data_1WUG
# 
_entry.id   1WUG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1WUG         
RCSB  RCSB024012   
WWPDB D_1000024012 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1B91 'STRUCTURE AND LIGAND OF A HISTONE ACETYLTRANSFERASE BROMODOMAIN' unspecified 
PDB 1JM4 'RECOGNITION OF HIV-1 TAT BY PCAF BROMODOMAIN'                    unspecified 
PDB 1WUM 'the same protein with small chemical ligand NP2'                 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WUG 
_pdbx_database_status.recvd_initial_deposition_date   2004-12-07 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zeng, L.'    1 
'Li, J.'      2 
'Muller, M.'  3 
'Yan, S.'     4 
'Mujtaba, S.' 5 
'Pan, C.'     6 
'Wang, Z.'    7 
'Zhou, M.M.'  8 
# 
_citation.id                        primary 
_citation.title                     'Selective small molecules blocking HIV-1 Tat and coactivator PCAF association' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            127 
_citation.page_first                2376 
_citation.page_last                 2377 
_citation.year                      2005 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15724976 
_citation.pdbx_database_id_DOI      10.1021/ja044885g 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zeng, L.'    1 
primary 'Li, J.'      2 
primary 'Muller, M.'  3 
primary 'Yan, S.'     4 
primary 'Mujtaba, S.' 5 
primary 'Pan, C.'     6 
primary 'Wang, Z.'    7 
primary 'Zhou, M.M.'  8 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone acetyltransferase PCAF'                14052.226 1 2.3.1.48 ? BROMODOMAIN ? 
2 non-polymer syn 'N-(3-AMINOPROPYL)-4-METHYL-2-NITROBENZENAMINE' 209.245   1 ?        ? ?           ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'P300/CBP-associated factor, P/CAF, Histone acetylase PCAF' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQR
VFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQR
VFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   SER n 
1 6   LYS n 
1 7   GLU n 
1 8   PRO n 
1 9   ARG n 
1 10  ASP n 
1 11  PRO n 
1 12  ASP n 
1 13  GLN n 
1 14  LEU n 
1 15  TYR n 
1 16  SER n 
1 17  THR n 
1 18  LEU n 
1 19  LYS n 
1 20  SER n 
1 21  ILE n 
1 22  LEU n 
1 23  GLN n 
1 24  GLN n 
1 25  VAL n 
1 26  LYS n 
1 27  SER n 
1 28  HIS n 
1 29  GLN n 
1 30  SER n 
1 31  ALA n 
1 32  TRP n 
1 33  PRO n 
1 34  PHE n 
1 35  MET n 
1 36  GLU n 
1 37  PRO n 
1 38  VAL n 
1 39  LYS n 
1 40  ARG n 
1 41  THR n 
1 42  GLU n 
1 43  ALA n 
1 44  PRO n 
1 45  GLY n 
1 46  TYR n 
1 47  TYR n 
1 48  GLU n 
1 49  VAL n 
1 50  ILE n 
1 51  ARG n 
1 52  PHE n 
1 53  PRO n 
1 54  MET n 
1 55  ASP n 
1 56  LEU n 
1 57  LYS n 
1 58  THR n 
1 59  MET n 
1 60  SER n 
1 61  GLU n 
1 62  ARG n 
1 63  LEU n 
1 64  LYS n 
1 65  ASN n 
1 66  ARG n 
1 67  TYR n 
1 68  TYR n 
1 69  VAL n 
1 70  SER n 
1 71  LYS n 
1 72  LYS n 
1 73  LEU n 
1 74  PHE n 
1 75  MET n 
1 76  ALA n 
1 77  ASP n 
1 78  LEU n 
1 79  GLN n 
1 80  ARG n 
1 81  VAL n 
1 82  PHE n 
1 83  THR n 
1 84  ASN n 
1 85  CYS n 
1 86  LYS n 
1 87  GLU n 
1 88  TYR n 
1 89  ASN n 
1 90  PRO n 
1 91  PRO n 
1 92  GLU n 
1 93  SER n 
1 94  GLU n 
1 95  TYR n 
1 96  TYR n 
1 97  LYS n 
1 98  CYS n 
1 99  ALA n 
1 100 ASN n 
1 101 ILE n 
1 102 LEU n 
1 103 GLU n 
1 104 LYS n 
1 105 PHE n 
1 106 PHE n 
1 107 PHE n 
1 108 SER n 
1 109 LYS n 
1 110 ILE n 
1 111 LYS n 
1 112 GLU n 
1 113 ALA n 
1 114 GLY n 
1 115 LEU n 
1 116 ILE n 
1 117 ASP n 
1 118 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PCAF 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET14B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PCAF_HUMAN 
_struct_ref.pdbx_db_accession          Q92831 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTN
CKEYNAAESEYYKCANILEKFFFSKIKEAGLIDK
;
_struct_ref.pdbx_align_begin           719 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WUG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 118 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q92831 
_struct_ref_seq.db_align_beg                  719 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  832 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       719 
_struct_ref_seq.pdbx_auth_seq_align_end       832 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WUG GLY A 1  ? UNP Q92831 ?   ?   'EXPRESSION TAG' 715 1 
1 1WUG SER A 2  ? UNP Q92831 ?   ?   'EXPRESSION TAG' 716 2 
1 1WUG HIS A 3  ? UNP Q92831 ?   ?   'EXPRESSION TAG' 717 3 
1 1WUG MET A 4  ? UNP Q92831 ?   ?   'EXPRESSION TAG' 718 4 
1 1WUG PRO A 90 ? UNP Q92831 ALA 804 CONFLICT         804 5 
1 1WUG PRO A 91 ? UNP Q92831 ALA 805 CONFLICT         805 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                      ? 'C5 H11 N O2 S'  149.211 
NP1 non-polymer         . 'N-(3-AMINOPROPYL)-4-METHYL-2-NITROBENZENAMINE' ? 'C10 H15 N3 O2'  209.245 
PHE 'L-peptide linking' y PHENYLALANINE                                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY          
2 1 1 3D_15N-separated_NOESY          
3 1 1 3D_13C_SEPARATED_FILTERED_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '0.5mM sample in 100mM phosphate buffer containing 5mM perdeuterated DTT' 
_pdbx_nmr_sample_details.solvent_system   '10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX500 500 
2 ? Bruker DRX600 600 
# 
_pdbx_nmr_refine.entry_id           1WUG 
_pdbx_nmr_refine.method             'DISTANCE GEOMETRY, SIMULATED ANNEALING' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1WUG 
_pdbx_nmr_details.text       'HNCACB, HN(CO)CACB, HCCH_TOCSY, (H)C(CO)NH_TOCSY, HNHA, 2D_1H_ROESY, 2D_1H_TOCSY' 
# 
_pdbx_nmr_ensemble.entry_id                                      1WUG 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          3.851 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.authors          ? 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1WUG 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1WUG 
_struct.title                     'complex structure of PCAF bromodomain with small chemical ligand NP1' 
_struct.pdbx_descriptor           'Histone acetyltransferase PCAF (E.C.2.3.1.48)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WUG 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'BROMODOMAIN, HISTONE-ACETYLTRANSFERASE, NMR-STRUCTURE, CHEMICAL LIGAND, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 10 ? HIS A 28  ? ASP A 724 HIS A 742 1 ? 19 
HELX_P HELX_P2 2 ALA A 31 ? GLU A 36  ? ALA A 745 GLU A 750 1 ? 6  
HELX_P HELX_P3 3 ASP A 55 ? ASN A 65  ? ASP A 769 ASN A 779 1 ? 11 
HELX_P HELX_P4 4 SER A 70 ? ASN A 89  ? SER A 784 ASN A 803 1 ? 20 
HELX_P HELX_P5 5 SER A 93 ? GLY A 114 ? SER A 807 GLY A 828 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE NP1 A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 GLU A 36 ? GLU A 750 . ? 1_555 ? 
2 AC1 7 VAL A 38 ? VAL A 752 . ? 1_555 ? 
3 AC1 7 GLU A 42 ? GLU A 756 . ? 1_555 ? 
4 AC1 7 ALA A 43 ? ALA A 757 . ? 1_555 ? 
5 AC1 7 PRO A 44 ? PRO A 758 . ? 1_555 ? 
6 AC1 7 TYR A 88 ? TYR A 802 . ? 1_555 ? 
7 AC1 7 TYR A 95 ? TYR A 809 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1WUG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WUG 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . GLY A 1 1   ? 10.899  -23.896 8.326   1.00 0.00 ? 715 GLY A N    1 
ATOM   2    C CA   . GLY A 1 1   ? 11.126  -23.570 9.762   1.00 0.00 ? 715 GLY A CA   1 
ATOM   3    C C    . GLY A 1 1   ? 10.116  -24.331 10.624  1.00 0.00 ? 715 GLY A C    1 
ATOM   4    O O    . GLY A 1 1   ? 9.396   -25.185 10.146  1.00 0.00 ? 715 GLY A O    1 
ATOM   5    H H1   . GLY A 1 1   ? 10.895  -24.928 8.201   1.00 0.00 ? 715 GLY A H1   1 
ATOM   6    H H2   . GLY A 1 1   ? 11.659  -23.479 7.752   1.00 0.00 ? 715 GLY A H2   1 
ATOM   7    H H3   . GLY A 1 1   ? 9.983   -23.506 8.023   1.00 0.00 ? 715 GLY A H3   1 
ATOM   8    H HA2  . GLY A 1 1   ? 12.128  -23.859 10.043  1.00 0.00 ? 715 GLY A HA2  1 
ATOM   9    H HA3  . GLY A 1 1   ? 11.001  -22.508 9.915   1.00 0.00 ? 715 GLY A HA3  1 
ATOM   10   N N    . SER A 1 2   ? 10.058  -24.028 11.892  1.00 0.00 ? 716 SER A N    1 
ATOM   11   C CA   . SER A 1 2   ? 9.094   -24.733 12.783  1.00 0.00 ? 716 SER A CA   1 
ATOM   12   C C    . SER A 1 2   ? 8.241   -23.720 13.549  1.00 0.00 ? 716 SER A C    1 
ATOM   13   O O    . SER A 1 2   ? 8.721   -23.027 14.425  1.00 0.00 ? 716 SER A O    1 
ATOM   14   C CB   . SER A 1 2   ? 9.968   -25.534 13.751  1.00 0.00 ? 716 SER A CB   1 
ATOM   15   O OG   . SER A 1 2   ? 10.117  -26.860 13.266  1.00 0.00 ? 716 SER A OG   1 
ATOM   16   H H    . SER A 1 2   ? 10.647  -23.336 12.258  1.00 0.00 ? 716 SER A H    1 
ATOM   17   H HA   . SER A 1 2   ? 8.465   -25.396 12.207  1.00 0.00 ? 716 SER A HA   1 
ATOM   18   H HB2  . SER A 1 2   ? 10.939  -25.067 13.829  1.00 0.00 ? 716 SER A HB2  1 
ATOM   19   H HB3  . SER A 1 2   ? 9.500   -25.556 14.724  1.00 0.00 ? 716 SER A HB3  1 
ATOM   20   H HG   . SER A 1 2   ? 10.883  -26.880 12.688  1.00 0.00 ? 716 SER A HG   1 
ATOM   21   N N    . HIS A 1 3   ? 6.973   -23.640 13.237  1.00 0.00 ? 717 HIS A N    1 
ATOM   22   C CA   . HIS A 1 3   ? 6.080   -22.670 13.942  1.00 0.00 ? 717 HIS A CA   1 
ATOM   23   C C    . HIS A 1 3   ? 6.604   -21.242 13.777  1.00 0.00 ? 717 HIS A C    1 
ATOM   24   O O    . HIS A 1 3   ? 7.759   -21.025 13.466  1.00 0.00 ? 717 HIS A O    1 
ATOM   25   C CB   . HIS A 1 3   ? 6.116   -23.085 15.417  1.00 0.00 ? 717 HIS A CB   1 
ATOM   26   C CG   . HIS A 1 3   ? 4.804   -22.743 16.069  1.00 0.00 ? 717 HIS A CG   1 
ATOM   27   N ND1  . HIS A 1 3   ? 4.594   -22.896 17.430  1.00 0.00 ? 717 HIS A ND1  1 
ATOM   28   C CD2  . HIS A 1 3   ? 3.626   -22.256 15.560  1.00 0.00 ? 717 HIS A CD2  1 
ATOM   29   C CE1  . HIS A 1 3   ? 3.333   -22.507 17.692  1.00 0.00 ? 717 HIS A CE1  1 
ATOM   30   N NE2  . HIS A 1 3   ? 2.698   -22.108 16.587  1.00 0.00 ? 717 HIS A NE2  1 
ATOM   31   H H    . HIS A 1 3   ? 6.609   -24.210 12.528  1.00 0.00 ? 717 HIS A H    1 
ATOM   32   H HA   . HIS A 1 3   ? 5.073   -22.745 13.559  1.00 0.00 ? 717 HIS A HA   1 
ATOM   33   H HB2  . HIS A 1 3   ? 6.285   -24.150 15.487  1.00 0.00 ? 717 HIS A HB2  1 
ATOM   34   H HB3  . HIS A 1 3   ? 6.915   -22.560 15.919  1.00 0.00 ? 717 HIS A HB3  1 
ATOM   35   H HD1  . HIS A 1 3   ? 5.245   -23.226 18.083  1.00 0.00 ? 717 HIS A HD1  1 
ATOM   36   H HD2  . HIS A 1 3   ? 3.446   -22.023 14.521  1.00 0.00 ? 717 HIS A HD2  1 
ATOM   37   H HE1  . HIS A 1 3   ? 2.888   -22.516 18.676  1.00 0.00 ? 717 HIS A HE1  1 
ATOM   38   N N    . MET A 1 4   ? 5.761   -20.265 13.971  1.00 0.00 ? 718 MET A N    1 
ATOM   39   C CA   . MET A 1 4   ? 6.208   -18.849 13.828  1.00 0.00 ? 718 MET A CA   1 
ATOM   40   C C    . MET A 1 4   ? 6.930   -18.644 12.493  1.00 0.00 ? 718 MET A C    1 
ATOM   41   O O    . MET A 1 4   ? 7.891   -17.906 12.404  1.00 0.00 ? 718 MET A O    1 
ATOM   42   C CB   . MET A 1 4   ? 7.173   -18.625 14.995  1.00 0.00 ? 718 MET A CB   1 
ATOM   43   C CG   . MET A 1 4   ? 6.376   -18.373 16.276  1.00 0.00 ? 718 MET A CG   1 
ATOM   44   S SD   . MET A 1 4   ? 6.014   -16.606 16.425  1.00 0.00 ? 718 MET A SD   1 
ATOM   45   C CE   . MET A 1 4   ? 5.823   -16.565 18.225  1.00 0.00 ? 718 MET A CE   1 
ATOM   46   H H    . MET A 1 4   ? 4.834   -20.462 14.221  1.00 0.00 ? 718 MET A H    1 
ATOM   47   H HA   . MET A 1 4   ? 5.364   -18.180 13.906  1.00 0.00 ? 718 MET A HA   1 
ATOM   48   H HB2  . MET A 1 4   ? 7.792   -19.501 15.122  1.00 0.00 ? 718 MET A HB2  1 
ATOM   49   H HB3  . MET A 1 4   ? 7.798   -17.770 14.785  1.00 0.00 ? 718 MET A HB3  1 
ATOM   50   H HG2  . MET A 1 4   ? 5.450   -18.929 16.240  1.00 0.00 ? 718 MET A HG2  1 
ATOM   51   H HG3  . MET A 1 4   ? 6.954   -18.695 17.130  1.00 0.00 ? 718 MET A HG3  1 
ATOM   52   H HE1  . MET A 1 4   ? 5.311   -17.457 18.554  1.00 0.00 ? 718 MET A HE1  1 
ATOM   53   H HE2  . MET A 1 4   ? 5.248   -15.695 18.506  1.00 0.00 ? 718 MET A HE2  1 
ATOM   54   H HE3  . MET A 1 4   ? 6.797   -16.517 18.689  1.00 0.00 ? 718 MET A HE3  1 
ATOM   55   N N    . SER A 1 5   ? 6.474   -19.289 11.454  1.00 0.00 ? 719 SER A N    1 
ATOM   56   C CA   . SER A 1 5   ? 7.136   -19.130 10.128  1.00 0.00 ? 719 SER A CA   1 
ATOM   57   C C    . SER A 1 5   ? 6.723   -17.807 9.480   1.00 0.00 ? 719 SER A C    1 
ATOM   58   O O    . SER A 1 5   ? 7.539   -17.089 8.938   1.00 0.00 ? 719 SER A O    1 
ATOM   59   C CB   . SER A 1 5   ? 6.634   -20.311 9.295   1.00 0.00 ? 719 SER A CB   1 
ATOM   60   O OG   . SER A 1 5   ? 6.681   -21.496 10.075  1.00 0.00 ? 719 SER A OG   1 
ATOM   61   H H    . SER A 1 5   ? 5.698   -19.881 11.546  1.00 0.00 ? 719 SER A H    1 
ATOM   62   H HA   . SER A 1 5   ? 8.210   -19.177 10.236  1.00 0.00 ? 719 SER A HA   1 
ATOM   63   H HB2  . SER A 1 5   ? 5.616   -20.124 8.984   1.00 0.00 ? 719 SER A HB2  1 
ATOM   64   H HB3  . SER A 1 5   ? 7.260   -20.428 8.423   1.00 0.00 ? 719 SER A HB3  1 
ATOM   65   H HG   . SER A 1 5   ? 5.866   -21.981 9.927   1.00 0.00 ? 719 SER A HG   1 
ATOM   66   N N    . LYS A 1 6   ? 5.460   -17.481 9.530   1.00 0.00 ? 720 LYS A N    1 
ATOM   67   C CA   . LYS A 1 6   ? 4.992   -16.205 8.918   1.00 0.00 ? 720 LYS A CA   1 
ATOM   68   C C    . LYS A 1 6   ? 5.726   -15.013 9.539   1.00 0.00 ? 720 LYS A C    1 
ATOM   69   O O    . LYS A 1 6   ? 5.266   -14.419 10.494  1.00 0.00 ? 720 LYS A O    1 
ATOM   70   C CB   . LYS A 1 6   ? 3.498   -16.144 9.247   1.00 0.00 ? 720 LYS A CB   1 
ATOM   71   C CG   . LYS A 1 6   ? 2.920   -14.803 8.788   1.00 0.00 ? 720 LYS A CG   1 
ATOM   72   C CD   . LYS A 1 6   ? 1.858   -15.048 7.715   1.00 0.00 ? 720 LYS A CD   1 
ATOM   73   C CE   . LYS A 1 6   ? 0.650   -15.745 8.345   1.00 0.00 ? 720 LYS A CE   1 
ATOM   74   N NZ   . LYS A 1 6   ? -0.123  -14.651 8.996   1.00 0.00 ? 720 LYS A NZ   1 
ATOM   75   H H    . LYS A 1 6   ? 4.819   -18.076 9.972   1.00 0.00 ? 720 LYS A H    1 
ATOM   76   H HA   . LYS A 1 6   ? 5.139   -16.224 7.850   1.00 0.00 ? 720 LYS A HA   1 
ATOM   77   H HB2  . LYS A 1 6   ? 2.986   -16.949 8.741   1.00 0.00 ? 720 LYS A HB2  1 
ATOM   78   H HB3  . LYS A 1 6   ? 3.363   -16.247 10.312  1.00 0.00 ? 720 LYS A HB3  1 
ATOM   79   H HG2  . LYS A 1 6   ? 2.472   -14.297 9.630   1.00 0.00 ? 720 LYS A HG2  1 
ATOM   80   H HG3  . LYS A 1 6   ? 3.711   -14.191 8.379   1.00 0.00 ? 720 LYS A HG3  1 
ATOM   81   H HD2  . LYS A 1 6   ? 1.549   -14.104 7.291   1.00 0.00 ? 720 LYS A HD2  1 
ATOM   82   H HD3  . LYS A 1 6   ? 2.270   -15.674 6.937   1.00 0.00 ? 720 LYS A HD3  1 
ATOM   83   H HE2  . LYS A 1 6   ? 0.054   -16.225 7.583   1.00 0.00 ? 720 LYS A HE2  1 
ATOM   84   H HE3  . LYS A 1 6   ? 0.975   -16.466 9.081   1.00 0.00 ? 720 LYS A HE3  1 
ATOM   85   H HZ1  . LYS A 1 6   ? -1.026  -15.028 9.349   1.00 0.00 ? 720 LYS A HZ1  1 
ATOM   86   H HZ2  . LYS A 1 6   ? -0.309  -13.898 8.304   1.00 0.00 ? 720 LYS A HZ2  1 
ATOM   87   H HZ3  . LYS A 1 6   ? 0.425   -14.265 9.791   1.00 0.00 ? 720 LYS A HZ3  1 
ATOM   88   N N    . GLU A 1 7   ? 6.862   -14.656 9.003   1.00 0.00 ? 721 GLU A N    1 
ATOM   89   C CA   . GLU A 1 7   ? 7.620   -13.502 9.566   1.00 0.00 ? 721 GLU A CA   1 
ATOM   90   C C    . GLU A 1 7   ? 8.863   -13.206 8.711   1.00 0.00 ? 721 GLU A C    1 
ATOM   91   O O    . GLU A 1 7   ? 9.647   -14.095 8.444   1.00 0.00 ? 721 GLU A O    1 
ATOM   92   C CB   . GLU A 1 7   ? 8.041   -13.957 10.965  1.00 0.00 ? 721 GLU A CB   1 
ATOM   93   C CG   . GLU A 1 7   ? 7.950   -12.776 11.934  1.00 0.00 ? 721 GLU A CG   1 
ATOM   94   C CD   . GLU A 1 7   ? 7.965   -13.296 13.373  1.00 0.00 ? 721 GLU A CD   1 
ATOM   95   O OE1  . GLU A 1 7   ? 8.988   -13.818 13.784  1.00 0.00 ? 721 GLU A OE1  1 
ATOM   96   O OE2  . GLU A 1 7   ? 6.952   -13.164 14.040  1.00 0.00 ? 721 GLU A OE2  1 
ATOM   97   H H    . GLU A 1 7   ? 7.217   -15.147 8.233   1.00 0.00 ? 721 GLU A H    1 
ATOM   98   H HA   . GLU A 1 7   ? 6.983   -12.634 9.631   1.00 0.00 ? 721 GLU A HA   1 
ATOM   99   H HB2  . GLU A 1 7   ? 7.386   -14.748 11.299  1.00 0.00 ? 721 GLU A HB2  1 
ATOM   100  H HB3  . GLU A 1 7   ? 9.058   -14.320 10.935  1.00 0.00 ? 721 GLU A HB3  1 
ATOM   101  H HG2  . GLU A 1 7   ? 8.793   -12.118 11.781  1.00 0.00 ? 721 GLU A HG2  1 
ATOM   102  H HG3  . GLU A 1 7   ? 7.033   -12.234 11.757  1.00 0.00 ? 721 GLU A HG3  1 
ATOM   103  N N    . PRO A 1 8   ? 9.015   -11.962 8.313   1.00 0.00 ? 722 PRO A N    1 
ATOM   104  C CA   . PRO A 1 8   ? 10.194  -11.573 7.499   1.00 0.00 ? 722 PRO A CA   1 
ATOM   105  C C    . PRO A 1 8   ? 11.454  -11.572 8.368   1.00 0.00 ? 722 PRO A C    1 
ATOM   106  O O    . PRO A 1 8   ? 12.498  -12.044 7.965   1.00 0.00 ? 722 PRO A O    1 
ATOM   107  C CB   . PRO A 1 8   ? 9.855   -10.157 7.034   1.00 0.00 ? 722 PRO A CB   1 
ATOM   108  C CG   . PRO A 1 8   ? 8.896   -9.633  8.055   1.00 0.00 ? 722 PRO A CG   1 
ATOM   109  C CD   . PRO A 1 8   ? 8.134   -10.817 8.590   1.00 0.00 ? 722 PRO A CD   1 
ATOM   110  H HA   . PRO A 1 8   ? 10.312  -12.235 6.654   1.00 0.00 ? 722 PRO A HA   1 
ATOM   111  H HB2  . PRO A 1 8   ? 10.743  -9.545  7.006   1.00 0.00 ? 722 PRO A HB2  1 
ATOM   112  H HB3  . PRO A 1 8   ? 9.387   -10.184 6.061   1.00 0.00 ? 722 PRO A HB3  1 
ATOM   113  H HG2  . PRO A 1 8   ? 9.438   -9.151  8.855   1.00 0.00 ? 722 PRO A HG2  1 
ATOM   114  H HG3  . PRO A 1 8   ? 8.215   -8.933  7.596   1.00 0.00 ? 722 PRO A HG3  1 
ATOM   115  H HD2  . PRO A 1 8   ? 7.971   -10.713 9.652   1.00 0.00 ? 722 PRO A HD2  1 
ATOM   116  H HD3  . PRO A 1 8   ? 7.195   -10.928 8.070   1.00 0.00 ? 722 PRO A HD3  1 
ATOM   117  N N    . ARG A 1 9   ? 11.353  -11.056 9.564   1.00 0.00 ? 723 ARG A N    1 
ATOM   118  C CA   . ARG A 1 9   ? 12.528  -11.036 10.485  1.00 0.00 ? 723 ARG A CA   1 
ATOM   119  C C    . ARG A 1 9   ? 13.737  -10.356 9.827   1.00 0.00 ? 723 ARG A C    1 
ATOM   120  O O    . ARG A 1 9   ? 13.962  -9.175  10.002  1.00 0.00 ? 723 ARG A O    1 
ATOM   121  C CB   . ARG A 1 9   ? 12.825  -12.509 10.776  1.00 0.00 ? 723 ARG A CB   1 
ATOM   122  C CG   . ARG A 1 9   ? 11.867  -13.019 11.854  1.00 0.00 ? 723 ARG A CG   1 
ATOM   123  C CD   . ARG A 1 9   ? 12.499  -12.825 13.233  1.00 0.00 ? 723 ARG A CD   1 
ATOM   124  N NE   . ARG A 1 9   ? 13.305  -14.061 13.460  1.00 0.00 ? 723 ARG A NE   1 
ATOM   125  C CZ   . ARG A 1 9   ? 14.250  -14.092 14.372  1.00 0.00 ? 723 ARG A CZ   1 
ATOM   126  N NH1  . ARG A 1 9   ? 14.512  -13.041 15.109  1.00 0.00 ? 723 ARG A NH1  1 
ATOM   127  N NH2  . ARG A 1 9   ? 14.937  -15.187 14.547  1.00 0.00 ? 723 ARG A NH2  1 
ATOM   128  H H    . ARG A 1 9   ? 10.494  -10.693 9.866   1.00 0.00 ? 723 ARG A H    1 
ATOM   129  H HA   . ARG A 1 9   ? 12.270  -10.524 11.400  1.00 0.00 ? 723 ARG A HA   1 
ATOM   130  H HB2  . ARG A 1 9   ? 12.694  -13.089 9.874   1.00 0.00 ? 723 ARG A HB2  1 
ATOM   131  H HB3  . ARG A 1 9   ? 13.843  -12.610 11.123  1.00 0.00 ? 723 ARG A HB3  1 
ATOM   132  H HG2  . ARG A 1 9   ? 10.940  -12.467 11.802  1.00 0.00 ? 723 ARG A HG2  1 
ATOM   133  H HG3  . ARG A 1 9   ? 11.670  -14.069 11.693  1.00 0.00 ? 723 ARG A HG3  1 
ATOM   134  H HD2  . ARG A 1 9   ? 13.138  -11.954 13.235  1.00 0.00 ? 723 ARG A HD2  1 
ATOM   135  H HD3  . ARG A 1 9   ? 11.733  -12.732 13.989  1.00 0.00 ? 723 ARG A HD3  1 
ATOM   136  H HE   . ARG A 1 9   ? 13.127  -14.860 12.921  1.00 0.00 ? 723 ARG A HE   1 
ATOM   137  H HH11 . ARG A 1 9   ? 13.995  -12.196 14.987  1.00 0.00 ? 723 ARG A HH11 1 
ATOM   138  H HH12 . ARG A 1 9   ? 15.235  -13.086 15.798  1.00 0.00 ? 723 ARG A HH12 1 
ATOM   139  H HH21 . ARG A 1 9   ? 14.744  -15.994 13.989  1.00 0.00 ? 723 ARG A HH21 1 
ATOM   140  H HH22 . ARG A 1 9   ? 15.658  -15.219 15.240  1.00 0.00 ? 723 ARG A HH22 1 
ATOM   141  N N    . ASP A 1 10  ? 14.534  -11.092 9.097   1.00 0.00 ? 724 ASP A N    1 
ATOM   142  C CA   . ASP A 1 10  ? 15.733  -10.482 8.456   1.00 0.00 ? 724 ASP A CA   1 
ATOM   143  C C    . ASP A 1 10  ? 15.345  -9.223  7.665   1.00 0.00 ? 724 ASP A C    1 
ATOM   144  O O    . ASP A 1 10  ? 14.524  -9.291  6.773   1.00 0.00 ? 724 ASP A O    1 
ATOM   145  C CB   . ASP A 1 10  ? 16.256  -11.561 7.506   1.00 0.00 ? 724 ASP A CB   1 
ATOM   146  C CG   . ASP A 1 10  ? 17.244  -12.461 8.250   1.00 0.00 ? 724 ASP A CG   1 
ATOM   147  O OD1  . ASP A 1 10  ? 16.844  -13.059 9.235   1.00 0.00 ? 724 ASP A OD1  1 
ATOM   148  O OD2  . ASP A 1 10  ? 18.384  -12.535 7.823   1.00 0.00 ? 724 ASP A OD2  1 
ATOM   149  H H    . ASP A 1 10  ? 14.345  -12.044 8.969   1.00 0.00 ? 724 ASP A H    1 
ATOM   150  H HA   . ASP A 1 10  ? 16.477  -10.253 9.202   1.00 0.00 ? 724 ASP A HA   1 
ATOM   151  H HB2  . ASP A 1 10  ? 15.429  -12.155 7.145   1.00 0.00 ? 724 ASP A HB2  1 
ATOM   152  H HB3  . ASP A 1 10  ? 16.755  -11.093 6.669   1.00 0.00 ? 724 ASP A HB3  1 
ATOM   153  N N    . PRO A 1 11  ? 15.955  -8.109  8.006   1.00 0.00 ? 725 PRO A N    1 
ATOM   154  C CA   . PRO A 1 11  ? 15.662  -6.844  7.287   1.00 0.00 ? 725 PRO A CA   1 
ATOM   155  C C    . PRO A 1 11  ? 16.182  -6.907  5.847   1.00 0.00 ? 725 PRO A C    1 
ATOM   156  O O    . PRO A 1 11  ? 15.893  -6.047  5.038   1.00 0.00 ? 725 PRO A O    1 
ATOM   157  C CB   . PRO A 1 11  ? 16.421  -5.783  8.083   1.00 0.00 ? 725 PRO A CB   1 
ATOM   158  C CG   . PRO A 1 11  ? 17.484  -6.531  8.824   1.00 0.00 ? 725 PRO A CG   1 
ATOM   159  C CD   . PRO A 1 11  ? 16.966  -7.924  9.057   1.00 0.00 ? 725 PRO A CD   1 
ATOM   160  H HA   . PRO A 1 11  ? 14.600  -6.638  7.298   1.00 0.00 ? 725 PRO A HA   1 
ATOM   161  H HB2  . PRO A 1 11  ? 16.868  -5.062  7.415   1.00 0.00 ? 725 PRO A HB2  1 
ATOM   162  H HB3  . PRO A 1 11  ? 15.757  -5.290  8.778   1.00 0.00 ? 725 PRO A HB3  1 
ATOM   163  H HG2  . PRO A 1 11  ? 18.387  -6.568  8.233   1.00 0.00 ? 725 PRO A HG2  1 
ATOM   164  H HG3  . PRO A 1 11  ? 17.682  -6.048  9.770   1.00 0.00 ? 725 PRO A HG3  1 
ATOM   165  H HD2  . PRO A 1 11  ? 17.762  -8.646  8.948   1.00 0.00 ? 725 PRO A HD2  1 
ATOM   166  H HD3  . PRO A 1 11  ? 16.514  -8.001  10.035  1.00 0.00 ? 725 PRO A HD3  1 
ATOM   167  N N    . ASP A 1 12  ? 16.961  -7.906  5.520   1.00 0.00 ? 726 ASP A N    1 
ATOM   168  C CA   . ASP A 1 12  ? 17.466  -8.026  4.125   1.00 0.00 ? 726 ASP A CA   1 
ATOM   169  C C    . ASP A 1 12  ? 16.469  -8.834  3.303   1.00 0.00 ? 726 ASP A C    1 
ATOM   170  O O    . ASP A 1 12  ? 16.250  -8.580  2.136   1.00 0.00 ? 726 ASP A O    1 
ATOM   171  C CB   . ASP A 1 12  ? 18.794  -8.775  4.247   1.00 0.00 ? 726 ASP A CB   1 
ATOM   172  C CG   . ASP A 1 12  ? 19.624  -8.547  2.983   1.00 0.00 ? 726 ASP A CG   1 
ATOM   173  O OD1  . ASP A 1 12  ? 20.166  -7.464  2.841   1.00 0.00 ? 726 ASP A OD1  1 
ATOM   174  O OD2  . ASP A 1 12  ? 19.702  -9.460  2.177   1.00 0.00 ? 726 ASP A OD2  1 
ATOM   175  H H    . ASP A 1 12  ? 17.168  -8.605  6.173   1.00 0.00 ? 726 ASP A H    1 
ATOM   176  H HA   . ASP A 1 12  ? 17.618  -7.049  3.690   1.00 0.00 ? 726 ASP A HA   1 
ATOM   177  H HB2  . ASP A 1 12  ? 19.337  -8.409  5.106   1.00 0.00 ? 726 ASP A HB2  1 
ATOM   178  H HB3  . ASP A 1 12  ? 18.601  -9.831  4.366   1.00 0.00 ? 726 ASP A HB3  1 
ATOM   179  N N    . GLN A 1 13  ? 15.846  -9.794  3.923   1.00 0.00 ? 727 GLN A N    1 
ATOM   180  C CA   . GLN A 1 13  ? 14.827  -10.606 3.213   1.00 0.00 ? 727 GLN A CA   1 
ATOM   181  C C    . GLN A 1 13  ? 13.583  -9.759  2.961   1.00 0.00 ? 727 GLN A C    1 
ATOM   182  O O    . GLN A 1 13  ? 13.005  -9.780  1.893   1.00 0.00 ? 727 GLN A O    1 
ATOM   183  C CB   . GLN A 1 13  ? 14.505  -11.743 4.184   1.00 0.00 ? 727 GLN A CB   1 
ATOM   184  C CG   . GLN A 1 13  ? 15.567  -12.822 4.092   1.00 0.00 ? 727 GLN A CG   1 
ATOM   185  C CD   . GLN A 1 13  ? 15.634  -13.360 2.661   1.00 0.00 ? 727 GLN A CD   1 
ATOM   186  O OE1  . GLN A 1 13  ? 14.664  -13.301 1.932   1.00 0.00 ? 727 GLN A OE1  1 
ATOM   187  N NE2  . GLN A 1 13  ? 16.747  -13.885 2.225   1.00 0.00 ? 727 GLN A NE2  1 
ATOM   188  H H    . GLN A 1 13  ? 16.029  -9.963  4.871   1.00 0.00 ? 727 GLN A H    1 
ATOM   189  H HA   . GLN A 1 13  ? 15.224  -10.993 2.286   1.00 0.00 ? 727 GLN A HA   1 
ATOM   190  H HB2  . GLN A 1 13  ? 14.471  -11.356 5.192   1.00 0.00 ? 727 GLN A HB2  1 
ATOM   191  H HB3  . GLN A 1 13  ? 13.561  -12.173 3.937   1.00 0.00 ? 727 GLN A HB3  1 
ATOM   192  H HG2  . GLN A 1 13  ? 16.516  -12.406 4.367   1.00 0.00 ? 727 GLN A HG2  1 
ATOM   193  H HG3  . GLN A 1 13  ? 15.312  -13.621 4.766   1.00 0.00 ? 727 GLN A HG3  1 
ATOM   194  H HE21 . GLN A 1 13  ? 17.529  -13.933 2.812   1.00 0.00 ? 727 GLN A HE21 1 
ATOM   195  H HE22 . GLN A 1 13  ? 16.799  -14.232 1.310   1.00 0.00 ? 727 GLN A HE22 1 
ATOM   196  N N    . LEU A 1 14  ? 13.178  -9.000  3.941   1.00 0.00 ? 728 LEU A N    1 
ATOM   197  C CA   . LEU A 1 14  ? 11.972  -8.143  3.782   1.00 0.00 ? 728 LEU A CA   1 
ATOM   198  C C    . LEU A 1 14  ? 12.197  -7.090  2.697   1.00 0.00 ? 728 LEU A C    1 
ATOM   199  O O    . LEU A 1 14  ? 11.286  -6.722  1.983   1.00 0.00 ? 728 LEU A O    1 
ATOM   200  C CB   . LEU A 1 14  ? 11.792  -7.480  5.147   1.00 0.00 ? 728 LEU A CB   1 
ATOM   201  C CG   . LEU A 1 14  ? 10.590  -6.549  5.103   1.00 0.00 ? 728 LEU A CG   1 
ATOM   202  C CD1  . LEU A 1 14  ? 9.325   -7.376  5.261   1.00 0.00 ? 728 LEU A CD1  1 
ATOM   203  C CD2  . LEU A 1 14  ? 10.683  -5.532  6.241   1.00 0.00 ? 728 LEU A CD2  1 
ATOM   204  H H    . LEU A 1 14  ? 13.666  -9.002  4.792   1.00 0.00 ? 728 LEU A H    1 
ATOM   205  H HA   . LEU A 1 14  ? 11.110  -8.748  3.543   1.00 0.00 ? 728 LEU A HA   1 
ATOM   206  H HB2  . LEU A 1 14  ? 11.633  -8.239  5.895   1.00 0.00 ? 728 LEU A HB2  1 
ATOM   207  H HB3  . LEU A 1 14  ? 12.664  -6.915  5.393   1.00 0.00 ? 728 LEU A HB3  1 
ATOM   208  H HG   . LEU A 1 14  ? 10.571  -6.034  4.158   1.00 0.00 ? 728 LEU A HG   1 
ATOM   209  H HD11 . LEU A 1 14  ? 8.602   -7.075  4.519   1.00 0.00 ? 728 LEU A HD11 1 
ATOM   210  H HD12 . LEU A 1 14  ? 8.919   -7.222  6.248   1.00 0.00 ? 728 LEU A HD12 1 
ATOM   211  H HD13 . LEU A 1 14  ? 9.568   -8.419  5.130   1.00 0.00 ? 728 LEU A HD13 1 
ATOM   212  H HD21 . LEU A 1 14  ? 10.521  -6.032  7.185   1.00 0.00 ? 728 LEU A HD21 1 
ATOM   213  H HD22 . LEU A 1 14  ? 9.931   -4.770  6.104   1.00 0.00 ? 728 LEU A HD22 1 
ATOM   214  H HD23 . LEU A 1 14  ? 11.662  -5.077  6.239   1.00 0.00 ? 728 LEU A HD23 1 
ATOM   215  N N    . TYR A 1 15  ? 13.400  -6.604  2.556   1.00 0.00 ? 729 TYR A N    1 
ATOM   216  C CA   . TYR A 1 15  ? 13.671  -5.584  1.500   1.00 0.00 ? 729 TYR A CA   1 
ATOM   217  C C    . TYR A 1 15  ? 13.126  -6.067  0.152   1.00 0.00 ? 729 TYR A C    1 
ATOM   218  O O    . TYR A 1 15  ? 12.461  -5.340  -0.563  1.00 0.00 ? 729 TYR A O    1 
ATOM   219  C CB   . TYR A 1 15  ? 15.198  -5.470  1.453   1.00 0.00 ? 729 TYR A CB   1 
ATOM   220  C CG   . TYR A 1 15  ? 15.607  -4.556  0.322   1.00 0.00 ? 729 TYR A CG   1 
ATOM   221  C CD1  . TYR A 1 15  ? 15.527  -3.168  0.479   1.00 0.00 ? 729 TYR A CD1  1 
ATOM   222  C CD2  . TYR A 1 15  ? 16.065  -5.100  -0.884  1.00 0.00 ? 729 TYR A CD2  1 
ATOM   223  C CE1  . TYR A 1 15  ? 15.905  -2.322  -0.571  1.00 0.00 ? 729 TYR A CE1  1 
ATOM   224  C CE2  . TYR A 1 15  ? 16.444  -4.254  -1.933  1.00 0.00 ? 729 TYR A CE2  1 
ATOM   225  C CZ   . TYR A 1 15  ? 16.364  -2.865  -1.777  1.00 0.00 ? 729 TYR A CZ   1 
ATOM   226  O OH   . TYR A 1 15  ? 16.737  -2.032  -2.811  1.00 0.00 ? 729 TYR A OH   1 
ATOM   227  H H    . TYR A 1 15  ? 14.127  -6.915  3.135   1.00 0.00 ? 729 TYR A H    1 
ATOM   228  H HA   . TYR A 1 15  ? 13.230  -4.636  1.769   1.00 0.00 ? 729 TYR A HA   1 
ATOM   229  H HB2  . TYR A 1 15  ? 15.557  -5.066  2.389   1.00 0.00 ? 729 TYR A HB2  1 
ATOM   230  H HB3  . TYR A 1 15  ? 15.626  -6.449  1.297   1.00 0.00 ? 729 TYR A HB3  1 
ATOM   231  H HD1  . TYR A 1 15  ? 15.173  -2.749  1.409   1.00 0.00 ? 729 TYR A HD1  1 
ATOM   232  H HD2  . TYR A 1 15  ? 16.127  -6.171  -1.005  1.00 0.00 ? 729 TYR A HD2  1 
ATOM   233  H HE1  . TYR A 1 15  ? 15.844  -1.250  -0.450  1.00 0.00 ? 729 TYR A HE1  1 
ATOM   234  H HE2  . TYR A 1 15  ? 16.797  -4.674  -2.864  1.00 0.00 ? 729 TYR A HE2  1 
ATOM   235  H HH   . TYR A 1 15  ? 17.230  -1.298  -2.437  1.00 0.00 ? 729 TYR A HH   1 
ATOM   236  N N    . SER A 1 16  ? 13.384  -7.299  -0.186  1.00 0.00 ? 730 SER A N    1 
ATOM   237  C CA   . SER A 1 16  ? 12.871  -7.837  -1.475  1.00 0.00 ? 730 SER A CA   1 
ATOM   238  C C    . SER A 1 16  ? 11.442  -8.352  -1.297  1.00 0.00 ? 730 SER A C    1 
ATOM   239  O O    . SER A 1 16  ? 10.586  -8.127  -2.129  1.00 0.00 ? 730 SER A O    1 
ATOM   240  C CB   . SER A 1 16  ? 13.820  -8.980  -1.838  1.00 0.00 ? 730 SER A CB   1 
ATOM   241  O OG   . SER A 1 16  ? 13.368  -10.189 -1.245  1.00 0.00 ? 730 SER A OG   1 
ATOM   242  H H    . SER A 1 16  ? 13.908  -7.872  0.413   1.00 0.00 ? 730 SER A H    1 
ATOM   243  H HA   . SER A 1 16  ? 12.900  -7.072  -2.236  1.00 0.00 ? 730 SER A HA   1 
ATOM   244  H HB2  . SER A 1 16  ? 13.845  -9.091  -2.912  1.00 0.00 ? 730 SER A HB2  1 
ATOM   245  H HB3  . SER A 1 16  ? 14.812  -8.751  -1.477  1.00 0.00 ? 730 SER A HB3  1 
ATOM   246  H HG   . SER A 1 16  ? 13.528  -10.135 -0.300  1.00 0.00 ? 730 SER A HG   1 
ATOM   247  N N    . THR A 1 17  ? 11.166  -9.024  -0.206  1.00 0.00 ? 731 THR A N    1 
ATOM   248  C CA   . THR A 1 17  ? 9.775   -9.515  0.029   1.00 0.00 ? 731 THR A CA   1 
ATOM   249  C C    . THR A 1 17  ? 8.796   -8.354  -0.131  1.00 0.00 ? 731 THR A C    1 
ATOM   250  O O    . THR A 1 17  ? 7.729   -8.496  -0.694  1.00 0.00 ? 731 THR A O    1 
ATOM   251  C CB   . THR A 1 17  ? 9.768   -10.029 1.470   1.00 0.00 ? 731 THR A CB   1 
ATOM   252  O OG1  . THR A 1 17  ? 10.870  -10.901 1.668   1.00 0.00 ? 731 THR A OG1  1 
ATOM   253  C CG2  . THR A 1 17  ? 8.465   -10.786 1.736   1.00 0.00 ? 731 THR A CG2  1 
ATOM   254  H H    . THR A 1 17  ? 11.863  -9.182  0.464   1.00 0.00 ? 731 THR A H    1 
ATOM   255  H HA   . THR A 1 17  ? 9.534   -10.312 -0.659  1.00 0.00 ? 731 THR A HA   1 
ATOM   256  H HB   . THR A 1 17  ? 9.843   -9.193  2.149   1.00 0.00 ? 731 THR A HB   1 
ATOM   257  H HG1  . THR A 1 17  ? 10.766  -11.651 1.077   1.00 0.00 ? 731 THR A HG1  1 
ATOM   258  H HG21 . THR A 1 17  ? 8.647   -11.576 2.450   1.00 0.00 ? 731 THR A HG21 1 
ATOM   259  H HG22 . THR A 1 17  ? 8.101   -11.212 0.812   1.00 0.00 ? 731 THR A HG22 1 
ATOM   260  H HG23 . THR A 1 17  ? 7.727   -10.105 2.133   1.00 0.00 ? 731 THR A HG23 1 
ATOM   261  N N    . LEU A 1 18  ? 9.177   -7.192  0.323   1.00 0.00 ? 732 LEU A N    1 
ATOM   262  C CA   . LEU A 1 18  ? 8.310   -6.002  0.134   1.00 0.00 ? 732 LEU A CA   1 
ATOM   263  C C    . LEU A 1 18  ? 8.393   -5.560  -1.327  1.00 0.00 ? 732 LEU A C    1 
ATOM   264  O O    . LEU A 1 18  ? 7.398   -5.287  -1.967  1.00 0.00 ? 732 LEU A O    1 
ATOM   265  C CB   . LEU A 1 18  ? 8.897   -4.921  1.049   1.00 0.00 ? 732 LEU A CB   1 
ATOM   266  C CG   . LEU A 1 18  ? 8.726   -5.321  2.518   1.00 0.00 ? 732 LEU A CG   1 
ATOM   267  C CD1  . LEU A 1 18  ? 9.232   -4.185  3.411   1.00 0.00 ? 732 LEU A CD1  1 
ATOM   268  C CD2  . LEU A 1 18  ? 7.249   -5.581  2.823   1.00 0.00 ? 732 LEU A CD2  1 
ATOM   269  H H    . LEU A 1 18  ? 10.058  -7.094  0.741   1.00 0.00 ? 732 LEU A H    1 
ATOM   270  H HA   . LEU A 1 18  ? 7.292   -6.228  0.411   1.00 0.00 ? 732 LEU A HA   1 
ATOM   271  H HB2  . LEU A 1 18  ? 9.948   -4.802  0.832   1.00 0.00 ? 732 LEU A HB2  1 
ATOM   272  H HB3  . LEU A 1 18  ? 8.388   -3.986  0.872   1.00 0.00 ? 732 LEU A HB3  1 
ATOM   273  H HG   . LEU A 1 18  ? 9.295   -6.217  2.715   1.00 0.00 ? 732 LEU A HG   1 
ATOM   274  H HD11 . LEU A 1 18  ? 8.953   -4.382  4.436   1.00 0.00 ? 732 LEU A HD11 1 
ATOM   275  H HD12 . LEU A 1 18  ? 8.795   -3.252  3.091   1.00 0.00 ? 732 LEU A HD12 1 
ATOM   276  H HD13 . LEU A 1 18  ? 10.309  -4.123  3.338   1.00 0.00 ? 732 LEU A HD13 1 
ATOM   277  H HD21 . LEU A 1 18  ? 7.104   -6.633  3.023   1.00 0.00 ? 732 LEU A HD21 1 
ATOM   278  H HD22 . LEU A 1 18  ? 6.648   -5.287  1.976   1.00 0.00 ? 732 LEU A HD22 1 
ATOM   279  H HD23 . LEU A 1 18  ? 6.956   -5.007  3.689   1.00 0.00 ? 732 LEU A HD23 1 
ATOM   280  N N    . LYS A 1 19  ? 9.585   -5.521  -1.865  1.00 0.00 ? 733 LYS A N    1 
ATOM   281  C CA   . LYS A 1 19  ? 9.754   -5.123  -3.290  1.00 0.00 ? 733 LYS A CA   1 
ATOM   282  C C    . LYS A 1 19  ? 8.834   -5.948  -4.192  1.00 0.00 ? 733 LYS A C    1 
ATOM   283  O O    . LYS A 1 19  ? 8.048   -5.414  -4.948  1.00 0.00 ? 733 LYS A O    1 
ATOM   284  C CB   . LYS A 1 19  ? 11.215  -5.446  -3.611  1.00 0.00 ? 733 LYS A CB   1 
ATOM   285  C CG   . LYS A 1 19  ? 11.728  -4.475  -4.676  1.00 0.00 ? 733 LYS A CG   1 
ATOM   286  C CD   . LYS A 1 19  ? 12.785  -5.171  -5.532  1.00 0.00 ? 733 LYS A CD   1 
ATOM   287  C CE   . LYS A 1 19  ? 12.297  -5.255  -6.979  1.00 0.00 ? 733 LYS A CE   1 
ATOM   288  N NZ   . LYS A 1 19  ? 12.952  -4.109  -7.670  1.00 0.00 ? 733 LYS A NZ   1 
ATOM   289  H H    . LYS A 1 19  ? 10.373  -5.753  -1.326  1.00 0.00 ? 733 LYS A H    1 
ATOM   290  H HA   . LYS A 1 19  ? 9.563   -4.068  -3.415  1.00 0.00 ? 733 LYS A HA   1 
ATOM   291  H HB2  . LYS A 1 19  ? 11.814  -5.355  -2.717  1.00 0.00 ? 733 LYS A HB2  1 
ATOM   292  H HB3  . LYS A 1 19  ? 11.284  -6.457  -3.987  1.00 0.00 ? 733 LYS A HB3  1 
ATOM   293  H HG2  . LYS A 1 19  ? 10.907  -4.166  -5.303  1.00 0.00 ? 733 LYS A HG2  1 
ATOM   294  H HG3  . LYS A 1 19  ? 12.163  -3.610  -4.197  1.00 0.00 ? 733 LYS A HG3  1 
ATOM   295  H HD2  . LYS A 1 19  ? 13.707  -4.610  -5.494  1.00 0.00 ? 733 LYS A HD2  1 
ATOM   296  H HD3  . LYS A 1 19  ? 12.953  -6.166  -5.152  1.00 0.00 ? 733 LYS A HD3  1 
ATOM   297  H HE2  . LYS A 1 19  ? 12.605  -6.189  -7.426  1.00 0.00 ? 733 LYS A HE2  1 
ATOM   298  H HE3  . LYS A 1 19  ? 11.222  -5.154  -7.020  1.00 0.00 ? 733 LYS A HE3  1 
ATOM   299  H HZ1  . LYS A 1 19  ? 12.470  -3.927  -8.573  1.00 0.00 ? 733 LYS A HZ1  1 
ATOM   300  H HZ2  . LYS A 1 19  ? 13.950  -4.338  -7.850  1.00 0.00 ? 733 LYS A HZ2  1 
ATOM   301  H HZ3  . LYS A 1 19  ? 12.892  -3.263  -7.069  1.00 0.00 ? 733 LYS A HZ3  1 
ATOM   302  N N    . SER A 1 20  ? 8.945   -7.249  -4.134  1.00 0.00 ? 734 SER A N    1 
ATOM   303  C CA   . SER A 1 20  ? 8.096   -8.116  -4.999  1.00 0.00 ? 734 SER A CA   1 
ATOM   304  C C    . SER A 1 20  ? 6.624   -7.725  -4.873  1.00 0.00 ? 734 SER A C    1 
ATOM   305  O O    . SER A 1 20  ? 5.922   -7.585  -5.855  1.00 0.00 ? 734 SER A O    1 
ATOM   306  C CB   . SER A 1 20  ? 8.315   -9.533  -4.466  1.00 0.00 ? 734 SER A CB   1 
ATOM   307  O OG   . SER A 1 20  ? 9.263   -10.205 -5.282  1.00 0.00 ? 734 SER A OG   1 
ATOM   308  H H    . SER A 1 20  ? 9.591   -7.656  -3.521  1.00 0.00 ? 734 SER A H    1 
ATOM   309  H HA   . SER A 1 20  ? 8.417   -8.048  -6.028  1.00 0.00 ? 734 SER A HA   1 
ATOM   310  H HB2  . SER A 1 20  ? 8.683   -9.483  -3.452  1.00 0.00 ? 734 SER A HB2  1 
ATOM   311  H HB3  . SER A 1 20  ? 7.379   -10.072 -4.483  1.00 0.00 ? 734 SER A HB3  1 
ATOM   312  H HG   . SER A 1 20  ? 10.103  -10.210 -4.817  1.00 0.00 ? 734 SER A HG   1 
ATOM   313  N N    . ILE A 1 21  ? 6.150   -7.551  -3.672  1.00 0.00 ? 735 ILE A N    1 
ATOM   314  C CA   . ILE A 1 21  ? 4.723   -7.172  -3.488  1.00 0.00 ? 735 ILE A CA   1 
ATOM   315  C C    . ILE A 1 21  ? 4.430   -5.851  -4.199  1.00 0.00 ? 735 ILE A C    1 
ATOM   316  O O    . ILE A 1 21  ? 3.604   -5.783  -5.086  1.00 0.00 ? 735 ILE A O    1 
ATOM   317  C CB   . ILE A 1 21  ? 4.551   -7.015  -1.976  1.00 0.00 ? 735 ILE A CB   1 
ATOM   318  C CG1  . ILE A 1 21  ? 4.783   -8.364  -1.294  1.00 0.00 ? 735 ILE A CG1  1 
ATOM   319  C CG2  . ILE A 1 21  ? 3.133   -6.526  -1.671  1.00 0.00 ? 735 ILE A CG2  1 
ATOM   320  C CD1  . ILE A 1 21  ? 4.761   -8.178  0.225   1.00 0.00 ? 735 ILE A CD1  1 
ATOM   321  H H    . ILE A 1 21  ? 6.731   -7.670  -2.892  1.00 0.00 ? 735 ILE A H    1 
ATOM   322  H HA   . ILE A 1 21  ? 4.079   -7.953  -3.863  1.00 0.00 ? 735 ILE A HA   1 
ATOM   323  H HB   . ILE A 1 21  ? 5.267   -6.297  -1.606  1.00 0.00 ? 735 ILE A HB   1 
ATOM   324  H HG12 . ILE A 1 21  ? 4.003   -9.053  -1.583  1.00 0.00 ? 735 ILE A HG12 1 
ATOM   325  H HG13 . ILE A 1 21  ? 5.742   -8.760  -1.594  1.00 0.00 ? 735 ILE A HG13 1 
ATOM   326  H HG21 . ILE A 1 21  ? 2.891   -5.698  -2.321  1.00 0.00 ? 735 ILE A HG21 1 
ATOM   327  H HG22 . ILE A 1 21  ? 3.077   -6.204  -0.642  1.00 0.00 ? 735 ILE A HG22 1 
ATOM   328  H HG23 . ILE A 1 21  ? 2.431   -7.330  -1.836  1.00 0.00 ? 735 ILE A HG23 1 
ATOM   329  H HD11 . ILE A 1 21  ? 5.759   -7.961  0.575   1.00 0.00 ? 735 ILE A HD11 1 
ATOM   330  H HD12 . ILE A 1 21  ? 4.404   -9.083  0.693   1.00 0.00 ? 735 ILE A HD12 1 
ATOM   331  H HD13 . ILE A 1 21  ? 4.104   -7.359  0.477   1.00 0.00 ? 735 ILE A HD13 1 
ATOM   332  N N    . LEU A 1 22  ? 5.101   -4.798  -3.817  1.00 0.00 ? 736 LEU A N    1 
ATOM   333  C CA   . LEU A 1 22  ? 4.859   -3.484  -4.478  1.00 0.00 ? 736 LEU A CA   1 
ATOM   334  C C    . LEU A 1 22  ? 5.000   -3.626  -5.994  1.00 0.00 ? 736 LEU A C    1 
ATOM   335  O O    . LEU A 1 22  ? 4.297   -2.994  -6.756  1.00 0.00 ? 736 LEU A O    1 
ATOM   336  C CB   . LEU A 1 22  ? 5.947   -2.557  -3.927  1.00 0.00 ? 736 LEU A CB   1 
ATOM   337  C CG   . LEU A 1 22  ? 5.494   -1.101  -4.037  1.00 0.00 ? 736 LEU A CG   1 
ATOM   338  C CD1  . LEU A 1 22  ? 5.283   -0.759  -5.506  1.00 0.00 ? 736 LEU A CD1  1 
ATOM   339  C CD2  . LEU A 1 22  ? 4.184   -0.902  -3.270  1.00 0.00 ? 736 LEU A CD2  1 
ATOM   340  H H    . LEU A 1 22  ? 5.766   -4.872  -3.100  1.00 0.00 ? 736 LEU A H    1 
ATOM   341  H HA   . LEU A 1 22  ? 3.879   -3.112  -4.224  1.00 0.00 ? 736 LEU A HA   1 
ATOM   342  H HB2  . LEU A 1 22  ? 6.132   -2.794  -2.897  1.00 0.00 ? 736 LEU A HB2  1 
ATOM   343  H HB3  . LEU A 1 22  ? 6.855   -2.694  -4.495  1.00 0.00 ? 736 LEU A HB3  1 
ATOM   344  H HG   . LEU A 1 22  ? 6.255   -0.456  -3.623  1.00 0.00 ? 736 LEU A HG   1 
ATOM   345  H HD11 . LEU A 1 22  ? 5.932   -1.375  -6.109  1.00 0.00 ? 736 LEU A HD11 1 
ATOM   346  H HD12 . LEU A 1 22  ? 5.515   0.282   -5.672  1.00 0.00 ? 736 LEU A HD12 1 
ATOM   347  H HD13 . LEU A 1 22  ? 4.255   -0.948  -5.774  1.00 0.00 ? 736 LEU A HD13 1 
ATOM   348  H HD21 . LEU A 1 22  ? 4.034   0.150   -3.082  1.00 0.00 ? 736 LEU A HD21 1 
ATOM   349  H HD22 . LEU A 1 22  ? 4.232   -1.432  -2.331  1.00 0.00 ? 736 LEU A HD22 1 
ATOM   350  H HD23 . LEU A 1 22  ? 3.361   -1.283  -3.857  1.00 0.00 ? 736 LEU A HD23 1 
ATOM   351  N N    . GLN A 1 23  ? 5.901   -4.460  -6.435  1.00 0.00 ? 737 GLN A N    1 
ATOM   352  C CA   . GLN A 1 23  ? 6.082   -4.653  -7.900  1.00 0.00 ? 737 GLN A CA   1 
ATOM   353  C C    . GLN A 1 23  ? 4.865   -5.370  -8.491  1.00 0.00 ? 737 GLN A C    1 
ATOM   354  O O    . GLN A 1 23  ? 4.362   -5.003  -9.534  1.00 0.00 ? 737 GLN A O    1 
ATOM   355  C CB   . GLN A 1 23  ? 7.335   -5.521  -8.032  1.00 0.00 ? 737 GLN A CB   1 
ATOM   356  C CG   . GLN A 1 23  ? 8.454   -4.705  -8.682  1.00 0.00 ? 737 GLN A CG   1 
ATOM   357  C CD   . GLN A 1 23  ? 8.569   -5.079  -10.161 1.00 0.00 ? 737 GLN A CD   1 
ATOM   358  O OE1  . GLN A 1 23  ? 8.356   -4.254  -11.027 1.00 0.00 ? 737 GLN A OE1  1 
ATOM   359  N NE2  . GLN A 1 23  ? 8.903   -6.298  -10.489 1.00 0.00 ? 737 GLN A NE2  1 
ATOM   360  H H    . GLN A 1 23  ? 6.454   -4.963  -5.802  1.00 0.00 ? 737 GLN A H    1 
ATOM   361  H HA   . GLN A 1 23  ? 6.231   -3.702  -8.388  1.00 0.00 ? 737 GLN A HA   1 
ATOM   362  H HB2  . GLN A 1 23  ? 7.652   -5.848  -7.052  1.00 0.00 ? 737 GLN A HB2  1 
ATOM   363  H HB3  . GLN A 1 23  ? 7.115   -6.382  -8.644  1.00 0.00 ? 737 GLN A HB3  1 
ATOM   364  H HG2  . GLN A 1 23  ? 8.229   -3.652  -8.595  1.00 0.00 ? 737 GLN A HG2  1 
ATOM   365  H HG3  . GLN A 1 23  ? 9.389   -4.914  -8.184  1.00 0.00 ? 737 GLN A HG3  1 
ATOM   366  H HE21 . GLN A 1 23  ? 9.076   -6.963  -9.792  1.00 0.00 ? 737 GLN A HE21 1 
ATOM   367  H HE22 . GLN A 1 23  ? 8.980   -6.547  -11.434 1.00 0.00 ? 737 GLN A HE22 1 
ATOM   368  N N    . GLN A 1 24  ? 4.378   -6.381  -7.823  1.00 0.00 ? 738 GLN A N    1 
ATOM   369  C CA   . GLN A 1 24  ? 3.188   -7.110  -8.345  1.00 0.00 ? 738 GLN A CA   1 
ATOM   370  C C    . GLN A 1 24  ? 1.944   -6.225  -8.248  1.00 0.00 ? 738 GLN A C    1 
ATOM   371  O O    . GLN A 1 24  ? 1.199   -6.080  -9.196  1.00 0.00 ? 738 GLN A O    1 
ATOM   372  C CB   . GLN A 1 24  ? 3.048   -8.338  -7.448  1.00 0.00 ? 738 GLN A CB   1 
ATOM   373  C CG   . GLN A 1 24  ? 3.740   -9.523  -8.121  1.00 0.00 ? 738 GLN A CG   1 
ATOM   374  C CD   . GLN A 1 24  ? 2.957   -10.805 -7.835  1.00 0.00 ? 738 GLN A CD   1 
ATOM   375  O OE1  . GLN A 1 24  ? 3.351   -11.601 -7.006  1.00 0.00 ? 738 GLN A OE1  1 
ATOM   376  N NE2  . GLN A 1 24  ? 1.859   -11.044 -8.499  1.00 0.00 ? 738 GLN A NE2  1 
ATOM   377  H H    . GLN A 1 24  ? 4.794   -6.660  -6.980  1.00 0.00 ? 738 GLN A H    1 
ATOM   378  H HA   . GLN A 1 24  ? 3.356   -7.416  -9.366  1.00 0.00 ? 738 GLN A HA   1 
ATOM   379  H HB2  . GLN A 1 24  ? 3.512   -8.143  -6.492  1.00 0.00 ? 738 GLN A HB2  1 
ATOM   380  H HB3  . GLN A 1 24  ? 2.002   -8.564  -7.304  1.00 0.00 ? 738 GLN A HB3  1 
ATOM   381  H HG2  . GLN A 1 24  ? 3.778   -9.357  -9.187  1.00 0.00 ? 738 GLN A HG2  1 
ATOM   382  H HG3  . GLN A 1 24  ? 4.743   -9.617  -7.737  1.00 0.00 ? 738 GLN A HG3  1 
ATOM   383  H HE21 . GLN A 1 24  ? 1.540   -10.400 -9.166  1.00 0.00 ? 738 GLN A HE21 1 
ATOM   384  H HE22 . GLN A 1 24  ? 1.348   -11.861 -8.324  1.00 0.00 ? 738 GLN A HE22 1 
ATOM   385  N N    . VAL A 1 25  ? 1.723   -5.613  -7.113  1.00 0.00 ? 739 VAL A N    1 
ATOM   386  C CA   . VAL A 1 25  ? 0.541   -4.715  -6.965  1.00 0.00 ? 739 VAL A CA   1 
ATOM   387  C C    . VAL A 1 25  ? 0.517   -3.697  -8.107  1.00 0.00 ? 739 VAL A C    1 
ATOM   388  O O    . VAL A 1 25  ? -0.495  -3.485  -8.743  1.00 0.00 ? 739 VAL A O    1 
ATOM   389  C CB   . VAL A 1 25  ? 0.745   -4.011  -5.620  1.00 0.00 ? 739 VAL A CB   1 
ATOM   390  C CG1  . VAL A 1 25  ? -0.350  -2.961  -5.418  1.00 0.00 ? 739 VAL A CG1  1 
ATOM   391  C CG2  . VAL A 1 25  ? 0.675   -5.040  -4.489  1.00 0.00 ? 739 VAL A CG2  1 
ATOM   392  H H    . VAL A 1 25  ? 2.342   -5.734  -6.364  1.00 0.00 ? 739 VAL A H    1 
ATOM   393  H HA   . VAL A 1 25  ? -0.372  -5.293  -6.955  1.00 0.00 ? 739 VAL A HA   1 
ATOM   394  H HB   . VAL A 1 25  ? 1.711   -3.529  -5.608  1.00 0.00 ? 739 VAL A HB   1 
ATOM   395  H HG11 . VAL A 1 25  ? -0.824  -3.115  -4.460  1.00 0.00 ? 739 VAL A HG11 1 
ATOM   396  H HG12 . VAL A 1 25  ? -1.087  -3.053  -6.203  1.00 0.00 ? 739 VAL A HG12 1 
ATOM   397  H HG13 . VAL A 1 25  ? 0.087   -1.974  -5.449  1.00 0.00 ? 739 VAL A HG13 1 
ATOM   398  H HG21 . VAL A 1 25  ? 1.028   -4.592  -3.573  1.00 0.00 ? 739 VAL A HG21 1 
ATOM   399  H HG22 . VAL A 1 25  ? 1.295   -5.889  -4.736  1.00 0.00 ? 739 VAL A HG22 1 
ATOM   400  H HG23 . VAL A 1 25  ? -0.346  -5.366  -4.361  1.00 0.00 ? 739 VAL A HG23 1 
ATOM   401  N N    . LYS A 1 26  ? 1.637   -3.088  -8.389  1.00 0.00 ? 740 LYS A N    1 
ATOM   402  C CA   . LYS A 1 26  ? 1.691   -2.111  -9.510  1.00 0.00 ? 740 LYS A CA   1 
ATOM   403  C C    . LYS A 1 26  ? 1.241   -2.781  -10.802 1.00 0.00 ? 740 LYS A C    1 
ATOM   404  O O    . LYS A 1 26  ? 0.388   -2.285  -11.510 1.00 0.00 ? 740 LYS A O    1 
ATOM   405  C CB   . LYS A 1 26  ? 3.163   -1.717  -9.615  1.00 0.00 ? 740 LYS A CB   1 
ATOM   406  C CG   . LYS A 1 26  ? 3.355   -0.759  -10.792 1.00 0.00 ? 740 LYS A CG   1 
ATOM   407  C CD   . LYS A 1 26  ? 4.593   0.106   -10.548 1.00 0.00 ? 740 LYS A CD   1 
ATOM   408  C CE   . LYS A 1 26  ? 5.836   -0.784  -10.498 1.00 0.00 ? 740 LYS A CE   1 
ATOM   409  N NZ   . LYS A 1 26  ? 6.946   0.133   -10.113 1.00 0.00 ? 740 LYS A NZ   1 
ATOM   410  H H    . LYS A 1 26  ? 2.446   -3.288  -7.874  1.00 0.00 ? 740 LYS A H    1 
ATOM   411  H HA   . LYS A 1 26  ? 1.079   -1.248  -9.294  1.00 0.00 ? 740 LYS A HA   1 
ATOM   412  H HB2  . LYS A 1 26  ? 3.469   -1.233  -8.706  1.00 0.00 ? 740 LYS A HB2  1 
ATOM   413  H HB3  . LYS A 1 26  ? 3.762   -2.602  -9.771  1.00 0.00 ? 740 LYS A HB3  1 
ATOM   414  H HG2  . LYS A 1 26  ? 3.486   -1.327  -11.701 1.00 0.00 ? 740 LYS A HG2  1 
ATOM   415  H HG3  . LYS A 1 26  ? 2.485   -0.125  -10.886 1.00 0.00 ? 740 LYS A HG3  1 
ATOM   416  H HD2  . LYS A 1 26  ? 4.695   0.823   -11.350 1.00 0.00 ? 740 LYS A HD2  1 
ATOM   417  H HD3  . LYS A 1 26  ? 4.488   0.629   -9.609  1.00 0.00 ? 740 LYS A HD3  1 
ATOM   418  H HE2  . LYS A 1 26  ? 5.714   -1.559  -9.756  1.00 0.00 ? 740 LYS A HE2  1 
ATOM   419  H HE3  . LYS A 1 26  ? 6.027   -1.219  -11.468 1.00 0.00 ? 740 LYS A HE3  1 
ATOM   420  H HZ1  . LYS A 1 26  ? 7.787   -0.425  -9.866  1.00 0.00 ? 740 LYS A HZ1  1 
ATOM   421  H HZ2  . LYS A 1 26  ? 6.655   0.703   -9.293  1.00 0.00 ? 740 LYS A HZ2  1 
ATOM   422  H HZ3  . LYS A 1 26  ? 7.169   0.762   -10.911 1.00 0.00 ? 740 LYS A HZ3  1 
ATOM   423  N N    . SER A 1 27  ? 1.813   -3.909  -11.114 1.00 0.00 ? 741 SER A N    1 
ATOM   424  C CA   . SER A 1 27  ? 1.425   -4.612  -12.362 1.00 0.00 ? 741 SER A CA   1 
ATOM   425  C C    . SER A 1 27  ? -0.012  -5.125  -12.253 1.00 0.00 ? 741 SER A C    1 
ATOM   426  O O    . SER A 1 27  ? -0.692  -5.310  -13.243 1.00 0.00 ? 741 SER A O    1 
ATOM   427  C CB   . SER A 1 27  ? 2.405   -5.781  -12.476 1.00 0.00 ? 741 SER A CB   1 
ATOM   428  O OG   . SER A 1 27  ? 2.429   -6.250  -13.816 1.00 0.00 ? 741 SER A OG   1 
ATOM   429  H H    . SER A 1 27  ? 2.503   -4.290  -10.529 1.00 0.00 ? 741 SER A H    1 
ATOM   430  H HA   . SER A 1 27  ? 1.529   -3.947  -13.205 1.00 0.00 ? 741 SER A HA   1 
ATOM   431  H HB2  . SER A 1 27  ? 3.394   -5.450  -12.193 1.00 0.00 ? 741 SER A HB2  1 
ATOM   432  H HB3  . SER A 1 27  ? 2.091   -6.580  -11.821 1.00 0.00 ? 741 SER A HB3  1 
ATOM   433  H HG   . SER A 1 27  ? 2.149   -7.168  -13.814 1.00 0.00 ? 741 SER A HG   1 
ATOM   434  N N    . HIS A 1 28  ? -0.483  -5.348  -11.055 1.00 0.00 ? 742 HIS A N    1 
ATOM   435  C CA   . HIS A 1 28  ? -1.875  -5.849  -10.882 1.00 0.00 ? 742 HIS A CA   1 
ATOM   436  C C    . HIS A 1 28  ? -2.863  -4.955  -11.640 1.00 0.00 ? 742 HIS A C    1 
ATOM   437  O O    . HIS A 1 28  ? -2.497  -3.936  -12.190 1.00 0.00 ? 742 HIS A O    1 
ATOM   438  C CB   . HIS A 1 28  ? -2.128  -5.794  -9.372  1.00 0.00 ? 742 HIS A CB   1 
ATOM   439  C CG   . HIS A 1 28  ? -3.254  -6.728  -9.023  1.00 0.00 ? 742 HIS A CG   1 
ATOM   440  N ND1  . HIS A 1 28  ? -4.416  -6.290  -8.407  1.00 0.00 ? 742 HIS A ND1  1 
ATOM   441  C CD2  . HIS A 1 28  ? -3.410  -8.081  -9.199  1.00 0.00 ? 742 HIS A CD2  1 
ATOM   442  C CE1  . HIS A 1 28  ? -5.212  -7.362  -8.236  1.00 0.00 ? 742 HIS A CE1  1 
ATOM   443  N NE2  . HIS A 1 28  ? -4.646  -8.479  -8.702  1.00 0.00 ? 742 HIS A NE2  1 
ATOM   444  H H    . HIS A 1 28  ? 0.084   -5.195  -10.270 1.00 0.00 ? 742 HIS A H    1 
ATOM   445  H HA   . HIS A 1 28  ? -1.950  -6.867  -11.234 1.00 0.00 ? 742 HIS A HA   1 
ATOM   446  H HB2  . HIS A 1 28  ? -1.234  -6.099  -8.848  1.00 0.00 ? 742 HIS A HB2  1 
ATOM   447  H HB3  . HIS A 1 28  ? -2.388  -4.787  -9.079  1.00 0.00 ? 742 HIS A HB3  1 
ATOM   448  H HD1  . HIS A 1 28  ? -4.620  -5.369  -8.144  1.00 0.00 ? 742 HIS A HD1  1 
ATOM   449  H HD2  . HIS A 1 28  ? -2.683  -8.736  -9.655  1.00 0.00 ? 742 HIS A HD2  1 
ATOM   450  H HE1  . HIS A 1 28  ? -6.188  -7.324  -7.777  1.00 0.00 ? 742 HIS A HE1  1 
ATOM   451  N N    . GLN A 1 29  ? -4.108  -5.345  -11.696 1.00 0.00 ? 743 GLN A N    1 
ATOM   452  C CA   . GLN A 1 29  ? -5.114  -4.542  -12.452 1.00 0.00 ? 743 GLN A CA   1 
ATOM   453  C C    . GLN A 1 29  ? -5.749  -3.470  -11.557 1.00 0.00 ? 743 GLN A C    1 
ATOM   454  O O    . GLN A 1 29  ? -6.350  -2.530  -12.036 1.00 0.00 ? 743 GLN A O    1 
ATOM   455  C CB   . GLN A 1 29  ? -6.149  -5.563  -12.909 1.00 0.00 ? 743 GLN A CB   1 
ATOM   456  C CG   . GLN A 1 29  ? -7.414  -4.863  -13.426 1.00 0.00 ? 743 GLN A CG   1 
ATOM   457  C CD   . GLN A 1 29  ? -8.537  -5.015  -12.396 1.00 0.00 ? 743 GLN A CD   1 
ATOM   458  O OE1  . GLN A 1 29  ? -9.065  -6.094  -12.214 1.00 0.00 ? 743 GLN A OE1  1 
ATOM   459  N NE2  . GLN A 1 29  ? -8.928  -3.974  -11.708 1.00 0.00 ? 743 GLN A NE2  1 
ATOM   460  H H    . GLN A 1 29  ? -4.379  -6.180  -11.260 1.00 0.00 ? 743 GLN A H    1 
ATOM   461  H HA   . GLN A 1 29  ? -4.662  -4.096  -13.305 1.00 0.00 ? 743 GLN A HA   1 
ATOM   462  H HB2  . GLN A 1 29  ? -5.729  -6.171  -13.697 1.00 0.00 ? 743 GLN A HB2  1 
ATOM   463  H HB3  . GLN A 1 29  ? -6.398  -6.183  -12.081 1.00 0.00 ? 743 GLN A HB3  1 
ATOM   464  H HG2  . GLN A 1 29  ? -7.207  -3.815  -13.583 1.00 0.00 ? 743 GLN A HG2  1 
ATOM   465  H HG3  . GLN A 1 29  ? -7.718  -5.313  -14.359 1.00 0.00 ? 743 GLN A HG3  1 
ATOM   466  H HE21 . GLN A 1 29  ? -8.504  -3.102  -11.851 1.00 0.00 ? 743 GLN A HE21 1 
ATOM   467  H HE22 . GLN A 1 29  ? -9.646  -4.066  -11.048 1.00 0.00 ? 743 GLN A HE22 1 
ATOM   468  N N    . SER A 1 30  ? -5.644  -3.610  -10.266 1.00 0.00 ? 744 SER A N    1 
ATOM   469  C CA   . SER A 1 30  ? -6.270  -2.604  -9.364  1.00 0.00 ? 744 SER A CA   1 
ATOM   470  C C    . SER A 1 30  ? -5.213  -1.669  -8.778  1.00 0.00 ? 744 SER A C    1 
ATOM   471  O O    . SER A 1 30  ? -5.310  -1.243  -7.645  1.00 0.00 ? 744 SER A O    1 
ATOM   472  C CB   . SER A 1 30  ? -6.923  -3.431  -8.257  1.00 0.00 ? 744 SER A CB   1 
ATOM   473  O OG   . SER A 1 30  ? -7.909  -4.280  -8.824  1.00 0.00 ? 744 SER A OG   1 
ATOM   474  H H    . SER A 1 30  ? -5.168  -4.380  -9.891  1.00 0.00 ? 744 SER A H    1 
ATOM   475  H HA   . SER A 1 30  ? -7.018  -2.036  -9.897  1.00 0.00 ? 744 SER A HA   1 
ATOM   476  H HB2  . SER A 1 30  ? -6.172  -4.030  -7.763  1.00 0.00 ? 744 SER A HB2  1 
ATOM   477  H HB3  . SER A 1 30  ? -7.386  -2.770  -7.540  1.00 0.00 ? 744 SER A HB3  1 
ATOM   478  H HG   . SER A 1 30  ? -7.498  -4.777  -9.536  1.00 0.00 ? 744 SER A HG   1 
ATOM   479  N N    . ALA A 1 31  ? -4.213  -1.328  -9.544  1.00 0.00 ? 745 ALA A N    1 
ATOM   480  C CA   . ALA A 1 31  ? -3.152  -0.426  -9.016  1.00 0.00 ? 745 ALA A CA   1 
ATOM   481  C C    . ALA A 1 31  ? -3.072  0.870   -9.829  1.00 0.00 ? 745 ALA A C    1 
ATOM   482  O O    . ALA A 1 31  ? -2.407  1.806   -9.438  1.00 0.00 ? 745 ALA A O    1 
ATOM   483  C CB   . ALA A 1 31  ? -1.856  -1.224  -9.164  1.00 0.00 ? 745 ALA A CB   1 
ATOM   484  H H    . ALA A 1 31  ? -4.149  -1.683  -10.455 1.00 0.00 ? 745 ALA A H    1 
ATOM   485  H HA   . ALA A 1 31  ? -3.335  -0.204  -7.975  1.00 0.00 ? 745 ALA A HA   1 
ATOM   486  H HB1  . ALA A 1 31  ? -1.059  -0.563  -9.474  1.00 0.00 ? 745 ALA A HB1  1 
ATOM   487  H HB2  . ALA A 1 31  ? -1.991  -1.997  -9.906  1.00 0.00 ? 745 ALA A HB2  1 
ATOM   488  H HB3  . ALA A 1 31  ? -1.601  -1.675  -8.216  1.00 0.00 ? 745 ALA A HB3  1 
ATOM   489  N N    . TRP A 1 32  ? -3.756  0.946   -10.942 1.00 0.00 ? 746 TRP A N    1 
ATOM   490  C CA   . TRP A 1 32  ? -3.693  2.188   -11.770 1.00 0.00 ? 746 TRP A CA   1 
ATOM   491  C C    . TRP A 1 32  ? -4.234  3.444   -11.040 1.00 0.00 ? 746 TRP A C    1 
ATOM   492  O O    . TRP A 1 32  ? -3.831  4.537   -11.382 1.00 0.00 ? 746 TRP A O    1 
ATOM   493  C CB   . TRP A 1 32  ? -4.519  1.893   -13.031 1.00 0.00 ? 746 TRP A CB   1 
ATOM   494  C CG   . TRP A 1 32  ? -5.918  1.517   -12.670 1.00 0.00 ? 746 TRP A CG   1 
ATOM   495  C CD1  . TRP A 1 32  ? -6.411  0.259   -12.695 1.00 0.00 ? 746 TRP A CD1  1 
ATOM   496  C CD2  . TRP A 1 32  ? -7.016  2.378   -12.246 1.00 0.00 ? 746 TRP A CD2  1 
ATOM   497  N NE1  . TRP A 1 32  ? -7.738  0.289   -12.307 1.00 0.00 ? 746 TRP A NE1  1 
ATOM   498  C CE2  . TRP A 1 32  ? -8.158  1.573   -12.020 1.00 0.00 ? 746 TRP A CE2  1 
ATOM   499  C CE3  . TRP A 1 32  ? -7.130  3.764   -12.033 1.00 0.00 ? 746 TRP A CE3  1 
ATOM   500  C CZ2  . TRP A 1 32  ? -9.369  2.122   -11.599 1.00 0.00 ? 746 TRP A CZ2  1 
ATOM   501  C CZ3  . TRP A 1 32  ? -8.349  4.320   -11.610 1.00 0.00 ? 746 TRP A CZ3  1 
ATOM   502  C CH2  . TRP A 1 32  ? -9.466  3.500   -11.392 1.00 0.00 ? 746 TRP A CH2  1 
ATOM   503  H H    . TRP A 1 32  ? -4.285  0.180   -11.247 1.00 0.00 ? 746 TRP A H    1 
ATOM   504  H HA   . TRP A 1 32  ? -2.668  2.365   -12.058 1.00 0.00 ? 746 TRP A HA   1 
ATOM   505  H HB2  . TRP A 1 32  ? -4.538  2.773   -13.658 1.00 0.00 ? 746 TRP A HB2  1 
ATOM   506  H HB3  . TRP A 1 32  ? -4.061  1.080   -13.574 1.00 0.00 ? 746 TRP A HB3  1 
ATOM   507  H HD1  . TRP A 1 32  ? -5.857  -0.626  -12.971 1.00 0.00 ? 746 TRP A HD1  1 
ATOM   508  H HE1  . TRP A 1 32  ? -8.325  -0.493  -12.239 1.00 0.00 ? 746 TRP A HE1  1 
ATOM   509  H HE3  . TRP A 1 32  ? -6.276  4.405   -12.197 1.00 0.00 ? 746 TRP A HE3  1 
ATOM   510  H HZ2  . TRP A 1 32  ? -10.226 1.485   -11.433 1.00 0.00 ? 746 TRP A HZ2  1 
ATOM   511  H HZ3  . TRP A 1 32  ? -8.426  5.386   -11.449 1.00 0.00 ? 746 TRP A HZ3  1 
ATOM   512  H HH2  . TRP A 1 32  ? -10.400 3.934   -11.066 1.00 0.00 ? 746 TRP A HH2  1 
ATOM   513  N N    . PRO A 1 33  ? -5.130  3.296   -10.076 1.00 0.00 ? 747 PRO A N    1 
ATOM   514  C CA   . PRO A 1 33  ? -5.643  4.489   -9.369  1.00 0.00 ? 747 PRO A CA   1 
ATOM   515  C C    . PRO A 1 33  ? -4.678  4.924   -8.264  1.00 0.00 ? 747 PRO A C    1 
ATOM   516  O O    . PRO A 1 33  ? -4.861  5.954   -7.645  1.00 0.00 ? 747 PRO A O    1 
ATOM   517  C CB   . PRO A 1 33  ? -6.961  4.020   -8.747  1.00 0.00 ? 747 PRO A CB   1 
ATOM   518  C CG   . PRO A 1 33  ? -7.023  2.530   -8.931  1.00 0.00 ? 747 PRO A CG   1 
ATOM   519  C CD   . PRO A 1 33  ? -5.719  2.072   -9.523  1.00 0.00 ? 747 PRO A CD   1 
ATOM   520  H HA   . PRO A 1 33  ? -5.819  5.303   -10.063 1.00 0.00 ? 747 PRO A HA   1 
ATOM   521  H HB2  . PRO A 1 33  ? -6.981  4.263   -7.695  1.00 0.00 ? 747 PRO A HB2  1 
ATOM   522  H HB3  . PRO A 1 33  ? -7.791  4.487   -9.248  1.00 0.00 ? 747 PRO A HB3  1 
ATOM   523  H HG2  . PRO A 1 33  ? -7.174  2.053   -7.975  1.00 0.00 ? 747 PRO A HG2  1 
ATOM   524  H HG3  . PRO A 1 33  ? -7.835  2.278   -9.597  1.00 0.00 ? 747 PRO A HG3  1 
ATOM   525  H HD2  . PRO A 1 33  ? -5.083  1.662   -8.753  1.00 0.00 ? 747 PRO A HD2  1 
ATOM   526  H HD3  . PRO A 1 33  ? -5.894  1.343   -10.295 1.00 0.00 ? 747 PRO A HD3  1 
ATOM   527  N N    . PHE A 1 34  ? -3.664  4.147   -7.993  1.00 0.00 ? 748 PHE A N    1 
ATOM   528  C CA   . PHE A 1 34  ? -2.728  4.521   -6.898  1.00 0.00 ? 748 PHE A CA   1 
ATOM   529  C C    . PHE A 1 34  ? -1.345  4.878   -7.451  1.00 0.00 ? 748 PHE A C    1 
ATOM   530  O O    . PHE A 1 34  ? -0.516  5.424   -6.750  1.00 0.00 ? 748 PHE A O    1 
ATOM   531  C CB   . PHE A 1 34  ? -2.637  3.273   -6.010  1.00 0.00 ? 748 PHE A CB   1 
ATOM   532  C CG   . PHE A 1 34  ? -4.023  2.833   -5.592  1.00 0.00 ? 748 PHE A CG   1 
ATOM   533  C CD1  . PHE A 1 34  ? -4.976  3.784   -5.206  1.00 0.00 ? 748 PHE A CD1  1 
ATOM   534  C CD2  . PHE A 1 34  ? -4.352  1.472   -5.589  1.00 0.00 ? 748 PHE A CD2  1 
ATOM   535  C CE1  . PHE A 1 34  ? -6.258  3.374   -4.821  1.00 0.00 ? 748 PHE A CE1  1 
ATOM   536  C CE2  . PHE A 1 34  ? -5.633  1.062   -5.203  1.00 0.00 ? 748 PHE A CE2  1 
ATOM   537  C CZ   . PHE A 1 34  ? -6.587  2.013   -4.819  1.00 0.00 ? 748 PHE A CZ   1 
ATOM   538  H H    . PHE A 1 34  ? -3.535  3.310   -8.484  1.00 0.00 ? 748 PHE A H    1 
ATOM   539  H HA   . PHE A 1 34  ? -3.132  5.349   -6.336  1.00 0.00 ? 748 PHE A HA   1 
ATOM   540  H HB2  . PHE A 1 34  ? -2.158  2.476   -6.560  1.00 0.00 ? 748 PHE A HB2  1 
ATOM   541  H HB3  . PHE A 1 34  ? -2.053  3.502   -5.131  1.00 0.00 ? 748 PHE A HB3  1 
ATOM   542  H HD1  . PHE A 1 34  ? -4.724  4.834   -5.209  1.00 0.00 ? 748 PHE A HD1  1 
ATOM   543  H HD2  . PHE A 1 34  ? -3.617  0.739   -5.885  1.00 0.00 ? 748 PHE A HD2  1 
ATOM   544  H HE1  . PHE A 1 34  ? -6.993  4.107   -4.526  1.00 0.00 ? 748 PHE A HE1  1 
ATOM   545  H HE2  . PHE A 1 34  ? -5.887  0.012   -5.201  1.00 0.00 ? 748 PHE A HE2  1 
ATOM   546  H HZ   . PHE A 1 34  ? -7.575  1.697   -4.521  1.00 0.00 ? 748 PHE A HZ   1 
ATOM   547  N N    . MET A 1 35  ? -1.077  4.571   -8.693  1.00 0.00 ? 749 MET A N    1 
ATOM   548  C CA   . MET A 1 35  ? 0.265   4.904   -9.256  1.00 0.00 ? 749 MET A CA   1 
ATOM   549  C C    . MET A 1 35  ? 0.539   6.396   -9.099  1.00 0.00 ? 749 MET A C    1 
ATOM   550  O O    . MET A 1 35  ? 1.436   6.804   -8.389  1.00 0.00 ? 749 MET A O    1 
ATOM   551  C CB   . MET A 1 35  ? 0.211   4.544   -10.748 1.00 0.00 ? 749 MET A CB   1 
ATOM   552  C CG   . MET A 1 35  ? -0.319  3.114   -10.971 1.00 0.00 ? 749 MET A CG   1 
ATOM   553  S SD   . MET A 1 35  ? 0.471   1.930   -9.840  1.00 0.00 ? 749 MET A SD   1 
ATOM   554  C CE   . MET A 1 35  ? 2.183   2.269   -10.311 1.00 0.00 ? 749 MET A CE   1 
ATOM   555  H H    . MET A 1 35  ? -1.753  4.133   -9.249  1.00 0.00 ? 749 MET A H    1 
ATOM   556  H HA   . MET A 1 35  ? 1.032   4.328   -8.759  1.00 0.00 ? 749 MET A HA   1 
ATOM   557  H HB2  . MET A 1 35  ? -0.440  5.240   -11.255 1.00 0.00 ? 749 MET A HB2  1 
ATOM   558  H HB3  . MET A 1 35  ? 1.203   4.627   -11.165 1.00 0.00 ? 749 MET A HB3  1 
ATOM   559  H HG2  . MET A 1 35  ? -1.383  3.103   -10.815 1.00 0.00 ? 749 MET A HG2  1 
ATOM   560  H HG3  . MET A 1 35  ? -0.110  2.818   -11.989 1.00 0.00 ? 749 MET A HG3  1 
ATOM   561  H HE1  . MET A 1 35  ? 2.846   1.660   -9.715  1.00 0.00 ? 749 MET A HE1  1 
ATOM   562  H HE2  . MET A 1 35  ? 2.404   3.313   -10.144 1.00 0.00 ? 749 MET A HE2  1 
ATOM   563  H HE3  . MET A 1 35  ? 2.322   2.035   -11.356 1.00 0.00 ? 749 MET A HE3  1 
ATOM   564  N N    . GLU A 1 36  ? -0.223  7.215   -9.770  1.00 0.00 ? 750 GLU A N    1 
ATOM   565  C CA   . GLU A 1 36  ? -0.010  8.680   -9.661  1.00 0.00 ? 750 GLU A CA   1 
ATOM   566  C C    . GLU A 1 36  ? -0.826  9.241   -8.487  1.00 0.00 ? 750 GLU A C    1 
ATOM   567  O O    . GLU A 1 36  ? -2.002  8.961   -8.371  1.00 0.00 ? 750 GLU A O    1 
ATOM   568  C CB   . GLU A 1 36  ? -0.517  9.247   -10.989 1.00 0.00 ? 750 GLU A CB   1 
ATOM   569  C CG   . GLU A 1 36  ? -0.489  10.776  -10.936 1.00 0.00 ? 750 GLU A CG   1 
ATOM   570  C CD   . GLU A 1 36  ? -0.381  11.335  -12.356 1.00 0.00 ? 750 GLU A CD   1 
ATOM   571  O OE1  . GLU A 1 36  ? 0.403   10.803  -13.125 1.00 0.00 ? 750 GLU A OE1  1 
ATOM   572  O OE2  . GLU A 1 36  ? -1.084  12.289  -12.651 1.00 0.00 ? 750 GLU A OE2  1 
ATOM   573  H H    . GLU A 1 36  ? -0.942  6.865   -10.335 1.00 0.00 ? 750 GLU A H    1 
ATOM   574  H HA   . GLU A 1 36  ? 1.038   8.894   -9.540  1.00 0.00 ? 750 GLU A HA   1 
ATOM   575  H HB2  . GLU A 1 36  ? 0.116   8.903   -11.793 1.00 0.00 ? 750 GLU A HB2  1 
ATOM   576  H HB3  . GLU A 1 36  ? -1.530  8.912   -11.160 1.00 0.00 ? 750 GLU A HB3  1 
ATOM   577  H HG2  . GLU A 1 36  ? -1.397  11.133  -10.475 1.00 0.00 ? 750 GLU A HG2  1 
ATOM   578  H HG3  . GLU A 1 36  ? 0.362   11.100  -10.356 1.00 0.00 ? 750 GLU A HG3  1 
ATOM   579  N N    . PRO A 1 37  ? -0.180  10.015  -7.646  1.00 0.00 ? 751 PRO A N    1 
ATOM   580  C CA   . PRO A 1 37  ? -0.885  10.602  -6.481  1.00 0.00 ? 751 PRO A CA   1 
ATOM   581  C C    . PRO A 1 37  ? -1.980  11.562  -6.949  1.00 0.00 ? 751 PRO A C    1 
ATOM   582  O O    . PRO A 1 37  ? -1.734  12.477  -7.710  1.00 0.00 ? 751 PRO A O    1 
ATOM   583  C CB   . PRO A 1 37  ? 0.209   11.362  -5.727  1.00 0.00 ? 751 PRO A CB   1 
ATOM   584  C CG   . PRO A 1 37  ? 1.323   11.543  -6.709  1.00 0.00 ? 751 PRO A CG   1 
ATOM   585  C CD   . PRO A 1 37  ? 1.232   10.414  -7.697  1.00 0.00 ? 751 PRO A CD   1 
ATOM   586  H HA   . PRO A 1 37  ? -1.302  9.824   -5.860  1.00 0.00 ? 751 PRO A HA   1 
ATOM   587  H HB2  . PRO A 1 37  ? -0.161  12.323  -5.402  1.00 0.00 ? 751 PRO A HB2  1 
ATOM   588  H HB3  . PRO A 1 37  ? 0.548   10.785  -4.880  1.00 0.00 ? 751 PRO A HB3  1 
ATOM   589  H HG2  . PRO A 1 37  ? 1.215   12.489  -7.220  1.00 0.00 ? 751 PRO A HG2  1 
ATOM   590  H HG3  . PRO A 1 37  ? 2.274   11.508  -6.197  1.00 0.00 ? 751 PRO A HG3  1 
ATOM   591  H HD2  . PRO A 1 37  ? 1.494   10.756  -8.688  1.00 0.00 ? 751 PRO A HD2  1 
ATOM   592  H HD3  . PRO A 1 37  ? 1.869   9.595   -7.397  1.00 0.00 ? 751 PRO A HD3  1 
ATOM   593  N N    . VAL A 1 38  ? -3.190  11.363  -6.499  1.00 0.00 ? 752 VAL A N    1 
ATOM   594  C CA   . VAL A 1 38  ? -4.300  12.268  -6.917  1.00 0.00 ? 752 VAL A CA   1 
ATOM   595  C C    . VAL A 1 38  ? -3.914  13.728  -6.670  1.00 0.00 ? 752 VAL A C    1 
ATOM   596  O O    . VAL A 1 38  ? -3.108  14.029  -5.813  1.00 0.00 ? 752 VAL A O    1 
ATOM   597  C CB   . VAL A 1 38  ? -5.482  11.871  -6.031  1.00 0.00 ? 752 VAL A CB   1 
ATOM   598  C CG1  . VAL A 1 38  ? -6.663  12.804  -6.307  1.00 0.00 ? 752 VAL A CG1  1 
ATOM   599  C CG2  . VAL A 1 38  ? -5.887  10.428  -6.339  1.00 0.00 ? 752 VAL A CG2  1 
ATOM   600  H H    . VAL A 1 38  ? -3.369  10.621  -5.885  1.00 0.00 ? 752 VAL A H    1 
ATOM   601  H HA   . VAL A 1 38  ? -4.540  12.112  -7.958  1.00 0.00 ? 752 VAL A HA   1 
ATOM   602  H HB   . VAL A 1 38  ? -5.196  11.950  -4.993  1.00 0.00 ? 752 VAL A HB   1 
ATOM   603  H HG11 . VAL A 1 38  ? -6.508  13.313  -7.246  1.00 0.00 ? 752 VAL A HG11 1 
ATOM   604  H HG12 . VAL A 1 38  ? -6.741  13.531  -5.512  1.00 0.00 ? 752 VAL A HG12 1 
ATOM   605  H HG13 . VAL A 1 38  ? -7.575  12.226  -6.356  1.00 0.00 ? 752 VAL A HG13 1 
ATOM   606  H HG21 . VAL A 1 38  ? -5.014  9.864   -6.632  1.00 0.00 ? 752 VAL A HG21 1 
ATOM   607  H HG22 . VAL A 1 38  ? -6.607  10.421  -7.145  1.00 0.00 ? 752 VAL A HG22 1 
ATOM   608  H HG23 . VAL A 1 38  ? -6.327  9.981   -5.460  1.00 0.00 ? 752 VAL A HG23 1 
ATOM   609  N N    . LYS A 1 39  ? -4.474  14.637  -7.420  1.00 0.00 ? 753 LYS A N    1 
ATOM   610  C CA   . LYS A 1 39  ? -4.130  16.072  -7.224  1.00 0.00 ? 753 LYS A CA   1 
ATOM   611  C C    . LYS A 1 39  ? -4.705  16.580  -5.900  1.00 0.00 ? 753 LYS A C    1 
ATOM   612  O O    . LYS A 1 39  ? -5.405  15.871  -5.205  1.00 0.00 ? 753 LYS A O    1 
ATOM   613  C CB   . LYS A 1 39  ? -4.776  16.794  -8.403  1.00 0.00 ? 753 LYS A CB   1 
ATOM   614  C CG   . LYS A 1 39  ? -3.712  17.591  -9.158  1.00 0.00 ? 753 LYS A CG   1 
ATOM   615  C CD   . LYS A 1 39  ? -4.253  18.984  -9.478  1.00 0.00 ? 753 LYS A CD   1 
ATOM   616  C CE   . LYS A 1 39  ? -3.316  20.043  -8.898  1.00 0.00 ? 753 LYS A CE   1 
ATOM   617  N NZ   . LYS A 1 39  ? -4.059  20.615  -7.740  1.00 0.00 ? 753 LYS A NZ   1 
ATOM   618  H H    . LYS A 1 39  ? -5.124  14.377  -8.109  1.00 0.00 ? 753 LYS A H    1 
ATOM   619  H HA   . LYS A 1 39  ? -3.059  16.208  -7.245  1.00 0.00 ? 753 LYS A HA   1 
ATOM   620  H HB2  . LYS A 1 39  ? -5.222  16.070  -9.067  1.00 0.00 ? 753 LYS A HB2  1 
ATOM   621  H HB3  . LYS A 1 39  ? -5.537  17.466  -8.039  1.00 0.00 ? 753 LYS A HB3  1 
ATOM   622  H HG2  . LYS A 1 39  ? -2.826  17.680  -8.545  1.00 0.00 ? 753 LYS A HG2  1 
ATOM   623  H HG3  . LYS A 1 39  ? -3.464  17.080  -10.077 1.00 0.00 ? 753 LYS A HG3  1 
ATOM   624  H HD2  . LYS A 1 39  ? -4.317  19.108  -10.549 1.00 0.00 ? 753 LYS A HD2  1 
ATOM   625  H HD3  . LYS A 1 39  ? -5.234  19.096  -9.043  1.00 0.00 ? 753 LYS A HD3  1 
ATOM   626  H HE2  . LYS A 1 39  ? -2.394  19.589  -8.566  1.00 0.00 ? 753 LYS A HE2  1 
ATOM   627  H HE3  . LYS A 1 39  ? -3.117  20.809  -9.631  1.00 0.00 ? 753 LYS A HE3  1 
ATOM   628  H HZ1  . LYS A 1 39  ? -4.808  21.247  -8.087  1.00 0.00 ? 753 LYS A HZ1  1 
ATOM   629  H HZ2  . LYS A 1 39  ? -3.402  21.154  -7.139  1.00 0.00 ? 753 LYS A HZ2  1 
ATOM   630  H HZ3  . LYS A 1 39  ? -4.483  19.845  -7.185  1.00 0.00 ? 753 LYS A HZ3  1 
ATOM   631  N N    . ARG A 1 40  ? -4.411  17.800  -5.542  1.00 0.00 ? 754 ARG A N    1 
ATOM   632  C CA   . ARG A 1 40  ? -4.928  18.343  -4.255  1.00 0.00 ? 754 ARG A CA   1 
ATOM   633  C C    . ARG A 1 40  ? -6.403  18.727  -4.380  1.00 0.00 ? 754 ARG A C    1 
ATOM   634  O O    . ARG A 1 40  ? -7.159  18.631  -3.434  1.00 0.00 ? 754 ARG A O    1 
ATOM   635  C CB   . ARG A 1 40  ? -4.079  19.586  -3.985  1.00 0.00 ? 754 ARG A CB   1 
ATOM   636  C CG   . ARG A 1 40  ? -2.786  19.175  -3.279  1.00 0.00 ? 754 ARG A CG   1 
ATOM   637  C CD   . ARG A 1 40  ? -1.748  20.289  -3.430  1.00 0.00 ? 754 ARG A CD   1 
ATOM   638  N NE   . ARG A 1 40  ? -1.629  20.889  -2.068  1.00 0.00 ? 754 ARG A NE   1 
ATOM   639  C CZ   . ARG A 1 40  ? -0.994  20.260  -1.106  1.00 0.00 ? 754 ARG A CZ   1 
ATOM   640  N NH1  . ARG A 1 40  ? -0.447  19.087  -1.312  1.00 0.00 ? 754 ARG A NH1  1 
ATOM   641  N NH2  . ARG A 1 40  ? -0.907  20.811  0.073   1.00 0.00 ? 754 ARG A NH2  1 
ATOM   642  H H    . ARG A 1 40  ? -3.837  18.353  -6.113  1.00 0.00 ? 754 ARG A H    1 
ATOM   643  H HA   . ARG A 1 40  ? -4.795  17.620  -3.464  1.00 0.00 ? 754 ARG A HA   1 
ATOM   644  H HB2  . ARG A 1 40  ? -3.841  20.070  -4.920  1.00 0.00 ? 754 ARG A HB2  1 
ATOM   645  H HB3  . ARG A 1 40  ? -4.631  20.269  -3.356  1.00 0.00 ? 754 ARG A HB3  1 
ATOM   646  H HG2  . ARG A 1 40  ? -2.985  19.009  -2.230  1.00 0.00 ? 754 ARG A HG2  1 
ATOM   647  H HG3  . ARG A 1 40  ? -2.407  18.266  -3.722  1.00 0.00 ? 754 ARG A HG3  1 
ATOM   648  H HD2  . ARG A 1 40  ? -0.799  19.878  -3.743  1.00 0.00 ? 754 ARG A HD2  1 
ATOM   649  H HD3  . ARG A 1 40  ? -2.091  21.028  -4.138  1.00 0.00 ? 754 ARG A HD3  1 
ATOM   650  H HE   . ARG A 1 40  ? -2.030  21.766  -1.890  1.00 0.00 ? 754 ARG A HE   1 
ATOM   651  H HH11 . ARG A 1 40  ? -0.506  18.652  -2.210  1.00 0.00 ? 754 ARG A HH11 1 
ATOM   652  H HH12 . ARG A 1 40  ? 0.032   18.624  -0.566  1.00 0.00 ? 754 ARG A HH12 1 
ATOM   653  H HH21 . ARG A 1 40  ? -1.321  21.706  0.239   1.00 0.00 ? 754 ARG A HH21 1 
ATOM   654  H HH22 . ARG A 1 40  ? -0.425  20.339  0.811   1.00 0.00 ? 754 ARG A HH22 1 
ATOM   655  N N    . THR A 1 41  ? -6.820  19.172  -5.533  1.00 0.00 ? 755 THR A N    1 
ATOM   656  C CA   . THR A 1 41  ? -8.245  19.571  -5.701  1.00 0.00 ? 755 THR A CA   1 
ATOM   657  C C    . THR A 1 41  ? -8.981  18.576  -6.601  1.00 0.00 ? 755 THR A C    1 
ATOM   658  O O    . THR A 1 41  ? -10.190 18.469  -6.562  1.00 0.00 ? 755 THR A O    1 
ATOM   659  C CB   . THR A 1 41  ? -8.190  20.950  -6.361  1.00 0.00 ? 755 THR A CB   1 
ATOM   660  O OG1  . THR A 1 41  ? -7.579  21.875  -5.474  1.00 0.00 ? 755 THR A OG1  1 
ATOM   661  C CG2  . THR A 1 41  ? -9.610  21.417  -6.686  1.00 0.00 ? 755 THR A CG2  1 
ATOM   662  H H    . THR A 1 41  ? -6.196  19.249  -6.285  1.00 0.00 ? 755 THR A H    1 
ATOM   663  H HA   . THR A 1 41  ? -8.731  19.635  -4.737  1.00 0.00 ? 755 THR A HA   1 
ATOM   664  H HB   . THR A 1 41  ? -7.613  20.890  -7.272  1.00 0.00 ? 755 THR A HB   1 
ATOM   665  H HG1  . THR A 1 41  ? -7.684  22.754  -5.845  1.00 0.00 ? 755 THR A HG1  1 
ATOM   666  H HG21 . THR A 1 41  ? -10.199 21.435  -5.781  1.00 0.00 ? 755 THR A HG21 1 
ATOM   667  H HG22 . THR A 1 41  ? -10.059 20.735  -7.394  1.00 0.00 ? 755 THR A HG22 1 
ATOM   668  H HG23 . THR A 1 41  ? -9.575  22.408  -7.113  1.00 0.00 ? 755 THR A HG23 1 
ATOM   669  N N    . GLU A 1 42  ? -8.264  17.840  -7.404  1.00 0.00 ? 756 GLU A N    1 
ATOM   670  C CA   . GLU A 1 42  ? -8.931  16.854  -8.302  1.00 0.00 ? 756 GLU A CA   1 
ATOM   671  C C    . GLU A 1 42  ? -9.861  15.941  -7.496  1.00 0.00 ? 756 GLU A C    1 
ATOM   672  O O    . GLU A 1 42  ? -10.782 15.355  -8.028  1.00 0.00 ? 756 GLU A O    1 
ATOM   673  C CB   . GLU A 1 42  ? -7.790  16.039  -8.919  1.00 0.00 ? 756 GLU A CB   1 
ATOM   674  C CG   . GLU A 1 42  ? -8.344  15.179  -10.057 1.00 0.00 ? 756 GLU A CG   1 
ATOM   675  C CD   . GLU A 1 42  ? -7.191  14.635  -10.905 1.00 0.00 ? 756 GLU A CD   1 
ATOM   676  O OE1  . GLU A 1 42  ? -6.118  15.213  -10.855 1.00 0.00 ? 756 GLU A OE1  1 
ATOM   677  O OE2  . GLU A 1 42  ? -7.404  13.653  -11.599 1.00 0.00 ? 756 GLU A OE2  1 
ATOM   678  H H    . GLU A 1 42  ? -7.290  17.942  -7.423  1.00 0.00 ? 756 GLU A H    1 
ATOM   679  H HA   . GLU A 1 42  ? -9.485  17.366  -9.074  1.00 0.00 ? 756 GLU A HA   1 
ATOM   680  H HB2  . GLU A 1 42  ? -7.037  16.707  -9.309  1.00 0.00 ? 756 GLU A HB2  1 
ATOM   681  H HB3  . GLU A 1 42  ? -7.353  15.404  -8.165  1.00 0.00 ? 756 GLU A HB3  1 
ATOM   682  H HG2  . GLU A 1 42  ? -8.907  14.358  -9.645  1.00 0.00 ? 756 GLU A HG2  1 
ATOM   683  H HG3  . GLU A 1 42  ? -8.989  15.781  -10.674 1.00 0.00 ? 756 GLU A HG3  1 
ATOM   684  N N    . ALA A 1 43  ? -9.635  15.823  -6.213  1.00 0.00 ? 757 ALA A N    1 
ATOM   685  C CA   . ALA A 1 43  ? -10.503 14.942  -5.381  1.00 0.00 ? 757 ALA A CA   1 
ATOM   686  C C    . ALA A 1 43  ? -11.583 15.760  -4.664  1.00 0.00 ? 757 ALA A C    1 
ATOM   687  O O    . ALA A 1 43  ? -11.450 16.959  -4.513  1.00 0.00 ? 757 ALA A O    1 
ATOM   688  C CB   . ALA A 1 43  ? -9.553  14.312  -4.363  1.00 0.00 ? 757 ALA A CB   1 
ATOM   689  H H    . ALA A 1 43  ? -8.884  16.296  -5.802  1.00 0.00 ? 757 ALA A H    1 
ATOM   690  H HA   . ALA A 1 43  ? -10.957 14.179  -5.991  1.00 0.00 ? 757 ALA A HA   1 
ATOM   691  H HB1  . ALA A 1 43  ? -9.986  13.399  -3.981  1.00 0.00 ? 757 ALA A HB1  1 
ATOM   692  H HB2  . ALA A 1 43  ? -9.392  15.002  -3.548  1.00 0.00 ? 757 ALA A HB2  1 
ATOM   693  H HB3  . ALA A 1 43  ? -8.609  14.091  -4.840  1.00 0.00 ? 757 ALA A HB3  1 
ATOM   694  N N    . PRO A 1 44  ? -12.623 15.082  -4.235  1.00 0.00 ? 758 PRO A N    1 
ATOM   695  C CA   . PRO A 1 44  ? -13.730 15.769  -3.525  1.00 0.00 ? 758 PRO A CA   1 
ATOM   696  C C    . PRO A 1 44  ? -13.255 16.294  -2.168  1.00 0.00 ? 758 PRO A C    1 
ATOM   697  O O    . PRO A 1 44  ? -13.846 17.188  -1.595  1.00 0.00 ? 758 PRO A O    1 
ATOM   698  C CB   . PRO A 1 44  ? -14.783 14.674  -3.337  1.00 0.00 ? 758 PRO A CB   1 
ATOM   699  C CG   . PRO A 1 44  ? -14.039 13.382  -3.467  1.00 0.00 ? 758 PRO A CG   1 
ATOM   700  C CD   . PRO A 1 44  ? -12.866 13.638  -4.373  1.00 0.00 ? 758 PRO A CD   1 
ATOM   701  H HA   . PRO A 1 44  ? -14.124 16.574  -4.127  1.00 0.00 ? 758 PRO A HA   1 
ATOM   702  H HB2  . PRO A 1 44  ? -15.230 14.750  -2.357  1.00 0.00 ? 758 PRO A HB2  1 
ATOM   703  H HB3  . PRO A 1 44  ? -15.541 14.748  -4.102  1.00 0.00 ? 758 PRO A HB3  1 
ATOM   704  H HG2  . PRO A 1 44  ? -13.692 13.057  -2.498  1.00 0.00 ? 758 PRO A HG2  1 
ATOM   705  H HG3  . PRO A 1 44  ? -14.682 12.628  -3.900  1.00 0.00 ? 758 PRO A HG3  1 
ATOM   706  H HD2  . PRO A 1 44  ? -12.004 13.076  -4.045  1.00 0.00 ? 758 PRO A HD2  1 
ATOM   707  H HD3  . PRO A 1 44  ? -13.115 13.391  -5.395  1.00 0.00 ? 758 PRO A HD3  1 
ATOM   708  N N    . GLY A 1 45  ? -12.192 15.743  -1.648  1.00 0.00 ? 759 GLY A N    1 
ATOM   709  C CA   . GLY A 1 45  ? -11.680 16.207  -0.328  1.00 0.00 ? 759 GLY A CA   1 
ATOM   710  C C    . GLY A 1 45  ? -10.530 15.300  0.113   1.00 0.00 ? 759 GLY A C    1 
ATOM   711  O O    . GLY A 1 45  ? -10.686 14.458  0.975   1.00 0.00 ? 759 GLY A O    1 
ATOM   712  H H    . GLY A 1 45  ? -11.731 15.022  -2.126  1.00 0.00 ? 759 GLY A H    1 
ATOM   713  H HA2  . GLY A 1 45  ? -11.325 17.223  -0.415  1.00 0.00 ? 759 GLY A HA2  1 
ATOM   714  H HA3  . GLY A 1 45  ? -12.474 16.163  0.403   1.00 0.00 ? 759 GLY A HA3  1 
ATOM   715  N N    . TYR A 1 46  ? -9.377  15.460  -0.477  1.00 0.00 ? 760 TYR A N    1 
ATOM   716  C CA   . TYR A 1 46  ? -8.220  14.601  -0.098  1.00 0.00 ? 760 TYR A CA   1 
ATOM   717  C C    . TYR A 1 46  ? -7.388  15.275  0.996   1.00 0.00 ? 760 TYR A C    1 
ATOM   718  O O    . TYR A 1 46  ? -6.634  14.632  1.700   1.00 0.00 ? 760 TYR A O    1 
ATOM   719  C CB   . TYR A 1 46  ? -7.397  14.472  -1.381  1.00 0.00 ? 760 TYR A CB   1 
ATOM   720  C CG   . TYR A 1 46  ? -6.677  13.144  -1.393  1.00 0.00 ? 760 TYR A CG   1 
ATOM   721  C CD1  . TYR A 1 46  ? -7.383  11.961  -1.142  1.00 0.00 ? 760 TYR A CD1  1 
ATOM   722  C CD2  . TYR A 1 46  ? -5.304  13.096  -1.665  1.00 0.00 ? 760 TYR A CD2  1 
ATOM   723  C CE1  . TYR A 1 46  ? -6.715  10.730  -1.158  1.00 0.00 ? 760 TYR A CE1  1 
ATOM   724  C CE2  . TYR A 1 46  ? -4.637  11.865  -1.682  1.00 0.00 ? 760 TYR A CE2  1 
ATOM   725  C CZ   . TYR A 1 46  ? -5.342  10.683  -1.428  1.00 0.00 ? 760 TYR A CZ   1 
ATOM   726  O OH   . TYR A 1 46  ? -4.683  9.470   -1.445  1.00 0.00 ? 760 TYR A OH   1 
ATOM   727  H H    . TYR A 1 46  ? -9.274  16.143  -1.174  1.00 0.00 ? 760 TYR A H    1 
ATOM   728  H HA   . TYR A 1 46  ? -8.564  13.629  0.229   1.00 0.00 ? 760 TYR A HA   1 
ATOM   729  H HB2  . TYR A 1 46  ? -8.052  14.533  -2.235  1.00 0.00 ? 760 TYR A HB2  1 
ATOM   730  H HB3  . TYR A 1 46  ? -6.674  15.273  -1.425  1.00 0.00 ? 760 TYR A HB3  1 
ATOM   731  H HD1  . TYR A 1 46  ? -8.442  11.997  -0.934  1.00 0.00 ? 760 TYR A HD1  1 
ATOM   732  H HD2  . TYR A 1 46  ? -4.760  14.008  -1.861  1.00 0.00 ? 760 TYR A HD2  1 
ATOM   733  H HE1  . TYR A 1 46  ? -7.258  9.818   -0.963  1.00 0.00 ? 760 TYR A HE1  1 
ATOM   734  H HE2  . TYR A 1 46  ? -3.577  11.828  -1.889  1.00 0.00 ? 760 TYR A HE2  1 
ATOM   735  H HH   . TYR A 1 46  ? -4.873  9.041   -2.283  1.00 0.00 ? 760 TYR A HH   1 
ATOM   736  N N    . TYR A 1 47  ? -7.513  16.567  1.141   1.00 0.00 ? 761 TYR A N    1 
ATOM   737  C CA   . TYR A 1 47  ? -6.719  17.282  2.181   1.00 0.00 ? 761 TYR A CA   1 
ATOM   738  C C    . TYR A 1 47  ? -7.419  17.224  3.545   1.00 0.00 ? 761 TYR A C    1 
ATOM   739  O O    . TYR A 1 47  ? -7.030  17.899  4.478   1.00 0.00 ? 761 TYR A O    1 
ATOM   740  C CB   . TYR A 1 47  ? -6.641  18.728  1.685   1.00 0.00 ? 761 TYR A CB   1 
ATOM   741  C CG   . TYR A 1 47  ? -5.363  19.362  2.180   1.00 0.00 ? 761 TYR A CG   1 
ATOM   742  C CD1  . TYR A 1 47  ? -4.140  18.707  1.999   1.00 0.00 ? 761 TYR A CD1  1 
ATOM   743  C CD2  . TYR A 1 47  ? -5.402  20.608  2.819   1.00 0.00 ? 761 TYR A CD2  1 
ATOM   744  C CE1  . TYR A 1 47  ? -2.955  19.296  2.458   1.00 0.00 ? 761 TYR A CE1  1 
ATOM   745  C CE2  . TYR A 1 47  ? -4.217  21.196  3.278   1.00 0.00 ? 761 TYR A CE2  1 
ATOM   746  C CZ   . TYR A 1 47  ? -2.994  20.540  3.098   1.00 0.00 ? 761 TYR A CZ   1 
ATOM   747  O OH   . TYR A 1 47  ? -1.826  21.121  3.550   1.00 0.00 ? 761 TYR A OH   1 
ATOM   748  H H    . TYR A 1 47  ? -8.121  17.069  0.559   1.00 0.00 ? 761 TYR A H    1 
ATOM   749  H HA   . TYR A 1 47  ? -5.728  16.858  2.251   1.00 0.00 ? 761 TYR A HA   1 
ATOM   750  H HB2  . TYR A 1 47  ? -6.652  18.739  0.605   1.00 0.00 ? 761 TYR A HB2  1 
ATOM   751  H HB3  . TYR A 1 47  ? -7.487  19.283  2.060   1.00 0.00 ? 761 TYR A HB3  1 
ATOM   752  H HD1  . TYR A 1 47  ? -4.109  17.746  1.506   1.00 0.00 ? 761 TYR A HD1  1 
ATOM   753  H HD2  . TYR A 1 47  ? -6.345  21.114  2.959   1.00 0.00 ? 761 TYR A HD2  1 
ATOM   754  H HE1  . TYR A 1 47  ? -2.011  18.789  2.319   1.00 0.00 ? 761 TYR A HE1  1 
ATOM   755  H HE2  . TYR A 1 47  ? -4.247  22.157  3.772   1.00 0.00 ? 761 TYR A HE2  1 
ATOM   756  H HH   . TYR A 1 47  ? -2.044  21.687  4.294   1.00 0.00 ? 761 TYR A HH   1 
ATOM   757  N N    . GLU A 1 48  ? -8.444  16.424  3.674   1.00 0.00 ? 762 GLU A N    1 
ATOM   758  C CA   . GLU A 1 48  ? -9.151  16.324  4.981   1.00 0.00 ? 762 GLU A CA   1 
ATOM   759  C C    . GLU A 1 48  ? -9.516  14.866  5.266   1.00 0.00 ? 762 GLU A C    1 
ATOM   760  O O    . GLU A 1 48  ? -9.074  14.282  6.236   1.00 0.00 ? 762 GLU A O    1 
ATOM   761  C CB   . GLU A 1 48  ? -10.416 17.168  4.811   1.00 0.00 ? 762 GLU A CB   1 
ATOM   762  C CG   . GLU A 1 48  ? -10.145 18.597  5.285   1.00 0.00 ? 762 GLU A CG   1 
ATOM   763  C CD   . GLU A 1 48  ? -11.465 19.262  5.680   1.00 0.00 ? 762 GLU A CD   1 
ATOM   764  O OE1  . GLU A 1 48  ? -12.488 18.871  5.141   1.00 0.00 ? 762 GLU A OE1  1 
ATOM   765  O OE2  . GLU A 1 48  ? -11.432 20.150  6.516   1.00 0.00 ? 762 GLU A OE2  1 
ATOM   766  H H    . GLU A 1 48  ? -8.743  15.883  2.916   1.00 0.00 ? 762 GLU A H    1 
ATOM   767  H HA   . GLU A 1 48  ? -8.536  16.722  5.775   1.00 0.00 ? 762 GLU A HA   1 
ATOM   768  H HB2  . GLU A 1 48  ? -10.702 17.182  3.769   1.00 0.00 ? 762 GLU A HB2  1 
ATOM   769  H HB3  . GLU A 1 48  ? -11.216 16.740  5.397   1.00 0.00 ? 762 GLU A HB3  1 
ATOM   770  H HG2  . GLU A 1 48  ? -9.484  18.573  6.139   1.00 0.00 ? 762 GLU A HG2  1 
ATOM   771  H HG3  . GLU A 1 48  ? -9.683  19.159  4.487   1.00 0.00 ? 762 GLU A HG3  1 
ATOM   772  N N    . VAL A 1 49  ? -10.310 14.271  4.419   1.00 0.00 ? 763 VAL A N    1 
ATOM   773  C CA   . VAL A 1 49  ? -10.689 12.846  4.625   1.00 0.00 ? 763 VAL A CA   1 
ATOM   774  C C    . VAL A 1 49  ? -9.433  11.971  4.690   1.00 0.00 ? 763 VAL A C    1 
ATOM   775  O O    . VAL A 1 49  ? -9.454  10.875  5.213   1.00 0.00 ? 763 VAL A O    1 
ATOM   776  C CB   . VAL A 1 49  ? -11.532 12.489  3.395   1.00 0.00 ? 763 VAL A CB   1 
ATOM   777  C CG1  . VAL A 1 49  ? -11.843 10.989  3.394   1.00 0.00 ? 763 VAL A CG1  1 
ATOM   778  C CG2  . VAL A 1 49  ? -12.841 13.280  3.430   1.00 0.00 ? 763 VAL A CG2  1 
ATOM   779  H H    . VAL A 1 49  ? -10.648 14.759  3.639   1.00 0.00 ? 763 VAL A H    1 
ATOM   780  H HA   . VAL A 1 49  ? -11.273 12.737  5.527   1.00 0.00 ? 763 VAL A HA   1 
ATOM   781  H HB   . VAL A 1 49  ? -10.984 12.742  2.500   1.00 0.00 ? 763 VAL A HB   1 
ATOM   782  H HG11 . VAL A 1 49  ? -12.801 10.821  2.925   1.00 0.00 ? 763 VAL A HG11 1 
ATOM   783  H HG12 . VAL A 1 49  ? -11.871 10.627  4.411   1.00 0.00 ? 763 VAL A HG12 1 
ATOM   784  H HG13 . VAL A 1 49  ? -11.075 10.463  2.844   1.00 0.00 ? 763 VAL A HG13 1 
ATOM   785  H HG21 . VAL A 1 49  ? -12.666 14.281  3.065   1.00 0.00 ? 763 VAL A HG21 1 
ATOM   786  H HG22 . VAL A 1 49  ? -13.207 13.326  4.445   1.00 0.00 ? 763 VAL A HG22 1 
ATOM   787  H HG23 . VAL A 1 49  ? -13.573 12.791  2.804   1.00 0.00 ? 763 VAL A HG23 1 
ATOM   788  N N    . ILE A 1 50  ? -8.341  12.447  4.158   1.00 0.00 ? 764 ILE A N    1 
ATOM   789  C CA   . ILE A 1 50  ? -7.088  11.641  4.178   1.00 0.00 ? 764 ILE A CA   1 
ATOM   790  C C    . ILE A 1 50  ? -5.948  12.446  4.804   1.00 0.00 ? 764 ILE A C    1 
ATOM   791  O O    . ILE A 1 50  ? -5.353  13.295  4.170   1.00 0.00 ? 764 ILE A O    1 
ATOM   792  C CB   . ILE A 1 50  ? -6.797  11.350  2.704   1.00 0.00 ? 764 ILE A CB   1 
ATOM   793  C CG1  . ILE A 1 50  ? -7.980  10.595  2.092   1.00 0.00 ? 764 ILE A CG1  1 
ATOM   794  C CG2  . ILE A 1 50  ? -5.529  10.502  2.591   1.00 0.00 ? 764 ILE A CG2  1 
ATOM   795  C CD1  . ILE A 1 50  ? -8.208  9.290   2.859   1.00 0.00 ? 764 ILE A CD1  1 
ATOM   796  H H    . ILE A 1 50  ? -8.346  13.331  3.736   1.00 0.00 ? 764 ILE A H    1 
ATOM   797  H HA   . ILE A 1 50  ? -7.242  10.720  4.720   1.00 0.00 ? 764 ILE A HA   1 
ATOM   798  H HB   . ILE A 1 50  ? -6.654  12.281  2.176   1.00 0.00 ? 764 ILE A HB   1 
ATOM   799  H HG12 . ILE A 1 50  ? -8.868  11.207  2.154   1.00 0.00 ? 764 ILE A HG12 1 
ATOM   800  H HG13 . ILE A 1 50  ? -7.770  10.372  1.057   1.00 0.00 ? 764 ILE A HG13 1 
ATOM   801  H HG21 . ILE A 1 50  ? -5.041  10.710  1.650   1.00 0.00 ? 764 ILE A HG21 1 
ATOM   802  H HG22 . ILE A 1 50  ? -5.789  9.456   2.638   1.00 0.00 ? 764 ILE A HG22 1 
ATOM   803  H HG23 . ILE A 1 50  ? -4.860  10.743  3.404   1.00 0.00 ? 764 ILE A HG23 1 
ATOM   804  H HD11 . ILE A 1 50  ? -7.282  8.972   3.314   1.00 0.00 ? 764 ILE A HD11 1 
ATOM   805  H HD12 . ILE A 1 50  ? -8.554  8.527   2.178   1.00 0.00 ? 764 ILE A HD12 1 
ATOM   806  H HD13 . ILE A 1 50  ? -8.950  9.449   3.628   1.00 0.00 ? 764 ILE A HD13 1 
ATOM   807  N N    . ARG A 1 51  ? -5.641  12.189  6.047   1.00 0.00 ? 765 ARG A N    1 
ATOM   808  C CA   . ARG A 1 51  ? -4.546  12.946  6.719   1.00 0.00 ? 765 ARG A CA   1 
ATOM   809  C C    . ARG A 1 51  ? -3.176  12.407  6.296   1.00 0.00 ? 765 ARG A C    1 
ATOM   810  O O    . ARG A 1 51  ? -2.164  13.056  6.474   1.00 0.00 ? 765 ARG A O    1 
ATOM   811  C CB   . ARG A 1 51  ? -4.772  12.713  8.215   1.00 0.00 ? 765 ARG A CB   1 
ATOM   812  C CG   . ARG A 1 51  ? -4.314  13.946  8.998   1.00 0.00 ? 765 ARG A CG   1 
ATOM   813  C CD   . ARG A 1 51  ? -5.213  14.137  10.221  1.00 0.00 ? 765 ARG A CD   1 
ATOM   814  N NE   . ARG A 1 51  ? -4.448  15.051  11.119  1.00 0.00 ? 765 ARG A NE   1 
ATOM   815  C CZ   . ARG A 1 51  ? -3.405  14.619  11.790  1.00 0.00 ? 765 ARG A CZ   1 
ATOM   816  N NH1  . ARG A 1 51  ? -3.005  13.375  11.692  1.00 0.00 ? 765 ARG A NH1  1 
ATOM   817  N NH2  . ARG A 1 51  ? -2.756  15.443  12.568  1.00 0.00 ? 765 ARG A NH2  1 
ATOM   818  H H    . ARG A 1 51  ? -6.137  11.503  6.541   1.00 0.00 ? 765 ARG A H    1 
ATOM   819  H HA   . ARG A 1 51  ? -4.623  13.998  6.488   1.00 0.00 ? 765 ARG A HA   1 
ATOM   820  H HB2  . ARG A 1 51  ? -5.822  12.540  8.398   1.00 0.00 ? 765 ARG A HB2  1 
ATOM   821  H HB3  . ARG A 1 51  ? -4.204  11.852  8.535   1.00 0.00 ? 765 ARG A HB3  1 
ATOM   822  H HG2  . ARG A 1 51  ? -3.292  13.809  9.320   1.00 0.00 ? 765 ARG A HG2  1 
ATOM   823  H HG3  . ARG A 1 51  ? -4.378  14.819  8.364   1.00 0.00 ? 765 ARG A HG3  1 
ATOM   824  H HD2  . ARG A 1 51  ? -6.149  14.591  9.932   1.00 0.00 ? 765 ARG A HD2  1 
ATOM   825  H HD3  . ARG A 1 51  ? -5.389  13.190  10.710  1.00 0.00 ? 765 ARG A HD3  1 
ATOM   826  H HE   . ARG A 1 51  ? -4.727  15.986  11.210  1.00 0.00 ? 765 ARG A HE   1 
ATOM   827  H HH11 . ARG A 1 51  ? -3.492  12.733  11.101  1.00 0.00 ? 765 ARG A HH11 1 
ATOM   828  H HH12 . ARG A 1 51  ? -2.209  13.066  12.211  1.00 0.00 ? 765 ARG A HH12 1 
ATOM   829  H HH21 . ARG A 1 51  ? -3.053  16.394  12.649  1.00 0.00 ? 765 ARG A HH21 1 
ATOM   830  H HH22 . ARG A 1 51  ? -1.960  15.122  13.083  1.00 0.00 ? 765 ARG A HH22 1 
ATOM   831  N N    . PHE A 1 52  ? -3.131  11.227  5.738   1.00 0.00 ? 766 PHE A N    1 
ATOM   832  C CA   . PHE A 1 52  ? -1.822  10.658  5.309   1.00 0.00 ? 766 PHE A CA   1 
ATOM   833  C C    . PHE A 1 52  ? -1.899  10.170  3.857   1.00 0.00 ? 766 PHE A C    1 
ATOM   834  O O    . PHE A 1 52  ? -1.985  8.983   3.612   1.00 0.00 ? 766 PHE A O    1 
ATOM   835  C CB   . PHE A 1 52  ? -1.578  9.480   6.254   1.00 0.00 ? 766 PHE A CB   1 
ATOM   836  C CG   . PHE A 1 52  ? -1.481  9.983   7.675   1.00 0.00 ? 766 PHE A CG   1 
ATOM   837  C CD1  . PHE A 1 52  ? -0.402  10.787  8.061   1.00 0.00 ? 766 PHE A CD1  1 
ATOM   838  C CD2  . PHE A 1 52  ? -2.468  9.641   8.607   1.00 0.00 ? 766 PHE A CD2  1 
ATOM   839  C CE1  . PHE A 1 52  ? -0.311  11.252  9.378   1.00 0.00 ? 766 PHE A CE1  1 
ATOM   840  C CE2  . PHE A 1 52  ? -2.377  10.106  9.925   1.00 0.00 ? 766 PHE A CE2  1 
ATOM   841  C CZ   . PHE A 1 52  ? -1.298  10.911  10.310  1.00 0.00 ? 766 PHE A CZ   1 
ATOM   842  H H    . PHE A 1 52  ? -3.956  10.716  5.603   1.00 0.00 ? 766 PHE A H    1 
ATOM   843  H HA   . PHE A 1 52  ? -1.039  11.395  5.418   1.00 0.00 ? 766 PHE A HA   1 
ATOM   844  H HB2  . PHE A 1 52  ? -2.396  8.779   6.175   1.00 0.00 ? 766 PHE A HB2  1 
ATOM   845  H HB3  . PHE A 1 52  ? -0.655  8.987   5.984   1.00 0.00 ? 766 PHE A HB3  1 
ATOM   846  H HD1  . PHE A 1 52  ? 0.360   11.050  7.342   1.00 0.00 ? 766 PHE A HD1  1 
ATOM   847  H HD2  . PHE A 1 52  ? -3.300  9.020   8.310   1.00 0.00 ? 766 PHE A HD2  1 
ATOM   848  H HE1  . PHE A 1 52  ? 0.521   11.873  9.676   1.00 0.00 ? 766 PHE A HE1  1 
ATOM   849  H HE2  . PHE A 1 52  ? -3.139  9.843   10.644  1.00 0.00 ? 766 PHE A HE2  1 
ATOM   850  H HZ   . PHE A 1 52  ? -1.228  11.270  11.327  1.00 0.00 ? 766 PHE A HZ   1 
ATOM   851  N N    . PRO A 1 53  ? -1.862  11.102  2.935   1.00 0.00 ? 767 PRO A N    1 
ATOM   852  C CA   . PRO A 1 53  ? -1.933  10.741  1.498   1.00 0.00 ? 767 PRO A CA   1 
ATOM   853  C C    . PRO A 1 53  ? -0.766  9.828   1.118   1.00 0.00 ? 767 PRO A C    1 
ATOM   854  O O    . PRO A 1 53  ? 0.348   10.274  0.927   1.00 0.00 ? 767 PRO A O    1 
ATOM   855  C CB   . PRO A 1 53  ? -1.823  12.082  0.768   1.00 0.00 ? 767 PRO A CB   1 
ATOM   856  C CG   . PRO A 1 53  ? -2.131  13.127  1.795   1.00 0.00 ? 767 PRO A CG   1 
ATOM   857  C CD   . PRO A 1 53  ? -1.761  12.554  3.135   1.00 0.00 ? 767 PRO A CD   1 
ATOM   858  H HA   . PRO A 1 53  ? -2.876  10.265  1.274   1.00 0.00 ? 767 PRO A HA   1 
ATOM   859  H HB2  . PRO A 1 53  ? -0.823  12.219  0.385   1.00 0.00 ? 767 PRO A HB2  1 
ATOM   860  H HB3  . PRO A 1 53  ? -2.541  12.129  -0.037  1.00 0.00 ? 767 PRO A HB3  1 
ATOM   861  H HG2  . PRO A 1 53  ? -1.549  14.016  1.602   1.00 0.00 ? 767 PRO A HG2  1 
ATOM   862  H HG3  . PRO A 1 53  ? -3.184  13.364  1.775   1.00 0.00 ? 767 PRO A HG3  1 
ATOM   863  H HD2  . PRO A 1 53  ? -0.751  12.830  3.400   1.00 0.00 ? 767 PRO A HD2  1 
ATOM   864  H HD3  . PRO A 1 53  ? -2.457  12.882  3.893   1.00 0.00 ? 767 PRO A HD3  1 
ATOM   865  N N    . MET A 1 54  ? -1.012  8.551   1.006   1.00 0.00 ? 768 MET A N    1 
ATOM   866  C CA   . MET A 1 54  ? 0.084   7.610   0.637   1.00 0.00 ? 768 MET A CA   1 
ATOM   867  C C    . MET A 1 54  ? -0.342  6.747   -0.556  1.00 0.00 ? 768 MET A C    1 
ATOM   868  O O    . MET A 1 54  ? -1.387  6.128   -0.547  1.00 0.00 ? 768 MET A O    1 
ATOM   869  C CB   . MET A 1 54  ? 0.298   6.751   1.892   1.00 0.00 ? 768 MET A CB   1 
ATOM   870  C CG   . MET A 1 54  ? 1.209   5.560   1.569   1.00 0.00 ? 768 MET A CG   1 
ATOM   871  S SD   . MET A 1 54  ? 2.489   5.413   2.840   1.00 0.00 ? 768 MET A SD   1 
ATOM   872  C CE   . MET A 1 54  ? 3.417   6.896   2.382   1.00 0.00 ? 768 MET A CE   1 
ATOM   873  H H    . MET A 1 54  ? -1.917  8.212   1.163   1.00 0.00 ? 768 MET A H    1 
ATOM   874  H HA   . MET A 1 54  ? 0.984   8.158   0.401   1.00 0.00 ? 768 MET A HA   1 
ATOM   875  H HB2  . MET A 1 54  ? 0.756   7.354   2.662   1.00 0.00 ? 768 MET A HB2  1 
ATOM   876  H HB3  . MET A 1 54  ? -0.654  6.387   2.244   1.00 0.00 ? 768 MET A HB3  1 
ATOM   877  H HG2  . MET A 1 54  ? 0.622   4.654   1.545   1.00 0.00 ? 768 MET A HG2  1 
ATOM   878  H HG3  . MET A 1 54  ? 1.674   5.713   0.607   1.00 0.00 ? 768 MET A HG3  1 
ATOM   879  H HE1  . MET A 1 54  ? 2.727   7.678   2.103   1.00 0.00 ? 768 MET A HE1  1 
ATOM   880  H HE2  . MET A 1 54  ? 4.064   6.671   1.547   1.00 0.00 ? 768 MET A HE2  1 
ATOM   881  H HE3  . MET A 1 54  ? 4.012   7.223   3.222   1.00 0.00 ? 768 MET A HE3  1 
ATOM   882  N N    . ASP A 1 55  ? 0.467   6.699   -1.578  1.00 0.00 ? 769 ASP A N    1 
ATOM   883  C CA   . ASP A 1 55  ? 0.121   5.871   -2.766  1.00 0.00 ? 769 ASP A CA   1 
ATOM   884  C C    . ASP A 1 55  ? 1.320   5.014   -3.175  1.00 0.00 ? 769 ASP A C    1 
ATOM   885  O O    . ASP A 1 55  ? 2.274   4.872   -2.435  1.00 0.00 ? 769 ASP A O    1 
ATOM   886  C CB   . ASP A 1 55  ? -0.215  6.883   -3.866  1.00 0.00 ? 769 ASP A CB   1 
ATOM   887  C CG   . ASP A 1 55  ? 1.015   7.743   -4.175  1.00 0.00 ? 769 ASP A CG   1 
ATOM   888  O OD1  . ASP A 1 55  ? 1.997   7.625   -3.460  1.00 0.00 ? 769 ASP A OD1  1 
ATOM   889  O OD2  . ASP A 1 55  ? 0.952   8.508   -5.124  1.00 0.00 ? 769 ASP A OD2  1 
ATOM   890  H H    . ASP A 1 55  ? 1.308   7.203   -1.560  1.00 0.00 ? 769 ASP A H    1 
ATOM   891  H HA   . ASP A 1 55  ? -0.734  5.248   -2.554  1.00 0.00 ? 769 ASP A HA   1 
ATOM   892  H HB2  . ASP A 1 55  ? -0.518  6.355   -4.758  1.00 0.00 ? 769 ASP A HB2  1 
ATOM   893  H HB3  . ASP A 1 55  ? -1.023  7.519   -3.534  1.00 0.00 ? 769 ASP A HB3  1 
ATOM   894  N N    . LEU A 1 56  ? 1.283   4.441   -4.345  1.00 0.00 ? 770 LEU A N    1 
ATOM   895  C CA   . LEU A 1 56  ? 2.426   3.599   -4.796  1.00 0.00 ? 770 LEU A CA   1 
ATOM   896  C C    . LEU A 1 56  ? 3.573   4.474   -5.315  1.00 0.00 ? 770 LEU A C    1 
ATOM   897  O O    . LEU A 1 56  ? 4.677   4.009   -5.513  1.00 0.00 ? 770 LEU A O    1 
ATOM   898  C CB   . LEU A 1 56  ? 1.855   2.742   -5.928  1.00 0.00 ? 770 LEU A CB   1 
ATOM   899  C CG   . LEU A 1 56  ? 1.039   1.592   -5.333  1.00 0.00 ? 770 LEU A CG   1 
ATOM   900  C CD1  . LEU A 1 56  ? 0.396   0.785   -6.463  1.00 0.00 ? 770 LEU A CD1  1 
ATOM   901  C CD2  . LEU A 1 56  ? 1.959   0.682   -4.517  1.00 0.00 ? 770 LEU A CD2  1 
ATOM   902  H H    . LEU A 1 56  ? 0.506   4.569   -4.929  1.00 0.00 ? 770 LEU A H    1 
ATOM   903  H HA   . LEU A 1 56  ? 2.769   2.970   -3.988  1.00 0.00 ? 770 LEU A HA   1 
ATOM   904  H HB2  . LEU A 1 56  ? 1.218   3.350   -6.553  1.00 0.00 ? 770 LEU A HB2  1 
ATOM   905  H HB3  . LEU A 1 56  ? 2.664   2.341   -6.520  1.00 0.00 ? 770 LEU A HB3  1 
ATOM   906  H HG   . LEU A 1 56  ? 0.267   1.992   -4.692  1.00 0.00 ? 770 LEU A HG   1 
ATOM   907  H HD11 . LEU A 1 56  ? 1.169   0.350   -7.079  1.00 0.00 ? 770 LEU A HD11 1 
ATOM   908  H HD12 . LEU A 1 56  ? -0.221  1.435   -7.065  1.00 0.00 ? 770 LEU A HD12 1 
ATOM   909  H HD13 . LEU A 1 56  ? -0.214  -0.001  -6.041  1.00 0.00 ? 770 LEU A HD13 1 
ATOM   910  H HD21 . LEU A 1 56  ? 1.563   -0.322  -4.516  1.00 0.00 ? 770 LEU A HD21 1 
ATOM   911  H HD22 . LEU A 1 56  ? 2.017   1.047   -3.502  1.00 0.00 ? 770 LEU A HD22 1 
ATOM   912  H HD23 . LEU A 1 56  ? 2.945   0.681   -4.956  1.00 0.00 ? 770 LEU A HD23 1 
ATOM   913  N N    . LYS A 1 57  ? 3.324   5.740   -5.529  1.00 0.00 ? 771 LYS A N    1 
ATOM   914  C CA   . LYS A 1 57  ? 4.396   6.636   -6.043  1.00 0.00 ? 771 LYS A CA   1 
ATOM   915  C C    . LYS A 1 57  ? 5.503   6.825   -5.001  1.00 0.00 ? 771 LYS A C    1 
ATOM   916  O O    . LYS A 1 57  ? 6.574   7.309   -5.308  1.00 0.00 ? 771 LYS A O    1 
ATOM   917  C CB   . LYS A 1 57  ? 3.688   7.965   -6.299  1.00 0.00 ? 771 LYS A CB   1 
ATOM   918  C CG   . LYS A 1 57  ? 4.552   8.835   -7.207  1.00 0.00 ? 771 LYS A CG   1 
ATOM   919  C CD   . LYS A 1 57  ? 4.374   10.297  -6.810  1.00 0.00 ? 771 LYS A CD   1 
ATOM   920  C CE   . LYS A 1 57  ? 5.715   11.022  -6.924  1.00 0.00 ? 771 LYS A CE   1 
ATOM   921  N NZ   . LYS A 1 57  ? 5.401   12.300  -7.622  1.00 0.00 ? 771 LYS A NZ   1 
ATOM   922  H H    . LYS A 1 57  ? 2.427   6.100   -5.372  1.00 0.00 ? 771 LYS A H    1 
ATOM   923  H HA   . LYS A 1 57  ? 4.806   6.247   -6.963  1.00 0.00 ? 771 LYS A HA   1 
ATOM   924  H HB2  . LYS A 1 57  ? 2.737   7.783   -6.775  1.00 0.00 ? 771 LYS A HB2  1 
ATOM   925  H HB3  . LYS A 1 57  ? 3.528   8.474   -5.360  1.00 0.00 ? 771 LYS A HB3  1 
ATOM   926  H HG2  . LYS A 1 57  ? 5.589   8.554   -7.096  1.00 0.00 ? 771 LYS A HG2  1 
ATOM   927  H HG3  . LYS A 1 57  ? 4.248   8.699   -8.234  1.00 0.00 ? 771 LYS A HG3  1 
ATOM   928  H HD2  . LYS A 1 57  ? 3.653   10.760  -7.465  1.00 0.00 ? 771 LYS A HD2  1 
ATOM   929  H HD3  . LYS A 1 57  ? 4.020   10.350  -5.791  1.00 0.00 ? 771 LYS A HD3  1 
ATOM   930  H HE2  . LYS A 1 57  ? 6.120   11.220  -5.943  1.00 0.00 ? 771 LYS A HE2  1 
ATOM   931  H HE3  . LYS A 1 57  ? 6.410   10.436  -7.507  1.00 0.00 ? 771 LYS A HE3  1 
ATOM   932  H HZ1  . LYS A 1 57  ? 6.284   12.750  -7.938  1.00 0.00 ? 771 LYS A HZ1  1 
ATOM   933  H HZ2  . LYS A 1 57  ? 4.901   12.938  -6.970  1.00 0.00 ? 771 LYS A HZ2  1 
ATOM   934  H HZ3  . LYS A 1 57  ? 4.797   12.105  -8.447  1.00 0.00 ? 771 LYS A HZ3  1 
ATOM   935  N N    . THR A 1 58  ? 5.256   6.466   -3.771  1.00 0.00 ? 772 THR A N    1 
ATOM   936  C CA   . THR A 1 58  ? 6.300   6.652   -2.722  1.00 0.00 ? 772 THR A CA   1 
ATOM   937  C C    . THR A 1 58  ? 6.785   5.301   -2.192  1.00 0.00 ? 772 THR A C    1 
ATOM   938  O O    . THR A 1 58  ? 7.909   5.164   -1.751  1.00 0.00 ? 772 THR A O    1 
ATOM   939  C CB   . THR A 1 58  ? 5.603   7.438   -1.609  1.00 0.00 ? 772 THR A CB   1 
ATOM   940  O OG1  . THR A 1 58  ? 4.396   6.782   -1.252  1.00 0.00 ? 772 THR A OG1  1 
ATOM   941  C CG2  . THR A 1 58  ? 5.288   8.852   -2.101  1.00 0.00 ? 772 THR A CG2  1 
ATOM   942  H H    . THR A 1 58  ? 4.384   6.085   -3.535  1.00 0.00 ? 772 THR A H    1 
ATOM   943  H HA   . THR A 1 58  ? 7.130   7.219   -3.118  1.00 0.00 ? 772 THR A HA   1 
ATOM   944  H HB   . THR A 1 58  ? 6.251   7.493   -0.747  1.00 0.00 ? 772 THR A HB   1 
ATOM   945  H HG1  . THR A 1 58  ? 4.482   6.474   -0.347  1.00 0.00 ? 772 THR A HG1  1 
ATOM   946  H HG21 . THR A 1 58  ? 4.361   9.189   -1.659  1.00 0.00 ? 772 THR A HG21 1 
ATOM   947  H HG22 . THR A 1 58  ? 5.193   8.846   -3.176  1.00 0.00 ? 772 THR A HG22 1 
ATOM   948  H HG23 . THR A 1 58  ? 6.087   9.520   -1.814  1.00 0.00 ? 772 THR A HG23 1 
ATOM   949  N N    . MET A 1 59  ? 5.946   4.303   -2.221  1.00 0.00 ? 773 MET A N    1 
ATOM   950  C CA   . MET A 1 59  ? 6.357   2.969   -1.701  1.00 0.00 ? 773 MET A CA   1 
ATOM   951  C C    . MET A 1 59  ? 7.667   2.514   -2.349  1.00 0.00 ? 773 MET A C    1 
ATOM   952  O O    . MET A 1 59  ? 8.718   2.556   -1.740  1.00 0.00 ? 773 MET A O    1 
ATOM   953  C CB   . MET A 1 59  ? 5.216   2.029   -2.091  1.00 0.00 ? 773 MET A CB   1 
ATOM   954  C CG   . MET A 1 59  ? 4.243   1.896   -0.917  1.00 0.00 ? 773 MET A CG   1 
ATOM   955  S SD   . MET A 1 59  ? 5.011   0.914   0.395   1.00 0.00 ? 773 MET A SD   1 
ATOM   956  C CE   . MET A 1 59  ? 3.592   -0.156  0.739   1.00 0.00 ? 773 MET A CE   1 
ATOM   957  H H    . MET A 1 59  ? 5.041   4.434   -2.574  1.00 0.00 ? 773 MET A H    1 
ATOM   958  H HA   . MET A 1 59  ? 6.462   3.003   -0.627  1.00 0.00 ? 773 MET A HA   1 
ATOM   959  H HB2  . MET A 1 59  ? 4.695   2.431   -2.948  1.00 0.00 ? 773 MET A HB2  1 
ATOM   960  H HB3  . MET A 1 59  ? 5.618   1.057   -2.338  1.00 0.00 ? 773 MET A HB3  1 
ATOM   961  H HG2  . MET A 1 59  ? 4.003   2.876   -0.537  1.00 0.00 ? 773 MET A HG2  1 
ATOM   962  H HG3  . MET A 1 59  ? 3.340   1.408   -1.251  1.00 0.00 ? 773 MET A HG3  1 
ATOM   963  H HE1  . MET A 1 59  ? 3.873   -0.903  1.466   1.00 0.00 ? 773 MET A HE1  1 
ATOM   964  H HE2  . MET A 1 59  ? 3.278   -0.642  -0.173  1.00 0.00 ? 773 MET A HE2  1 
ATOM   965  H HE3  . MET A 1 59  ? 2.779   0.439   1.128   1.00 0.00 ? 773 MET A HE3  1 
ATOM   966  N N    . SER A 1 60  ? 7.613   2.068   -3.575  1.00 0.00 ? 774 SER A N    1 
ATOM   967  C CA   . SER A 1 60  ? 8.854   1.592   -4.254  1.00 0.00 ? 774 SER A CA   1 
ATOM   968  C C    . SER A 1 60  ? 9.972   2.631   -4.136  1.00 0.00 ? 774 SER A C    1 
ATOM   969  O O    . SER A 1 60  ? 11.095  2.309   -3.802  1.00 0.00 ? 774 SER A O    1 
ATOM   970  C CB   . SER A 1 60  ? 8.454   1.413   -5.718  1.00 0.00 ? 774 SER A CB   1 
ATOM   971  O OG   . SER A 1 60  ? 9.617   1.189   -6.502  1.00 0.00 ? 774 SER A OG   1 
ATOM   972  H H    . SER A 1 60  ? 6.754   2.034   -4.045  1.00 0.00 ? 774 SER A H    1 
ATOM   973  H HA   . SER A 1 60  ? 9.172   0.649   -3.835  1.00 0.00 ? 774 SER A HA   1 
ATOM   974  H HB2  . SER A 1 60  ? 7.789   0.566   -5.810  1.00 0.00 ? 774 SER A HB2  1 
ATOM   975  H HB3  . SER A 1 60  ? 7.953   2.303   -6.064  1.00 0.00 ? 774 SER A HB3  1 
ATOM   976  H HG   . SER A 1 60  ? 9.372   1.271   -7.427  1.00 0.00 ? 774 SER A HG   1 
ATOM   977  N N    . GLU A 1 61  ? 9.678   3.875   -4.410  1.00 0.00 ? 775 GLU A N    1 
ATOM   978  C CA   . GLU A 1 61  ? 10.732  4.927   -4.311  1.00 0.00 ? 775 GLU A CA   1 
ATOM   979  C C    . GLU A 1 61  ? 11.431  4.850   -2.952  1.00 0.00 ? 775 GLU A C    1 
ATOM   980  O O    . GLU A 1 61  ? 12.642  4.898   -2.863  1.00 0.00 ? 775 GLU A O    1 
ATOM   981  C CB   . GLU A 1 61  ? 9.980   6.253   -4.450  1.00 0.00 ? 775 GLU A CB   1 
ATOM   982  C CG   . GLU A 1 61  ? 9.452   6.394   -5.877  1.00 0.00 ? 775 GLU A CG   1 
ATOM   983  C CD   . GLU A 1 61  ? 10.589  6.830   -6.803  1.00 0.00 ? 775 GLU A CD   1 
ATOM   984  O OE1  . GLU A 1 61  ? 10.795  8.025   -6.934  1.00 0.00 ? 775 GLU A OE1  1 
ATOM   985  O OE2  . GLU A 1 61  ? 11.234  5.960   -7.365  1.00 0.00 ? 775 GLU A OE2  1 
ATOM   986  H H    . GLU A 1 61  ? 8.767   4.116   -4.678  1.00 0.00 ? 775 GLU A H    1 
ATOM   987  H HA   . GLU A 1 61  ? 11.450  4.816   -5.111  1.00 0.00 ? 775 GLU A HA   1 
ATOM   988  H HB2  . GLU A 1 61  ? 9.152   6.273   -3.759  1.00 0.00 ? 775 GLU A HB2  1 
ATOM   989  H HB3  . GLU A 1 61  ? 10.651  7.071   -4.232  1.00 0.00 ? 775 GLU A HB3  1 
ATOM   990  H HG2  . GLU A 1 61  ? 9.058   5.446   -6.211  1.00 0.00 ? 775 GLU A HG2  1 
ATOM   991  H HG3  . GLU A 1 61  ? 8.669   7.135   -5.894  1.00 0.00 ? 775 GLU A HG3  1 
ATOM   992  N N    . ARG A 1 62  ? 10.679  4.716   -1.895  1.00 0.00 ? 776 ARG A N    1 
ATOM   993  C CA   . ARG A 1 62  ? 11.305  4.608   -0.549  1.00 0.00 ? 776 ARG A CA   1 
ATOM   994  C C    . ARG A 1 62  ? 11.999  3.253   -0.409  1.00 0.00 ? 776 ARG A C    1 
ATOM   995  O O    . ARG A 1 62  ? 13.066  3.147   0.163   1.00 0.00 ? 776 ARG A O    1 
ATOM   996  C CB   . ARG A 1 62  ? 10.142  4.716   0.438   1.00 0.00 ? 776 ARG A CB   1 
ATOM   997  C CG   . ARG A 1 62  ? 10.105  6.126   1.031   1.00 0.00 ? 776 ARG A CG   1 
ATOM   998  C CD   . ARG A 1 62  ? 9.565   7.107   -0.011  1.00 0.00 ? 776 ARG A CD   1 
ATOM   999  N NE   . ARG A 1 62  ? 9.919   8.457   0.520   1.00 0.00 ? 776 ARG A NE   1 
ATOM   1000 C CZ   . ARG A 1 62  ? 9.301   9.534   0.091   1.00 0.00 ? 776 ARG A CZ   1 
ATOM   1001 N NH1  . ARG A 1 62  ? 8.358   9.456   -0.815  1.00 0.00 ? 776 ARG A NH1  1 
ATOM   1002 N NH2  . ARG A 1 62  ? 9.632   10.699  0.576   1.00 0.00 ? 776 ARG A NH2  1 
ATOM   1003 H H    . ARG A 1 62  ? 9.705   4.666   -1.988  1.00 0.00 ? 776 ARG A H    1 
ATOM   1004 H HA   . ARG A 1 62  ? 12.008  5.413   -0.394  1.00 0.00 ? 776 ARG A HA   1 
ATOM   1005 H HB2  . ARG A 1 62  ? 9.214   4.517   -0.077  1.00 0.00 ? 776 ARG A HB2  1 
ATOM   1006 H HB3  . ARG A 1 62  ? 10.275  3.995   1.231   1.00 0.00 ? 776 ARG A HB3  1 
ATOM   1007 H HG2  . ARG A 1 62  ? 9.463   6.134   1.900   1.00 0.00 ? 776 ARG A HG2  1 
ATOM   1008 H HG3  . ARG A 1 62  ? 11.103  6.420   1.320   1.00 0.00 ? 776 ARG A HG3  1 
ATOM   1009 H HD2  . ARG A 1 62  ? 10.042  6.941   -0.966  1.00 0.00 ? 776 ARG A HD2  1 
ATOM   1010 H HD3  . ARG A 1 62  ? 8.494   7.008   -0.102  1.00 0.00 ? 776 ARG A HD3  1 
ATOM   1011 H HE   . ARG A 1 62  ? 10.621  8.541   1.199   1.00 0.00 ? 776 ARG A HE   1 
ATOM   1012 H HH11 . ARG A 1 62  ? 8.094   8.571   -1.196  1.00 0.00 ? 776 ARG A HH11 1 
ATOM   1013 H HH12 . ARG A 1 62  ? 7.900   10.289  -1.128  1.00 0.00 ? 776 ARG A HH12 1 
ATOM   1014 H HH21 . ARG A 1 62  ? 10.351  10.767  1.269   1.00 0.00 ? 776 ARG A HH21 1 
ATOM   1015 H HH22 . ARG A 1 62  ? 9.168   11.525  0.256   1.00 0.00 ? 776 ARG A HH22 1 
ATOM   1016 N N    . LEU A 1 63  ? 11.406  2.217   -0.938  1.00 0.00 ? 777 LEU A N    1 
ATOM   1017 C CA   . LEU A 1 63  ? 12.041  0.873   -0.854  1.00 0.00 ? 777 LEU A CA   1 
ATOM   1018 C C    . LEU A 1 63  ? 13.373  0.877   -1.604  1.00 0.00 ? 777 LEU A C    1 
ATOM   1019 O O    . LEU A 1 63  ? 14.315  0.214   -1.218  1.00 0.00 ? 777 LEU A O    1 
ATOM   1020 C CB   . LEU A 1 63  ? 11.056  -0.076  -1.534  1.00 0.00 ? 777 LEU A CB   1 
ATOM   1021 C CG   . LEU A 1 63  ? 11.231  -1.487  -0.966  1.00 0.00 ? 777 LEU A CG   1 
ATOM   1022 C CD1  . LEU A 1 63  ? 9.915   -1.954  -0.346  1.00 0.00 ? 777 LEU A CD1  1 
ATOM   1023 C CD2  . LEU A 1 63  ? 11.634  -2.444  -2.090  1.00 0.00 ? 777 LEU A CD2  1 
ATOM   1024 H H    . LEU A 1 63  ? 10.550  2.326   -1.403  1.00 0.00 ? 777 LEU A H    1 
ATOM   1025 H HA   . LEU A 1 63  ? 12.188  0.589   0.178   1.00 0.00 ? 777 LEU A HA   1 
ATOM   1026 H HB2  . LEU A 1 63  ? 10.045  0.263   -1.358  1.00 0.00 ? 777 LEU A HB2  1 
ATOM   1027 H HB3  . LEU A 1 63  ? 11.250  -0.090  -2.593  1.00 0.00 ? 777 LEU A HB3  1 
ATOM   1028 H HG   . LEU A 1 63  ? 12.000  -1.480  -0.208  1.00 0.00 ? 777 LEU A HG   1 
ATOM   1029 H HD11 . LEU A 1 63  ? 9.292   -1.098  -0.138  1.00 0.00 ? 777 LEU A HD11 1 
ATOM   1030 H HD12 . LEU A 1 63  ? 10.120  -2.483  0.573   1.00 0.00 ? 777 LEU A HD12 1 
ATOM   1031 H HD13 . LEU A 1 63  ? 9.407   -2.612  -1.035  1.00 0.00 ? 777 LEU A HD13 1 
ATOM   1032 H HD21 . LEU A 1 63  ? 11.459  -1.971  -3.045  1.00 0.00 ? 777 LEU A HD21 1 
ATOM   1033 H HD22 . LEU A 1 63  ? 11.046  -3.347  -2.023  1.00 0.00 ? 777 LEU A HD22 1 
ATOM   1034 H HD23 . LEU A 1 63  ? 12.682  -2.688  -1.996  1.00 0.00 ? 777 LEU A HD23 1 
ATOM   1035 N N    . LYS A 1 64  ? 13.463  1.626   -2.676  1.00 0.00 ? 778 LYS A N    1 
ATOM   1036 C CA   . LYS A 1 64  ? 14.753  1.715   -3.425  1.00 0.00 ? 778 LYS A CA   1 
ATOM   1037 C C    . LYS A 1 64  ? 15.894  1.993   -2.443  1.00 0.00 ? 778 LYS A C    1 
ATOM   1038 O O    . LYS A 1 64  ? 16.963  1.421   -2.530  1.00 0.00 ? 778 LYS A O    1 
ATOM   1039 C CB   . LYS A 1 64  ? 14.569  2.893   -4.382  1.00 0.00 ? 778 LYS A CB   1 
ATOM   1040 C CG   . LYS A 1 64  ? 14.686  2.371   -5.818  1.00 0.00 ? 778 LYS A CG   1 
ATOM   1041 C CD   . LYS A 1 64  ? 16.154  2.322   -6.288  1.00 0.00 ? 778 LYS A CD   1 
ATOM   1042 C CE   . LYS A 1 64  ? 17.109  1.995   -5.134  1.00 0.00 ? 778 LYS A CE   1 
ATOM   1043 N NZ   . LYS A 1 64  ? 18.459  1.916   -5.759  1.00 0.00 ? 778 LYS A NZ   1 
ATOM   1044 H H    . LYS A 1 64  ? 12.697  2.170   -2.957  1.00 0.00 ? 778 LYS A H    1 
ATOM   1045 H HA   . LYS A 1 64  ? 14.943  0.807   -3.986  1.00 0.00 ? 778 LYS A HA   1 
ATOM   1046 H HB2  . LYS A 1 64  ? 13.595  3.335   -4.233  1.00 0.00 ? 778 LYS A HB2  1 
ATOM   1047 H HB3  . LYS A 1 64  ? 15.336  3.632   -4.200  1.00 0.00 ? 778 LYS A HB3  1 
ATOM   1048 H HG2  . LYS A 1 64  ? 14.278  1.374   -5.858  1.00 0.00 ? 778 LYS A HG2  1 
ATOM   1049 H HG3  . LYS A 1 64  ? 14.123  3.013   -6.478  1.00 0.00 ? 778 LYS A HG3  1 
ATOM   1050 H HD2  . LYS A 1 64  ? 16.244  1.551   -7.033  1.00 0.00 ? 778 LYS A HD2  1 
ATOM   1051 H HD3  . LYS A 1 64  ? 16.425  3.273   -6.721  1.00 0.00 ? 778 LYS A HD3  1 
ATOM   1052 H HE2  . LYS A 1 64  ? 17.084  2.781   -4.396  1.00 0.00 ? 778 LYS A HE2  1 
ATOM   1053 H HE3  . LYS A 1 64  ? 16.840  1.049   -4.688  1.00 0.00 ? 778 LYS A HE3  1 
ATOM   1054 H HZ1  . LYS A 1 64  ? 18.565  1.001   -6.242  1.00 0.00 ? 778 LYS A HZ1  1 
ATOM   1055 H HZ2  . LYS A 1 64  ? 19.188  2.006   -5.023  1.00 0.00 ? 778 LYS A HZ2  1 
ATOM   1056 H HZ3  . LYS A 1 64  ? 18.567  2.687   -6.449  1.00 0.00 ? 778 LYS A HZ3  1 
ATOM   1057 N N    . ASN A 1 65  ? 15.649  2.837   -1.480  1.00 0.00 ? 779 ASN A N    1 
ATOM   1058 C CA   . ASN A 1 65  ? 16.685  3.121   -0.452  1.00 0.00 ? 779 ASN A CA   1 
ATOM   1059 C C    . ASN A 1 65  ? 16.303  2.433   0.859   1.00 0.00 ? 779 ASN A C    1 
ATOM   1060 O O    . ASN A 1 65  ? 16.382  3.020   1.918   1.00 0.00 ? 779 ASN A O    1 
ATOM   1061 C CB   . ASN A 1 65  ? 16.671  4.642   -0.284  1.00 0.00 ? 779 ASN A CB   1 
ATOM   1062 C CG   . ASN A 1 65  ? 17.855  5.248   -1.040  1.00 0.00 ? 779 ASN A CG   1 
ATOM   1063 O OD1  . ASN A 1 65  ? 18.867  5.570   -0.449  1.00 0.00 ? 779 ASN A OD1  1 
ATOM   1064 N ND2  . ASN A 1 65  ? 17.772  5.418   -2.331  1.00 0.00 ? 779 ASN A ND2  1 
ATOM   1065 H H    . ASN A 1 65  ? 14.769  3.264   -1.418  1.00 0.00 ? 779 ASN A H    1 
ATOM   1066 H HA   . ASN A 1 65  ? 17.655  2.786   -0.789  1.00 0.00 ? 779 ASN A HA   1 
ATOM   1067 H HB2  . ASN A 1 65  ? 15.748  5.039   -0.682  1.00 0.00 ? 779 ASN A HB2  1 
ATOM   1068 H HB3  . ASN A 1 65  ? 16.747  4.889   0.764   1.00 0.00 ? 779 ASN A HB3  1 
ATOM   1069 H HD21 . ASN A 1 65  ? 16.956  5.158   -2.807  1.00 0.00 ? 779 ASN A HD21 1 
ATOM   1070 H HD22 . ASN A 1 65  ? 18.525  5.805   -2.824  1.00 0.00 ? 779 ASN A HD22 1 
ATOM   1071 N N    . ARG A 1 66  ? 15.932  1.170   0.782   1.00 0.00 ? 780 ARG A N    1 
ATOM   1072 C CA   . ARG A 1 66  ? 15.505  0.377   1.992   1.00 0.00 ? 780 ARG A CA   1 
ATOM   1073 C C    . ARG A 1 66  ? 14.820  1.251   3.050   1.00 0.00 ? 780 ARG A C    1 
ATOM   1074 O O    . ARG A 1 66  ? 14.922  1.005   4.235   1.00 0.00 ? 780 ARG A O    1 
ATOM   1075 C CB   . ARG A 1 66  ? 16.772  -0.304  2.553   1.00 0.00 ? 780 ARG A CB   1 
ATOM   1076 C CG   . ARG A 1 66  ? 17.886  0.706   2.873   1.00 0.00 ? 780 ARG A CG   1 
ATOM   1077 C CD   . ARG A 1 66  ? 17.536  1.496   4.137   1.00 0.00 ? 780 ARG A CD   1 
ATOM   1078 N NE   . ARG A 1 66  ? 18.835  2.070   4.596   1.00 0.00 ? 780 ARG A NE   1 
ATOM   1079 C CZ   . ARG A 1 66  ? 19.778  1.299   5.085   1.00 0.00 ? 780 ARG A CZ   1 
ATOM   1080 N NH1  . ARG A 1 66  ? 19.607  0.004   5.189   1.00 0.00 ? 780 ARG A NH1  1 
ATOM   1081 N NH2  . ARG A 1 66  ? 20.903  1.831   5.477   1.00 0.00 ? 780 ARG A NH2  1 
ATOM   1082 H H    . ARG A 1 66  ? 15.877  0.747   -0.100  1.00 0.00 ? 780 ARG A H    1 
ATOM   1083 H HA   . ARG A 1 66  ? 14.811  -0.389  1.676   1.00 0.00 ? 780 ARG A HA   1 
ATOM   1084 H HB2  . ARG A 1 66  ? 16.512  -0.834  3.457   1.00 0.00 ? 780 ARG A HB2  1 
ATOM   1085 H HB3  . ARG A 1 66  ? 17.140  -1.012  1.825   1.00 0.00 ? 780 ARG A HB3  1 
ATOM   1086 H HG2  . ARG A 1 66  ? 18.808  0.169   3.039   1.00 0.00 ? 780 ARG A HG2  1 
ATOM   1087 H HG3  . ARG A 1 66  ? 18.020  1.381   2.048   1.00 0.00 ? 780 ARG A HG3  1 
ATOM   1088 H HD2  . ARG A 1 66  ? 16.838  2.287   3.909   1.00 0.00 ? 780 ARG A HD2  1 
ATOM   1089 H HD3  . ARG A 1 66  ? 17.128  0.839   4.890   1.00 0.00 ? 780 ARG A HD3  1 
ATOM   1090 H HE   . ARG A 1 66  ? 18.988  3.036   4.528   1.00 0.00 ? 780 ARG A HE   1 
ATOM   1091 H HH11 . ARG A 1 66  ? 18.751  -0.418  4.894   1.00 0.00 ? 780 ARG A HH11 1 
ATOM   1092 H HH12 . ARG A 1 66  ? 20.338  -0.565  5.565   1.00 0.00 ? 780 ARG A HH12 1 
ATOM   1093 H HH21 . ARG A 1 66  ? 21.043  2.819   5.402   1.00 0.00 ? 780 ARG A HH21 1 
ATOM   1094 H HH22 . ARG A 1 66  ? 21.627  1.251   5.852   1.00 0.00 ? 780 ARG A HH22 1 
ATOM   1095 N N    . TYR A 1 67  ? 14.082  2.241   2.625   1.00 0.00 ? 781 TYR A N    1 
ATOM   1096 C CA   . TYR A 1 67  ? 13.367  3.107   3.603   1.00 0.00 ? 781 TYR A CA   1 
ATOM   1097 C C    . TYR A 1 67  ? 12.232  2.325   4.268   1.00 0.00 ? 781 TYR A C    1 
ATOM   1098 O O    . TYR A 1 67  ? 11.768  2.675   5.335   1.00 0.00 ? 781 TYR A O    1 
ATOM   1099 C CB   . TYR A 1 67  ? 12.802  4.261   2.773   1.00 0.00 ? 781 TYR A CB   1 
ATOM   1100 C CG   . TYR A 1 67  ? 12.756  5.511   3.619   1.00 0.00 ? 781 TYR A CG   1 
ATOM   1101 C CD1  . TYR A 1 67  ? 13.905  6.295   3.772   1.00 0.00 ? 781 TYR A CD1  1 
ATOM   1102 C CD2  . TYR A 1 67  ? 11.564  5.883   4.254   1.00 0.00 ? 781 TYR A CD2  1 
ATOM   1103 C CE1  . TYR A 1 67  ? 13.863  7.453   4.557   1.00 0.00 ? 781 TYR A CE1  1 
ATOM   1104 C CE2  . TYR A 1 67  ? 11.522  7.041   5.039   1.00 0.00 ? 781 TYR A CE2  1 
ATOM   1105 C CZ   . TYR A 1 67  ? 12.671  7.826   5.191   1.00 0.00 ? 781 TYR A CZ   1 
ATOM   1106 O OH   . TYR A 1 67  ? 12.630  8.969   5.965   1.00 0.00 ? 781 TYR A OH   1 
ATOM   1107 H H    . TYR A 1 67  ? 13.997  2.412   1.664   1.00 0.00 ? 781 TYR A H    1 
ATOM   1108 H HA   . TYR A 1 67  ? 14.054  3.480   4.348   1.00 0.00 ? 781 TYR A HA   1 
ATOM   1109 H HB2  . TYR A 1 67  ? 13.435  4.430   1.914   1.00 0.00 ? 781 TYR A HB2  1 
ATOM   1110 H HB3  . TYR A 1 67  ? 11.805  4.012   2.442   1.00 0.00 ? 781 TYR A HB3  1 
ATOM   1111 H HD1  . TYR A 1 67  ? 14.824  6.007   3.283   1.00 0.00 ? 781 TYR A HD1  1 
ATOM   1112 H HD2  . TYR A 1 67  ? 10.678  5.278   4.136   1.00 0.00 ? 781 TYR A HD2  1 
ATOM   1113 H HE1  . TYR A 1 67  ? 14.749  8.059   4.675   1.00 0.00 ? 781 TYR A HE1  1 
ATOM   1114 H HE2  . TYR A 1 67  ? 10.603  7.329   5.528   1.00 0.00 ? 781 TYR A HE2  1 
ATOM   1115 H HH   . TYR A 1 67  ? 12.538  8.703   6.883   1.00 0.00 ? 781 TYR A HH   1 
ATOM   1116 N N    . TYR A 1 68  ? 11.777  1.271   3.645   1.00 0.00 ? 782 TYR A N    1 
ATOM   1117 C CA   . TYR A 1 68  ? 10.690  0.459   4.257   1.00 0.00 ? 782 TYR A CA   1 
ATOM   1118 C C    . TYR A 1 68  ? 11.217  -0.932  4.590   1.00 0.00 ? 782 TYR A C    1 
ATOM   1119 O O    . TYR A 1 68  ? 11.424  -1.754  3.719   1.00 0.00 ? 782 TYR A O    1 
ATOM   1120 C CB   . TYR A 1 68  ? 9.604   0.372   3.187   1.00 0.00 ? 782 TYR A CB   1 
ATOM   1121 C CG   . TYR A 1 68  ? 8.791   1.644   3.190   1.00 0.00 ? 782 TYR A CG   1 
ATOM   1122 C CD1  . TYR A 1 68  ? 8.289   2.149   4.395   1.00 0.00 ? 782 TYR A CD1  1 
ATOM   1123 C CD2  . TYR A 1 68  ? 8.538   2.317   1.989   1.00 0.00 ? 782 TYR A CD2  1 
ATOM   1124 C CE1  . TYR A 1 68  ? 7.534   3.327   4.400   1.00 0.00 ? 782 TYR A CE1  1 
ATOM   1125 C CE2  . TYR A 1 68  ? 7.782   3.495   1.994   1.00 0.00 ? 782 TYR A CE2  1 
ATOM   1126 C CZ   . TYR A 1 68  ? 7.280   4.001   3.199   1.00 0.00 ? 782 TYR A CZ   1 
ATOM   1127 O OH   . TYR A 1 68  ? 6.536   5.163   3.203   1.00 0.00 ? 782 TYR A OH   1 
ATOM   1128 H H    . TYR A 1 68  ? 12.175  0.992   2.791   1.00 0.00 ? 782 TYR A H    1 
ATOM   1129 H HA   . TYR A 1 68  ? 10.310  0.943   5.144   1.00 0.00 ? 782 TYR A HA   1 
ATOM   1130 H HB2  . TYR A 1 68  ? 10.064  0.237   2.221   1.00 0.00 ? 782 TYR A HB2  1 
ATOM   1131 H HB3  . TYR A 1 68  ? 8.959   -0.467  3.399   1.00 0.00 ? 782 TYR A HB3  1 
ATOM   1132 H HD1  . TYR A 1 68  ? 8.484   1.629   5.322   1.00 0.00 ? 782 TYR A HD1  1 
ATOM   1133 H HD2  . TYR A 1 68  ? 8.925   1.927   1.059   1.00 0.00 ? 782 TYR A HD2  1 
ATOM   1134 H HE1  . TYR A 1 68  ? 7.146   3.717   5.329   1.00 0.00 ? 782 TYR A HE1  1 
ATOM   1135 H HE2  . TYR A 1 68  ? 7.587   4.015   1.067   1.00 0.00 ? 782 TYR A HE2  1 
ATOM   1136 H HH   . TYR A 1 68  ? 6.818   5.693   3.953   1.00 0.00 ? 782 TYR A HH   1 
ATOM   1137 N N    . VAL A 1 69  ? 11.461  -1.197  5.839   1.00 0.00 ? 783 VAL A N    1 
ATOM   1138 C CA   . VAL A 1 69  ? 12.008  -2.524  6.217   1.00 0.00 ? 783 VAL A CA   1 
ATOM   1139 C C    . VAL A 1 69  ? 11.383  -3.006  7.528   1.00 0.00 ? 783 VAL A C    1 
ATOM   1140 O O    . VAL A 1 69  ? 12.071  -3.350  8.468   1.00 0.00 ? 783 VAL A O    1 
ATOM   1141 C CB   . VAL A 1 69  ? 13.508  -2.277  6.382   1.00 0.00 ? 783 VAL A CB   1 
ATOM   1142 C CG1  . VAL A 1 69  ? 13.738  -1.276  7.515   1.00 0.00 ? 783 VAL A CG1  1 
ATOM   1143 C CG2  . VAL A 1 69  ? 14.214  -3.592  6.704   1.00 0.00 ? 783 VAL A CG2  1 
ATOM   1144 H H    . VAL A 1 69  ? 11.303  -0.516  6.526   1.00 0.00 ? 783 VAL A H    1 
ATOM   1145 H HA   . VAL A 1 69  ? 11.830  -3.242  5.430   1.00 0.00 ? 783 VAL A HA   1 
ATOM   1146 H HB   . VAL A 1 69  ? 13.907  -1.873  5.463   1.00 0.00 ? 783 VAL A HB   1 
ATOM   1147 H HG11 . VAL A 1 69  ? 13.603  -1.771  8.466   1.00 0.00 ? 783 VAL A HG11 1 
ATOM   1148 H HG12 . VAL A 1 69  ? 13.029  -0.465  7.427   1.00 0.00 ? 783 VAL A HG12 1 
ATOM   1149 H HG13 . VAL A 1 69  ? 14.742  -0.885  7.452   1.00 0.00 ? 783 VAL A HG13 1 
ATOM   1150 H HG21 . VAL A 1 69  ? 14.815  -3.891  5.858   1.00 0.00 ? 783 VAL A HG21 1 
ATOM   1151 H HG22 . VAL A 1 69  ? 13.478  -4.354  6.910   1.00 0.00 ? 783 VAL A HG22 1 
ATOM   1152 H HG23 . VAL A 1 69  ? 14.847  -3.459  7.568   1.00 0.00 ? 783 VAL A HG23 1 
ATOM   1153 N N    . SER A 1 70  ? 10.080  -3.038  7.591   1.00 0.00 ? 784 SER A N    1 
ATOM   1154 C CA   . SER A 1 70  ? 9.401   -3.508  8.830   1.00 0.00 ? 784 SER A CA   1 
ATOM   1155 C C    . SER A 1 70  ? 8.019   -4.072  8.492   1.00 0.00 ? 784 SER A C    1 
ATOM   1156 O O    . SER A 1 70  ? 7.445   -3.760  7.468   1.00 0.00 ? 784 SER A O    1 
ATOM   1157 C CB   . SER A 1 70  ? 9.269   -2.261  9.706   1.00 0.00 ? 784 SER A CB   1 
ATOM   1158 O OG   . SER A 1 70  ? 10.368  -2.192  10.603  1.00 0.00 ? 784 SER A OG   1 
ATOM   1159 H H    . SER A 1 70  ? 9.547   -2.760  6.817   1.00 0.00 ? 784 SER A H    1 
ATOM   1160 H HA   . SER A 1 70  ? 10.002  -4.255  9.328   1.00 0.00 ? 784 SER A HA   1 
ATOM   1161 H HB2  . SER A 1 70  ? 9.260   -1.381  9.080   1.00 0.00 ? 784 SER A HB2  1 
ATOM   1162 H HB3  . SER A 1 70  ? 8.348   -2.311  10.268  1.00 0.00 ? 784 SER A HB3  1 
ATOM   1163 H HG   . SER A 1 70  ? 10.886  -1.417  10.377  1.00 0.00 ? 784 SER A HG   1 
ATOM   1164 N N    . LYS A 1 71  ? 7.484   -4.904  9.342   1.00 0.00 ? 785 LYS A N    1 
ATOM   1165 C CA   . LYS A 1 71  ? 6.145   -5.495  9.063   1.00 0.00 ? 785 LYS A CA   1 
ATOM   1166 C C    . LYS A 1 71  ? 5.064   -4.411  9.068   1.00 0.00 ? 785 LYS A C    1 
ATOM   1167 O O    . LYS A 1 71  ? 4.619   -3.958  8.032   1.00 0.00 ? 785 LYS A O    1 
ATOM   1168 C CB   . LYS A 1 71  ? 5.911   -6.484  10.207  1.00 0.00 ? 785 LYS A CB   1 
ATOM   1169 C CG   . LYS A 1 71  ? 6.861   -7.674  10.055  1.00 0.00 ? 785 LYS A CG   1 
ATOM   1170 C CD   . LYS A 1 71  ? 7.479   -8.010  11.413  1.00 0.00 ? 785 LYS A CD   1 
ATOM   1171 C CE   . LYS A 1 71  ? 6.372   -8.401  12.395  1.00 0.00 ? 785 LYS A CE   1 
ATOM   1172 N NZ   . LYS A 1 71  ? 6.884   -7.986  13.731  1.00 0.00 ? 785 LYS A NZ   1 
ATOM   1173 H H    . LYS A 1 71  ? 7.965   -5.147  10.160  1.00 0.00 ? 785 LYS A H    1 
ATOM   1174 H HA   . LYS A 1 71  ? 6.154   -6.013  8.115   1.00 0.00 ? 785 LYS A HA   1 
ATOM   1175 H HB2  . LYS A 1 71  ? 6.097   -5.993  11.151  1.00 0.00 ? 785 LYS A HB2  1 
ATOM   1176 H HB3  . LYS A 1 71  ? 4.889   -6.833  10.178  1.00 0.00 ? 785 LYS A HB3  1 
ATOM   1177 H HG2  . LYS A 1 71  ? 6.312   -8.528  9.687   1.00 0.00 ? 785 LYS A HG2  1 
ATOM   1178 H HG3  . LYS A 1 71  ? 7.644   -7.421  9.355   1.00 0.00 ? 785 LYS A HG3  1 
ATOM   1179 H HD2  . LYS A 1 71  ? 8.168   -8.834  11.301  1.00 0.00 ? 785 LYS A HD2  1 
ATOM   1180 H HD3  . LYS A 1 71  ? 8.007   -7.148  11.792  1.00 0.00 ? 785 LYS A HD3  1 
ATOM   1181 H HE2  . LYS A 1 71  ? 5.459   -7.874  12.162  1.00 0.00 ? 785 LYS A HE2  1 
ATOM   1182 H HE3  . LYS A 1 71  ? 6.208   -9.468  12.370  1.00 0.00 ? 785 LYS A HE3  1 
ATOM   1183 H HZ1  . LYS A 1 71  ? 7.110   -6.971  13.716  1.00 0.00 ? 785 LYS A HZ1  1 
ATOM   1184 H HZ2  . LYS A 1 71  ? 7.743   -8.529  13.957  1.00 0.00 ? 785 LYS A HZ2  1 
ATOM   1185 H HZ3  . LYS A 1 71  ? 6.158   -8.169  14.453  1.00 0.00 ? 785 LYS A HZ3  1 
ATOM   1186 N N    . LYS A 1 72  ? 4.635   -3.998  10.228  1.00 0.00 ? 786 LYS A N    1 
ATOM   1187 C CA   . LYS A 1 72  ? 3.570   -2.958  10.307  1.00 0.00 ? 786 LYS A CA   1 
ATOM   1188 C C    . LYS A 1 72  ? 3.944   -1.729  9.474   1.00 0.00 ? 786 LYS A C    1 
ATOM   1189 O O    . LYS A 1 72  ? 3.091   -0.971  9.057   1.00 0.00 ? 786 LYS A O    1 
ATOM   1190 C CB   . LYS A 1 72  ? 3.497   -2.590  11.791  1.00 0.00 ? 786 LYS A CB   1 
ATOM   1191 C CG   . LYS A 1 72  ? 2.145   -1.940  12.089  1.00 0.00 ? 786 LYS A CG   1 
ATOM   1192 C CD   . LYS A 1 72  ? 1.770   -2.188  13.551  1.00 0.00 ? 786 LYS A CD   1 
ATOM   1193 C CE   . LYS A 1 72  ? 2.469   -1.156  14.439  1.00 0.00 ? 786 LYS A CE   1 
ATOM   1194 N NZ   . LYS A 1 72  ? 1.851   -1.328  15.784  1.00 0.00 ? 786 LYS A NZ   1 
ATOM   1195 H H    . LYS A 1 72  ? 5.002   -4.384  11.051  1.00 0.00 ? 786 LYS A H    1 
ATOM   1196 H HA   . LYS A 1 72  ? 2.626   -3.363  9.975   1.00 0.00 ? 786 LYS A HA   1 
ATOM   1197 H HB2  . LYS A 1 72  ? 3.607   -3.483  12.388  1.00 0.00 ? 786 LYS A HB2  1 
ATOM   1198 H HB3  . LYS A 1 72  ? 4.290   -1.897  12.029  1.00 0.00 ? 786 LYS A HB3  1 
ATOM   1199 H HG2  . LYS A 1 72  ? 2.210   -0.877  11.910  1.00 0.00 ? 786 LYS A HG2  1 
ATOM   1200 H HG3  . LYS A 1 72  ? 1.390   -2.368  11.446  1.00 0.00 ? 786 LYS A HG3  1 
ATOM   1201 H HD2  . LYS A 1 72  ? 0.700   -2.100  13.669  1.00 0.00 ? 786 LYS A HD2  1 
ATOM   1202 H HD3  . LYS A 1 72  ? 2.083   -3.181  13.839  1.00 0.00 ? 786 LYS A HD3  1 
ATOM   1203 H HE2  . LYS A 1 72  ? 3.529   -1.356  14.484  1.00 0.00 ? 786 LYS A HE2  1 
ATOM   1204 H HE3  . LYS A 1 72  ? 2.288   -0.158  14.068  1.00 0.00 ? 786 LYS A HE3  1 
ATOM   1205 H HZ1  . LYS A 1 72  ? 2.045   -0.487  16.364  1.00 0.00 ? 786 LYS A HZ1  1 
ATOM   1206 H HZ2  . LYS A 1 72  ? 2.256   -2.168  16.246  1.00 0.00 ? 786 LYS A HZ2  1 
ATOM   1207 H HZ3  . LYS A 1 72  ? 0.824   -1.450  15.681  1.00 0.00 ? 786 LYS A HZ3  1 
ATOM   1208 N N    . LEU A 1 73  ? 5.209   -1.518  9.233   1.00 0.00 ? 787 LEU A N    1 
ATOM   1209 C CA   . LEU A 1 73  ? 5.620   -0.326  8.439   1.00 0.00 ? 787 LEU A CA   1 
ATOM   1210 C C    . LEU A 1 73  ? 5.092   -0.425  7.006   1.00 0.00 ? 787 LEU A C    1 
ATOM   1211 O O    . LEU A 1 73  ? 4.236   0.336   6.598   1.00 0.00 ? 787 LEU A O    1 
ATOM   1212 C CB   . LEU A 1 73  ? 7.150   -0.349  8.449   1.00 0.00 ? 787 LEU A CB   1 
ATOM   1213 C CG   . LEU A 1 73  ? 7.684   0.948   7.835   1.00 0.00 ? 787 LEU A CG   1 
ATOM   1214 C CD1  . LEU A 1 73  ? 7.166   2.145   8.637   1.00 0.00 ? 787 LEU A CD1  1 
ATOM   1215 C CD2  . LEU A 1 73  ? 9.213   0.938   7.866   1.00 0.00 ? 787 LEU A CD2  1 
ATOM   1216 H H    . LEU A 1 73  ? 5.886   -2.134  9.582   1.00 0.00 ? 787 LEU A H    1 
ATOM   1217 H HA   . LEU A 1 73  ? 5.259   0.577   8.908   1.00 0.00 ? 787 LEU A HA   1 
ATOM   1218 H HB2  . LEU A 1 73  ? 7.502   -0.436  9.467   1.00 0.00 ? 787 LEU A HB2  1 
ATOM   1219 H HB3  . LEU A 1 73  ? 7.503   -1.192  7.874   1.00 0.00 ? 787 LEU A HB3  1 
ATOM   1220 H HG   . LEU A 1 73  ? 7.346   1.027   6.812   1.00 0.00 ? 787 LEU A HG   1 
ATOM   1221 H HD11 . LEU A 1 73  ? 6.165   2.388   8.314   1.00 0.00 ? 787 LEU A HD11 1 
ATOM   1222 H HD12 . LEU A 1 73  ? 7.813   2.994   8.474   1.00 0.00 ? 787 LEU A HD12 1 
ATOM   1223 H HD13 . LEU A 1 73  ? 7.156   1.896   9.688   1.00 0.00 ? 787 LEU A HD13 1 
ATOM   1224 H HD21 . LEU A 1 73  ? 9.556   1.268   8.836   1.00 0.00 ? 787 LEU A HD21 1 
ATOM   1225 H HD22 . LEU A 1 73  ? 9.593   1.603   7.105   1.00 0.00 ? 787 LEU A HD22 1 
ATOM   1226 H HD23 . LEU A 1 73  ? 9.571   -0.064  7.680   1.00 0.00 ? 787 LEU A HD23 1 
ATOM   1227 N N    . PHE A 1 74  ? 5.592   -1.352  6.233   1.00 0.00 ? 788 PHE A N    1 
ATOM   1228 C CA   . PHE A 1 74  ? 5.110   -1.480  4.829   1.00 0.00 ? 788 PHE A CA   1 
ATOM   1229 C C    . PHE A 1 74  ? 3.619   -1.817  4.810   1.00 0.00 ? 788 PHE A C    1 
ATOM   1230 O O    . PHE A 1 74  ? 2.849   -1.223  4.080   1.00 0.00 ? 788 PHE A O    1 
ATOM   1231 C CB   . PHE A 1 74  ? 5.922   -2.627  4.225   1.00 0.00 ? 788 PHE A CB   1 
ATOM   1232 C CG   . PHE A 1 74  ? 5.787   -2.583  2.722   1.00 0.00 ? 788 PHE A CG   1 
ATOM   1233 C CD1  . PHE A 1 74  ? 6.680   -1.817  1.964   1.00 0.00 ? 788 PHE A CD1  1 
ATOM   1234 C CD2  . PHE A 1 74  ? 4.755   -3.286  2.091   1.00 0.00 ? 788 PHE A CD2  1 
ATOM   1235 C CE1  . PHE A 1 74  ? 6.551   -1.768  0.571   1.00 0.00 ? 788 PHE A CE1  1 
ATOM   1236 C CE2  . PHE A 1 74  ? 4.625   -3.235  0.698   1.00 0.00 ? 788 PHE A CE2  1 
ATOM   1237 C CZ   . PHE A 1 74  ? 5.522   -2.475  -0.061  1.00 0.00 ? 788 PHE A CZ   1 
ATOM   1238 H H    . PHE A 1 74  ? 6.282   -1.958  6.574   1.00 0.00 ? 788 PHE A H    1 
ATOM   1239 H HA   . PHE A 1 74  ? 5.295   -0.565  4.287   1.00 0.00 ? 788 PHE A HA   1 
ATOM   1240 H HB2  . PHE A 1 74  ? 6.961   -2.518  4.499   1.00 0.00 ? 788 PHE A HB2  1 
ATOM   1241 H HB3  . PHE A 1 74  ? 5.547   -3.569  4.595   1.00 0.00 ? 788 PHE A HB3  1 
ATOM   1242 H HD1  . PHE A 1 74  ? 7.472   -1.270  2.452   1.00 0.00 ? 788 PHE A HD1  1 
ATOM   1243 H HD2  . PHE A 1 74  ? 4.064   -3.873  2.677   1.00 0.00 ? 788 PHE A HD2  1 
ATOM   1244 H HE1  . PHE A 1 74  ? 7.241   -1.180  -0.015  1.00 0.00 ? 788 PHE A HE1  1 
ATOM   1245 H HE2  . PHE A 1 74  ? 3.834   -3.784  0.209   1.00 0.00 ? 788 PHE A HE2  1 
ATOM   1246 H HZ   . PHE A 1 74  ? 5.420   -2.432  -1.134  1.00 0.00 ? 788 PHE A HZ   1 
ATOM   1247 N N    . MET A 1 75  ? 3.200   -2.758  5.615   1.00 0.00 ? 789 MET A N    1 
ATOM   1248 C CA   . MET A 1 75  ? 1.752   -3.117  5.656   1.00 0.00 ? 789 MET A CA   1 
ATOM   1249 C C    . MET A 1 75  ? 0.903   -1.858  5.819   1.00 0.00 ? 789 MET A C    1 
ATOM   1250 O O    . MET A 1 75  ? 0.103   -1.530  4.970   1.00 0.00 ? 789 MET A O    1 
ATOM   1251 C CB   . MET A 1 75  ? 1.605   -4.024  6.879   1.00 0.00 ? 789 MET A CB   1 
ATOM   1252 C CG   . MET A 1 75  ? 1.629   -5.486  6.431   1.00 0.00 ? 789 MET A CG   1 
ATOM   1253 S SD   . MET A 1 75  ? 3.343   -6.021  6.208   1.00 0.00 ? 789 MET A SD   1 
ATOM   1254 C CE   . MET A 1 75  ? 3.139   -6.749  4.563   1.00 0.00 ? 789 MET A CE   1 
ATOM   1255 H H    . MET A 1 75  ? 3.835   -3.218  6.202   1.00 0.00 ? 789 MET A H    1 
ATOM   1256 H HA   . MET A 1 75  ? 1.464   -3.646  4.759   1.00 0.00 ? 789 MET A HA   1 
ATOM   1257 H HB2  . MET A 1 75  ? 2.421   -3.843  7.562   1.00 0.00 ? 789 MET A HB2  1 
ATOM   1258 H HB3  . MET A 1 75  ? 0.668   -3.813  7.373   1.00 0.00 ? 789 MET A HB3  1 
ATOM   1259 H HG2  . MET A 1 75  ? 1.154   -6.101  7.182   1.00 0.00 ? 789 MET A HG2  1 
ATOM   1260 H HG3  . MET A 1 75  ? 1.096   -5.585  5.497   1.00 0.00 ? 789 MET A HG3  1 
ATOM   1261 H HE1  . MET A 1 75  ? 4.091   -7.115  4.211   1.00 0.00 ? 789 MET A HE1  1 
ATOM   1262 H HE2  . MET A 1 75  ? 2.767   -5.998  3.882   1.00 0.00 ? 789 MET A HE2  1 
ATOM   1263 H HE3  . MET A 1 75  ? 2.436   -7.567  4.616   1.00 0.00 ? 789 MET A HE3  1 
ATOM   1264 N N    . ALA A 1 76  ? 1.110   -1.122  6.878   1.00 0.00 ? 790 ALA A N    1 
ATOM   1265 C CA   . ALA A 1 76  ? 0.324   0.128   7.086   1.00 0.00 ? 790 ALA A CA   1 
ATOM   1266 C C    . ALA A 1 76  ? 0.326   0.983   5.815   1.00 0.00 ? 790 ALA A C    1 
ATOM   1267 O O    . ALA A 1 76  ? -0.710  1.388   5.332   1.00 0.00 ? 790 ALA A O    1 
ATOM   1268 C CB   . ALA A 1 76  ? 1.045   0.860   8.221   1.00 0.00 ? 790 ALA A CB   1 
ATOM   1269 H H    . ALA A 1 76  ? 1.772   -1.401  7.546   1.00 0.00 ? 790 ALA A H    1 
ATOM   1270 H HA   . ALA A 1 76  ? -0.688  -0.110  7.377   1.00 0.00 ? 790 ALA A HA   1 
ATOM   1271 H HB1  . ALA A 1 76  ? 0.935   0.298   9.137   1.00 0.00 ? 790 ALA A HB1  1 
ATOM   1272 H HB2  . ALA A 1 76  ? 0.614   1.842   8.347   1.00 0.00 ? 790 ALA A HB2  1 
ATOM   1273 H HB3  . ALA A 1 76  ? 2.093   0.954   7.980   1.00 0.00 ? 790 ALA A HB3  1 
ATOM   1274 N N    . ASP A 1 77  ? 1.477   1.223   5.245   1.00 0.00 ? 791 ASP A N    1 
ATOM   1275 C CA   . ASP A 1 77  ? 1.538   2.044   4.000   1.00 0.00 ? 791 ASP A CA   1 
ATOM   1276 C C    . ASP A 1 77  ? 0.546   1.523   2.955   1.00 0.00 ? 791 ASP A C    1 
ATOM   1277 O O    . ASP A 1 77  ? -0.454  2.151   2.672   1.00 0.00 ? 791 ASP A O    1 
ATOM   1278 C CB   . ASP A 1 77  ? 2.972   1.884   3.497   1.00 0.00 ? 791 ASP A CB   1 
ATOM   1279 C CG   . ASP A 1 77  ? 3.948   2.377   4.567   1.00 0.00 ? 791 ASP A CG   1 
ATOM   1280 O OD1  . ASP A 1 77  ? 3.590   3.290   5.293   1.00 0.00 ? 791 ASP A OD1  1 
ATOM   1281 O OD2  . ASP A 1 77  ? 5.037   1.832   4.643   1.00 0.00 ? 791 ASP A OD2  1 
ATOM   1282 H H    . ASP A 1 77  ? 2.304   0.880   5.647   1.00 0.00 ? 791 ASP A H    1 
ATOM   1283 H HA   . ASP A 1 77  ? 1.335   3.081   4.226   1.00 0.00 ? 791 ASP A HA   1 
ATOM   1284 H HB2  . ASP A 1 77  ? 3.161   0.844   3.289   1.00 0.00 ? 791 ASP A HB2  1 
ATOM   1285 H HB3  . ASP A 1 77  ? 3.103   2.462   2.594   1.00 0.00 ? 791 ASP A HB3  1 
ATOM   1286 N N    . LEU A 1 78  ? 0.810   0.382   2.373   1.00 0.00 ? 792 LEU A N    1 
ATOM   1287 C CA   . LEU A 1 78  ? -0.132  -0.166  1.352   1.00 0.00 ? 792 LEU A CA   1 
ATOM   1288 C C    . LEU A 1 78  ? -1.553  -0.210  1.921   1.00 0.00 ? 792 LEU A C    1 
ATOM   1289 O O    . LEU A 1 78  ? -2.497  0.254   1.307   1.00 0.00 ? 792 LEU A O    1 
ATOM   1290 C CB   . LEU A 1 78  ? 0.374   -1.581  1.063   1.00 0.00 ? 792 LEU A CB   1 
ATOM   1291 C CG   . LEU A 1 78  ? 0.552   -1.764  -0.447  1.00 0.00 ? 792 LEU A CG   1 
ATOM   1292 C CD1  . LEU A 1 78  ? 1.696   -2.743  -0.709  1.00 0.00 ? 792 LEU A CD1  1 
ATOM   1293 C CD2  . LEU A 1 78  ? -0.741  -2.318  -1.051  1.00 0.00 ? 792 LEU A CD2  1 
ATOM   1294 H H    . LEU A 1 78  ? 1.619   -0.117  2.613   1.00 0.00 ? 792 LEU A H    1 
ATOM   1295 H HA   . LEU A 1 78  ? -0.104  0.434   0.454   1.00 0.00 ? 792 LEU A HA   1 
ATOM   1296 H HB2  . LEU A 1 78  ? 1.323   -1.731  1.557   1.00 0.00 ? 792 LEU A HB2  1 
ATOM   1297 H HB3  . LEU A 1 78  ? -0.341  -2.301  1.430   1.00 0.00 ? 792 LEU A HB3  1 
ATOM   1298 H HG   . LEU A 1 78  ? 0.782   -0.811  -0.902  1.00 0.00 ? 792 LEU A HG   1 
ATOM   1299 H HD11 . LEU A 1 78  ? 2.543   -2.208  -1.111  1.00 0.00 ? 792 LEU A HD11 1 
ATOM   1300 H HD12 . LEU A 1 78  ? 1.374   -3.492  -1.417  1.00 0.00 ? 792 LEU A HD12 1 
ATOM   1301 H HD13 . LEU A 1 78  ? 1.978   -3.221  0.217   1.00 0.00 ? 792 LEU A HD13 1 
ATOM   1302 H HD21 . LEU A 1 78  ? -0.838  -3.362  -0.796  1.00 0.00 ? 792 LEU A HD21 1 
ATOM   1303 H HD22 . LEU A 1 78  ? -0.711  -2.211  -2.126  1.00 0.00 ? 792 LEU A HD22 1 
ATOM   1304 H HD23 . LEU A 1 78  ? -1.585  -1.770  -0.658  1.00 0.00 ? 792 LEU A HD23 1 
ATOM   1305 N N    . GLN A 1 79  ? -1.709  -0.742  3.103   1.00 0.00 ? 793 GLN A N    1 
ATOM   1306 C CA   . GLN A 1 79  ? -3.059  -0.778  3.726   1.00 0.00 ? 793 GLN A CA   1 
ATOM   1307 C C    . GLN A 1 79  ? -3.620  0.643   3.800   1.00 0.00 ? 793 GLN A C    1 
ATOM   1308 O O    . GLN A 1 79  ? -4.816  0.854   3.767   1.00 0.00 ? 793 GLN A O    1 
ATOM   1309 C CB   . GLN A 1 79  ? -2.835  -1.351  5.128   1.00 0.00 ? 793 GLN A CB   1 
ATOM   1310 C CG   . GLN A 1 79  ? -4.072  -2.134  5.562   1.00 0.00 ? 793 GLN A CG   1 
ATOM   1311 C CD   . GLN A 1 79  ? -3.642  -3.462  6.190   1.00 0.00 ? 793 GLN A CD   1 
ATOM   1312 O OE1  . GLN A 1 79  ? -4.165  -4.505  5.850   1.00 0.00 ? 793 GLN A OE1  1 
ATOM   1313 N NE2  . GLN A 1 79  ? -2.705  -3.469  7.099   1.00 0.00 ? 793 GLN A NE2  1 
ATOM   1314 H H    . GLN A 1 79  ? -0.934  -1.094  3.588   1.00 0.00 ? 793 GLN A H    1 
ATOM   1315 H HA   . GLN A 1 79  ? -3.720  -1.416  3.158   1.00 0.00 ? 793 GLN A HA   1 
ATOM   1316 H HB2  . GLN A 1 79  ? -1.984  -2.013  5.114   1.00 0.00 ? 793 GLN A HB2  1 
ATOM   1317 H HB3  . GLN A 1 79  ? -2.655  -0.545  5.824   1.00 0.00 ? 793 GLN A HB3  1 
ATOM   1318 H HG2  . GLN A 1 79  ? -4.627  -1.558  6.285   1.00 0.00 ? 793 GLN A HG2  1 
ATOM   1319 H HG3  . GLN A 1 79  ? -4.692  -2.328  4.701   1.00 0.00 ? 793 GLN A HG3  1 
ATOM   1320 H HE21 . GLN A 1 79  ? -2.283  -2.628  7.374   1.00 0.00 ? 793 GLN A HE21 1 
ATOM   1321 H HE22 . GLN A 1 79  ? -2.424  -4.315  7.507   1.00 0.00 ? 793 GLN A HE22 1 
ATOM   1322 N N    . ARG A 1 80  ? -2.758  1.624   3.869   1.00 0.00 ? 794 ARG A N    1 
ATOM   1323 C CA   . ARG A 1 80  ? -3.236  3.034   3.892   1.00 0.00 ? 794 ARG A CA   1 
ATOM   1324 C C    . ARG A 1 80  ? -3.758  3.413   2.507   1.00 0.00 ? 794 ARG A C    1 
ATOM   1325 O O    . ARG A 1 80  ? -4.709  4.155   2.369   1.00 0.00 ? 794 ARG A O    1 
ATOM   1326 C CB   . ARG A 1 80  ? -2.005  3.876   4.240   1.00 0.00 ? 794 ARG A CB   1 
ATOM   1327 C CG   . ARG A 1 80  ? -2.457  5.254   4.723   1.00 0.00 ? 794 ARG A CG   1 
ATOM   1328 C CD   . ARG A 1 80  ? -1.261  6.012   5.299   1.00 0.00 ? 794 ARG A CD   1 
ATOM   1329 N NE   . ARG A 1 80  ? -0.719  5.119   6.366   1.00 0.00 ? 794 ARG A NE   1 
ATOM   1330 C CZ   . ARG A 1 80  ? -1.325  5.011   7.526   1.00 0.00 ? 794 ARG A CZ   1 
ATOM   1331 N NH1  . ARG A 1 80  ? -2.422  5.681   7.781   1.00 0.00 ? 794 ARG A NH1  1 
ATOM   1332 N NH2  . ARG A 1 80  ? -0.827  4.224   8.440   1.00 0.00 ? 794 ARG A NH2  1 
ATOM   1333 H H    . ARG A 1 80  ? -1.797  1.433   3.870   1.00 0.00 ? 794 ARG A H    1 
ATOM   1334 H HA   . ARG A 1 80  ? -4.005  3.163   4.638   1.00 0.00 ? 794 ARG A HA   1 
ATOM   1335 H HB2  . ARG A 1 80  ? -1.442  3.389   5.021   1.00 0.00 ? 794 ARG A HB2  1 
ATOM   1336 H HB3  . ARG A 1 80  ? -1.384  3.987   3.364   1.00 0.00 ? 794 ARG A HB3  1 
ATOM   1337 H HG2  . ARG A 1 80  ? -2.868  5.808   3.892   1.00 0.00 ? 794 ARG A HG2  1 
ATOM   1338 H HG3  . ARG A 1 80  ? -3.212  5.139   5.487   1.00 0.00 ? 794 ARG A HG3  1 
ATOM   1339 H HD2  . ARG A 1 80  ? -0.517  6.178   4.534   1.00 0.00 ? 794 ARG A HD2  1 
ATOM   1340 H HD3  . ARG A 1 80  ? -1.582  6.951   5.722   1.00 0.00 ? 794 ARG A HD3  1 
ATOM   1341 H HE   . ARG A 1 80  ? 0.101   4.609   6.199   1.00 0.00 ? 794 ARG A HE   1 
ATOM   1342 H HH11 . ARG A 1 80  ? -2.816  6.288   7.091   1.00 0.00 ? 794 ARG A HH11 1 
ATOM   1343 H HH12 . ARG A 1 80  ? -2.868  5.585   8.670   1.00 0.00 ? 794 ARG A HH12 1 
ATOM   1344 H HH21 . ARG A 1 80  ? 0.010   3.709   8.253   1.00 0.00 ? 794 ARG A HH21 1 
ATOM   1345 H HH22 . ARG A 1 80  ? -1.282  4.135   9.326   1.00 0.00 ? 794 ARG A HH22 1 
ATOM   1346 N N    . VAL A 1 81  ? -3.141  2.894   1.481   1.00 0.00 ? 795 VAL A N    1 
ATOM   1347 C CA   . VAL A 1 81  ? -3.588  3.208   0.097   1.00 0.00 ? 795 VAL A CA   1 
ATOM   1348 C C    . VAL A 1 81  ? -5.005  2.683   -0.137  1.00 0.00 ? 795 VAL A C    1 
ATOM   1349 O O    . VAL A 1 81  ? -5.858  3.380   -0.650  1.00 0.00 ? 795 VAL A O    1 
ATOM   1350 C CB   . VAL A 1 81  ? -2.592  2.477   -0.806  1.00 0.00 ? 795 VAL A CB   1 
ATOM   1351 C CG1  . VAL A 1 81  ? -2.992  2.670   -2.270  1.00 0.00 ? 795 VAL A CG1  1 
ATOM   1352 C CG2  . VAL A 1 81  ? -1.189  3.044   -0.581  1.00 0.00 ? 795 VAL A CG2  1 
ATOM   1353 H H    . VAL A 1 81  ? -2.378  2.296   1.623   1.00 0.00 ? 795 VAL A H    1 
ATOM   1354 H HA   . VAL A 1 81  ? -3.546  4.273   -0.080  1.00 0.00 ? 795 VAL A HA   1 
ATOM   1355 H HB   . VAL A 1 81  ? -2.597  1.424   -0.568  1.00 0.00 ? 795 VAL A HB   1 
ATOM   1356 H HG11 . VAL A 1 81  ? -2.818  3.696   -2.559  1.00 0.00 ? 795 VAL A HG11 1 
ATOM   1357 H HG12 . VAL A 1 81  ? -4.039  2.434   -2.392  1.00 0.00 ? 795 VAL A HG12 1 
ATOM   1358 H HG13 . VAL A 1 81  ? -2.401  2.015   -2.893  1.00 0.00 ? 795 VAL A HG13 1 
ATOM   1359 H HG21 . VAL A 1 81  ? -0.479  2.232   -0.512  1.00 0.00 ? 795 VAL A HG21 1 
ATOM   1360 H HG22 . VAL A 1 81  ? -1.173  3.615   0.335   1.00 0.00 ? 795 VAL A HG22 1 
ATOM   1361 H HG23 . VAL A 1 81  ? -0.923  3.685   -1.409  1.00 0.00 ? 795 VAL A HG23 1 
ATOM   1362 N N    . PHE A 1 82  ? -5.267  1.458   0.234   1.00 0.00 ? 796 PHE A N    1 
ATOM   1363 C CA   . PHE A 1 82  ? -6.632  0.898   0.017   1.00 0.00 ? 796 PHE A CA   1 
ATOM   1364 C C    . PHE A 1 82  ? -7.655  1.618   0.901   1.00 0.00 ? 796 PHE A C    1 
ATOM   1365 O O    . PHE A 1 82  ? -8.667  2.093   0.427   1.00 0.00 ? 796 PHE A O    1 
ATOM   1366 C CB   . PHE A 1 82  ? -6.529  -0.583  0.403   1.00 0.00 ? 796 PHE A CB   1 
ATOM   1367 C CG   . PHE A 1 82  ? -5.468  -1.271  -0.436  1.00 0.00 ? 796 PHE A CG   1 
ATOM   1368 C CD1  . PHE A 1 82  ? -5.275  -0.908  -1.778  1.00 0.00 ? 796 PHE A CD1  1 
ATOM   1369 C CD2  . PHE A 1 82  ? -4.693  -2.292  0.127   1.00 0.00 ? 796 PHE A CD2  1 
ATOM   1370 C CE1  . PHE A 1 82  ? -4.294  -1.549  -2.543  1.00 0.00 ? 796 PHE A CE1  1 
ATOM   1371 C CE2  . PHE A 1 82  ? -3.718  -2.939  -0.643  1.00 0.00 ? 796 PHE A CE2  1 
ATOM   1372 C CZ   . PHE A 1 82  ? -3.520  -2.568  -1.978  1.00 0.00 ? 796 PHE A CZ   1 
ATOM   1373 H H    . PHE A 1 82  ? -4.565  0.905   0.642   1.00 0.00 ? 796 PHE A H    1 
ATOM   1374 H HA   . PHE A 1 82  ? -6.911  0.993   -1.022  1.00 0.00 ? 796 PHE A HA   1 
ATOM   1375 H HB2  . PHE A 1 82  ? -6.268  -0.665  1.446   1.00 0.00 ? 796 PHE A HB2  1 
ATOM   1376 H HB3  . PHE A 1 82  ? -7.482  -1.063  0.235   1.00 0.00 ? 796 PHE A HB3  1 
ATOM   1377 H HD1  . PHE A 1 82  ? -5.872  -0.123  -2.217  1.00 0.00 ? 796 PHE A HD1  1 
ATOM   1378 H HD2  . PHE A 1 82  ? -4.844  -2.579  1.157   1.00 0.00 ? 796 PHE A HD2  1 
ATOM   1379 H HE1  . PHE A 1 82  ? -4.145  -1.266  -3.575  1.00 0.00 ? 796 PHE A HE1  1 
ATOM   1380 H HE2  . PHE A 1 82  ? -3.117  -3.722  -0.205  1.00 0.00 ? 796 PHE A HE2  1 
ATOM   1381 H HZ   . PHE A 1 82  ? -2.768  -3.066  -2.573  1.00 0.00 ? 796 PHE A HZ   1 
ATOM   1382 N N    . THR A 1 83  ? -7.402  1.713   2.178   1.00 0.00 ? 797 THR A N    1 
ATOM   1383 C CA   . THR A 1 83  ? -8.369  2.414   3.070   1.00 0.00 ? 797 THR A CA   1 
ATOM   1384 C C    . THR A 1 83  ? -8.501  3.881   2.652   1.00 0.00 ? 797 THR A C    1 
ATOM   1385 O O    . THR A 1 83  ? -9.583  4.434   2.626   1.00 0.00 ? 797 THR A O    1 
ATOM   1386 C CB   . THR A 1 83  ? -7.774  2.303   4.476   1.00 0.00 ? 797 THR A CB   1 
ATOM   1387 O OG1  . THR A 1 83  ? -8.659  2.900   5.412   1.00 0.00 ? 797 THR A OG1  1 
ATOM   1388 C CG2  . THR A 1 83  ? -6.425  3.022   4.521   1.00 0.00 ? 797 THR A CG2  1 
ATOM   1389 H H    . THR A 1 83  ? -6.579  1.328   2.548   1.00 0.00 ? 797 THR A H    1 
ATOM   1390 H HA   . THR A 1 83  ? -9.332  1.926   3.033   1.00 0.00 ? 797 THR A HA   1 
ATOM   1391 H HB   . THR A 1 83  ? -7.635  1.262   4.726   1.00 0.00 ? 797 THR A HB   1 
ATOM   1392 H HG1  . THR A 1 83  ? -9.370  2.279   5.585   1.00 0.00 ? 797 THR A HG1  1 
ATOM   1393 H HG21 . THR A 1 83  ? -6.587  4.089   4.565   1.00 0.00 ? 797 THR A HG21 1 
ATOM   1394 H HG22 . THR A 1 83  ? -5.858  2.780   3.635   1.00 0.00 ? 797 THR A HG22 1 
ATOM   1395 H HG23 . THR A 1 83  ? -5.878  2.704   5.397   1.00 0.00 ? 797 THR A HG23 1 
ATOM   1396 N N    . ASN A 1 84  ? -7.410  4.513   2.309   1.00 0.00 ? 798 ASN A N    1 
ATOM   1397 C CA   . ASN A 1 84  ? -7.481  5.933   1.863   1.00 0.00 ? 798 ASN A CA   1 
ATOM   1398 C C    . ASN A 1 84  ? -8.392  6.042   0.641   1.00 0.00 ? 798 ASN A C    1 
ATOM   1399 O O    . ASN A 1 84  ? -9.307  6.843   0.600   1.00 0.00 ? 798 ASN A O    1 
ATOM   1400 C CB   . ASN A 1 84  ? -6.040  6.297   1.492   1.00 0.00 ? 798 ASN A CB   1 
ATOM   1401 C CG   . ASN A 1 84  ? -5.986  7.725   0.944   1.00 0.00 ? 798 ASN A CG   1 
ATOM   1402 O OD1  . ASN A 1 84  ? -7.005  8.320   0.654   1.00 0.00 ? 798 ASN A OD1  1 
ATOM   1403 N ND2  . ASN A 1 84  ? -4.828  8.307   0.793   1.00 0.00 ? 798 ASN A ND2  1 
ATOM   1404 H H    . ASN A 1 84  ? -6.549  4.045   2.320   1.00 0.00 ? 798 ASN A H    1 
ATOM   1405 H HA   . ASN A 1 84  ? -7.838  6.565   2.662   1.00 0.00 ? 798 ASN A HA   1 
ATOM   1406 H HB2  . ASN A 1 84  ? -5.415  6.226   2.370   1.00 0.00 ? 798 ASN A HB2  1 
ATOM   1407 H HB3  . ASN A 1 84  ? -5.679  5.610   0.740   1.00 0.00 ? 798 ASN A HB3  1 
ATOM   1408 H HD21 . ASN A 1 84  ? -4.005  7.829   1.026   1.00 0.00 ? 798 ASN A HD21 1 
ATOM   1409 H HD22 . ASN A 1 84  ? -4.780  9.220   0.442   1.00 0.00 ? 798 ASN A HD22 1 
ATOM   1410 N N    . CYS A 1 85  ? -8.156  5.226   -0.349  1.00 0.00 ? 799 CYS A N    1 
ATOM   1411 C CA   . CYS A 1 85  ? -9.018  5.250   -1.561  1.00 0.00 ? 799 CYS A CA   1 
ATOM   1412 C C    . CYS A 1 85  ? -10.483 5.083   -1.159  1.00 0.00 ? 799 CYS A C    1 
ATOM   1413 O O    . CYS A 1 85  ? -11.337 5.857   -1.541  1.00 0.00 ? 799 CYS A O    1 
ATOM   1414 C CB   . CYS A 1 85  ? -8.551  4.050   -2.386  1.00 0.00 ? 799 CYS A CB   1 
ATOM   1415 S SG   . CYS A 1 85  ? -9.562  3.912   -3.880  1.00 0.00 ? 799 CYS A SG   1 
ATOM   1416 H H    . CYS A 1 85  ? -7.421  4.580   -0.285  1.00 0.00 ? 799 CYS A H    1 
ATOM   1417 H HA   . CYS A 1 85  ? -8.875  6.169   -2.111  1.00 0.00 ? 799 CYS A HA   1 
ATOM   1418 H HB2  . CYS A 1 85  ? -7.516  4.185   -2.662  1.00 0.00 ? 799 CYS A HB2  1 
ATOM   1419 H HB3  . CYS A 1 85  ? -8.652  3.149   -1.799  1.00 0.00 ? 799 CYS A HB3  1 
ATOM   1420 H HG   . CYS A 1 85  ? -9.091  3.358   -4.507  1.00 0.00 ? 799 CYS A HG   1 
ATOM   1421 N N    . LYS A 1 86  ? -10.773 4.082   -0.376  1.00 0.00 ? 800 LYS A N    1 
ATOM   1422 C CA   . LYS A 1 86  ? -12.174 3.868   0.078   1.00 0.00 ? 800 LYS A CA   1 
ATOM   1423 C C    . LYS A 1 86  ? -12.617 5.020   0.983   1.00 0.00 ? 800 LYS A C    1 
ATOM   1424 O O    . LYS A 1 86  ? -13.793 5.252   1.177   1.00 0.00 ? 800 LYS A O    1 
ATOM   1425 C CB   . LYS A 1 86  ? -12.129 2.559   0.868   1.00 0.00 ? 800 LYS A CB   1 
ATOM   1426 C CG   . LYS A 1 86  ? -13.364 1.721   0.539   1.00 0.00 ? 800 LYS A CG   1 
ATOM   1427 C CD   . LYS A 1 86  ? -13.630 0.737   1.680   1.00 0.00 ? 800 LYS A CD   1 
ATOM   1428 C CE   . LYS A 1 86  ? -12.474 -0.261  1.773   1.00 0.00 ? 800 LYS A CE   1 
ATOM   1429 N NZ   . LYS A 1 86  ? -12.266 -0.469  3.233   1.00 0.00 ? 800 LYS A NZ   1 
ATOM   1430 H H    . LYS A 1 86  ? -10.064 3.477   -0.072  1.00 0.00 ? 800 LYS A H    1 
ATOM   1431 H HA   . LYS A 1 86  ? -12.836 3.776   -0.771  1.00 0.00 ? 800 LYS A HA   1 
ATOM   1432 H HB2  . LYS A 1 86  ? -11.239 2.009   0.601   1.00 0.00 ? 800 LYS A HB2  1 
ATOM   1433 H HB3  . LYS A 1 86  ? -12.113 2.778   1.925   1.00 0.00 ? 800 LYS A HB3  1 
ATOM   1434 H HG2  . LYS A 1 86  ? -14.218 2.371   0.417   1.00 0.00 ? 800 LYS A HG2  1 
ATOM   1435 H HG3  . LYS A 1 86  ? -13.195 1.174   -0.377  1.00 0.00 ? 800 LYS A HG3  1 
ATOM   1436 H HD2  . LYS A 1 86  ? -13.713 1.279   2.610   1.00 0.00 ? 800 LYS A HD2  1 
ATOM   1437 H HD3  . LYS A 1 86  ? -14.550 0.205   1.490   1.00 0.00 ? 800 LYS A HD3  1 
ATOM   1438 H HE2  . LYS A 1 86  ? -12.743 -1.192  1.295   1.00 0.00 ? 800 LYS A HE2  1 
ATOM   1439 H HE3  . LYS A 1 86  ? -11.584 0.151   1.321   1.00 0.00 ? 800 LYS A HE3  1 
ATOM   1440 H HZ1  . LYS A 1 86  ? -11.934 0.416   3.666   1.00 0.00 ? 800 LYS A HZ1  1 
ATOM   1441 H HZ2  . LYS A 1 86  ? -11.556 -1.215  3.379   1.00 0.00 ? 800 LYS A HZ2  1 
ATOM   1442 H HZ3  . LYS A 1 86  ? -13.164 -0.755  3.674   1.00 0.00 ? 800 LYS A HZ3  1 
ATOM   1443 N N    . GLU A 1 87  ? -11.682 5.742   1.541   1.00 0.00 ? 801 GLU A N    1 
ATOM   1444 C CA   . GLU A 1 87  ? -12.050 6.872   2.437   1.00 0.00 ? 801 GLU A CA   1 
ATOM   1445 C C    . GLU A 1 87  ? -12.686 8.008   1.635   1.00 0.00 ? 801 GLU A C    1 
ATOM   1446 O O    . GLU A 1 87  ? -13.810 8.399   1.883   1.00 0.00 ? 801 GLU A O    1 
ATOM   1447 C CB   . GLU A 1 87  ? -10.728 7.334   3.050   1.00 0.00 ? 801 GLU A CB   1 
ATOM   1448 C CG   . GLU A 1 87  ? -10.907 7.531   4.556   1.00 0.00 ? 801 GLU A CG   1 
ATOM   1449 C CD   . GLU A 1 87  ? -11.040 6.168   5.236   1.00 0.00 ? 801 GLU A CD   1 
ATOM   1450 O OE1  . GLU A 1 87  ? -10.301 5.270   4.867   1.00 0.00 ? 801 GLU A OE1  1 
ATOM   1451 O OE2  . GLU A 1 87  ? -11.879 6.045   6.113   1.00 0.00 ? 801 GLU A OE2  1 
ATOM   1452 H H    . GLU A 1 87  ? -10.739 5.537   1.375   1.00 0.00 ? 801 GLU A H    1 
ATOM   1453 H HA   . GLU A 1 87  ? -12.724 6.534   3.211   1.00 0.00 ? 801 GLU A HA   1 
ATOM   1454 H HB2  . GLU A 1 87  ? -9.968  6.588   2.871   1.00 0.00 ? 801 GLU A HB2  1 
ATOM   1455 H HB3  . GLU A 1 87  ? -10.430 8.268   2.598   1.00 0.00 ? 801 GLU A HB3  1 
ATOM   1456 H HG2  . GLU A 1 87  ? -10.048 8.051   4.955   1.00 0.00 ? 801 GLU A HG2  1 
ATOM   1457 H HG3  . GLU A 1 87  ? -11.798 8.114   4.739   1.00 0.00 ? 801 GLU A HG3  1 
ATOM   1458 N N    . TYR A 1 88  ? -11.977 8.550   0.682   1.00 0.00 ? 802 TYR A N    1 
ATOM   1459 C CA   . TYR A 1 88  ? -12.552 9.667   -0.119  1.00 0.00 ? 802 TYR A CA   1 
ATOM   1460 C C    . TYR A 1 88  ? -13.567 9.118   -1.136  1.00 0.00 ? 802 TYR A C    1 
ATOM   1461 O O    . TYR A 1 88  ? -14.633 9.669   -1.327  1.00 0.00 ? 802 TYR A O    1 
ATOM   1462 C CB   . TYR A 1 88  ? -11.329 10.357  -0.784  1.00 0.00 ? 802 TYR A CB   1 
ATOM   1463 C CG   . TYR A 1 88  ? -11.120 9.927   -2.230  1.00 0.00 ? 802 TYR A CG   1 
ATOM   1464 C CD1  . TYR A 1 88  ? -12.008 10.360  -3.224  1.00 0.00 ? 802 TYR A CD1  1 
ATOM   1465 C CD2  . TYR A 1 88  ? -10.015 9.141   -2.577  1.00 0.00 ? 802 TYR A CD2  1 
ATOM   1466 C CE1  . TYR A 1 88  ? -11.816 9.973   -4.554  1.00 0.00 ? 802 TYR A CE1  1 
ATOM   1467 C CE2  . TYR A 1 88  ? -9.817  8.761   -3.912  1.00 0.00 ? 802 TYR A CE2  1 
ATOM   1468 C CZ   . TYR A 1 88  ? -10.719 9.175   -4.901  1.00 0.00 ? 802 TYR A CZ   1 
ATOM   1469 O OH   . TYR A 1 88  ? -10.519 8.806   -6.218  1.00 0.00 ? 802 TYR A OH   1 
ATOM   1470 H H    . TYR A 1 88  ? -11.068 8.225   0.497   1.00 0.00 ? 802 TYR A H    1 
ATOM   1471 H HA   . TYR A 1 88  ? -13.043 10.369  0.540   1.00 0.00 ? 802 TYR A HA   1 
ATOM   1472 H HB2  . TYR A 1 88  ? -11.476 11.427  -0.758  1.00 0.00 ? 802 TYR A HB2  1 
ATOM   1473 H HB3  . TYR A 1 88  ? -10.442 10.113  -0.218  1.00 0.00 ? 802 TYR A HB3  1 
ATOM   1474 H HD1  . TYR A 1 88  ? -12.861 10.967  -2.957  1.00 0.00 ? 802 TYR A HD1  1 
ATOM   1475 H HD2  . TYR A 1 88  ? -9.320  8.820   -1.816  1.00 0.00 ? 802 TYR A HD2  1 
ATOM   1476 H HE1  . TYR A 1 88  ? -12.515 10.291  -5.312  1.00 0.00 ? 802 TYR A HE1  1 
ATOM   1477 H HE2  . TYR A 1 88  ? -8.969  8.147   -4.177  1.00 0.00 ? 802 TYR A HE2  1 
ATOM   1478 H HH   . TYR A 1 88  ? -11.374 8.604   -6.608  1.00 0.00 ? 802 TYR A HH   1 
ATOM   1479 N N    . ASN A 1 89  ? -13.225 8.049   -1.803  1.00 0.00 ? 803 ASN A N    1 
ATOM   1480 C CA   . ASN A 1 89  ? -14.143 7.480   -2.831  1.00 0.00 ? 803 ASN A CA   1 
ATOM   1481 C C    . ASN A 1 89  ? -15.392 6.873   -2.181  1.00 0.00 ? 803 ASN A C    1 
ATOM   1482 O O    . ASN A 1 89  ? -15.309 5.844   -1.543  1.00 0.00 ? 803 ASN A O    1 
ATOM   1483 C CB   . ASN A 1 89  ? -13.329 6.378   -3.512  1.00 0.00 ? 803 ASN A CB   1 
ATOM   1484 C CG   . ASN A 1 89  ? -13.794 6.226   -4.961  1.00 0.00 ? 803 ASN A CG   1 
ATOM   1485 O OD1  . ASN A 1 89  ? -14.068 5.132   -5.413  1.00 0.00 ? 803 ASN A OD1  1 
ATOM   1486 N ND2  . ASN A 1 89  ? -13.895 7.287   -5.715  1.00 0.00 ? 803 ASN A ND2  1 
ATOM   1487 H H    . ASN A 1 89  ? -12.353 7.632   -1.642  1.00 0.00 ? 803 ASN A H    1 
ATOM   1488 H HA   . ASN A 1 89  ? -14.415 8.238   -3.549  1.00 0.00 ? 803 ASN A HA   1 
ATOM   1489 H HB2  . ASN A 1 89  ? -12.283 6.638   -3.495  1.00 0.00 ? 803 ASN A HB2  1 
ATOM   1490 H HB3  . ASN A 1 89  ? -13.477 5.446   -2.988  1.00 0.00 ? 803 ASN A HB3  1 
ATOM   1491 H HD21 . ASN A 1 89  ? -13.674 8.169   -5.351  1.00 0.00 ? 803 ASN A HD21 1 
ATOM   1492 H HD22 . ASN A 1 89  ? -14.191 7.200   -6.645  1.00 0.00 ? 803 ASN A HD22 1 
ATOM   1493 N N    . PRO A 1 90  ? -16.523 7.506   -2.389  1.00 0.00 ? 804 PRO A N    1 
ATOM   1494 C CA   . PRO A 1 90  ? -17.788 6.968   -1.836  1.00 0.00 ? 804 PRO A CA   1 
ATOM   1495 C C    . PRO A 1 90  ? -18.078 5.591   -2.447  1.00 0.00 ? 804 PRO A C    1 
ATOM   1496 O O    . PRO A 1 90  ? -17.490 5.231   -3.446  1.00 0.00 ? 804 PRO A O    1 
ATOM   1497 C CB   . PRO A 1 90  ? -18.849 7.985   -2.267  1.00 0.00 ? 804 PRO A CB   1 
ATOM   1498 C CG   . PRO A 1 90  ? -18.224 8.772   -3.376  1.00 0.00 ? 804 PRO A CG   1 
ATOM   1499 C CD   . PRO A 1 90  ? -16.736 8.740   -3.158  1.00 0.00 ? 804 PRO A CD   1 
ATOM   1500 H HA   . PRO A 1 90  ? -17.736 6.905   -0.759  1.00 0.00 ? 804 PRO A HA   1 
ATOM   1501 H HB2  . PRO A 1 90  ? -19.732 7.476   -2.622  1.00 0.00 ? 804 PRO A HB2  1 
ATOM   1502 H HB3  . PRO A 1 90  ? -19.099 8.636   -1.442  1.00 0.00 ? 804 PRO A HB3  1 
ATOM   1503 H HG2  . PRO A 1 90  ? -18.466 8.323   -4.328  1.00 0.00 ? 804 PRO A HG2  1 
ATOM   1504 H HG3  . PRO A 1 90  ? -18.578 9.792   -3.349  1.00 0.00 ? 804 PRO A HG3  1 
ATOM   1505 H HD2  . PRO A 1 90  ? -16.216 8.696   -4.103  1.00 0.00 ? 804 PRO A HD2  1 
ATOM   1506 H HD3  . PRO A 1 90  ? -16.418 9.601   -2.588  1.00 0.00 ? 804 PRO A HD3  1 
ATOM   1507 N N    . PRO A 1 91  ? -18.975 4.861   -1.828  1.00 0.00 ? 805 PRO A N    1 
ATOM   1508 C CA   . PRO A 1 91  ? -19.317 3.503   -2.322  1.00 0.00 ? 805 PRO A CA   1 
ATOM   1509 C C    . PRO A 1 91  ? -20.013 3.578   -3.684  1.00 0.00 ? 805 PRO A C    1 
ATOM   1510 O O    . PRO A 1 91  ? -21.162 3.207   -3.822  1.00 0.00 ? 805 PRO A O    1 
ATOM   1511 C CB   . PRO A 1 91  ? -20.280 2.954   -1.264  1.00 0.00 ? 805 PRO A CB   1 
ATOM   1512 C CG   . PRO A 1 91  ? -20.155 3.865   -0.087  1.00 0.00 ? 805 PRO A CG   1 
ATOM   1513 C CD   . PRO A 1 91  ? -19.716 5.203   -0.610  1.00 0.00 ? 805 PRO A CD   1 
ATOM   1514 H HA   . PRO A 1 91  ? -18.431 2.889   -2.382  1.00 0.00 ? 805 PRO A HA   1 
ATOM   1515 H HB2  . PRO A 1 91  ? -21.293 2.967   -1.640  1.00 0.00 ? 805 PRO A HB2  1 
ATOM   1516 H HB3  . PRO A 1 91  ? -19.999 1.952   -0.985  1.00 0.00 ? 805 PRO A HB3  1 
ATOM   1517 H HG2  . PRO A 1 91  ? -21.108 3.954   0.407   1.00 0.00 ? 805 PRO A HG2  1 
ATOM   1518 H HG3  . PRO A 1 91  ? -19.417 3.479   0.601   1.00 0.00 ? 805 PRO A HG3  1 
ATOM   1519 H HD2  . PRO A 1 91  ? -20.571 5.820   -0.845  1.00 0.00 ? 805 PRO A HD2  1 
ATOM   1520 H HD3  . PRO A 1 91  ? -19.072 5.698   0.102   1.00 0.00 ? 805 PRO A HD3  1 
ATOM   1521 N N    . GLU A 1 92  ? -19.330 4.048   -4.693  1.00 0.00 ? 806 GLU A N    1 
ATOM   1522 C CA   . GLU A 1 92  ? -19.960 4.135   -6.042  1.00 0.00 ? 806 GLU A CA   1 
ATOM   1523 C C    . GLU A 1 92  ? -18.948 4.623   -7.082  1.00 0.00 ? 806 GLU A C    1 
ATOM   1524 O O    . GLU A 1 92  ? -19.259 5.438   -7.928  1.00 0.00 ? 806 GLU A O    1 
ATOM   1525 C CB   . GLU A 1 92  ? -21.091 5.155   -5.885  1.00 0.00 ? 806 GLU A CB   1 
ATOM   1526 C CG   . GLU A 1 92  ? -22.436 4.425   -5.870  1.00 0.00 ? 806 GLU A CG   1 
ATOM   1527 C CD   . GLU A 1 92  ? -23.310 4.944   -7.013  1.00 0.00 ? 806 GLU A CD   1 
ATOM   1528 O OE1  . GLU A 1 92  ? -23.769 6.070   -6.917  1.00 0.00 ? 806 GLU A OE1  1 
ATOM   1529 O OE2  . GLU A 1 92  ? -23.506 4.206   -7.965  1.00 0.00 ? 806 GLU A OE2  1 
ATOM   1530 H H    . GLU A 1 92  ? -18.403 4.340   -4.565  1.00 0.00 ? 806 GLU A H    1 
ATOM   1531 H HA   . GLU A 1 92  ? -20.360 3.174   -6.331  1.00 0.00 ? 806 GLU A HA   1 
ATOM   1532 H HB2  . GLU A 1 92  ? -20.964 5.694   -4.959  1.00 0.00 ? 806 GLU A HB2  1 
ATOM   1533 H HB3  . GLU A 1 92  ? -21.067 5.849   -6.713  1.00 0.00 ? 806 GLU A HB3  1 
ATOM   1534 H HG2  . GLU A 1 92  ? -22.271 3.365   -5.995  1.00 0.00 ? 806 GLU A HG2  1 
ATOM   1535 H HG3  . GLU A 1 92  ? -22.932 4.604   -4.927  1.00 0.00 ? 806 GLU A HG3  1 
ATOM   1536 N N    . SER A 1 93  ? -17.741 4.126   -7.035  1.00 0.00 ? 807 SER A N    1 
ATOM   1537 C CA   . SER A 1 93  ? -16.721 4.560   -8.032  1.00 0.00 ? 807 SER A CA   1 
ATOM   1538 C C    . SER A 1 93  ? -15.719 3.437   -8.300  1.00 0.00 ? 807 SER A C    1 
ATOM   1539 O O    . SER A 1 93  ? -15.655 2.463   -7.578  1.00 0.00 ? 807 SER A O    1 
ATOM   1540 C CB   . SER A 1 93  ? -16.013 5.751   -7.386  1.00 0.00 ? 807 SER A CB   1 
ATOM   1541 O OG   . SER A 1 93  ? -16.628 6.958   -7.813  1.00 0.00 ? 807 SER A OG   1 
ATOM   1542 H H    . SER A 1 93  ? -17.508 3.466   -6.350  1.00 0.00 ? 807 SER A H    1 
ATOM   1543 H HA   . SER A 1 93  ? -17.200 4.863   -8.952  1.00 0.00 ? 807 SER A HA   1 
ATOM   1544 H HB2  . SER A 1 93  ? -16.081 5.672   -6.311  1.00 0.00 ? 807 SER A HB2  1 
ATOM   1545 H HB3  . SER A 1 93  ? -14.973 5.752   -7.683  1.00 0.00 ? 807 SER A HB3  1 
ATOM   1546 H HG   . SER A 1 93  ? -16.195 7.687   -7.363  1.00 0.00 ? 807 SER A HG   1 
ATOM   1547 N N    . GLU A 1 94  ? -14.926 3.577   -9.326  1.00 0.00 ? 808 GLU A N    1 
ATOM   1548 C CA   . GLU A 1 94  ? -13.919 2.526   -9.646  1.00 0.00 ? 808 GLU A CA   1 
ATOM   1549 C C    . GLU A 1 94  ? -12.828 2.486   -8.574  1.00 0.00 ? 808 GLU A C    1 
ATOM   1550 O O    . GLU A 1 94  ? -12.274 1.447   -8.273  1.00 0.00 ? 808 GLU A O    1 
ATOM   1551 C CB   . GLU A 1 94  ? -13.322 2.961   -10.985 1.00 0.00 ? 808 GLU A CB   1 
ATOM   1552 C CG   . GLU A 1 94  ? -14.399 2.909   -12.071 1.00 0.00 ? 808 GLU A CG   1 
ATOM   1553 C CD   . GLU A 1 94  ? -14.375 1.537   -12.748 1.00 0.00 ? 808 GLU A CD   1 
ATOM   1554 O OE1  . GLU A 1 94  ? -13.289 1.051   -13.019 1.00 0.00 ? 808 GLU A OE1  1 
ATOM   1555 O OE2  . GLU A 1 94  ? -15.442 0.996   -12.985 1.00 0.00 ? 808 GLU A OE2  1 
ATOM   1556 H H    . GLU A 1 94  ? -14.994 4.374   -9.891  1.00 0.00 ? 808 GLU A H    1 
ATOM   1557 H HA   . GLU A 1 94  ? -14.395 1.561   -9.739  1.00 0.00 ? 808 GLU A HA   1 
ATOM   1558 H HB2  . GLU A 1 94  ? -12.947 3.970   -10.900 1.00 0.00 ? 808 GLU A HB2  1 
ATOM   1559 H HB3  . GLU A 1 94  ? -12.513 2.298   -11.248 1.00 0.00 ? 808 GLU A HB3  1 
ATOM   1560 H HG2  . GLU A 1 94  ? -15.368 3.075   -11.626 1.00 0.00 ? 808 GLU A HG2  1 
ATOM   1561 H HG3  . GLU A 1 94  ? -14.205 3.676   -12.807 1.00 0.00 ? 808 GLU A HG3  1 
ATOM   1562 N N    . TYR A 1 95  ? -12.506 3.615   -8.009  1.00 0.00 ? 809 TYR A N    1 
ATOM   1563 C CA   . TYR A 1 95  ? -11.441 3.656   -6.968  1.00 0.00 ? 809 TYR A CA   1 
ATOM   1564 C C    . TYR A 1 95  ? -11.738 2.650   -5.856  1.00 0.00 ? 809 TYR A C    1 
ATOM   1565 O O    . TYR A 1 95  ? -10.874 1.912   -5.427  1.00 0.00 ? 809 TYR A O    1 
ATOM   1566 C CB   . TYR A 1 95  ? -11.484 5.083   -6.418  1.00 0.00 ? 809 TYR A CB   1 
ATOM   1567 C CG   . TYR A 1 95  ? -10.235 5.823   -6.835  1.00 0.00 ? 809 TYR A CG   1 
ATOM   1568 C CD1  . TYR A 1 95  ? -9.902  5.923   -8.190  1.00 0.00 ? 809 TYR A CD1  1 
ATOM   1569 C CD2  . TYR A 1 95  ? -9.411  6.410   -5.867  1.00 0.00 ? 809 TYR A CD2  1 
ATOM   1570 C CE1  . TYR A 1 95  ? -8.747  6.612   -8.578  1.00 0.00 ? 809 TYR A CE1  1 
ATOM   1571 C CE2  . TYR A 1 95  ? -8.258  7.101   -6.255  1.00 0.00 ? 809 TYR A CE2  1 
ATOM   1572 C CZ   . TYR A 1 95  ? -7.925  7.199   -7.611  1.00 0.00 ? 809 TYR A CZ   1 
ATOM   1573 O OH   . TYR A 1 95  ? -6.790  7.881   -7.995  1.00 0.00 ? 809 TYR A OH   1 
ATOM   1574 H H    . TYR A 1 95  ? -12.964 4.439   -8.274  1.00 0.00 ? 809 TYR A H    1 
ATOM   1575 H HA   . TYR A 1 95  ? -10.476 3.454   -7.410  1.00 0.00 ? 809 TYR A HA   1 
ATOM   1576 H HB2  . TYR A 1 95  ? -12.350 5.593   -6.811  1.00 0.00 ? 809 TYR A HB2  1 
ATOM   1577 H HB3  . TYR A 1 95  ? -11.541 5.052   -5.340  1.00 0.00 ? 809 TYR A HB3  1 
ATOM   1578 H HD1  . TYR A 1 95  ? -10.537 5.469   -8.937  1.00 0.00 ? 809 TYR A HD1  1 
ATOM   1579 H HD2  . TYR A 1 95  ? -9.671  6.338   -4.821  1.00 0.00 ? 809 TYR A HD2  1 
ATOM   1580 H HE1  . TYR A 1 95  ? -8.490  6.689   -9.624  1.00 0.00 ? 809 TYR A HE1  1 
ATOM   1581 H HE2  . TYR A 1 95  ? -7.624  7.556   -5.509  1.00 0.00 ? 809 TYR A HE2  1 
ATOM   1582 H HH   . TYR A 1 95  ? -7.066  8.669   -8.469  1.00 0.00 ? 809 TYR A HH   1 
ATOM   1583 N N    . TYR A 1 96  ? -12.948 2.622   -5.373  1.00 0.00 ? 810 TYR A N    1 
ATOM   1584 C CA   . TYR A 1 96  ? -13.291 1.648   -4.304  1.00 0.00 ? 810 TYR A CA   1 
ATOM   1585 C C    . TYR A 1 96  ? -13.165 0.229   -4.855  1.00 0.00 ? 810 TYR A C    1 
ATOM   1586 O O    . TYR A 1 96  ? -12.511 -0.619  -4.281  1.00 0.00 ? 810 TYR A O    1 
ATOM   1587 C CB   . TYR A 1 96  ? -14.743 1.966   -3.941  1.00 0.00 ? 810 TYR A CB   1 
ATOM   1588 C CG   . TYR A 1 96  ? -15.218 1.025   -2.859  1.00 0.00 ? 810 TYR A CG   1 
ATOM   1589 C CD1  . TYR A 1 96  ? -15.482 -0.316  -3.163  1.00 0.00 ? 810 TYR A CD1  1 
ATOM   1590 C CD2  . TYR A 1 96  ? -15.406 1.497   -1.555  1.00 0.00 ? 810 TYR A CD2  1 
ATOM   1591 C CE1  . TYR A 1 96  ? -15.927 -1.186  -2.160  1.00 0.00 ? 810 TYR A CE1  1 
ATOM   1592 C CE2  . TYR A 1 96  ? -15.851 0.627   -0.553  1.00 0.00 ? 810 TYR A CE2  1 
ATOM   1593 C CZ   . TYR A 1 96  ? -16.111 -0.714  -0.855  1.00 0.00 ? 810 TYR A CZ   1 
ATOM   1594 O OH   . TYR A 1 96  ? -16.550 -1.572  0.133   1.00 0.00 ? 810 TYR A OH   1 
ATOM   1595 H H    . TYR A 1 96  ? -13.639 3.210   -5.741  1.00 0.00 ? 810 TYR A H    1 
ATOM   1596 H HA   . TYR A 1 96  ? -12.648 1.782   -3.447  1.00 0.00 ? 810 TYR A HA   1 
ATOM   1597 H HB2  . TYR A 1 96  ? -14.808 2.986   -3.586  1.00 0.00 ? 810 TYR A HB2  1 
ATOM   1598 H HB3  . TYR A 1 96  ? -15.365 1.851   -4.817  1.00 0.00 ? 810 TYR A HB3  1 
ATOM   1599 H HD1  . TYR A 1 96  ? -15.339 -0.681  -4.170  1.00 0.00 ? 810 TYR A HD1  1 
ATOM   1600 H HD2  . TYR A 1 96  ? -15.205 2.533   -1.321  1.00 0.00 ? 810 TYR A HD2  1 
ATOM   1601 H HE1  . TYR A 1 96  ? -16.128 -2.222  -2.394  1.00 0.00 ? 810 TYR A HE1  1 
ATOM   1602 H HE2  . TYR A 1 96  ? -15.994 0.992   0.454   1.00 0.00 ? 810 TYR A HE2  1 
ATOM   1603 H HH   . TYR A 1 96  ? -17.129 -2.221  -0.273  1.00 0.00 ? 810 TYR A HH   1 
ATOM   1604 N N    . LYS A 1 97  ? -13.747 -0.012  -5.998  1.00 0.00 ? 811 LYS A N    1 
ATOM   1605 C CA   . LYS A 1 97  ? -13.657 -1.362  -6.630  1.00 0.00 ? 811 LYS A CA   1 
ATOM   1606 C C    . LYS A 1 97  ? -12.211 -1.876  -6.613  1.00 0.00 ? 811 LYS A C    1 
ATOM   1607 O O    . LYS A 1 97  ? -11.867 -2.764  -5.858  1.00 0.00 ? 811 LYS A O    1 
ATOM   1608 C CB   . LYS A 1 97  ? -14.117 -1.144  -8.076  1.00 0.00 ? 811 LYS A CB   1 
ATOM   1609 C CG   . LYS A 1 97  ? -15.576 -0.684  -8.098  1.00 0.00 ? 811 LYS A CG   1 
ATOM   1610 C CD   . LYS A 1 97  ? -16.054 -0.600  -9.548  1.00 0.00 ? 811 LYS A CD   1 
ATOM   1611 C CE   . LYS A 1 97  ? -17.280 0.310   -9.631  1.00 0.00 ? 811 LYS A CE   1 
ATOM   1612 N NZ   . LYS A 1 97  ? -17.063 1.132   -10.856 1.00 0.00 ? 811 LYS A NZ   1 
ATOM   1613 H H    . LYS A 1 97  ? -14.254 0.698   -6.439  1.00 0.00 ? 811 LYS A H    1 
ATOM   1614 H HA   . LYS A 1 97  ? -14.311 -2.059  -6.126  1.00 0.00 ? 811 LYS A HA   1 
ATOM   1615 H HB2  . LYS A 1 97  ? -13.500 -0.389  -8.539  1.00 0.00 ? 811 LYS A HB2  1 
ATOM   1616 H HB3  . LYS A 1 97  ? -14.025 -2.070  -8.625  1.00 0.00 ? 811 LYS A HB3  1 
ATOM   1617 H HG2  . LYS A 1 97  ? -16.185 -1.388  -7.554  1.00 0.00 ? 811 LYS A HG2  1 
ATOM   1618 H HG3  . LYS A 1 97  ? -15.658 0.288   -7.640  1.00 0.00 ? 811 LYS A HG3  1 
ATOM   1619 H HD2  . LYS A 1 97  ? -15.262 -0.192  -10.161 1.00 0.00 ? 811 LYS A HD2  1 
ATOM   1620 H HD3  . LYS A 1 97  ? -16.312 -1.587  -9.901  1.00 0.00 ? 811 LYS A HD3  1 
ATOM   1621 H HE2  . LYS A 1 97  ? -18.180 -0.279  -9.728  1.00 0.00 ? 811 LYS A HE2  1 
ATOM   1622 H HE3  . LYS A 1 97  ? -17.337 0.944   -8.759  1.00 0.00 ? 811 LYS A HE3  1 
ATOM   1623 H HZ1  . LYS A 1 97  ? -16.064 1.415   -10.910 1.00 0.00 ? 811 LYS A HZ1  1 
ATOM   1624 H HZ2  . LYS A 1 97  ? -17.662 1.981   -10.814 1.00 0.00 ? 811 LYS A HZ2  1 
ATOM   1625 H HZ3  . LYS A 1 97  ? -17.311 0.573   -11.697 1.00 0.00 ? 811 LYS A HZ3  1 
ATOM   1626 N N    . CYS A 1 98  ? -11.361 -1.315  -7.433  1.00 0.00 ? 812 CYS A N    1 
ATOM   1627 C CA   . CYS A 1 98  ? -9.940  -1.768  -7.468  1.00 0.00 ? 812 CYS A CA   1 
ATOM   1628 C C    . CYS A 1 98  ? -9.343  -1.798  -6.056  1.00 0.00 ? 812 CYS A C    1 
ATOM   1629 O O    . CYS A 1 98  ? -8.579  -2.680  -5.719  1.00 0.00 ? 812 CYS A O    1 
ATOM   1630 C CB   . CYS A 1 98  ? -9.210  -0.741  -8.345  1.00 0.00 ? 812 CYS A CB   1 
ATOM   1631 S SG   . CYS A 1 98  ? -9.513  0.936   -7.730  1.00 0.00 ? 812 CYS A SG   1 
ATOM   1632 H H    . CYS A 1 98  ? -11.657 -0.604  -8.036  1.00 0.00 ? 812 CYS A H    1 
ATOM   1633 H HA   . CYS A 1 98  ? -9.876  -2.748  -7.917  1.00 0.00 ? 812 CYS A HA   1 
ATOM   1634 H HB2  . CYS A 1 98  ? -8.149  -0.941  -8.324  1.00 0.00 ? 812 CYS A HB2  1 
ATOM   1635 H HB3  . CYS A 1 98  ? -9.569  -0.819  -9.361  1.00 0.00 ? 812 CYS A HB3  1 
ATOM   1636 H HG   . CYS A 1 98  ? -10.279 0.906   -7.151  1.00 0.00 ? 812 CYS A HG   1 
ATOM   1637 N N    . ALA A 1 99  ? -9.683  -0.850  -5.224  1.00 0.00 ? 813 ALA A N    1 
ATOM   1638 C CA   . ALA A 1 99  ? -9.129  -0.855  -3.840  1.00 0.00 ? 813 ALA A CA   1 
ATOM   1639 C C    . ALA A 1 99  ? -9.448  -2.187  -3.158  1.00 0.00 ? 813 ALA A C    1 
ATOM   1640 O O    . ALA A 1 99  ? -8.611  -2.781  -2.508  1.00 0.00 ? 813 ALA A O    1 
ATOM   1641 C CB   . ALA A 1 99  ? -9.832  0.297   -3.121  1.00 0.00 ? 813 ALA A CB   1 
ATOM   1642 H H    . ALA A 1 99  ? -10.308 -0.149  -5.501  1.00 0.00 ? 813 ALA A H    1 
ATOM   1643 H HA   . ALA A 1 99  ? -8.062  -0.690  -3.862  1.00 0.00 ? 813 ALA A HA   1 
ATOM   1644 H HB1  . ALA A 1 99  ? -9.732  1.200   -3.705  1.00 0.00 ? 813 ALA A HB1  1 
ATOM   1645 H HB2  . ALA A 1 99  ? -9.380  0.445   -2.151  1.00 0.00 ? 813 ALA A HB2  1 
ATOM   1646 H HB3  . ALA A 1 99  ? -10.878 0.061   -2.998  1.00 0.00 ? 813 ALA A HB3  1 
ATOM   1647 N N    . ASN A 1 100 ? -10.650 -2.669  -3.319  1.00 0.00 ? 814 ASN A N    1 
ATOM   1648 C CA   . ASN A 1 100 ? -11.018 -3.974  -2.704  1.00 0.00 ? 814 ASN A CA   1 
ATOM   1649 C C    . ASN A 1 100 ? -10.289 -5.110  -3.422  1.00 0.00 ? 814 ASN A C    1 
ATOM   1650 O O    . ASN A 1 100 ? -9.865  -6.074  -2.815  1.00 0.00 ? 814 ASN A O    1 
ATOM   1651 C CB   . ASN A 1 100 ? -12.529 -4.093  -2.920  1.00 0.00 ? 814 ASN A CB   1 
ATOM   1652 C CG   . ASN A 1 100 ? -13.146 -4.899  -1.776  1.00 0.00 ? 814 ASN A CG   1 
ATOM   1653 O OD1  . ASN A 1 100 ? -12.505 -5.143  -0.774  1.00 0.00 ? 814 ASN A OD1  1 
ATOM   1654 N ND2  . ASN A 1 100 ? -14.375 -5.324  -1.884  1.00 0.00 ? 814 ASN A ND2  1 
ATOM   1655 H H    . ASN A 1 100 ? -11.306 -2.179  -3.858  1.00 0.00 ? 814 ASN A H    1 
ATOM   1656 H HA   . ASN A 1 100 ? -10.784 -3.976  -1.650  1.00 0.00 ? 814 ASN A HA   1 
ATOM   1657 H HB2  . ASN A 1 100 ? -12.968 -3.106  -2.944  1.00 0.00 ? 814 ASN A HB2  1 
ATOM   1658 H HB3  . ASN A 1 100 ? -12.719 -4.594  -3.857  1.00 0.00 ? 814 ASN A HB3  1 
ATOM   1659 H HD21 . ASN A 1 100 ? -14.893 -5.127  -2.692  1.00 0.00 ? 814 ASN A HD21 1 
ATOM   1660 H HD22 . ASN A 1 100 ? -14.780 -5.842  -1.157  1.00 0.00 ? 814 ASN A HD22 1 
ATOM   1661 N N    . ILE A 1 101 ? -10.135 -4.997  -4.712  1.00 0.00 ? 815 ILE A N    1 
ATOM   1662 C CA   . ILE A 1 101 ? -9.431  -6.062  -5.478  1.00 0.00 ? 815 ILE A CA   1 
ATOM   1663 C C    . ILE A 1 101 ? -7.954  -6.114  -5.081  1.00 0.00 ? 815 ILE A C    1 
ATOM   1664 O O    . ILE A 1 101 ? -7.471  -7.114  -4.588  1.00 0.00 ? 815 ILE A O    1 
ATOM   1665 C CB   . ILE A 1 101 ? -9.579  -5.648  -6.943  1.00 0.00 ? 815 ILE A CB   1 
ATOM   1666 C CG1  . ILE A 1 101 ? -11.060 -5.649  -7.326  1.00 0.00 ? 815 ILE A CG1  1 
ATOM   1667 C CG2  . ILE A 1 101 ? -8.825  -6.637  -7.832  1.00 0.00 ? 815 ILE A CG2  1 
ATOM   1668 C CD1  . ILE A 1 101 ? -11.266 -4.769  -8.561  1.00 0.00 ? 815 ILE A CD1  1 
ATOM   1669 H H    . ILE A 1 101 ? -10.483 -4.208  -5.179  1.00 0.00 ? 815 ILE A H    1 
ATOM   1670 H HA   . ILE A 1 101 ? -9.901  -7.019  -5.309  1.00 0.00 ? 815 ILE A HA   1 
ATOM   1671 H HB   . ILE A 1 101 ? -9.172  -4.657  -7.081  1.00 0.00 ? 815 ILE A HB   1 
ATOM   1672 H HG12 . ILE A 1 101 ? -11.374 -6.658  -7.546  1.00 0.00 ? 815 ILE A HG12 1 
ATOM   1673 H HG13 . ILE A 1 101 ? -11.644 -5.260  -6.505  1.00 0.00 ? 815 ILE A HG13 1 
ATOM   1674 H HG21 . ILE A 1 101 ? -7.813  -6.290  -7.978  1.00 0.00 ? 815 ILE A HG21 1 
ATOM   1675 H HG22 . ILE A 1 101 ? -9.321  -6.713  -8.788  1.00 0.00 ? 815 ILE A HG22 1 
ATOM   1676 H HG23 . ILE A 1 101 ? -8.807  -7.607  -7.357  1.00 0.00 ? 815 ILE A HG23 1 
ATOM   1677 H HD11 . ILE A 1 101 ? -11.935 -5.265  -9.248  1.00 0.00 ? 815 ILE A HD11 1 
ATOM   1678 H HD12 . ILE A 1 101 ? -10.315 -4.598  -9.044  1.00 0.00 ? 815 ILE A HD12 1 
ATOM   1679 H HD13 . ILE A 1 101 ? -11.694 -3.824  -8.262  1.00 0.00 ? 815 ILE A HD13 1 
ATOM   1680 N N    . LEU A 1 102 ? -7.231  -5.043  -5.282  1.00 0.00 ? 816 LEU A N    1 
ATOM   1681 C CA   . LEU A 1 102 ? -5.789  -5.043  -4.904  1.00 0.00 ? 816 LEU A CA   1 
ATOM   1682 C C    . LEU A 1 102 ? -5.631  -5.450  -3.439  1.00 0.00 ? 816 LEU A C    1 
ATOM   1683 O O    . LEU A 1 102 ? -4.830  -6.298  -3.106  1.00 0.00 ? 816 LEU A O    1 
ATOM   1684 C CB   . LEU A 1 102 ? -5.316  -3.600  -5.104  1.00 0.00 ? 816 LEU A CB   1 
ATOM   1685 C CG   . LEU A 1 102 ? -3.998  -3.580  -5.894  1.00 0.00 ? 816 LEU A CG   1 
ATOM   1686 C CD1  . LEU A 1 102 ? -3.464  -2.147  -5.951  1.00 0.00 ? 816 LEU A CD1  1 
ATOM   1687 C CD2  . LEU A 1 102 ? -2.953  -4.476  -5.221  1.00 0.00 ? 816 LEU A CD2  1 
ATOM   1688 H H    . LEU A 1 102 ? -7.637  -4.243  -5.676  1.00 0.00 ? 816 LEU A H    1 
ATOM   1689 H HA   . LEU A 1 102 ? -5.233  -5.713  -5.543  1.00 0.00 ? 816 LEU A HA   1 
ATOM   1690 H HB2  . LEU A 1 102 ? -6.068  -3.050  -5.649  1.00 0.00 ? 816 LEU A HB2  1 
ATOM   1691 H HB3  . LEU A 1 102 ? -5.164  -3.139  -4.141  1.00 0.00 ? 816 LEU A HB3  1 
ATOM   1692 H HG   . LEU A 1 102 ? -4.177  -3.934  -6.895  1.00 0.00 ? 816 LEU A HG   1 
ATOM   1693 H HD11 . LEU A 1 102 ? -4.247  -1.459  -5.669  1.00 0.00 ? 816 LEU A HD11 1 
ATOM   1694 H HD12 . LEU A 1 102 ? -3.134  -1.925  -6.955  1.00 0.00 ? 816 LEU A HD12 1 
ATOM   1695 H HD13 . LEU A 1 102 ? -2.632  -2.045  -5.269  1.00 0.00 ? 816 LEU A HD13 1 
ATOM   1696 H HD21 . LEU A 1 102 ? -2.563  -3.980  -4.345  1.00 0.00 ? 816 LEU A HD21 1 
ATOM   1697 H HD22 . LEU A 1 102 ? -2.147  -4.667  -5.917  1.00 0.00 ? 816 LEU A HD22 1 
ATOM   1698 H HD23 . LEU A 1 102 ? -3.406  -5.412  -4.934  1.00 0.00 ? 816 LEU A HD23 1 
ATOM   1699 N N    . GLU A 1 103 ? -6.393  -4.858  -2.558  1.00 0.00 ? 817 GLU A N    1 
ATOM   1700 C CA   . GLU A 1 103 ? -6.286  -5.228  -1.117  1.00 0.00 ? 817 GLU A CA   1 
ATOM   1701 C C    . GLU A 1 103 ? -6.431  -6.742  -0.953  1.00 0.00 ? 817 GLU A C    1 
ATOM   1702 O O    . GLU A 1 103 ? -5.744  -7.360  -0.164  1.00 0.00 ? 817 GLU A O    1 
ATOM   1703 C CB   . GLU A 1 103 ? -7.443  -4.497  -0.431  1.00 0.00 ? 817 GLU A CB   1 
ATOM   1704 C CG   . GLU A 1 103 ? -7.353  -4.712  1.082   1.00 0.00 ? 817 GLU A CG   1 
ATOM   1705 C CD   . GLU A 1 103 ? -8.762  -4.762  1.676   1.00 0.00 ? 817 GLU A CD   1 
ATOM   1706 O OE1  . GLU A 1 103 ? -9.391  -5.803  1.572   1.00 0.00 ? 817 GLU A OE1  1 
ATOM   1707 O OE2  . GLU A 1 103 ? -9.187  -3.761  2.229   1.00 0.00 ? 817 GLU A OE2  1 
ATOM   1708 H H    . GLU A 1 103 ? -7.038  -4.178  -2.844  1.00 0.00 ? 817 GLU A H    1 
ATOM   1709 H HA   . GLU A 1 103 ? -5.341  -4.895  -0.714  1.00 0.00 ? 817 GLU A HA   1 
ATOM   1710 H HB2  . GLU A 1 103 ? -7.382  -3.442  -0.648  1.00 0.00 ? 817 GLU A HB2  1 
ATOM   1711 H HB3  . GLU A 1 103 ? -8.381  -4.886  -0.794  1.00 0.00 ? 817 GLU A HB3  1 
ATOM   1712 H HG2  . GLU A 1 103 ? -6.844  -5.643  1.284   1.00 0.00 ? 817 GLU A HG2  1 
ATOM   1713 H HG3  . GLU A 1 103 ? -6.804  -3.897  1.529   1.00 0.00 ? 817 GLU A HG3  1 
ATOM   1714 N N    . LYS A 1 104 ? -7.310  -7.347  -1.706  1.00 0.00 ? 818 LYS A N    1 
ATOM   1715 C CA   . LYS A 1 104 ? -7.465  -8.824  -1.628  1.00 0.00 ? 818 LYS A CA   1 
ATOM   1716 C C    . LYS A 1 104 ? -6.153  -9.496  -2.038  1.00 0.00 ? 818 LYS A C    1 
ATOM   1717 O O    . LYS A 1 104 ? -5.563  -10.243 -1.282  1.00 0.00 ? 818 LYS A O    1 
ATOM   1718 C CB   . LYS A 1 104 ? -8.571  -9.145  -2.634  1.00 0.00 ? 818 LYS A CB   1 
ATOM   1719 C CG   . LYS A 1 104 ? -9.413  -10.324 -2.132  1.00 0.00 ? 818 LYS A CG   1 
ATOM   1720 C CD   . LYS A 1 104 ? -8.511  -11.525 -1.854  1.00 0.00 ? 818 LYS A CD   1 
ATOM   1721 C CE   . LYS A 1 104 ? -9.215  -12.796 -2.321  1.00 0.00 ? 818 LYS A CE   1 
ATOM   1722 N NZ   . LYS A 1 104 ? -8.477  -13.908 -1.659  1.00 0.00 ? 818 LYS A NZ   1 
ATOM   1723 H H    . LYS A 1 104 ? -7.838  -6.836  -2.354  1.00 0.00 ? 818 LYS A H    1 
ATOM   1724 H HA   . LYS A 1 104 ? -7.755  -9.131  -0.636  1.00 0.00 ? 818 LYS A HA   1 
ATOM   1725 H HB2  . LYS A 1 104 ? -9.205  -8.280  -2.757  1.00 0.00 ? 818 LYS A HB2  1 
ATOM   1726 H HB3  . LYS A 1 104 ? -8.126  -9.398  -3.583  1.00 0.00 ? 818 LYS A HB3  1 
ATOM   1727 H HG2  . LYS A 1 104 ? -9.925  -10.044 -1.224  1.00 0.00 ? 818 LYS A HG2  1 
ATOM   1728 H HG3  . LYS A 1 104 ? -10.141 -10.590 -2.884  1.00 0.00 ? 818 LYS A HG3  1 
ATOM   1729 H HD2  . LYS A 1 104 ? -7.582  -11.408 -2.386  1.00 0.00 ? 818 LYS A HD2  1 
ATOM   1730 H HD3  . LYS A 1 104 ? -8.314  -11.591 -0.794  1.00 0.00 ? 818 LYS A HD3  1 
ATOM   1731 H HE2  . LYS A 1 104 ? -10.247 -12.785 -2.005  1.00 0.00 ? 818 LYS A HE2  1 
ATOM   1732 H HE3  . LYS A 1 104 ? -9.150  -12.888 -3.395  1.00 0.00 ? 818 LYS A HE3  1 
ATOM   1733 H HZ1  . LYS A 1 104 ? -8.497  -13.772 -0.628  1.00 0.00 ? 818 LYS A HZ1  1 
ATOM   1734 H HZ2  . LYS A 1 104 ? -7.491  -13.915 -1.990  1.00 0.00 ? 818 LYS A HZ2  1 
ATOM   1735 H HZ3  . LYS A 1 104 ? -8.929  -14.814 -1.898  1.00 0.00 ? 818 LYS A HZ3  1 
ATOM   1736 N N    . PHE A 1 105 ? -5.683  -9.223  -3.225  1.00 0.00 ? 819 PHE A N    1 
ATOM   1737 C CA   . PHE A 1 105 ? -4.394  -9.821  -3.675  1.00 0.00 ? 819 PHE A CA   1 
ATOM   1738 C C    . PHE A 1 105 ? -3.297  -9.507  -2.653  1.00 0.00 ? 819 PHE A C    1 
ATOM   1739 O O    . PHE A 1 105 ? -2.630  -10.390 -2.150  1.00 0.00 ? 819 PHE A O    1 
ATOM   1740 C CB   . PHE A 1 105 ? -4.099  -9.140  -5.020  1.00 0.00 ? 819 PHE A CB   1 
ATOM   1741 C CG   . PHE A 1 105 ? -2.689  -9.461  -5.464  1.00 0.00 ? 819 PHE A CG   1 
ATOM   1742 C CD1  . PHE A 1 105 ? -2.253  -10.791 -5.505  1.00 0.00 ? 819 PHE A CD1  1 
ATOM   1743 C CD2  . PHE A 1 105 ? -1.810  -8.426  -5.805  1.00 0.00 ? 819 PHE A CD2  1 
ATOM   1744 C CE1  . PHE A 1 105 ? -0.944  -11.086 -5.904  1.00 0.00 ? 819 PHE A CE1  1 
ATOM   1745 C CE2  . PHE A 1 105 ? -0.501  -8.721  -6.203  1.00 0.00 ? 819 PHE A CE2  1 
ATOM   1746 C CZ   . PHE A 1 105 ? -0.068  -10.051 -6.252  1.00 0.00 ? 819 PHE A CZ   1 
ATOM   1747 H H    . PHE A 1 105 ? -6.168  -8.607  -3.813  1.00 0.00 ? 819 PHE A H    1 
ATOM   1748 H HA   . PHE A 1 105 ? -4.498  -10.888 -3.805  1.00 0.00 ? 819 PHE A HA   1 
ATOM   1749 H HB2  . PHE A 1 105 ? -4.798  -9.492  -5.762  1.00 0.00 ? 819 PHE A HB2  1 
ATOM   1750 H HB3  . PHE A 1 105 ? -4.203  -8.070  -4.909  1.00 0.00 ? 819 PHE A HB3  1 
ATOM   1751 H HD1  . PHE A 1 105 ? -2.929  -11.589 -5.237  1.00 0.00 ? 819 PHE A HD1  1 
ATOM   1752 H HD2  . PHE A 1 105 ? -2.145  -7.399  -5.766  1.00 0.00 ? 819 PHE A HD2  1 
ATOM   1753 H HE1  . PHE A 1 105 ? -0.610  -12.112 -5.943  1.00 0.00 ? 819 PHE A HE1  1 
ATOM   1754 H HE2  . PHE A 1 105 ? 0.174   -7.922  -6.472  1.00 0.00 ? 819 PHE A HE2  1 
ATOM   1755 H HZ   . PHE A 1 105 ? 0.942   -10.278 -6.557  1.00 0.00 ? 819 PHE A HZ   1 
ATOM   1756 N N    . PHE A 1 106 ? -3.112  -8.251  -2.346  1.00 0.00 ? 820 PHE A N    1 
ATOM   1757 C CA   . PHE A 1 106 ? -2.064  -7.855  -1.361  1.00 0.00 ? 820 PHE A CA   1 
ATOM   1758 C C    . PHE A 1 106 ? -2.133  -8.740  -0.113  1.00 0.00 ? 820 PHE A C    1 
ATOM   1759 O O    . PHE A 1 106 ? -1.196  -9.438  0.211   1.00 0.00 ? 820 PHE A O    1 
ATOM   1760 C CB   . PHE A 1 106 ? -2.399  -6.404  -1.007  1.00 0.00 ? 820 PHE A CB   1 
ATOM   1761 C CG   . PHE A 1 106 ? -1.463  -5.911  0.071   1.00 0.00 ? 820 PHE A CG   1 
ATOM   1762 C CD1  . PHE A 1 106 ? -0.079  -5.947  -0.134  1.00 0.00 ? 820 PHE A CD1  1 
ATOM   1763 C CD2  . PHE A 1 106 ? -1.980  -5.419  1.276   1.00 0.00 ? 820 PHE A CD2  1 
ATOM   1764 C CE1  . PHE A 1 106 ? 0.788   -5.491  0.865   1.00 0.00 ? 820 PHE A CE1  1 
ATOM   1765 C CE2  . PHE A 1 106 ? -1.113  -4.963  2.275   1.00 0.00 ? 820 PHE A CE2  1 
ATOM   1766 C CZ   . PHE A 1 106 ? 0.272   -4.999  2.070   1.00 0.00 ? 820 PHE A CZ   1 
ATOM   1767 H H    . PHE A 1 106 ? -3.662  -7.562  -2.771  1.00 0.00 ? 820 PHE A H    1 
ATOM   1768 H HA   . PHE A 1 106 ? -1.084  -7.915  -1.811  1.00 0.00 ? 820 PHE A HA   1 
ATOM   1769 H HB2  . PHE A 1 106 ? -2.291  -5.786  -1.886  1.00 0.00 ? 820 PHE A HB2  1 
ATOM   1770 H HB3  . PHE A 1 106 ? -3.417  -6.347  -0.651  1.00 0.00 ? 820 PHE A HB3  1 
ATOM   1771 H HD1  . PHE A 1 106 ? 0.319   -6.327  -1.063  1.00 0.00 ? 820 PHE A HD1  1 
ATOM   1772 H HD2  . PHE A 1 106 ? -3.048  -5.392  1.433   1.00 0.00 ? 820 PHE A HD2  1 
ATOM   1773 H HE1  . PHE A 1 106 ? 1.856   -5.518  0.707   1.00 0.00 ? 820 PHE A HE1  1 
ATOM   1774 H HE2  . PHE A 1 106 ? -1.512  -4.583  3.204   1.00 0.00 ? 820 PHE A HE2  1 
ATOM   1775 H HZ   . PHE A 1 106 ? 0.941   -4.646  2.840   1.00 0.00 ? 820 PHE A HZ   1 
ATOM   1776 N N    . PHE A 1 107 ? -3.247  -8.736  0.572   1.00 0.00 ? 821 PHE A N    1 
ATOM   1777 C CA   . PHE A 1 107 ? -3.380  -9.577  1.798   1.00 0.00 ? 821 PHE A CA   1 
ATOM   1778 C C    . PHE A 1 107 ? -2.913  -11.010 1.530   1.00 0.00 ? 821 PHE A C    1 
ATOM   1779 O O    . PHE A 1 107 ? -2.052  -11.526 2.207   1.00 0.00 ? 821 PHE A O    1 
ATOM   1780 C CB   . PHE A 1 107 ? -4.874  -9.562  2.121   1.00 0.00 ? 821 PHE A CB   1 
ATOM   1781 C CG   . PHE A 1 107 ? -5.144  -8.554  3.212   1.00 0.00 ? 821 PHE A CG   1 
ATOM   1782 C CD1  . PHE A 1 107 ? -5.247  -7.194  2.898   1.00 0.00 ? 821 PHE A CD1  1 
ATOM   1783 C CD2  . PHE A 1 107 ? -5.290  -8.980  4.538   1.00 0.00 ? 821 PHE A CD2  1 
ATOM   1784 C CE1  . PHE A 1 107 ? -5.496  -6.259  3.910   1.00 0.00 ? 821 PHE A CE1  1 
ATOM   1785 C CE2  . PHE A 1 107 ? -5.540  -8.044  5.550   1.00 0.00 ? 821 PHE A CE2  1 
ATOM   1786 C CZ   . PHE A 1 107 ? -5.642  -6.684  5.235   1.00 0.00 ? 821 PHE A CZ   1 
ATOM   1787 H H    . PHE A 1 107 ? -3.992  -8.166  0.288   1.00 0.00 ? 821 PHE A H    1 
ATOM   1788 H HA   . PHE A 1 107 ? -2.817  -9.145  2.612   1.00 0.00 ? 821 PHE A HA   1 
ATOM   1789 H HB2  . PHE A 1 107 ? -5.428  -9.292  1.236   1.00 0.00 ? 821 PHE A HB2  1 
ATOM   1790 H HB3  . PHE A 1 107 ? -5.181  -10.543 2.453   1.00 0.00 ? 821 PHE A HB3  1 
ATOM   1791 H HD1  . PHE A 1 107 ? -5.133  -6.866  1.876   1.00 0.00 ? 821 PHE A HD1  1 
ATOM   1792 H HD2  . PHE A 1 107 ? -5.211  -10.029 4.781   1.00 0.00 ? 821 PHE A HD2  1 
ATOM   1793 H HE1  . PHE A 1 107 ? -5.575  -5.209  3.667   1.00 0.00 ? 821 PHE A HE1  1 
ATOM   1794 H HE2  . PHE A 1 107 ? -5.653  -8.372  6.573   1.00 0.00 ? 821 PHE A HE2  1 
ATOM   1795 H HZ   . PHE A 1 107 ? -5.835  -5.962  6.016   1.00 0.00 ? 821 PHE A HZ   1 
ATOM   1796 N N    . SER A 1 108 ? -3.482  -11.661 0.557   1.00 0.00 ? 822 SER A N    1 
ATOM   1797 C CA   . SER A 1 108 ? -3.057  -13.054 0.252   1.00 0.00 ? 822 SER A CA   1 
ATOM   1798 C C    . SER A 1 108 ? -1.553  -13.090 -0.017  1.00 0.00 ? 822 SER A C    1 
ATOM   1799 O O    . SER A 1 108 ? -0.863  -14.014 0.368   1.00 0.00 ? 822 SER A O    1 
ATOM   1800 C CB   . SER A 1 108 ? -3.836  -13.437 -1.008  1.00 0.00 ? 822 SER A CB   1 
ATOM   1801 O OG   . SER A 1 108 ? -3.476  -14.752 -1.405  1.00 0.00 ? 822 SER A OG   1 
ATOM   1802 H H    . SER A 1 108 ? -4.170  -11.229 0.016   1.00 0.00 ? 822 SER A H    1 
ATOM   1803 H HA   . SER A 1 108 ? -3.310  -13.713 1.068   1.00 0.00 ? 822 SER A HA   1 
ATOM   1804 H HB2  . SER A 1 108 ? -4.895  -13.401 -0.801  1.00 0.00 ? 822 SER A HB2  1 
ATOM   1805 H HB3  . SER A 1 108 ? -3.601  -12.744 -1.802  1.00 0.00 ? 822 SER A HB3  1 
ATOM   1806 H HG   . SER A 1 108 ? -3.807  -15.363 -0.743  1.00 0.00 ? 822 SER A HG   1 
ATOM   1807 N N    . LYS A 1 109 ? -1.037  -12.082 -0.664  1.00 0.00 ? 823 LYS A N    1 
ATOM   1808 C CA   . LYS A 1 109 ? 0.423   -12.049 -0.943  1.00 0.00 ? 823 LYS A CA   1 
ATOM   1809 C C    . LYS A 1 109 ? 1.206   -11.916 0.366   1.00 0.00 ? 823 LYS A C    1 
ATOM   1810 O O    . LYS A 1 109 ? 2.081   -12.707 0.657   1.00 0.00 ? 823 LYS A O    1 
ATOM   1811 C CB   . LYS A 1 109 ? 0.632   -10.813 -1.820  1.00 0.00 ? 823 LYS A CB   1 
ATOM   1812 C CG   . LYS A 1 109 ? 1.683   -11.119 -2.890  1.00 0.00 ? 823 LYS A CG   1 
ATOM   1813 C CD   . LYS A 1 109 ? 2.993   -11.539 -2.217  1.00 0.00 ? 823 LYS A CD   1 
ATOM   1814 C CE   . LYS A 1 109 ? 4.166   -11.228 -3.148  1.00 0.00 ? 823 LYS A CE   1 
ATOM   1815 N NZ   . LYS A 1 109 ? 5.376   -11.320 -2.282  1.00 0.00 ? 823 LYS A NZ   1 
ATOM   1816 H H    . LYS A 1 109 ? -1.610  -11.343 -0.958  1.00 0.00 ? 823 LYS A H    1 
ATOM   1817 H HA   . LYS A 1 109 ? 0.724   -12.941 -1.473  1.00 0.00 ? 823 LYS A HA   1 
ATOM   1818 H HB2  . LYS A 1 109 ? -0.300  -10.547 -2.297  1.00 0.00 ? 823 LYS A HB2  1 
ATOM   1819 H HB3  . LYS A 1 109 ? 0.971   -9.990  -1.208  1.00 0.00 ? 823 LYS A HB3  1 
ATOM   1820 H HG2  . LYS A 1 109 ? 1.331   -11.921 -3.521  1.00 0.00 ? 823 LYS A HG2  1 
ATOM   1821 H HG3  . LYS A 1 109 ? 1.854   -10.237 -3.490  1.00 0.00 ? 823 LYS A HG3  1 
ATOM   1822 H HD2  . LYS A 1 109 ? 3.113   -10.994 -1.292  1.00 0.00 ? 823 LYS A HD2  1 
ATOM   1823 H HD3  . LYS A 1 109 ? 2.966   -12.599 -2.009  1.00 0.00 ? 823 LYS A HD3  1 
ATOM   1824 H HE2  . LYS A 1 109 ? 4.216   -11.957 -3.944  1.00 0.00 ? 823 LYS A HE2  1 
ATOM   1825 H HE3  . LYS A 1 109 ? 4.070   -10.233 -3.554  1.00 0.00 ? 823 LYS A HE3  1 
ATOM   1826 H HZ1  . LYS A 1 109 ? 5.576   -12.318 -2.069  1.00 0.00 ? 823 LYS A HZ1  1 
ATOM   1827 H HZ2  . LYS A 1 109 ? 5.209   -10.803 -1.395  1.00 0.00 ? 823 LYS A HZ2  1 
ATOM   1828 H HZ3  . LYS A 1 109 ? 6.190   -10.903 -2.778  1.00 0.00 ? 823 LYS A HZ3  1 
ATOM   1829 N N    . ILE A 1 110 ? 0.896   -10.927 1.164   1.00 0.00 ? 824 ILE A N    1 
ATOM   1830 C CA   . ILE A 1 110 ? 1.628   -10.764 2.455   1.00 0.00 ? 824 ILE A CA   1 
ATOM   1831 C C    . ILE A 1 110 ? 1.417   -12.002 3.332   1.00 0.00 ? 824 ILE A C    1 
ATOM   1832 O O    . ILE A 1 110 ? 2.348   -12.523 3.913   1.00 0.00 ? 824 ILE A O    1 
ATOM   1833 C CB   . ILE A 1 110 ? 1.053   -9.500  3.116   1.00 0.00 ? 824 ILE A CB   1 
ATOM   1834 C CG1  . ILE A 1 110 ? -0.464  -9.610  3.295   1.00 0.00 ? 824 ILE A CG1  1 
ATOM   1835 C CG2  . ILE A 1 110 ? 1.370   -8.287  2.239   1.00 0.00 ? 824 ILE A CG2  1 
ATOM   1836 C CD1  . ILE A 1 110 ? -0.977  -8.355  4.002   1.00 0.00 ? 824 ILE A CD1  1 
ATOM   1837 H H    . ILE A 1 110 ? 0.187   -10.300 0.915   1.00 0.00 ? 824 ILE A H    1 
ATOM   1838 H HA   . ILE A 1 110 ? 2.684   -10.628 2.264   1.00 0.00 ? 824 ILE A HA   1 
ATOM   1839 H HB   . ILE A 1 110 ? 1.510   -9.365  4.083   1.00 0.00 ? 824 ILE A HB   1 
ATOM   1840 H HG12 . ILE A 1 110 ? -0.937  -9.693  2.334   1.00 0.00 ? 824 ILE A HG12 1 
ATOM   1841 H HG13 . ILE A 1 110 ? -0.700  -10.477 3.891   1.00 0.00 ? 824 ILE A HG13 1 
ATOM   1842 H HG21 . ILE A 1 110 ? 2.437   -8.117  2.231   1.00 0.00 ? 824 ILE A HG21 1 
ATOM   1843 H HG22 . ILE A 1 110 ? 0.870   -7.415  2.636   1.00 0.00 ? 824 ILE A HG22 1 
ATOM   1844 H HG23 . ILE A 1 110 ? 1.027   -8.471  1.232   1.00 0.00 ? 824 ILE A HG23 1 
ATOM   1845 H HD11 . ILE A 1 110 ? -1.098  -7.560  3.280   1.00 0.00 ? 824 ILE A HD11 1 
ATOM   1846 H HD12 . ILE A 1 110 ? -0.267  -8.051  4.756   1.00 0.00 ? 824 ILE A HD12 1 
ATOM   1847 H HD13 . ILE A 1 110 ? -1.929  -8.567  4.467   1.00 0.00 ? 824 ILE A HD13 1 
ATOM   1848 N N    . LYS A 1 111 ? 0.216   -12.513 3.390   1.00 0.00 ? 825 LYS A N    1 
ATOM   1849 C CA   . LYS A 1 111 ? -0.028  -13.747 4.185   1.00 0.00 ? 825 LYS A CA   1 
ATOM   1850 C C    . LYS A 1 111 ? 0.933   -14.849 3.736   1.00 0.00 ? 825 LYS A C    1 
ATOM   1851 O O    . LYS A 1 111 ? 1.434   -15.618 4.533   1.00 0.00 ? 825 LYS A O    1 
ATOM   1852 C CB   . LYS A 1 111 ? -1.469  -14.135 3.854   1.00 0.00 ? 825 LYS A CB   1 
ATOM   1853 C CG   . LYS A 1 111 ? -2.192  -14.578 5.126   1.00 0.00 ? 825 LYS A CG   1 
ATOM   1854 C CD   . LYS A 1 111 ? -3.576  -15.130 4.768   1.00 0.00 ? 825 LYS A CD   1 
ATOM   1855 C CE   . LYS A 1 111 ? -4.356  -14.103 3.937   1.00 0.00 ? 825 LYS A CE   1 
ATOM   1856 N NZ   . LYS A 1 111 ? -5.625  -14.792 3.569   1.00 0.00 ? 825 LYS A NZ   1 
ATOM   1857 H H    . LYS A 1 111 ? -0.520  -12.101 2.894   1.00 0.00 ? 825 LYS A H    1 
ATOM   1858 H HA   . LYS A 1 111 ? 0.082   -13.549 5.241   1.00 0.00 ? 825 LYS A HA   1 
ATOM   1859 H HB2  . LYS A 1 111 ? -1.979  -13.285 3.435   1.00 0.00 ? 825 LYS A HB2  1 
ATOM   1860 H HB3  . LYS A 1 111 ? -1.471  -14.941 3.136   1.00 0.00 ? 825 LYS A HB3  1 
ATOM   1861 H HG2  . LYS A 1 111 ? -1.614  -15.347 5.617   1.00 0.00 ? 825 LYS A HG2  1 
ATOM   1862 H HG3  . LYS A 1 111 ? -2.302  -13.734 5.789   1.00 0.00 ? 825 LYS A HG3  1 
ATOM   1863 H HD2  . LYS A 1 111 ? -3.464  -16.041 4.199   1.00 0.00 ? 825 LYS A HD2  1 
ATOM   1864 H HD3  . LYS A 1 111 ? -4.118  -15.338 5.675   1.00 0.00 ? 825 LYS A HD3  1 
ATOM   1865 H HE2  . LYS A 1 111 ? -4.563  -13.222 4.526   1.00 0.00 ? 825 LYS A HE2  1 
ATOM   1866 H HE3  . LYS A 1 111 ? -3.801  -13.840 3.049   1.00 0.00 ? 825 LYS A HE3  1 
ATOM   1867 H HZ1  . LYS A 1 111 ? -5.417  -15.578 2.921   1.00 0.00 ? 825 LYS A HZ1  1 
ATOM   1868 H HZ2  . LYS A 1 111 ? -6.263  -14.117 3.102   1.00 0.00 ? 825 LYS A HZ2  1 
ATOM   1869 H HZ3  . LYS A 1 111 ? -6.080  -15.162 4.428   1.00 0.00 ? 825 LYS A HZ3  1 
ATOM   1870 N N    . GLU A 1 112 ? 1.203   -14.920 2.460   1.00 0.00 ? 826 GLU A N    1 
ATOM   1871 C CA   . GLU A 1 112 ? 2.136   -15.961 1.948   1.00 0.00 ? 826 GLU A CA   1 
ATOM   1872 C C    . GLU A 1 112 ? 3.579   -15.610 2.317   1.00 0.00 ? 826 GLU A C    1 
ATOM   1873 O O    . GLU A 1 112 ? 4.294   -16.404 2.895   1.00 0.00 ? 826 GLU A O    1 
ATOM   1874 C CB   . GLU A 1 112 ? 1.956   -15.933 0.433   1.00 0.00 ? 826 GLU A CB   1 
ATOM   1875 C CG   . GLU A 1 112 ? 0.532   -16.367 0.093   1.00 0.00 ? 826 GLU A CG   1 
ATOM   1876 C CD   . GLU A 1 112 ? 0.503   -17.876 -0.154  1.00 0.00 ? 826 GLU A CD   1 
ATOM   1877 O OE1  . GLU A 1 112 ? 0.957   -18.293 -1.207  1.00 0.00 ? 826 GLU A OE1  1 
ATOM   1878 O OE2  . GLU A 1 112 ? 0.027   -18.590 0.714   1.00 0.00 ? 826 GLU A OE2  1 
ATOM   1879 H H    . GLU A 1 112 ? 0.787   -14.286 1.837   1.00 0.00 ? 826 GLU A H    1 
ATOM   1880 H HA   . GLU A 1 112 ? 1.867   -16.930 2.335   1.00 0.00 ? 826 GLU A HA   1 
ATOM   1881 H HB2  . GLU A 1 112 ? 2.125   -14.930 0.068   1.00 0.00 ? 826 GLU A HB2  1 
ATOM   1882 H HB3  . GLU A 1 112 ? 2.660   -16.609 -0.027  1.00 0.00 ? 826 GLU A HB3  1 
ATOM   1883 H HG2  . GLU A 1 112 ? -0.123  -16.123 0.915   1.00 0.00 ? 826 GLU A HG2  1 
ATOM   1884 H HG3  . GLU A 1 112 ? 0.203   -15.851 -0.791  1.00 0.00 ? 826 GLU A HG3  1 
ATOM   1885 N N    . ALA A 1 113 ? 4.010   -14.424 1.984   1.00 0.00 ? 827 ALA A N    1 
ATOM   1886 C CA   . ALA A 1 113 ? 5.406   -14.016 2.309   1.00 0.00 ? 827 ALA A CA   1 
ATOM   1887 C C    . ALA A 1 113 ? 5.656   -14.110 3.816   1.00 0.00 ? 827 ALA A C    1 
ATOM   1888 O O    . ALA A 1 113 ? 6.784   -14.168 4.264   1.00 0.00 ? 827 ALA A O    1 
ATOM   1889 C CB   . ALA A 1 113 ? 5.503   -12.561 1.845   1.00 0.00 ? 827 ALA A CB   1 
ATOM   1890 H H    . ALA A 1 113 ? 3.415   -13.802 1.517   1.00 0.00 ? 827 ALA A H    1 
ATOM   1891 H HA   . ALA A 1 113 ? 6.112   -14.630 1.770   1.00 0.00 ? 827 ALA A HA   1 
ATOM   1892 H HB1  . ALA A 1 113 ? 4.613   -12.027 2.147   1.00 0.00 ? 827 ALA A HB1  1 
ATOM   1893 H HB2  . ALA A 1 113 ? 5.592   -12.532 0.768   1.00 0.00 ? 827 ALA A HB2  1 
ATOM   1894 H HB3  . ALA A 1 113 ? 6.370   -12.097 2.291   1.00 0.00 ? 827 ALA A HB3  1 
ATOM   1895 N N    . GLY A 1 114 ? 4.615   -14.120 4.602   1.00 0.00 ? 828 GLY A N    1 
ATOM   1896 C CA   . GLY A 1 114 ? 4.797   -14.199 6.078   1.00 0.00 ? 828 GLY A CA   1 
ATOM   1897 C C    . GLY A 1 114 ? 4.894   -12.783 6.649   1.00 0.00 ? 828 GLY A C    1 
ATOM   1898 O O    . GLY A 1 114 ? 5.688   -12.509 7.527   1.00 0.00 ? 828 GLY A O    1 
ATOM   1899 H H    . GLY A 1 114 ? 3.713   -14.067 4.222   1.00 0.00 ? 828 GLY A H    1 
ATOM   1900 H HA2  . GLY A 1 114 ? 3.953   -14.709 6.519   1.00 0.00 ? 828 GLY A HA2  1 
ATOM   1901 H HA3  . GLY A 1 114 ? 5.703   -14.741 6.302   1.00 0.00 ? 828 GLY A HA3  1 
ATOM   1902 N N    . LEU A 1 115 ? 4.094   -11.881 6.152   1.00 0.00 ? 829 LEU A N    1 
ATOM   1903 C CA   . LEU A 1 115 ? 4.144   -10.478 6.655   1.00 0.00 ? 829 LEU A CA   1 
ATOM   1904 C C    . LEU A 1 115 ? 2.909   -10.195 7.534   1.00 0.00 ? 829 LEU A C    1 
ATOM   1905 O O    . LEU A 1 115 ? 2.694   -10.866 8.524   1.00 0.00 ? 829 LEU A O    1 
ATOM   1906 C CB   . LEU A 1 115 ? 4.158   -9.610  5.388   1.00 0.00 ? 829 LEU A CB   1 
ATOM   1907 C CG   . LEU A 1 115 ? 5.269   -10.078 4.442   1.00 0.00 ? 829 LEU A CG   1 
ATOM   1908 C CD1  . LEU A 1 115 ? 5.165   -9.319  3.118   1.00 0.00 ? 829 LEU A CD1  1 
ATOM   1909 C CD2  . LEU A 1 115 ? 6.630   -9.804  5.079   1.00 0.00 ? 829 LEU A CD2  1 
ATOM   1910 H H    . LEU A 1 115 ? 3.465   -12.124 5.441   1.00 0.00 ? 829 LEU A H    1 
ATOM   1911 H HA   . LEU A 1 115 ? 5.049   -10.319 7.223   1.00 0.00 ? 829 LEU A HA   1 
ATOM   1912 H HB2  . LEU A 1 115 ? 3.207   -9.694  4.889   1.00 0.00 ? 829 LEU A HB2  1 
ATOM   1913 H HB3  . LEU A 1 115 ? 4.329   -8.580  5.661   1.00 0.00 ? 829 LEU A HB3  1 
ATOM   1914 H HG   . LEU A 1 115 ? 5.164   -11.137 4.260   1.00 0.00 ? 829 LEU A HG   1 
ATOM   1915 H HD11 . LEU A 1 115 ? 5.817   -8.459  3.144   1.00 0.00 ? 829 LEU A HD11 1 
ATOM   1916 H HD12 . LEU A 1 115 ? 4.146   -8.995  2.967   1.00 0.00 ? 829 LEU A HD12 1 
ATOM   1917 H HD13 . LEU A 1 115 ? 5.460   -9.970  2.307   1.00 0.00 ? 829 LEU A HD13 1 
ATOM   1918 H HD21 . LEU A 1 115 ? 7.041   -10.727 5.459   1.00 0.00 ? 829 LEU A HD21 1 
ATOM   1919 H HD22 . LEU A 1 115 ? 6.513   -9.100  5.889   1.00 0.00 ? 829 LEU A HD22 1 
ATOM   1920 H HD23 . LEU A 1 115 ? 7.296   -9.391  4.337   1.00 0.00 ? 829 LEU A HD23 1 
ATOM   1921 N N    . ILE A 1 116 ? 2.093   -9.222  7.195   1.00 0.00 ? 830 ILE A N    1 
ATOM   1922 C CA   . ILE A 1 116 ? 0.887   -8.934  8.026   1.00 0.00 ? 830 ILE A CA   1 
ATOM   1923 C C    . ILE A 1 116 ? 1.276   -8.721  9.491   1.00 0.00 ? 830 ILE A C    1 
ATOM   1924 O O    . ILE A 1 116 ? 1.477   -9.660  10.235  1.00 0.00 ? 830 ILE A O    1 
ATOM   1925 C CB   . ILE A 1 116 ? -0.001  -10.175 7.879   1.00 0.00 ? 830 ILE A CB   1 
ATOM   1926 C CG1  . ILE A 1 116 ? -0.466  -10.295 6.427   1.00 0.00 ? 830 ILE A CG1  1 
ATOM   1927 C CG2  . ILE A 1 116 ? -1.223  -10.043 8.793   1.00 0.00 ? 830 ILE A CG2  1 
ATOM   1928 C CD1  . ILE A 1 116 ? -1.297  -11.569 6.258   1.00 0.00 ? 830 ILE A CD1  1 
ATOM   1929 H H    . ILE A 1 116 ? 2.265   -8.683  6.399   1.00 0.00 ? 830 ILE A H    1 
ATOM   1930 H HA   . ILE A 1 116 ? 0.373   -8.063  7.647   1.00 0.00 ? 830 ILE A HA   1 
ATOM   1931 H HB   . ILE A 1 116 ? 0.559   -11.056 8.152   1.00 0.00 ? 830 ILE A HB   1 
ATOM   1932 H HG12 . ILE A 1 116 ? -1.069  -9.437  6.172   1.00 0.00 ? 830 ILE A HG12 1 
ATOM   1933 H HG13 . ILE A 1 116 ? 0.394   -10.337 5.776   1.00 0.00 ? 830 ILE A HG13 1 
ATOM   1934 H HG21 . ILE A 1 116 ? -1.789  -9.167  8.512   1.00 0.00 ? 830 ILE A HG21 1 
ATOM   1935 H HG22 . ILE A 1 116 ? -0.897  -9.948  9.818   1.00 0.00 ? 830 ILE A HG22 1 
ATOM   1936 H HG23 . ILE A 1 116 ? -1.844  -10.921 8.693   1.00 0.00 ? 830 ILE A HG23 1 
ATOM   1937 H HD11 . ILE A 1 116 ? -2.326  -11.363 6.511   1.00 0.00 ? 830 ILE A HD11 1 
ATOM   1938 H HD12 . ILE A 1 116 ? -0.912  -12.339 6.911   1.00 0.00 ? 830 ILE A HD12 1 
ATOM   1939 H HD13 . ILE A 1 116 ? -1.238  -11.903 5.233   1.00 0.00 ? 830 ILE A HD13 1 
ATOM   1940 N N    . ASP A 1 117 ? 1.361   -7.491  9.917   1.00 0.00 ? 831 ASP A N    1 
ATOM   1941 C CA   . ASP A 1 117 ? 1.715   -7.217  11.337  1.00 0.00 ? 831 ASP A CA   1 
ATOM   1942 C C    . ASP A 1 117 ? 0.543   -7.577  12.253  1.00 0.00 ? 831 ASP A C    1 
ATOM   1943 O O    . ASP A 1 117 ? 0.711   -7.804  13.434  1.00 0.00 ? 831 ASP A O    1 
ATOM   1944 C CB   . ASP A 1 117 ? 1.992   -5.714  11.391  1.00 0.00 ? 831 ASP A CB   1 
ATOM   1945 C CG   . ASP A 1 117 ? 0.737   -4.949  10.963  1.00 0.00 ? 831 ASP A CG   1 
ATOM   1946 O OD1  . ASP A 1 117 ? 0.307   -5.139  9.837   1.00 0.00 ? 831 ASP A OD1  1 
ATOM   1947 O OD2  . ASP A 1 117 ? 0.226   -4.190  11.769  1.00 0.00 ? 831 ASP A OD2  1 
ATOM   1948 H H    . ASP A 1 117 ? 1.184   -6.747  9.304   1.00 0.00 ? 831 ASP A H    1 
ATOM   1949 H HA   . ASP A 1 117 ? 2.598   -7.773  11.618  1.00 0.00 ? 831 ASP A HA   1 
ATOM   1950 H HB2  . ASP A 1 117 ? 2.259   -5.432  12.399  1.00 0.00 ? 831 ASP A HB2  1 
ATOM   1951 H HB3  . ASP A 1 117 ? 2.806   -5.473  10.722  1.00 0.00 ? 831 ASP A HB3  1 
ATOM   1952 N N    . LYS A 1 118 ? -0.646  -7.639  11.714  1.00 0.00 ? 832 LYS A N    1 
ATOM   1953 C CA   . LYS A 1 118 ? -1.829  -7.987  12.551  1.00 0.00 ? 832 LYS A CA   1 
ATOM   1954 C C    . LYS A 1 118 ? -1.570  -9.274  13.338  1.00 0.00 ? 832 LYS A C    1 
ATOM   1955 O O    . LYS A 1 118 ? -0.598  -9.946  13.034  1.00 0.00 ? 832 LYS A O    1 
ATOM   1956 C CB   . LYS A 1 118 ? -2.963  -8.199  11.547  1.00 0.00 ? 832 LYS A CB   1 
ATOM   1957 C CG   . LYS A 1 118 ? -3.591  -6.850  11.192  1.00 0.00 ? 832 LYS A CG   1 
ATOM   1958 C CD   . LYS A 1 118 ? -5.103  -7.017  11.036  1.00 0.00 ? 832 LYS A CD   1 
ATOM   1959 C CE   . LYS A 1 118 ? -5.392  -8.007  9.905   1.00 0.00 ? 832 LYS A CE   1 
ATOM   1960 N NZ   . LYS A 1 118 ? -6.874  -8.160  9.903   1.00 0.00 ? 832 LYS A NZ   1 
ATOM   1961 O OXT  . LYS A 1 118 ? -2.343  -9.560  14.238  1.00 0.00 ? 832 LYS A OXT  1 
ATOM   1962 H H    . LYS A 1 118 ? -0.761  -7.452  10.758  1.00 0.00 ? 832 LYS A H    1 
ATOM   1963 H HA   . LYS A 1 118 ? -2.068  -7.175  13.222  1.00 0.00 ? 832 LYS A HA   1 
ATOM   1964 H HB2  . LYS A 1 118 ? -2.570  -8.659  10.652  1.00 0.00 ? 832 LYS A HB2  1 
ATOM   1965 H HB3  . LYS A 1 118 ? -3.714  -8.842  11.982  1.00 0.00 ? 832 LYS A HB3  1 
ATOM   1966 H HG2  . LYS A 1 118 ? -3.387  -6.139  11.979  1.00 0.00 ? 832 LYS A HG2  1 
ATOM   1967 H HG3  . LYS A 1 118 ? -3.171  -6.490  10.265  1.00 0.00 ? 832 LYS A HG3  1 
ATOM   1968 H HD2  . LYS A 1 118 ? -5.521  -7.393  11.958  1.00 0.00 ? 832 LYS A HD2  1 
ATOM   1969 H HD3  . LYS A 1 118 ? -5.549  -6.062  10.801  1.00 0.00 ? 832 LYS A HD3  1 
ATOM   1970 H HE2  . LYS A 1 118 ? -5.054  -7.607  8.960   1.00 0.00 ? 832 LYS A HE2  1 
ATOM   1971 H HE3  . LYS A 1 118 ? -4.916  -8.956  10.104  1.00 0.00 ? 832 LYS A HE3  1 
ATOM   1972 H HZ1  . LYS A 1 118 ? -7.188  -8.507  10.832  1.00 0.00 ? 832 LYS A HZ1  1 
ATOM   1973 H HZ2  . LYS A 1 118 ? -7.152  -8.840  9.167   1.00 0.00 ? 832 LYS A HZ2  1 
ATOM   1974 H HZ3  . LYS A 1 118 ? -7.317  -7.239  9.709   1.00 0.00 ? 832 LYS A HZ3  1 
HETATM 1975 N NZ   . NP1 B 2 .   ? -3.638  10.305  -11.745 1.00 0.00 ? 201 NP1 A NZ   1 
HETATM 1976 C CA   . NP1 B 2 .   ? -3.822  10.221  -10.263 1.00 0.00 ? 201 NP1 A CA   1 
HETATM 1977 C CB   . NP1 B 2 .   ? -5.316  10.463  -10.023 1.00 0.00 ? 201 NP1 A CB   1 
HETATM 1978 C CG   . NP1 B 2 .   ? -6.136  9.440   -10.817 1.00 0.00 ? 201 NP1 A CG   1 
HETATM 1979 N NE   . NP1 B 2 .   ? -7.437  10.118  -11.107 1.00 0.00 ? 201 NP1 A NE   1 
HETATM 1980 C CD   . NP1 B 2 .   ? -8.221  10.536  -10.112 1.00 0.00 ? 201 NP1 A CD   1 
HETATM 1981 C CE1  . NP1 B 2 .   ? -7.979  11.794  -9.506  1.00 0.00 ? 201 NP1 A CE1  1 
HETATM 1982 C CE2  . NP1 B 2 .   ? -9.325  9.751   -9.687  1.00 0.00 ? 201 NP1 A CE2  1 
HETATM 1983 N NO2  . NP1 B 2 .   ? -9.577  8.573   -10.249 1.00 0.00 ? 201 NP1 A NO2  1 
HETATM 1984 O OC1  . NP1 B 2 .   ? -8.747  8.084   -11.293 1.00 0.00 ? 201 NP1 A OC1  1 
HETATM 1985 O OC2  . NP1 B 2 .   ? -10.683 7.802   -9.797  1.00 0.00 ? 201 NP1 A OC2  1 
HETATM 1986 C CR1  . NP1 B 2 .   ? -8.819  12.252  -8.465  1.00 0.00 ? 201 NP1 A CR1  1 
HETATM 1987 C CR2  . NP1 B 2 .   ? -10.163 10.215  -8.648  1.00 0.00 ? 201 NP1 A CR2  1 
HETATM 1988 C CZ   . NP1 B 2 .   ? -9.910  11.463  -8.038  1.00 0.00 ? 201 NP1 A CZ   1 
HETATM 1989 C CM   . NP1 B 2 .   ? -10.811 11.954  -6.936  1.00 0.00 ? 201 NP1 A CM   1 
HETATM 1990 H HNZ1 . NP1 B 2 .   ? -3.745  9.358   -12.162 1.00 0.00 ? 201 NP1 A HNZ1 1 
HETATM 1991 H HNZ2 . NP1 B 2 .   ? -4.349  10.947  -12.155 1.00 0.00 ? 201 NP1 A HNZ2 1 
HETATM 1992 H HA1  . NP1 B 2 .   ? -3.540  9.241   -9.906  1.00 0.00 ? 201 NP1 A HA1  1 
HETATM 1993 H HA2  . NP1 B 2 .   ? -3.236  10.982  -9.770  1.00 0.00 ? 201 NP1 A HA2  1 
HETATM 1994 H HB1  . NP1 B 2 .   ? -5.571  11.461  -10.349 1.00 0.00 ? 201 NP1 A HB1  1 
HETATM 1995 H HB2  . NP1 B 2 .   ? -5.533  10.360  -8.970  1.00 0.00 ? 201 NP1 A HB2  1 
HETATM 1996 H HG1  . NP1 B 2 .   ? -6.294  8.545   -10.231 1.00 0.00 ? 201 NP1 A HG1  1 
HETATM 1997 H HG2  . NP1 B 2 .   ? -5.633  9.194   -11.741 1.00 0.00 ? 201 NP1 A HG2  1 
HETATM 1998 H HNE  . NP1 B 2 .   ? -7.653  10.371  -12.029 1.00 0.00 ? 201 NP1 A HNE  1 
HETATM 1999 H HE1  . NP1 B 2 .   ? -7.149  12.400  -9.831  1.00 0.00 ? 201 NP1 A HE1  1 
HETATM 2000 H HR1  . NP1 B 2 .   ? -8.630  13.208  -8.000  1.00 0.00 ? 201 NP1 A HR1  1 
HETATM 2001 H HR2  . NP1 B 2 .   ? -10.998 9.614   -8.319  1.00 0.00 ? 201 NP1 A HR2  1 
HETATM 2002 H HM1  . NP1 B 2 .   ? -11.493 11.168  -6.657  1.00 0.00 ? 201 NP1 A HM1  1 
HETATM 2003 H HM2  . NP1 B 2 .   ? -11.371 12.808  -7.285  1.00 0.00 ? 201 NP1 A HM2  1 
HETATM 2004 H HM3  . NP1 B 2 .   ? -10.215 12.236  -6.081  1.00 0.00 ? 201 NP1 A HM3  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   715 715 GLY GLY A . n 
A 1 2   SER 2   716 716 SER SER A . n 
A 1 3   HIS 3   717 717 HIS HIS A . n 
A 1 4   MET 4   718 718 MET MET A . n 
A 1 5   SER 5   719 719 SER SER A . n 
A 1 6   LYS 6   720 720 LYS LYS A . n 
A 1 7   GLU 7   721 721 GLU GLU A . n 
A 1 8   PRO 8   722 722 PRO PRO A . n 
A 1 9   ARG 9   723 723 ARG ARG A . n 
A 1 10  ASP 10  724 724 ASP ASP A . n 
A 1 11  PRO 11  725 725 PRO PRO A . n 
A 1 12  ASP 12  726 726 ASP ASP A . n 
A 1 13  GLN 13  727 727 GLN GLN A . n 
A 1 14  LEU 14  728 728 LEU LEU A . n 
A 1 15  TYR 15  729 729 TYR TYR A . n 
A 1 16  SER 16  730 730 SER SER A . n 
A 1 17  THR 17  731 731 THR THR A . n 
A 1 18  LEU 18  732 732 LEU LEU A . n 
A 1 19  LYS 19  733 733 LYS LYS A . n 
A 1 20  SER 20  734 734 SER SER A . n 
A 1 21  ILE 21  735 735 ILE ILE A . n 
A 1 22  LEU 22  736 736 LEU LEU A . n 
A 1 23  GLN 23  737 737 GLN GLN A . n 
A 1 24  GLN 24  738 738 GLN GLN A . n 
A 1 25  VAL 25  739 739 VAL VAL A . n 
A 1 26  LYS 26  740 740 LYS LYS A . n 
A 1 27  SER 27  741 741 SER SER A . n 
A 1 28  HIS 28  742 742 HIS HIS A . n 
A 1 29  GLN 29  743 743 GLN GLN A . n 
A 1 30  SER 30  744 744 SER SER A . n 
A 1 31  ALA 31  745 745 ALA ALA A . n 
A 1 32  TRP 32  746 746 TRP TRP A . n 
A 1 33  PRO 33  747 747 PRO PRO A . n 
A 1 34  PHE 34  748 748 PHE PHE A . n 
A 1 35  MET 35  749 749 MET MET A . n 
A 1 36  GLU 36  750 750 GLU GLU A . n 
A 1 37  PRO 37  751 751 PRO PRO A . n 
A 1 38  VAL 38  752 752 VAL VAL A . n 
A 1 39  LYS 39  753 753 LYS LYS A . n 
A 1 40  ARG 40  754 754 ARG ARG A . n 
A 1 41  THR 41  755 755 THR THR A . n 
A 1 42  GLU 42  756 756 GLU GLU A . n 
A 1 43  ALA 43  757 757 ALA ALA A . n 
A 1 44  PRO 44  758 758 PRO PRO A . n 
A 1 45  GLY 45  759 759 GLY GLY A . n 
A 1 46  TYR 46  760 760 TYR TYR A . n 
A 1 47  TYR 47  761 761 TYR TYR A . n 
A 1 48  GLU 48  762 762 GLU GLU A . n 
A 1 49  VAL 49  763 763 VAL VAL A . n 
A 1 50  ILE 50  764 764 ILE ILE A . n 
A 1 51  ARG 51  765 765 ARG ARG A . n 
A 1 52  PHE 52  766 766 PHE PHE A . n 
A 1 53  PRO 53  767 767 PRO PRO A . n 
A 1 54  MET 54  768 768 MET MET A . n 
A 1 55  ASP 55  769 769 ASP ASP A . n 
A 1 56  LEU 56  770 770 LEU LEU A . n 
A 1 57  LYS 57  771 771 LYS LYS A . n 
A 1 58  THR 58  772 772 THR THR A . n 
A 1 59  MET 59  773 773 MET MET A . n 
A 1 60  SER 60  774 774 SER SER A . n 
A 1 61  GLU 61  775 775 GLU GLU A . n 
A 1 62  ARG 62  776 776 ARG ARG A . n 
A 1 63  LEU 63  777 777 LEU LEU A . n 
A 1 64  LYS 64  778 778 LYS LYS A . n 
A 1 65  ASN 65  779 779 ASN ASN A . n 
A 1 66  ARG 66  780 780 ARG ARG A . n 
A 1 67  TYR 67  781 781 TYR TYR A . n 
A 1 68  TYR 68  782 782 TYR TYR A . n 
A 1 69  VAL 69  783 783 VAL VAL A . n 
A 1 70  SER 70  784 784 SER SER A . n 
A 1 71  LYS 71  785 785 LYS LYS A . n 
A 1 72  LYS 72  786 786 LYS LYS A . n 
A 1 73  LEU 73  787 787 LEU LEU A . n 
A 1 74  PHE 74  788 788 PHE PHE A . n 
A 1 75  MET 75  789 789 MET MET A . n 
A 1 76  ALA 76  790 790 ALA ALA A . n 
A 1 77  ASP 77  791 791 ASP ASP A . n 
A 1 78  LEU 78  792 792 LEU LEU A . n 
A 1 79  GLN 79  793 793 GLN GLN A . n 
A 1 80  ARG 80  794 794 ARG ARG A . n 
A 1 81  VAL 81  795 795 VAL VAL A . n 
A 1 82  PHE 82  796 796 PHE PHE A . n 
A 1 83  THR 83  797 797 THR THR A . n 
A 1 84  ASN 84  798 798 ASN ASN A . n 
A 1 85  CYS 85  799 799 CYS CYS A . n 
A 1 86  LYS 86  800 800 LYS LYS A . n 
A 1 87  GLU 87  801 801 GLU GLU A . n 
A 1 88  TYR 88  802 802 TYR TYR A . n 
A 1 89  ASN 89  803 803 ASN ASN A . n 
A 1 90  PRO 90  804 804 PRO PRO A . n 
A 1 91  PRO 91  805 805 PRO PRO A . n 
A 1 92  GLU 92  806 806 GLU GLU A . n 
A 1 93  SER 93  807 807 SER SER A . n 
A 1 94  GLU 94  808 808 GLU GLU A . n 
A 1 95  TYR 95  809 809 TYR TYR A . n 
A 1 96  TYR 96  810 810 TYR TYR A . n 
A 1 97  LYS 97  811 811 LYS LYS A . n 
A 1 98  CYS 98  812 812 CYS CYS A . n 
A 1 99  ALA 99  813 813 ALA ALA A . n 
A 1 100 ASN 100 814 814 ASN ASN A . n 
A 1 101 ILE 101 815 815 ILE ILE A . n 
A 1 102 LEU 102 816 816 LEU LEU A . n 
A 1 103 GLU 103 817 817 GLU GLU A . n 
A 1 104 LYS 104 818 818 LYS LYS A . n 
A 1 105 PHE 105 819 819 PHE PHE A . n 
A 1 106 PHE 106 820 820 PHE PHE A . n 
A 1 107 PHE 107 821 821 PHE PHE A . n 
A 1 108 SER 108 822 822 SER SER A . n 
A 1 109 LYS 109 823 823 LYS LYS A . n 
A 1 110 ILE 110 824 824 ILE ILE A . n 
A 1 111 LYS 111 825 825 LYS LYS A . n 
A 1 112 GLU 112 826 826 GLU GLU A . n 
A 1 113 ALA 113 827 827 ALA ALA A . n 
A 1 114 GLY 114 828 828 GLY GLY A . n 
A 1 115 LEU 115 829 829 LEU LEU A . n 
A 1 116 ILE 116 830 830 ILE ILE A . n 
A 1 117 ASP 117 831 831 ASP ASP A . n 
A 1 118 LYS 118 832 832 LYS LYS A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          NP1 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     201 
_pdbx_nonpoly_scheme.auth_seq_num    201 
_pdbx_nonpoly_scheme.pdb_mon_id      NP1 
_pdbx_nonpoly_scheme.auth_mon_id     NP1 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-08-16 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 717 ? ? 58.15   159.85  
2  1 LYS A 720 ? ? -58.03  87.76   
3  1 GLU A 721 ? ? -175.74 128.39  
4  1 ARG A 723 ? ? 54.83   -87.07  
5  1 HIS A 742 ? ? -52.37  173.16  
6  1 GLU A 762 ? ? -139.46 -60.87  
7  1 PRO A 767 ? ? -59.91  101.73  
8  1 MET A 773 ? ? -52.67  -76.20  
9  1 ASN A 779 ? ? -105.77 47.41   
10 1 ARG A 780 ? ? 31.67   34.79   
11 1 VAL A 783 ? ? -141.58 53.71   
12 1 LYS A 785 ? ? -65.48  -78.98  
13 1 ASP A 791 ? ? -50.62  -71.10  
14 1 PRO A 805 ? ? -66.75  64.27   
15 1 GLU A 806 ? ? -176.14 42.58   
16 1 LYS A 811 ? ? -46.90  -72.66  
17 1 LEU A 829 ? ? -106.51 -121.06 
18 1 ILE A 830 ? ? 53.70   100.27  
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'N-(3-AMINOPROPYL)-4-METHYL-2-NITROBENZENAMINE' 
_pdbx_entity_nonpoly.comp_id     NP1 
#