU A 1 631 ? 29.358 52.483  67.792 1.00 66.33  ? 631  LEU A N   1 
ATOM   5168 C  CA  . LEU A 1 631 ? 30.294 51.504  68.315 1.00 69.98  ? 631  LEU A CA  1 
ATOM   5169 C  C   . LEU A 1 631 ? 31.616 52.139  68.732 1.00 72.66  ? 631  LEU A C   1 
ATOM   5170 O  O   . LEU A 1 631 ? 31.840 52.409  69.915 1.00 73.58  ? 631  LEU A O   1 
ATOM   5171 C  CB  . LEU A 1 631 ? 30.561 50.413  67.274 1.00 69.72  ? 631  LEU A CB  1 
ATOM   5172 C  CG  . LEU A 1 631 ? 29.456 49.392  66.997 1.00 70.00  ? 631  LEU A CG  1 
ATOM   5173 C  CD1 . LEU A 1 631 ? 29.916 48.443  65.908 1.00 70.73  ? 631  LEU A CD1 1 
ATOM   5174 C  CD2 . LEU A 1 631 ? 29.127 48.619  68.263 1.00 70.01  ? 631  LEU A CD2 1 
ATOM   5175 N  N   . LYS A 1 632 ? 32.480 52.373  67.744 1.00 75.18  ? 632  LYS A N   1 
ATOM   5176 C  CA  . LYS A 1 632 ? 33.807 52.950  67.958 1.00 76.03  ? 632  LYS A CA  1 
ATOM   5177 C  C   . LYS A 1 632 ? 33.767 54.211  68.797 1.00 76.48  ? 632  LYS A C   1 
ATOM   5178 O  O   . LYS A 1 632 ? 34.275 54.254  69.924 1.00 76.65  ? 632  LYS A O   1 
ATOM   5179 C  CB  . LYS A 1 632 ? 34.468 53.255  66.608 1.00 76.05  ? 632  LYS A CB  1 
ATOM   5180 C  CG  . LYS A 1 632 ? 35.914 53.735  66.701 1.00 76.20  ? 632  LYS A CG  1 
ATOM   5181 C  CD  . LYS A 1 632 ? 36.592 53.684  65.339 1.00 76.14  ? 632  LYS A CD  1 
ATOM   5182 C  CE  . LYS A 1 632 ? 36.662 52.250  64.823 1.00 76.68  ? 632  LYS A CE  1 
ATOM   5183 N  NZ  . LYS A 1 632 ? 37.250 52.138  63.462 1.00 77.09  ? 632  LYS A NZ  1 
ATOM   5184 N  N   . ASP A 1 633 ? 33.160 55.245  68.238 1.00 76.88  ? 633  ASP A N   1 
ATOM   5185 C  CA  . ASP A 1 633 ? 33.071 56.500  68.941 1.00 77.54  ? 633  ASP A CA  1 
ATOM   5186 C  C   . ASP A 1 633 ? 32.304 56.281  70.239 1.00 77.15  ? 633  ASP A C   1 
ATOM   5187 O  O   . ASP A 1 633 ? 32.632 56.868  71.266 1.00 76.93  ? 633  ASP A O   1 
ATOM   5188 C  CB  . ASP A 1 633 ? 32.396 57.541  68.042 1.00 78.67  ? 633  ASP A CB  1 
ATOM   5189 C  CG  . ASP A 1 633 ? 33.122 57.716  66.700 1.00 79.91  ? 633  ASP A CG  1 
ATOM   5190 O  OD1 . ASP A 1 633 ? 34.372 57.811  66.697 1.00 79.13  ? 633  ASP A OD1 1 
ATOM   5191 O  OD2 . ASP A 1 633 ? 32.445 57.766  65.647 1.00 80.56  ? 633  ASP A OD2 1 
ATOM   5192 N  N   . GLY A 1 634 ? 31.307 55.403  70.198 1.00 77.58  ? 634  GLY A N   1 
ATOM   5193 C  CA  . GLY A 1 634 ? 30.522 55.128  71.389 1.00 77.88  ? 634  GLY A CA  1 
ATOM   5194 C  C   . GLY A 1 634 ? 29.908 56.409  71.903 1.00 78.08  ? 634  GLY A C   1 
ATOM   5195 O  O   . GLY A 1 634 ? 29.792 56.626  73.109 1.00 77.11  ? 634  GLY A O   1 
ATOM   5196 N  N   . ASP A 1 635 ? 29.515 57.258  70.960 1.00 79.58  ? 635  ASP A N   1 
ATOM   5197 C  CA  . ASP A 1 635 ? 28.920 58.550  71.262 1.00 81.15  ? 635  ASP A CA  1 
ATOM   5198 C  C   . ASP A 1 635 ? 27.465 58.548  70.818 1.00 81.91  ? 635  ASP A C   1 
ATOM   5199 O  O   . ASP A 1 635 ? 27.152 58.867  69.675 1.00 82.35  ? 635  ASP A O   1 
ATOM   5200 C  CB  . ASP A 1 635 ? 29.680 59.654  70.520 1.00 81.70  ? 635  ASP A CB  1 
ATOM   5201 C  CG  . ASP A 1 635 ? 29.911 60.886  71.372 1.00 82.34  ? 635  ASP A CG  1 
ATOM   5202 O  OD1 . ASP A 1 635 ? 28.933 61.377  71.977 1.00 83.11  ? 635  ASP A OD1 1 
ATOM   5203 O  OD2 . ASP A 1 635 ? 31.069 61.365  71.427 1.00 81.14  ? 635  ASP A OD2 1 
ATOM   5204 N  N   . VAL A 1 636 ? 26.579 58.175  71.727 1.00 83.30  ? 636  VAL A N   1 
ATOM   5205 C  CA  . VAL A 1 636 ? 25.155 58.137  71.430 1.00 84.84  ? 636  VAL A CA  1 
ATOM   5206 C  C   . VAL A 1 636 ? 24.664 59.452  70.823 1.00 85.05  ? 636  VAL A C   1 
ATOM   5207 O  O   . VAL A 1 636 ? 24.124 59.476  69.720 1.00 83.79  ? 636  VAL A O   1 
ATOM   5208 C  CB  . VAL A 1 636 ? 24.337 57.849  72.714 1.00 86.45  ? 636  VAL A CB  1 
ATOM   5209 C  CG1 . VAL A 1 636 ? 24.466 56.381  73.097 1.00 85.98  ? 636  VAL A CG1 1 
ATOM   5210 C  CG2 . VAL A 1 636 ? 24.837 58.739  73.864 1.00 86.48  ? 636  VAL A CG2 1 
ATOM   5211 N  N   . GLU A 1 637 ? 24.864 60.545  71.551 1.00 86.47  ? 637  GLU A N   1 
ATOM   5212 C  CA  . GLU A 1 637 ? 24.424 61.859  71.100 1.00 87.97  ? 637  GLU A CA  1 
ATOM   5213 C  C   . GLU A 1 637 ? 25.206 62.383  69.910 1.00 88.28  ? 637  GLU A C   1 
ATOM   5214 O  O   . GLU A 1 637 ? 25.236 63.588  69.666 1.00 88.80  ? 637  GLU A O   1 
ATOM   5215 C  CB  . GLU A 1 637 ? 24.501 62.866  72.251 1.00 88.67  ? 637  GLU A CB  1 
ATOM   5216 C  CG  . GLU A 1 637 ? 23.545 62.550  73.392 1.00 89.47  ? 637  GLU A CG  1 
ATOM   5217 C  CD  . GLU A 1 637 ? 23.498 63.636  74.446 1.00 89.64  ? 637  GLU A CD  1 
ATOM   5218 O  OE1 . GLU A 1 637 ? 23.218 64.800  74.088 1.00 90.00  ? 637  GLU A OE1 1 
ATOM   5219 O  OE2 . GLU A 1 637 ? 23.732 63.324  75.634 1.00 90.05  ? 637  GLU A OE2 1 
ATOM   5220 N  N   . LYS A 1 638 ? 25.837 61.478  69.172 1.00 88.22  ? 638  LYS A N   1 
ATOM   5221 C  CA  . LYS A 1 638 ? 26.603 61.867  67.999 1.00 88.49  ? 638  LYS A CA  1 
ATOM   5222 C  C   . LYS A 1 638 ? 25.995 61.299  66.727 1.00 88.58  ? 638  LYS A C   1 
ATOM   5223 O  O   . LYS A 1 638 ? 25.653 62.050  65.819 1.00 88.90  ? 638  LYS A O   1 
ATOM   5224 C  CB  . LYS A 1 638 ? 28.056 61.414  68.138 1.00 88.99  ? 638  LYS A CB  1 
ATOM   5225 C  CG  . LYS A 1 638 ? 29.013 62.511  68.599 1.00 90.39  ? 638  LYS A CG  1 
ATOM   5226 C  CD  . LYS A 1 638 ? 28.489 63.260  69.820 1.00 91.35  ? 638  LYS A CD  1 
ATOM   5227 C  CE  . LYS A 1 638 ? 29.556 64.167  70.423 1.00 91.35  ? 638  LYS A CE  1 
ATOM   5228 N  NZ  . LYS A 1 638 ? 30.072 65.172  69.456 1.00 91.76  ? 638  LYS A NZ  1 
ATOM   5229 N  N   . ALA A 1 639 ? 25.855 59.978  66.663 1.00 88.92  ? 639  ALA A N   1 
ATOM   5230 C  CA  . ALA A 1 639 ? 25.277 59.321  65.491 1.00 88.53  ? 639  ALA A CA  1 
ATOM   5231 C  C   . ALA A 1 639 ? 23.903 59.902  65.181 1.00 88.78  ? 639  ALA A C   1 
ATOM   5232 O  O   . ALA A 1 639 ? 23.567 60.143  64.025 1.00 88.08  ? 639  ALA A O   1 
ATOM   5233 C  CB  . ALA A 1 639 ? 25.166 57.821  65.728 1.00 87.74  ? 639  ALA A CB  1 
ATOM   5234 N  N   . VAL A 1 640 ? 23.106 60.122  66.219 1.00 90.06  ? 640  VAL A N   1 
ATOM   5235 C  CA  . VAL A 1 640 ? 21.784 60.694  66.028 1.00 91.48  ? 640  VAL A CA  1 
ATOM   5236 C  C   . VAL A 1 640 ? 21.967 62.134  65.585 1.00 92.49  ? 640  VAL A C   1 
ATOM   5237 O  O   . VAL A 1 640 ? 21.195 62.642  64.775 1.00 93.33  ? 640  VAL A O   1 
ATOM   5238 C  CB  . VAL A 1 640 ? 20.963 60.676  67.319 1.00 91.98  ? 640  VAL A CB  1 
ATOM   5239 C  CG1 . VAL A 1 640 ? 19.574 61.240  67.053 1.00 91.28  ? 640  VAL A CG1 1 
ATOM   5240 C  CG2 . VAL A 1 640 ? 20.876 59.259  67.850 1.00 92.00  ? 640  VAL A CG2 1 
ATOM   5241 N  N   . ARG A 1 641 ? 22.985 62.798  66.126 1.00 93.34  ? 641  ARG A N   1 
ATOM   5242 C  CA  . ARG A 1 641 ? 23.258 64.172  65.731 1.00 93.71  ? 641  ARG A CA  1 
ATOM   5243 C  C   . ARG A 1 641 ? 23.714 64.176  64.273 1.00 93.60  ? 641  ARG A C   1 
ATOM   5244 O  O   . ARG A 1 641 ? 23.419 65.109  63.531 1.00 93.84  ? 641  ARG A O   1 
ATOM   5245 C  CB  . ARG A 1 641 ? 24.343 64.801  66.610 1.00 93.78  ? 641  ARG A CB  1 
ATOM   5246 C  CG  . ARG A 1 641 ? 23.844 65.382  67.924 1.00 94.00  ? 641  ARG A CG  1 
ATOM   5247 C  CD  . ARG A 1 641 ? 24.698 66.581  68.327 1.00 94.62  ? 641  ARG A CD  1 
ATOM   5248 N  NE  . ARG A 1 641 ? 26.122 66.253  68.399 1.00 95.18  ? 641  ARG A NE  1 
ATOM   5249 C  CZ  . ARG A 1 641 ? 27.104 67.152  68.376 1.00 94.95  ? 641  ARG A CZ  1 
ATOM   5250 N  NH1 . ARG A 1 641 ? 26.828 68.446  68.279 1.00 94.88  ? 641  ARG A NH1 1 
ATOM   5251 N  NH2 . ARG A 1 641 ? 28.366 66.757  68.450 1.00 94.77  ? 641  ARG A NH2 1 
ATOM   5252 N  N   . ILE A 1 642 ? 24.422 63.122  63.869 1.00 93.20  ? 642  ILE A N   1 
ATOM   5253 C  CA  . ILE A 1 642 ? 24.917 62.991  62.500 1.00 93.23  ? 642  ILE A CA  1 
ATOM   5254 C  C   . ILE A 1 642 ? 23.761 62.947  61.506 1.00 94.15  ? 642  ILE A C   1 
ATOM   5255 O  O   . ILE A 1 642 ? 23.922 63.289  60.335 1.00 93.52  ? 642  ILE A O   1 
ATOM   5256 C  CB  . ILE A 1 642 ? 25.759 61.706  62.326 1.00 92.54  ? 642  ILE A CB  1 
ATOM   5257 C  CG1 . ILE A 1 642 ? 26.982 61.755  63.240 1.00 92.71  ? 642  ILE A CG1 1 
ATOM   5258 C  CG2 . ILE A 1 642 ? 26.210 61.566  60.885 1.00 91.58  ? 642  ILE A CG2 1 
ATOM   5259 C  CD1 . ILE A 1 642 ? 27.832 60.503  63.198 1.00 92.67  ? 642  ILE A CD1 1 
ATOM   5260 N  N   . VAL A 1 643 ? 22.595 62.520  61.981 1.00 95.63  ? 643  VAL A N   1 
ATOM   5261 C  CA  . VAL A 1 643 ? 21.406 62.439  61.139 1.00 96.91  ? 643  VAL A CA  1 
ATOM   5262 C  C   . VAL A 1 643 ? 20.792 63.828  60.967 1.00 97.56  ? 643  VAL A C   1 
ATOM   5263 O  O   . VAL A 1 643 ? 20.632 64.314  59.847 1.00 97.31  ? 643  VAL A O   1 
ATOM   5264 C  CB  . VAL A 1 643 ? 20.348 61.495  61.756 1.00 96.82  ? 643  VAL A CB  1 
ATOM   5265 C  CG1 . VAL A 1 643 ? 19.078 61.511  60.912 1.00 97.45  ? 643  VAL A CG1 1 
ATOM   5266 C  CG2 . VAL A 1 643 ? 20.908 60.081  61.854 1.00 96.19  ? 643  VAL A CG2 1 
ATOM   5267 N  N   . LYS A 1 644 ? 20.451 64.458  62.086 1.00 98.32  ? 644  LYS A N   1 
ATOM   5268 C  CA  . LYS A 1 644 ? 19.867 65.791  62.065 1.00 99.23  ? 644  LYS A CA  1 
ATOM   5269 C  C   . LYS A 1 644 ? 20.794 66.783  61.365 1.00 99.95  ? 644  LYS A C   1 
ATOM   5270 O  O   . LYS A 1 644 ? 20.343 67.791  60.821 1.00 100.62 ? 644  LYS A O   1 
ATOM   5271 C  CB  . LYS A 1 644 ? 19.568 66.251  63.499 1.00 98.92  ? 644  LYS A CB  1 
ATOM   5272 C  CG  . LYS A 1 644 ? 20.614 65.831  64.524 1.00 98.07  ? 644  LYS A CG  1 
ATOM   5273 C  CD  . LYS A 1 644 ? 20.129 66.065  65.953 1.00 97.25  ? 644  LYS A CD  1 
ATOM   5274 C  CE  . LYS A 1 644 ? 20.351 67.494  66.413 1.00 96.24  ? 644  LYS A CE  1 
ATOM   5275 N  NZ  . LYS A 1 644 ? 21.799 67.770  66.615 1.00 95.67  ? 644  LYS A NZ  1 
ATOM   5276 N  N   . GLU A 1 645 ? 22.090 66.489  61.370 1.00 100.67 ? 645  GLU A N   1 
ATOM   5277 C  CA  . GLU A 1 645 ? 23.070 67.358  60.727 1.00 101.46 ? 645  GLU A CA  1 
ATOM   5278 C  C   . GLU A 1 645 ? 23.087 67.124  59.214 1.00 101.49 ? 645  GLU A C   1 
ATOM   5279 O  O   . GLU A 1 645 ? 23.510 67.987  58.448 1.00 101.16 ? 645  GLU A O   1 
ATOM   5280 C  CB  . GLU A 1 645 ? 24.466 67.120  61.331 1.00 101.81 ? 645  GLU A CB  1 
ATOM   5281 C  CG  . GLU A 1 645 ? 24.590 67.546  62.805 1.00 102.76 ? 645  GLU A CG  1 
ATOM   5282 C  CD  . GLU A 1 645 ? 25.894 67.100  63.467 1.00 103.37 ? 645  GLU A CD  1 
ATOM   5283 O  OE1 . GLU A 1 645 ? 26.064 67.349  64.683 1.00 102.98 ? 645  GLU A OE1 1 
ATOM   5284 O  OE2 . GLU A 1 645 ? 26.750 66.502  62.780 1.00 103.99 ? 645  GLU A OE2 1 
ATOM   5285 N  N   . VAL A 1 646 ? 22.614 65.955  58.790 1.00 101.85 ? 646  VAL A N   1 
ATOM   5286 C  CA  . VAL A 1 646 ? 22.565 65.610  57.371 1.00 102.18 ? 646  VAL A CA  1 
ATOM   5287 C  C   . VAL A 1 646 ? 21.167 65.872  56.822 1.00 102.47 ? 646  VAL A C   1 
ATOM   5288 O  O   . VAL A 1 646 ? 20.985 66.069  55.621 1.00 102.05 ? 646  VAL A O   1 
ATOM   5289 C  CB  . VAL A 1 646 ? 22.937 64.119  57.137 1.00 102.05 ? 646  VAL A CB  1 
ATOM   5290 C  CG1 . VAL A 1 646 ? 22.717 63.738  55.678 1.00 100.86 ? 646  VAL A CG1 1 
ATOM   5291 C  CG2 . VAL A 1 646 ? 24.389 63.882  57.521 1.00 100.86 ? 646  VAL A CG2 1 
ATOM   5292 N  N   . THR A 1 647 ? 20.177 65.868  57.705 1.00 103.27 ? 647  THR A N   1 
ATOM   5293 C  CA  . THR A 1 647 ? 18.810 66.128  57.283 1.00 104.34 ? 647  THR A CA  1 
ATOM   5294 C  C   . THR A 1 647 ? 18.679 67.623  57.033 1.00 105.01 ? 647  THR A C   1 
ATOM   5295 O  O   . THR A 1 647 ? 17.750 68.074  56.366 1.00 105.32 ? 647  THR A O   1 
ATOM   5296 C  CB  . THR A 1 647 ? 17.778 65.709  58.358 1.00 104.65 ? 647  THR A CB  1 
ATOM   5297 O  OG1 . THR A 1 647 ? 18.015 66.440  59.568 1.00 104.67 ? 647  THR A OG1 1 
ATOM   5298 C  CG2 . THR A 1 647 ? 17.874 64.217  58.636 1.00 105.10 ? 647  THR A CG2 1 
ATOM   5299 N  N   . GLU A 1 648 ? 19.621 68.392  57.573 1.00 105.37 ? 648  GLU A N   1 
ATOM   5300 C  CA  . GLU A 1 648 ? 19.604 69.837  57.398 1.00 105.77 ? 648  GLU A CA  1 
ATOM   5301 C  C   . GLU A 1 648 ? 20.491 70.206  56.214 1.00 106.62 ? 648  GLU A C   1 
ATOM   5302 O  O   . GLU A 1 648 ? 20.726 71.383  55.947 1.00 107.47 ? 648  GLU A O   1 
ATOM   5303 C  CB  . GLU A 1 648 ? 20.099 70.529  58.672 1.00 105.26 ? 648  GLU A CB  1 
ATOM   5304 C  CG  . GLU A 1 648 ? 19.781 72.024  58.751 1.00 104.67 ? 648  GLU A CG  1 
ATOM   5305 C  CD  . GLU A 1 648 ? 20.910 72.911  58.250 1.00 104.17 ? 648  GLU A CD  1 
ATOM   5306 O  OE1 . GLU A 1 648 ? 20.700 74.140  58.158 1.00 103.68 ? 648  GLU A OE1 1 
ATOM   5307 O  OE2 . GLU A 1 648 ? 22.006 72.384  57.958 1.00 103.23 ? 648  GLU A OE2 1 
ATOM   5308 N  N   . LYS A 1 649 ? 20.971 69.190  55.502 1.00 107.13 ? 649  LYS A N   1 
ATOM   5309 C  CA  . LYS A 1 649 ? 21.836 69.401  54.345 1.00 107.21 ? 649  LYS A CA  1 
ATOM   5310 C  C   . LYS A 1 649 ? 21.179 68.939  53.044 1.00 107.56 ? 649  LYS A C   1 
ATOM   5311 O  O   . LYS A 1 649 ? 20.978 69.730  52.124 1.00 107.59 ? 649  LYS A O   1 
ATOM   5312 C  CB  . LYS A 1 649 ? 23.164 68.658  54.536 1.00 106.90 ? 649  LYS A CB  1 
ATOM   5313 C  CG  . LYS A 1 649 ? 23.882 68.977  55.837 1.00 106.77 ? 649  LYS A CG  1 
ATOM   5314 C  CD  . LYS A 1 649 ? 24.257 70.449  55.929 1.00 107.05 ? 649  LYS A CD  1 
ATOM   5315 C  CE  . LYS A 1 649 ? 24.885 70.788  57.278 1.00 106.65 ? 649  LYS A CE  1 
ATOM   5316 N  NZ  . LYS A 1 649 ? 23.945 70.580  58.416 1.00 105.92 ? 649  LYS A NZ  1 
ATOM   5317 N  N   . LEU A 1 650 ? 20.845 67.655  52.971 1.00 108.10 ? 650  LEU A N   1 
ATOM   5318 C  CA  . LEU A 1 650 ? 20.226 67.101  51.773 1.00 108.44 ? 650  LEU A CA  1 
ATOM   5319 C  C   . LEU A 1 650 ? 18.899 67.770  51.423 1.00 108.45 ? 650  LEU A C   1 
ATOM   5320 O  O   . LEU A 1 650 ? 18.629 68.047  50.255 1.00 108.23 ? 650  LEU A O   1 
ATOM   5321 C  CB  . LEU A 1 650 ? 20.046 65.583  51.930 1.00 108.71 ? 650  LEU A CB  1 
ATOM   5322 C  CG  . LEU A 1 650 ? 19.415 65.022  53.206 1.00 108.57 ? 650  LEU A CG  1 
ATOM   5323 C  CD1 . LEU A 1 650 ? 17.918 65.262  53.209 1.00 109.27 ? 650  LEU A CD1 1 
ATOM   5324 C  CD2 . LEU A 1 650 ? 19.696 63.535  53.272 1.00 109.41 ? 650  LEU A CD2 1 
ATOM   5325 N  N   . SER A 1 651 ? 18.074 68.034  52.431 1.00 108.62 ? 651  SER A N   1 
ATOM   5326 C  CA  . SER A 1 651 ? 16.792 68.685  52.199 1.00 108.41 ? 651  SER A CA  1 
ATOM   5327 C  C   . SER A 1 651 ? 17.079 70.108  51.739 1.00 107.96 ? 651  SER A C   1 
ATOM   5328 O  O   . SER A 1 651 ? 16.283 70.714  51.020 1.00 108.41 ? 651  SER A O   1 
ATOM   5329 C  CB  . SER A 1 651 ? 15.962 68.715  53.484 1.00 108.91 ? 651  SER A CB  1 
ATOM   5330 O  OG  . SER A 1 651 ? 16.588 69.518  54.470 1.00 109.50 ? 651  SER A OG  1 
ATOM   5331 N  N   . LYS A 1 652 ? 18.224 70.635  52.165 1.00 106.84 ? 652  LYS A N   1 
ATOM   5332 C  CA  . LYS A 1 652 ? 18.639 71.981  51.792 1.00 105.92 ? 652  LYS A CA  1 
ATOM   5333 C  C   . LYS A 1 652 ? 19.344 71.926  50.439 1.00 105.51 ? 652  LYS A C   1 
ATOM   5334 O  O   . LYS A 1 652 ? 19.825 72.943  49.936 1.00 105.73 ? 652  LYS A O   1 
ATOM   5335 C  CB  . LYS A 1 652 ? 19.575 72.556  52.849 1.00 105.46 ? 652  LYS A CB  1 
ATOM   5336 N  N   . TYR A 1 653 ? 19.403 70.727  49.861 1.00 104.73 ? 653  TYR A N   1 
ATOM   5337 C  CA  . TYR A 1 653 ? 20.039 70.512  48.562 1.00 103.36 ? 653  TYR A CA  1 
ATOM   5338 C  C   . TYR A 1 653 ? 21.543 70.801  48.605 1.00 102.34 ? 653  TYR A C   1 
ATOM   5339 O  O   . TYR A 1 653 ? 22.023 71.768  48.009 1.00 101.85 ? 653  TYR A O   1 
ATOM   5340 C  CB  . TYR A 1 653 ? 19.346 71.380  47.503 1.00 102.91 ? 653  TYR A CB  1 
ATOM   5341 C  CG  . TYR A 1 653 ? 17.890 71.016  47.285 1.00 102.52 ? 653  TYR A CG  1 
ATOM   5342 C  CD1 . TYR A 1 653 ? 16.990 71.936  46.745 1.00 102.00 ? 653  TYR A CD1 1 
ATOM   5343 C  CD2 . TYR A 1 653 ? 17.414 69.744  47.609 1.00 102.74 ? 653  TYR A CD2 1 
ATOM   5344 C  CE1 . TYR A 1 653 ? 15.653 71.597  46.533 1.00 101.52 ? 653  TYR A CE1 1 
ATOM   5345 C  CE2 . TYR A 1 653 ? 16.083 69.396  47.401 1.00 102.50 ? 653  TYR A CE2 1 
ATOM   5346 C  CZ  . TYR A 1 653 ? 15.209 70.325  46.863 1.00 102.09 ? 653  TYR A CZ  1 
ATOM   5347 O  OH  . TYR A 1 653 ? 13.896 69.972  46.651 1.00 102.51 ? 653  TYR A OH  1 
ATOM   5348 N  N   . GLU A 1 654 ? 22.276 69.944  49.315 1.00 101.10 ? 654  GLU A N   1 
ATOM   5349 C  CA  . GLU A 1 654 ? 23.721 70.090  49.456 1.00 99.66  ? 654  GLU A CA  1 
ATOM   5350 C  C   . GLU A 1 654 ? 24.497 68.798  49.165 1.00 98.85  ? 654  GLU A C   1 
ATOM   5351 O  O   . GLU A 1 654 ? 25.570 68.841  48.557 1.00 99.23  ? 654  GLU A O   1 
ATOM   5352 C  CB  . GLU A 1 654 ? 24.055 70.587  50.864 1.00 99.16  ? 654  GLU A CB  1 
ATOM   5353 C  CG  . GLU A 1 654 ? 23.387 71.903  51.223 1.00 98.06  ? 654  GLU A CG  1 
ATOM   5354 C  CD  . GLU A 1 654 ? 23.785 72.403  52.595 1.00 97.88  ? 654  GLU A CD  1 
ATOM   5355 O  OE1 . GLU A 1 654 ? 23.249 73.447  53.023 1.00 97.67  ? 654  GLU A OE1 1 
ATOM   5356 O  OE2 . GLU A 1 654 ? 24.635 71.753  53.242 1.00 97.14  ? 654  GLU A OE2 1 
ATOM   5357 N  N   . VAL A 1 655 ? 23.961 67.655  49.596 1.00 97.30  ? 655  VAL A N   1 
ATOM   5358 C  CA  . VAL A 1 655 ? 24.627 66.372  49.368 1.00 94.93  ? 655  VAL A CA  1 
ATOM   5359 C  C   . VAL A 1 655 ? 24.852 66.134  47.871 1.00 93.68  ? 655  VAL A C   1 
ATOM   5360 O  O   . VAL A 1 655 ? 23.944 66.298  47.056 1.00 92.80  ? 655  VAL A O   1 
ATOM   5361 C  CB  . VAL A 1 655 ? 23.818 65.184  49.980 1.00 93.66  ? 655  VAL A CB  1 
ATOM   5362 C  CG1 . VAL A 1 655 ? 22.507 64.993  49.245 1.00 92.82  ? 655  VAL A CG1 1 
ATOM   5363 C  CG2 . VAL A 1 655 ? 24.646 63.913  49.934 1.00 92.71  ? 655  VAL A CG2 1 
ATOM   5364 N  N   . PRO A 1 656 ? 26.083 65.759  47.496 1.00 93.15  ? 656  PRO A N   1 
ATOM   5365 C  CA  . PRO A 1 656 ? 26.491 65.488  46.114 1.00 93.04  ? 656  PRO A CA  1 
ATOM   5366 C  C   . PRO A 1 656 ? 25.447 64.811  45.223 1.00 92.89  ? 656  PRO A C   1 
ATOM   5367 O  O   . PRO A 1 656 ? 24.470 64.242  45.706 1.00 92.90  ? 656  PRO A O   1 
ATOM   5368 C  CB  . PRO A 1 656 ? 27.746 64.650  46.300 1.00 93.14  ? 656  PRO A CB  1 
ATOM   5369 C  CG  . PRO A 1 656 ? 28.383 65.329  47.477 1.00 93.06  ? 656  PRO A CG  1 
ATOM   5370 C  CD  . PRO A 1 656 ? 27.210 65.534  48.422 1.00 92.79  ? 656  PRO A CD  1 
ATOM   5371 N  N   . PRO A 1 657 ? 25.655 64.872  43.898 1.00 93.16  ? 657  PRO A N   1 
ATOM   5372 C  CA  . PRO A 1 657 ? 24.785 64.299  42.863 1.00 93.41  ? 657  PRO A CA  1 
ATOM   5373 C  C   . PRO A 1 657 ? 24.846 62.784  42.677 1.00 93.34  ? 657  PRO A C   1 
ATOM   5374 O  O   . PRO A 1 657 ? 23.852 62.088  42.881 1.00 93.13  ? 657  PRO A O   1 
ATOM   5375 C  CB  . PRO A 1 657 ? 25.227 65.040  41.607 1.00 93.87  ? 657  PRO A CB  1 
ATOM   5376 C  CG  . PRO A 1 657 ? 26.704 65.194  41.836 1.00 93.75  ? 657  PRO A CG  1 
ATOM   5377 C  CD  . PRO A 1 657 ? 26.763 65.631  43.284 1.00 93.17  ? 657  PRO A CD  1 
ATOM   5378 N  N   . GLU A 1 658 ? 26.008 62.281  42.271 1.00 93.66  ? 658  GLU A N   1 
ATOM   5379 C  CA  . GLU A 1 658 ? 26.184 60.851  42.043 1.00 93.84  ? 658  GLU A CA  1 
ATOM   5380 C  C   . GLU A 1 658 ? 25.806 60.025  43.270 1.00 93.66  ? 658  GLU A C   1 
ATOM   5381 O  O   . GLU A 1 658 ? 25.519 58.831  43.154 1.00 93.59  ? 658  GLU A O   1 
ATOM   5382 C  CB  . GLU A 1 658 ? 27.631 60.547  41.630 1.00 94.69  ? 658  GLU A CB  1 
ATOM   5383 C  CG  . GLU A 1 658 ? 28.690 60.808  42.699 1.00 96.31  ? 658  GLU A CG  1 
ATOM   5384 C  CD  . GLU A 1 658 ? 28.801 62.272  43.083 1.00 97.77  ? 658  GLU A CD  1 
ATOM   5385 O  OE1 . GLU A 1 658 ? 28.972 63.114  42.174 1.00 98.66  ? 658  GLU A OE1 1 
ATOM   5386 O  OE2 . GLU A 1 658 ? 28.724 62.580  44.294 1.00 97.98  ? 658  GLU A OE2 1 
ATOM   5387 N  N   . LYS A 1 659 ? 25.806 60.666  44.438 1.00 93.03  ? 659  LYS A N   1 
ATOM   5388 C  CA  . LYS A 1 659 ? 25.456 60.003  45.691 1.00 92.13  ? 659  LYS A CA  1 
ATOM   5389 C  C   . LYS A 1 659 ? 23.952 59.815  45.823 1.00 93.32  ? 659  LYS A C   1 
ATOM   5390 O  O   . LYS A 1 659 ? 23.442 59.575  46.918 1.00 93.64  ? 659  LYS A O   1 
ATOM   5391 C  CB  . LYS A 1 659 ? 25.939 60.821  46.883 1.00 90.01  ? 659  LYS A CB  1 
ATOM   5392 C  CG  . LYS A 1 659 ? 27.407 60.703  47.202 1.00 87.88  ? 659  LYS A CG  1 
ATOM   5393 C  CD  . LYS A 1 659 ? 27.685 61.459  48.484 1.00 85.88  ? 659  LYS A CD  1 
ATOM   5394 C  CE  . LYS A 1 659 ? 29.124 61.349  48.915 1.00 84.49  ? 659  LYS A CE  1 
ATOM   5395 N  NZ  . LYS A 1 659 ? 29.319 62.096  50.185 1.00 83.98  ? 659  LYS A NZ  1 
ATOM   5396 N  N   . LEU A 1 660 ? 23.239 59.928  44.711 1.00 94.46  ? 660  LEU A N   1 
ATOM   5397 C  CA  . LEU A 1 660 ? 21.793 59.776  44.732 1.00 95.53  ? 660  LEU A CA  1 
ATOM   5398 C  C   . LEU A 1 660 ? 21.331 58.821  43.635 1.00 96.61  ? 660  LEU A C   1 
ATOM   5399 O  O   . LEU A 1 660 ? 20.203 58.332  43.662 1.00 96.89  ? 660  LEU A O   1 
ATOM   5400 C  CB  . LEU A 1 660 ? 21.128 61.146  44.555 1.00 95.80  ? 660  LEU A CB  1 
ATOM   5401 C  CG  . LEU A 1 660 ? 21.635 62.293  45.444 1.00 95.80  ? 660  LEU A CG  1 
ATOM   5402 C  CD1 . LEU A 1 660 ? 20.856 63.572  45.140 1.00 94.73  ? 660  LEU A CD1 1 
ATOM   5403 C  CD2 . LEU A 1 660 ? 21.491 61.915  46.907 1.00 95.33  ? 660  LEU A CD2 1 
ATOM   5404 N  N   . VAL A 1 661 ? 22.211 58.554  42.674 1.00 98.07  ? 661  VAL A N   1 
ATOM   5405 C  CA  . VAL A 1 661 ? 21.893 57.658  41.565 1.00 99.09  ? 661  VAL A CA  1 
ATOM   5406 C  C   . VAL A 1 661 ? 21.646 56.241  42.064 1.00 99.96  ? 661  VAL A C   1 
ATOM   5407 O  O   . VAL A 1 661 ? 22.568 55.432  42.146 1.00 100.41 ? 661  VAL A O   1 
ATOM   5408 C  CB  . VAL A 1 661 ? 23.028 57.662  40.545 1.00 98.40  ? 661  VAL A CB  1 
ATOM   5409 N  N   . ILE A 1 662 ? 20.396 55.945  42.399 1.00 101.10 ? 662  ILE A N   1 
ATOM   5410 C  CA  . ILE A 1 662 ? 20.028 54.622  42.887 1.00 102.39 ? 662  ILE A CA  1 
ATOM   5411 C  C   . ILE A 1 662 ? 20.446 53.566  41.866 1.00 103.42 ? 662  ILE A C   1 
ATOM   5412 O  O   . ILE A 1 662 ? 19.857 53.460  40.790 1.00 103.64 ? 662  ILE A O   1 
ATOM   5413 C  CB  . ILE A 1 662 ? 18.506 54.534  43.124 1.00 102.26 ? 662  ILE A CB  1 
ATOM   5414 C  CG1 . ILE A 1 662 ? 18.072 55.647  44.083 1.00 102.56 ? 662  ILE A CG1 1 
ATOM   5415 C  CG2 . ILE A 1 662 ? 18.141 53.167  43.685 1.00 101.86 ? 662  ILE A CG2 1 
ATOM   5416 C  CD1 . ILE A 1 662 ? 16.577 55.710  44.332 1.00 102.77 ? 662  ILE A CD1 1 
ATOM   5417 N  N   . HIS A 1 663 ? 21.469 52.788  42.205 1.00 104.31 ? 663  HIS A N   1 
ATOM   5418 C  CA  . HIS A 1 663 ? 21.970 51.750  41.310 1.00 105.14 ? 663  HIS A CA  1 
ATOM   5419 C  C   . HIS A 1 663 ? 21.085 50.501  41.323 1.00 104.87 ? 663  HIS A C   1 
ATOM   5420 O  O   . HIS A 1 663 ? 21.445 49.492  41.933 1.00 105.14 ? 663  HIS A O   1 
ATOM   5421 C  CB  . HIS A 1 663 ? 23.400 51.361  41.705 1.00 106.92 ? 663  HIS A CB  1 
ATOM   5422 C  CG  . HIS A 1 663 ? 24.388 52.487  41.627 1.00 108.84 ? 663  HIS A CG  1 
ATOM   5423 N  ND1 . HIS A 1 663 ? 24.686 53.139  40.448 1.00 109.43 ? 663  HIS A ND1 1 
ATOM   5424 C  CD2 . HIS A 1 663 ? 25.168 53.056  42.577 1.00 109.26 ? 663  HIS A CD2 1 
ATOM   5425 C  CE1 . HIS A 1 663 ? 25.607 54.059  40.676 1.00 109.67 ? 663  HIS A CE1 1 
ATOM   5426 N  NE2 . HIS A 1 663 ? 25.918 54.029  41.960 1.00 109.24 ? 663  HIS A NE2 1 
ATOM   5427 N  N   . GLU A 1 664 ? 19.938 50.565  40.649 1.00 104.28 ? 664  GLU A N   1 
ATOM   5428 C  CA  . GLU A 1 664 ? 19.016 49.427  40.593 1.00 104.30 ? 664  GLU A CA  1 
ATOM   5429 C  C   . GLU A 1 664 ? 18.419 49.259  39.199 1.00 104.12 ? 664  GLU A C   1 
ATOM   5430 O  O   . GLU A 1 664 ? 18.543 50.146  38.358 1.00 104.11 ? 664  GLU A O   1 
ATOM   5431 C  CB  . GLU A 1 664 ? 17.898 49.606  41.619 1.00 104.13 ? 664  GLU A CB  1 
ATOM   5432 N  N   . GLN A 1 665 ? 17.771 48.120  38.958 1.00 104.33 ? 665  GLN A N   1 
ATOM   5433 C  CA  . GLN A 1 665 ? 17.158 47.848  37.657 1.00 104.62 ? 665  GLN A CA  1 
ATOM   5434 C  C   . GLN A 1 665 ? 16.394 46.523  37.615 1.00 104.52 ? 665  GLN A C   1 
ATOM   5435 O  O   . GLN A 1 665 ? 16.117 45.917  38.654 1.00 104.03 ? 665  GLN A O   1 
ATOM   5436 C  CB  . GLN A 1 665 ? 18.228 47.863  36.563 1.00 104.73 ? 665  GLN A CB  1 
ATOM   5437 N  N   . ILE A 1 666 ? 16.060 46.084  36.401 1.00 104.28 ? 666  ILE A N   1 
ATOM   5438 C  CA  . ILE A 1 666 ? 15.331 44.834  36.191 1.00 103.88 ? 666  ILE A CA  1 
ATOM   5439 C  C   . ILE A 1 666 ? 15.517 44.304  34.768 1.00 103.50 ? 666  ILE A C   1 
ATOM   5440 O  O   . ILE A 1 666 ? 14.495 44.148  34.068 1.00 103.66 ? 666  ILE A O   1 
ATOM   5441 C  CB  . ILE A 1 666 ? 13.844 45.041  36.480 1.00 104.15 ? 666  ILE A CB  1 
ATOM   5442 N  N   . PRO A 1 678 ? 8.060  55.990  39.354 1.00 112.50 ? 678  PRO A N   1 
ATOM   5443 C  CA  . PRO A 1 678 ? 8.042  54.518  39.553 1.00 112.24 ? 678  PRO A CA  1 
ATOM   5444 C  C   . PRO A 1 678 ? 9.288  53.781  39.031 1.00 111.69 ? 678  PRO A C   1 
ATOM   5445 O  O   . PRO A 1 678 ? 10.310 54.399  38.718 1.00 110.64 ? 678  PRO A O   1 
ATOM   5446 C  CB  . PRO A 1 678 ? 6.765  53.998  38.891 1.00 112.46 ? 678  PRO A CB  1 
ATOM   5447 C  CG  . PRO A 1 678 ? 6.393  55.154  37.939 1.00 112.25 ? 678  PRO A CG  1 
ATOM   5448 C  CD  . PRO A 1 678 ? 6.819  56.422  38.686 1.00 112.18 ? 678  PRO A CD  1 
ATOM   5449 N  N   . HIS A 1 679 ? 9.189  52.455  38.952 1.00 111.64 ? 679  HIS A N   1 
ATOM   5450 C  CA  . HIS A 1 679 ? 10.282 51.598  38.489 1.00 111.52 ? 679  HIS A CA  1 
ATOM   5451 C  C   . HIS A 1 679 ? 10.616 51.762  37.008 1.00 111.42 ? 679  HIS A C   1 
ATOM   5452 O  O   . HIS A 1 679 ? 11.782 51.928  36.638 1.00 111.46 ? 679  HIS A O   1 
ATOM   5453 C  CB  . HIS A 1 679 ? 9.952  50.126  38.780 1.00 111.44 ? 679  HIS A CB  1 
ATOM   5454 C  CG  . HIS A 1 679 ? 8.612  49.687  38.268 1.00 111.80 ? 679  HIS A CG  1 
ATOM   5455 N  ND1 . HIS A 1 679 ? 8.286  49.688  36.927 1.00 111.86 ? 679  HIS A ND1 1 
ATOM   5456 C  CD2 . HIS A 1 679 ? 7.517  49.227  38.919 1.00 111.40 ? 679  HIS A CD2 1 
ATOM   5457 C  CE1 . HIS A 1 679 ? 7.049  49.247  36.775 1.00 111.52 ? 679  HIS A CE1 1 
ATOM   5458 N  NE2 . HIS A 1 679 ? 6.560  48.961  37.969 1.00 111.32 ? 679  HIS A NE2 1 
ATOM   5459 N  N   . VAL A 1 680 ? 9.590  51.705  36.164 1.00 111.10 ? 680  VAL A N   1 
ATOM   5460 C  CA  . VAL A 1 680 ? 9.769  51.844  34.724 1.00 110.59 ? 680  VAL A CA  1 
ATOM   5461 C  C   . VAL A 1 680 ? 9.548  53.290  34.288 1.00 110.05 ? 680  VAL A C   1 
ATOM   5462 O  O   . VAL A 1 680 ? 9.440  53.578  33.095 1.00 109.57 ? 680  VAL A O   1 
ATOM   5463 C  CB  . VAL A 1 680 ? 8.807  50.916  33.990 1.00 110.45 ? 680  VAL A CB  1 
ATOM   5464 N  N   . ALA A 1 681 ? 9.482  54.194  35.263 1.00 109.65 ? 681  ALA A N   1 
ATOM   5465 C  CA  . ALA A 1 681 ? 9.277  55.616  34.994 1.00 109.24 ? 681  ALA A CA  1 
ATOM   5466 C  C   . ALA A 1 681 ? 10.333 56.113  34.013 1.00 108.91 ? 681  ALA A C   1 
ATOM   5467 O  O   . ALA A 1 681 ? 10.050 56.328  32.831 1.00 108.69 ? 681  ALA A O   1 
ATOM   5468 C  CB  . ALA A 1 681 ? 9.357  56.409  36.295 1.00 109.13 ? 681  ALA A CB  1 
ATOM   5469 N  N   . VAL A 1 682 ? 11.548 56.299  34.518 1.00 108.02 ? 682  VAL A N   1 
ATOM   5470 C  CA  . VAL A 1 682 ? 12.663 56.748  33.696 1.00 107.05 ? 682  VAL A CA  1 
ATOM   5471 C  C   . VAL A 1 682 ? 13.158 55.560  32.890 1.00 106.40 ? 682  VAL A C   1 
ATOM   5472 O  O   . VAL A 1 682 ? 13.696 55.717  31.793 1.00 106.10 ? 682  VAL A O   1 
ATOM   5473 C  CB  . VAL A 1 682 ? 13.810 57.288  34.568 1.00 107.15 ? 682  VAL A CB  1 
ATOM   5474 C  CG1 . VAL A 1 682 ? 15.086 57.424  33.748 1.00 106.51 ? 682  VAL A CG1 1 
ATOM   5475 C  CG2 . VAL A 1 682 ? 13.409 58.631  35.150 1.00 107.53 ? 682  VAL A CG2 1 
ATOM   5476 N  N   . ALA A 1 683 ? 12.970 54.369  33.448 1.00 105.79 ? 683  ALA A N   1 
ATOM   5477 C  CA  . ALA A 1 683 ? 13.382 53.149  32.776 1.00 105.32 ? 683  ALA A CA  1 
ATOM   5478 C  C   . ALA A 1 683 ? 12.834 53.188  31.353 1.00 105.05 ? 683  ALA A C   1 
ATOM   5479 O  O   . ALA A 1 683 ? 13.563 53.484  30.406 1.00 104.75 ? 683  ALA A O   1 
ATOM   5480 C  CB  . ALA A 1 683 ? 12.847 51.930  33.525 1.00 104.38 ? 683  ALA A CB  1 
ATOM   5481 N  N   . LYS A 1 684 ? 11.540 52.915  31.212 1.00 105.11 ? 684  LYS A N   1 
ATOM   5482 C  CA  . LYS A 1 684 ? 10.890 52.914  29.905 1.00 105.11 ? 684  LYS A CA  1 
ATOM   5483 C  C   . LYS A 1 684 ? 11.012 54.257  29.186 1.00 104.96 ? 684  LYS A C   1 
ATOM   5484 O  O   . LYS A 1 684 ? 11.004 54.310  27.952 1.00 105.08 ? 684  LYS A O   1 
ATOM   5485 C  CB  . LYS A 1 684 ? 9.414  52.538  30.058 1.00 105.10 ? 684  LYS A CB  1 
ATOM   5486 N  N   . ARG A 1 685 ? 11.129 55.336  29.960 1.00 104.48 ? 685  ARG A N   1 
ATOM   5487 C  CA  . ARG A 1 685 ? 11.238 56.684  29.408 1.00 103.42 ? 685  ARG A CA  1 
ATOM   5488 C  C   . ARG A 1 685 ? 12.500 56.882  28.573 1.00 103.08 ? 685  ARG A C   1 
ATOM   5489 O  O   . ARG A 1 685 ? 13.037 57.986  28.498 1.00 102.85 ? 685  ARG A O   1 
ATOM   5490 C  CB  . ARG A 1 685 ? 11.189 57.712  30.531 1.00 102.64 ? 685  ARG A CB  1 
ATOM   5491 N  N   . LEU A 1 686 ? 12.966 55.805  27.947 1.00 102.73 ? 686  LEU A N   1 
ATOM   5492 C  CA  . LEU A 1 686 ? 14.151 55.849  27.103 1.00 102.43 ? 686  LEU A CA  1 
ATOM   5493 C  C   . LEU A 1 686 ? 13.939 54.919  25.915 1.00 102.36 ? 686  LEU A C   1 
ATOM   5494 O  O   . LEU A 1 686 ? 14.899 54.454  25.299 1.00 101.93 ? 686  LEU A O   1 
ATOM   5495 C  CB  . LEU A 1 686 ? 15.382 55.424  27.899 1.00 102.22 ? 686  LEU A CB  1 
ATOM   5496 N  N   . ALA A 1 687 ? 12.672 54.663  25.597 1.00 102.83 ? 687  ALA A N   1 
ATOM   5497 C  CA  . ALA A 1 687 ? 12.304 53.786  24.488 1.00 103.95 ? 687  ALA A CA  1 
ATOM   5498 C  C   . ALA A 1 687 ? 11.725 54.569  23.308 1.00 104.75 ? 687  ALA A C   1 
ATOM   5499 O  O   . ALA A 1 687 ? 12.017 55.752  23.134 1.00 104.74 ? 687  ALA A O   1 
ATOM   5500 C  CB  . ALA A 1 687 ? 11.296 52.744  24.966 1.00 103.08 ? 687  ALA A CB  1 
ATOM   5501 N  N   . ALA A 1 688 ? 10.908 53.896  22.498 1.00 105.74 ? 688  ALA A N   1 
ATOM   5502 C  CA  . ALA A 1 688 ? 10.272 54.513  21.333 1.00 106.39 ? 688  ALA A CA  1 
ATOM   5503 C  C   . ALA A 1 688 ? 8.943  55.179  21.714 1.00 106.97 ? 688  ALA A C   1 
ATOM   5504 O  O   . ALA A 1 688 ? 7.885  54.704  21.233 1.00 107.09 ? 688  ALA A O   1 
ATOM   5505 C  CB  . ALA A 1 688 ? 10.041 53.461  20.238 1.00 105.45 ? 688  ALA A CB  1 
ATOM   5506 N  N   . THR A 1 697 ? 18.703 46.737  29.898 1.00 97.07  ? 697  THR A N   1 
ATOM   5507 C  CA  . THR A 1 697 ? 19.540 45.922  30.829 1.00 97.99  ? 697  THR A CA  1 
ATOM   5508 C  C   . THR A 1 697 ? 19.655 46.542  32.226 1.00 98.53  ? 697  THR A C   1 
ATOM   5509 O  O   . THR A 1 697 ? 19.215 45.944  33.210 1.00 98.07  ? 697  THR A O   1 
ATOM   5510 C  CB  . THR A 1 697 ? 20.966 45.706  30.258 1.00 97.42  ? 697  THR A CB  1 
ATOM   5511 O  OG1 . THR A 1 697 ? 21.590 46.973  30.017 1.00 97.43  ? 697  THR A OG1 1 
ATOM   5512 C  CG2 . THR A 1 697 ? 20.907 44.930  28.954 1.00 97.38  ? 697  THR A CG2 1 
ATOM   5513 N  N   . VAL A 1 698 ? 20.244 47.736  32.308 1.00 99.55  ? 698  VAL A N   1 
ATOM   5514 C  CA  . VAL A 1 698 ? 20.422 48.432  33.586 1.00 100.03 ? 698  VAL A CA  1 
ATOM   5515 C  C   . VAL A 1 698 ? 20.958 49.859  33.414 1.00 100.32 ? 698  VAL A C   1 
ATOM   5516 O  O   . VAL A 1 698 ? 21.754 50.125  32.509 1.00 100.12 ? 698  VAL A O   1 
ATOM   5517 C  CB  . VAL A 1 698 ? 21.365 47.634  34.479 1.00 100.47 ? 698  VAL A CB  1 
ATOM   5518 N  N   . ILE A 1 699 ? 20.526 50.767  34.291 1.00 100.56 ? 699  ILE A N   1 
ATOM   5519 C  CA  . ILE A 1 699 ? 20.964 52.168  34.241 1.00 100.95 ? 699  ILE A CA  1 
ATOM   5520 C  C   . ILE A 1 699 ? 20.565 52.983  35.485 1.00 100.82 ? 699  ILE A C   1 
ATOM   5521 O  O   . ILE A 1 699 ? 19.436 52.882  35.968 1.00 100.93 ? 699  ILE A O   1 
ATOM   5522 C  CB  . ILE A 1 699 ? 20.413 52.836  32.981 1.00 100.75 ? 699  ILE A CB  1 
ATOM   5523 N  N   . SER A 1 700 ? 21.498 53.795  35.986 1.00 100.11 ? 700  SER A N   1 
ATOM   5524 C  CA  . SER A 1 700 ? 21.274 54.633  37.169 1.00 99.42  ? 700  SER A CA  1 
ATOM   5525 C  C   . SER A 1 700 ? 20.158 55.655  36.964 1.00 99.10  ? 700  SER A C   1 
ATOM   5526 O  O   . SER A 1 700 ? 19.648 55.817  35.857 1.00 98.79  ? 700  SER A O   1 
ATOM   5527 C  CB  . SER A 1 700 ? 22.561 55.385  37.542 1.00 99.56  ? 700  SER A CB  1 
ATOM   5528 O  OG  . SER A 1 700 ? 23.616 54.504  37.884 1.00 98.95  ? 700  SER A OG  1 
ATOM   5529 N  N   . TYR A 1 701 ? 19.786 56.343  38.043 1.00 99.22  ? 701  TYR A N   1 
ATOM   5530 C  CA  . TYR A 1 701 ? 18.745 57.368  37.991 1.00 99.13  ? 701  TYR A CA  1 
ATOM   5531 C  C   . TYR A 1 701 ? 18.717 58.223  39.264 1.00 98.95  ? 701  TYR A C   1 
ATOM   5532 O  O   . TYR A 1 701 ? 19.005 57.742  40.362 1.00 98.70  ? 701  TYR A O   1 
ATOM   5533 C  CB  . TYR A 1 701 ? 17.370 56.725  37.739 1.00 99.20  ? 701  TYR A CB  1 
ATOM   5534 C  CG  . TYR A 1 701 ? 16.756 56.027  38.931 1.00 99.46  ? 701  TYR A CG  1 
ATOM   5535 C  CD1 . TYR A 1 701 ? 16.033 56.742  39.886 1.00 100.22 ? 701  TYR A CD1 1 
ATOM   5536 C  CD2 . TYR A 1 701 ? 16.903 54.652  39.110 1.00 99.79  ? 701  TYR A CD2 1 
ATOM   5537 C  CE1 . TYR A 1 701 ? 15.470 56.105  40.993 1.00 100.98 ? 701  TYR A CE1 1 
ATOM   5538 C  CE2 . TYR A 1 701 ? 16.345 54.004  40.214 1.00 100.73 ? 701  TYR A CE2 1 
ATOM   5539 C  CZ  . TYR A 1 701 ? 15.631 54.736  41.151 1.00 100.90 ? 701  TYR A CZ  1 
ATOM   5540 O  OH  . TYR A 1 701 ? 15.079 54.105  42.244 1.00 101.18 ? 701  TYR A OH  1 
ATOM   5541 N  N   . ILE A 1 702 ? 18.383 59.499  39.102 1.00 98.83  ? 702  ILE A N   1 
ATOM   5542 C  CA  . ILE A 1 702 ? 18.319 60.431  40.223 1.00 98.93  ? 702  ILE A CA  1 
ATOM   5543 C  C   . ILE A 1 702 ? 17.103 61.343  40.079 1.00 99.14  ? 702  ILE A C   1 
ATOM   5544 O  O   . ILE A 1 702 ? 17.215 62.567  40.157 1.00 99.36  ? 702  ILE A O   1 
ATOM   5545 C  CB  . ILE A 1 702 ? 19.600 61.263  40.285 1.00 98.55  ? 702  ILE A CB  1 
ATOM   5546 N  N   . VAL A 1 703 ? 15.942 60.730  39.870 1.00 99.22  ? 703  VAL A N   1 
ATOM   5547 C  CA  . VAL A 1 703 ? 14.686 61.456  39.711 1.00 98.99  ? 703  VAL A CA  1 
ATOM   5548 C  C   . VAL A 1 703 ? 14.417 62.422  40.862 1.00 98.58  ? 703  VAL A C   1 
ATOM   5549 O  O   . VAL A 1 703 ? 15.107 62.406  41.880 1.00 98.02  ? 703  VAL A O   1 
ATOM   5550 C  CB  . VAL A 1 703 ? 13.532 60.465  39.584 1.00 98.89  ? 703  VAL A CB  1 
ATOM   5551 N  N   . LEU A 1 704 ? 13.401 63.261  40.691 1.00 98.87  ? 704  LEU A N   1 
ATOM   5552 C  CA  . LEU A 1 704 ? 13.034 64.237  41.707 1.00 99.09  ? 704  LEU A CA  1 
ATOM   5553 C  C   . LEU A 1 704 ? 11.521 64.450  41.735 1.00 99.01  ? 704  LEU A C   1 
ATOM   5554 O  O   . LEU A 1 704 ? 10.843 63.927  40.823 1.00 98.88  ? 704  LEU A O   1 
ATOM   5555 C  CB  . LEU A 1 704 ? 13.744 65.555  41.431 1.00 99.13  ? 704  LEU A CB  1 
ATOM   5556 N  N   . ARG A 1 713 ? 10.531 61.350  39.092 1.00 82.70  ? 713  ARG A N   1 
ATOM   5557 C  CA  . ARG A 1 713 ? 10.604 60.715  37.745 1.00 83.37  ? 713  ARG A CA  1 
ATOM   5558 C  C   . ARG A 1 713 ? 11.522 61.532  36.845 1.00 84.86  ? 713  ARG A C   1 
ATOM   5559 O  O   . ARG A 1 713 ? 11.069 62.455  36.170 1.00 85.09  ? 713  ARG A O   1 
ATOM   5560 C  CB  . ARG A 1 713 ? 9.204  60.629  37.116 1.00 81.29  ? 713  ARG A CB  1 
ATOM   5561 C  CG  . ARG A 1 713 ? 8.091  61.235  37.960 1.00 79.59  ? 713  ARG A CG  1 
ATOM   5562 C  CD  . ARG A 1 713 ? 7.945  60.520  39.297 1.00 77.95  ? 713  ARG A CD  1 
ATOM   5563 N  NE  . ARG A 1 713 ? 7.233  61.344  40.269 1.00 77.80  ? 713  ARG A NE  1 
ATOM   5564 C  CZ  . ARG A 1 713 ? 7.141  61.067  41.567 1.00 77.63  ? 713  ARG A CZ  1 
ATOM   5565 N  NH1 . ARG A 1 713 ? 7.715  59.975  42.064 1.00 77.04  ? 713  ARG A NH1 1 
ATOM   5566 N  NH2 . ARG A 1 713 ? 6.484  61.892  42.372 1.00 76.77  ? 713  ARG A NH2 1 
ATOM   5567 N  N   . ALA A 1 714 ? 12.810 61.190  36.838 1.00 86.67  ? 714  ALA A N   1 
ATOM   5568 C  CA  . ALA A 1 714 ? 13.796 61.904  36.025 1.00 88.93  ? 714  ALA A CA  1 
ATOM   5569 C  C   . ALA A 1 714 ? 15.097 61.111  35.866 1.00 90.88  ? 714  ALA A C   1 
ATOM   5570 O  O   . ALA A 1 714 ? 15.593 60.519  36.826 1.00 91.21  ? 714  ALA A O   1 
ATOM   5571 C  CB  . ALA A 1 714 ? 14.093 63.262  36.651 1.00 88.02  ? 714  ALA A CB  1 
ATOM   5572 N  N   . ILE A 1 715 ? 15.647 61.110  34.653 1.00 92.74  ? 715  ILE A N   1 
ATOM   5573 C  CA  . ILE A 1 715 ? 16.886 60.391  34.351 1.00 95.08  ? 715  ILE A CA  1 
ATOM   5574 C  C   . ILE A 1 715 ? 18.132 61.237  34.631 1.00 97.26  ? 715  ILE A C   1 
ATOM   5575 O  O   . ILE A 1 715 ? 18.067 62.467  34.648 1.00 97.08  ? 715  ILE A O   1 
ATOM   5576 C  CB  . ILE A 1 715 ? 16.882 59.937  32.893 1.00 94.91  ? 715  ILE A CB  1 
ATOM   5577 N  N   . PRO A 1 716 ? 19.285 60.579  34.861 1.00 99.49  ? 716  PRO A N   1 
ATOM   5578 C  CA  . PRO A 1 716 ? 20.556 61.256  35.145 1.00 101.23 ? 716  PRO A CA  1 
ATOM   5579 C  C   . PRO A 1 716 ? 21.622 61.202  34.041 1.00 102.39 ? 716  PRO A C   1 
ATOM   5580 O  O   . PRO A 1 716 ? 21.952 60.135  33.519 1.00 102.74 ? 716  PRO A O   1 
ATOM   5581 C  CB  . PRO A 1 716 ? 21.027 60.542  36.402 1.00 101.40 ? 716  PRO A CB  1 
ATOM   5582 C  CG  . PRO A 1 716 ? 20.709 59.121  36.056 1.00 100.98 ? 716  PRO A CG  1 
ATOM   5583 C  CD  . PRO A 1 716 ? 19.329 59.195  35.373 1.00 100.42 ? 716  PRO A CD  1 
ATOM   5584 N  N   . PHE A 1 717 ? 22.151 62.376  33.713 1.00 103.80 ? 717  PHE A N   1 
ATOM   5585 C  CA  . PHE A 1 717 ? 23.207 62.560  32.720 1.00 105.13 ? 717  PHE A CA  1 
ATOM   5586 C  C   . PHE A 1 717 ? 23.628 64.031  32.823 1.00 107.06 ? 717  PHE A C   1 
ATOM   5587 O  O   . PHE A 1 717 ? 23.403 64.667  33.861 1.00 107.59 ? 717  PHE A O   1 
ATOM   5588 C  CB  . PHE A 1 717 ? 22.714 62.245  31.294 1.00 103.11 ? 717  PHE A CB  1 
ATOM   5589 C  CG  . PHE A 1 717 ? 22.832 60.787  30.902 1.00 101.39 ? 717  PHE A CG  1 
ATOM   5590 C  CD1 . PHE A 1 717 ? 23.955 60.047  31.264 1.00 100.75 ? 717  PHE A CD1 1 
ATOM   5591 C  CD2 . PHE A 1 717 ? 21.827 60.158  30.177 1.00 100.80 ? 717  PHE A CD2 1 
ATOM   5592 C  CE1 . PHE A 1 717 ? 24.081 58.704  30.920 1.00 99.84  ? 717  PHE A CE1 1 
ATOM   5593 C  CE2 . PHE A 1 717 ? 21.943 58.811  29.825 1.00 100.25 ? 717  PHE A CE2 1 
ATOM   5594 C  CZ  . PHE A 1 717 ? 23.063 58.085  30.194 1.00 100.02 ? 717  PHE A CZ  1 
ATOM   5595 N  N   . ASP A 1 718 ? 24.242 64.567  31.768 1.00 108.66 ? 718  ASP A N   1 
ATOM   5596 C  CA  . ASP A 1 718 ? 24.675 65.963  31.766 1.00 110.32 ? 718  ASP A CA  1 
ATOM   5597 C  C   . ASP A 1 718 ? 23.547 66.863  31.243 1.00 111.56 ? 718  ASP A C   1 
ATOM   5598 O  O   . ASP A 1 718 ? 23.806 67.932  30.688 1.00 111.93 ? 718  ASP A O   1 
ATOM   5599 C  CB  . ASP A 1 718 ? 25.926 66.123  30.901 1.00 109.51 ? 718  ASP A CB  1 
ATOM   5600 N  N   . GLU A 1 719 ? 22.296 66.449  31.455 1.00 112.74 ? 719  GLU A N   1 
ATOM   5601 C  CA  . GLU A 1 719 ? 21.147 67.215  30.968 1.00 113.34 ? 719  GLU A CA  1 
ATOM   5602 C  C   . GLU A 1 719 ? 20.238 67.836  32.036 1.00 113.76 ? 719  GLU A C   1 
ATOM   5603 O  O   . GLU A 1 719 ? 19.518 68.799  31.752 1.00 113.73 ? 719  GLU A O   1 
ATOM   5604 C  CB  . GLU A 1 719 ? 20.312 66.338  30.030 1.00 113.12 ? 719  GLU A CB  1 
ATOM   5605 N  N   . PHE A 1 720 ? 20.260 67.292  33.251 1.00 114.09 ? 720  PHE A N   1 
ATOM   5606 C  CA  . PHE A 1 720 ? 19.410 67.810  34.323 1.00 114.40 ? 720  PHE A CA  1 
ATOM   5607 C  C   . PHE A 1 720 ? 20.078 68.793  35.296 1.00 114.56 ? 720  PHE A C   1 
ATOM   5608 O  O   . PHE A 1 720 ? 19.624 69.918  35.454 1.00 114.28 ? 720  PHE A O   1 
ATOM   5609 C  CB  . PHE A 1 720 ? 18.806 66.641  35.105 1.00 113.50 ? 720  PHE A CB  1 
ATOM   5610 N  N   . ASP A 1 721 ? 21.161 68.347  35.922 1.00 114.95 ? 721  ASP A N   1 
ATOM   5611 C  CA  . ASP A 1 721 ? 21.922 69.094  36.928 1.00 115.48 ? 721  ASP A CA  1 
ATOM   5612 C  C   . ASP A 1 721 ? 22.791 70.306  36.532 1.00 115.54 ? 721  ASP A C   1 
ATOM   5613 O  O   . ASP A 1 721 ? 23.995 70.152  36.311 1.00 115.44 ? 721  ASP A O   1 
ATOM   5614 C  CB  . ASP A 1 721 ? 22.812 68.091  37.661 1.00 115.88 ? 721  ASP A CB  1 
ATOM   5615 C  CG  . ASP A 1 721 ? 23.555 67.167  36.699 1.00 116.18 ? 721  ASP A CG  1 
ATOM   5616 O  OD1 . ASP A 1 721 ? 22.892 66.336  36.035 1.00 115.88 ? 721  ASP A OD1 1 
ATOM   5617 O  OD2 . ASP A 1 721 ? 24.798 67.278  36.597 1.00 116.32 ? 721  ASP A OD2 1 
ATOM   5618 N  N   . PRO A 1 722 ? 22.214 71.527  36.462 1.00 115.52 ? 722  PRO A N   1 
ATOM   5619 C  CA  . PRO A 1 722 ? 23.095 72.638  36.091 1.00 115.45 ? 722  PRO A CA  1 
ATOM   5620 C  C   . PRO A 1 722 ? 23.613 73.349  37.345 1.00 115.59 ? 722  PRO A C   1 
ATOM   5621 O  O   . PRO A 1 722 ? 24.299 74.370  37.255 1.00 115.67 ? 722  PRO A O   1 
ATOM   5622 C  CB  . PRO A 1 722 ? 22.182 73.529  35.264 1.00 114.73 ? 722  PRO A CB  1 
ATOM   5623 C  CG  . PRO A 1 722 ? 20.918 73.440  36.022 1.00 114.48 ? 722  PRO A CG  1 
ATOM   5624 C  CD  . PRO A 1 722 ? 20.806 71.962  36.399 1.00 115.38 ? 722  PRO A CD  1 
ATOM   5625 N  N   . THR A 1 723 ? 23.275 72.795  38.509 1.00 115.76 ? 723  THR A N   1 
ATOM   5626 C  CA  . THR A 1 723 ? 23.678 73.351  39.802 1.00 115.55 ? 723  THR A CA  1 
ATOM   5627 C  C   . THR A 1 723 ? 23.195 74.793  39.935 1.00 115.52 ? 723  THR A C   1 
ATOM   5628 O  O   . THR A 1 723 ? 23.647 75.541  40.808 1.00 114.96 ? 723  THR A O   1 
ATOM   5629 C  CB  . THR A 1 723 ? 25.194 73.283  39.960 1.00 115.28 ? 723  THR A CB  1 
ATOM   5630 N  N   . LYS A 1 724 ? 22.268 75.165  39.053 1.00 115.60 ? 724  LYS A N   1 
ATOM   5631 C  CA  . LYS A 1 724 ? 21.680 76.501  39.023 1.00 115.16 ? 724  LYS A CA  1 
ATOM   5632 C  C   . LYS A 1 724 ? 20.334 76.462  38.289 1.00 114.90 ? 724  LYS A C   1 
ATOM   5633 O  O   . LYS A 1 724 ? 19.981 77.401  37.567 1.00 114.66 ? 724  LYS A O   1 
ATOM   5634 C  CB  . LYS A 1 724 ? 22.633 77.483  38.335 1.00 114.65 ? 724  LYS A CB  1 
ATOM   5635 N  N   . HIS A 1 725 ? 19.596 75.365  38.475 1.00 114.37 ? 725  HIS A N   1 
ATOM   5636 C  CA  . HIS A 1 725 ? 18.282 75.184  37.853 1.00 113.28 ? 725  HIS A CA  1 
ATOM   5637 C  C   . HIS A 1 725 ? 17.576 73.901  38.311 1.00 112.24 ? 725  HIS A C   1 
ATOM   5638 O  O   . HIS A 1 725 ? 16.381 73.916  38.619 1.00 111.36 ? 725  HIS A O   1 
ATOM   5639 C  CB  . HIS A 1 725 ? 18.414 75.190  36.329 1.00 113.90 ? 725  HIS A CB  1 
ATOM   5640 N  N   . LYS A 1 726 ? 18.315 72.795  38.356 1.00 111.24 ? 726  LYS A N   1 
ATOM   5641 C  CA  . LYS A 1 726 ? 17.751 71.511  38.770 1.00 109.61 ? 726  LYS A CA  1 
ATOM   5642 C  C   . LYS A 1 726 ? 18.328 71.005  40.093 1.00 108.94 ? 726  LYS A C   1 
ATOM   5643 O  O   . LYS A 1 726 ? 19.503 71.231  40.401 1.00 108.61 ? 726  LYS A O   1 
ATOM   5644 C  CB  . LYS A 1 726 ? 17.982 70.464  37.679 1.00 108.77 ? 726  LYS A CB  1 
ATOM   5645 C  CG  . LYS A 1 726 ? 17.281 70.761  36.360 1.00 107.90 ? 726  LYS A CG  1 
ATOM   5646 C  CD  . LYS A 1 726 ? 16.052 69.885  36.147 1.00 107.20 ? 726  LYS A CD  1 
ATOM   5647 C  CE  . LYS A 1 726 ? 14.847 70.346  36.963 1.00 106.67 ? 726  LYS A CE  1 
ATOM   5648 N  NZ  . LYS A 1 726 ? 15.020 70.195  38.427 1.00 105.96 ? 726  LYS A NZ  1 
ATOM   5649 N  N   . TYR A 1 727 ? 17.486 70.315  40.864 1.00 108.33 ? 727  TYR A N   1 
ATOM   5650 C  CA  . TYR A 1 727 ? 17.867 69.753  42.160 1.00 107.33 ? 727  TYR A CA  1 
ATOM   5651 C  C   . TYR A 1 727 ? 17.353 68.316  42.317 1.00 106.12 ? 727  TYR A C   1 
ATOM   5652 O  O   . TYR A 1 727 ? 17.053 67.644  41.330 1.00 105.77 ? 727  TYR A O   1 
ATOM   5653 C  CB  . TYR A 1 727 ? 17.322 70.633  43.289 1.00 107.16 ? 727  TYR A CB  1 
ATOM   5654 N  N   . ASP A 1 728 ? 17.257 67.853  43.561 1.00 105.12 ? 728  ASP A N   1 
ATOM   5655 C  CA  . ASP A 1 728 ? 16.781 66.502  43.853 1.00 104.27 ? 728  ASP A CA  1 
ATOM   5656 C  C   . ASP A 1 728 ? 15.325 66.532  44.317 1.00 103.41 ? 728  ASP A C   1 
ATOM   5657 O  O   . ASP A 1 728 ? 14.470 67.123  43.663 1.00 103.53 ? 728  ASP A O   1 
ATOM   5658 C  CB  . ASP A 1 728 ? 17.663 65.862  44.924 1.00 104.78 ? 728  ASP A CB  1 
ATOM   5659 N  N   . ALA A 1 729 ? 15.047 65.893  45.448 1.00 102.34 ? 729  ALA A N   1 
ATOM   5660 C  CA  . ALA A 1 729 ? 13.696 65.865  45.990 1.00 101.66 ? 729  ALA A CA  1 
ATOM   5661 C  C   . ALA A 1 729 ? 13.747 65.532  47.473 1.00 101.41 ? 729  ALA A C   1 
ATOM   5662 O  O   . ALA A 1 729 ? 14.789 65.131  47.986 1.00 100.88 ? 729  ALA A O   1 
ATOM   5663 C  CB  . ALA A 1 729 ? 12.851 64.838  45.250 1.00 101.04 ? 729  ALA A CB  1 
ATOM   5664 N  N   . GLU A 1 730 ? 12.617 65.699  48.153 1.00 101.56 ? 730  GLU A N   1 
ATOM   5665 C  CA  . GLU A 1 730 ? 12.518 65.424  49.585 1.00 101.29 ? 730  GLU A CA  1 
ATOM   5666 C  C   . GLU A 1 730 ? 12.211 63.954  49.877 1.00 101.02 ? 730  GLU A C   1 
ATOM   5667 O  O   . GLU A 1 730 ? 11.548 63.636  50.865 1.00 100.66 ? 730  GLU A O   1 
ATOM   5668 C  CB  . GLU A 1 730 ? 11.443 66.313  50.210 1.00 100.85 ? 730  GLU A CB  1 
ATOM   5669 N  N   . TYR A 1 731 ? 12.692 63.064  49.013 1.00 100.89 ? 731  TYR A N   1 
ATOM   5670 C  CA  . TYR A 1 731 ? 12.474 61.631  49.188 1.00 100.59 ? 731  TYR A CA  1 
ATOM   5671 C  C   . TYR A 1 731 ? 13.727 60.960  49.763 1.00 100.52 ? 731  TYR A C   1 
ATOM   5672 O  O   . TYR A 1 731 ? 13.635 60.080  50.620 1.00 99.73  ? 731  TYR A O   1 
ATOM   5673 C  CB  . TYR A 1 731 ? 12.092 60.992  47.850 1.00 100.15 ? 731  TYR A CB  1 
ATOM   5674 N  N   . TYR A 1 732 ? 14.896 61.384  49.291 1.00 100.29 ? 732  TYR A N   1 
ATOM   5675 C  CA  . TYR A 1 732 ? 16.161 60.830  49.765 1.00 99.78  ? 732  TYR A CA  1 
ATOM   5676 C  C   . TYR A 1 732 ? 16.312 61.035  51.267 1.00 99.56  ? 732  TYR A C   1 
ATOM   5677 O  O   . TYR A 1 732 ? 17.266 60.548  51.870 1.00 100.08 ? 732  TYR A O   1 
ATOM   5678 C  CB  . TYR A 1 732 ? 17.341 61.492  49.044 1.00 100.24 ? 732  TYR A CB  1 
ATOM   5679 C  CG  . TYR A 1 732 ? 17.488 61.107  47.586 1.00 100.68 ? 732  TYR A CG  1 
ATOM   5680 C  CD1 . TYR A 1 732 ? 17.877 59.819  47.220 1.00 100.62 ? 732  TYR A CD1 1 
ATOM   5681 C  CD2 . TYR A 1 732 ? 17.227 62.029  46.571 1.00 101.27 ? 732  TYR A CD2 1 
ATOM   5682 C  CE1 . TYR A 1 732 ? 18.002 59.457  45.880 1.00 100.67 ? 732  TYR A CE1 1 
ATOM   5683 C  CE2 . TYR A 1 732 ? 17.347 61.677  45.227 1.00 101.14 ? 732  TYR A CE2 1 
ATOM   5684 C  CZ  . TYR A 1 732 ? 17.733 60.390  44.891 1.00 100.94 ? 732  TYR A CZ  1 
ATOM   5685 O  OH  . TYR A 1 732 ? 17.834 60.034  43.568 1.00 101.63 ? 732  TYR A OH  1 
ATOM   5686 N  N   . ILE A 1 733 ? 15.374 61.765  51.865 1.00 98.89  ? 733  ILE A N   1 
ATOM   5687 C  CA  . ILE A 1 733 ? 15.405 62.029  53.300 1.00 98.14  ? 733  ILE A CA  1 
ATOM   5688 C  C   . ILE A 1 733 ? 14.417 61.143  54.042 1.00 98.37  ? 733  ILE A C   1 
ATOM   5689 O  O   . ILE A 1 733 ? 14.620 60.819  55.208 1.00 97.99  ? 733  ILE A O   1 
ATOM   5690 C  CB  . ILE A 1 733 ? 15.066 63.507  53.612 1.00 97.16  ? 733  ILE A CB  1 
ATOM   5691 C  CG1 . ILE A 1 733 ? 14.846 63.684  55.118 1.00 95.95  ? 733  ILE A CG1 1 
ATOM   5692 C  CG2 . ILE A 1 733 ? 13.847 63.940  52.819 1.00 96.58  ? 733  ILE A CG2 1 
ATOM   5693 C  CD1 . ILE A 1 733 ? 14.443 65.082  55.523 1.00 95.75  ? 733  ILE A CD1 1 
ATOM   5694 N  N   . GLU A 1 734 ? 13.350 60.750  53.356 1.00 99.32  ? 734  GLU A N   1 
ATOM   5695 C  CA  . GLU A 1 734 ? 12.316 59.911  53.956 1.00 100.15 ? 734  GLU A CA  1 
ATOM   5696 C  C   . GLU A 1 734 ? 12.187 58.543  53.284 1.00 99.42  ? 734  GLU A C   1 
ATOM   5697 O  O   . GLU A 1 734 ? 11.326 57.744  53.657 1.00 99.36  ? 734  GLU A O   1 
ATOM   5698 C  CB  . GLU A 1 734 ? 10.965 60.639  53.906 1.00 101.29 ? 734  GLU A CB  1 
ATOM   5699 C  CG  . GLU A 1 734 ? 10.867 61.860  54.824 1.00 103.24 ? 734  GLU A CG  1 
ATOM   5700 C  CD  . GLU A 1 734 ? 10.532 61.494  56.264 1.00 104.45 ? 734  GLU A CD  1 
ATOM   5701 O  OE1 . GLU A 1 734 ? 10.638 62.377  57.145 1.00 104.92 ? 734  GLU A OE1 1 
ATOM   5702 O  OE2 . GLU A 1 734 ? 10.152 60.327  56.514 1.00 104.58 ? 734  GLU A OE2 1 
ATOM   5703 N  N   . ASN A 1 735 ? 13.043 58.271  52.302 1.00 98.45  ? 735  ASN A N   1 
ATOM   5704 C  CA  . ASN A 1 735 ? 12.999 56.995  51.593 1.00 96.92  ? 735  ASN A CA  1 
ATOM   5705 C  C   . ASN A 1 735 ? 14.388 56.443  51.286 1.00 95.64  ? 735  ASN A C   1 
ATOM   5706 O  O   . ASN A 1 735 ? 14.558 55.687  50.326 1.00 95.55  ? 735  ASN A O   1 
ATOM   5707 C  CB  . ASN A 1 735 ? 12.201 57.143  50.299 1.00 97.11  ? 735  ASN A CB  1 
ATOM   5708 N  N   . GLN A 1 736 ? 15.372 56.821  52.102 1.00 93.82  ? 736  GLN A N   1 
ATOM   5709 C  CA  . GLN A 1 736 ? 16.749 56.358  51.924 1.00 91.97  ? 736  GLN A CA  1 
ATOM   5710 C  C   . GLN A 1 736 ? 17.603 56.555  53.173 1.00 90.25  ? 736  GLN A C   1 
ATOM   5711 O  O   . GLN A 1 736 ? 17.966 55.593  53.850 1.00 90.03  ? 736  GLN A O   1 
ATOM   5712 C  CB  . GLN A 1 736 ? 17.404 57.074  50.737 1.00 92.09  ? 736  GLN A CB  1 
ATOM   5713 C  CG  . GLN A 1 736 ? 17.210 56.366  49.399 1.00 91.82  ? 736  GLN A CG  1 
ATOM   5714 C  CD  . GLN A 1 736 ? 18.071 55.121  49.266 1.00 92.01  ? 736  GLN A CD  1 
ATOM   5715 O  OE1 . GLN A 1 736 ? 17.843 54.287  48.390 1.00 91.91  ? 736  GLN A OE1 1 
ATOM   5716 N  NE2 . GLN A 1 736 ? 19.075 54.999  50.129 1.00 92.43  ? 736  GLN A NE2 1 
ATOM   5717 N  N   . VAL A 1 737 ? 17.921 57.810  53.466 1.00 88.41  ? 737  VAL A N   1 
ATOM   5718 C  CA  . VAL A 1 737 ? 18.732 58.162  54.625 1.00 86.86  ? 737  VAL A CA  1 
ATOM   5719 C  C   . VAL A 1 737 ? 18.084 57.792  55.952 1.00 85.61  ? 737  VAL A C   1 
ATOM   5720 O  O   . VAL A 1 737 ? 18.706 57.162  56.809 1.00 84.43  ? 737  VAL A O   1 
ATOM   5721 C  CB  . VAL A 1 737 ? 19.006 59.675  54.663 1.00 87.24  ? 737  VAL A CB  1 
ATOM   5722 C  CG1 . VAL A 1 737 ? 19.665 60.050  55.988 1.00 87.24  ? 737  VAL A CG1 1 
ATOM   5723 C  CG2 . VAL A 1 737 ? 19.884 60.076  53.482 1.00 87.64  ? 737  VAL A CG2 1 
ATOM   5724 N  N   . LEU A 1 738 ? 16.830 58.203  56.107 1.00 84.90  ? 738  LEU A N   1 
ATOM   5725 C  CA  . LEU A 1 738 ? 16.068 57.973  57.328 1.00 84.41  ? 738  LEU A CA  1 
ATOM   5726 C  C   . LEU A 1 738 ? 15.746 56.503  57.620 1.00 84.13  ? 738  LEU A C   1 
ATOM   5727 O  O   . LEU A 1 738 ? 16.173 55.963  58.645 1.00 83.64  ? 738  LEU A O   1 
ATOM   5728 C  CB  . LEU A 1 738 ? 14.774 58.802  57.282 1.00 83.62  ? 738  LEU A CB  1 
ATOM   5729 C  CG  . LEU A 1 738 ? 14.074 59.177  58.591 1.00 82.69  ? 738  LEU A CG  1 
ATOM   5730 C  CD1 . LEU A 1 738 ? 15.020 59.995  59.464 1.00 82.05  ? 738  LEU A CD1 1 
ATOM   5731 C  CD2 . LEU A 1 738 ? 12.816 59.973  58.283 1.00 81.74  ? 738  LEU A CD2 1 
ATOM   5732 N  N   . PRO A 1 739 ? 14.995 55.834  56.724 1.00 83.85  ? 739  PRO A N   1 
ATOM   5733 C  CA  . PRO A 1 739 ? 14.620 54.424  56.904 1.00 83.22  ? 739  PRO A CA  1 
ATOM   5734 C  C   . PRO A 1 739 ? 15.775 53.441  57.140 1.00 82.08  ? 739  PRO A C   1 
ATOM   5735 O  O   . PRO A 1 739 ? 15.552 52.313  57.587 1.00 82.45  ? 739  PRO A O   1 
ATOM   5736 C  CB  . PRO A 1 739 ? 13.854 54.106  55.619 1.00 83.36  ? 739  PRO A CB  1 
ATOM   5737 C  CG  . PRO A 1 739 ? 13.249 55.427  55.257 1.00 84.23  ? 739  PRO A CG  1 
ATOM   5738 C  CD  . PRO A 1 739 ? 14.408 56.365  55.481 1.00 83.93  ? 739  PRO A CD  1 
ATOM   5739 N  N   . ALA A 1 740 ? 17.001 53.865  56.843 1.00 80.51  ? 740  ALA A N   1 
ATOM   5740 C  CA  . ALA A 1 740 ? 18.167 53.004  57.017 1.00 78.26  ? 740  ALA A CA  1 
ATOM   5741 C  C   . ALA A 1 740 ? 18.626 52.905  58.470 1.00 76.77  ? 740  ALA A C   1 
ATOM   5742 O  O   . ALA A 1 740 ? 18.901 51.815  58.964 1.00 75.89  ? 740  ALA A O   1 
ATOM   5743 C  CB  . ALA A 1 740 ? 19.314 53.502  56.138 1.00 78.53  ? 740  ALA A CB  1 
ATOM   5744 N  N   . VAL A 1 741 ? 18.696 54.045  59.152 1.00 75.82  ? 741  VAL A N   1 
ATOM   5745 C  CA  . VAL A 1 741 ? 19.144 54.091  60.542 1.00 74.73  ? 741  VAL A CA  1 
ATOM   5746 C  C   . VAL A 1 741 ? 18.015 54.165  61.578 1.00 73.99  ? 741  VAL A C   1 
ATOM   5747 O  O   . VAL A 1 741 ? 18.254 53.970  62.769 1.00 72.97  ? 741  VAL A O   1 
ATOM   5748 C  CB  . VAL A 1 741 ? 20.101 55.275  60.730 1.00 73.87  ? 741  VAL A CB  1 
ATOM   5749 N  N   . GLU A 1 742 ? 16.795 54.442  61.123 1.00 73.92  ? 742  GLU A N   1 
ATOM   5750 C  CA  . GLU A 1 742 ? 15.631 54.554  62.007 1.00 73.67  ? 742  GLU A CA  1 
ATOM   5751 C  C   . GLU A 1 742 ? 15.562 53.475  63.080 1.00 73.69  ? 742  GLU A C   1 
ATOM   5752 O  O   . GLU A 1 742 ? 15.240 53.758  64.234 1.00 73.68  ? 742  GLU A O   1 
ATOM   5753 C  CB  . GLU A 1 742 ? 14.350 54.533  61.182 1.00 73.51  ? 742  GLU A CB  1 
ATOM   5754 N  N   . ARG A 1 743 ? 15.854 52.237  62.692 1.00 74.05  ? 743  ARG A N   1 
ATOM   5755 C  CA  . ARG A 1 743 ? 15.824 51.110  63.615 1.00 74.44  ? 743  ARG A CA  1 
ATOM   5756 C  C   . ARG A 1 743 ? 17.017 51.138  64.562 1.00 75.87  ? 743  ARG A C   1 
ATOM   5757 O  O   . ARG A 1 743 ? 16.848 51.189  65.778 1.00 75.77  ? 743  ARG A O   1 
ATOM   5758 C  CB  . ARG A 1 743 ? 15.807 49.800  62.838 1.00 73.45  ? 743  ARG A CB  1 
ATOM   5759 N  N   . ILE A 1 744 ? 18.223 51.109  64.000 1.00 77.99  ? 744  ILE A N   1 
ATOM   5760 C  CA  . ILE A 1 744 ? 19.447 51.126  64.802 1.00 79.60  ? 744  ILE A CA  1 
ATOM   5761 C  C   . ILE A 1 744 ? 19.390 52.231  65.853 1.00 80.79  ? 744  ILE A C   1 
ATOM   5762 O  O   . ILE A 1 744 ? 19.769 52.034  67.007 1.00 80.73  ? 744  ILE A O   1 
ATOM   5763 C  CB  . ILE A 1 744 ? 20.704 51.357  63.922 1.00 80.00  ? 744  ILE A CB  1 
ATOM   5764 C  CG1 . ILE A 1 744 ? 20.801 50.284  62.830 1.00 79.64  ? 744  ILE A CG1 1 
ATOM   5765 C  CG2 . ILE A 1 744 ? 21.956 51.327  64.792 1.00 80.55  ? 744  ILE A CG2 1 
ATOM   5766 C  CD1 . ILE A 1 744 ? 21.991 50.460  61.893 1.00 78.14  ? 744  ILE A CD1 1 
ATOM   5767 N  N   . LEU A 1 745 ? 18.920 53.399  65.439 1.00 82.60  ? 745  LEU A N   1 
ATOM   5768 C  CA  . LEU A 1 745 ? 18.803 54.533  66.337 1.00 84.77  ? 745  LEU A CA  1 
ATOM   5769 C  C   . LEU A 1 745 ? 17.695 54.243  67.345 1.00 86.48  ? 745  LEU A C   1 
ATOM   5770 O  O   . LEU A 1 745 ? 16.531 54.549  67.100 1.00 85.93  ? 745  LEU A O   1 
ATOM   5771 C  CB  . LEU A 1 745 ? 18.472 55.789  65.532 1.00 84.91  ? 745  LEU A CB  1 
ATOM   5772 C  CG  . LEU A 1 745 ? 19.473 56.150  64.429 1.00 85.15  ? 745  LEU A CG  1 
ATOM   5773 C  CD1 . LEU A 1 745 ? 18.917 57.268  63.565 1.00 85.14  ? 745  LEU A CD1 1 
ATOM   5774 C  CD2 . LEU A 1 745 ? 20.793 56.560  65.056 1.00 85.70  ? 745  LEU A CD2 1 
ATOM   5775 N  N   . ARG A 1 746 ? 18.065 53.642  68.474 1.00 89.47  ? 746  ARG A N   1 
ATOM   5776 C  CA  . ARG A 1 746 ? 17.102 53.299  69.521 1.00 92.26  ? 746  ARG A CA  1 
ATOM   5777 C  C   . ARG A 1 746 ? 17.203 54.167  70.762 1.00 93.27  ? 746  ARG A C   1 
ATOM   5778 O  O   . ARG A 1 746 ? 18.081 53.967  71.605 1.00 93.27  ? 746  ARG A O   1 
ATOM   5779 C  CB  . ARG A 1 746 ? 17.248 51.828  69.929 1.00 92.97  ? 746  ARG A CB  1 
ATOM   5780 C  CG  . ARG A 1 746 ? 16.468 50.860  69.052 1.00 94.70  ? 746  ARG A CG  1 
ATOM   5781 C  CD  . ARG A 1 746 ? 14.961 50.990  69.271 1.00 96.33  ? 746  ARG A CD  1 
ATOM   5782 N  NE  . ARG A 1 746 ? 14.448 52.331  68.979 1.00 97.80  ? 746  ARG A NE  1 
ATOM   5783 C  CZ  . ARG A 1 746 ? 14.397 52.879  67.766 1.00 98.33  ? 746  ARG A CZ  1 
ATOM   5784 N  NH1 . ARG A 1 746 ? 14.827 52.211  66.705 1.00 98.52  ? 746  ARG A NH1 1 
ATOM   5785 N  NH2 . ARG A 1 746 ? 13.914 54.104  67.611 1.00 99.06  ? 746  ARG A NH2 1 
ATOM   5786 N  N   . ALA A 1 747 ? 16.286 55.125  70.867 1.00 94.61  ? 747  ALA A N   1 
ATOM   5787 C  CA  . ALA A 1 747 ? 16.235 56.039  72.002 1.00 96.12  ? 747  ALA A CA  1 
ATOM   5788 C  C   . ALA A 1 747 ? 15.181 57.124  71.782 1.00 97.03  ? 747  ALA A C   1 
ATOM   5789 O  O   . ALA A 1 747 ? 14.373 57.402  72.668 1.00 97.28  ? 747  ALA A O   1 
ATOM   5790 C  CB  . ALA A 1 747 ? 17.606 56.674  72.234 1.00 96.32  ? 747  ALA A CB  1 
ATOM   5791 N  N   . PHE A 1 748 ? 15.192 57.739  70.604 1.00 97.93  ? 748  PHE A N   1 
ATOM   5792 C  CA  . PHE A 1 748 ? 14.225 58.787  70.295 1.00 99.19  ? 748  PHE A CA  1 
ATOM   5793 C  C   . PHE A 1 748 ? 13.668 58.653  68.873 1.00 100.37 ? 748  PHE A C   1 
ATOM   5794 O  O   . PHE A 1 748 ? 14.356 58.174  67.969 1.00 100.02 ? 748  PHE A O   1 
ATOM   5795 C  CB  . PHE A 1 748 ? 14.854 60.180  70.497 1.00 99.22  ? 748  PHE A CB  1 
ATOM   5796 C  CG  . PHE A 1 748 ? 16.343 60.162  70.790 1.00 99.68  ? 748  PHE A CG  1 
ATOM   5797 C  CD1 . PHE A 1 748 ? 17.264 59.781  69.815 1.00 99.15  ? 748  PHE A CD1 1 
ATOM   5798 C  CD2 . PHE A 1 748 ? 16.825 60.551  72.040 1.00 100.05 ? 748  PHE A CD2 1 
ATOM   5799 C  CE1 . PHE A 1 748 ? 18.641 59.791  70.081 1.00 98.60  ? 748  PHE A CE1 1 
ATOM   5800 C  CE2 . PHE A 1 748 ? 18.204 60.563  72.313 1.00 99.45  ? 748  PHE A CE2 1 
ATOM   5801 C  CZ  . PHE A 1 748 ? 19.109 60.182  71.329 1.00 98.13  ? 748  PHE A CZ  1 
ATOM   5802 N  N   . GLY A 1 749 ? 12.416 59.070  68.686 1.00 101.35 ? 749  GLY A N   1 
ATOM   5803 C  CA  . GLY A 1 749 ? 11.783 58.985  67.376 1.00 102.19 ? 749  GLY A CA  1 
ATOM   5804 C  C   . GLY A 1 749 ? 12.390 59.944  66.371 1.00 102.83 ? 749  GLY A C   1 
ATOM   5805 O  O   . GLY A 1 749 ? 12.972 60.957  66.762 1.00 102.96 ? 749  GLY A O   1 
ATOM   5806 N  N   . TYR A 1 750 ? 12.249 59.645  65.079 1.00 103.76 ? 750  TYR A N   1 
ATOM   5807 C  CA  . TYR A 1 750 ? 12.820 60.505  64.041 1.00 104.51 ? 750  TYR A CA  1 
ATOM   5808 C  C   . TYR A 1 750 ? 12.187 61.892  64.012 1.00 104.08 ? 750  TYR A C   1 
ATOM   5809 O  O   . TYR A 1 750 ? 12.483 62.702  63.133 1.00 103.76 ? 750  TYR A O   1 
ATOM   5810 C  CB  . TYR A 1 750 ? 12.711 59.855  62.651 1.00 106.02 ? 750  TYR A CB  1 
ATOM   5811 C  CG  . TYR A 1 750 ? 11.404 60.094  61.917 1.00 108.14 ? 750  TYR A CG  1 
ATOM   5812 C  CD1 . TYR A 1 750 ? 10.286 59.294  62.156 1.00 109.05 ? 750  TYR A CD1 1 
ATOM   5813 C  CD2 . TYR A 1 750 ? 11.288 61.124  60.976 1.00 108.88 ? 750  TYR A CD2 1 
ATOM   5814 C  CE1 . TYR A 1 750 ? 9.083  59.511  61.475 1.00 109.84 ? 750  TYR A CE1 1 
ATOM   5815 C  CE2 . TYR A 1 750 ? 10.090 61.351  60.291 1.00 109.37 ? 750  TYR A CE2 1 
ATOM   5816 C  CZ  . TYR A 1 750 ? 8.993  60.539  60.546 1.00 109.74 ? 750  TYR A CZ  1 
ATOM   5817 O  OH  . TYR A 1 750 ? 7.808  60.750  59.879 1.00 109.51 ? 750  TYR A OH  1 
ATOM   5818 N  N   . ARG A 1 751 ? 11.311 62.160  64.974 1.00 103.82 ? 751  ARG A N   1 
ATOM   5819 C  CA  . ARG A 1 751 ? 10.667 63.461  65.060 1.00 103.63 ? 751  ARG A CA  1 
ATOM   5820 C  C   . ARG A 1 751 ? 11.752 64.503  65.331 1.00 103.15 ? 751  ARG A C   1 
ATOM   5821 O  O   . ARG A 1 751 ? 11.585 65.689  65.038 1.00 102.92 ? 751  ARG A O   1 
ATOM   5822 C  CB  . ARG A 1 751 ? 9.617  63.456  66.180 1.00 103.83 ? 751  ARG A CB  1 
ATOM   5823 C  CG  . ARG A 1 751 ? 8.297  62.794  65.783 1.00 103.94 ? 751  ARG A CG  1 
ATOM   5824 C  CD  . ARG A 1 751 ? 7.379  62.598  66.977 1.00 104.55 ? 751  ARG A CD  1 
ATOM   5825 N  NE  . ARG A 1 751 ? 7.863  61.533  67.848 1.00 106.14 ? 751  ARG A NE  1 
ATOM   5826 C  CZ  . ARG A 1 751 ? 7.948  60.256  67.486 1.00 106.62 ? 751  ARG A CZ  1 
ATOM   5827 N  NH1 . ARG A 1 751 ? 7.578  59.883  66.267 1.00 106.69 ? 751  ARG A NH1 1 
ATOM   5828 N  NH2 . ARG A 1 751 ? 8.411  59.350  68.339 1.00 106.54 ? 751  ARG A NH2 1 
ATOM   5829 N  N   . LYS A 1 752 ? 12.873 64.038  65.878 1.00 103.04 ? 752  LYS A N   1 
ATOM   5830 C  CA  . LYS A 1 752 ? 14.005 64.905  66.182 1.00 102.67 ? 752  LYS A CA  1 
ATOM   5831 C  C   . LYS A 1 752 ? 15.272 64.468  65.448 1.00 103.61 ? 752  LYS A C   1 
ATOM   5832 O  O   . LYS A 1 752 ? 16.387 64.748  65.892 1.00 103.55 ? 752  LYS A O   1 
ATOM   5833 C  CB  . LYS A 1 752 ? 14.254 64.944  67.692 1.00 100.92 ? 752  LYS A CB  1 
ATOM   5834 C  CG  . LYS A 1 752 ? 13.170 65.690  68.464 1.00 98.12  ? 752  LYS A CG  1 
ATOM   5835 C  CD  . LYS A 1 752 ? 12.915 67.073  67.858 1.00 95.71  ? 752  LYS A CD  1 
ATOM   5836 C  CE  . LYS A 1 752 ? 14.187 67.911  67.810 1.00 93.61  ? 752  LYS A CE  1 
ATOM   5837 N  NZ  . LYS A 1 752 ? 13.973 69.229  67.160 1.00 91.36  ? 752  LYS A NZ  1 
ATOM   5838 N  N   . GLU A 1 753 ? 15.077 63.778  64.323 1.00 104.89 ? 753  GLU A N   1 
ATOM   5839 C  CA  . GLU A 1 753 ? 16.166 63.297  63.468 1.00 105.48 ? 753  GLU A CA  1 
ATOM   5840 C  C   . GLU A 1 753 ? 16.222 64.165  62.208 1.00 106.21 ? 753  GLU A C   1 
ATOM   5841 O  O   . GLU A 1 753 ? 17.088 63.985  61.348 1.00 105.77 ? 753  GLU A O   1 
ATOM   5842 C  CB  . GLU A 1 753 ? 15.944 61.829  63.076 1.00 105.21 ? 753  GLU A CB  1 
ATOM   5843 C  CG  . GLU A 1 753 ? 16.479 60.799  64.077 1.00 105.02 ? 753  GLU A CG  1 
ATOM   5844 C  CD  . GLU A 1 753 ? 15.696 60.749  65.382 1.00 104.87 ? 753  GLU A CD  1 
ATOM   5845 O  OE1 . GLU A 1 753 ? 15.568 61.794  66.057 1.00 104.54 ? 753  GLU A OE1 1 
ATOM   5846 O  OE2 . GLU A 1 753 ? 15.213 59.653  65.738 1.00 104.23 ? 753  GLU A OE2 1 
ATOM   5847 N  N   . ASP A 1 754 ? 15.273 65.094  62.115 1.00 107.17 ? 754  ASP A N   1 
ATOM   5848 C  CA  . ASP A 1 754 ? 15.167 66.040  61.004 1.00 108.00 ? 754  ASP A CA  1 
ATOM   5849 C  C   . ASP A 1 754 ? 15.437 67.423  61.583 1.00 108.62 ? 754  ASP A C   1 
ATOM   5850 O  O   . ASP A 1 754 ? 15.930 68.319  60.892 1.00 108.88 ? 754  ASP A O   1 
ATOM   5851 C  CB  . ASP A 1 754 ? 13.755 66.020  60.406 1.00 107.66 ? 754  ASP A CB  1 
ATOM   5852 C  CG  . ASP A 1 754 ? 13.469 64.761  59.617 1.00 107.51 ? 754  ASP A CG  1 
ATOM   5853 O  OD1 . ASP A 1 754 ? 12.285 64.528  59.291 1.00 107.16 ? 754  ASP A OD1 1 
ATOM   5854 O  OD2 . ASP A 1 754 ? 14.424 64.014  59.315 1.00 107.02 ? 754  ASP A OD2 1 
ATOM   5855 N  N   . LEU A 1 755 ? 15.098 67.569  62.865 1.00 109.00 ? 755  LEU A N   1 
ATOM   5856 C  CA  . LEU A 1 755 ? 15.260 68.810  63.624 1.00 109.14 ? 755  LEU A CA  1 
ATOM   5857 C  C   . LEU A 1 755 ? 14.374 69.932  63.067 1.00 109.50 ? 755  LEU A C   1 
ATOM   5858 O  O   . LEU A 1 755 ? 14.745 70.621  62.111 1.00 109.09 ? 755  LEU A O   1 
ATOM   5859 C  CB  . LEU A 1 755 ? 16.738 69.237  63.646 1.00 107.63 ? 755  LEU A CB  1 
ATOM   5860 C  CG  . LEU A 1 755 ? 17.171 70.258  64.706 1.00 106.38 ? 755  LEU A CG  1 
ATOM   5861 C  CD1 . LEU A 1 755 ? 16.759 69.791  66.097 1.00 104.88 ? 755  LEU A CD1 1 
ATOM   5862 C  CD2 . LEU A 1 755 ? 18.679 70.442  64.637 1.00 105.88 ? 755  LEU A CD2 1 
ATOM   5863 N  N   . ARG A 1 756 ? 13.199 70.094  63.678 1.00 109.93 ? 756  ARG A N   1 
ATOM   5864 C  CA  . ARG A 1 756 ? 12.222 71.108  63.281 1.00 110.06 ? 756  ARG A CA  1 
ATOM   5865 C  C   . ARG A 1 756 ? 11.598 70.773  61.928 1.00 109.89 ? 756  ARG A C   1 
ATOM   5866 O  O   . ARG A 1 756 ? 12.031 69.775  61.311 1.00 109.43 ? 756  ARG A O   1 
ATOM   5867 C  CB  . ARG A 1 756 ? 12.880 72.495  63.223 1.00 110.40 ? 756  ARG A CB  1 
ATOM   5868 C  CG  . ARG A 1 756 ? 13.328 73.029  64.577 1.00 111.18 ? 756  ARG A CG  1 
ATOM   5869 C  CD  . ARG A 1 756 ? 14.185 74.287  64.438 1.00 112.12 ? 756  ARG A CD  1 
ATOM   5870 N  NE  . ARG A 1 756 ? 14.552 74.847  65.741 1.00 113.36 ? 756  ARG A NE  1 
ATOM   5871 C  CZ  . ARG A 1 756 ? 15.428 75.835  65.924 1.00 113.29 ? 756  ARG A CZ  1 
ATOM   5872 N  NH1 . ARG A 1 756 ? 16.046 76.387  64.886 1.00 112.68 ? 756  ARG A NH1 1 
ATOM   5873 N  NH2 . ARG A 1 756 ? 15.687 76.273  67.151 1.00 113.31 ? 756  ARG A NH2 1 
HETATM 5874 NI NI  . NI  B 2 .   ? 25.454 28.321  32.842 1.00 41.61  ? 1001 NI  A NI  1 
HETATM 5875 C  C1  . GOL C 3 .   ? 21.721 23.933  67.891 1.00 72.11  ? 2001 GOL A C1  1 
HETATM 5876 O  O1  . GOL C 3 .   ? 21.678 25.327  68.256 1.00 70.93  ? 2001 GOL A O1  1 
HETATM 5877 C  C2  . GOL C 3 .   ? 21.795 23.836  66.360 1.00 72.42  ? 2001 GOL A C2  1 
HETATM 5878 O  O2  . GOL C 3 .   ? 23.105 24.245  65.965 1.00 70.99  ? 2001 GOL A O2  1 
HETATM 5879 C  C3  . GOL C 3 .   ? 21.500 22.468  65.903 1.00 73.09  ? 2001 GOL A C3  1 
HETATM 5880 O  O3  . GOL C 3 .   ? 22.194 22.256  64.605 1.00 74.41  ? 2001 GOL A O3  1 
HETATM 5881 O  O   . HOH D 4 .   ? 21.220 7.502   40.839 1.00 4.11   ? 2002 HOH A O   1 
HETATM 5882 O  O   . HOH D 4 .   ? 34.398 -5.754  42.800 1.00 35.61  ? 2003 HOH A O   1 
HETATM 5883 O  O   . HOH D 4 .   ? 32.586 -10.218 46.106 1.00 29.03  ? 2004 HOH A O   1 
HETATM 5884 O  O   . HOH D 4 .   ? 15.219 -2.635  49.255 1.00 20.35  ? 2005 HOH A O   1 
HETATM 5885 O  O   . HOH D 4 .   ? 17.331 -3.850  52.081 1.00 20.75  ? 2006 HOH A O   1 
HETATM 5886 O  O   . HOH D 4 .   ? 4.695  0.480   49.686 1.00 25.31  ? 2007 HOH A O   1 
HETATM 5887 O  O   . HOH D 4 .   ? 35.671 1.193   51.449 1.00 27.33  ? 2008 HOH A O   1 
HETATM 5888 O  O   . HOH D 4 .   ? 23.568 -15.878 52.583 1.00 38.39  ? 2009 HOH A O   1 
HETATM 5889 O  O   . HOH D 4 .   ? 18.969 -10.769 68.886 1.00 35.80  ? 2010 HOH A O   1 
HETATM 5890 O  O   . HOH D 4 .   ? 3.970  -4.118  45.445 1.00 35.23  ? 2011 HOH A O   1 
HETATM 5891 O  O   . HOH D 4 .   ? 15.170 5.573   46.980 1.00 25.05  ? 2012 HOH A O   1 
HETATM 5892 O  O   . HOH D 4 .   ? 23.781 29.752  33.347 1.00 50.05  ? 2013 HOH A O   1 
HETATM 5893 O  O   . HOH D 4 .   ? 9.730  -24.205 56.035 1.00 63.07  ? 2014 HOH A O   1 
HETATM 5894 O  O   . HOH D 4 .   ? 41.154 14.463  45.052 1.00 19.11  ? 2015 HOH A O   1 
HETATM 5895 O  O   . HOH D 4 .   ? 21.871 2.079   39.447 1.00 31.49  ? 2016 HOH A O   1 
HETATM 5896 O  O   . HOH D 4 .   ? 14.683 -11.367 36.840 1.00 40.84  ? 2017 HOH A O   1 
HETATM 5897 O  O   . HOH D 4 .   ? 19.310 -5.574  56.598 1.00 2.03   ? 2018 HOH A O   1 
HETATM 5898 O  O   . HOH D 4 .   ? 13.227 -0.155  45.855 1.00 33.43  ? 2019 HOH A O   1 
HETATM 5899 O  O   . HOH D 4 .   ? 8.004  2.631   50.412 1.00 58.80  ? 2020 HOH A O   1 
HETATM 5900 O  O   . HOH D 4 .   ? 11.863 0.334   54.020 1.00 19.25  ? 2021 HOH A O   1 
HETATM 5901 O  O   . HOH D 4 .   ? 17.072 6.922   52.141 1.00 15.22  ? 2022 HOH A O   1 
HETATM 5902 O  O   . HOH D 4 .   ? 19.343 0.788   42.592 1.00 20.48  ? 2023 HOH A O   1 
HETATM 5903 O  O   . HOH D 4 .   ? 21.554 3.538   43.670 1.00 15.94  ? 2024 HOH A O   1 
HETATM 5904 O  O   . HOH D 4 .   ? 20.253 -1.303  57.007 1.00 15.05  ? 2025 HOH A O   1 
HETATM 5905 O  O   . HOH D 4 .   ? 43.520 18.801  35.987 1.00 37.60  ? 2026 HOH A O   1 
HETATM 5906 O  O   . HOH D 4 .   ? 44.101 18.064  29.134 1.00 24.69  ? 2027 HOH A O   1 
HETATM 5907 O  O   . HOH D 4 .   ? 23.972 20.228  49.595 1.00 2.20   ? 2028 HOH A O   1 
HETATM 5908 O  O   . HOH D 4 .   ? 25.735 20.887  53.823 1.00 15.18  ? 2029 HOH A O   1 
HETATM 5909 O  O   . HOH D 4 .   ? 24.436 37.699  37.797 1.00 32.19  ? 2030 HOH A O   1 
HETATM 5910 O  O   . HOH D 4 .   ? 29.790 39.957  40.933 1.00 38.17  ? 2031 HOH A O   1 
HETATM 5911 O  O   . HOH D 4 .   ? 34.587 39.940  35.516 1.00 27.29  ? 2032 HOH A O   1 
HETATM 5912 O  O   . HOH D 4 .   ? 32.482 37.772  33.417 1.00 32.25  ? 2033 HOH A O   1 
HETATM 5913 O  O   . HOH D 4 .   ? 3.885  29.285  64.692 1.00 44.23  ? 2034 HOH A O   1 
HETATM 5914 O  O   . HOH D 4 .   ? 19.178 9.193   48.401 1.00 9.20   ? 2035 HOH A O   1 
HETATM 5915 O  O   . HOH D 4 .   ? 26.252 -8.472  60.265 1.00 14.31  ? 2036 HOH A O   1 
HETATM 5916 O  O   . HOH D 4 .   ? 15.510 -0.230  65.528 1.00 23.16  ? 2037 HOH A O   1 
HETATM 5917 O  O   . HOH D 4 .   ? 3.841  5.375   58.652 1.00 4.50   ? 2038 HOH A O   1 
HETATM 5918 O  O   . HOH D 4 .   ? -2.607 14.524  58.939 1.00 32.77  ? 2039 HOH A O   1 
HETATM 5919 O  O   . HOH D 4 .   ? 7.683  9.904   78.873 1.00 30.96  ? 2040 HOH A O   1 
HETATM 5920 O  O   . HOH D 4 .   ? 23.409 4.391   85.315 1.00 11.81  ? 2041 HOH A O   1 
HETATM 5921 O  O   . HOH D 4 .   ? 41.596 21.744  50.233 1.00 43.55  ? 2042 HOH A O   1 
HETATM 5922 O  O   . HOH D 4 .   ? 34.427 24.762  53.524 1.00 32.00  ? 2043 HOH A O   1 
HETATM 5923 O  O   . HOH D 4 .   ? 27.124 23.150  62.320 1.00 18.60  ? 2044 HOH A O   1 
HETATM 5924 O  O   . HOH D 4 .   ? 13.331 14.668  49.607 1.00 20.70  ? 2045 HOH A O   1 
HETATM 5925 O  O   . HOH D 4 .   ? 7.753  7.933   66.987 1.00 12.12  ? 2046 HOH A O   1 
HETATM 5926 O  O   . HOH D 4 .   ? 12.333 23.694  65.374 1.00 29.81  ? 2047 HOH A O   1 
HETATM 5927 O  O   . HOH D 4 .   ? 8.736  18.113  58.935 1.00 15.04  ? 2048 HOH A O   1 
HETATM 5928 O  O   . HOH D 4 .   ? 15.147 18.099  85.037 1.00 23.65  ? 2049 HOH A O   1 
HETATM 5929 O  O   . HOH D 4 .   ? 5.849  20.280  73.502 1.00 14.49  ? 2050 HOH A O   1 
HETATM 5930 O  O   . HOH D 4 .   ? 18.126 37.979  75.231 1.00 6.06   ? 2051 HOH A O   1 
HETATM 5931 O  O   . HOH D 4 .   ? 25.328 24.901  70.558 1.00 37.62  ? 2052 HOH A O   1 
HETATM 5932 O  O   . HOH D 4 .   ? 29.948 54.003  53.772 1.00 34.27  ? 2053 HOH A O   1 
HETATM 5933 O  O   . HOH D 4 .   ? 32.043 -12.259 43.343 1.00 28.01  ? 2054 HOH A O   1 
HETATM 5934 O  O   . HOH D 4 .   ? 29.482 -13.704 48.307 1.00 24.19  ? 2055 HOH A O   1 
HETATM 5935 O  O   . HOH D 4 .   ? 36.813 4.550   48.098 1.00 35.60  ? 2056 HOH A O   1 
HETATM 5936 O  O   . HOH D 4 .   ? 18.777 -2.721  34.360 1.00 25.25  ? 2057 HOH A O   1 
HETATM 5937 O  O   . HOH D 4 .   ? 33.348 -9.445  43.124 1.00 33.27  ? 2058 HOH A O   1 
HETATM 5938 O  O   . HOH D 4 .   ? 33.895 -10.121 48.851 1.00 32.47  ? 2059 HOH A O   1 
HETATM 5939 O  O   . HOH D 4 .   ? 25.731 -11.661 33.038 1.00 28.15  ? 2060 HOH A O   1 
HETATM 5940 O  O   . HOH D 4 .   ? 26.796 -10.496 48.007 1.00 23.17  ? 2061 HOH A O   1 
HETATM 5941 O  O   . HOH D 4 .   ? 21.449 -5.823  52.787 1.00 2.03   ? 2062 HOH A O   1 
HETATM 5942 O  O   . HOH D 4 .   ? -2.668 -17.341 48.678 1.00 39.23  ? 2063 HOH A O   1 
HETATM 5943 O  O   . HOH D 4 .   ? 2.157  -13.321 50.570 1.00 41.06  ? 2064 HOH A O   1 
HETATM 5944 O  O   . HOH D 4 .   ? -0.084 -11.871 39.870 1.00 29.69  ? 2065 HOH A O   1 
HETATM 5945 O  O   . HOH D 4 .   ? 8.537  -1.238  33.328 1.00 33.77  ? 2066 HOH A O   1 
HETATM 5946 O  O   . HOH D 4 .   ? 16.176 -19.853 58.398 1.00 30.39  ? 2067 HOH A O   1 
HETATM 5947 O  O   . HOH D 4 .   ? 20.127 -18.389 60.055 1.00 49.99  ? 2068 HOH A O   1 
HETATM 5948 O  O   . HOH D 4 .   ? 20.669 -5.055  59.196 1.00 32.27  ? 2069 HOH A O   1 
HETATM 5949 O  O   . HOH D 4 .   ? 12.664 0.971   66.632 1.00 13.15  ? 2070 HOH A O   1 
HETATM 5950 O  O   . HOH D 4 .   ? 6.910  -4.095  74.711 1.00 19.24  ? 2071 HOH A O   1 
HETATM 5951 O  O   . HOH D 4 .   ? 8.700  -2.362  69.401 1.00 15.07  ? 2072 HOH A O   1 
HETATM 5952 O  O   . HOH D 4 .   ? 16.751 -9.478  70.023 1.00 45.15  ? 2073 HOH A O   1 
HETATM 5953 O  O   . HOH D 4 .   ? 19.790 -9.790  58.933 1.00 26.15  ? 2074 HOH A O   1 
HETATM 5954 O  O   . HOH D 4 .   ? 13.639 -2.428  45.045 1.00 31.57  ? 2075 HOH A O   1 
HETATM 5955 O  O   . HOH D 4 .   ? 6.858  -2.812  62.073 1.00 17.40  ? 2076 HOH A O   1 
HETATM 5956 O  O   . HOH D 4 .   ? 10.293 2.896   53.421 1.00 25.91  ? 2077 HOH A O   1 
HETATM 5957 O  O   . HOH D 4 .   ? 14.052 2.533   46.092 1.00 46.29  ? 2078 HOH A O   1 
HETATM 5958 O  O   . HOH D 4 .   ? 39.986 7.614   54.144 1.00 28.40  ? 2079 HOH A O   1 
HETATM 5959 O  O   . HOH D 4 .   ? 11.758 29.310  18.299 1.00 46.95  ? 2080 HOH A O   1 
HETATM 5960 O  O   . HOH D 4 .   ? 13.838 42.701  17.789 1.00 45.02  ? 2081 HOH A O   1 
HETATM 5961 O  O   . HOH D 4 .   ? 5.640  25.983  21.059 1.00 41.60  ? 2082 HOH A O   1 
HETATM 5962 O  O   . HOH D 4 .   ? 40.099 17.846  33.397 1.00 24.12  ? 2083 HOH A O   1 
HETATM 5963 O  O   . HOH D 4 .   ? 46.076 18.037  35.079 1.00 32.81  ? 2084 HOH A O   1 
HETATM 5964 O  O   . HOH D 4 .   ? 29.365 31.749  18.484 1.00 26.40  ? 2085 HOH A O   1 
HETATM 5965 O  O   . HOH D 4 .   ? 35.490 30.888  15.680 1.00 38.92  ? 2086 HOH A O   1 
HETATM 5966 O  O   . HOH D 4 .   ? 42.155 32.420  15.264 1.00 50.30  ? 2087 HOH A O   1 
HETATM 5967 O  O   . HOH D 4 .   ? 45.647 36.951  16.831 1.00 27.24  ? 2088 HOH A O   1 
HETATM 5968 O  O   . HOH D 4 .   ? 45.135 34.854  19.139 1.00 38.05  ? 2089 HOH A O   1 
HETATM 5969 O  O   . HOH D 4 .   ? 46.397 28.841  22.373 1.00 61.16  ? 2090 HOH A O   1 
HETATM 5970 O  O   . HOH D 4 .   ? 24.790 25.052  13.632 1.00 26.41  ? 2091 HOH A O   1 
HETATM 5971 O  O   . HOH D 4 .   ? 27.079 23.182  9.079  1.00 40.10  ? 2092 HOH A O   1 
HETATM 5972 O  O   . HOH D 4 .   ? 40.949 19.267  21.150 1.00 31.88  ? 2093 HOH A O   1 
HETATM 5973 O  O   . HOH D 4 .   ? 36.384 9.317   29.039 1.00 45.94  ? 2094 HOH A O   1 
HETATM 5974 O  O   . HOH D 4 .   ? 25.294 2.325   31.884 1.00 35.30  ? 2095 HOH A O   1 
HETATM 5975 O  O   . HOH D 4 .   ? 23.593 5.925   24.634 1.00 36.01  ? 2096 HOH A O   1 
HETATM 5976 O  O   . HOH D 4 .   ? 22.693 6.776   27.888 1.00 29.35  ? 2097 HOH A O   1 
HETATM 5977 O  O   . HOH D 4 .   ? 11.811 13.052  43.768 1.00 43.62  ? 2098 HOH A O   1 
HETATM 5978 O  O   . HOH D 4 .   ? 9.984  14.112  42.016 1.00 46.84  ? 2099 HOH A O   1 
HETATM 5979 O  O   . HOH D 4 .   ? 18.275 23.111  44.671 1.00 24.14  ? 2100 HOH A O   1 
HETATM 5980 O  O   . HOH D 4 .   ? 16.609 25.912  46.179 1.00 24.99  ? 2101 HOH A O   1 
HETATM 5981 O  O   . HOH D 4 .   ? 18.933 33.437  42.621 1.00 41.39  ? 2102 HOH A O   1 
HETATM 5982 O  O   . HOH D 4 .   ? 33.680 27.356  52.124 1.00 40.03  ? 2103 HOH A O   1 
HETATM 5983 O  O   . HOH D 4 .   ? 29.633 8.241   51.932 1.00 13.94  ? 2104 HOH A O   1 
HETATM 5984 O  O   . HOH D 4 .   ? 35.999 13.378  55.881 1.00 35.34  ? 2105 HOH A O   1 
HETATM 5985 O  O   . HOH D 4 .   ? 38.381 11.049  56.175 1.00 18.93  ? 2106 HOH A O   1 
HETATM 5986 O  O   . HOH D 4 .   ? 27.960 11.174  37.633 1.00 10.60  ? 2107 HOH A O   1 
HETATM 5987 O  O   . HOH D 4 .   ? 25.608 4.967   54.277 1.00 42.18  ? 2108 HOH A O   1 
HETATM 5988 O  O   . HOH D 4 .   ? 23.545 7.640   42.812 1.00 22.74  ? 2109 HOH A O   1 
HETATM 5989 O  O   . HOH D 4 .   ? 31.300 6.263   61.038 1.00 27.89  ? 2110 HOH A O   1 
HETATM 5990 O  O   . HOH D 4 .   ? 31.277 2.717   59.160 1.00 30.25  ? 2111 HOH A O   1 
HETATM 5991 O  O   . HOH D 4 .   ? 25.064 6.436   46.887 1.00 31.81  ? 2112 HOH A O   1 
HETATM 5992 O  O   . HOH D 4 .   ? 18.137 21.666  58.231 1.00 37.37  ? 2113 HOH A O   1 
HETATM 5993 O  O   . HOH D 4 .   ? 29.232 2.740   65.927 1.00 41.96  ? 2114 HOH A O   1 
HETATM 5994 O  O   . HOH D 4 .   ? 23.055 -9.601  58.597 1.00 20.66  ? 2115 HOH A O   1 
HETATM 5995 O  O   . HOH D 4 .   ? 30.407 -1.680  63.891 1.00 53.72  ? 2116 HOH A O   1 
HETATM 5996 O  O   . HOH D 4 .   ? -6.796 10.267  59.089 1.00 35.61  ? 2117 HOH A O   1 
HETATM 5997 O  O   . HOH D 4 .   ? 4.920  11.126  67.353 1.00 21.92  ? 2118 HOH A O   1 
HETATM 5998 O  O   . HOH D 4 .   ? 7.010  20.388  60.086 1.00 38.20  ? 2119 HOH A O   1 
HETATM 5999 O  O   . HOH D 4 .   ? 2.419  24.086  61.955 1.00 35.75  ? 2120 HOH A O   1 
HETATM 6000 O  O   . HOH D 4 .   ? 5.778  23.463  60.357 1.00 35.67  ? 2121 HOH A O   1 
HETATM 6001 O  O   . HOH D 4 .   ? 13.093 38.355  70.900 1.00 28.88  ? 2122 HOH A O   1 
HETATM 6002 O  O   . HOH D 4 .   ? 9.639  41.041  70.546 1.00 39.25  ? 2123 HOH A O   1 
HETATM 6003 O  O   . HOH D 4 .   ? 14.244 57.055  24.313 1.00 79.95  ? 2124 HOH A O   1 
HETATM 6004 O  O   . HOH D 4 .   ? 21.276 53.314  70.994 1.00 21.43  ? 2125 HOH A O   1 
HETATM 6005 O  O   . HOH D 4 .   ? 21.282 45.961  73.316 1.00 40.38  ? 2126 HOH A O   1 
HETATM 6006 O  O   . HOH D 4 .   ? 32.536 47.407  81.089 1.00 25.76  ? 2127 HOH A O   1 
HETATM 6007 O  O   . HOH D 4 .   ? 32.856 29.646  70.450 1.00 31.97  ? 2128 HOH A O   1 
HETATM 6008 O  O   . HOH D 4 .   ? 27.184 11.455  79.879 1.00 44.64  ? 2129 HOH A O   1 
HETATM 6009 O  O   . HOH D 4 .   ? 7.580  2.858   74.328 1.00 42.23  ? 2130 HOH A O   1 
HETATM 6010 O  O   . HOH D 4 .   ? 11.423 -3.506  76.836 1.00 46.76  ? 2131 HOH A O   1 
HETATM 6011 O  O   . HOH D 4 .   ? 33.984 3.932   26.378 1.00 44.13  ? 2132 HOH A O   1 
HETATM 6012 O  O   . HOH D 4 .   ? 32.552 6.377   22.980 1.00 60.55  ? 2133 HOH A O   1 
HETATM 6013 O  O   . HOH D 4 .   ? 5.591  9.609   80.453 1.00 34.69  ? 2134 HOH A O   1 
HETATM 6014 O  O   . HOH D 4 .   ? 3.610  12.880  77.250 1.00 25.44  ? 2135 HOH A O   1 
HETATM 6015 O  O   . HOH D 4 .   ? 30.103 5.611   72.708 1.00 45.24  ? 2136 HOH A O   1 
HETATM 6016 O  O   . HOH D 4 .   ? 23.964 0.945   69.113 1.00 22.52  ? 2137 HOH A O   1 
HETATM 6017 O  O   . HOH D 4 .   ? 5.882  51.355  38.140 1.00 35.92  ? 2138 HOH A O   1 
HETATM 6018 O  O   . HOH D 4 .   ? 35.736 19.038  74.878 1.00 61.31  ? 2139 HOH A O   1 
HETATM 6019 O  O   . HOH D 4 .   ? 38.634 24.084  64.799 1.00 32.64  ? 2140 HOH A O   1 
HETATM 6020 O  O   . HOH D 4 .   ? 22.305 25.820  91.973 1.00 42.25  ? 2141 HOH A O   1 
HETATM 6021 O  O   . HOH D 4 .   ? 21.378 30.774  95.118 1.00 30.68  ? 2142 HOH A O   1 
HETATM 6022 O  O   . HOH D 4 .   ? 35.727 30.362  88.707 1.00 33.00  ? 2143 HOH A O   1 
HETATM 6023 O  O   . HOH D 4 .   ? 19.441 40.856  75.525 1.00 35.56  ? 2144 HOH A O   1 
HETATM 6024 O  O   . HOH D 4 .   ? 21.458 35.387  68.429 1.00 44.36  ? 2145 HOH A O   1 
HETATM 6025 O  O   . HOH D 4 .   ? 39.216 51.338  85.920 1.00 31.63  ? 2146 HOH A O   1 
HETATM 6026 O  O   . HOH D 4 .   ? 38.130 52.031  83.063 1.00 67.88  ? 2147 HOH A O   1 
HETATM 6027 O  O   . HOH D 4 .   ? 41.401 41.813  85.623 1.00 26.85  ? 2148 HOH A O   1 
HETATM 6028 O  O   . HOH D 4 .   ? 36.078 45.466  87.461 1.00 49.90  ? 2149 HOH A O   1 
HETATM 6029 O  O   . HOH D 4 .   ? 43.570 37.078  77.501 1.00 31.15  ? 2150 HOH A O   1 
HETATM 6030 O  O   . HOH D 4 .   ? 36.134 37.051  89.889 1.00 38.45  ? 2151 HOH A O   1 
HETATM 6031 O  O   . HOH D 4 .   ? 39.926 31.365  85.007 1.00 34.11  ? 2152 HOH A O   1 
HETATM 6032 O  O   . HOH D 4 .   ? 29.517 16.099  85.925 1.00 29.33  ? 2153 HOH A O   1 
HETATM 6033 O  O   . HOH D 4 .   ? 33.489 19.487  80.480 1.00 57.00  ? 2154 HOH A O   1 
HETATM 6034 O  O   . HOH D 4 .   ? 36.633 22.640  74.378 1.00 54.02  ? 2155 HOH A O   1 
HETATM 6035 O  O   . HOH D 4 .   ? 38.531 50.539  72.923 1.00 26.54  ? 2156 HOH A O   1 
HETATM 6036 O  O   . HOH D 4 .   ? 24.061 38.165  59.140 1.00 37.42  ? 2157 HOH A O   1 
HETATM 6037 O  O   . HOH D 4 .   ? 20.194 41.772  45.097 1.00 47.16  ? 2158 HOH A O   1 
HETATM 6038 O  O   . HOH D 4 .   ? 18.634 50.527  45.531 1.00 44.68  ? 2159 HOH A O   1 
HETATM 6039 O  O   . HOH D 4 .   ? 21.675 74.034  54.952 1.00 60.20  ? 2160 HOH A O   1 
HETATM 6040 O  O   . HOH D 4 .   ? 26.228 73.204  54.527 1.00 38.27  ? 2161 HOH A O   1 
HETATM 6041 O  O   . HOH D 4 .   ? 25.719 71.577  47.708 1.00 38.25  ? 2162 HOH A O   1 
HETATM 6042 O  O   . HOH D 4 .   ? 24.350 58.709  35.169 1.00 50.80  ? 2163 HOH A O   1 
HETATM 6043 O  O   . HOH D 4 .   ? 17.361 54.391  23.929 1.00 42.82  ? 2164 HOH A O   1 
HETATM 6044 O  O   . HOH D 4 .   ? 23.494 50.190  28.346 1.00 24.31  ? 2165 HOH A O   1 
HETATM 6045 O  O   . HOH D 4 .   ? 19.069 43.112  32.366 1.00 40.65  ? 2166 HOH A O   1 
HETATM 6046 O  O   . HOH D 4 .   ? 6.103  56.572  43.445 1.00 79.50  ? 2167 HOH A O   1 
HETATM 6047 O  O   . HOH D 4 .   ? 16.784 47.359  56.553 1.00 36.64  ? 2168 HOH A O   1 
HETATM 6048 O  O   . HOH D 4 .   ? 20.054 70.888  61.536 1.00 44.18  ? 2169 HOH A O   1 
HETATM 6049 O  O   . HOH D 4 .   ? 34.287 11.460  77.692 1.00 28.00  ? 2170 HOH A O   1 
HETATM 6050 O  O   . HOH D 4 .   ? 24.748 4.302   44.204 1.00 28.18  ? 2171 HOH A O   1 
HETATM 6051 O  O   . HOH D 4 .   ? 22.948 2.422   34.136 1.00 36.43  ? 2172 HOH A O   1 
HETATM 6052 O  O   . HOH D 4 .   ? 31.307 -2.385  30.681 1.00 109.85 ? 2173 HOH A O   1 
HETATM 6053 O  O   . HOH D 4 .   ? 49.096 3.860   48.347 1.00 40.54  ? 2174 HOH A O   1 
HETATM 6054 O  O   . HOH D 4 .   ? 35.662 -6.705  44.898 1.00 26.30  ? 2175 HOH A O   1 
HETATM 6055 O  O   . HOH D 4 .   ? 22.557 -8.761  52.370 1.00 25.91  ? 2176 HOH A O   1 
HETATM 6056 O  O   . HOH D 4 .   ? 1.551  -20.645 68.121 1.00 56.12  ? 2177 HOH A O   1 
HETATM 6057 O  O   . HOH D 4 .   ? -4.127 -19.287 52.414 1.00 55.25  ? 2178 HOH A O   1 
HETATM 6058 O  O   . HOH D 4 .   ? 0.000  -23.249 51.571 1.00 27.44  ? 2179 HOH A O   1 
HETATM 6059 O  O   . HOH D 4 .   ? -4.708 -23.291 49.776 1.00 54.87  ? 2180 HOH A O   1 
HETATM 6060 O  O   . HOH D 4 .   ? -2.756 -21.597 50.383 1.00 39.04  ? 2181 HOH A O   1 
HETATM 6061 O  O   . HOH D 4 .   ? -5.158 -22.895 52.844 1.00 30.46  ? 2182 HOH A O   1 
HETATM 6062 O  O   . HOH D 4 .   ? 0.437  -16.362 45.364 1.00 37.95  ? 2183 HOH A O   1 
HETATM 6063 O  O   . HOH D 4 .   ? 41.672 10.347  35.238 1.00 40.65  ? 2184 HOH A O   1 
HETATM 6064 O  O   . HOH D 4 .   ? -0.302 -10.369 31.582 1.00 40.40  ? 2185 HOH A O   1 
HETATM 6065 O  O   . HOH D 4 .   ? 23.453 -15.604 55.512 1.00 68.18  ? 2186 HOH A O   1 
HETATM 6066 O  O   . HOH D 4 .   ? 15.581 -20.445 66.333 1.00 33.29  ? 2187 HOH A O   1 
HETATM 6067 O  O   . HOH D 4 .   ? 10.981 2.999   73.114 1.00 67.67  ? 2188 HOH A O   1 
HETATM 6068 O  O   . HOH D 4 .   ? 13.732 -20.969 60.530 1.00 29.46  ? 2189 HOH A O   1 
HETATM 6069 O  O   . HOH D 4 .   ? 21.157 -9.445  56.794 1.00 15.26  ? 2190 HOH A O   1 
HETATM 6070 O  O   . HOH D 4 .   ? 9.489  -1.532  36.146 1.00 24.24  ? 2191 HOH A O   1 
HETATM 6071 O  O   . HOH D 4 .   ? 2.003  -6.048  45.235 1.00 28.89  ? 2192 HOH A O   1 
HETATM 6072 O  O   . HOH D 4 .   ? 1.158  -3.039  57.632 1.00 31.57  ? 2193 HOH A O   1 
HETATM 6073 O  O   . HOH D 4 .   ? 20.993 8.445   43.270 1.00 61.95  ? 2194 HOH A O   1 
HETATM 6074 O  O   . HOH D 4 .   ? 22.603 -2.328  54.094 1.00 47.07  ? 2195 HOH A O   1 
HETATM 6075 O  O   . HOH D 4 .   ? 42.581 8.625   53.730 1.00 28.19  ? 2196 HOH A O   1 
HETATM 6076 O  O   . HOH D 4 .   ? 41.371 3.853   51.796 1.00 52.52  ? 2197 HOH A O   1 
HETATM 6077 O  O   . HOH D 4 .   ? 21.454 33.170  27.673 1.00 52.36  ? 2198 HOH A O   1 
HETATM 6078 O  O   . HOH D 4 .   ? 36.421 27.263  10.579 1.00 54.99  ? 2199 HOH A O   1 
HETATM 6079 O  O   . HOH D 4 .   ? 46.659 16.489  27.921 1.00 36.36  ? 2200 HOH A O   1 
HETATM 6080 O  O   . HOH D 4 .   ? 43.111 18.123  26.203 1.00 35.53  ? 2201 HOH A O   1 
HETATM 6081 O  O   . HOH D 4 .   ? 15.060 18.081  14.076 1.00 26.18  ? 2202 HOH A O   1 
HETATM 6082 O  O   . HOH D 4 .   ? 13.183 10.380  36.024 1.00 59.99  ? 2203 HOH A O   1 
HETATM 6083 O  O   . HOH D 4 .   ? 19.622 19.946  41.879 1.00 38.81  ? 2204 HOH A O   1 
HETATM 6084 O  O   . HOH D 4 .   ? 33.355 9.370   27.238 1.00 30.00  ? 2205 HOH A O   1 
HETATM 6085 O  O   . HOH D 4 .   ? 20.670 5.415   37.704 1.00 56.66  ? 2206 HOH A O   1 
HETATM 6086 O  O   . HOH D 4 .   ? 29.753 22.682  51.864 1.00 38.99  ? 2207 HOH A O   1 
HETATM 6087 O  O   . HOH D 4 .   ? 33.699 42.396  47.065 1.00 25.78  ? 2208 HOH A O   1 
HETATM 6088 O  O   . HOH D 4 .   ? 15.933 41.733  32.385 1.00 26.18  ? 2209 HOH A O   1 
HETATM 6089 O  O   . HOH D 4 .   ? 17.007 3.435   39.138 1.00 19.98  ? 2210 HOH A O   1 
HETATM 6090 O  O   . HOH D 4 .   ? 20.196 -0.272  35.664 1.00 46.21  ? 2211 HOH A O   1 
HETATM 6091 O  O   . HOH D 4 .   ? 30.557 -0.903  32.579 1.00 53.25  ? 2212 HOH A O   1 
HETATM 6092 O  O   . HOH D 4 .   ? 47.484 6.868   43.871 1.00 29.15  ? 2213 HOH A O   1 
HETATM 6093 O  O   . HOH D 4 .   ? 43.047 0.546   35.782 1.00 44.62  ? 2214 HOH A O   1 
HETATM 6094 O  O   . HOH D 4 .   ? 30.682 -11.984 46.935 1.00 49.39  ? 2215 HOH A O   1 
HETATM 6095 O  O   . HOH D 4 .   ? 8.244  -13.817 61.786 1.00 35.78  ? 2216 HOH A O   1 
HETATM 6096 O  O   . HOH D 4 .   ? 8.892  -15.161 65.083 1.00 44.72  ? 2217 HOH A O   1 
HETATM 6097 O  O   . HOH D 4 .   ? 38.287 25.655  10.763 1.00 32.14  ? 2218 HOH A O   1 
HETATM 6098 O  O   . HOH D 4 .   ? 1.103  -13.811 36.610 1.00 50.45  ? 2219 HOH A O   1 
HETATM 6099 O  O   . HOH D 4 .   ? 0.340  -16.415 43.019 1.00 59.62  ? 2220 HOH A O   1 
HETATM 6100 O  O   . HOH D 4 .   ? 5.328  -8.626  27.429 1.00 43.98  ? 2221 HOH A O   1 
HETATM 6101 O  O   . HOH D 4 .   ? 12.180 -12.845 38.660 1.00 42.99  ? 2222 HOH A O   1 
HETATM 6102 O  O   . HOH D 4 .   ? 16.754 -4.089  47.444 1.00 35.91  ? 2223 HOH A O   1 
HETATM 6103 O  O   . HOH D 4 .   ? 8.370  38.953  73.301 1.00 39.38  ? 2224 HOH A O   1 
HETATM 6104 O  O   . HOH D 4 .   ? 28.930 31.092  26.914 1.00 43.71  ? 2225 HOH A O   1 
HETATM 6105 O  O   . HOH D 4 .   ? 7.476  25.211  25.112 1.00 51.76  ? 2226 HOH A O   1 
HETATM 6106 O  O   . HOH D 4 .   ? 22.947 34.237  29.471 1.00 55.06  ? 2227 HOH A O   1 
HETATM 6107 O  O   . HOH D 4 .   ? 18.494 31.619  17.835 1.00 68.76  ? 2228 HOH A O   1 
HETATM 6108 O  O   . HOH D 4 .   ? 43.905 20.329  33.432 1.00 44.89  ? 2229 HOH A O   1 
HETATM 6109 O  O   . HOH D 4 .   ? 6.365  28.971  72.486 1.00 25.76  ? 2230 HOH A O   1 
HETATM 6110 O  O   . HOH D 4 .   ? 45.940 33.290  14.762 1.00 68.37  ? 2231 HOH A O   1 
HETATM 6111 O  O   . HOH D 4 .   ? 40.853 31.044  17.701 1.00 63.70  ? 2232 HOH A O   1 
HETATM 6112 O  O   . HOH D 4 .   ? 45.156 29.421  25.795 1.00 46.49  ? 2233 HOH A O   1 
HETATM 6113 O  O   . HOH D 4 .   ? 41.957 27.869  16.931 1.00 49.84  ? 2234 HOH A O   1 
HETATM 6114 O  O   . HOH D 4 .   ? 40.602 12.835  20.958 1.00 25.30  ? 2235 HOH A O   1 
HETATM 6115 O  O   . HOH D 4 .   ? 13.608 8.425   37.358 1.00 44.15  ? 2236 HOH A O   1 
HETATM 6116 O  O   . HOH D 4 .   ? 19.177 20.601  54.380 1.00 21.85  ? 2237 HOH A O   1 
HETATM 6117 O  O   . HOH D 4 .   ? 37.224 36.339  36.715 1.00 33.62  ? 2238 HOH A O   1 
HETATM 6118 O  O   . HOH D 4 .   ? 17.020 40.574  19.245 1.00 36.04  ? 2239 HOH A O   1 
HETATM 6119 O  O   . HOH D 4 .   ? 35.124 11.354  59.344 1.00 24.87  ? 2240 HOH A O   1 
HETATM 6120 O  O   . HOH D 4 .   ? 19.503 19.527  63.509 1.00 26.53  ? 2241 HOH A O   1 
HETATM 6121 O  O   . HOH D 4 .   ? 15.375 4.920   51.805 1.00 45.25  ? 2242 HOH A O   1 
HETATM 6122 O  O   . HOH D 4 .   ? 4.241  17.030  50.314 1.00 71.06  ? 2243 HOH A O   1 
HETATM 6123 O  O   . HOH D 4 .   ? 6.730  14.216  50.758 1.00 56.56  ? 2244 HOH A O   1 
HETATM 6124 O  O   . HOH D 4 .   ? 7.438  10.279  85.382 1.00 34.21  ? 2245 HOH A O   1 
HETATM 6125 O  O   . HOH D 4 .   ? 2.498  9.683   79.082 1.00 40.67  ? 2246 HOH A O   1 
HETATM 6126 O  O   . HOH D 4 .   ? 4.644  18.278  74.865 1.00 37.91  ? 2247 HOH A O   1 
HETATM 6127 O  O   . HOH D 4 .   ? 40.309 22.386  66.595 1.00 57.22  ? 2248 HOH A O   1 
HETATM 6128 O  O   . HOH D 4 .   ? 38.527 25.708  67.250 1.00 32.29  ? 2249 HOH A O   1 
HETATM 6129 O  O   . HOH D 4 .   ? 8.575  17.305  63.975 1.00 18.09  ? 2250 HOH A O   1 
HETATM 6130 O  O   . HOH D 4 .   ? 8.099  10.735  67.418 1.00 16.15  ? 2251 HOH A O   1 
HETATM 6131 O  O   . HOH D 4 .   ? 11.628 20.561  68.990 1.00 28.12  ? 2252 HOH A O   1 
HETATM 6132 O  O   . HOH D 4 .   ? 33.450 36.113  92.508 1.00 35.90  ? 2253 HOH A O   1 
HETATM 6133 O  O   . HOH D 4 .   ? 35.449 31.644  90.783 1.00 38.34  ? 2254 HOH A O   1 
HETATM 6134 O  O   . HOH D 4 .   ? 37.792 39.089  94.051 1.00 36.87  ? 2255 HOH A O   1 
HETATM 6135 O  O   . HOH D 4 .   ? 22.736 32.909  70.526 1.00 57.79  ? 2256 HOH A O   1 
HETATM 6136 O  O   . HOH D 4 .   ? 39.978 33.928  71.776 1.00 43.71  ? 2257 HOH A O   1 
HETATM 6137 O  O   . HOH D 4 .   ? 38.572 33.820  69.706 1.00 72.74  ? 2258 HOH A O   1 
HETATM 6138 O  O   . HOH D 4 .   ? 15.852 38.421  61.906 1.00 39.47  ? 2259 HOH A O   1 
HETATM 6139 O  O   . HOH D 4 .   ? 10.100 37.162  72.166 1.00 53.43  ? 2260 HOH A O   1 
HETATM 6140 O  O   . HOH D 4 .   ? 12.584 54.007  49.128 1.00 45.29  ? 2261 HOH A O   1 
HETATM 6141 O  O   . HOH D 4 .   ? 18.660 50.001  52.829 1.00 38.09  ? 2262 HOH A O   1 
HETATM 6142 O  O   . HOH D 4 .   ? 21.677 49.681  53.680 1.00 43.83  ? 2263 HOH A O   1 
HETATM 6143 O  O   . HOH D 4 .   ? 27.248 63.847  79.435 1.00 65.95  ? 2264 HOH A O   1 
HETATM 6144 O  O   . HOH D 4 .   ? 29.453 65.854  64.569 1.00 26.63  ? 2265 HOH A O   1 
HETATM 6145 O  O   . HOH D 4 .   ? 26.612 70.161  64.807 1.00 34.69  ? 2266 HOH A O   1 
HETATM 6146 O  O   . HOH D 4 .   ? 27.090 73.959  61.165 1.00 46.70  ? 2267 HOH A O   1 
HETATM 6147 O  O   . HOH D 4 .   ? 15.459 66.649  49.726 1.00 60.02  ? 2268 HOH A O   1 
HETATM 6148 O  O   . HOH D 4 .   ? 23.738 56.664  44.339 1.00 33.14  ? 2269 HOH A O   1 
HETATM 6149 O  O   . HOH D 4 .   ? 16.536 54.520  20.874 1.00 44.88  ? 2270 HOH A O   1 
HETATM 6150 O  O   . HOH D 4 .   ? 13.932 57.535  21.959 1.00 31.97  ? 2271 HOH A O   1 
HETATM 6151 O  O   . HOH D 4 .   ? 4.186  62.208  52.540 1.00 56.64  ? 2272 HOH A O   1 
HETATM 6152 O  O   . HOH D 4 .   ? 38.225 11.312  52.695 1.00 25.93  ? 2273 HOH A O   1 
HETATM 6153 O  O   . HOH D 4 .   ? -0.223 -1.058  73.873 1.00 34.29  ? 2274 HOH A O   1 
HETATM 6154 O  O   . HOH D 4 .   ? 8.917  21.022  73.422 1.00 34.78  ? 2275 HOH A O   1 
HETATM 6155 O  O   . HOH D 4 .   ? 5.596  22.438  74.188 1.00 13.74  ? 2276 HOH A O   1 
HETATM 6156 O  O   . HOH D 4 .   ? 5.869  21.852  71.800 1.00 44.16  ? 2277 HOH A O   1 
HETATM 6157 O  O   . HOH D 4 .   ? 4.326  26.545  63.160 1.00 37.08  ? 2278 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   ASP 4   4   4   ASP ASP A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  TYR 30  30  30  TYR TYR A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  THR 55  55  55  THR THR A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  ARG 58  58  58  ARG ARG A . n 
A 1 59  HIS 59  59  59  HIS HIS A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  HIS 89  89  89  HIS HIS A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 HIS 103 103 103 HIS HIS A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 TYR 120 120 120 TYR TYR A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 MET 129 129 129 MET MET A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 MET 137 137 137 MET MET A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 MET 159 159 159 MET MET A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 ASP 164 164 164 ASP ASP A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 ARG 169 169 169 ARG ARG A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 THR 172 172 172 THR THR A . n 
A 1 173 TRP 173 173 173 TRP TRP A . n 
A 1 174 LYS 174 174 174 LYS LYS A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 PRO 179 179 179 PRO PRO A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 SER 185 185 185 SER SER A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 GLU 189 189 189 GLU GLU A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 ARG 193 193 193 ARG ARG A . n 
A 1 194 PHE 194 194 194 PHE PHE A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 PRO 203 203 203 PRO PRO A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 THR 208 208 208 THR THR A . n 
A 1 209 TYR 209 209 209 TYR TYR A . n 
A 1 210 ASN 210 210 210 ASN ASN A . n 
A 1 211 GLY 211 211 211 GLY GLY A . n 
A 1 212 ASP 212 212 212 ASP ASP A . n 
A 1 213 ASN 213 213 213 ASN ASN A . n 
A 1 214 PHE 214 214 214 PHE PHE A . n 
A 1 215 ASP 215 215 215 ASP ASP A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 TYR 218 218 218 TYR TYR A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 CYS 223 223 223 CYS CYS A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 ASN 229 229 229 ASN ASN A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 ASP 235 235 235 ASP ASP A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 MET 244 244 244 MET MET A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 ASP 246 246 246 ASP ASP A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 PHE 248 248 248 PHE PHE A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 GLU 251 251 251 GLU GLU A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 GLY 254 254 254 GLY GLY A . n 
A 1 255 ARG 255 255 255 ARG ARG A . n 
A 1 256 ILE 256 256 256 ILE ILE A . n 
A 1 257 HIS 257 257 257 HIS HIS A . n 
A 1 258 PHE 258 258 258 PHE PHE A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 TYR 261 261 261 TYR TYR A . n 
A 1 262 PRO 262 262 262 PRO PRO A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 ILE 264 264 264 ILE ILE A . n 
A 1 265 ARG 265 265 265 ARG ARG A . n 
A 1 266 ARG 266 266 266 ARG ARG A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 ILE 268 268 268 ILE ILE A . n 
A 1 269 ASN 269 269 269 ASN ASN A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 THR 272 272 272 THR THR A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 VAL 278 278 278 VAL VAL A . n 
A 1 279 TYR 279 279 279 TYR TYR A . n 
A 1 280 GLU 280 280 280 GLU GLU A . n 
A 1 281 ALA 281 281 281 ALA ALA A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 PHE 283 283 283 PHE PHE A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 GLN 285 285 285 GLN GLN A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 LYS 289 289 289 LYS LYS A . n 
A 1 290 VAL 290 290 290 VAL VAL A . n 
A 1 291 TYR 291 291 291 TYR TYR A . n 
A 1 292 ALA 292 292 292 ALA ALA A . n 
A 1 293 GLU 293 293 293 GLU GLU A . n 
A 1 294 GLU 294 294 294 GLU GLU A . n 
A 1 295 ILE 295 295 295 ILE ILE A . n 
A 1 296 THR 296 296 296 THR THR A . n 
A 1 297 THR 297 297 297 THR THR A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 TRP 299 299 299 TRP TRP A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 THR 301 301 301 THR THR A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 GLU 303 303 303 GLU GLU A . n 
A 1 304 ASN 304 304 304 ASN ASN A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 ALA 309 309 309 ALA ALA A . n 
A 1 310 ARG 310 310 310 ARG ARG A . n 
A 1 311 TYR 311 311 311 TYR TYR A . n 
A 1 312 SER 312 312 312 SER SER A . n 
A 1 313 MET 313 313 313 MET MET A . n 
A 1 314 GLU 314 314 314 GLU GLU A . n 
A 1 315 ASP 315 315 315 ASP ASP A . n 
A 1 316 ALA 316 316 316 ALA ALA A . n 
A 1 317 LYS 317 317 317 LYS LYS A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 THR 319 319 319 THR THR A . n 
A 1 320 TYR 320 320 320 TYR TYR A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 LEU 322 322 322 LEU LEU A . n 
A 1 323 GLY 323 323 323 GLY GLY A . n 
A 1 324 LYS 324 324 324 LYS LYS A . n 
A 1 325 GLU 325 325 325 GLU GLU A . n 
A 1 326 PHE 326 326 326 PHE PHE A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 PRO 328 328 328 PRO PRO A . n 
A 1 329 MET 329 329 329 MET MET A . n 
A 1 330 GLU 330 330 330 GLU GLU A . n 
A 1 331 ALA 331 331 331 ALA ALA A . n 
A 1 332 GLN 332 332 332 GLN GLN A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 SER 334 334 334 SER SER A . n 
A 1 335 ARG 335 335 335 ARG ARG A . n 
A 1 336 LEU 336 336 336 LEU LEU A . n 
A 1 337 ILE 337 337 337 ILE ILE A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 GLN 339 339 339 GLN GLN A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 TRP 342 342 342 TRP TRP A . n 
A 1 343 ASP 343 343 343 ASP ASP A . n 
A 1 344 VAL 344 344 344 VAL VAL A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 ARG 346 346 346 ARG ARG A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 THR 349 349 349 THR THR A . n 
A 1 350 GLY 350 350 350 GLY GLY A . n 
A 1 351 ASN 351 351 351 ASN ASN A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 VAL 353 353 353 VAL VAL A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 TRP 355 355 355 TRP TRP A . n 
A 1 356 PHE 356 356 356 PHE PHE A . n 
A 1 357 LEU 357 357 357 LEU LEU A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 ARG 359 359 359 ARG ARG A . n 
A 1 360 LYS 360 360 360 LYS LYS A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 TYR 362 362 362 TYR TYR A . n 
A 1 363 GLU 363 363 363 GLU GLU A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ASN 365 365 365 ASN ASN A . n 
A 1 366 GLU 366 366 366 GLU GLU A . n 
A 1 367 LEU 367 367 367 LEU LEU A . n 
A 1 368 ALA 368 368 368 ALA ALA A . n 
A 1 369 PRO 369 369 369 PRO PRO A . n 
A 1 370 ASN 370 370 370 ASN ASN A . n 
A 1 371 LYS 371 371 371 LYS LYS A . n 
A 1 372 PRO 372 372 372 PRO PRO A . n 
A 1 373 ASP 373 373 373 ASP ASP A . n 
A 1 374 GLU 374 374 374 GLU GLU A . n 
A 1 375 LYS 375 375 375 LYS LYS A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 LEU 377 377 377 LEU LEU A . n 
A 1 378 ALA 378 378 378 ALA ALA A . n 
A 1 379 ARG 379 379 379 ARG ARG A . n 
A 1 380 ARG 380 380 380 ARG ARG A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 GLN 382 382 382 GLN GLN A . n 
A 1 383 SER 383 383 383 SER SER A . n 
A 1 384 TYR 384 384 384 TYR TYR A . n 
A 1 385 GLU 385 385 385 GLU GLU A . n 
A 1 386 GLY 386 386 386 GLY GLY A . n 
A 1 387 GLY 387 387 387 GLY GLY A . n 
A 1 388 TYR 388 388 388 TYR TYR A . n 
A 1 389 VAL 389 389 389 VAL VAL A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 GLU 391 391 391 GLU GLU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLU 393 393 393 GLU GLU A . n 
A 1 394 ARG 394 394 394 ARG ARG A . n 
A 1 395 GLY 395 395 395 GLY GLY A . n 
A 1 396 LEU 396 396 396 LEU ALA A . n 
A 1 397 TRP 397 397 397 TRP TRP A . n 
A 1 398 GLU 398 398 398 GLU GLU A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 TYR 402 402 402 TYR TYR A . n 
A 1 403 LEU 403 403 403 LEU LEU A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 PHE 405 405 405 PHE PHE A . n 
A 1 406 ARG 406 406 406 ARG ARG A . n 
A 1 407 SER 407 407 407 SER SER A . n 
A 1 408 LEU 408 408 408 LEU LEU A . n 
A 1 409 TYR 409 409 409 TYR TYR A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 SER 411 411 411 SER SER A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 ILE 414 414 414 ILE ILE A . n 
A 1 415 THR 415 415 415 THR THR A . n 
A 1 416 HIS 416 416 416 HIS HIS A . n 
A 1 417 ASN 417 417 417 ASN ASN A . n 
A 1 418 VAL 418 418 418 VAL VAL A . n 
A 1 419 SER 419 419 419 SER SER A . n 
A 1 420 PRO 420 420 420 PRO PRO A . n 
A 1 421 ASP 421 421 421 ASP ASP A . n 
A 1 422 THR 422 422 422 THR THR A . n 
A 1 423 LEU 423 423 423 LEU LEU A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 ARG 425 425 425 ARG ARG A . n 
A 1 426 GLU 426 426 426 GLU GLU A . n 
A 1 427 GLY 427 427 427 GLY GLY A . n 
A 1 428 CYS 428 428 428 CYS CYS A . n 
A 1 429 LYS 429 429 429 LYS LYS A . n 
A 1 430 GLU 430 430 430 GLU GLU A . n 
A 1 431 TYR 431 431 431 TYR TYR A . n 
A 1 432 ASP 432 432 432 ASP ASP A . n 
A 1 433 VAL 433 433 433 VAL VAL A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 PRO 435 435 435 PRO PRO A . n 
A 1 436 GLN 436 436 436 GLN GLN A . n 
A 1 437 VAL 437 437 437 VAL VAL A . n 
A 1 438 GLY 438 438 438 GLY GLY A . n 
A 1 439 HIS 439 439 439 HIS HIS A . n 
A 1 440 ARG 440 440 440 ARG ARG A . n 
A 1 441 PHE 441 441 441 PHE PHE A . n 
A 1 442 CYS 442 442 442 CYS CYS A . n 
A 1 443 LYS 443 443 443 LYS LYS A . n 
A 1 444 ASP 444 444 444 ASP ASP A . n 
A 1 445 PHE 445 445 445 PHE PHE A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 GLY 447 447 447 GLY GLY A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 ILE 449 449 449 ILE ILE A . n 
A 1 450 PRO 450 450 450 PRO PRO A . n 
A 1 451 SER 451 451 451 SER SER A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 LEU 453 453 453 LEU LEU A . n 
A 1 454 GLY 454 454 454 GLY GLY A . n 
A 1 455 ASP 455 455 455 ASP ASP A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 GLU 458 458 458 GLU GLU A . n 
A 1 459 GLU 459 459 459 GLU GLU A . n 
A 1 460 ARG 460 460 460 ARG ARG A . n 
A 1 461 GLN 461 461 461 GLN GLN A . n 
A 1 462 LYS 462 462 462 LYS LYS A . n 
A 1 463 ILE 463 463 463 ILE ILE A . n 
A 1 464 LYS 464 464 464 LYS LYS A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 LYS 466 466 466 LYS LYS A . n 
A 1 467 MET 467 467 467 MET MET A . n 
A 1 468 LYS 468 468 468 LYS LYS A . n 
A 1 469 ALA 469 469 469 ALA ALA A . n 
A 1 470 THR 470 470 470 THR THR A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 ASP 472 472 472 ASP ASP A . n 
A 1 473 PRO 473 473 473 PRO PRO A . n 
A 1 474 ILE 474 474 474 ILE ILE A . n 
A 1 475 GLU 475 475 475 GLU GLU A . n 
A 1 476 ARG 476 476 476 ARG ARG A . n 
A 1 477 LYS 477 477 477 LYS LYS A . n 
A 1 478 LEU 478 478 478 LEU LEU A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 ASP 480 480 480 ASP ASP A . n 
A 1 481 TYR 481 481 481 TYR TYR A . n 
A 1 482 ARG 482 482 482 ARG ARG A . n 
A 1 483 GLN 483 483 483 GLN GLN A . n 
A 1 484 ARG 484 484 484 ARG ARG A . n 
A 1 485 ALA 485 485 485 ALA ALA A . n 
A 1 486 ILE 486 486 486 ILE ILE A . n 
A 1 487 LYS 487 487 487 LYS LYS A . n 
A 1 488 ILE 488 488 488 ILE ILE A . n 
A 1 489 LEU 489 489 489 LEU LEU A . n 
A 1 490 ALA 490 490 490 ALA ALA A . n 
A 1 491 ASN 491 491 491 ASN ASN A . n 
A 1 492 SER 492 492 492 SER SER A . n 
A 1 493 TYR 493 493 493 TYR TYR A . n 
A 1 494 TYR 494 494 494 TYR TYR A . n 
A 1 495 GLY 495 495 495 GLY GLY A . n 
A 1 496 TYR 496 496 496 TYR TYR A . n 
A 1 497 TYR 497 497 497 TYR TYR A . n 
A 1 498 GLY 498 498 498 GLY GLY A . n 
A 1 499 TYR 499 499 499 TYR TYR A . n 
A 1 500 ALA 500 500 500 ALA ALA A . n 
A 1 501 ARG 501 501 501 ARG ARG A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 ARG 503 503 503 ARG ARG A . n 
A 1 504 TRP 504 504 504 TRP TRP A . n 
A 1 505 TYR 505 505 505 TYR TYR A . n 
A 1 506 CYS 506 506 506 CYS CYS A . n 
A 1 507 LYS 507 507 507 LYS LYS A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 CYS 509 509 509 CYS CYS A . n 
A 1 510 ALA 510 510 510 ALA ALA A . n 
A 1 511 GLU 511 511 511 GLU GLU A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 THR 514 514 514 THR THR A . n 
A 1 515 ALA 515 515 515 ALA ALA A . n 
A 1 516 TRP 516 516 516 TRP TRP A . n 
A 1 517 GLY 517 517 517 GLY GLY A . n 
A 1 518 ARG 518 518 518 ARG ARG A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 TYR 520 520 520 TYR TYR A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 THR 522 522 522 THR THR A . n 
A 1 523 MET 523 523 523 MET MET A . n 
A 1 524 THR 524 524 524 THR THR A . n 
A 1 525 ILE 525 525 525 ILE ILE A . n 
A 1 526 LYS 526 526 526 LYS LYS A . n 
A 1 527 GLU 527 527 527 GLU GLU A . n 
A 1 528 ILE 528 528 528 ILE ILE A . n 
A 1 529 GLU 529 529 529 GLU GLU A . n 
A 1 530 GLU 530 530 530 GLU GLU A . n 
A 1 531 LYS 531 531 531 LYS LYS A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 GLY 533 533 533 GLY GLY A . n 
A 1 534 PHE 534 534 534 PHE PHE A . n 
A 1 535 LYS 535 535 535 LYS LYS A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 ILE 537 537 537 ILE ILE A . n 
A 1 538 TYR 538 538 538 TYR TYR A . n 
A 1 539 SER 539 539 539 SER SER A . n 
A 1 540 ASP 540 540 540 ASP ASP A . n 
A 1 541 THR 541 541 541 THR THR A . n 
A 1 542 ASP 542 542 542 ASP ASP A . n 
A 1 543 GLY 543 543 543 GLY GLY A . n 
A 1 544 PHE 544 544 544 PHE PHE A . n 
A 1 545 PHE 545 545 545 PHE PHE A . n 
A 1 546 ALA 546 546 546 ALA ALA A . n 
A 1 547 THR 547 547 547 THR THR A . n 
A 1 548 ILE 548 548 548 ILE ILE A . n 
A 1 549 PRO 549 549 549 PRO PRO A . n 
A 1 550 GLY 550 550 550 GLY GLY A . n 
A 1 551 ALA 551 551 551 ALA ALA A . n 
A 1 552 ASP 552 552 552 ASP ASP A . n 
A 1 553 ALA 553 553 553 ALA ALA A . n 
A 1 554 GLU 554 554 554 GLU GLU A . n 
A 1 555 THR 555 555 555 THR THR A . n 
A 1 556 VAL 556 556 556 VAL VAL A . n 
A 1 557 LYS 557 557 557 LYS LYS A . n 
A 1 558 LYS 558 558 558 LYS ALA A . n 
A 1 559 LYS 559 559 559 LYS ALA A . n 
A 1 560 ALA 560 560 560 ALA ALA A . n 
A 1 561 MET 561 561 561 MET MET A . n 
A 1 562 GLU 562 562 562 GLU GLU A . n 
A 1 563 PHE 563 563 563 PHE PHE A . n 
A 1 564 LEU 564 564 564 LEU LEU A . n 
A 1 565 LYS 565 565 565 LYS LYS A . n 
A 1 566 TYR 566 566 566 TYR TYR A . n 
A 1 567 ILE 567 567 567 ILE ILE A . n 
A 1 568 ASN 568 568 568 ASN ASN A . n 
A 1 569 ALA 569 569 569 ALA ALA A . n 
A 1 570 LYS 570 570 570 LYS LYS A . n 
A 1 571 LEU 571 571 571 LEU LEU A . n 
A 1 572 PRO 572 572 572 PRO PRO A . n 
A 1 573 GLY 573 573 573 GLY GLY A . n 
A 1 574 ALA 574 574 574 ALA ALA A . n 
A 1 575 LEU 575 575 575 LEU LEU A . n 
A 1 576 GLU 576 576 576 GLU GLU A . n 
A 1 577 LEU 577 577 577 LEU LEU A . n 
A 1 578 GLU 578 578 578 GLU GLU A . n 
A 1 579 TYR 579 579 579 TYR TYR A . n 
A 1 580 GLU 580 580 580 GLU GLU A . n 
A 1 581 GLY 581 581 581 GLY GLY A . n 
A 1 582 PHE 582 582 582 PHE PHE A . n 
A 1 583 TYR 583 583 583 TYR TYR A . n 
A 1 584 GLU 584 584 584 GLU GLU A . n 
A 1 585 ARG 585 585 585 ARG ARG A . n 
A 1 586 GLY 586 586 586 GLY GLY A . n 
A 1 587 PHE 587 587 587 PHE PHE A . n 
A 1 588 PHE 588 588 588 PHE PHE A . n 
A 1 589 VAL 589 589 589 VAL VAL A . n 
A 1 590 THR 590 590 590 THR THR A . n 
A 1 591 LYS 591 591 591 LYS LYS A . n 
A 1 592 LYS 592 592 592 LYS LYS A . n 
A 1 593 LYS 593 593 593 LYS ALA A . n 
A 1 594 TYR 594 594 594 TYR TYR A . n 
A 1 595 ALA 595 595 595 ALA ALA A . n 
A 1 596 VAL 596 596 596 VAL VAL A . n 
A 1 597 ILE 597 597 597 ILE ILE A . n 
A 1 598 ASP 598 598 598 ASP ASP A . n 
A 1 599 GLU 599 599 599 GLU GLU A . n 
A 1 600 GLU 600 600 600 GLU GLU A . n 
A 1 601 GLY 601 601 601 GLY GLY A . n 
A 1 602 LYS 602 602 602 LYS LYS A . n 
A 1 603 ILE 603 603 603 ILE ILE A . n 
A 1 604 THR 604 604 604 THR THR A . n 
A 1 605 THR 605 605 605 THR THR A . n 
A 1 606 ARG 606 606 606 ARG ARG A . n 
A 1 607 GLY 607 607 607 GLY GLY A . n 
A 1 608 LEU 608 608 608 LEU LEU A . n 
A 1 609 GLU 609 609 609 GLU GLU A . n 
A 1 610 ILE 610 610 610 ILE ALA A . n 
A 1 611 VAL 611 611 611 VAL VAL A . n 
A 1 612 ARG 612 612 612 ARG ARG A . n 
A 1 613 ARG 613 613 613 ARG ALA A . n 
A 1 614 ASP 614 614 614 ASP ALA A . n 
A 1 615 TRP 615 615 615 TRP TRP A . n 
A 1 616 SER 616 616 616 SER SER A . n 
A 1 617 GLU 617 617 617 GLU ALA A . n 
A 1 618 ILE 618 618 618 ILE ILE A . n 
A 1 619 ALA 619 619 619 ALA ALA A . n 
A 1 620 LYS 620 620 620 LYS LYS A . n 
A 1 621 GLU 621 621 621 GLU GLU A . n 
A 1 622 THR 622 622 622 THR THR A . n 
A 1 623 GLN 623 623 623 GLN GLN A . n 
A 1 624 ALA 624 624 624 ALA ALA A . n 
A 1 625 ARG 625 625 625 ARG ARG A . n 
A 1 626 VAL 626 626 626 VAL VAL A . n 
A 1 627 LEU 627 627 627 LEU LEU A . n 
A 1 628 GLU 628 628 628 GLU GLU A . n 
A 1 629 ALA 629 629 629 ALA ALA A . n 
A 1 630 LEU 630 630 630 LEU LEU A . n 
A 1 631 LEU 631 631 631 LEU LEU A . n 
A 1 632 LYS 632 632 632 LYS LYS A . n 
A 1 633 ASP 633 633 633 ASP ASP A . n 
A 1 634 GLY 634 634 634 GLY GLY A . n 
A 1 635 ASP 635 635 635 ASP ASP A . n 
A 1 636 VAL 636 636 636 VAL VAL A . n 
A 1 637 GLU 637 637 637 GLU GLU A . n 
A 1 638 LYS 638 638 638 LYS LYS A . n 
A 1 639 ALA 639 639 639 ALA ALA A . n 
A 1 640 VAL 640 640 640 VAL VAL A . n 
A 1 641 ARG 641 641 641 ARG ARG A . n 
A 1 642 ILE 642 642 642 ILE ILE A . n 
A 1 643 VAL 643 643 643 VAL VAL A . n 
A 1 644 LYS 644 644 644 LYS LYS A . n 
A 1 645 GLU 645 645 645 GLU GLU A . n 
A 1 646 VAL 646 646 646 VAL VAL A . n 
A 1 647 THR 647 647 647 THR THR A . n 
A 1 648 GLU 648 648 648 GLU GLU A . n 
A 1 649 LYS 649 649 649 LYS LYS A . n 
A 1 650 LEU 650 650 650 LEU LEU A . n 
A 1 651 SER 651 651 651 SER SER A . n 
A 1 652 LYS 652 652 652 LYS ALA A . n 
A 1 653 TYR 653 653 653 TYR TYR A . n 
A 1 654 GLU 654 654 654 GLU GLU A . n 
A 1 655 VAL 655 655 655 VAL VAL A . n 
A 1 656 PRO 656 656 656 PRO PRO A . n 
A 1 657 PRO 657 657 657 PRO PRO A . n 
A 1 658 GLU 658 658 658 GLU GLU A . n 
A 1 659 LYS 659 659 659 LYS LYS A . n 
A 1 660 LEU 660 660 660 LEU LEU A . n 
A 1 661 VAL 661 661 661 VAL ALA A . n 
A 1 662 ILE 662 662 662 ILE ILE A . n 
A 1 663 HIS 663 663 663 HIS HIS A . n 
A 1 664 GLU 664 664 664 GLU ALA A . n 
A 1 665 GLN 665 665 665 GLN ALA A . n 
A 1 666 ILE 666 666 666 ILE ALA A . n 
A 1 667 THR 667 667 ?   ?   ?   A . n 
A 1 668 ARG 668 668 ?   ?   ?   A . n 
A 1 669 ASP 669 669 ?   ?   ?   A . n 
A 1 670 LEU 670 670 ?   ?   ?   A . n 
A 1 671 LYS 671 671 ?   ?   ?   A . n 
A 1 672 ASP 672 672 ?   ?   ?   A . n 
A 1 673 TYR 673 673 ?   ?   ?   A . n 
A 1 674 LYS 674 674 ?   ?   ?   A . n 
A 1 675 ALA 675 675 ?   ?   ?   A . n 
A 1 676 THR 676 676 ?   ?   ?   A . n 
A 1 677 GLY 677 677 ?   ?   ?   A . n 
A 1 678 PRO 678 678 678 PRO PRO A . n 
A 1 679 HIS 679 679 679 HIS HIS A . n 
A 1 680 VAL 680 680 680 VAL ALA A . n 
A 1 681 ALA 681 681 681 ALA ALA A . n 
A 1 682 VAL 682 682 682 VAL VAL A . n 
A 1 683 ALA 683 683 683 ALA ALA A . n 
A 1 684 LYS 684 684 684 LYS ALA A . n 
A 1 685 ARG 685 685 685 ARG ALA A . n 
A 1 686 LEU 686 686 686 LEU ALA A . n 
A 1 687 ALA 687 687 687 ALA ALA A . n 
A 1 688 ALA 688 688 688 ALA ALA A . n 
A 1 689 ARG 689 689 ?   ?   ?   A . n 
A 1 690 GLY 690 690 ?   ?   ?   A . n 
A 1 691 VAL 691 691 ?   ?   ?   A . n 
A 1 692 LYS 692 692 ?   ?   ?   A . n 
A 1 693 ILE 693 693 ?   ?   ?   A . n 
A 1 694 ARG 694 694 ?   ?   ?   A . n 
A 1 695 PRO 695 695 ?   ?   ?   A . n 
A 1 696 GLY 696 696 ?   ?   ?   A . n 
A 1 697 THR 697 697 697 THR THR A . n 
A 1 698 VAL 698 698 698 VAL ALA A . n 
A 1 699 ILE 699 699 699 ILE ALA A . n 
A 1 700 SER 700 700 700 SER SER A . n 
A 1 701 TYR 701 701 701 TYR TYR A . n 
A 1 702 ILE 702 702 702 ILE ALA A . n 
A 1 703 VAL 703 703 703 VAL ALA A . n 
A 1 704 LEU 704 704 704 LEU ALA A . n 
A 1 705 LYS 705 705 ?   ?   ?   A . n 
A 1 706 GLY 706 706 ?   ?   ?   A . n 
A 1 707 SER 707 707 ?   ?   ?   A . n 
A 1 708 GLY 708 708 ?   ?   ?   A . n 
A 1 709 ARG 709 709 ?   ?   ?   A . n 
A 1 710 ILE 710 710 ?   ?   ?   A . n 
A 1 711 GLY 711 711 ?   ?   ?   A . n 
A 1 712 ASP 712 712 ?   ?   ?   A . n 
A 1 713 ARG 713 713 713 ARG ARG A . n 
A 1 714 ALA 714 714 714 ALA ALA A . n 
A 1 715 ILE 715 715 715 ILE ALA A . n 
A 1 716 PRO 716 716 716 PRO PRO A . n 
A 1 717 PHE 717 717 717 PHE PHE A . n 
A 1 718 ASP 718 718 718 ASP ALA A . n 
A 1 719 GLU 719 719 719 GLU ALA A . n 
A 1 720 PHE 720 720 720 PHE ALA A . n 
A 1 721 ASP 721 721 721 ASP ASP A . n 
A 1 722 PRO 722 722 722 PRO PRO A . n 
A 1 723 THR 723 723 723 THR ALA A . n 
A 1 724 LYS 724 724 724 LYS ALA A . n 
A 1 725 HIS 725 725 725 HIS ALA A . n 
A 1 726 LYS 726 726 726 LYS LYS A . n 
A 1 727 TYR 727 727 727 TYR ALA A . n 
A 1 728 ASP 728 728 728 ASP ALA A . n 
A 1 729 ALA 729 729 729 ALA ALA A . n 
A 1 730 GLU 730 730 730 GLU ALA A . n 
A 1 731 TYR 731 731 731 TYR ALA A . n 
A 1 732 TYR 732 732 732 TYR TYR A . n 
A 1 733 ILE 733 733 733 ILE ILE A . n 
A 1 734 GLU 734 734 734 GLU GLU A . n 
A 1 735 ASN 735 735 735 ASN ALA A . n 
A 1 736 GLN 736 736 736 GLN GLN A . n 
A 1 737 VAL 737 737 737 VAL VAL A . n 
A 1 738 LEU 738 738 738 LEU LEU A . n 
A 1 739 PRO 739 739 739 PRO PRO A . n 
A 1 740 ALA 740 740 740 ALA ALA A . n 
A 1 741 VAL 741 741 741 VAL ALA A . n 
A 1 742 GLU 742 742 742 GLU ALA A . n 
A 1 743 ARG 743 743 743 ARG ALA A . n 
A 1 744 ILE 744 744 744 ILE ILE A . n 
A 1 745 LEU 745 745 745 LEU LEU A . n 
A 1 746 ARG 746 746 746 ARG ARG A . n 
A 1 747 ALA 747 747 747 ALA ALA A . n 
A 1 748 PHE 748 748 748 PHE PHE A . n 
A 1 749 GLY 749 749 749 GLY GLY A . n 
A 1 750 TYR 750 750 750 TYR TYR A . n 
A 1 751 ARG 751 751 751 ARG ARG A . n 
A 1 752 LYS 752 752 752 LYS LYS A . n 
A 1 753 GLU 753 753 753 GLU GLU A . n 
A 1 754 ASP 754 754 754 ASP ASP A . n 
A 1 755 LEU 755 755 755 LEU LEU A . n 
A 1 756 ARG 756 756 756 ARG ARG A . n 
A 1 757 TYR 757 757 ?   ?   ?   A . n 
A 1 758 GLN 758 758 ?   ?   ?   A . n 
A 1 759 LYS 759 759 ?   ?   ?   A . n 
A 1 760 THR 760 760 ?   ?   ?   A . n 
A 1 761 ARG 761 761 ?   ?   ?   A . n 
A 1 762 GLN 762 762 ?   ?   ?   A . n 
A 1 763 VAL 763 763 ?   ?   ?   A . n 
A 1 764 GLY 764 764 ?   ?   ?   A . n 
A 1 765 LEU 765 765 ?   ?   ?   A . n 
A 1 766 SER 766 766 ?   ?   ?   A . n 
A 1 767 ALA 767 767 ?   ?   ?   A . n 
A 1 768 TRP 768 768 ?   ?   ?   A . n 
A 1 769 LEU 769 769 ?   ?   ?   A . n 
A 1 770 LYS 770 770 ?   ?   ?   A . n 
A 1 771 PRO 771 771 ?   ?   ?   A . n 
A 1 772 LYS 772 772 ?   ?   ?   A . n 
A 1 773 GLY 773 773 ?   ?   ?   A . n 
A 1 774 THR 774 774 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   O 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   D 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   HOH 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    HOH 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     2013 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   NI 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   NI 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    NI 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     1001 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   OD1 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   ASP 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    141 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    ASP 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     141 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 159.1 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-08-02 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       1.0 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OH  A TYR 37  ? ? O A HOH 2062 ? ? 2.05 
2 1 OD2 A ASP 123 ? ? O A HOH 2062 ? ? 2.09 
3 1 N   A GLN 339 ? ? O A HOH 2104 ? ? 2.11 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 GLU A 22  ? ? -87.94  -112.64 
2   1 PHE A 26  ? ? -43.98  159.31  
3   1 LYS A 27  ? ? 178.27  123.51  
4   1 TYR A 37  ? ? 178.97  173.62  
5   1 ASP A 45  ? ? -49.79  2.86    
6   1 ALA A 47  ? ? -59.79  -0.70   
7   1 LYS A 52  ? ? -62.54  13.46   
8   1 THR A 61  ? ? -97.63  -151.81 
9   1 LYS A 66  ? ? -61.61  -101.78 
10  1 PRO A 115 ? ? -42.96  106.97  
11  1 GLU A 147 ? ? -173.45 112.42  
12  1 GLU A 150 ? ? -19.63  131.69  
13  1 PHE A 152 ? ? 174.60  133.33  
14  1 LYS A 174 ? ? -46.22  160.82  
15  1 VAL A 176 ? ? -146.85 -57.06  
16  1 ASP A 177 ? ? 69.19   72.45   
17  1 SER A 185 ? ? -93.30  -83.33  
18  1 ASP A 202 ? ? 38.50   66.23   
19  1 PHE A 214 ? ? -124.06 -70.17  
20  1 TYR A 218 ? ? -61.26  -70.03  
21  1 ALA A 231 ? ? -91.28  57.50   
22  1 MET A 244 ? ? -154.62 58.24   
23  1 ARG A 247 ? ? -105.09 -161.74 
24  1 VAL A 252 ? ? -152.86 86.35   
25  1 LYS A 253 ? ? -39.87  136.46  
26  1 ARG A 255 ? ? -114.10 -165.00 
27  1 THR A 267 ? ? -94.16  -70.77  
28  1 THR A 297 ? ? -78.02  41.37   
29  1 ALA A 298 ? ? -139.60 -33.89  
30  1 GLU A 300 ? ? -91.27  -61.97  
31  1 ASN A 304 ? ? 164.54  -1.75   
32  1 SER A 334 ? ? -55.07  -78.83  
33  1 ARG A 335 ? ? -35.72  -29.40  
34  1 GLU A 374 ? ? -27.02  -52.50  
35  1 SER A 383 ? ? -43.59  162.54  
36  1 ARG A 394 ? ? -34.27  141.25  
37  1 LEU A 408 ? ? -51.40  -70.35  
38  1 ASN A 417 ? ? 34.12   55.11   
39  1 ALA A 434 ? ? -35.74  134.36  
40  1 GLN A 436 ? ? 55.99   -87.55  
41  1 ASP A 444 ? ? -42.25  -71.44  
42  1 PHE A 448 ? ? -46.60  -75.33  
43  1 ALA A 469 ? ? -163.92 87.71   
44  1 THR A 470 ? ? -159.33 -42.51  
45  1 ILE A 471 ? ? 78.99   -67.23  
46  1 ASP A 472 ? ? -48.85  97.58   
47  1 TYR A 499 ? ? -58.81  109.08  
48  1 ALA A 500 ? ? -49.31  -16.07  
49  1 TRP A 504 ? ? -96.94  47.54   
50  1 CYS A 506 ? ? -160.60 89.64   
51  1 GLU A 529 ? ? -68.93  -74.47  
52  1 TYR A 532 ? ? -140.46 23.94   
53  1 ILE A 537 ? ? -74.06  -86.35  
54  1 THR A 541 ? ? -36.70  147.94  
55  1 ASP A 542 ? ? 93.26   -66.28  
56  1 PRO A 549 ? ? -31.79  123.64  
57  1 ALA A 551 ? ? -170.42 130.45  
58  1 ALA A 553 ? ? -57.01  -5.37   
59  1 ALA A 560 ? ? -65.03  -71.45  
60  1 TYR A 566 ? ? -59.69  -84.43  
61  1 LYS A 570 ? ? -90.95  -69.94  
62  1 PRO A 572 ? ? -44.92  -173.60 
63  1 THR A 590 ? ? 73.43   -167.86 
64  1 LYS A 592 ? ? 20.59   43.14   
65  1 TYR A 594 ? ? -171.42 -163.22 
66  1 LYS A 602 ? ? 54.66   122.24  
67  1 THR A 604 ? ? -73.97  -87.25  
68  1 THR A 605 ? ? 62.86   146.28  
69  1 ARG A 606 ? ? -159.67 -14.85  
70  1 GLU A 609 ? ? -76.77  -93.64  
71  1 VAL A 611 ? ? -61.40  -167.79 
72  1 ARG A 613 ? ? 66.82   -84.53  
73  1 TRP A 615 ? ? -66.62  15.07   
74  1 SER A 616 ? ? 59.01   -54.40  
75  1 GLU A 617 ? ? 151.90  -107.32 
76  1 LEU A 631 ? ? -77.11  -81.02  
77  1 GLU A 637 ? ? -69.11  21.52   
78  1 TYR A 653 ? ? 64.28   68.83   
79  1 GLU A 654 ? ? -130.71 -38.99  
80  1 PRO A 656 ? ? -36.62  163.00  
81  1 VAL A 661 ? ? -64.16  89.44   
82  1 ILE A 662 ? ? -56.06  108.91  
83  1 GLN A 665 ? ? -176.59 -166.26 
84  1 ALA A 681 ? ? -54.31  -75.72  
85  1 ALA A 683 ? ? -49.92  -77.05  
86  1 ARG A 685 ? ? -63.52  30.13   
87  1 LEU A 686 ? ? -143.21 23.47   
88  1 ALA A 687 ? ? -108.29 -154.93 
89  1 VAL A 698 ? ? -172.64 146.00  
90  1 VAL A 703 ? ? -53.38  170.21  
91  1 PHE A 717 ? ? -172.21 -158.61 
92  1 THR A 723 ? ? 57.22   15.11   
93  1 LYS A 724 ? ? -158.96 36.23   
94  1 HIS A 725 ? ? -175.03 -44.72  
95  1 TYR A 727 ? ? -135.51 -159.45 
96  1 ASP A 728 ? ? -101.51 -128.84 
97  1 GLU A 730 ? ? -85.84  31.52   
98  1 TYR A 732 ? ? -59.29  -5.98   
99  1 ASN A 735 ? ? -140.39 26.37   
100 1 GLN A 736 ? ? -162.55 -71.07  
101 1 LEU A 745 ? ? -69.45  90.54   
102 1 ALA A 747 ? ? 173.80  -47.73  
103 1 TYR A 750 ? ? -64.56  5.31    
104 1 LEU A 755 ? ? 64.64   95.77   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LEU 396 ? CG  ? A LEU 396 CG  
2   1 Y 1 A LEU 396 ? CD1 ? A LEU 396 CD1 
3   1 Y 1 A LEU 396 ? CD2 ? A LEU 396 CD2 
4   1 Y 1 A LYS 558 ? CG  ? A LYS 558 CG  
5   1 Y 1 A LYS 558 ? CD  ? A LYS 558 CD  
6   1 Y 1 A LYS 558 ? CE  ? A LYS 558 CE  
7   1 Y 1 A LYS 558 ? NZ  ? A LYS 558 NZ  
8   1 Y 1 A LYS 559 ? CG  ? A LYS 559 CG  
9   1 Y 1 A LYS 559 ? CD  ? A LYS 559 CD  
10  1 Y 1 A LYS 559 ? CE  ? A LYS 559 CE  
11  1 Y 1 A LYS 559 ? NZ  ? A LYS 559 NZ  
12  1 Y 1 A LYS 593 ? CG  ? A LYS 593 CG  
13  1 Y 1 A LYS 593 ? CD  ? A LYS 593 CD  
14  1 Y 1 A LYS 593 ? CE  ? A LYS 593 CE  
15  1 Y 1 A LYS 593 ? NZ  ? A LYS 593 NZ  
16  1 Y 1 A ILE 610 ? CG1 ? A ILE 610 CG1 
17  1 Y 1 A ILE 610 ? CG2 ? A ILE 610 CG2 
18  1 Y 1 A ILE 610 ? CD1 ? A ILE 610 CD1 
19  1 Y 1 A ARG 613 ? CG  ? A ARG 613 CG  
20  1 Y 1 A ARG 613 ? CD  ? A ARG 613 CD  
21  1 Y 1 A ARG 613 ? NE  ? A ARG 613 NE  
22  1 Y 1 A ARG 613 ? CZ  ? A ARG 613 CZ  
23  1 Y 1 A ARG 613 ? NH1 ? A ARG 613 NH1 
24  1 Y 1 A ARG 613 ? NH2 ? A ARG 613 NH2 
25  1 Y 1 A ASP 614 ? CG  ? A ASP 614 CG  
26  1 Y 1 A ASP 614 ? OD1 ? A ASP 614 OD1 
27  1 Y 1 A ASP 614 ? OD2 ? A ASP 614 OD2 
28  1 Y 1 A GLU 617 ? CG  ? A GLU 617 CG  
29  1 Y 1 A GLU 617 ? CD  ? A GLU 617 CD  
30  1 Y 1 A GLU 617 ? OE1 ? A GLU 617 OE1 
31  1 Y 1 A GLU 617 ? OE2 ? A GLU 617 OE2 
32  1 Y 1 A LYS 652 ? CG  ? A LYS 652 CG  
33  1 Y 1 A LYS 652 ? CD  ? A LYS 652 CD  
34  1 Y 1 A LYS 652 ? CE  ? A LYS 652 CE  
35  1 Y 1 A LYS 652 ? NZ  ? A LYS 652 NZ  
36  1 Y 1 A VAL 661 ? CG1 ? A VAL 661 CG1 
37  1 Y 1 A VAL 661 ? CG2 ? A VAL 661 CG2 
38  1 Y 1 A GLU 664 ? CG  ? A GLU 664 CG  
39  1 Y 1 A GLU 664 ? CD  ? A GLU 664 CD  
40  1 Y 1 A GLU 664 ? OE1 ? A GLU 664 OE1 
41  1 Y 1 A GLU 664 ? OE2 ? A GLU 664 OE2 
42  1 Y 1 A GLN 665 ? CG  ? A GLN 665 CG  
43  1 Y 1 A GLN 665 ? CD  ? A GLN 665 CD  
44  1 Y 1 A GLN 665 ? OE1 ? A GLN 665 OE1 
45  1 Y 1 A GLN 665 ? NE2 ? A GLN 665 NE2 
46  1 Y 1 A ILE 666 ? CG1 ? A ILE 666 CG1 
47  1 Y 1 A ILE 666 ? CG2 ? A ILE 666 CG2 
48  1 Y 1 A ILE 666 ? CD1 ? A ILE 666 CD1 
49  1 Y 1 A VAL 680 ? CG1 ? A VAL 680 CG1 
50  1 Y 1 A VAL 680 ? CG2 ? A VAL 680 CG2 
51  1 Y 1 A LYS 684 ? CG  ? A LYS 684 CG  
52  1 Y 1 A LYS 684 ? CD  ? A LYS 684 CD  
53  1 Y 1 A LYS 684 ? CE  ? A LYS 684 CE  
54  1 Y 1 A LYS 684 ? NZ  ? A LYS 684 NZ  
55  1 Y 1 A ARG 685 ? CG  ? A ARG 685 CG  
56  1 Y 1 A ARG 685 ? CD  ? A ARG 685 CD  
57  1 Y 1 A ARG 685 ? NE  ? A ARG 685 NE  
58  1 Y 1 A ARG 685 ? CZ  ? A ARG 685 CZ  
59  1 Y 1 A ARG 685 ? NH1 ? A ARG 685 NH1 
60  1 Y 1 A ARG 685 ? NH2 ? A ARG 685 NH2 
61  1 Y 1 A LEU 686 ? CG  ? A LEU 686 CG  
62  1 Y 1 A LEU 686 ? CD1 ? A LEU 686 CD1 
63  1 Y 1 A LEU 686 ? CD2 ? A LEU 686 CD2 
64  1 Y 1 A VAL 698 ? CG1 ? A VAL 698 CG1 
65  1 Y 1 A VAL 698 ? CG2 ? A VAL 698 CG2 
66  1 Y 1 A ILE 699 ? CG1 ? A ILE 699 CG1 
67  1 Y 1 A ILE 699 ? CG2 ? A ILE 699 CG2 
68  1 Y 1 A ILE 699 ? CD1 ? A ILE 699 CD1 
69  1 Y 1 A ILE 702 ? CG1 ? A ILE 702 CG1 
70  1 Y 1 A ILE 702 ? CG2 ? A ILE 702 CG2 
71  1 Y 1 A ILE 702 ? CD1 ? A ILE 702 CD1 
72  1 Y 1 A VAL 703 ? CG1 ? A VAL 703 CG1 
73  1 Y 1 A VAL 703 ? CG2 ? A VAL 703 CG2 
74  1 Y 1 A LEU 704 ? CG  ? A LEU 704 CG  
75  1 Y 1 A LEU 704 ? CD1 ? A LEU 704 CD1 
76  1 Y 1 A LEU 704 ? CD2 ? A LEU 704 CD2 
77  1 Y 1 A ILE 715 ? CG1 ? A ILE 715 CG1 
78  1 Y 1 A ILE 715 ? CG2 ? A ILE 715 CG2 
79  1 Y 1 A ILE 715 ? CD1 ? A ILE 715 CD1 
80  1 Y 1 A ASP 718 ? CG  ? A ASP 718 CG  
81  1 Y 1 A ASP 718 ? OD1 ? A ASP 718 OD1 
82  1 Y 1 A ASP 718 ? OD2 ? A ASP 718 OD2 
83  1 Y 1 A GLU 719 ? CG  ? A GLU 719 CG  
84  1 Y 1 A GLU 719 ? CD  ? A GLU 719 CD  
85  1 Y 1 A GLU 719 ? OE1 ? A GLU 719 OE1 
86  1 Y 1 A GLU 719 ? OE2 ? A GLU 719 OE2 
87  1 Y 1 A PHE 720 ? CG  ? A PHE 720 CG  
88  1 Y 1 A PHE 720 ? CD1 ? A PHE 720 CD1 
89  1 Y 1 A PHE 720 ? CD2 ? A PHE 720 CD2 
90  1 Y 1 A PHE 720 ? CE1 ? A PHE 720 CE1 
91  1 Y 1 A PHE 720 ? CE2 ? A PHE 720 CE2 
92  1 Y 1 A PHE 720 ? CZ  ? A PHE 720 CZ  
93  1 Y 1 A THR 723 ? OG1 ? A THR 723 OG1 
94  1 Y 1 A THR 723 ? CG2 ? A THR 723 CG2 
95  1 Y 1 A LYS 724 ? CG  ? A LYS 724 CG  
96  1 Y 1 A LYS 724 ? CD  ? A LYS 724 CD  
97  1 Y 1 A LYS 724 ? CE  ? A LYS 724 CE  
98  1 Y 1 A LYS 724 ? NZ  ? A LYS 724 NZ  
99  1 Y 1 A HIS 725 ? CG  ? A HIS 725 CG  
100 1 Y 1 A HIS 725 ? ND1 ? A HIS 725 ND1 
101 1 Y 1 A HIS 725 ? CD2 ? A HIS 725 CD2 
102 1 Y 1 A HIS 725 ? CE1 ? A HIS 725 CE1 
103 1 Y 1 A HIS 725 ? NE2 ? A HIS 725 NE2 
104 1 Y 1 A TYR 727 ? CG  ? A TYR 727 CG  
105 1 Y 1 A TYR 727 ? CD1 ? A TYR 727 CD1 
106 1 Y 1 A TYR 727 ? CD2 ? A TYR 727 CD2 
107 1 Y 1 A TYR 727 ? CE1 ? A TYR 727 CE1 
108 1 Y 1 A TYR 727 ? CE2 ? A TYR 727 CE2 
109 1 Y 1 A TYR 727 ? CZ  ? A TYR 727 CZ  
110 1 Y 1 A TYR 727 ? OH  ? A TYR 727 OH  
111 1 Y 1 A ASP 728 ? CG  ? A ASP 728 CG  
112 1 Y 1 A ASP 728 ? OD1 ? A ASP 728 OD1 
113 1 Y 1 A ASP 728 ? OD2 ? A ASP 728 OD2 
114 1 Y 1 A GLU 730 ? CG  ? A GLU 730 CG  
115 1 Y 1 A GLU 730 ? CD  ? A GLU 730 CD  
116 1 Y 1 A GLU 730 ? OE1 ? A GLU 730 OE1 
117 1 Y 1 A GLU 730 ? OE2 ? A GLU 730 OE2 
118 1 Y 1 A TYR 731 ? CG  ? A TYR 731 CG  
119 1 Y 1 A TYR 731 ? CD1 ? A TYR 731 CD1 
120 1 Y 1 A TYR 731 ? CD2 ? A TYR 731 CD2 
121 1 Y 1 A TYR 731 ? CE1 ? A TYR 731 CE1 
122 1 Y 1 A TYR 731 ? CE2 ? A TYR 731 CE2 
123 1 Y 1 A TYR 731 ? CZ  ? A TYR 731 CZ  
124 1 Y 1 A TYR 731 ? OH  ? A TYR 731 OH  
125 1 Y 1 A ASN 735 ? CG  ? A ASN 735 CG  
126 1 Y 1 A ASN 735 ? OD1 ? A ASN 735 OD1 
127 1 Y 1 A ASN 735 ? ND2 ? A ASN 735 ND2 
128 1 Y 1 A VAL 741 ? CG1 ? A VAL 741 CG1 
129 1 Y 1 A VAL 741 ? CG2 ? A VAL 741 CG2 
130 1 Y 1 A GLU 742 ? CG  ? A GLU 742 CG  
131 1 Y 1 A GLU 742 ? CD  ? A GLU 742 CD  
132 1 Y 1 A GLU 742 ? OE1 ? A GLU 742 OE1 
133 1 Y 1 A GLU 742 ? OE2 ? A GLU 742 OE2 
134 1 Y 1 A ARG 743 ? CG  ? A ARG 743 CG  
135 1 Y 1 A ARG 743 ? CD  ? A ARG 743 CD  
136 1 Y 1 A ARG 743 ? NE  ? A ARG 743 NE  
137 1 Y 1 A ARG 743 ? CZ  ? A ARG 743 CZ  
138 1 Y 1 A ARG 743 ? NH1 ? A ARG 743 NH1 
139 1 Y 1 A ARG 743 ? NH2 ? A ARG 743 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A THR 667 ? A THR 667 
2  1 Y 1 A ARG 668 ? A ARG 668 
3  1 Y 1 A ASP 669 ? A ASP 669 
4  1 Y 1 A LEU 670 ? A LEU 670 
5  1 Y 1 A LYS 671 ? A LYS 671 
6  1 Y 1 A ASP 672 ? A ASP 672 
7  1 Y 1 A TYR 673 ? A TYR 673 
8  1 Y 1 A LYS 674 ? A LYS 674 
9  1 Y 1 A ALA 675 ? A ALA 675 
10 1 Y 1 A THR 676 ? A THR 676 
11 1 Y 1 A GLY 677 ? A GLY 677 
12 1 Y 1 A ARG 689 ? A ARG 689 
13 1 Y 1 A GLY 690 ? A GLY 690 
14 1 Y 1 A VAL 691 ? A VAL 691 
15 1 Y 1 A LYS 692 ? A LYS 692 
16 1 Y 1 A ILE 693 ? A ILE 693 
17 1 Y 1 A ARG 694 ? A ARG 694 
18 1 Y 1 A PRO 695 ? A PRO 695 
19 1 Y 1 A GLY 696 ? A GLY 696 
20 1 Y 1 A LYS 705 ? A LYS 705 
21 1 Y 1 A GLY 706 ? A GLY 706 
22 1 Y 1 A SER 707 ? A SER 707 
23 1 Y 1 A GLY 708 ? A GLY 708 
24 1 Y 1 A ARG 709 ? A ARG 709 
25 1 Y 1 A ILE 710 ? A ILE 710 
26 1 Y 1 A GLY 711 ? A GLY 711 
27 1 Y 1 A ASP 712 ? A ASP 712 
28 1 Y 1 A TYR 757 ? A TYR 757 
29 1 Y 1 A GLN 758 ? A GLN 758 
30 1 Y 1 A LYS 759 ? A LYS 759 
31 1 Y 1 A THR 760 ? A THR 760 
32 1 Y 1 A ARG 761 ? A ARG 761 
33 1 Y 1 A GLN 762 ? A GLN 762 
34 1 Y 1 A VAL 763 ? A VAL 763 
35 1 Y 1 A GLY 764 ? A GLY 764 
36 1 Y 1 A LEU 765 ? A LEU 765 
37 1 Y 1 A SER 766 ? A SER 766 
38 1 Y 1 A ALA 767 ? A ALA 767 
39 1 Y 1 A TRP 768 ? A TRP 768 
40 1 Y 1 A LEU 769 ? A LEU 769 
41 1 Y 1 A LYS 770 ? A LYS 770 
42 1 Y 1 A PRO 771 ? A PRO 771 
43 1 Y 1 A LYS 772 ? A LYS 772 
44 1 Y 1 A GLY 773 ? A GLY 773 
45 1 Y 1 A THR 774 ? A THR 774 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'NICKEL (II) ION' NI  
3 GLYCEROL          GOL 
4 water             HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NI  1   1001 1   NI  NI2 A . 
C 3 GOL 1   2001 1   GOL GLL A . 
D 4 HOH 1   2002 0   HOH WAT A . 
D 4 HOH 2   2003 1   HOH WAT A . 
D 4 HOH 3   2004 2   HOH WAT A . 
D 4 HOH 4   2005 3   HOH WAT A . 
D 4 HOH 5   2006 4   HOH WAT A . 
D 4 HOH 6   2007 5   HOH WAT A . 
D 4 HOH 7   2008 6   HOH WAT A . 
D 4 HOH 8   2009 7   HOH WAT A . 
D 4 HOH 9   2010 8   HOH WAT A . 
D 4 HOH 10  2011 9   HOH WAT A . 
D 4 HOH 11  2012 10  HOH WAT A . 
D 4 HOH 12  2013 11  HOH WAT A . 
D 4 HOH 13  2014 12  HOH WAT A . 
D 4 HOH 14  2015 13  HOH WAT A . 
D 4 HOH 15  2016 14  HOH WAT A . 
D 4 HOH 16  2017 15  HOH WAT A . 
D 4 HOH 17  2018 16  HOH WAT A . 
D 4 HOH 18  2019 17  HOH WAT A . 
D 4 HOH 19  2020 18  HOH WAT A . 
D 4 HOH 20  2021 19  HOH WAT A . 
D 4 HOH 21  2022 20  HOH WAT A . 
D 4 HOH 22  2023 21  HOH WAT A . 
D 4 HOH 23  2024 22  HOH WAT A . 
D 4 HOH 24  2025 23  HOH WAT A . 
D 4 HOH 25  2026 24  HOH WAT A . 
D 4 HOH 26  2027 25  HOH WAT A . 
D 4 HOH 27  2028 26  HOH WAT A . 
D 4 HOH 28  2029 27  HOH WAT A . 
D 4 HOH 29  2030 28  HOH WAT A . 
D 4 HOH 30  2031 29  HOH WAT A . 
D 4 HOH 31  2032 30  HOH WAT A . 
D 4 HOH 32  2033 31  HOH WAT A . 
D 4 HOH 33  2034 32  HOH WAT A . 
D 4 HOH 34  2035 33  HOH WAT A . 
D 4 HOH 35  2036 34  HOH WAT A . 
D 4 HOH 36  2037 35  HOH WAT A . 
D 4 HOH 37  2038 36  HOH WAT A . 
D 4 HOH 38  2039 37  HOH WAT A . 
D 4 HOH 39  2040 38  HOH WAT A . 
D 4 HOH 40  2041 39  HOH WAT A . 
D 4 HOH 41  2042 40  HOH WAT A . 
D 4 HOH 42  2043 41  HOH WAT A . 
D 4 HOH 43  2044 42  HOH WAT A . 
D 4 HOH 44  2045 43  HOH WAT A . 
D 4 HOH 45  2046 44  HOH WAT A . 
D 4 HOH 46  2047 45  HOH WAT A . 
D 4 HOH 47  2048 46  HOH WAT A . 
D 4 HOH 48  2049 47  HOH WAT A . 
D 4 HOH 49  2050 48  HOH WAT A . 
D 4 HOH 50  2051 49  HOH WAT A . 
D 4 HOH 51  2052 50  HOH WAT A . 
D 4 HOH 52  2053 51  HOH WAT A . 
D 4 HOH 53  2054 52  HOH WAT A . 
D 4 HOH 54  2055 53  HOH WAT A . 
D 4 HOH 55  2056 54  HOH WAT A . 
D 4 HOH 56  2057 55  HOH WAT A . 
D 4 HOH 57  2058 56  HOH WAT A . 
D 4 HOH 58  2059 57  HOH WAT A . 
D 4 HOH 59  2060 58  HOH WAT A . 
D 4 HOH 60  2061 59  HOH WAT A . 
D 4 HOH 61  2062 60  HOH WAT A . 
D 4 HOH 62  2063 61  HOH WAT A . 
D 4 HOH 63  2064 62  HOH WAT A . 
D 4 HOH 64  2065 63  HOH WAT A . 
D 4 HOH 65  2066 64  HOH WAT A . 
D 4 HOH 66  2067 65  HOH WAT A . 
D 4 HOH 67  2068 66  HOH WAT A . 
D 4 HOH 68  2069 67  HOH WAT A . 
D 4 HOH 69  2070 68  HOH WAT A . 
D 4 HOH 70  2071 69  HOH WAT A . 
D 4 HOH 71  2072 70  HOH WAT A . 
D 4 HOH 72  2073 71  HOH WAT A . 
D 4 HOH 73  2074 72  HOH WAT A . 
D 4 HOH 74  2075 73  HOH WAT A . 
D 4 HOH 75  2076 74  HOH WAT A . 
D 4 HOH 76  2077 75  HOH WAT A . 
D 4 HOH 77  2078 76  HOH WAT A . 
D 4 HOH 78  2079 77  HOH WAT A . 
D 4 HOH 79  2080 78  HOH WAT A . 
D 4 HOH 80  2081 79  HOH WAT A . 
D 4 HOH 81  2082 80  HOH WAT A . 
D 4 HOH 82  2083 81  HOH WAT A . 
D 4 HOH 83  2084 82  HOH WAT A . 
D 4 HOH 84  2085 83  HOH WAT A . 
D 4 HOH 85  2086 84  HOH WAT A . 
D 4 HOH 86  2087 85  HOH WAT A . 
D 4 HOH 87  2088 86  HOH WAT A . 
D 4 HOH 88  2089 87  HOH WAT A . 
D 4 HOH 89  2090 88  HOH WAT A . 
D 4 HOH 90  2091 89  HOH WAT A . 
D 4 HOH 91  2092 90  HOH WAT A . 
D 4 HOH 92  2093 91  HOH WAT A . 
D 4 HOH 93  2094 92  HOH WAT A . 
D 4 HOH 94  2095 93  HOH WAT A . 
D 4 HOH 95  2096 94  HOH WAT A . 
D 4 HOH 96  2097 95  HOH WAT A . 
D 4 HOH 97  2098 96  HOH WAT A . 
D 4 HOH 98  2099 97  HOH WAT A . 
D 4 HOH 99  2100 98  HOH WAT A . 
D 4 HOH 100 2101 99  HOH WAT A . 
D 4 HOH 101 2102 100 HOH WAT A . 
D 4 HOH 102 2103 101 HOH WAT A . 
D 4 HOH 103 2104 102 HOH WAT A . 
D 4 HOH 104 2105 103 HOH WAT A . 
D 4 HOH 105 2106 104 HOH WAT A . 
D 4 HOH 106 2107 105 HOH WAT A . 
D 4 HOH 107 2108 106 HOH WAT A . 
D 4 HOH 108 2109 107 HOH WAT A . 
D 4 HOH 109 2110 108 HOH WAT A . 
D 4 HOH 110 2111 109 HOH WAT A . 
D 4 HOH 111 2112 110 HOH WAT A . 
D 4 HOH 112 2113 111 HOH WAT A . 
D 4 HOH 113 2114 112 HOH WAT A . 
D 4 HOH 114 2115 113 HOH WAT A . 
D 4 HOH 115 2116 114 HOH WAT A . 
D 4 HOH 116 2117 115 HOH WAT A . 
D 4 HOH 117 2118 116 HOH WAT A . 
D 4 HOH 118 2119 117 HOH WAT A . 
D 4 HOH 119 2120 118 HOH WAT A . 
D 4 HOH 120 2121 119 HOH WAT A . 
D 4 HOH 121 2122 120 HOH WAT A . 
D 4 HOH 122 2123 121 HOH WAT A . 
D 4 HOH 123 2124 122 HOH WAT A . 
D 4 HOH 124 2125 123 HOH WAT A . 
D 4 HOH 125 2126 124 HOH WAT A . 
D 4 HOH 126 2127 125 HOH WAT A . 
D 4 HOH 127 2128 126 HOH WAT A . 
D 4 HOH 128 2129 127 HOH WAT A . 
D 4 HOH 129 2130 128 HOH WAT A . 
D 4 HOH 130 2131 129 HOH WAT A . 
D 4 HOH 131 2132 130 HOH WAT A . 
D 4 HOH 132 2133 131 HOH WAT A . 
D 4 HOH 133 2134 132 HOH WAT A . 
D 4 HOH 134 2135 133 HOH WAT A . 
D 4 HOH 135 2136 134 HOH WAT A . 
D 4 HOH 136 2137 135 HOH WAT A . 
D 4 HOH 137 2138 136 HOH WAT A . 
D 4 HOH 138 2139 137 HOH WAT A . 
D 4 HOH 139 2140 138 HOH WAT A . 
D 4 HOH 140 2141 139 HOH WAT A . 
D 4 HOH 141 2142 140 HOH WAT A . 
D 4 HOH 142 2143 141 HOH WAT A . 
D 4 HOH 143 2144 142 HOH WAT A . 
D 4 HOH 144 2145 143 HOH WAT A . 
D 4 HOH 145 2146 144 HOH WAT A . 
D 4 HOH 146 2147 145 HOH WAT A . 
D 4 HOH 147 2148 146 HOH WAT A . 
D 4 HOH 148 2149 147 HOH WAT A . 
D 4 HOH 149 2150 148 HOH WAT A . 
D 4 HOH 150 2151 149 HOH WAT A . 
D 4 HOH 151 2152 150 HOH WAT A . 
D 4 HOH 152 2153 151 HOH WAT A . 
D 4 HOH 153 2154 152 HOH WAT A . 
D 4 HOH 154 2155 153 HOH WAT A . 
D 4 HOH 155 2156 154 HOH WAT A . 
D 4 HOH 156 2157 155 HOH WAT A . 
D 4 HOH 157 2158 156 HOH WAT A . 
D 4 HOH 158 2159 157 HOH WAT A . 
D 4 HOH 159 2160 158 HOH WAT A . 
D 4 HOH 160 2161 159 HOH WAT A . 
D 4 HOH 161 2162 160 HOH WAT A . 
D 4 HOH 162 2163 161 HOH WAT A . 
D 4 HOH 163 2164 162 HOH WAT A . 
D 4 HOH 164 2165 163 HOH WAT A . 
D 4 HOH 165 2166 164 HOH WAT A . 
D 4 HOH 166 2167 165 HOH WAT A . 
D 4 HOH 167 2168 166 HOH WAT A . 
D 4 HOH 168 2169 167 HOH WAT A . 
D 4 HOH 169 2170 168 HOH WAT A . 
D 4 HOH 170 2171 169 HOH WAT A . 
D 4 HOH 171 2172 170 HOH WAT A . 
D 4 HOH 172 2173 171 HOH WAT A . 
D 4 HOH 173 2174 172 HOH WAT A . 
D 4 HOH 174 2175 173 HOH WAT A . 
D 4 HOH 175 2176 174 HOH WAT A . 
D 4 HOH 176 2177 175 HOH WAT A . 
D 4 HOH 177 2178 176 HOH WAT A . 
D 4 HOH 178 2179 177 HOH WAT A . 
D 4 HOH 179 2180 178 HOH WAT A . 
D 4 HOH 180 2181 179 HOH WAT A . 
D 4 HOH 181 2182 180 HOH WAT A . 
D 4 HOH 182 2183 181 HOH WAT A . 
D 4 HOH 183 2184 182 HOH WAT A . 
D 4 HOH 184 2185 183 HOH WAT A . 
D 4 HOH 185 2186 184 HOH WAT A . 
D 4 HOH 186 2187 185 HOH WAT A . 
D 4 HOH 187 2188 186 HOH WAT A . 
D 4 HOH 188 2189 187 HOH WAT A . 
D 4 HOH 189 2190 188 HOH WAT A . 
D 4 HOH 190 2191 189 HOH WAT A . 
D 4 HOH 191 2192 190 HOH WAT A . 
D 4 HOH 192 2193 191 HOH WAT A . 
D 4 HOH 193 2194 192 HOH WAT A . 
D 4 HOH 194 2195 193 HOH WAT A . 
D 4 HOH 195 2196 194 HOH WAT A . 
D 4 HOH 196 2197 195 HOH WAT A . 
D 4 HOH 197 2198 196 HOH WAT A . 
D 4 HOH 198 2199 197 HOH WAT A . 
D 4 HOH 199 2200 198 HOH WAT A . 
D 4 HOH 200 2201 199 HOH WAT A . 
D 4 HOH 201 2202 200 HOH WAT A . 
D 4 HOH 202 2203 201 HOH WAT A . 
D 4 HOH 203 2204 202 HOH WAT A . 
D 4 HOH 204 2205 203 HOH WAT A . 
D 4 HOH 205 2206 204 HOH WAT A . 
D 4 HOH 206 2207 205 HOH WAT A . 
D 4 HOH 207 2208 206 HOH WAT A . 
D 4 HOH 208 2209 207 HOH WAT A . 
D 4 HOH 209 2210 208 HOH WAT A . 
D 4 HOH 210 2211 209 HOH WAT A . 
D 4 HOH 211 2212 210 HOH WAT A . 
D 4 HOH 212 2213 211 HOH WAT A . 
D 4 HOH 213 2214 212 HOH WAT A . 
D 4 HOH 214 2215 213 HOH WAT A . 
D 4 HOH 215 2216 214 HOH WAT A . 
D 4 HOH 216 2217 215 HOH WAT A . 
D 4 HOH 217 2218 216 HOH WAT A . 
D 4 HOH 218 2219 217 HOH WAT A . 
D 4 HOH 219 2220 218 HOH WAT A . 
D 4 HOH 220 2221 219 HOH WAT A . 
D 4 HOH 221 2222 220 HOH WAT A . 
D 4 HOH 222 2223 221 HOH WAT A . 
D 4 HOH 223 2224 222 HOH WAT A . 
D 4 HOH 224 2225 223 HOH WAT A . 
D 4 HOH 225 2226 224 HOH WAT A . 
D 4 HOH 226 2227 225 HOH WAT A . 
D 4 HOH 227 2228 226 HOH WAT A . 
D 4 HOH 228 2229 227 HOH WAT A . 
D 4 HOH 229 2230 228 HOH WAT A . 
D 4 HOH 230 2231 229 HOH WAT A . 
D 4 HOH 231 2232 230 HOH WAT A . 
D 4 HOH 232 2233 231 HOH WAT A . 
D 4 HOH 233 2234 232 HOH WAT A . 
D 4 HOH 234 2235 233 HOH WAT A . 
D 4 HOH 235 2236 234 HOH WAT A . 
D 4 HOH 236 2237 235 HOH WAT A . 
D 4 HOH 237 2238 236 HOH WAT A . 
D 4 HOH 238 2239 237 HOH WAT A . 
D 4 HOH 239 2240 238 HOH WAT A . 
D 4 HOH 240 2241 239 HOH WAT A . 
D 4 HOH 241 2242 240 HOH WAT A . 
D 4 HOH 242 2243 241 HOH WAT A . 
D 4 HOH 243 2244 242 HOH WAT A . 
D 4 HOH 244 2245 243 HOH WAT A . 
D 4 HOH 245 2246 244 HOH WAT A . 
D 4 HOH 246 2247 245 HOH WAT A . 
D 4 HOH 247 2248 246 HOH WAT A . 
D 4 HOH 248 2249 247 HOH WAT A . 
D 4 HOH 249 2250 248 HOH WAT A . 
D 4 HOH 250 2251 249 HOH WAT A . 
D 4 HOH 251 2252 250 HOH WAT A . 
D 4 HOH 252 2253 251 HOH WAT A . 
D 4 HOH 253 2254 252 HOH WAT A . 
D 4 HOH 254 2255 253 HOH WAT A . 
D 4 HOH 255 2256 254 HOH WAT A . 
D 4 HOH 256 2257 255 HOH WAT A . 
D 4 HOH 257 2258 256 HOH WAT A . 
D 4 HOH 258 2259 257 HOH WAT A . 
D 4 HOH 259 2260 258 HOH WAT A . 
D 4 HOH 260 2261 259 HOH WAT A . 
D 4 HOH 261 2262 260 HOH WAT A . 
D 4 HOH 262 2263 261 HOH WAT A . 
D 4 HOH 263 2264 262 HOH WAT A . 
D 4 HOH 264 2265 263 HOH WAT A . 
D 4 HOH 265 2266 264 HOH WAT A . 
D 4 HOH 266 2267 265 HOH WAT A . 
D 4 HOH 267 2268 266 HOH WAT A . 
D 4 HOH 268 2269 267 HOH WAT A . 
D 4 HOH 269 2270 268 HOH WAT A . 
D 4 HOH 270 2271 269 HOH WAT A . 
D 4 HOH 271 2272 270 HOH WAT A . 
D 4 HOH 272 2273 271 HOH WAT A . 
D 4 HOH 273 2274 272 HOH WAT A . 
D 4 HOH 274 2275 273 HOH WAT A . 
D 4 HOH 275 2276 274 HOH WAT A . 
D 4 HOH 276 2277 275 HOH WAT A . 
D 4 HOH 277 2278 276 HOH WAT A . 
#