data_1WUR
# 
_entry.id   1WUR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1WUR         
RCSB  RCSB024023   
WWPDB D_1000024023 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      1WUQ           'GTP cyclohydrolase I Complexed with 8-oxo-GTP' unspecified 
TargetDB ttk003000188.2 .                                               unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WUR 
_pdbx_database_status.recvd_initial_deposition_date   2004-12-08 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tanaka, Y.'                                             1 
'Nakagawa, N.'                                           2 
'Masui, R.'                                              3 
'Yokoyama, S.'                                           4 
'Kuramitsu, S.'                                          5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     
;Novel reaction mechanism of GTP cyclohydrolase I. High-resolution X-ray crystallography of Thermus thermophilus HB8 enzyme complexed with a transition state analogue, the 8-oxoguanine derivative
;
_citation.journal_abbrev            'J.Biochem.(Tokyo)' 
_citation.journal_volume            138 
_citation.page_first                263 
_citation.page_last                 275 
_citation.year                      2005 
_citation.journal_id_ASTM           JOBIAO 
_citation.country                   JA 
_citation.journal_id_ISSN           0021-924X 
_citation.journal_id_CSD            0418 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16169877 
_citation.pdbx_database_id_DOI      10.1093/jb/mvi120 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tanaka, Y.'    1 
primary 'Nakagawa, N.'  2 
primary 'Kuramitsu, S.' 3 
primary 'Yokoyama, S.'  4 
primary 'Masui, R.'     5 
# 
_cell.entry_id           1WUR 
_cell.length_a           160.570 
_cell.length_b           110.560 
_cell.length_c           70.530 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.78 
_cell.angle_gamma        90.00 
_cell.Z_PDB              20 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1WUR 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GTP cyclohydrolase I'                    24571.332 5   3.5.4.16 ? ? ? 
2 non-polymer syn 'ZINC ION'                                65.409    5   ?        ? ? ? 
3 non-polymer syn "8-OXO-2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" 523.180   5   ?        ? ? ? 
4 water       nat water                                     18.015    417 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSPGPQSGGQERGSMERKMVELEDTGLTFATEVDLERLQALAAEWLQVIGEDPGREGLLKTPERVAKAWAFLTRGYRQRL
EEVVGGAVFPAEGSEMVVVKGVEFYSMCEHHLLPFFGKVHIGYIPDGKILGLSKFARIVDMFARRLQVQERLAVQIAEAI
QEVLEPQGVGVVVEGVHLCMMMRGVEKQHSRTVTSAMLGVFRENQKTREEFLSHLRDGTA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSPGPQSGGQERGSMERKMVELEDTGLTFATEVDLERLQALAAEWLQVIGEDPGREGLLKTPERVAKAWAFLTRGYRQRL
EEVVGGAVFPAEGSEMVVVKGVEFYSMCEHHLLPFFGKVHIGYIPDGKILGLSKFARIVDMFARRLQVQERLAVQIAEAI
QEVLEPQGVGVVVEGVHLCMMMRGVEKQHSRTVTSAMLGVFRENQKTREEFLSHLRDGTA
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E 
_entity_poly.pdbx_target_identifier         ttk003000188.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   PRO n 
1 4   GLY n 
1 5   PRO n 
1 6   GLN n 
1 7   SER n 
1 8   GLY n 
1 9   GLY n 
1 10  GLN n 
1 11  GLU n 
1 12  ARG n 
1 13  GLY n 
1 14  SER n 
1 15  MET n 
1 16  GLU n 
1 17  ARG n 
1 18  LYS n 
1 19  MET n 
1 20  VAL n 
1 21  GLU n 
1 22  LEU n 
1 23  GLU n 
1 24  ASP n 
1 25  THR n 
1 26  GLY n 
1 27  LEU n 
1 28  THR n 
1 29  PHE n 
1 30  ALA n 
1 31  THR n 
1 32  GLU n 
1 33  VAL n 
1 34  ASP n 
1 35  LEU n 
1 36  GLU n 
1 37  ARG n 
1 38  LEU n 
1 39  GLN n 
1 40  ALA n 
1 41  LEU n 
1 42  ALA n 
1 43  ALA n 
1 44  GLU n 
1 45  TRP n 
1 46  LEU n 
1 47  GLN n 
1 48  VAL n 
1 49  ILE n 
1 50  GLY n 
1 51  GLU n 
1 52  ASP n 
1 53  PRO n 
1 54  GLY n 
1 55  ARG n 
1 56  GLU n 
1 57  GLY n 
1 58  LEU n 
1 59  LEU n 
1 60  LYS n 
1 61  THR n 
1 62  PRO n 
1 63  GLU n 
1 64  ARG n 
1 65  VAL n 
1 66  ALA n 
1 67  LYS n 
1 68  ALA n 
1 69  TRP n 
1 70  ALA n 
1 71  PHE n 
1 72  LEU n 
1 73  THR n 
1 74  ARG n 
1 75  GLY n 
1 76  TYR n 
1 77  ARG n 
1 78  GLN n 
1 79  ARG n 
1 80  LEU n 
1 81  GLU n 
1 82  GLU n 
1 83  VAL n 
1 84  VAL n 
1 85  GLY n 
1 86  GLY n 
1 87  ALA n 
1 88  VAL n 
1 89  PHE n 
1 90  PRO n 
1 91  ALA n 
1 92  GLU n 
1 93  GLY n 
1 94  SER n 
1 95  GLU n 
1 96  MET n 
1 97  VAL n 
1 98  VAL n 
1 99  VAL n 
1 100 LYS n 
1 101 GLY n 
1 102 VAL n 
1 103 GLU n 
1 104 PHE n 
1 105 TYR n 
1 106 SER n 
1 107 MET n 
1 108 CYS n 
1 109 GLU n 
1 110 HIS n 
1 111 HIS n 
1 112 LEU n 
1 113 LEU n 
1 114 PRO n 
1 115 PHE n 
1 116 PHE n 
1 117 GLY n 
1 118 LYS n 
1 119 VAL n 
1 120 HIS n 
1 121 ILE n 
1 122 GLY n 
1 123 TYR n 
1 124 ILE n 
1 125 PRO n 
1 126 ASP n 
1 127 GLY n 
1 128 LYS n 
1 129 ILE n 
1 130 LEU n 
1 131 GLY n 
1 132 LEU n 
1 133 SER n 
1 134 LYS n 
1 135 PHE n 
1 136 ALA n 
1 137 ARG n 
1 138 ILE n 
1 139 VAL n 
1 140 ASP n 
1 141 MET n 
1 142 PHE n 
1 143 ALA n 
1 144 ARG n 
1 145 ARG n 
1 146 LEU n 
1 147 GLN n 
1 148 VAL n 
1 149 GLN n 
1 150 GLU n 
1 151 ARG n 
1 152 LEU n 
1 153 ALA n 
1 154 VAL n 
1 155 GLN n 
1 156 ILE n 
1 157 ALA n 
1 158 GLU n 
1 159 ALA n 
1 160 ILE n 
1 161 GLN n 
1 162 GLU n 
1 163 VAL n 
1 164 LEU n 
1 165 GLU n 
1 166 PRO n 
1 167 GLN n 
1 168 GLY n 
1 169 VAL n 
1 170 GLY n 
1 171 VAL n 
1 172 VAL n 
1 173 VAL n 
1 174 GLU n 
1 175 GLY n 
1 176 VAL n 
1 177 HIS n 
1 178 LEU n 
1 179 CYS n 
1 180 MET n 
1 181 MET n 
1 182 MET n 
1 183 ARG n 
1 184 GLY n 
1 185 VAL n 
1 186 GLU n 
1 187 LYS n 
1 188 GLN n 
1 189 HIS n 
1 190 SER n 
1 191 ARG n 
1 192 THR n 
1 193 VAL n 
1 194 THR n 
1 195 SER n 
1 196 ALA n 
1 197 MET n 
1 198 LEU n 
1 199 GLY n 
1 200 VAL n 
1 201 PHE n 
1 202 ARG n 
1 203 GLU n 
1 204 ASN n 
1 205 GLN n 
1 206 LYS n 
1 207 THR n 
1 208 ARG n 
1 209 GLU n 
1 210 GLU n 
1 211 PHE n 
1 212 LEU n 
1 213 SER n 
1 214 HIS n 
1 215 LEU n 
1 216 ARG n 
1 217 ASP n 
1 218 GLY n 
1 219 THR n 
1 220 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     274 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET11A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q5SH52_THET8 
_struct_ref.pdbx_db_accession          Q5SH52 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSPGPQSGGQERGSMERKMVELEDTGLTFATEVDLERLQALAAEWLQVIGEDPGREGLLKTPERVAKAWAFLTRGYRQRL
EEVVGGAVFPAEGSEMVVVKGVEFYSMCEHHLLPFFGKVHIGYIPDGKILGLSKFARIVDMFARRLQVQERLAVQIAEAI
QEVLEPQGVGVVVEGVHLCMMMRGVEKQHSRTVTSAMLGVFRENQKTREEFLSHLRDGTA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1WUR A 1 ? 220 ? Q5SH52 1 ? 220 ? 1 220 
2 1 1WUR B 1 ? 220 ? Q5SH52 1 ? 220 ? 1 220 
3 1 1WUR C 1 ? 220 ? Q5SH52 1 ? 220 ? 1 220 
4 1 1WUR D 1 ? 220 ? Q5SH52 1 ? 220 ? 1 220 
5 1 1WUR E 1 ? 220 ? Q5SH52 1 ? 220 ? 1 220 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8DG non-polymer         . "8-OXO-2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O14 P3' 523.180 
ALA 'L-peptide linking' y ALANINE                                   ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                  ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                 ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                   ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                     ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                   ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                    ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                             ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                   ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                    ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                 ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                  ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                    ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                ? 'Zn 2'              65.409  
# 
_exptl.entry_id          1WUR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.46 
_exptl_crystal.density_percent_sol   50.0 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pdbx_details    
'3.4% PEG400, 0.1M HEPES, 2.0M Ammonium sulfate, 15% glycerol, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RIGAKU JUPITER 210' 
_diffrn_detector.pdbx_collection_date   2002-06-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL45XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL45XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
# 
_reflns.entry_id                     1WUR 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            1.82 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   103478 
_reflns.number_obs                   103478 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.0 
_reflns.B_iso_Wilson_estimate        15.2 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.82 
_reflns_shell.d_res_low              1.89 
_reflns_shell.percent_possible_all   98.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1WUR 
_refine.ls_d_res_high                            1.82 
_refine.ls_d_res_low                             46.69 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     99268 
_refine.ls_number_reflns_obs                     99268 
_refine.ls_number_reflns_R_free                  9983 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.206 
_refine.ls_R_factor_R_free                       0.237 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7326 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         165 
_refine_hist.number_atoms_solvent             417 
_refine_hist.number_atoms_total               7908 
_refine_hist.d_res_high                       1.82 
_refine_hist.d_res_low                        46.69 
# 
_struct.entry_id                  1WUR 
_struct.title                     'Structure of GTP cyclohydrolase I Complexed with 8-oxo-dGTP' 
_struct.pdbx_descriptor           'GTP cyclohydrolase I (E.C.3.5.4.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WUR 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;BETA BARREL, PROTEIN-INHIBITOR COMPLEX, HYDROLASE, PTERIDINE, TETRAHYDROBIOPTERIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 2 ? 
J N N 2 ? 
K N N 3 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 2 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'Biological unit is a decamer generated from the symmetry operation with asymmetrical unit: (-x, y, -z)' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 34  ? ILE A 49  ? ASP A 34  ILE A 49  1 ? 16 
HELX_P HELX_P2  2  ARG A 55  ? LEU A 59  ? ARG A 55  LEU A 59  5 ? 5  
HELX_P HELX_P3  3  LYS A 60  ? THR A 73  ? LYS A 60  THR A 73  1 ? 14 
HELX_P HELX_P4  4  ARG A 74  ? GLN A 78  ? ARG A 74  GLN A 78  5 ? 5  
HELX_P HELX_P5  5  ARG A 79  ? GLY A 85  ? ARG A 79  GLY A 85  1 ? 7  
HELX_P HELX_P6  6  GLY A 131 ? ARG A 144 ? GLY A 131 ARG A 144 1 ? 14 
HELX_P HELX_P7  7  VAL A 148 ? GLU A 165 ? VAL A 148 GLU A 165 1 ? 18 
HELX_P HELX_P8  8  LEU A 178 ? MET A 182 ? LEU A 178 MET A 182 1 ? 5  
HELX_P HELX_P9  9  VAL A 200 ? ASN A 204 ? VAL A 200 ASN A 204 1 ? 5  
HELX_P HELX_P10 10 ASN A 204 ? LEU A 215 ? ASN A 204 LEU A 215 1 ? 12 
HELX_P HELX_P11 11 ASP B 34  ? ILE B 49  ? ASP B 34  ILE B 49  1 ? 16 
HELX_P HELX_P12 12 ARG B 55  ? LEU B 59  ? ARG B 55  LEU B 59  5 ? 5  
HELX_P HELX_P13 13 LYS B 60  ? THR B 73  ? LYS B 60  THR B 73  1 ? 14 
HELX_P HELX_P14 14 ARG B 74  ? GLN B 78  ? ARG B 74  GLN B 78  5 ? 5  
HELX_P HELX_P15 15 ARG B 79  ? GLY B 85  ? ARG B 79  GLY B 85  1 ? 7  
HELX_P HELX_P16 16 GLY B 131 ? ARG B 144 ? GLY B 131 ARG B 144 1 ? 14 
HELX_P HELX_P17 17 VAL B 148 ? GLU B 165 ? VAL B 148 GLU B 165 1 ? 18 
HELX_P HELX_P18 18 LEU B 178 ? MET B 182 ? LEU B 178 MET B 182 1 ? 5  
HELX_P HELX_P19 19 VAL B 200 ? ASN B 204 ? VAL B 200 ASN B 204 1 ? 5  
HELX_P HELX_P20 20 ASN B 204 ? LEU B 215 ? ASN B 204 LEU B 215 1 ? 12 
HELX_P HELX_P21 21 ASP C 34  ? ILE C 49  ? ASP C 34  ILE C 49  1 ? 16 
HELX_P HELX_P22 22 ARG C 55  ? LEU C 59  ? ARG C 55  LEU C 59  5 ? 5  
HELX_P HELX_P23 23 LYS C 60  ? THR C 73  ? LYS C 60  THR C 73  1 ? 14 
HELX_P HELX_P24 24 ARG C 74  ? GLN C 78  ? ARG C 74  GLN C 78  5 ? 5  
HELX_P HELX_P25 25 ARG C 79  ? GLY C 85  ? ARG C 79  GLY C 85  1 ? 7  
HELX_P HELX_P26 26 GLY C 131 ? ARG C 144 ? GLY C 131 ARG C 144 1 ? 14 
HELX_P HELX_P27 27 VAL C 148 ? GLU C 165 ? VAL C 148 GLU C 165 1 ? 18 
HELX_P HELX_P28 28 CYS C 179 ? MET C 181 ? CYS C 179 MET C 181 5 ? 3  
HELX_P HELX_P29 29 VAL C 200 ? ASN C 204 ? VAL C 200 ASN C 204 1 ? 5  
HELX_P HELX_P30 30 ASN C 204 ? ARG C 216 ? ASN C 204 ARG C 216 1 ? 13 
HELX_P HELX_P31 31 ASP D 34  ? ILE D 49  ? ASP D 34  ILE D 49  1 ? 16 
HELX_P HELX_P32 32 ARG D 55  ? LEU D 59  ? ARG D 55  LEU D 59  5 ? 5  
HELX_P HELX_P33 33 LYS D 60  ? THR D 73  ? LYS D 60  THR D 73  1 ? 14 
HELX_P HELX_P34 34 ARG D 74  ? GLN D 78  ? ARG D 74  GLN D 78  5 ? 5  
HELX_P HELX_P35 35 ARG D 79  ? GLY D 85  ? ARG D 79  GLY D 85  1 ? 7  
HELX_P HELX_P36 36 GLY D 131 ? ARG D 144 ? GLY D 131 ARG D 144 1 ? 14 
HELX_P HELX_P37 37 VAL D 148 ? LEU D 164 ? VAL D 148 LEU D 164 1 ? 17 
HELX_P HELX_P38 38 LEU D 178 ? MET D 182 ? LEU D 178 MET D 182 1 ? 5  
HELX_P HELX_P39 39 VAL D 200 ? ASN D 204 ? VAL D 200 ASN D 204 1 ? 5  
HELX_P HELX_P40 40 ASN D 204 ? ARG D 216 ? ASN D 204 ARG D 216 1 ? 13 
HELX_P HELX_P41 41 ASP E 34  ? ILE E 49  ? ASP E 34  ILE E 49  1 ? 16 
HELX_P HELX_P42 42 ARG E 55  ? LEU E 59  ? ARG E 55  LEU E 59  5 ? 5  
HELX_P HELX_P43 43 LYS E 60  ? THR E 73  ? LYS E 60  THR E 73  1 ? 14 
HELX_P HELX_P44 44 ARG E 74  ? GLN E 78  ? ARG E 74  GLN E 78  5 ? 5  
HELX_P HELX_P45 45 ARG E 79  ? GLY E 85  ? ARG E 79  GLY E 85  1 ? 7  
HELX_P HELX_P46 46 GLY E 131 ? ARG E 144 ? GLY E 131 ARG E 144 1 ? 14 
HELX_P HELX_P47 47 VAL E 148 ? GLU E 165 ? VAL E 148 GLU E 165 1 ? 18 
HELX_P HELX_P48 48 LEU E 178 ? MET E 182 ? LEU E 178 MET E 182 1 ? 5  
HELX_P HELX_P49 49 VAL E 200 ? ASN E 204 ? VAL E 200 ASN E 204 1 ? 5  
HELX_P HELX_P50 50 ASN E 204 ? LEU E 215 ? ASN E 204 LEU E 215 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G 8DG . O8 ? ? ? 1_555 F ZN  .   ZN  ? ? A 8DG 821  A ZN  1001 1_555 ? ? ? ? ? ? ? 1.970 ? 
metalc2  metalc ? ? F ZN  . ZN ? ? ? 1_555 A CYS 108 SG  ? ? A ZN  1001 A CYS 108  1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc3  metalc ? ? F ZN  . ZN ? ? ? 1_555 A CYS 179 SG  ? ? A ZN  1001 A CYS 179  1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc4  metalc ? ? F ZN  . ZN ? ? ? 1_555 A HIS 111 ND1 ? ? A ZN  1001 A HIS 111  1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc5  metalc ? ? I ZN  . ZN ? ? ? 1_555 B CYS 179 SG  ? ? B ZN  1002 B CYS 179  1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc6  metalc ? ? I ZN  . ZN ? ? ? 1_555 K 8DG .   O8  ? ? B ZN  1002 C 8DG 822  1_555 ? ? ? ? ? ? ? 2.011 ? 
metalc7  metalc ? ? I ZN  . ZN ? ? ? 1_555 B HIS 111 ND1 ? ? B ZN  1002 B HIS 111  1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc8  metalc ? ? I ZN  . ZN ? ? ? 1_555 B CYS 108 SG  ? ? B ZN  1002 B CYS 108  1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc9  metalc ? ? J ZN  . ZN ? ? ? 1_555 C CYS 179 SG  ? ? C ZN  1003 C CYS 179  1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc10 metalc ? ? J ZN  . ZN ? ? ? 1_555 M 8DG .   O8  ? ? C ZN  1003 D 8DG 823  1_555 ? ? ? ? ? ? ? 2.024 ? 
metalc11 metalc ? ? J ZN  . ZN ? ? ? 1_555 C CYS 108 SG  ? ? C ZN  1003 C CYS 108  1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc12 metalc ? ? J ZN  . ZN ? ? ? 1_555 C HIS 111 ND1 ? ? C ZN  1003 C HIS 111  1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc13 metalc ? ? N 8DG . O8 ? ? ? 1_555 L ZN  .   ZN  ? ? D 8DG 824  D ZN  1004 1_555 ? ? ? ? ? ? ? 1.999 ? 
metalc14 metalc ? ? L ZN  . ZN ? ? ? 1_555 D HIS 111 ND1 ? ? D ZN  1004 D HIS 111  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc15 metalc ? ? L ZN  . ZN ? ? ? 1_555 D CYS 108 SG  ? ? D ZN  1004 D CYS 108  1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc16 metalc ? ? L ZN  . ZN ? ? ? 1_555 D CYS 179 SG  ? ? D ZN  1004 D CYS 179  1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc17 metalc ? ? O ZN  . ZN ? ? ? 1_555 H 8DG .   O8  ? ? E ZN  1005 A 8DG 825  1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc18 metalc ? ? O ZN  . ZN ? ? ? 1_555 E CYS 108 SG  ? ? E ZN  1005 E CYS 108  1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc19 metalc ? ? O ZN  . ZN ? ? ? 1_555 E CYS 179 SG  ? ? E ZN  1005 E CYS 179  1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc20 metalc ? ? O ZN  . ZN ? ? ? 1_555 E HIS 111 ND1 ? ? E ZN  1005 E HIS 111  1_555 ? ? ? ? ? ? ? 2.206 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2  ? 
B ? 30 ? 
C ? 2  ? 
D ? 2  ? 
E ? 2  ? 
F ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
B 1  2  ? parallel      
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? anti-parallel 
B 9  10 ? anti-parallel 
B 10 11 ? anti-parallel 
B 11 12 ? anti-parallel 
B 12 13 ? parallel      
B 13 14 ? parallel      
B 14 15 ? anti-parallel 
B 15 16 ? anti-parallel 
B 16 17 ? anti-parallel 
B 17 18 ? anti-parallel 
B 18 19 ? parallel      
B 19 20 ? parallel      
B 20 21 ? anti-parallel 
B 21 22 ? anti-parallel 
B 22 23 ? anti-parallel 
B 23 24 ? anti-parallel 
B 24 25 ? parallel      
B 25 26 ? parallel      
B 26 27 ? anti-parallel 
B 27 28 ? anti-parallel 
B 28 29 ? anti-parallel 
B 29 30 ? anti-parallel 
C 1  2  ? anti-parallel 
D 1  2  ? anti-parallel 
E 1  2  ? anti-parallel 
F 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL A 88  ? PRO A 90  ? VAL A 88  PRO A 90  
A 2  LYS A 128 ? LEU A 130 ? LYS A 128 LEU A 130 
B 1  LEU A 146 ? GLN A 147 ? LEU A 146 GLN A 147 
B 2  VAL A 97  ? CYS A 108 ? VAL A 97  CYS A 108 
B 3  PRO A 114 ? ILE A 124 ? PRO A 114 ILE A 124 
B 4  GLY A 168 ? HIS A 177 ? GLY A 168 HIS A 177 
B 5  ARG A 191 ? GLY A 199 ? ARG A 191 GLY A 199 
B 6  VAL B 97  ? CYS B 108 ? VAL B 97  CYS B 108 
B 7  LEU B 146 ? GLN B 147 ? LEU B 146 GLN B 147 
B 8  VAL B 97  ? CYS B 108 ? VAL B 97  CYS B 108 
B 9  PRO B 114 ? ILE B 124 ? PRO B 114 ILE B 124 
B 10 GLY B 168 ? HIS B 177 ? GLY B 168 HIS B 177 
B 11 ARG B 191 ? GLY B 199 ? ARG B 191 GLY B 199 
B 12 VAL C 97  ? CYS C 108 ? VAL C 97  CYS C 108 
B 13 LEU C 146 ? GLN C 147 ? LEU C 146 GLN C 147 
B 14 VAL C 97  ? CYS C 108 ? VAL C 97  CYS C 108 
B 15 PRO C 114 ? ILE C 124 ? PRO C 114 ILE C 124 
B 16 GLY C 168 ? HIS C 177 ? GLY C 168 HIS C 177 
B 17 ARG C 191 ? GLY C 199 ? ARG C 191 GLY C 199 
B 18 VAL D 97  ? CYS D 108 ? VAL D 97  CYS D 108 
B 19 LEU D 146 ? GLN D 147 ? LEU D 146 GLN D 147 
B 20 VAL D 97  ? CYS D 108 ? VAL D 97  CYS D 108 
B 21 PRO D 114 ? ILE D 124 ? PRO D 114 ILE D 124 
B 22 GLY D 168 ? HIS D 177 ? GLY D 168 HIS D 177 
B 23 ARG D 191 ? GLY D 199 ? ARG D 191 GLY D 199 
B 24 VAL E 97  ? CYS E 108 ? VAL E 97  CYS E 108 
B 25 LEU E 146 ? GLN E 147 ? LEU E 146 GLN E 147 
B 26 VAL E 97  ? CYS E 108 ? VAL E 97  CYS E 108 
B 27 PRO E 114 ? ILE E 124 ? PRO E 114 ILE E 124 
B 28 GLY E 168 ? HIS E 177 ? GLY E 168 HIS E 177 
B 29 ARG E 191 ? GLY E 199 ? ARG E 191 GLY E 199 
B 30 VAL A 97  ? CYS A 108 ? VAL A 97  CYS A 108 
C 1  VAL B 88  ? PRO B 90  ? VAL B 88  PRO B 90  
C 2  LYS B 128 ? LEU B 130 ? LYS B 128 LEU B 130 
D 1  VAL C 88  ? PRO C 90  ? VAL C 88  PRO C 90  
D 2  LYS C 128 ? LEU C 130 ? LYS C 128 LEU C 130 
E 1  VAL D 88  ? PRO D 90  ? VAL D 88  PRO D 90  
E 2  LYS D 128 ? LEU D 130 ? LYS D 128 LEU D 130 
F 1  VAL E 88  ? PRO E 90  ? VAL E 88  PRO E 90  
F 2  LYS E 128 ? LEU E 130 ? LYS E 128 LEU E 130 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O PHE A 89  ? O PHE A 89  N ILE A 129 ? N ILE A 129 
B 1  2  N GLN A 147 ? N GLN A 147 O MET A 107 ? O MET A 107 
B 2  3  N SER A 106 ? N SER A 106 O PHE A 115 ? O PHE A 115 
B 3  4  N ILE A 124 ? N ILE A 124 O GLY A 168 ? O GLY A 168 
B 4  5  O GLY A 175 ? O GLY A 175 N THR A 192 ? N THR A 192 
B 5  6  N VAL A 193 ? N VAL A 193 O VAL B 98  ? O VAL B 98  
B 6  7  O MET B 107 ? O MET B 107 N GLN B 147 ? N GLN B 147 
B 7  8  N GLN B 147 ? N GLN B 147 O MET B 107 ? O MET B 107 
B 8  9  N SER B 106 ? N SER B 106 O PHE B 115 ? O PHE B 115 
B 9  10 N ILE B 124 ? N ILE B 124 O GLY B 168 ? O GLY B 168 
B 10 11 O GLY B 175 ? O GLY B 175 N THR B 192 ? N THR B 192 
B 11 12 N VAL B 193 ? N VAL B 193 O VAL C 98  ? O VAL C 98  
B 12 13 O MET C 107 ? O MET C 107 N GLN C 147 ? N GLN C 147 
B 13 14 N GLN C 147 ? N GLN C 147 O MET C 107 ? O MET C 107 
B 14 15 N SER C 106 ? N SER C 106 O PHE C 115 ? O PHE C 115 
B 15 16 N ILE C 124 ? N ILE C 124 O GLY C 168 ? O GLY C 168 
B 16 17 O GLY C 175 ? O GLY C 175 N THR C 192 ? N THR C 192 
B 17 18 N VAL C 193 ? N VAL C 193 O VAL D 98  ? O VAL D 98  
B 18 19 O MET D 107 ? O MET D 107 N GLN D 147 ? N GLN D 147 
B 19 20 N GLN D 147 ? N GLN D 147 O MET D 107 ? O MET D 107 
B 20 21 N SER D 106 ? N SER D 106 O PHE D 115 ? O PHE D 115 
B 21 22 N ILE D 124 ? N ILE D 124 O GLY D 168 ? O GLY D 168 
B 22 23 O GLY D 175 ? O GLY D 175 N THR D 192 ? N THR D 192 
B 23 24 N VAL D 193 ? N VAL D 193 O VAL E 98  ? O VAL E 98  
B 24 25 O MET E 107 ? O MET E 107 N GLN E 147 ? N GLN E 147 
B 25 26 N GLN E 147 ? N GLN E 147 O MET E 107 ? O MET E 107 
B 26 27 N SER E 106 ? N SER E 106 O PHE E 115 ? O PHE E 115 
B 27 28 N ILE E 124 ? N ILE E 124 O GLY E 168 ? O GLY E 168 
B 28 29 O GLY E 175 ? O GLY E 175 N THR E 192 ? N THR E 192 
B 29 30 N VAL E 193 ? N VAL E 193 O VAL A 98  ? O VAL A 98  
C 1  2  O PHE B 89  ? O PHE B 89  N ILE B 129 ? N ILE B 129 
D 1  2  O PHE C 89  ? O PHE C 89  N ILE C 129 ? N ILE C 129 
E 1  2  O PHE D 89  ? O PHE D 89  N ILE D 129 ? N ILE D 129 
F 1  2  O PHE E 89  ? O PHE E 89  N ILE E 129 ? N ILE E 129 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1001' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 1002' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 1003' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 1004' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN E 1005' 
AC6 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE 8DG A 821' 
AC7 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE 8DG C 822' 
AC8 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE 8DG D 823' 
AC9 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE 8DG D 824' 
BC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE 8DG A 825' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  CYS A 108 ? CYS A 108  . ? 1_555 ? 
2   AC1 4  HIS A 111 ? HIS A 111  . ? 1_555 ? 
3   AC1 4  CYS A 179 ? CYS A 179  . ? 1_555 ? 
4   AC1 4  8DG G .   ? 8DG A 821  . ? 1_555 ? 
5   AC2 4  CYS B 108 ? CYS B 108  . ? 1_555 ? 
6   AC2 4  HIS B 111 ? HIS B 111  . ? 1_555 ? 
7   AC2 4  CYS B 179 ? CYS B 179  . ? 1_555 ? 
8   AC2 4  8DG K .   ? 8DG C 822  . ? 1_555 ? 
9   AC3 4  CYS C 108 ? CYS C 108  . ? 1_555 ? 
10  AC3 4  HIS C 111 ? HIS C 111  . ? 1_555 ? 
11  AC3 4  CYS C 179 ? CYS C 179  . ? 1_555 ? 
12  AC3 4  8DG M .   ? 8DG D 823  . ? 1_555 ? 
13  AC4 4  CYS D 108 ? CYS D 108  . ? 1_555 ? 
14  AC4 4  HIS D 111 ? HIS D 111  . ? 1_555 ? 
15  AC4 4  CYS D 179 ? CYS D 179  . ? 1_555 ? 
16  AC4 4  8DG N .   ? 8DG D 824  . ? 1_555 ? 
17  AC5 4  8DG H .   ? 8DG A 825  . ? 1_555 ? 
18  AC5 4  CYS E 108 ? CYS E 108  . ? 1_555 ? 
19  AC5 4  HIS E 111 ? HIS E 111  . ? 1_555 ? 
20  AC5 4  CYS E 179 ? CYS E 179  . ? 1_555 ? 
21  AC6 23 CYS A 108 ? CYS A 108  . ? 1_555 ? 
22  AC6 23 HIS A 110 ? HIS A 110  . ? 1_555 ? 
23  AC6 23 HIS A 111 ? HIS A 111  . ? 1_555 ? 
24  AC6 23 VAL A 148 ? VAL A 148  . ? 1_555 ? 
25  AC6 23 GLN A 149 ? GLN A 149  . ? 1_555 ? 
26  AC6 23 GLU A 150 ? GLU A 150  . ? 1_555 ? 
27  AC6 23 HIS A 177 ? HIS A 177  . ? 1_555 ? 
28  AC6 23 CYS A 179 ? CYS A 179  . ? 1_555 ? 
29  AC6 23 ARG A 183 ? ARG A 183  . ? 1_555 ? 
30  AC6 23 ZN  F .   ? ZN  A 1001 . ? 1_555 ? 
31  AC6 23 HOH P .   ? HOH A 1012 . ? 1_555 ? 
32  AC6 23 HOH P .   ? HOH A 1038 . ? 1_555 ? 
33  AC6 23 HOH P .   ? HOH A 1060 . ? 1_555 ? 
34  AC6 23 HOH P .   ? HOH A 1079 . ? 1_555 ? 
35  AC6 23 ALA B 87  ? ALA B 87   . ? 1_555 ? 
36  AC6 23 LEU B 130 ? LEU B 130  . ? 1_555 ? 
37  AC6 23 GLY B 131 ? GLY B 131  . ? 1_555 ? 
38  AC6 23 LEU B 132 ? LEU B 132  . ? 1_555 ? 
39  AC6 23 SER B 133 ? SER B 133  . ? 1_555 ? 
40  AC6 23 LYS B 134 ? LYS B 134  . ? 1_555 ? 
41  AC6 23 ARG B 137 ? ARG B 137  . ? 1_555 ? 
42  AC6 23 ARG E 64  ? ARG E 64   . ? 2_555 ? 
43  AC6 23 HOH T .   ? HOH E 1029 . ? 2_555 ? 
44  AC7 20 CYS B 108 ? CYS B 108  . ? 1_555 ? 
45  AC7 20 HIS B 110 ? HIS B 110  . ? 1_555 ? 
46  AC7 20 HIS B 111 ? HIS B 111  . ? 1_555 ? 
47  AC7 20 VAL B 148 ? VAL B 148  . ? 1_555 ? 
48  AC7 20 GLN B 149 ? GLN B 149  . ? 1_555 ? 
49  AC7 20 GLU B 150 ? GLU B 150  . ? 1_555 ? 
50  AC7 20 HIS B 177 ? HIS B 177  . ? 1_555 ? 
51  AC7 20 CYS B 179 ? CYS B 179  . ? 1_555 ? 
52  AC7 20 ARG B 183 ? ARG B 183  . ? 1_555 ? 
53  AC7 20 ZN  I .   ? ZN  B 1002 . ? 1_555 ? 
54  AC7 20 HOH Q .   ? HOH B 1010 . ? 1_555 ? 
55  AC7 20 ALA C 87  ? ALA C 87   . ? 1_555 ? 
56  AC7 20 LEU C 130 ? LEU C 130  . ? 1_555 ? 
57  AC7 20 GLY C 131 ? GLY C 131  . ? 1_555 ? 
58  AC7 20 LEU C 132 ? LEU C 132  . ? 1_555 ? 
59  AC7 20 SER C 133 ? SER C 133  . ? 1_555 ? 
60  AC7 20 LYS C 134 ? LYS C 134  . ? 1_555 ? 
61  AC7 20 ARG C 137 ? ARG C 137  . ? 1_555 ? 
62  AC7 20 ARG D 64  ? ARG D 64   . ? 2_555 ? 
63  AC7 20 HOH S .   ? HOH D 1043 . ? 2_555 ? 
64  AC8 22 ARG C 64  ? ARG C 64   . ? 2_555 ? 
65  AC8 22 CYS C 108 ? CYS C 108  . ? 1_555 ? 
66  AC8 22 HIS C 110 ? HIS C 110  . ? 1_555 ? 
67  AC8 22 HIS C 111 ? HIS C 111  . ? 1_555 ? 
68  AC8 22 VAL C 148 ? VAL C 148  . ? 1_555 ? 
69  AC8 22 GLN C 149 ? GLN C 149  . ? 1_555 ? 
70  AC8 22 GLU C 150 ? GLU C 150  . ? 1_555 ? 
71  AC8 22 HIS C 177 ? HIS C 177  . ? 1_555 ? 
72  AC8 22 CYS C 179 ? CYS C 179  . ? 1_555 ? 
73  AC8 22 ARG C 183 ? ARG C 183  . ? 1_555 ? 
74  AC8 22 ZN  J .   ? ZN  C 1003 . ? 1_555 ? 
75  AC8 22 HOH R .   ? HOH C 1019 . ? 1_555 ? 
76  AC8 22 HOH R .   ? HOH C 1046 . ? 2_555 ? 
77  AC8 22 ALA D 87  ? ALA D 87   . ? 1_555 ? 
78  AC8 22 LEU D 130 ? LEU D 130  . ? 1_555 ? 
79  AC8 22 GLY D 131 ? GLY D 131  . ? 1_555 ? 
80  AC8 22 LEU D 132 ? LEU D 132  . ? 1_555 ? 
81  AC8 22 SER D 133 ? SER D 133  . ? 1_555 ? 
82  AC8 22 LYS D 134 ? LYS D 134  . ? 1_555 ? 
83  AC8 22 ARG D 137 ? ARG D 137  . ? 1_555 ? 
84  AC8 22 HOH S .   ? HOH D 1008 . ? 1_555 ? 
85  AC8 22 HOH S .   ? HOH D 1050 . ? 1_555 ? 
86  AC9 21 ARG B 64  ? ARG B 64   . ? 2_555 ? 
87  AC9 21 HOH Q .   ? HOH B 1042 . ? 2_555 ? 
88  AC9 21 CYS D 108 ? CYS D 108  . ? 1_555 ? 
89  AC9 21 HIS D 110 ? HIS D 110  . ? 1_555 ? 
90  AC9 21 HIS D 111 ? HIS D 111  . ? 1_555 ? 
91  AC9 21 VAL D 148 ? VAL D 148  . ? 1_555 ? 
92  AC9 21 GLN D 149 ? GLN D 149  . ? 1_555 ? 
93  AC9 21 GLU D 150 ? GLU D 150  . ? 1_555 ? 
94  AC9 21 HIS D 177 ? HIS D 177  . ? 1_555 ? 
95  AC9 21 CYS D 179 ? CYS D 179  . ? 1_555 ? 
96  AC9 21 ARG D 183 ? ARG D 183  . ? 1_555 ? 
97  AC9 21 ZN  L .   ? ZN  D 1004 . ? 1_555 ? 
98  AC9 21 HOH S .   ? HOH D 1005 . ? 1_555 ? 
99  AC9 21 HOH S .   ? HOH D 1052 . ? 1_555 ? 
100 AC9 21 ALA E 87  ? ALA E 87   . ? 1_555 ? 
101 AC9 21 LEU E 130 ? LEU E 130  . ? 1_555 ? 
102 AC9 21 GLY E 131 ? GLY E 131  . ? 1_555 ? 
103 AC9 21 LEU E 132 ? LEU E 132  . ? 1_555 ? 
104 AC9 21 SER E 133 ? SER E 133  . ? 1_555 ? 
105 AC9 21 LYS E 134 ? LYS E 134  . ? 1_555 ? 
106 AC9 21 ARG E 137 ? ARG E 137  . ? 1_555 ? 
107 BC1 22 ARG A 64  ? ARG A 64   . ? 2_555 ? 
108 BC1 22 ALA A 87  ? ALA A 87   . ? 1_555 ? 
109 BC1 22 LEU A 130 ? LEU A 130  . ? 1_555 ? 
110 BC1 22 GLY A 131 ? GLY A 131  . ? 1_555 ? 
111 BC1 22 LEU A 132 ? LEU A 132  . ? 1_555 ? 
112 BC1 22 SER A 133 ? SER A 133  . ? 1_555 ? 
113 BC1 22 LYS A 134 ? LYS A 134  . ? 1_555 ? 
114 BC1 22 ARG A 137 ? ARG A 137  . ? 1_555 ? 
115 BC1 22 HOH P .   ? HOH A 1039 . ? 1_555 ? 
116 BC1 22 HOH P .   ? HOH A 1042 . ? 1_555 ? 
117 BC1 22 CYS E 108 ? CYS E 108  . ? 1_555 ? 
118 BC1 22 HIS E 110 ? HIS E 110  . ? 1_555 ? 
119 BC1 22 HIS E 111 ? HIS E 111  . ? 1_555 ? 
120 BC1 22 VAL E 148 ? VAL E 148  . ? 1_555 ? 
121 BC1 22 GLN E 149 ? GLN E 149  . ? 1_555 ? 
122 BC1 22 GLU E 150 ? GLU E 150  . ? 1_555 ? 
123 BC1 22 HIS E 177 ? HIS E 177  . ? 1_555 ? 
124 BC1 22 CYS E 179 ? CYS E 179  . ? 1_555 ? 
125 BC1 22 ARG E 183 ? ARG E 183  . ? 1_555 ? 
126 BC1 22 ZN  O .   ? ZN  E 1005 . ? 1_555 ? 
127 BC1 22 HOH T .   ? HOH E 1022 . ? 1_555 ? 
128 BC1 22 HOH T .   ? HOH E 1023 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1WUR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WUR 
_atom_sites.fract_transf_matrix[1][1]   0.006228 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001760 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009045 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014734 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 32  ? -14.701 -44.989 5.133   1.00 51.03 ? 32   GLU A N     1 
ATOM   2    C  CA    . GLU A 1 32  ? -14.191 -44.495 3.823   1.00 50.54 ? 32   GLU A CA    1 
ATOM   3    C  C     . GLU A 1 32  ? -15.349 -44.070 2.920   1.00 48.38 ? 32   GLU A C     1 
ATOM   4    O  O     . GLU A 1 32  ? -16.455 -44.609 3.013   1.00 50.21 ? 32   GLU A O     1 
ATOM   5    C  CB    . GLU A 1 32  ? -13.359 -45.583 3.140   1.00 53.97 ? 32   GLU A CB    1 
ATOM   6    C  CG    . GLU A 1 32  ? -12.633 -45.127 1.884   1.00 58.03 ? 32   GLU A CG    1 
ATOM   7    C  CD    . GLU A 1 32  ? -11.849 -46.248 1.225   1.00 61.49 ? 32   GLU A CD    1 
ATOM   8    O  OE1   . GLU A 1 32  ? -12.482 -47.197 0.711   1.00 62.68 ? 32   GLU A OE1   1 
ATOM   9    O  OE2   . GLU A 1 32  ? -10.601 -46.179 1.222   1.00 62.59 ? 32   GLU A OE2   1 
ATOM   10   N  N     . VAL A 1 33  ? -15.084 -43.102 2.047   1.00 43.60 ? 33   VAL A N     1 
ATOM   11   C  CA    . VAL A 1 33  ? -16.093 -42.583 1.127   1.00 38.32 ? 33   VAL A CA    1 
ATOM   12   C  C     . VAL A 1 33  ? -16.253 -43.443 -0.127  1.00 34.90 ? 33   VAL A C     1 
ATOM   13   O  O     . VAL A 1 33  ? -15.270 -43.839 -0.752  1.00 34.49 ? 33   VAL A O     1 
ATOM   14   C  CB    . VAL A 1 33  ? -15.762 -41.128 0.705   1.00 37.38 ? 33   VAL A CB    1 
ATOM   15   C  CG1   . VAL A 1 33  ? -16.774 -40.623 -0.303  1.00 36.54 ? 33   VAL A CG1   1 
ATOM   16   C  CG2   . VAL A 1 33  ? -15.747 -40.220 1.923   1.00 37.86 ? 33   VAL A CG2   1 
ATOM   17   N  N     . ASP A 1 34  ? -17.506 -43.706 -0.490  1.00 31.89 ? 34   ASP A N     1 
ATOM   18   C  CA    . ASP A 1 34  ? -17.846 -44.499 -1.671  1.00 30.57 ? 34   ASP A CA    1 
ATOM   19   C  C     . ASP A 1 34  ? -17.723 -43.625 -2.926  1.00 28.50 ? 34   ASP A C     1 
ATOM   20   O  O     . ASP A 1 34  ? -18.698 -43.012 -3.362  1.00 27.65 ? 34   ASP A O     1 
ATOM   21   C  CB    . ASP A 1 34  ? -19.281 -45.032 -1.528  1.00 32.95 ? 34   ASP A CB    1 
ATOM   22   C  CG    . ASP A 1 34  ? -19.679 -46.004 -2.638  1.00 34.43 ? 34   ASP A CG    1 
ATOM   23   O  OD1   . ASP A 1 34  ? -18.904 -46.212 -3.596  1.00 34.81 ? 34   ASP A OD1   1 
ATOM   24   O  OD2   . ASP A 1 34  ? -20.793 -46.562 -2.546  1.00 37.93 ? 34   ASP A OD2   1 
ATOM   25   N  N     . LEU A 1 35  ? -16.527 -43.597 -3.508  1.00 28.64 ? 35   LEU A N     1 
ATOM   26   C  CA    . LEU A 1 35  ? -16.249 -42.802 -4.703  1.00 28.62 ? 35   LEU A CA    1 
ATOM   27   C  C     . LEU A 1 35  ? -17.139 -43.140 -5.889  1.00 30.42 ? 35   LEU A C     1 
ATOM   28   O  O     . LEU A 1 35  ? -17.504 -42.257 -6.667  1.00 28.25 ? 35   LEU A O     1 
ATOM   29   C  CB    . LEU A 1 35  ? -14.785 -42.953 -5.114  1.00 30.47 ? 35   LEU A CB    1 
ATOM   30   C  CG    . LEU A 1 35  ? -13.754 -42.472 -4.094  1.00 31.84 ? 35   LEU A CG    1 
ATOM   31   C  CD1   . LEU A 1 35  ? -12.350 -42.782 -4.594  1.00 30.98 ? 35   LEU A CD1   1 
ATOM   32   C  CD2   . LEU A 1 35  ? -13.929 -40.980 -3.854  1.00 28.78 ? 35   LEU A CD2   1 
ATOM   33   N  N     . GLU A 1 36  ? -17.475 -44.419 -6.031  1.00 31.65 ? 36   GLU A N     1 
ATOM   34   C  CA    . GLU A 1 36  ? -18.322 -44.870 -7.129  1.00 32.21 ? 36   GLU A CA    1 
ATOM   35   C  C     . GLU A 1 36  ? -19.707 -44.240 -7.068  1.00 28.40 ? 36   GLU A C     1 
ATOM   36   O  O     . GLU A 1 36  ? -20.244 -43.822 -8.093  1.00 29.55 ? 36   GLU A O     1 
ATOM   37   C  CB    . GLU A 1 36  ? -18.440 -46.398 -7.133  1.00 38.09 ? 36   GLU A CB    1 
ATOM   38   C  CG    . GLU A 1 36  ? -17.110 -47.130 -7.281  1.00 45.78 ? 36   GLU A CG    1 
ATOM   39   C  CD    . GLU A 1 36  ? -16.308 -46.667 -8.487  1.00 50.67 ? 36   GLU A CD    1 
ATOM   40   O  OE1   . GLU A 1 36  ? -16.892 -46.521 -9.584  1.00 52.64 ? 36   GLU A OE1   1 
ATOM   41   O  OE2   . GLU A 1 36  ? -15.087 -46.448 -8.333  1.00 53.74 ? 36   GLU A OE2   1 
ATOM   42   N  N     . ARG A 1 37  ? -20.286 -44.183 -5.871  1.00 25.66 ? 37   ARG A N     1 
ATOM   43   C  CA    . ARG A 1 37  ? -21.606 -43.589 -5.708  1.00 26.39 ? 37   ARG A CA    1 
ATOM   44   C  C     . ARG A 1 37  ? -21.538 -42.083 -5.942  1.00 25.02 ? 37   ARG A C     1 
ATOM   45   O  O     . ARG A 1 37  ? -22.433 -41.508 -6.562  1.00 23.35 ? 37   ARG A O     1 
ATOM   46   C  CB    . ARG A 1 37  ? -22.197 -43.896 -4.329  1.00 28.29 ? 37   ARG A CB    1 
ATOM   47   C  CG    . ARG A 1 37  ? -23.656 -43.463 -4.187  1.00 31.70 ? 37   ARG A CG    1 
ATOM   48   C  CD    . ARG A 1 37  ? -24.499 -43.996 -5.349  1.00 34.68 ? 37   ARG A CD    1 
ATOM   49   N  NE    . ARG A 1 37  ? -25.890 -43.551 -5.291  1.00 36.67 ? 37   ARG A NE    1 
ATOM   50   C  CZ    . ARG A 1 37  ? -26.687 -43.418 -6.349  1.00 37.46 ? 37   ARG A CZ    1 
ATOM   51   N  NH1   . ARG A 1 37  ? -26.242 -43.693 -7.569  1.00 38.02 ? 37   ARG A NH1   1 
ATOM   52   N  NH2   . ARG A 1 37  ? -27.940 -43.012 -6.186  1.00 37.42 ? 37   ARG A NH2   1 
ATOM   53   N  N     . LEU A 1 38  ? -20.464 -41.454 -5.465  1.00 26.85 ? 38   LEU A N     1 
ATOM   54   C  CA    . LEU A 1 38  ? -20.285 -40.018 -5.662  1.00 25.23 ? 38   LEU A CA    1 
ATOM   55   C  C     . LEU A 1 38  ? -20.214 -39.707 -7.151  1.00 22.63 ? 38   LEU A C     1 
ATOM   56   O  O     . LEU A 1 38  ? -20.832 -38.749 -7.614  1.00 21.83 ? 38   LEU A O     1 
ATOM   57   C  CB    . LEU A 1 38  ? -19.023 -39.517 -4.956  1.00 24.30 ? 38   LEU A CB    1 
ATOM   58   C  CG    . LEU A 1 38  ? -19.104 -39.365 -3.437  1.00 25.03 ? 38   LEU A CG    1 
ATOM   59   C  CD1   . LEU A 1 38  ? -17.828 -38.705 -2.926  1.00 24.05 ? 38   LEU A CD1   1 
ATOM   60   C  CD2   . LEU A 1 38  ? -20.316 -38.515 -3.064  1.00 24.86 ? 38   LEU A CD2   1 
ATOM   61   N  N     . GLN A 1 39  ? -19.495 -40.545 -7.900  1.00 23.46 ? 39   GLN A N     1 
ATOM   62   C  CA    . GLN A 1 39  ? -19.362 -40.369 -9.345  1.00 24.35 ? 39   GLN A CA    1 
ATOM   63   C  C     . GLN A 1 39  ? -20.721 -40.468 -10.023 1.00 24.42 ? 39   GLN A C     1 
ATOM   64   O  O     . GLN A 1 39  ? -21.028 -39.685 -10.918 1.00 25.28 ? 39   GLN A O     1 
ATOM   65   C  CB    . GLN A 1 39  ? -18.418 -41.415 -9.950  1.00 26.54 ? 39   GLN A CB    1 
ATOM   66   C  CG    . GLN A 1 39  ? -16.954 -41.214 -9.607  1.00 31.87 ? 39   GLN A CG    1 
ATOM   67   C  CD    . GLN A 1 39  ? -16.042 -42.226 -10.283 1.00 35.25 ? 39   GLN A CD    1 
ATOM   68   O  OE1   . GLN A 1 39  ? -16.194 -42.524 -11.468 1.00 37.47 ? 39   GLN A OE1   1 
ATOM   69   N  NE2   . GLN A 1 39  ? -15.080 -42.751 -9.530  1.00 36.82 ? 39   GLN A NE2   1 
ATOM   70   N  N     . ALA A 1 40  ? -21.527 -41.436 -9.589  1.00 25.00 ? 40   ALA A N     1 
ATOM   71   C  CA    . ALA A 1 40  ? -22.861 -41.641 -10.144 1.00 23.61 ? 40   ALA A CA    1 
ATOM   72   C  C     . ALA A 1 40  ? -23.740 -40.425 -9.871  1.00 21.07 ? 40   ALA A C     1 
ATOM   73   O  O     . ALA A 1 40  ? -24.451 -39.948 -10.755 1.00 20.37 ? 40   ALA A O     1 
ATOM   74   C  CB    . ALA A 1 40  ? -23.492 -42.897 -9.550  1.00 24.96 ? 40   ALA A CB    1 
ATOM   75   N  N     . LEU A 1 41  ? -23.672 -39.913 -8.646  1.00 22.15 ? 41   LEU A N     1 
ATOM   76   C  CA    . LEU A 1 41  ? -24.457 -38.747 -8.266  1.00 22.38 ? 41   LEU A CA    1 
ATOM   77   C  C     . LEU A 1 41  ? -24.031 -37.500 -9.044  1.00 20.88 ? 41   LEU A C     1 
ATOM   78   O  O     . LEU A 1 41  ? -24.876 -36.715 -9.475  1.00 22.68 ? 41   LEU A O     1 
ATOM   79   C  CB    . LEU A 1 41  ? -24.348 -38.500 -6.761  1.00 22.71 ? 41   LEU A CB    1 
ATOM   80   C  CG    . LEU A 1 41  ? -25.082 -39.497 -5.859  1.00 27.34 ? 41   LEU A CG    1 
ATOM   81   C  CD1   . LEU A 1 41  ? -24.709 -39.256 -4.407  1.00 26.65 ? 41   LEU A CD1   1 
ATOM   82   C  CD2   . LEU A 1 41  ? -26.587 -39.364 -6.058  1.00 23.39 ? 41   LEU A CD2   1 
ATOM   83   N  N     . ALA A 1 42  ? -22.722 -37.331 -9.221  1.00 21.74 ? 42   ALA A N     1 
ATOM   84   C  CA    . ALA A 1 42  ? -22.176 -36.190 -9.949  1.00 21.02 ? 42   ALA A CA    1 
ATOM   85   C  C     . ALA A 1 42  ? -22.571 -36.256 -11.423 1.00 22.26 ? 42   ALA A C     1 
ATOM   86   O  O     . ALA A 1 42  ? -22.922 -35.242 -12.027 1.00 19.60 ? 42   ALA A O     1 
ATOM   87   C  CB    . ALA A 1 42  ? -20.661 -36.146 -9.808  1.00 21.07 ? 42   ALA A CB    1 
ATOM   88   N  N     . ALA A 1 43  ? -22.520 -37.458 -11.989 1.00 23.14 ? 43   ALA A N     1 
ATOM   89   C  CA    . ALA A 1 43  ? -22.891 -37.666 -13.387 1.00 24.91 ? 43   ALA A CA    1 
ATOM   90   C  C     . ALA A 1 43  ? -24.347 -37.259 -13.592 1.00 25.78 ? 43   ALA A C     1 
ATOM   91   O  O     . ALA A 1 43  ? -24.680 -36.584 -14.569 1.00 23.17 ? 43   ALA A O     1 
ATOM   92   C  CB    . ALA A 1 43  ? -22.687 -39.128 -13.775 1.00 26.09 ? 43   ALA A CB    1 
ATOM   93   N  N     . GLU A 1 44  ? -25.206 -37.642 -12.647 1.00 25.27 ? 44   GLU A N     1 
ATOM   94   C  CA    . GLU A 1 44  ? -26.622 -37.301 -12.731 1.00 24.08 ? 44   GLU A CA    1 
ATOM   95   C  C     . GLU A 1 44  ? -26.822 -35.804 -12.489 1.00 24.54 ? 44   GLU A C     1 
ATOM   96   O  O     . GLU A 1 44  ? -27.689 -35.182 -13.099 1.00 24.15 ? 44   GLU A O     1 
ATOM   97   C  CB    . GLU A 1 44  ? -27.449 -38.119 -11.734 1.00 25.52 ? 44   GLU A CB    1 
ATOM   98   C  CG    . GLU A 1 44  ? -28.946 -38.100 -12.046 1.00 32.86 ? 44   GLU A CG    1 
ATOM   99   C  CD    . GLU A 1 44  ? -29.780 -38.963 -11.112 1.00 35.51 ? 44   GLU A CD    1 
ATOM   100  O  OE1   . GLU A 1 44  ? -29.276 -39.998 -10.623 1.00 37.28 ? 44   GLU A OE1   1 
ATOM   101  O  OE2   . GLU A 1 44  ? -30.955 -38.606 -10.880 1.00 39.61 ? 44   GLU A OE2   1 
ATOM   102  N  N     . TRP A 1 45  ? -25.992 -35.222 -11.624 1.00 22.95 ? 45   TRP A N     1 
ATOM   103  C  CA    . TRP A 1 45  ? -26.075 -33.793 -11.325 1.00 21.64 ? 45   TRP A CA    1 
ATOM   104  C  C     . TRP A 1 45  ? -25.889 -32.993 -12.614 1.00 18.77 ? 45   TRP A C     1 
ATOM   105  O  O     . TRP A 1 45  ? -26.647 -32.065 -12.900 1.00 17.53 ? 45   TRP A O     1 
ATOM   106  C  CB    . TRP A 1 45  ? -24.989 -33.399 -10.319 1.00 21.05 ? 45   TRP A CB    1 
ATOM   107  C  CG    . TRP A 1 45  ? -25.175 -32.037 -9.717  1.00 23.79 ? 45   TRP A CG    1 
ATOM   108  C  CD1   . TRP A 1 45  ? -24.618 -30.865 -10.144 1.00 23.21 ? 45   TRP A CD1   1 
ATOM   109  C  CD2   . TRP A 1 45  ? -25.961 -31.711 -8.565  1.00 23.78 ? 45   TRP A CD2   1 
ATOM   110  N  NE1   . TRP A 1 45  ? -25.008 -29.829 -9.326  1.00 19.42 ? 45   TRP A NE1   1 
ATOM   111  C  CE2   . TRP A 1 45  ? -25.834 -30.320 -8.350  1.00 22.25 ? 45   TRP A CE2   1 
ATOM   112  C  CE3   . TRP A 1 45  ? -26.760 -32.460 -7.690  1.00 21.68 ? 45   TRP A CE3   1 
ATOM   113  C  CZ2   . TRP A 1 45  ? -26.480 -29.662 -7.297  1.00 22.47 ? 45   TRP A CZ2   1 
ATOM   114  C  CZ3   . TRP A 1 45  ? -27.401 -31.806 -6.640  1.00 23.65 ? 45   TRP A CZ3   1 
ATOM   115  C  CH2   . TRP A 1 45  ? -27.256 -30.419 -6.455  1.00 26.04 ? 45   TRP A CH2   1 
ATOM   116  N  N     . LEU A 1 46  ? -24.884 -33.385 -13.392 1.00 20.63 ? 46   LEU A N     1 
ATOM   117  C  CA    . LEU A 1 46  ? -24.570 -32.726 -14.654 1.00 22.68 ? 46   LEU A CA    1 
ATOM   118  C  C     . LEU A 1 46  ? -25.750 -32.717 -15.620 1.00 24.76 ? 46   LEU A C     1 
ATOM   119  O  O     . LEU A 1 46  ? -26.024 -31.699 -16.257 1.00 23.17 ? 46   LEU A O     1 
ATOM   120  C  CB    . LEU A 1 46  ? -23.354 -33.385 -15.315 1.00 22.07 ? 46   LEU A CB    1 
ATOM   121  C  CG    . LEU A 1 46  ? -22.012 -33.236 -14.591 1.00 23.58 ? 46   LEU A CG    1 
ATOM   122  C  CD1   . LEU A 1 46  ? -20.927 -34.011 -15.320 1.00 21.03 ? 46   LEU A CD1   1 
ATOM   123  C  CD2   . LEU A 1 46  ? -21.637 -31.765 -14.489 1.00 24.46 ? 46   LEU A CD2   1 
ATOM   124  N  N     . GLN A 1 47  ? -26.470 -33.830 -15.713 1.00 25.92 ? 47   GLN A N     1 
ATOM   125  C  CA    . GLN A 1 47  ? -27.606 -33.870 -16.627 1.00 29.38 ? 47   GLN A CA    1 
ATOM   126  C  C     . GLN A 1 47  ? -28.801 -33.070 -16.121 1.00 28.26 ? 47   GLN A C     1 
ATOM   127  O  O     . GLN A 1 47  ? -29.485 -32.421 -16.908 1.00 28.75 ? 47   GLN A O     1 
ATOM   128  C  CB    . GLN A 1 47  ? -28.004 -35.307 -16.984 1.00 33.78 ? 47   GLN A CB    1 
ATOM   129  C  CG    . GLN A 1 47  ? -28.553 -36.157 -15.854 1.00 44.17 ? 47   GLN A CG    1 
ATOM   130  C  CD    . GLN A 1 47  ? -29.026 -37.525 -16.333 1.00 48.82 ? 47   GLN A CD    1 
ATOM   131  O  OE1   . GLN A 1 47  ? -28.735 -37.939 -17.459 1.00 49.71 ? 47   GLN A OE1   1 
ATOM   132  N  NE2   . GLN A 1 47  ? -29.761 -38.231 -15.479 1.00 49.64 ? 47   GLN A NE2   1 
ATOM   133  N  N     . VAL A 1 48  ? -29.021 -33.074 -14.807 1.00 28.11 ? 48   VAL A N     1 
ATOM   134  C  CA    . VAL A 1 48  ? -30.142 -32.335 -14.228 1.00 25.84 ? 48   VAL A CA    1 
ATOM   135  C  C     . VAL A 1 48  ? -29.989 -30.821 -14.392 1.00 25.88 ? 48   VAL A C     1 
ATOM   136  O  O     . VAL A 1 48  ? -30.977 -30.124 -14.614 1.00 24.73 ? 48   VAL A O     1 
ATOM   137  C  CB    . VAL A 1 48  ? -30.360 -32.695 -12.736 1.00 28.00 ? 48   VAL A CB    1 
ATOM   138  C  CG1   . VAL A 1 48  ? -31.538 -31.907 -12.163 1.00 25.63 ? 48   VAL A CG1   1 
ATOM   139  C  CG2   . VAL A 1 48  ? -30.622 -34.190 -12.592 1.00 24.36 ? 48   VAL A CG2   1 
ATOM   140  N  N     . ILE A 1 49  ? -28.758 -30.312 -14.309 1.00 25.20 ? 49   ILE A N     1 
ATOM   141  C  CA    . ILE A 1 49  ? -28.534 -28.872 -14.466 1.00 25.30 ? 49   ILE A CA    1 
ATOM   142  C  C     . ILE A 1 49  ? -28.571 -28.416 -15.929 1.00 26.41 ? 49   ILE A C     1 
ATOM   143  O  O     . ILE A 1 49  ? -28.466 -27.224 -16.215 1.00 29.32 ? 49   ILE A O     1 
ATOM   144  C  CB    . ILE A 1 49  ? -27.215 -28.392 -13.791 1.00 23.20 ? 49   ILE A CB    1 
ATOM   145  C  CG1   . ILE A 1 49  ? -26.000 -29.059 -14.433 1.00 23.07 ? 49   ILE A CG1   1 
ATOM   146  C  CG2   . ILE A 1 49  ? -27.263 -28.663 -12.291 1.00 22.02 ? 49   ILE A CG2   1 
ATOM   147  C  CD1   . ILE A 1 49  ? -24.667 -28.544 -13.901 1.00 25.07 ? 49   ILE A CD1   1 
ATOM   148  N  N     . GLY A 1 50  ? -28.710 -29.369 -16.848 1.00 25.10 ? 50   GLY A N     1 
ATOM   149  C  CA    . GLY A 1 50  ? -28.786 -29.037 -18.261 1.00 25.52 ? 50   GLY A CA    1 
ATOM   150  C  C     . GLY A 1 50  ? -27.531 -29.232 -19.089 1.00 26.34 ? 50   GLY A C     1 
ATOM   151  O  O     . GLY A 1 50  ? -27.480 -28.798 -20.241 1.00 27.31 ? 50   GLY A O     1 
ATOM   152  N  N     . GLU A 1 51  ? -26.513 -29.867 -18.517 1.00 23.95 ? 51   GLU A N     1 
ATOM   153  C  CA    . GLU A 1 51  ? -25.272 -30.108 -19.241 1.00 24.98 ? 51   GLU A CA    1 
ATOM   154  C  C     . GLU A 1 51  ? -25.242 -31.469 -19.924 1.00 28.34 ? 51   GLU A C     1 
ATOM   155  O  O     . GLU A 1 51  ? -26.157 -32.282 -19.763 1.00 29.32 ? 51   GLU A O     1 
ATOM   156  C  CB    . GLU A 1 51  ? -24.065 -29.974 -18.307 1.00 24.65 ? 51   GLU A CB    1 
ATOM   157  C  CG    . GLU A 1 51  ? -23.381 -28.616 -18.368 1.00 22.26 ? 51   GLU A CG    1 
ATOM   158  C  CD    . GLU A 1 51  ? -22.576 -28.393 -19.644 1.00 24.21 ? 51   GLU A CD    1 
ATOM   159  O  OE1   . GLU A 1 51  ? -22.571 -29.268 -20.539 1.00 21.49 ? 51   GLU A OE1   1 
ATOM   160  O  OE2   . GLU A 1 51  ? -21.926 -27.334 -19.746 1.00 20.88 ? 51   GLU A OE2   1 
ATOM   161  N  N     . ASP A 1 52  ? -24.194 -31.696 -20.709 1.00 28.31 ? 52   ASP A N     1 
ATOM   162  C  CA    . ASP A 1 52  ? -24.015 -32.953 -21.417 1.00 30.01 ? 52   ASP A CA    1 
ATOM   163  C  C     . ASP A 1 52  ? -22.872 -33.745 -20.780 1.00 30.25 ? 52   ASP A C     1 
ATOM   164  O  O     . ASP A 1 52  ? -21.699 -33.452 -21.014 1.00 30.87 ? 52   ASP A O     1 
ATOM   165  C  CB    . ASP A 1 52  ? -23.724 -32.691 -22.901 1.00 29.23 ? 52   ASP A CB    1 
ATOM   166  C  CG    . ASP A 1 52  ? -23.490 -33.971 -23.696 1.00 31.72 ? 52   ASP A CG    1 
ATOM   167  O  OD1   . ASP A 1 52  ? -23.820 -35.068 -23.197 1.00 33.04 ? 52   ASP A OD1   1 
ATOM   168  O  OD2   . ASP A 1 52  ? -22.970 -33.879 -24.828 1.00 34.67 ? 52   ASP A OD2   1 
ATOM   169  N  N     . PRO A 1 53  ? -23.205 -34.768 -19.972 1.00 30.71 ? 53   PRO A N     1 
ATOM   170  C  CA    . PRO A 1 53  ? -22.222 -35.618 -19.291 1.00 32.21 ? 53   PRO A CA    1 
ATOM   171  C  C     . PRO A 1 53  ? -21.315 -36.355 -20.270 1.00 31.94 ? 53   PRO A C     1 
ATOM   172  O  O     . PRO A 1 53  ? -20.247 -36.843 -19.898 1.00 31.29 ? 53   PRO A O     1 
ATOM   173  C  CB    . PRO A 1 53  ? -23.101 -36.606 -18.522 1.00 31.04 ? 53   PRO A CB    1 
ATOM   174  C  CG    . PRO A 1 53  ? -24.354 -35.836 -18.276 1.00 32.54 ? 53   PRO A CG    1 
ATOM   175  C  CD    . PRO A 1 53  ? -24.574 -35.164 -19.600 1.00 30.76 ? 53   PRO A CD    1 
ATOM   176  N  N     . GLY A 1 54  ? -21.750 -36.419 -21.525 1.00 33.94 ? 54   GLY A N     1 
ATOM   177  C  CA    . GLY A 1 54  ? -20.988 -37.104 -22.550 1.00 32.93 ? 54   GLY A CA    1 
ATOM   178  C  C     . GLY A 1 54  ? -19.979 -36.266 -23.310 1.00 31.78 ? 54   GLY A C     1 
ATOM   179  O  O     . GLY A 1 54  ? -19.135 -36.825 -24.009 1.00 31.89 ? 54   GLY A O     1 
ATOM   180  N  N     . ARG A 1 55  ? -20.049 -34.941 -23.191 1.00 30.30 ? 55   ARG A N     1 
ATOM   181  C  CA    . ARG A 1 55  ? -19.101 -34.090 -23.906 1.00 30.67 ? 55   ARG A CA    1 
ATOM   182  C  C     . ARG A 1 55  ? -17.688 -34.208 -23.340 1.00 31.66 ? 55   ARG A C     1 
ATOM   183  O  O     . ARG A 1 55  ? -17.500 -34.404 -22.137 1.00 31.66 ? 55   ARG A O     1 
ATOM   184  C  CB    . ARG A 1 55  ? -19.568 -32.630 -23.952 1.00 30.03 ? 55   ARG A CB    1 
ATOM   185  C  CG    . ARG A 1 55  ? -19.478 -31.843 -22.650 1.00 26.13 ? 55   ARG A CG    1 
ATOM   186  C  CD    . ARG A 1 55  ? -19.899 -30.399 -22.910 1.00 24.47 ? 55   ARG A CD    1 
ATOM   187  N  NE    . ARG A 1 55  ? -19.915 -29.570 -21.707 1.00 23.37 ? 55   ARG A NE    1 
ATOM   188  C  CZ    . ARG A 1 55  ? -18.862 -28.911 -21.226 1.00 22.45 ? 55   ARG A CZ    1 
ATOM   189  N  NH1   . ARG A 1 55  ? -17.684 -28.983 -21.835 1.00 17.28 ? 55   ARG A NH1   1 
ATOM   190  N  NH2   . ARG A 1 55  ? -18.999 -28.145 -20.150 1.00 19.54 ? 55   ARG A NH2   1 
ATOM   191  N  N     . GLU A 1 56  ? -16.706 -34.101 -24.231 1.00 32.39 ? 56   GLU A N     1 
ATOM   192  C  CA    . GLU A 1 56  ? -15.286 -34.225 -23.902 1.00 35.24 ? 56   GLU A CA    1 
ATOM   193  C  C     . GLU A 1 56  ? -14.811 -33.675 -22.553 1.00 33.97 ? 56   GLU A C     1 
ATOM   194  O  O     . GLU A 1 56  ? -14.207 -34.408 -21.766 1.00 32.96 ? 56   GLU A O     1 
ATOM   195  C  CB    . GLU A 1 56  ? -14.431 -33.633 -25.029 1.00 40.12 ? 56   GLU A CB    1 
ATOM   196  C  CG    . GLU A 1 56  ? -12.932 -33.898 -24.878 1.00 47.18 ? 56   GLU A CG    1 
ATOM   197  C  CD    . GLU A 1 56  ? -12.096 -33.377 -26.045 1.00 51.75 ? 56   GLU A CD    1 
ATOM   198  O  OE1   . GLU A 1 56  ? -12.660 -32.776 -26.987 1.00 54.49 ? 56   GLU A OE1   1 
ATOM   199  O  OE2   . GLU A 1 56  ? -10.861 -33.575 -26.016 1.00 53.16 ? 56   GLU A OE2   1 
ATOM   200  N  N     . GLY A 1 57  ? -15.091 -32.401 -22.291 1.00 31.92 ? 57   GLY A N     1 
ATOM   201  C  CA    . GLY A 1 57  ? -14.656 -31.774 -21.052 1.00 28.59 ? 57   GLY A CA    1 
ATOM   202  C  C     . GLY A 1 57  ? -15.296 -32.229 -19.751 1.00 28.11 ? 57   GLY A C     1 
ATOM   203  O  O     . GLY A 1 57  ? -14.769 -31.947 -18.670 1.00 28.18 ? 57   GLY A O     1 
ATOM   204  N  N     . LEU A 1 58  ? -16.425 -32.922 -19.839 1.00 23.62 ? 58   LEU A N     1 
ATOM   205  C  CA    . LEU A 1 58  ? -17.127 -33.395 -18.646 1.00 23.33 ? 58   LEU A CA    1 
ATOM   206  C  C     . LEU A 1 58  ? -16.987 -34.891 -18.390 1.00 22.18 ? 58   LEU A C     1 
ATOM   207  O  O     . LEU A 1 58  ? -17.409 -35.381 -17.345 1.00 22.66 ? 58   LEU A O     1 
ATOM   208  C  CB    . LEU A 1 58  ? -18.614 -33.025 -18.721 1.00 20.21 ? 58   LEU A CB    1 
ATOM   209  C  CG    . LEU A 1 58  ? -18.968 -31.542 -18.578 1.00 19.28 ? 58   LEU A CG    1 
ATOM   210  C  CD1   . LEU A 1 58  ? -20.475 -31.364 -18.679 1.00 16.77 ? 58   LEU A CD1   1 
ATOM   211  C  CD2   . LEU A 1 58  ? -18.469 -31.004 -17.238 1.00 19.09 ? 58   LEU A CD2   1 
ATOM   212  N  N     . LEU A 1 59  ? -16.382 -35.613 -19.329 1.00 24.98 ? 59   LEU A N     1 
ATOM   213  C  CA    . LEU A 1 59  ? -16.212 -37.059 -19.186 1.00 25.79 ? 59   LEU A CA    1 
ATOM   214  C  C     . LEU A 1 59  ? -15.520 -37.517 -17.899 1.00 26.69 ? 59   LEU A C     1 
ATOM   215  O  O     . LEU A 1 59  ? -15.969 -38.468 -17.260 1.00 27.31 ? 59   LEU A O     1 
ATOM   216  C  CB    . LEU A 1 59  ? -15.500 -37.639 -20.413 1.00 29.08 ? 59   LEU A CB    1 
ATOM   217  C  CG    . LEU A 1 59  ? -16.380 -37.760 -21.662 1.00 31.19 ? 59   LEU A CG    1 
ATOM   218  C  CD1   . LEU A 1 59  ? -15.553 -38.198 -22.859 1.00 33.65 ? 59   LEU A CD1   1 
ATOM   219  C  CD2   . LEU A 1 59  ? -17.507 -38.750 -21.398 1.00 33.84 ? 59   LEU A CD2   1 
ATOM   220  N  N     . LYS A 1 60  ? -14.445 -36.834 -17.515 1.00 26.66 ? 60   LYS A N     1 
ATOM   221  C  CA    . LYS A 1 60  ? -13.699 -37.175 -16.305 1.00 26.07 ? 60   LYS A CA    1 
ATOM   222  C  C     . LYS A 1 60  ? -14.169 -36.400 -15.074 1.00 24.12 ? 60   LYS A C     1 
ATOM   223  O  O     . LYS A 1 60  ? -13.679 -36.632 -13.966 1.00 22.89 ? 60   LYS A O     1 
ATOM   224  C  CB    . LYS A 1 60  ? -12.206 -36.910 -16.517 1.00 30.73 ? 60   LYS A CB    1 
ATOM   225  C  CG    . LYS A 1 60  ? -11.560 -37.706 -17.643 1.00 39.08 ? 60   LYS A CG    1 
ATOM   226  C  CD    . LYS A 1 60  ? -11.386 -39.169 -17.272 1.00 44.06 ? 60   LYS A CD    1 
ATOM   227  C  CE    . LYS A 1 60  ? -10.655 -39.930 -18.370 1.00 47.80 ? 60   LYS A CE    1 
ATOM   228  N  NZ    . LYS A 1 60  ? -10.420 -41.359 -18.008 1.00 49.40 ? 60   LYS A NZ    1 
ATOM   229  N  N     . THR A 1 61  ? -15.128 -35.498 -15.264 1.00 23.48 ? 61   THR A N     1 
ATOM   230  C  CA    . THR A 1 61  ? -15.646 -34.671 -14.176 1.00 21.72 ? 61   THR A CA    1 
ATOM   231  C  C     . THR A 1 61  ? -16.228 -35.423 -12.976 1.00 22.78 ? 61   THR A C     1 
ATOM   232  O  O     . THR A 1 61  ? -15.862 -35.135 -11.837 1.00 20.09 ? 61   THR A O     1 
ATOM   233  C  CB    . THR A 1 61  ? -16.621 -33.597 -14.712 1.00 22.76 ? 61   THR A CB    1 
ATOM   234  O  OG1   . THR A 1 61  ? -15.902 -32.721 -15.589 1.00 17.51 ? 61   THR A OG1   1 
ATOM   235  C  CG2   . THR A 1 61  ? -17.220 -32.773 -13.575 1.00 21.72 ? 61   THR A CG2   1 
ATOM   236  N  N     . PRO A 1 62  ? -17.125 -36.404 -13.204 1.00 20.80 ? 62   PRO A N     1 
ATOM   237  C  CA    . PRO A 1 62  ? -17.684 -37.135 -12.059 1.00 20.37 ? 62   PRO A CA    1 
ATOM   238  C  C     . PRO A 1 62  ? -16.579 -37.735 -11.179 1.00 19.73 ? 62   PRO A C     1 
ATOM   239  O  O     . PRO A 1 62  ? -16.661 -37.694 -9.951  1.00 21.91 ? 62   PRO A O     1 
ATOM   240  C  CB    . PRO A 1 62  ? -18.521 -38.224 -12.732 1.00 20.65 ? 62   PRO A CB    1 
ATOM   241  C  CG    . PRO A 1 62  ? -19.022 -37.534 -13.956 1.00 21.38 ? 62   PRO A CG    1 
ATOM   242  C  CD    . PRO A 1 62  ? -17.777 -36.822 -14.459 1.00 21.94 ? 62   PRO A CD    1 
ATOM   243  N  N     . GLU A 1 63  ? -15.540 -38.260 -11.825 1.00 19.14 ? 63   GLU A N     1 
ATOM   244  C  CA    . GLU A 1 63  ? -14.393 -38.863 -11.142 1.00 21.75 ? 63   GLU A CA    1 
ATOM   245  C  C     . GLU A 1 63  ? -13.611 -37.799 -10.369 1.00 19.97 ? 63   GLU A C     1 
ATOM   246  O  O     . GLU A 1 63  ? -13.257 -38.001 -9.206  1.00 17.77 ? 63   GLU A O     1 
ATOM   247  C  CB    . GLU A 1 63  ? -13.479 -39.539 -12.170 1.00 26.34 ? 63   GLU A CB    1 
ATOM   248  C  CG    . GLU A 1 63  ? -12.249 -40.235 -11.594 1.00 33.73 ? 63   GLU A CG    1 
ATOM   249  C  CD    . GLU A 1 63  ? -11.341 -40.818 -12.672 1.00 37.72 ? 63   GLU A CD    1 
ATOM   250  O  OE1   . GLU A 1 63  ? -10.134 -40.995 -12.401 1.00 40.57 ? 63   GLU A OE1   1 
ATOM   251  O  OE2   . GLU A 1 63  ? -11.828 -41.099 -13.790 1.00 41.99 ? 63   GLU A OE2   1 
ATOM   252  N  N     . ARG A 1 64  ? -13.352 -36.668 -11.022 1.00 19.78 ? 64   ARG A N     1 
ATOM   253  C  CA    . ARG A 1 64  ? -12.624 -35.557 -10.396 1.00 20.64 ? 64   ARG A CA    1 
ATOM   254  C  C     . ARG A 1 64  ? -13.389 -34.995 -9.194  1.00 21.04 ? 64   ARG A C     1 
ATOM   255  O  O     . ARG A 1 64  ? -12.807 -34.749 -8.134  1.00 22.34 ? 64   ARG A O     1 
ATOM   256  C  CB    . ARG A 1 64  ? -12.362 -34.444 -11.418 1.00 20.78 ? 64   ARG A CB    1 
ATOM   257  C  CG    . ARG A 1 64  ? -11.268 -34.767 -12.422 1.00 22.67 ? 64   ARG A CG    1 
ATOM   258  C  CD    . ARG A 1 64  ? -11.004 -33.606 -13.376 1.00 22.96 ? 64   ARG A CD    1 
ATOM   259  N  NE    . ARG A 1 64  ? -12.101 -33.388 -14.316 1.00 22.30 ? 64   ARG A NE    1 
ATOM   260  C  CZ    . ARG A 1 64  ? -11.987 -33.473 -15.639 1.00 23.63 ? 64   ARG A CZ    1 
ATOM   261  N  NH1   . ARG A 1 64  ? -10.816 -33.774 -16.195 1.00 22.32 ? 64   ARG A NH1   1 
ATOM   262  N  NH2   . ARG A 1 64  ? -13.047 -33.263 -16.412 1.00 21.60 ? 64   ARG A NH2   1 
ATOM   263  N  N     . VAL A 1 65  ? -14.694 -34.799 -9.367  1.00 20.84 ? 65   VAL A N     1 
ATOM   264  C  CA    . VAL A 1 65  ? -15.550 -34.279 -8.302  1.00 19.35 ? 65   VAL A CA    1 
ATOM   265  C  C     . VAL A 1 65  ? -15.590 -35.234 -7.104  1.00 21.84 ? 65   VAL A C     1 
ATOM   266  O  O     . VAL A 1 65  ? -15.468 -34.804 -5.948  1.00 19.85 ? 65   VAL A O     1 
ATOM   267  C  CB    . VAL A 1 65  ? -16.984 -34.019 -8.823  1.00 18.25 ? 65   VAL A CB    1 
ATOM   268  C  CG1   . VAL A 1 65  ? -17.896 -33.574 -7.690  1.00 20.34 ? 65   VAL A CG1   1 
ATOM   269  C  CG2   . VAL A 1 65  ? -16.956 -32.973 -9.917  1.00 19.43 ? 65   VAL A CG2   1 
ATOM   270  N  N     . ALA A 1 66  ? -15.730 -36.529 -7.381  1.00 21.42 ? 66   ALA A N     1 
ATOM   271  C  CA    . ALA A 1 66  ? -15.778 -37.541 -6.327  1.00 21.89 ? 66   ALA A CA    1 
ATOM   272  C  C     . ALA A 1 66  ? -14.516 -37.505 -5.466  1.00 21.19 ? 66   ALA A C     1 
ATOM   273  O  O     . ALA A 1 66  ? -14.591 -37.486 -4.237  1.00 18.13 ? 66   ALA A O     1 
ATOM   274  C  CB    . ALA A 1 66  ? -15.961 -38.933 -6.934  1.00 24.14 ? 66   ALA A CB    1 
ATOM   275  N  N     . LYS A 1 67  ? -13.358 -37.486 -6.120  1.00 19.88 ? 67   LYS A N     1 
ATOM   276  C  CA    . LYS A 1 67  ? -12.083 -37.450 -5.409  1.00 22.04 ? 67   LYS A CA    1 
ATOM   277  C  C     . LYS A 1 67  ? -11.912 -36.144 -4.641  1.00 21.40 ? 67   LYS A C     1 
ATOM   278  O  O     . LYS A 1 67  ? -11.399 -36.139 -3.522  1.00 20.15 ? 67   LYS A O     1 
ATOM   279  C  CB    . LYS A 1 67  ? -10.915 -37.637 -6.379  1.00 26.16 ? 67   LYS A CB    1 
ATOM   280  C  CG    . LYS A 1 67  ? -10.930 -38.970 -7.107  1.00 32.35 ? 67   LYS A CG    1 
ATOM   281  C  CD    . LYS A 1 67  ? -9.667  -39.180 -7.930  1.00 38.17 ? 67   LYS A CD    1 
ATOM   282  C  CE    . LYS A 1 67  ? -8.473  -39.517 -7.044  1.00 43.99 ? 67   LYS A CE    1 
ATOM   283  N  NZ    . LYS A 1 67  ? -8.666  -40.813 -6.320  1.00 47.93 ? 67   LYS A NZ    1 
ATOM   284  N  N     . ALA A 1 68  ? -12.356 -35.044 -5.245  1.00 22.73 ? 68   ALA A N     1 
ATOM   285  C  CA    . ALA A 1 68  ? -12.251 -33.727 -4.620  1.00 20.77 ? 68   ALA A CA    1 
ATOM   286  C  C     . ALA A 1 68  ? -13.026 -33.672 -3.313  1.00 19.54 ? 68   ALA A C     1 
ATOM   287  O  O     . ALA A 1 68  ? -12.501 -33.221 -2.294  1.00 20.58 ? 68   ALA A O     1 
ATOM   288  C  CB    . ALA A 1 68  ? -12.739 -32.648 -5.572  1.00 19.03 ? 68   ALA A CB    1 
ATOM   289  N  N     . TRP A 1 69  ? -14.265 -34.160 -3.333  1.00 17.89 ? 69   TRP A N     1 
ATOM   290  C  CA    . TRP A 1 69  ? -15.095 -34.153 -2.135  1.00 17.38 ? 69   TRP A CA    1 
ATOM   291  C  C     . TRP A 1 69  ? -14.633 -35.099 -1.039  1.00 15.92 ? 69   TRP A C     1 
ATOM   292  O  O     . TRP A 1 69  ? -14.854 -34.831 0.142   1.00 18.63 ? 69   TRP A O     1 
ATOM   293  C  CB    . TRP A 1 69  ? -16.567 -34.365 -2.487  1.00 18.57 ? 69   TRP A CB    1 
ATOM   294  C  CG    . TRP A 1 69  ? -17.204 -33.080 -2.910  1.00 18.71 ? 69   TRP A CG    1 
ATOM   295  C  CD1   . TRP A 1 69  ? -17.164 -32.515 -4.150  1.00 18.82 ? 69   TRP A CD1   1 
ATOM   296  C  CD2   . TRP A 1 69  ? -17.914 -32.162 -2.071  1.00 20.85 ? 69   TRP A CD2   1 
ATOM   297  N  NE1   . TRP A 1 69  ? -17.800 -31.297 -4.137  1.00 19.54 ? 69   TRP A NE1   1 
ATOM   298  C  CE2   . TRP A 1 69  ? -18.270 -31.055 -2.872  1.00 20.08 ? 69   TRP A CE2   1 
ATOM   299  C  CE3   . TRP A 1 69  ? -18.279 -32.165 -0.714  1.00 21.06 ? 69   TRP A CE3   1 
ATOM   300  C  CZ2   . TRP A 1 69  ? -18.974 -29.957 -2.366  1.00 19.61 ? 69   TRP A CZ2   1 
ATOM   301  C  CZ3   . TRP A 1 69  ? -18.979 -31.073 -0.209  1.00 22.67 ? 69   TRP A CZ3   1 
ATOM   302  C  CH2   . TRP A 1 69  ? -19.319 -29.984 -1.035  1.00 23.10 ? 69   TRP A CH2   1 
ATOM   303  N  N     . ALA A 1 70  ? -13.974 -36.191 -1.419  1.00 19.41 ? 70   ALA A N     1 
ATOM   304  C  CA    . ALA A 1 70  ? -13.452 -37.127 -0.428  1.00 20.47 ? 70   ALA A CA    1 
ATOM   305  C  C     . ALA A 1 70  ? -12.339 -36.385 0.326   1.00 21.49 ? 70   ALA A C     1 
ATOM   306  O  O     . ALA A 1 70  ? -12.224 -36.488 1.548   1.00 20.23 ? 70   ALA A O     1 
ATOM   307  C  CB    . ALA A 1 70  ? -12.900 -38.375 -1.108  1.00 24.98 ? 70   ALA A CB    1 
ATOM   308  N  N     . PHE A 1 71  ? -11.549 -35.609 -0.414  1.00 20.54 ? 71   PHE A N     1 
ATOM   309  C  CA    . PHE A 1 71  ? -10.459 -34.820 0.166   1.00 20.00 ? 71   PHE A CA    1 
ATOM   310  C  C     . PHE A 1 71  ? -11.018 -33.673 1.016   1.00 19.19 ? 71   PHE A C     1 
ATOM   311  O  O     . PHE A 1 71  ? -10.565 -33.441 2.138   1.00 19.14 ? 71   PHE A O     1 
ATOM   312  C  CB    . PHE A 1 71  ? -9.559  -34.252 -0.944  1.00 20.67 ? 71   PHE A CB    1 
ATOM   313  C  CG    . PHE A 1 71  ? -8.450  -33.364 -0.439  1.00 21.97 ? 71   PHE A CG    1 
ATOM   314  C  CD1   . PHE A 1 71  ? -7.262  -33.914 0.037   1.00 20.95 ? 71   PHE A CD1   1 
ATOM   315  C  CD2   . PHE A 1 71  ? -8.600  -31.977 -0.422  1.00 21.63 ? 71   PHE A CD2   1 
ATOM   316  C  CE1   . PHE A 1 71  ? -6.239  -33.098 0.525   1.00 22.61 ? 71   PHE A CE1   1 
ATOM   317  C  CE2   . PHE A 1 71  ? -7.582  -31.153 0.064   1.00 21.78 ? 71   PHE A CE2   1 
ATOM   318  C  CZ    . PHE A 1 71  ? -6.401  -31.717 0.539   1.00 21.81 ? 71   PHE A CZ    1 
ATOM   319  N  N     . LEU A 1 72  ? -12.021 -32.977 0.485   1.00 16.84 ? 72   LEU A N     1 
ATOM   320  C  CA    . LEU A 1 72  ? -12.630 -31.849 1.180   1.00 15.68 ? 72   LEU A CA    1 
ATOM   321  C  C     . LEU A 1 72  ? -13.372 -32.213 2.460   1.00 16.69 ? 72   LEU A C     1 
ATOM   322  O  O     . LEU A 1 72  ? -13.700 -31.339 3.256   1.00 14.50 ? 72   LEU A O     1 
ATOM   323  C  CB    . LEU A 1 72  ? -13.545 -31.067 0.233   1.00 17.40 ? 72   LEU A CB    1 
ATOM   324  C  CG    . LEU A 1 72  ? -12.828 -30.406 -0.950  1.00 17.11 ? 72   LEU A CG    1 
ATOM   325  C  CD1   . LEU A 1 72  ? -13.827 -29.649 -1.817  1.00 19.60 ? 72   LEU A CD1   1 
ATOM   326  C  CD2   . LEU A 1 72  ? -11.747 -29.456 -0.444  1.00 19.49 ? 72   LEU A CD2   1 
ATOM   327  N  N     . THR A 1 73  ? -13.638 -33.501 2.656   1.00 18.16 ? 73   THR A N     1 
ATOM   328  C  CA    . THR A 1 73  ? -14.326 -33.960 3.857   1.00 18.71 ? 73   THR A CA    1 
ATOM   329  C  C     . THR A 1 73  ? -13.453 -34.933 4.654   1.00 18.19 ? 73   THR A C     1 
ATOM   330  O  O     . THR A 1 73  ? -13.925 -35.574 5.594   1.00 19.77 ? 73   THR A O     1 
ATOM   331  C  CB    . THR A 1 73  ? -15.676 -34.645 3.514   1.00 18.71 ? 73   THR A CB    1 
ATOM   332  O  OG1   . THR A 1 73  ? -15.437 -35.764 2.652   1.00 18.48 ? 73   THR A OG1   1 
ATOM   333  C  CG2   . THR A 1 73  ? -16.612 -33.668 2.820   1.00 18.17 ? 73   THR A CG2   1 
ATOM   334  N  N     . ARG A 1 74  ? -12.169 -35.002 4.309   1.00 19.36 ? 74   ARG A N     1 
ATOM   335  C  CA    . ARG A 1 74  ? -11.238 -35.908 4.983   1.00 19.96 ? 74   ARG A CA    1 
ATOM   336  C  C     . ARG A 1 74  ? -11.053 -35.604 6.468   1.00 20.83 ? 74   ARG A C     1 
ATOM   337  O  O     . ARG A 1 74  ? -10.642 -36.475 7.236   1.00 17.91 ? 74   ARG A O     1 
ATOM   338  C  CB    . ARG A 1 74  ? -9.880  -35.916 4.270   1.00 22.16 ? 74   ARG A CB    1 
ATOM   339  C  CG    . ARG A 1 74  ? -8.962  -34.736 4.594   1.00 24.38 ? 74   ARG A CG    1 
ATOM   340  C  CD    . ARG A 1 74  ? -7.780  -34.665 3.623   1.00 27.91 ? 74   ARG A CD    1 
ATOM   341  N  NE    . ARG A 1 74  ? -7.074  -35.942 3.495   1.00 29.40 ? 74   ARG A NE    1 
ATOM   342  C  CZ    . ARG A 1 74  ? -6.122  -36.368 4.323   1.00 35.31 ? 74   ARG A CZ    1 
ATOM   343  N  NH1   . ARG A 1 74  ? -5.744  -35.622 5.354   1.00 34.54 ? 74   ARG A NH1   1 
ATOM   344  N  NH2   . ARG A 1 74  ? -5.547  -37.549 4.121   1.00 36.45 ? 74   ARG A NH2   1 
ATOM   345  N  N     . GLY A 1 75  ? -11.382 -34.376 6.868   1.00 18.29 ? 75   GLY A N     1 
ATOM   346  C  CA    . GLY A 1 75  ? -11.238 -33.974 8.257   1.00 17.58 ? 75   GLY A CA    1 
ATOM   347  C  C     . GLY A 1 75  ? -12.082 -34.770 9.239   1.00 19.47 ? 75   GLY A C     1 
ATOM   348  O  O     . GLY A 1 75  ? -11.710 -34.899 10.407  1.00 19.55 ? 75   GLY A O     1 
ATOM   349  N  N     . TYR A 1 76  ? -13.219 -35.289 8.776   1.00 18.27 ? 76   TYR A N     1 
ATOM   350  C  CA    . TYR A 1 76  ? -14.109 -36.088 9.620   1.00 21.09 ? 76   TYR A CA    1 
ATOM   351  C  C     . TYR A 1 76  ? -13.425 -37.384 10.042  1.00 23.52 ? 76   TYR A C     1 
ATOM   352  O  O     . TYR A 1 76  ? -13.633 -37.877 11.149  1.00 24.58 ? 76   TYR A O     1 
ATOM   353  C  CB    . TYR A 1 76  ? -15.379 -36.482 8.856   1.00 21.35 ? 76   TYR A CB    1 
ATOM   354  C  CG    . TYR A 1 76  ? -16.347 -35.366 8.563   1.00 19.18 ? 76   TYR A CG    1 
ATOM   355  C  CD1   . TYR A 1 76  ? -17.015 -34.709 9.592   1.00 20.32 ? 76   TYR A CD1   1 
ATOM   356  C  CD2   . TYR A 1 76  ? -16.619 -34.985 7.251   1.00 18.72 ? 76   TYR A CD2   1 
ATOM   357  C  CE1   . TYR A 1 76  ? -17.932 -33.701 9.323   1.00 18.76 ? 76   TYR A CE1   1 
ATOM   358  C  CE2   . TYR A 1 76  ? -17.538 -33.976 6.973   1.00 18.97 ? 76   TYR A CE2   1 
ATOM   359  C  CZ    . TYR A 1 76  ? -18.186 -33.342 8.014   1.00 17.85 ? 76   TYR A CZ    1 
ATOM   360  O  OH    . TYR A 1 76  ? -19.079 -32.332 7.753   1.00 18.31 ? 76   TYR A OH    1 
ATOM   361  N  N     . ARG A 1 77  ? -12.608 -37.916 9.139   1.00 25.60 ? 77   ARG A N     1 
ATOM   362  C  CA    . ARG A 1 77  ? -11.913 -39.180 9.339   1.00 28.16 ? 77   ARG A CA    1 
ATOM   363  C  C     . ARG A 1 77  ? -10.522 -39.101 9.959   1.00 28.85 ? 77   ARG A C     1 
ATOM   364  O  O     . ARG A 1 77  ? -9.802  -40.098 9.996   1.00 30.24 ? 77   ARG A O     1 
ATOM   365  C  CB    . ARG A 1 77  ? -11.876 -39.938 8.010   1.00 30.68 ? 77   ARG A CB    1 
ATOM   366  C  CG    . ARG A 1 77  ? -13.278 -40.192 7.449   1.00 35.25 ? 77   ARG A CG    1 
ATOM   367  C  CD    . ARG A 1 77  ? -13.268 -40.887 6.095   1.00 37.69 ? 77   ARG A CD    1 
ATOM   368  N  NE    . ARG A 1 77  ? -12.847 -40.014 4.999   1.00 39.76 ? 77   ARG A NE    1 
ATOM   369  C  CZ    . ARG A 1 77  ? -13.590 -39.041 4.474   1.00 40.72 ? 77   ARG A CZ    1 
ATOM   370  N  NH1   . ARG A 1 77  ? -14.806 -38.786 4.945   1.00 42.36 ? 77   ARG A NH1   1 
ATOM   371  N  NH2   . ARG A 1 77  ? -13.134 -38.353 3.437   1.00 39.03 ? 77   ARG A NH2   1 
ATOM   372  N  N     . GLN A 1 78  ? -10.151 -37.926 10.459  1.00 26.32 ? 78   GLN A N     1 
ATOM   373  C  CA    . GLN A 1 78  ? -8.848  -37.752 11.088  1.00 25.37 ? 78   GLN A CA    1 
ATOM   374  C  C     . GLN A 1 78  ? -8.937  -37.820 12.607  1.00 25.49 ? 78   GLN A C     1 
ATOM   375  O  O     . GLN A 1 78  ? -9.983  -37.538 13.193  1.00 26.08 ? 78   GLN A O     1 
ATOM   376  C  CB    . GLN A 1 78  ? -8.214  -36.422 10.674  1.00 23.44 ? 78   GLN A CB    1 
ATOM   377  C  CG    . GLN A 1 78  ? -7.702  -36.390 9.248   1.00 22.05 ? 78   GLN A CG    1 
ATOM   378  C  CD    . GLN A 1 78  ? -7.103  -35.044 8.891   1.00 24.19 ? 78   GLN A CD    1 
ATOM   379  O  OE1   . GLN A 1 78  ? -7.814  -34.046 8.784   1.00 21.81 ? 78   GLN A OE1   1 
ATOM   380  N  NE2   . GLN A 1 78  ? -5.787  -35.006 8.727   1.00 22.06 ? 78   GLN A NE2   1 
ATOM   381  N  N     . ARG A 1 79  ? -7.828  -38.201 13.232  1.00 25.47 ? 79   ARG A N     1 
ATOM   382  C  CA    . ARG A 1 79  ? -7.742  -38.307 14.684  1.00 27.44 ? 79   ARG A CA    1 
ATOM   383  C  C     . ARG A 1 79  ? -6.779  -37.255 15.218  1.00 24.51 ? 79   ARG A C     1 
ATOM   384  O  O     . ARG A 1 79  ? -5.642  -37.159 14.758  1.00 24.72 ? 79   ARG A O     1 
ATOM   385  C  CB    . ARG A 1 79  ? -7.257  -39.699 15.094  1.00 29.50 ? 79   ARG A CB    1 
ATOM   386  C  CG    . ARG A 1 79  ? -8.302  -40.795 14.975  1.00 37.54 ? 79   ARG A CG    1 
ATOM   387  C  CD    . ARG A 1 79  ? -7.744  -42.120 15.471  1.00 44.42 ? 79   ARG A CD    1 
ATOM   388  N  NE    . ARG A 1 79  ? -8.788  -43.122 15.663  1.00 51.78 ? 79   ARG A NE    1 
ATOM   389  C  CZ    . ARG A 1 79  ? -8.564  -44.372 16.059  1.00 56.42 ? 79   ARG A CZ    1 
ATOM   390  N  NH1   . ARG A 1 79  ? -7.327  -44.788 16.305  1.00 57.70 ? 79   ARG A NH1   1 
ATOM   391  N  NH2   . ARG A 1 79  ? -9.582  -45.206 16.226  1.00 59.15 ? 79   ARG A NH2   1 
ATOM   392  N  N     . LEU A 1 80  ? -7.230  -36.497 16.212  1.00 25.00 ? 80   LEU A N     1 
ATOM   393  C  CA    . LEU A 1 80  ? -6.429  -35.440 16.818  1.00 25.88 ? 80   LEU A CA    1 
ATOM   394  C  C     . LEU A 1 80  ? -5.063  -35.938 17.296  1.00 28.07 ? 80   LEU A C     1 
ATOM   395  O  O     . LEU A 1 80  ? -4.059  -35.238 17.159  1.00 26.74 ? 80   LEU A O     1 
ATOM   396  C  CB    . LEU A 1 80  ? -7.196  -34.799 17.976  1.00 26.07 ? 80   LEU A CB    1 
ATOM   397  C  CG    . LEU A 1 80  ? -6.583  -33.549 18.616  1.00 29.37 ? 80   LEU A CG    1 
ATOM   398  C  CD1   . LEU A 1 80  ? -6.359  -32.471 17.556  1.00 28.80 ? 80   LEU A CD1   1 
ATOM   399  C  CD2   . LEU A 1 80  ? -7.497  -33.031 19.718  1.00 27.08 ? 80   LEU A CD2   1 
ATOM   400  N  N     . GLU A 1 81  ? -5.034  -37.153 17.836  1.00 28.70 ? 81   GLU A N     1 
ATOM   401  C  CA    . GLU A 1 81  ? -3.798  -37.752 18.328  1.00 31.32 ? 81   GLU A CA    1 
ATOM   402  C  C     . GLU A 1 81  ? -2.790  -37.970 17.198  1.00 29.71 ? 81   GLU A C     1 
ATOM   403  O  O     . GLU A 1 81  ? -1.605  -37.683 17.358  1.00 28.50 ? 81   GLU A O     1 
ATOM   404  C  CB    . GLU A 1 81  ? -4.103  -39.074 19.043  1.00 35.71 ? 81   GLU A CB    1 
ATOM   405  C  CG    . GLU A 1 81  ? -2.903  -39.709 19.739  1.00 44.73 ? 81   GLU A CG    1 
ATOM   406  C  CD    . GLU A 1 81  ? -3.284  -40.852 20.676  1.00 48.49 ? 81   GLU A CD    1 
ATOM   407  O  OE1   . GLU A 1 81  ? -2.437  -41.231 21.512  1.00 49.46 ? 81   GLU A OE1   1 
ATOM   408  O  OE2   . GLU A 1 81  ? -4.421  -41.368 20.586  1.00 48.95 ? 81   GLU A OE2   1 
ATOM   409  N  N     . GLU A 1 82  ? -3.267  -38.455 16.054  1.00 29.06 ? 82   GLU A N     1 
ATOM   410  C  CA    . GLU A 1 82  ? -2.404  -38.698 14.896  1.00 30.08 ? 82   GLU A CA    1 
ATOM   411  C  C     . GLU A 1 82  ? -1.971  -37.391 14.241  1.00 28.55 ? 82   GLU A C     1 
ATOM   412  O  O     . GLU A 1 82  ? -0.843  -37.270 13.757  1.00 30.41 ? 82   GLU A O     1 
ATOM   413  C  CB    . GLU A 1 82  ? -3.116  -39.582 13.871  1.00 33.43 ? 82   GLU A CB    1 
ATOM   414  C  CG    . GLU A 1 82  ? -3.428  -40.985 14.382  1.00 42.25 ? 82   GLU A CG    1 
ATOM   415  C  CD    . GLU A 1 82  ? -4.180  -41.845 13.377  1.00 46.28 ? 82   GLU A CD    1 
ATOM   416  O  OE1   . GLU A 1 82  ? -4.166  -41.528 12.166  1.00 49.83 ? 82   GLU A OE1   1 
ATOM   417  O  OE2   . GLU A 1 82  ? -4.785  -42.850 13.804  1.00 49.27 ? 82   GLU A OE2   1 
ATOM   418  N  N     . VAL A 1 83  ? -2.876  -36.415 14.233  1.00 27.07 ? 83   VAL A N     1 
ATOM   419  C  CA    . VAL A 1 83  ? -2.607  -35.102 13.653  1.00 25.68 ? 83   VAL A CA    1 
ATOM   420  C  C     . VAL A 1 83  ? -1.490  -34.371 14.400  1.00 25.94 ? 83   VAL A C     1 
ATOM   421  O  O     . VAL A 1 83  ? -0.626  -33.748 13.781  1.00 25.94 ? 83   VAL A O     1 
ATOM   422  C  CB    . VAL A 1 83  ? -3.897  -34.245 13.626  1.00 25.63 ? 83   VAL A CB    1 
ATOM   423  C  CG1   . VAL A 1 83  ? -3.581  -32.791 13.340  1.00 26.39 ? 83   VAL A CG1   1 
ATOM   424  C  CG2   . VAL A 1 83  ? -4.849  -34.784 12.566  1.00 22.83 ? 83   VAL A CG2   1 
ATOM   425  N  N     . VAL A 1 84  ? -1.505  -34.463 15.728  1.00 25.30 ? 84   VAL A N     1 
ATOM   426  C  CA    . VAL A 1 84  ? -0.489  -33.823 16.560  1.00 26.73 ? 84   VAL A CA    1 
ATOM   427  C  C     . VAL A 1 84  ? 0.845   -34.564 16.438  1.00 28.27 ? 84   VAL A C     1 
ATOM   428  O  O     . VAL A 1 84  ? 1.914   -33.948 16.464  1.00 28.61 ? 84   VAL A O     1 
ATOM   429  C  CB    . VAL A 1 84  ? -0.941  -33.756 18.041  1.00 26.31 ? 84   VAL A CB    1 
ATOM   430  C  CG1   . VAL A 1 84  ? 0.196   -33.282 18.935  1.00 26.68 ? 84   VAL A CG1   1 
ATOM   431  C  CG2   . VAL A 1 84  ? -2.126  -32.813 18.171  1.00 26.55 ? 84   VAL A CG2   1 
ATOM   432  N  N     . GLY A 1 85  ? 0.771   -35.885 16.289  1.00 27.63 ? 85   GLY A N     1 
ATOM   433  C  CA    . GLY A 1 85  ? 1.968   -36.699 16.147  1.00 30.12 ? 85   GLY A CA    1 
ATOM   434  C  C     . GLY A 1 85  ? 2.948   -36.625 17.305  1.00 26.68 ? 85   GLY A C     1 
ATOM   435  O  O     . GLY A 1 85  ? 4.152   -36.788 17.112  1.00 29.51 ? 85   GLY A O     1 
ATOM   436  N  N     . GLY A 1 86  ? 2.435   -36.357 18.502  1.00 28.99 ? 86   GLY A N     1 
ATOM   437  C  CA    . GLY A 1 86  ? 3.283   -36.265 19.679  1.00 29.46 ? 86   GLY A CA    1 
ATOM   438  C  C     . GLY A 1 86  ? 4.288   -35.127 19.649  1.00 32.27 ? 86   GLY A C     1 
ATOM   439  O  O     . GLY A 1 86  ? 5.260   -35.135 20.407  1.00 31.24 ? 86   GLY A O     1 
ATOM   440  N  N     . ALA A 1 87  ? 4.062   -34.149 18.773  1.00 30.49 ? 87   ALA A N     1 
ATOM   441  C  CA    . ALA A 1 87  ? 4.957   -33.003 18.656  1.00 28.52 ? 87   ALA A CA    1 
ATOM   442  C  C     . ALA A 1 87  ? 4.627   -31.952 19.710  1.00 29.12 ? 87   ALA A C     1 
ATOM   443  O  O     . ALA A 1 87  ? 4.252   -30.821 19.397  1.00 30.47 ? 87   ALA A O     1 
ATOM   444  C  CB    . ALA A 1 87  ? 4.884   -32.411 17.255  1.00 29.93 ? 87   ALA A CB    1 
ATOM   445  N  N     . VAL A 1 88  ? 4.730   -32.364 20.968  1.00 27.59 ? 88   VAL A N     1 
ATOM   446  C  CA    . VAL A 1 88  ? 4.473   -31.503 22.112  1.00 29.27 ? 88   VAL A CA    1 
ATOM   447  C  C     . VAL A 1 88  ? 5.805   -31.431 22.845  1.00 30.29 ? 88   VAL A C     1 
ATOM   448  O  O     . VAL A 1 88  ? 6.399   -32.463 23.163  1.00 31.82 ? 88   VAL A O     1 
ATOM   449  C  CB    . VAL A 1 88  ? 3.386   -32.104 23.029  1.00 29.02 ? 88   VAL A CB    1 
ATOM   450  C  CG1   . VAL A 1 88  ? 3.112   -31.179 24.200  1.00 28.94 ? 88   VAL A CG1   1 
ATOM   451  C  CG2   . VAL A 1 88  ? 2.109   -32.343 22.237  1.00 27.51 ? 88   VAL A CG2   1 
ATOM   452  N  N     . PHE A 1 89  ? 6.283   -30.215 23.089  1.00 30.40 ? 89   PHE A N     1 
ATOM   453  C  CA    . PHE A 1 89  ? 7.574   -30.016 23.738  1.00 30.64 ? 89   PHE A CA    1 
ATOM   454  C  C     . PHE A 1 89  ? 7.487   -29.220 25.033  1.00 30.44 ? 89   PHE A C     1 
ATOM   455  O  O     . PHE A 1 89  ? 6.466   -28.598 25.326  1.00 29.35 ? 89   PHE A O     1 
ATOM   456  C  CB    . PHE A 1 89  ? 8.521   -29.281 22.779  1.00 31.09 ? 89   PHE A CB    1 
ATOM   457  C  CG    . PHE A 1 89  ? 8.474   -29.788 21.368  1.00 31.71 ? 89   PHE A CG    1 
ATOM   458  C  CD1   . PHE A 1 89  ? 9.018   -31.023 21.038  1.00 31.87 ? 89   PHE A CD1   1 
ATOM   459  C  CD2   . PHE A 1 89  ? 7.883   -29.025 20.365  1.00 31.74 ? 89   PHE A CD2   1 
ATOM   460  C  CE1   . PHE A 1 89  ? 8.974   -31.492 19.728  1.00 32.14 ? 89   PHE A CE1   1 
ATOM   461  C  CE2   . PHE A 1 89  ? 7.836   -29.486 19.057  1.00 31.03 ? 89   PHE A CE2   1 
ATOM   462  C  CZ    . PHE A 1 89  ? 8.381   -30.720 18.736  1.00 30.74 ? 89   PHE A CZ    1 
ATOM   463  N  N     . PRO A 1 90  ? 8.556   -29.262 25.847  1.00 30.67 ? 90   PRO A N     1 
ATOM   464  C  CA    . PRO A 1 90  ? 8.570   -28.517 27.109  1.00 30.89 ? 90   PRO A CA    1 
ATOM   465  C  C     . PRO A 1 90  ? 8.571   -27.026 26.789  1.00 29.99 ? 90   PRO A C     1 
ATOM   466  O  O     . PRO A 1 90  ? 9.250   -26.590 25.853  1.00 29.54 ? 90   PRO A O     1 
ATOM   467  C  CB    . PRO A 1 90  ? 9.907   -28.929 27.732  1.00 32.24 ? 90   PRO A CB    1 
ATOM   468  C  CG    . PRO A 1 90  ? 10.128  -30.301 27.189  1.00 33.26 ? 90   PRO A CG    1 
ATOM   469  C  CD    . PRO A 1 90  ? 9.733   -30.142 25.747  1.00 30.76 ? 90   PRO A CD    1 
ATOM   470  N  N     . ALA A 1 91  ? 7.798   -26.255 27.544  1.00 29.03 ? 91   ALA A N     1 
ATOM   471  C  CA    . ALA A 1 91  ? 7.726   -24.811 27.340  1.00 28.79 ? 91   ALA A CA    1 
ATOM   472  C  C     . ALA A 1 91  ? 9.092   -24.173 27.579  1.00 30.40 ? 91   ALA A C     1 
ATOM   473  O  O     . ALA A 1 91  ? 9.854   -24.624 28.439  1.00 30.17 ? 91   ALA A O     1 
ATOM   474  C  CB    . ALA A 1 91  ? 6.693   -24.198 28.273  1.00 27.86 ? 91   ALA A CB    1 
ATOM   475  N  N     . GLU A 1 92  ? 9.398   -23.143 26.796  1.00 28.55 ? 92   GLU A N     1 
ATOM   476  C  CA    . GLU A 1 92  ? 10.663  -22.419 26.901  1.00 28.38 ? 92   GLU A CA    1 
ATOM   477  C  C     . GLU A 1 92  ? 10.497  -21.161 27.742  1.00 28.22 ? 92   GLU A C     1 
ATOM   478  O  O     . GLU A 1 92  ? 11.473  -20.614 28.257  1.00 29.73 ? 92   GLU A O     1 
ATOM   479  C  CB    . GLU A 1 92  ? 11.164  -22.020 25.511  1.00 25.78 ? 92   GLU A CB    1 
ATOM   480  C  CG    . GLU A 1 92  ? 11.497  -23.184 24.592  1.00 26.11 ? 92   GLU A CG    1 
ATOM   481  C  CD    . GLU A 1 92  ? 12.776  -23.919 24.979  1.00 24.77 ? 92   GLU A CD    1 
ATOM   482  O  OE1   . GLU A 1 92  ? 13.629  -23.339 25.685  1.00 22.80 ? 92   GLU A OE1   1 
ATOM   483  O  OE2   . GLU A 1 92  ? 12.936  -25.076 24.547  1.00 25.13 ? 92   GLU A OE2   1 
ATOM   484  N  N     . GLY A 1 93  ? 9.255   -20.701 27.858  1.00 28.74 ? 93   GLY A N     1 
ATOM   485  C  CA    . GLY A 1 93  ? 8.959   -19.504 28.621  1.00 28.91 ? 93   GLY A CA    1 
ATOM   486  C  C     . GLY A 1 93  ? 7.498   -19.451 29.024  1.00 30.39 ? 93   GLY A C     1 
ATOM   487  O  O     . GLY A 1 93  ? 6.750   -20.406 28.806  1.00 31.75 ? 93   GLY A O     1 
ATOM   488  N  N     . SER A 1 94  ? 7.080   -18.318 29.578  1.00 29.41 ? 94   SER A N     1 
ATOM   489  C  CA    . SER A 1 94  ? 5.704   -18.156 30.033  1.00 30.21 ? 94   SER A CA    1 
ATOM   490  C  C     . SER A 1 94  ? 4.862   -17.206 29.184  1.00 27.10 ? 94   SER A C     1 
ATOM   491  O  O     . SER A 1 94  ? 3.668   -17.035 29.446  1.00 26.31 ? 94   SER A O     1 
ATOM   492  C  CB    . SER A 1 94  ? 5.691   -17.694 31.496  1.00 33.84 ? 94   SER A CB    1 
ATOM   493  O  OG    . SER A 1 94  ? 6.390   -16.468 31.656  1.00 36.99 ? 94   SER A OG    1 
ATOM   494  N  N     . GLU A 1 95  ? 5.468   -16.607 28.162  1.00 23.97 ? 95   GLU A N     1 
ATOM   495  C  CA    . GLU A 1 95  ? 4.744   -15.665 27.319  1.00 21.98 ? 95   GLU A CA    1 
ATOM   496  C  C     . GLU A 1 95  ? 3.857   -16.301 26.258  1.00 18.97 ? 95   GLU A C     1 
ATOM   497  O  O     . GLU A 1 95  ? 4.000   -17.468 25.896  1.00 17.82 ? 95   GLU A O     1 
ATOM   498  C  CB    . GLU A 1 95  ? 5.696   -14.657 26.664  1.00 25.35 ? 95   GLU A CB    1 
ATOM   499  C  CG    . GLU A 1 95  ? 6.449   -13.750 27.646  1.00 26.26 ? 95   GLU A CG    1 
ATOM   500  C  CD    . GLU A 1 95  ? 5.531   -12.937 28.549  1.00 30.61 ? 95   GLU A CD    1 
ATOM   501  O  OE1   . GLU A 1 95  ? 4.565   -12.329 28.042  1.00 30.42 ? 95   GLU A OE1   1 
ATOM   502  O  OE2   . GLU A 1 95  ? 5.786   -12.895 29.773  1.00 31.67 ? 95   GLU A OE2   1 
ATOM   503  N  N     . MET A 1 96  ? 2.915   -15.502 25.786  1.00 19.15 ? 96   MET A N     1 
ATOM   504  C  CA    . MET A 1 96  ? 1.971   -15.911 24.765  1.00 17.42 ? 96   MET A CA    1 
ATOM   505  C  C     . MET A 1 96  ? 2.697   -16.255 23.464  1.00 14.78 ? 96   MET A C     1 
ATOM   506  O  O     . MET A 1 96  ? 3.723   -15.658 23.139  1.00 14.88 ? 96   MET A O     1 
ATOM   507  C  CB    . MET A 1 96  ? 1.009   -14.749 24.522  1.00 20.28 ? 96   MET A CB    1 
ATOM   508  C  CG    . MET A 1 96  ? -0.063  -14.971 23.482  1.00 21.57 ? 96   MET A CG    1 
ATOM   509  S  SD    . MET A 1 96  ? -0.993  -13.441 23.272  1.00 19.51 ? 96   MET A SD    1 
ATOM   510  C  CE    . MET A 1 96  ? -1.695  -13.258 24.955  1.00 17.79 ? 96   MET A CE    1 
ATOM   511  N  N     . VAL A 1 97  ? 2.213   -17.291 22.786  1.00 13.55 ? 97   VAL A N     1 
ATOM   512  C  CA    . VAL A 1 97  ? 2.750   -17.686 21.488  1.00 14.85 ? 97   VAL A CA    1 
ATOM   513  C  C     . VAL A 1 97  ? 1.591   -17.405 20.540  1.00 14.51 ? 97   VAL A C     1 
ATOM   514  O  O     . VAL A 1 97  ? 0.457   -17.782 20.832  1.00 15.52 ? 97   VAL A O     1 
ATOM   515  C  CB    . VAL A 1 97  ? 3.084   -19.188 21.414  1.00 13.49 ? 97   VAL A CB    1 
ATOM   516  C  CG1   . VAL A 1 97  ? 3.547   -19.539 20.006  1.00 12.84 ? 97   VAL A CG1   1 
ATOM   517  C  CG2   . VAL A 1 97  ? 4.170   -19.545 22.432  1.00 14.23 ? 97   VAL A CG2   1 
ATOM   518  N  N     . VAL A 1 98  ? 1.862   -16.707 19.439  1.00 14.29 ? 98   VAL A N     1 
ATOM   519  C  CA    . VAL A 1 98  ? 0.818   -16.382 18.471  1.00 14.61 ? 98   VAL A CA    1 
ATOM   520  C  C     . VAL A 1 98  ? 1.203   -16.890 17.089  1.00 15.22 ? 98   VAL A C     1 
ATOM   521  O  O     . VAL A 1 98  ? 2.257   -16.543 16.568  1.00 15.21 ? 98   VAL A O     1 
ATOM   522  C  CB    . VAL A 1 98  ? 0.567   -14.847 18.381  1.00 16.90 ? 98   VAL A CB    1 
ATOM   523  C  CG1   . VAL A 1 98  ? -0.542  -14.550 17.362  1.00 16.58 ? 98   VAL A CG1   1 
ATOM   524  C  CG2   . VAL A 1 98  ? 0.193   -14.275 19.750  1.00 15.83 ? 98   VAL A CG2   1 
ATOM   525  N  N     . VAL A 1 99  ? 0.382   -17.779 16.537  1.00 14.77 ? 99   VAL A N     1 
ATOM   526  C  CA    . VAL A 1 99  ? 0.622   -18.312 15.202  1.00 15.17 ? 99   VAL A CA    1 
ATOM   527  C  C     . VAL A 1 99  ? -0.476  -17.687 14.351  1.00 17.31 ? 99   VAL A C     1 
ATOM   528  O  O     . VAL A 1 99  ? -1.642  -18.075 14.440  1.00 18.62 ? 99   VAL A O     1 
ATOM   529  C  CB    . VAL A 1 99  ? 0.497   -19.851 15.158  1.00 15.59 ? 99   VAL A CB    1 
ATOM   530  C  CG1   . VAL A 1 99  ? 0.646   -20.349 13.726  1.00 12.36 ? 99   VAL A CG1   1 
ATOM   531  C  CG2   . VAL A 1 99  ? 1.552   -20.503 16.066  1.00 13.47 ? 99   VAL A CG2   1 
ATOM   532  N  N     . LYS A 1 100 ? -0.123  -16.687 13.557  1.00 15.33 ? 100  LYS A N     1 
ATOM   533  C  CA    . LYS A 1 100 ? -1.143  -16.048 12.746  1.00 15.84 ? 100  LYS A CA    1 
ATOM   534  C  C     . LYS A 1 100 ? -1.085  -16.326 11.260  1.00 12.11 ? 100  LYS A C     1 
ATOM   535  O  O     . LYS A 1 100 ? -0.114  -16.889 10.752  1.00 11.02 ? 100  LYS A O     1 
ATOM   536  C  CB    . LYS A 1 100 ? -1.186  -14.548 13.021  1.00 21.23 ? 100  LYS A CB    1 
ATOM   537  C  CG    . LYS A 1 100 ? 0.127   -13.832 12.906  1.00 23.52 ? 100  LYS A CG    1 
ATOM   538  C  CD    . LYS A 1 100 ? 0.058   -12.486 13.618  1.00 24.56 ? 100  LYS A CD    1 
ATOM   539  C  CE    . LYS A 1 100 ? 1.355   -11.735 13.490  1.00 25.93 ? 100  LYS A CE    1 
ATOM   540  N  NZ    . LYS A 1 100 ? 1.450   -10.516 14.366  1.00 29.79 ? 100  LYS A NZ    1 
ATOM   541  N  N     . GLY A 1 101 ? -2.180  -15.993 10.587  1.00 11.78 ? 101  GLY A N     1 
ATOM   542  C  CA    . GLY A 1 101 ? -2.256  -16.161 9.149   1.00 11.46 ? 101  GLY A CA    1 
ATOM   543  C  C     . GLY A 1 101 ? -2.244  -17.570 8.599   1.00 10.59 ? 101  GLY A C     1 
ATOM   544  O  O     . GLY A 1 101 ? -1.725  -17.782 7.509   1.00 11.95 ? 101  GLY A O     1 
ATOM   545  N  N     . VAL A 1 102 ? -2.778  -18.534 9.343   1.00 11.08 ? 102  VAL A N     1 
ATOM   546  C  CA    . VAL A 1 102 ? -2.836  -19.901 8.837   1.00 11.95 ? 102  VAL A CA    1 
ATOM   547  C  C     . VAL A 1 102 ? -4.041  -19.937 7.892   1.00 10.29 ? 102  VAL A C     1 
ATOM   548  O  O     . VAL A 1 102 ? -5.185  -19.902 8.341   1.00 11.33 ? 102  VAL A O     1 
ATOM   549  C  CB    . VAL A 1 102 ? -3.040  -20.935 9.966   1.00 14.33 ? 102  VAL A CB    1 
ATOM   550  C  CG1   . VAL A 1 102 ? -3.082  -22.356 9.375   1.00 14.68 ? 102  VAL A CG1   1 
ATOM   551  C  CG2   . VAL A 1 102 ? -1.924  -20.816 11.003  1.00 11.45 ? 102  VAL A CG2   1 
ATOM   552  N  N     . GLU A 1 103 ? -3.787  -19.939 6.588   1.00 11.11 ? 103  GLU A N     1 
ATOM   553  C  CA    . GLU A 1 103 ? -4.888  -19.961 5.634   1.00 11.87 ? 103  GLU A CA    1 
ATOM   554  C  C     . GLU A 1 103 ? -5.690  -21.253 5.752   1.00 12.12 ? 103  GLU A C     1 
ATOM   555  O  O     . GLU A 1 103 ? -5.143  -22.321 6.070   1.00 10.51 ? 103  GLU A O     1 
ATOM   556  C  CB    . GLU A 1 103 ? -4.398  -19.762 4.193   1.00 11.83 ? 103  GLU A CB    1 
ATOM   557  C  CG    . GLU A 1 103 ? -3.587  -20.917 3.615   1.00 12.81 ? 103  GLU A CG    1 
ATOM   558  C  CD    . GLU A 1 103 ? -2.082  -20.718 3.719   1.00 13.68 ? 103  GLU A CD    1 
ATOM   559  O  OE1   . GLU A 1 103 ? -1.613  -20.011 4.641   1.00 11.64 ? 103  GLU A OE1   1 
ATOM   560  O  OE2   . GLU A 1 103 ? -1.365  -21.279 2.866   1.00 12.92 ? 103  GLU A OE2   1 
ATOM   561  N  N     . PHE A 1 104 ? -6.997  -21.134 5.541   1.00 11.38 ? 104  PHE A N     1 
ATOM   562  C  CA    . PHE A 1 104 ? -7.889  -22.283 5.604   1.00 10.90 ? 104  PHE A CA    1 
ATOM   563  C  C     . PHE A 1 104 ? -8.947  -22.192 4.511   1.00 10.93 ? 104  PHE A C     1 
ATOM   564  O  O     . PHE A 1 104 ? -9.254  -21.108 4.010   1.00 9.14  ? 104  PHE A O     1 
ATOM   565  C  CB    . PHE A 1 104 ? -8.596  -22.352 6.965   1.00 13.04 ? 104  PHE A CB    1 
ATOM   566  C  CG    . PHE A 1 104 ? -9.806  -21.466 7.066   1.00 10.59 ? 104  PHE A CG    1 
ATOM   567  C  CD1   . PHE A 1 104 ? -9.679  -20.125 7.415   1.00 9.56  ? 104  PHE A CD1   1 
ATOM   568  C  CD2   . PHE A 1 104 ? -11.077 -21.965 6.763   1.00 12.44 ? 104  PHE A CD2   1 
ATOM   569  C  CE1   . PHE A 1 104 ? -10.798 -19.290 7.454   1.00 9.09  ? 104  PHE A CE1   1 
ATOM   570  C  CE2   . PHE A 1 104 ? -12.195 -21.143 6.800   1.00 13.74 ? 104  PHE A CE2   1 
ATOM   571  C  CZ    . PHE A 1 104 ? -12.059 -19.805 7.143   1.00 12.25 ? 104  PHE A CZ    1 
ATOM   572  N  N     . TYR A 1 105 ? -9.526  -23.341 4.180   1.00 9.27  ? 105  TYR A N     1 
ATOM   573  C  CA    . TYR A 1 105 ? -10.589 -23.422 3.194   1.00 9.77  ? 105  TYR A CA    1 
ATOM   574  C  C     . TYR A 1 105 ? -11.587 -24.412 3.761   1.00 11.26 ? 105  TYR A C     1 
ATOM   575  O  O     . TYR A 1 105 ? -11.202 -25.457 4.279   1.00 11.36 ? 105  TYR A O     1 
ATOM   576  C  CB    . TYR A 1 105 ? -10.078 -23.944 1.848   1.00 11.40 ? 105  TYR A CB    1 
ATOM   577  C  CG    . TYR A 1 105 ? -9.145  -23.004 1.134   1.00 10.37 ? 105  TYR A CG    1 
ATOM   578  C  CD1   . TYR A 1 105 ? -9.626  -22.091 0.192   1.00 11.81 ? 105  TYR A CD1   1 
ATOM   579  C  CD2   . TYR A 1 105 ? -7.776  -23.008 1.416   1.00 14.14 ? 105  TYR A CD2   1 
ATOM   580  C  CE1   . TYR A 1 105 ? -8.761  -21.191 -0.451  1.00 11.20 ? 105  TYR A CE1   1 
ATOM   581  C  CE2   . TYR A 1 105 ? -6.907  -22.120 0.781   1.00 12.45 ? 105  TYR A CE2   1 
ATOM   582  C  CZ    . TYR A 1 105 ? -7.409  -21.213 -0.145  1.00 12.96 ? 105  TYR A CZ    1 
ATOM   583  O  OH    . TYR A 1 105 ? -6.556  -20.304 -0.734  1.00 12.54 ? 105  TYR A OH    1 
ATOM   584  N  N     . SER A 1 106 ? -12.862 -24.054 3.709   1.00 11.95 ? 106  SER A N     1 
ATOM   585  C  CA    . SER A 1 106 ? -13.907 -24.933 4.206   1.00 12.44 ? 106  SER A CA    1 
ATOM   586  C  C     . SER A 1 106 ? -15.122 -24.848 3.281   1.00 13.12 ? 106  SER A C     1 
ATOM   587  O  O     . SER A 1 106 ? -15.079 -24.181 2.245   1.00 14.71 ? 106  SER A O     1 
ATOM   588  C  CB    . SER A 1 106 ? -14.270 -24.558 5.645   1.00 12.22 ? 106  SER A CB    1 
ATOM   589  O  OG    . SER A 1 106 ? -15.149 -25.509 6.223   1.00 14.72 ? 106  SER A OG    1 
ATOM   590  N  N     . MET A 1 107 ? -16.178 -25.569 3.638   1.00 13.10 ? 107  MET A N     1 
ATOM   591  C  CA    . MET A 1 107 ? -17.420 -25.599 2.868   1.00 16.12 ? 107  MET A CA    1 
ATOM   592  C  C     . MET A 1 107 ? -18.551 -25.293 3.832   1.00 12.66 ? 107  MET A C     1 
ATOM   593  O  O     . MET A 1 107 ? -18.657 -25.933 4.877   1.00 12.13 ? 107  MET A O     1 
ATOM   594  C  CB    . MET A 1 107 ? -17.631 -26.994 2.271   1.00 18.65 ? 107  MET A CB    1 
ATOM   595  C  CG    . MET A 1 107 ? -16.814 -27.271 1.031   1.00 25.15 ? 107  MET A CG    1 
ATOM   596  S  SD    . MET A 1 107 ? -17.451 -26.353 -0.384  1.00 27.95 ? 107  MET A SD    1 
ATOM   597  C  CE    . MET A 1 107 ? -16.594 -27.160 -1.705  1.00 24.85 ? 107  MET A CE    1 
ATOM   598  N  N     . CYS A 1 108 ? -19.376 -24.298 3.523   1.00 11.87 ? 108  CYS A N     1 
ATOM   599  C  CA    . CYS A 1 108 ? -20.472 -23.981 4.431   1.00 12.81 ? 108  CYS A CA    1 
ATOM   600  C  C     . CYS A 1 108 ? -21.502 -25.102 4.362   1.00 14.83 ? 108  CYS A C     1 
ATOM   601  O  O     . CYS A 1 108 ? -21.865 -25.552 3.276   1.00 15.27 ? 108  CYS A O     1 
ATOM   602  C  CB    . CYS A 1 108 ? -21.116 -22.635 4.098   1.00 16.07 ? 108  CYS A CB    1 
ATOM   603  S  SG    . CYS A 1 108 ? -22.094 -22.591 2.587   1.00 20.33 ? 108  CYS A SG    1 
ATOM   604  N  N     . GLU A 1 109 ? -21.937 -25.577 5.523   1.00 15.02 ? 109  GLU A N     1 
ATOM   605  C  CA    . GLU A 1 109 ? -22.913 -26.662 5.566   1.00 15.80 ? 109  GLU A CA    1 
ATOM   606  C  C     . GLU A 1 109 ? -24.277 -26.259 5.018   1.00 17.43 ? 109  GLU A C     1 
ATOM   607  O  O     . GLU A 1 109 ? -25.064 -27.118 4.633   1.00 19.88 ? 109  GLU A O     1 
ATOM   608  C  CB    . GLU A 1 109 ? -23.054 -27.215 6.988   1.00 14.60 ? 109  GLU A CB    1 
ATOM   609  C  CG    . GLU A 1 109 ? -23.689 -26.271 7.998   1.00 15.12 ? 109  GLU A CG    1 
ATOM   610  C  CD    . GLU A 1 109 ? -23.585 -26.799 9.421   1.00 14.26 ? 109  GLU A CD    1 
ATOM   611  O  OE1   . GLU A 1 109 ? -22.688 -27.623 9.682   1.00 21.97 ? 109  GLU A OE1   1 
ATOM   612  O  OE2   . GLU A 1 109 ? -24.383 -26.384 10.279  1.00 18.31 ? 109  GLU A OE2   1 
ATOM   613  N  N     . HIS A 1 110 ? -24.531 -24.955 4.930   1.00 15.36 ? 110  HIS A N     1 
ATOM   614  C  CA    . HIS A 1 110 ? -25.812 -24.461 4.441   1.00 17.97 ? 110  HIS A CA    1 
ATOM   615  C  C     . HIS A 1 110 ? -25.995 -24.457 2.924   1.00 19.06 ? 110  HIS A C     1 
ATOM   616  O  O     . HIS A 1 110 ? -27.095 -24.715 2.440   1.00 19.14 ? 110  HIS A O     1 
ATOM   617  C  CB    . HIS A 1 110 ? -26.085 -23.063 4.994   1.00 18.11 ? 110  HIS A CB    1 
ATOM   618  C  CG    . HIS A 1 110 ? -26.125 -23.005 6.487   1.00 24.02 ? 110  HIS A CG    1 
ATOM   619  N  ND1   . HIS A 1 110 ? -25.659 -21.924 7.201   1.00 27.48 ? 110  HIS A ND1   1 
ATOM   620  C  CD2   . HIS A 1 110 ? -26.562 -23.900 7.403   1.00 29.20 ? 110  HIS A CD2   1 
ATOM   621  C  CE1   . HIS A 1 110 ? -25.805 -22.154 8.492   1.00 28.43 ? 110  HIS A CE1   1 
ATOM   622  N  NE2   . HIS A 1 110 ? -26.352 -23.346 8.642   1.00 30.18 ? 110  HIS A NE2   1 
ATOM   623  N  N     . HIS A 1 111 ? -24.925 -24.194 2.177   1.00 18.90 ? 111  HIS A N     1 
ATOM   624  C  CA    . HIS A 1 111 ? -25.012 -24.141 0.716   1.00 20.03 ? 111  HIS A CA    1 
ATOM   625  C  C     . HIS A 1 111 ? -24.008 -25.016 -0.006  1.00 18.42 ? 111  HIS A C     1 
ATOM   626  O  O     . HIS A 1 111 ? -24.039 -25.101 -1.232  1.00 19.79 ? 111  HIS A O     1 
ATOM   627  C  CB    . HIS A 1 111 ? -24.801 -22.706 0.221   1.00 19.62 ? 111  HIS A CB    1 
ATOM   628  C  CG    . HIS A 1 111 ? -25.748 -21.715 0.811   1.00 22.35 ? 111  HIS A CG    1 
ATOM   629  N  ND1   . HIS A 1 111 ? -25.508 -21.084 2.012   1.00 21.26 ? 111  HIS A ND1   1 
ATOM   630  C  CD2   . HIS A 1 111 ? -26.942 -21.253 0.373   1.00 20.44 ? 111  HIS A CD2   1 
ATOM   631  C  CE1   . HIS A 1 111 ? -26.514 -20.276 2.290   1.00 23.98 ? 111  HIS A CE1   1 
ATOM   632  N  NE2   . HIS A 1 111 ? -27.398 -20.361 1.311   1.00 23.47 ? 111  HIS A NE2   1 
ATOM   633  N  N     . LEU A 1 112 ? -23.102 -25.634 0.744   1.00 18.41 ? 112  LEU A N     1 
ATOM   634  C  CA    . LEU A 1 112 ? -22.050 -26.471 0.174   1.00 17.92 ? 112  LEU A CA    1 
ATOM   635  C  C     . LEU A 1 112 ? -21.180 -25.655 -0.793  1.00 17.20 ? 112  LEU A C     1 
ATOM   636  O  O     . LEU A 1 112 ? -20.826 -26.112 -1.882  1.00 18.12 ? 112  LEU A O     1 
ATOM   637  C  CB    . LEU A 1 112 ? -22.624 -27.715 -0.520  1.00 20.00 ? 112  LEU A CB    1 
ATOM   638  C  CG    . LEU A 1 112 ? -23.479 -28.677 0.308   1.00 24.19 ? 112  LEU A CG    1 
ATOM   639  C  CD1   . LEU A 1 112 ? -23.705 -29.956 -0.484  1.00 24.59 ? 112  LEU A CD1   1 
ATOM   640  C  CD2   . LEU A 1 112 ? -22.804 -28.995 1.627   1.00 23.40 ? 112  LEU A CD2   1 
ATOM   641  N  N     . LEU A 1 113 ? -20.909 -24.412 -0.405  1.00 15.02 ? 113  LEU A N     1 
ATOM   642  C  CA    . LEU A 1 113 ? -20.062 -23.511 -1.178  1.00 14.20 ? 113  LEU A CA    1 
ATOM   643  C  C     . LEU A 1 113 ? -18.891 -23.138 -0.275  1.00 12.24 ? 113  LEU A C     1 
ATOM   644  O  O     . LEU A 1 113 ? -19.046 -22.986 0.935   1.00 11.87 ? 113  LEU A O     1 
ATOM   645  C  CB    . LEU A 1 113 ? -20.836 -22.263 -1.623  1.00 14.59 ? 113  LEU A CB    1 
ATOM   646  C  CG    . LEU A 1 113 ? -21.866 -22.506 -2.736  1.00 15.38 ? 113  LEU A CG    1 
ATOM   647  C  CD1   . LEU A 1 113 ? -22.725 -21.266 -2.946  1.00 15.73 ? 113  LEU A CD1   1 
ATOM   648  C  CD2   . LEU A 1 113 ? -21.152 -22.889 -4.024  1.00 14.85 ? 113  LEU A CD2   1 
ATOM   649  N  N     . PRO A 1 114 ? -17.705 -22.955 -0.858  1.00 12.11 ? 114  PRO A N     1 
ATOM   650  C  CA    . PRO A 1 114 ? -16.527 -22.608 -0.065  1.00 13.23 ? 114  PRO A CA    1 
ATOM   651  C  C     . PRO A 1 114 ? -16.534 -21.286 0.682   1.00 12.27 ? 114  PRO A C     1 
ATOM   652  O  O     . PRO A 1 114 ? -17.151 -20.313 0.252   1.00 12.09 ? 114  PRO A O     1 
ATOM   653  C  CB    . PRO A 1 114 ? -15.405 -22.592 -1.110  1.00 12.04 ? 114  PRO A CB    1 
ATOM   654  C  CG    . PRO A 1 114 ? -15.918 -23.490 -2.202  1.00 13.96 ? 114  PRO A CG    1 
ATOM   655  C  CD    . PRO A 1 114 ? -17.355 -23.086 -2.281  1.00 13.67 ? 114  PRO A CD    1 
ATOM   656  N  N     . PHE A 1 115 ? -15.918 -21.309 1.861   1.00 11.80 ? 115  PHE A N     1 
ATOM   657  C  CA    . PHE A 1 115 ? -15.683 -20.101 2.649   1.00 12.28 ? 115  PHE A CA    1 
ATOM   658  C  C     . PHE A 1 115 ? -14.228 -20.296 3.062   1.00 12.83 ? 115  PHE A C     1 
ATOM   659  O  O     . PHE A 1 115 ? -13.791 -21.424 3.322   1.00 12.34 ? 115  PHE A O     1 
ATOM   660  C  CB    . PHE A 1 115 ? -16.690 -19.843 3.799   1.00 12.66 ? 115  PHE A CB    1 
ATOM   661  C  CG    . PHE A 1 115 ? -16.565 -20.744 4.999   1.00 12.83 ? 115  PHE A CG    1 
ATOM   662  C  CD1   . PHE A 1 115 ? -17.272 -21.945 5.061   1.00 12.82 ? 115  PHE A CD1   1 
ATOM   663  C  CD2   . PHE A 1 115 ? -15.852 -20.329 6.126   1.00 9.17  ? 115  PHE A CD2   1 
ATOM   664  C  CE1   . PHE A 1 115 ? -17.277 -22.716 6.230   1.00 15.87 ? 115  PHE A CE1   1 
ATOM   665  C  CE2   . PHE A 1 115 ? -15.850 -21.094 7.300   1.00 11.89 ? 115  PHE A CE2   1 
ATOM   666  C  CZ    . PHE A 1 115 ? -16.567 -22.290 7.352   1.00 10.31 ? 115  PHE A CZ    1 
ATOM   667  N  N     . PHE A 1 116 ? -13.447 -19.227 2.988   1.00 12.46 ? 116  PHE A N     1 
ATOM   668  C  CA    . PHE A 1 116 ? -12.028 -19.343 3.276   1.00 11.16 ? 116  PHE A CA    1 
ATOM   669  C  C     . PHE A 1 116 ? -11.430 -18.051 3.785   1.00 10.91 ? 116  PHE A C     1 
ATOM   670  O  O     . PHE A 1 116 ? -12.027 -16.981 3.657   1.00 10.40 ? 116  PHE A O     1 
ATOM   671  C  CB    . PHE A 1 116 ? -11.300 -19.778 2.001   1.00 11.75 ? 116  PHE A CB    1 
ATOM   672  C  CG    . PHE A 1 116 ? -11.494 -18.839 0.840   1.00 18.75 ? 116  PHE A CG    1 
ATOM   673  C  CD1   . PHE A 1 116 ? -12.642 -18.908 0.052   1.00 22.20 ? 116  PHE A CD1   1 
ATOM   674  C  CD2   . PHE A 1 116 ? -10.535 -17.873 0.545   1.00 20.20 ? 116  PHE A CD2   1 
ATOM   675  C  CE1   . PHE A 1 116 ? -12.834 -18.022 -1.017  1.00 20.35 ? 116  PHE A CE1   1 
ATOM   676  C  CE2   . PHE A 1 116 ? -10.720 -16.984 -0.522  1.00 20.40 ? 116  PHE A CE2   1 
ATOM   677  C  CZ    . PHE A 1 116 ? -11.870 -17.062 -1.298  1.00 18.03 ? 116  PHE A CZ    1 
ATOM   678  N  N     . GLY A 1 117 ? -10.224 -18.163 4.327   1.00 11.56 ? 117  GLY A N     1 
ATOM   679  C  CA    . GLY A 1 117 ? -9.543  -17.004 4.866   1.00 8.96  ? 117  GLY A CA    1 
ATOM   680  C  C     . GLY A 1 117 ? -8.363  -17.430 5.707   1.00 7.60  ? 117  GLY A C     1 
ATOM   681  O  O     . GLY A 1 117 ? -7.573  -18.272 5.288   1.00 10.37 ? 117  GLY A O     1 
ATOM   682  N  N     . LYS A 1 118 ? -8.270  -16.885 6.915   1.00 10.36 ? 118  LYS A N     1 
ATOM   683  C  CA    . LYS A 1 118 ? -7.155  -17.200 7.787   1.00 10.44 ? 118  LYS A CA    1 
ATOM   684  C  C     . LYS A 1 118 ? -7.576  -17.452 9.226   1.00 8.44  ? 118  LYS A C     1 
ATOM   685  O  O     . LYS A 1 118 ? -8.603  -16.949 9.689   1.00 12.15 ? 118  LYS A O     1 
ATOM   686  C  CB    . LYS A 1 118 ? -6.120  -16.059 7.747   1.00 15.05 ? 118  LYS A CB    1 
ATOM   687  C  CG    . LYS A 1 118 ? -5.494  -15.836 6.368   1.00 17.99 ? 118  LYS A CG    1 
ATOM   688  C  CD    . LYS A 1 118 ? -4.413  -14.771 6.378   1.00 27.89 ? 118  LYS A CD    1 
ATOM   689  C  CE    . LYS A 1 118 ? -4.958  -13.410 6.764   1.00 33.25 ? 118  LYS A CE    1 
ATOM   690  N  NZ    . LYS A 1 118 ? -3.890  -12.369 6.750   1.00 39.83 ? 118  LYS A NZ    1 
ATOM   691  N  N     . VAL A 1 119 ? -6.772  -18.255 9.912   1.00 10.49 ? 119  VAL A N     1 
ATOM   692  C  CA    . VAL A 1 119 ? -6.990  -18.582 11.321  1.00 10.91 ? 119  VAL A CA    1 
ATOM   693  C  C     . VAL A 1 119 ? -5.770  -18.078 12.083  1.00 11.00 ? 119  VAL A C     1 
ATOM   694  O  O     . VAL A 1 119 ? -4.631  -18.299 11.656  1.00 9.36  ? 119  VAL A O     1 
ATOM   695  C  CB    . VAL A 1 119 ? -7.100  -20.106 11.541  1.00 10.24 ? 119  VAL A CB    1 
ATOM   696  C  CG1   . VAL A 1 119 ? -7.347  -20.420 13.027  1.00 8.60  ? 119  VAL A CG1   1 
ATOM   697  C  CG2   . VAL A 1 119 ? -8.219  -20.684 10.687  1.00 11.73 ? 119  VAL A CG2   1 
ATOM   698  N  N     . HIS A 1 120 ? -6.020  -17.414 13.210  1.00 9.68  ? 120  HIS A N     1 
ATOM   699  C  CA    . HIS A 1 120 ? -4.967  -16.870 14.054  1.00 11.09 ? 120  HIS A CA    1 
ATOM   700  C  C     . HIS A 1 120 ? -5.120  -17.560 15.403  1.00 12.59 ? 120  HIS A C     1 
ATOM   701  O  O     . HIS A 1 120 ? -6.215  -17.604 15.967  1.00 12.13 ? 120  HIS A O     1 
ATOM   702  C  CB    . HIS A 1 120 ? -5.147  -15.356 14.218  1.00 13.88 ? 120  HIS A CB    1 
ATOM   703  C  CG    . HIS A 1 120 ? -5.351  -14.626 12.928  1.00 15.58 ? 120  HIS A CG    1 
ATOM   704  N  ND1   . HIS A 1 120 ? -4.386  -14.563 11.946  1.00 14.05 ? 120  HIS A ND1   1 
ATOM   705  C  CD2   . HIS A 1 120 ? -6.423  -13.950 12.445  1.00 17.93 ? 120  HIS A CD2   1 
ATOM   706  C  CE1   . HIS A 1 120 ? -4.854  -13.886 10.913  1.00 15.99 ? 120  HIS A CE1   1 
ATOM   707  N  NE2   . HIS A 1 120 ? -6.088  -13.502 11.190  1.00 13.70 ? 120  HIS A NE2   1 
ATOM   708  N  N     . ILE A 1 121 ? -4.024  -18.109 15.908  1.00 12.07 ? 121  ILE A N     1 
ATOM   709  C  CA    . ILE A 1 121 ? -4.058  -18.824 17.169  1.00 14.12 ? 121  ILE A CA    1 
ATOM   710  C  C     . ILE A 1 121 ? -3.116  -18.225 18.202  1.00 12.80 ? 121  ILE A C     1 
ATOM   711  O  O     . ILE A 1 121 ? -1.981  -17.869 17.892  1.00 13.64 ? 121  ILE A O     1 
ATOM   712  C  CB    . ILE A 1 121 ? -3.693  -20.302 16.945  1.00 16.61 ? 121  ILE A CB    1 
ATOM   713  C  CG1   . ILE A 1 121 ? -4.693  -20.944 15.968  1.00 15.41 ? 121  ILE A CG1   1 
ATOM   714  C  CG2   . ILE A 1 121 ? -3.674  -21.042 18.271  1.00 18.82 ? 121  ILE A CG2   1 
ATOM   715  C  CD1   . ILE A 1 121 ? -4.228  -22.251 15.366  1.00 16.81 ? 121  ILE A CD1   1 
ATOM   716  N  N     . GLY A 1 122 ? -3.601  -18.112 19.430  1.00 12.81 ? 122  GLY A N     1 
ATOM   717  C  CA    . GLY A 1 122 ? -2.775  -17.590 20.499  1.00 14.38 ? 122  GLY A CA    1 
ATOM   718  C  C     . GLY A 1 122 ? -2.970  -18.416 21.754  1.00 14.10 ? 122  GLY A C     1 
ATOM   719  O  O     . GLY A 1 122 ? -4.085  -18.853 22.039  1.00 12.37 ? 122  GLY A O     1 
ATOM   720  N  N     . TYR A 1 123 ? -1.889  -18.698 22.471  1.00 12.29 ? 123  TYR A N     1 
ATOM   721  C  CA    . TYR A 1 123 ? -2.014  -19.451 23.718  1.00 14.70 ? 123  TYR A CA    1 
ATOM   722  C  C     . TYR A 1 123 ? -0.862  -19.179 24.673  1.00 17.92 ? 123  TYR A C     1 
ATOM   723  O  O     . TYR A 1 123 ? 0.194   -18.684 24.277  1.00 18.35 ? 123  TYR A O     1 
ATOM   724  C  CB    . TYR A 1 123 ? -2.127  -20.961 23.461  1.00 12.34 ? 123  TYR A CB    1 
ATOM   725  C  CG    . TYR A 1 123 ? -0.819  -21.638 23.112  1.00 17.75 ? 123  TYR A CG    1 
ATOM   726  C  CD1   . TYR A 1 123 ? -0.186  -22.487 24.025  1.00 17.64 ? 123  TYR A CD1   1 
ATOM   727  C  CD2   . TYR A 1 123 ? -0.219  -21.438 21.871  1.00 10.38 ? 123  TYR A CD2   1 
ATOM   728  C  CE1   . TYR A 1 123 ? 1.016   -23.123 23.701  1.00 16.18 ? 123  TYR A CE1   1 
ATOM   729  C  CE2   . TYR A 1 123 ? 0.979   -22.067 21.540  1.00 13.67 ? 123  TYR A CE2   1 
ATOM   730  C  CZ    . TYR A 1 123 ? 1.589   -22.906 22.457  1.00 16.47 ? 123  TYR A CZ    1 
ATOM   731  O  OH    . TYR A 1 123 ? 2.764   -23.529 22.123  1.00 16.27 ? 123  TYR A OH    1 
ATOM   732  N  N     . ILE A 1 124 ? -1.109  -19.463 25.946  1.00 17.70 ? 124  ILE A N     1 
ATOM   733  C  CA    . ILE A 1 124 ? -0.109  -19.306 26.991  1.00 18.46 ? 124  ILE A CA    1 
ATOM   734  C  C     . ILE A 1 124 ? 0.093   -20.716 27.526  1.00 17.05 ? 124  ILE A C     1 
ATOM   735  O  O     . ILE A 1 124 ? -0.842  -21.346 28.029  1.00 18.16 ? 124  ILE A O     1 
ATOM   736  C  CB    . ILE A 1 124 ? -0.587  -18.348 28.095  1.00 18.48 ? 124  ILE A CB    1 
ATOM   737  C  CG1   . ILE A 1 124 ? -0.644  -16.923 27.538  1.00 17.69 ? 124  ILE A CG1   1 
ATOM   738  C  CG2   . ILE A 1 124 ? 0.361   -18.404 29.304  1.00 19.70 ? 124  ILE A CG2   1 
ATOM   739  C  CD1   . ILE A 1 124 ? -1.297  -15.920 28.454  1.00 20.68 ? 124  ILE A CD1   1 
ATOM   740  N  N     . PRO A 1 125 ? 1.313   -21.243 27.387  1.00 19.20 ? 125  PRO A N     1 
ATOM   741  C  CA    . PRO A 1 125 ? 1.669   -22.592 27.835  1.00 22.52 ? 125  PRO A CA    1 
ATOM   742  C  C     . PRO A 1 125 ? 1.561   -22.827 29.334  1.00 23.34 ? 125  PRO A C     1 
ATOM   743  O  O     . PRO A 1 125 ? 1.583   -21.891 30.133  1.00 23.24 ? 125  PRO A O     1 
ATOM   744  C  CB    . PRO A 1 125 ? 3.133   -22.727 27.399  1.00 21.10 ? 125  PRO A CB    1 
ATOM   745  C  CG    . PRO A 1 125 ? 3.317   -21.656 26.350  1.00 26.98 ? 125  PRO A CG    1 
ATOM   746  C  CD    . PRO A 1 125 ? 2.501   -20.532 26.885  1.00 18.89 ? 125  PRO A CD    1 
ATOM   747  N  N     . ASP A 1 126 ? 1.408   -24.096 29.686  1.00 26.51 ? 126  ASP A N     1 
ATOM   748  C  CA    . ASP A 1 126 ? 1.377   -24.533 31.073  1.00 28.30 ? 126  ASP A CA    1 
ATOM   749  C  C     . ASP A 1 126 ? 2.280   -25.760 31.068  1.00 27.68 ? 126  ASP A C     1 
ATOM   750  O  O     . ASP A 1 126 ? 1.823   -26.895 31.220  1.00 29.41 ? 126  ASP A O     1 
ATOM   751  C  CB    . ASP A 1 126 ? -0.034  -24.901 31.542  1.00 30.02 ? 126  ASP A CB    1 
ATOM   752  C  CG    . ASP A 1 126 ? -0.077  -25.266 33.024  1.00 35.14 ? 126  ASP A CG    1 
ATOM   753  O  OD1   . ASP A 1 126 ? 0.731   -24.704 33.800  1.00 32.76 ? 126  ASP A OD1   1 
ATOM   754  O  OD2   . ASP A 1 126 ? -0.909  -26.117 33.411  1.00 34.52 ? 126  ASP A OD2   1 
ATOM   755  N  N     . GLY A 1 127 ? 3.557   -25.517 30.791  1.00 28.21 ? 127  GLY A N     1 
ATOM   756  C  CA    . GLY A 1 127 ? 4.531   -26.590 30.745  1.00 29.64 ? 127  GLY A CA    1 
ATOM   757  C  C     . GLY A 1 127 ? 4.731   -27.224 29.379  1.00 29.63 ? 127  GLY A C     1 
ATOM   758  O  O     . GLY A 1 127 ? 5.737   -27.903 29.165  1.00 32.56 ? 127  GLY A O     1 
ATOM   759  N  N     . LYS A 1 128 ? 3.802   -27.004 28.447  1.00 26.39 ? 128  LYS A N     1 
ATOM   760  C  CA    . LYS A 1 128 ? 3.920   -27.600 27.116  1.00 26.51 ? 128  LYS A CA    1 
ATOM   761  C  C     . LYS A 1 128 ? 3.582   -26.683 25.938  1.00 23.40 ? 128  LYS A C     1 
ATOM   762  O  O     . LYS A 1 128 ? 2.605   -25.939 25.977  1.00 22.95 ? 128  LYS A O     1 
ATOM   763  C  CB    . LYS A 1 128 ? 3.056   -28.865 27.023  1.00 30.34 ? 128  LYS A CB    1 
ATOM   764  C  CG    . LYS A 1 128 ? 3.557   -30.037 27.862  1.00 39.66 ? 128  LYS A CG    1 
ATOM   765  C  CD    . LYS A 1 128 ? 2.529   -30.479 28.897  1.00 46.12 ? 128  LYS A CD    1 
ATOM   766  C  CE    . LYS A 1 128 ? 1.278   -31.065 28.250  1.00 48.86 ? 128  LYS A CE    1 
ATOM   767  N  NZ    . LYS A 1 128 ? 0.266   -31.483 29.265  1.00 50.91 ? 128  LYS A NZ    1 
ATOM   768  N  N     . ILE A 1 129 ? 4.412   -26.739 24.902  1.00 23.32 ? 129  ILE A N     1 
ATOM   769  C  CA    . ILE A 1 129 ? 4.191   -25.963 23.683  1.00 21.65 ? 129  ILE A CA    1 
ATOM   770  C  C     . ILE A 1 129 ? 3.998   -26.961 22.548  1.00 21.44 ? 129  ILE A C     1 
ATOM   771  O  O     . ILE A 1 129 ? 4.477   -28.093 22.618  1.00 23.61 ? 129  ILE A O     1 
ATOM   772  C  CB    . ILE A 1 129 ? 5.371   -25.012 23.346  1.00 22.22 ? 129  ILE A CB    1 
ATOM   773  C  CG1   . ILE A 1 129 ? 6.697   -25.779 23.315  1.00 24.16 ? 129  ILE A CG1   1 
ATOM   774  C  CG2   . ILE A 1 129 ? 5.413   -23.846 24.329  1.00 20.71 ? 129  ILE A CG2   1 
ATOM   775  C  CD1   . ILE A 1 129 ? 7.896   -24.923 22.930  1.00 24.89 ? 129  ILE A CD1   1 
ATOM   776  N  N     . LEU A 1 130 ? 3.305   -26.538 21.498  1.00 22.49 ? 130  LEU A N     1 
ATOM   777  C  CA    . LEU A 1 130 ? 3.034   -27.406 20.360  1.00 21.01 ? 130  LEU A CA    1 
ATOM   778  C  C     . LEU A 1 130 ? 3.902   -27.078 19.148  1.00 21.51 ? 130  LEU A C     1 
ATOM   779  O  O     . LEU A 1 130 ? 4.258   -25.917 18.928  1.00 21.98 ? 130  LEU A O     1 
ATOM   780  C  CB    . LEU A 1 130 ? 1.555   -27.280 19.972  1.00 24.32 ? 130  LEU A CB    1 
ATOM   781  C  CG    . LEU A 1 130 ? 1.006   -28.132 18.825  1.00 22.98 ? 130  LEU A CG    1 
ATOM   782  C  CD1   . LEU A 1 130 ? 0.971   -29.592 19.243  1.00 24.05 ? 130  LEU A CD1   1 
ATOM   783  C  CD2   . LEU A 1 130 ? -0.393  -27.655 18.457  1.00 21.70 ? 130  LEU A CD2   1 
ATOM   784  N  N     . GLY A 1 131 ? 4.262   -28.108 18.382  1.00 19.08 ? 131  GLY A N     1 
ATOM   785  C  CA    . GLY A 1 131 ? 5.039   -27.892 17.175  1.00 21.65 ? 131  GLY A CA    1 
ATOM   786  C  C     . GLY A 1 131 ? 4.195   -26.948 16.333  1.00 19.61 ? 131  GLY A C     1 
ATOM   787  O  O     . GLY A 1 131 ? 2.996   -27.176 16.187  1.00 19.57 ? 131  GLY A O     1 
ATOM   788  N  N     . LEU A 1 132 ? 4.797   -25.876 15.824  1.00 20.61 ? 132  LEU A N     1 
ATOM   789  C  CA    . LEU A 1 132 ? 4.066   -24.875 15.041  1.00 19.12 ? 132  LEU A CA    1 
ATOM   790  C  C     . LEU A 1 132 ? 3.180   -25.408 13.911  1.00 20.13 ? 132  LEU A C     1 
ATOM   791  O  O     . LEU A 1 132 ? 2.035   -24.973 13.757  1.00 18.53 ? 132  LEU A O     1 
ATOM   792  C  CB    . LEU A 1 132 ? 5.023   -23.805 14.500  1.00 19.21 ? 132  LEU A CB    1 
ATOM   793  C  CG    . LEU A 1 132 ? 5.787   -22.952 15.520  1.00 21.03 ? 132  LEU A CG    1 
ATOM   794  C  CD1   . LEU A 1 132 ? 6.610   -21.915 14.783  1.00 22.78 ? 132  LEU A CD1   1 
ATOM   795  C  CD2   . LEU A 1 132 ? 4.844   -22.280 16.509  1.00 18.57 ? 132  LEU A CD2   1 
ATOM   796  N  N     . SER A 1 133 ? 3.697   -26.353 13.134  1.00 18.09 ? 133  SER A N     1 
ATOM   797  C  CA    . SER A 1 133 ? 2.945   -26.918 12.019  1.00 18.04 ? 133  SER A CA    1 
ATOM   798  C  C     . SER A 1 133 ? 1.686   -27.676 12.444  1.00 18.91 ? 133  SER A C     1 
ATOM   799  O  O     . SER A 1 133 ? 0.734   -27.772 11.671  1.00 19.28 ? 133  SER A O     1 
ATOM   800  C  CB    . SER A 1 133 ? 3.832   -27.846 11.189  1.00 21.64 ? 133  SER A CB    1 
ATOM   801  O  OG    . SER A 1 133 ? 4.110   -29.037 11.908  1.00 25.71 ? 133  SER A OG    1 
ATOM   802  N  N     . LYS A 1 134 ? 1.675   -28.209 13.665  1.00 18.20 ? 134  LYS A N     1 
ATOM   803  C  CA    . LYS A 1 134 ? 0.510   -28.959 14.133  1.00 18.42 ? 134  LYS A CA    1 
ATOM   804  C  C     . LYS A 1 134 ? -0.721  -28.065 14.272  1.00 17.29 ? 134  LYS A C     1 
ATOM   805  O  O     . LYS A 1 134 ? -1.846  -28.549 14.227  1.00 16.88 ? 134  LYS A O     1 
ATOM   806  C  CB    . LYS A 1 134 ? 0.806   -29.707 15.437  1.00 17.11 ? 134  LYS A CB    1 
ATOM   807  C  CG    . LYS A 1 134 ? 2.044   -30.604 15.377  1.00 16.21 ? 134  LYS A CG    1 
ATOM   808  C  CD    . LYS A 1 134 ? 2.046   -31.555 14.184  1.00 17.45 ? 134  LYS A CD    1 
ATOM   809  C  CE    . LYS A 1 134 ? 3.375   -32.309 14.102  1.00 17.52 ? 134  LYS A CE    1 
ATOM   810  N  NZ    . LYS A 1 134 ? 3.483   -33.206 12.927  1.00 19.78 ? 134  LYS A NZ    1 
ATOM   811  N  N     . PHE A 1 135 ? -0.507  -26.760 14.427  1.00 15.38 ? 135  PHE A N     1 
ATOM   812  C  CA    . PHE A 1 135 ? -1.628  -25.829 14.517  1.00 17.04 ? 135  PHE A CA    1 
ATOM   813  C  C     . PHE A 1 135 ? -2.329  -25.812 13.162  1.00 16.99 ? 135  PHE A C     1 
ATOM   814  O  O     . PHE A 1 135 ? -3.559  -25.788 13.088  1.00 17.06 ? 135  PHE A O     1 
ATOM   815  C  CB    . PHE A 1 135 ? -1.156  -24.419 14.883  1.00 16.05 ? 135  PHE A CB    1 
ATOM   816  C  CG    . PHE A 1 135 ? -0.794  -24.260 16.329  1.00 19.41 ? 135  PHE A CG    1 
ATOM   817  C  CD1   . PHE A 1 135 ? -1.779  -24.288 17.310  1.00 17.12 ? 135  PHE A CD1   1 
ATOM   818  C  CD2   . PHE A 1 135 ? 0.533   -24.092 16.712  1.00 16.13 ? 135  PHE A CD2   1 
ATOM   819  C  CE1   . PHE A 1 135 ? -1.449  -24.151 18.661  1.00 19.11 ? 135  PHE A CE1   1 
ATOM   820  C  CE2   . PHE A 1 135 ? 0.873   -23.955 18.055  1.00 17.89 ? 135  PHE A CE2   1 
ATOM   821  C  CZ    . PHE A 1 135 ? -0.117  -23.985 19.029  1.00 18.60 ? 135  PHE A CZ    1 
ATOM   822  N  N     . ALA A 1 136 ? -1.531  -25.847 12.097  1.00 13.96 ? 136  ALA A N     1 
ATOM   823  C  CA    . ALA A 1 136 ? -2.053  -25.855 10.734  1.00 15.11 ? 136  ALA A CA    1 
ATOM   824  C  C     . ALA A 1 136 ? -2.772  -27.174 10.450  1.00 16.32 ? 136  ALA A C     1 
ATOM   825  O  O     . ALA A 1 136 ? -3.829  -27.197 9.818   1.00 13.02 ? 136  ALA A O     1 
ATOM   826  C  CB    . ALA A 1 136 ? -0.923  -25.635 9.740   1.00 16.55 ? 136  ALA A CB    1 
ATOM   827  N  N     . ARG A 1 137 ? -2.201  -28.275 10.934  1.00 14.70 ? 137  ARG A N     1 
ATOM   828  C  CA    . ARG A 1 137 ? -2.810  -29.584 10.740  1.00 15.23 ? 137  ARG A CA    1 
ATOM   829  C  C     . ARG A 1 137 ? -4.150  -29.686 11.476  1.00 13.49 ? 137  ARG A C     1 
ATOM   830  O  O     . ARG A 1 137 ? -5.085  -30.321 10.985  1.00 17.49 ? 137  ARG A O     1 
ATOM   831  C  CB    . ARG A 1 137 ? -1.843  -30.696 11.170  1.00 14.83 ? 137  ARG A CB    1 
ATOM   832  C  CG    . ARG A 1 137 ? -0.620  -30.815 10.266  1.00 16.24 ? 137  ARG A CG    1 
ATOM   833  C  CD    . ARG A 1 137 ? 0.284   -31.991 10.644  1.00 19.74 ? 137  ARG A CD    1 
ATOM   834  N  NE    . ARG A 1 137 ? 1.467   -32.068 9.784   1.00 21.79 ? 137  ARG A NE    1 
ATOM   835  C  CZ    . ARG A 1 137 ? 1.461   -32.506 8.527   1.00 23.21 ? 137  ARG A CZ    1 
ATOM   836  N  NH1   . ARG A 1 137 ? 0.332   -32.922 7.964   1.00 27.83 ? 137  ARG A NH1   1 
ATOM   837  N  NH2   . ARG A 1 137 ? 2.585   -32.514 7.821   1.00 24.78 ? 137  ARG A NH2   1 
ATOM   838  N  N     . ILE A 1 138 ? -4.248  -29.053 12.642  1.00 13.30 ? 138  ILE A N     1 
ATOM   839  C  CA    . ILE A 1 138 ? -5.488  -29.056 13.412  1.00 13.97 ? 138  ILE A CA    1 
ATOM   840  C  C     . ILE A 1 138 ? -6.537  -28.224 12.663  1.00 16.42 ? 138  ILE A C     1 
ATOM   841  O  O     . ILE A 1 138 ? -7.697  -28.628 12.547  1.00 17.21 ? 138  ILE A O     1 
ATOM   842  C  CB    . ILE A 1 138 ? -5.272  -28.494 14.842  1.00 15.18 ? 138  ILE A CB    1 
ATOM   843  C  CG1   . ILE A 1 138 ? -4.452  -29.495 15.669  1.00 16.81 ? 138  ILE A CG1   1 
ATOM   844  C  CG2   . ILE A 1 138 ? -6.617  -28.214 15.517  1.00 15.42 ? 138  ILE A CG2   1 
ATOM   845  C  CD1   . ILE A 1 138 ? -4.063  -28.998 17.045  1.00 15.03 ? 138  ILE A CD1   1 
ATOM   846  N  N     . VAL A 1 139 ? -6.110  -27.079 12.135  1.00 15.17 ? 139  VAL A N     1 
ATOM   847  C  CA    . VAL A 1 139 ? -6.998  -26.201 11.367  1.00 13.13 ? 139  VAL A CA    1 
ATOM   848  C  C     . VAL A 1 139 ? -7.609  -26.966 10.192  1.00 10.60 ? 139  VAL A C     1 
ATOM   849  O  O     . VAL A 1 139 ? -8.824  -26.948 10.002  1.00 13.41 ? 139  VAL A O     1 
ATOM   850  C  CB    . VAL A 1 139 ? -6.235  -24.967 10.809  1.00 14.45 ? 139  VAL A CB    1 
ATOM   851  C  CG1   . VAL A 1 139 ? -7.090  -24.222 9.778   1.00 12.34 ? 139  VAL A CG1   1 
ATOM   852  C  CG2   . VAL A 1 139 ? -5.850  -24.031 11.941  1.00 11.61 ? 139  VAL A CG2   1 
ATOM   853  N  N     . ASP A 1 140 ? -6.761  -27.649 9.425   1.00 12.54 ? 140  ASP A N     1 
ATOM   854  C  CA    . ASP A 1 140 ? -7.213  -28.418 8.263   1.00 13.91 ? 140  ASP A CA    1 
ATOM   855  C  C     . ASP A 1 140 ? -8.152  -29.562 8.643   1.00 14.50 ? 140  ASP A C     1 
ATOM   856  O  O     . ASP A 1 140 ? -9.071  -29.892 7.895   1.00 14.92 ? 140  ASP A O     1 
ATOM   857  C  CB    . ASP A 1 140 ? -6.015  -28.977 7.487   1.00 16.07 ? 140  ASP A CB    1 
ATOM   858  C  CG    . ASP A 1 140 ? -5.270  -27.907 6.703   1.00 18.01 ? 140  ASP A CG    1 
ATOM   859  O  OD1   . ASP A 1 140 ? -5.809  -26.795 6.523   1.00 18.11 ? 140  ASP A OD1   1 
ATOM   860  O  OD2   . ASP A 1 140 ? -4.145  -28.187 6.254   1.00 18.13 ? 140  ASP A OD2   1 
ATOM   861  N  N     . MET A 1 141 ? -7.916  -30.159 9.806   1.00 15.10 ? 141  MET A N     1 
ATOM   862  C  CA    . MET A 1 141 ? -8.742  -31.267 10.279  1.00 16.99 ? 141  MET A CA    1 
ATOM   863  C  C     . MET A 1 141 ? -10.191 -30.836 10.470  1.00 18.36 ? 141  MET A C     1 
ATOM   864  O  O     . MET A 1 141 ? -11.116 -31.576 10.141  1.00 16.24 ? 141  MET A O     1 
ATOM   865  C  CB    . MET A 1 141 ? -8.196  -31.821 11.595  1.00 17.40 ? 141  MET A CB    1 
ATOM   866  C  CG    . MET A 1 141 ? -9.028  -32.961 12.169  1.00 19.95 ? 141  MET A CG    1 
ATOM   867  S  SD    . MET A 1 141 ? -8.365  -33.563 13.728  1.00 23.20 ? 141  MET A SD    1 
ATOM   868  C  CE    . MET A 1 141 ? -9.885  -34.018 14.594  1.00 19.29 ? 141  MET A CE    1 
ATOM   869  N  N     . PHE A 1 142 ? -10.384 -29.635 11.005  1.00 16.85 ? 142  PHE A N     1 
ATOM   870  C  CA    . PHE A 1 142 ? -11.727 -29.128 11.229  1.00 16.03 ? 142  PHE A CA    1 
ATOM   871  C  C     . PHE A 1 142 ? -12.291 -28.325 10.061  1.00 14.99 ? 142  PHE A C     1 
ATOM   872  O  O     . PHE A 1 142 ? -13.503 -28.232 9.911   1.00 14.21 ? 142  PHE A O     1 
ATOM   873  C  CB    . PHE A 1 142 ? -11.790 -28.351 12.540  1.00 14.00 ? 142  PHE A CB    1 
ATOM   874  C  CG    . PHE A 1 142 ? -11.591 -29.218 13.753  1.00 19.10 ? 142  PHE A CG    1 
ATOM   875  C  CD1   . PHE A 1 142 ? -12.646 -29.967 14.269  1.00 18.66 ? 142  PHE A CD1   1 
ATOM   876  C  CD2   . PHE A 1 142 ? -10.340 -29.318 14.355  1.00 16.51 ? 142  PHE A CD2   1 
ATOM   877  C  CE1   . PHE A 1 142 ? -12.455 -30.808 15.371  1.00 23.41 ? 142  PHE A CE1   1 
ATOM   878  C  CE2   . PHE A 1 142 ? -10.138 -30.155 15.453  1.00 20.27 ? 142  PHE A CE2   1 
ATOM   879  C  CZ    . PHE A 1 142 ? -11.198 -30.900 15.960  1.00 21.54 ? 142  PHE A CZ    1 
ATOM   880  N  N     . ALA A 1 143 ? -11.416 -27.799 9.208   1.00 12.36 ? 143  ALA A N     1 
ATOM   881  C  CA    . ALA A 1 143 ? -11.858 -27.029 8.047   1.00 13.62 ? 143  ALA A CA    1 
ATOM   882  C  C     . ALA A 1 143 ? -12.327 -27.954 6.917   1.00 13.30 ? 143  ALA A C     1 
ATOM   883  O  O     . ALA A 1 143 ? -13.258 -27.626 6.193   1.00 13.88 ? 143  ALA A O     1 
ATOM   884  C  CB    . ALA A 1 143 ? -10.741 -26.113 7.556   1.00 13.09 ? 143  ALA A CB    1 
ATOM   885  N  N     . ARG A 1 144 ? -11.699 -29.120 6.787   1.00 11.83 ? 144  ARG A N     1 
ATOM   886  C  CA    . ARG A 1 144 ? -12.073 -30.066 5.736   1.00 11.78 ? 144  ARG A CA    1 
ATOM   887  C  C     . ARG A 1 144 ? -13.278 -30.904 6.145   1.00 12.98 ? 144  ARG A C     1 
ATOM   888  O  O     . ARG A 1 144 ? -13.207 -32.128 6.302   1.00 14.13 ? 144  ARG A O     1 
ATOM   889  C  CB    . ARG A 1 144 ? -10.869 -30.915 5.325   1.00 13.91 ? 144  ARG A CB    1 
ATOM   890  C  CG    . ARG A 1 144 ? -9.830  -30.057 4.596   1.00 17.01 ? 144  ARG A CG    1 
ATOM   891  C  CD    . ARG A 1 144 ? -8.520  -30.755 4.306   1.00 21.14 ? 144  ARG A CD    1 
ATOM   892  N  NE    . ARG A 1 144 ? -7.614  -29.840 3.610   1.00 22.45 ? 144  ARG A NE    1 
ATOM   893  C  CZ    . ARG A 1 144 ? -6.296  -29.996 3.513   1.00 23.82 ? 144  ARG A CZ    1 
ATOM   894  N  NH1   . ARG A 1 144 ? -5.696  -31.038 4.069   1.00 21.26 ? 144  ARG A NH1   1 
ATOM   895  N  NH2   . ARG A 1 144 ? -5.577  -29.114 2.833   1.00 23.78 ? 144  ARG A NH2   1 
ATOM   896  N  N     . ARG A 1 145 ? -14.391 -30.196 6.304   1.00 11.02 ? 145  ARG A N     1 
ATOM   897  C  CA    . ARG A 1 145 ? -15.679 -30.749 6.709   1.00 12.88 ? 145  ARG A CA    1 
ATOM   898  C  C     . ARG A 1 145 ? -16.715 -29.709 6.298   1.00 16.48 ? 145  ARG A C     1 
ATOM   899  O  O     . ARG A 1 145 ? -16.361 -28.634 5.811   1.00 14.48 ? 145  ARG A O     1 
ATOM   900  C  CB    . ARG A 1 145 ? -15.756 -30.835 8.244   1.00 14.05 ? 145  ARG A CB    1 
ATOM   901  C  CG    . ARG A 1 145 ? -14.673 -31.653 8.932   1.00 12.63 ? 145  ARG A CG    1 
ATOM   902  C  CD    . ARG A 1 145 ? -14.830 -31.601 10.455  1.00 15.71 ? 145  ARG A CD    1 
ATOM   903  N  NE    . ARG A 1 145 ? -13.821 -32.428 11.109  1.00 16.89 ? 145  ARG A NE    1 
ATOM   904  C  CZ    . ARG A 1 145 ? -13.927 -32.927 12.337  1.00 20.45 ? 145  ARG A CZ    1 
ATOM   905  N  NH1   . ARG A 1 145 ? -15.004 -32.683 13.076  1.00 20.18 ? 145  ARG A NH1   1 
ATOM   906  N  NH2   . ARG A 1 145 ? -12.958 -33.696 12.815  1.00 18.75 ? 145  ARG A NH2   1 
ATOM   907  N  N     . LEU A 1 146 ? -17.993 -30.029 6.504   1.00 15.70 ? 146  LEU A N     1 
ATOM   908  C  CA    . LEU A 1 146 ? -19.061 -29.072 6.251   1.00 14.63 ? 146  LEU A CA    1 
ATOM   909  C  C     . LEU A 1 146 ? -19.057 -28.301 7.567   1.00 17.45 ? 146  LEU A C     1 
ATOM   910  O  O     . LEU A 1 146 ? -19.073 -28.904 8.647   1.00 18.23 ? 146  LEU A O     1 
ATOM   911  C  CB    . LEU A 1 146 ? -20.403 -29.772 6.042   1.00 16.60 ? 146  LEU A CB    1 
ATOM   912  C  CG    . LEU A 1 146 ? -20.470 -30.739 4.852   1.00 15.39 ? 146  LEU A CG    1 
ATOM   913  C  CD1   . LEU A 1 146 ? -21.913 -31.116 4.603   1.00 18.58 ? 146  LEU A CD1   1 
ATOM   914  C  CD2   . LEU A 1 146 ? -19.875 -30.110 3.596   1.00 13.88 ? 146  LEU A CD2   1 
ATOM   915  N  N     . GLN A 1 147 ? -19.070 -26.977 7.489   1.00 13.37 ? 147  GLN A N     1 
ATOM   916  C  CA    . GLN A 1 147 ? -18.968 -26.168 8.695   1.00 12.01 ? 147  GLN A CA    1 
ATOM   917  C  C     . GLN A 1 147 ? -19.774 -24.875 8.720   1.00 11.81 ? 147  GLN A C     1 
ATOM   918  O  O     . GLN A 1 147 ? -20.450 -24.521 7.756   1.00 12.69 ? 147  GLN A O     1 
ATOM   919  C  CB    . GLN A 1 147 ? -17.489 -25.767 8.852   1.00 12.62 ? 147  GLN A CB    1 
ATOM   920  C  CG    . GLN A 1 147 ? -16.586 -26.821 9.475   1.00 14.83 ? 147  GLN A CG    1 
ATOM   921  C  CD    . GLN A 1 147 ? -16.729 -26.858 10.980  1.00 12.86 ? 147  GLN A CD    1 
ATOM   922  O  OE1   . GLN A 1 147 ? -17.633 -26.238 11.540  1.00 15.82 ? 147  GLN A OE1   1 
ATOM   923  N  NE2   . GLN A 1 147 ? -15.818 -27.564 11.649  1.00 16.20 ? 147  GLN A NE2   1 
ATOM   924  N  N     . VAL A 1 148 ? -19.736 -24.230 9.884   1.00 12.95 ? 148  VAL A N     1 
ATOM   925  C  CA    . VAL A 1 148 ? -20.297 -22.898 10.113  1.00 15.83 ? 148  VAL A CA    1 
ATOM   926  C  C     . VAL A 1 148 ? -19.067 -22.253 10.767  1.00 15.69 ? 148  VAL A C     1 
ATOM   927  O  O     . VAL A 1 148 ? -18.424 -22.874 11.619  1.00 13.27 ? 148  VAL A O     1 
ATOM   928  C  CB    . VAL A 1 148 ? -21.538 -22.861 11.051  1.00 19.78 ? 148  VAL A CB    1 
ATOM   929  C  CG1   . VAL A 1 148 ? -22.708 -23.572 10.397  1.00 22.85 ? 148  VAL A CG1   1 
ATOM   930  C  CG2   . VAL A 1 148 ? -21.240 -23.460 12.394  1.00 22.32 ? 148  VAL A CG2   1 
ATOM   931  N  N     . GLN A 1 149 ? -18.693 -21.054 10.330  1.00 14.60 ? 149  GLN A N     1 
ATOM   932  C  CA    . GLN A 1 149 ? -17.486 -20.411 10.859  1.00 11.87 ? 149  GLN A CA    1 
ATOM   933  C  C     . GLN A 1 149 ? -17.421 -20.275 12.380  1.00 10.81 ? 149  GLN A C     1 
ATOM   934  O  O     . GLN A 1 149 ? -16.341 -20.360 12.970  1.00 10.85 ? 149  GLN A O     1 
ATOM   935  C  CB    . GLN A 1 149 ? -17.247 -19.061 10.191  1.00 13.20 ? 149  GLN A CB    1 
ATOM   936  C  CG    . GLN A 1 149 ? -15.804 -18.576 10.329  1.00 10.70 ? 149  GLN A CG    1 
ATOM   937  C  CD    . GLN A 1 149 ? -15.580 -17.239 9.657   1.00 12.04 ? 149  GLN A CD    1 
ATOM   938  O  OE1   . GLN A 1 149 ? -15.918 -17.063 8.494   1.00 13.94 ? 149  GLN A OE1   1 
ATOM   939  N  NE2   . GLN A 1 149 ? -15.014 -16.288 10.390  1.00 8.26  ? 149  GLN A NE2   1 
ATOM   940  N  N     . GLU A 1 150 ? -18.572 -20.069 13.011  1.00 12.44 ? 150  GLU A N     1 
ATOM   941  C  CA    . GLU A 1 150 ? -18.636 -19.939 14.466  1.00 13.62 ? 150  GLU A CA    1 
ATOM   942  C  C     . GLU A 1 150 ? -18.154 -21.211 15.161  1.00 15.83 ? 150  GLU A C     1 
ATOM   943  O  O     . GLU A 1 150 ? -17.513 -21.148 16.214  1.00 16.77 ? 150  GLU A O     1 
ATOM   944  C  CB    . GLU A 1 150 ? -20.064 -19.614 14.922  1.00 14.38 ? 150  GLU A CB    1 
ATOM   945  C  CG    . GLU A 1 150 ? -20.562 -18.224 14.518  1.00 16.29 ? 150  GLU A CG    1 
ATOM   946  C  CD    . GLU A 1 150 ? -21.174 -18.156 13.121  1.00 18.09 ? 150  GLU A CD    1 
ATOM   947  O  OE1   . GLU A 1 150 ? -20.930 -19.048 12.283  1.00 18.60 ? 150  GLU A OE1   1 
ATOM   948  O  OE2   . GLU A 1 150 ? -21.915 -17.186 12.860  1.00 18.69 ? 150  GLU A OE2   1 
ATOM   949  N  N     . ARG A 1 151 ? -18.476 -22.360 14.572  1.00 13.66 ? 151  ARG A N     1 
ATOM   950  C  CA    . ARG A 1 151 ? -18.087 -23.662 15.119  1.00 15.31 ? 151  ARG A CA    1 
ATOM   951  C  C     . ARG A 1 151 ? -16.622 -23.972 14.857  1.00 14.27 ? 151  ARG A C     1 
ATOM   952  O  O     . ARG A 1 151 ? -15.942 -24.543 15.708  1.00 13.59 ? 151  ARG A O     1 
ATOM   953  C  CB    . ARG A 1 151 ? -18.937 -24.775 14.499  1.00 14.32 ? 151  ARG A CB    1 
ATOM   954  C  CG    . ARG A 1 151 ? -18.640 -26.180 15.023  1.00 14.49 ? 151  ARG A CG    1 
ATOM   955  C  CD    . ARG A 1 151 ? -19.418 -27.231 14.229  1.00 19.50 ? 151  ARG A CD    1 
ATOM   956  N  NE    . ARG A 1 151 ? -20.836 -26.890 14.136  1.00 23.36 ? 151  ARG A NE    1 
ATOM   957  C  CZ    . ARG A 1 151 ? -21.582 -27.052 13.046  1.00 22.58 ? 151  ARG A CZ    1 
ATOM   958  N  NH1   . ARG A 1 151 ? -21.059 -27.561 11.937  1.00 20.52 ? 151  ARG A NH1   1 
ATOM   959  N  NH2   . ARG A 1 151 ? -22.843 -26.652 13.051  1.00 24.96 ? 151  ARG A NH2   1 
ATOM   960  N  N     . LEU A 1 152 ? -16.159 -23.634 13.658  1.00 13.89 ? 152  LEU A N     1 
ATOM   961  C  CA    . LEU A 1 152 ? -14.775 -23.872 13.260  1.00 15.23 ? 152  LEU A CA    1 
ATOM   962  C  C     . LEU A 1 152 ? -13.791 -23.282 14.278  1.00 12.72 ? 152  LEU A C     1 
ATOM   963  O  O     . LEU A 1 152 ? -12.831 -23.942 14.671  1.00 14.25 ? 152  LEU A O     1 
ATOM   964  C  CB    . LEU A 1 152 ? -14.521 -23.286 11.863  1.00 11.69 ? 152  LEU A CB    1 
ATOM   965  C  CG    . LEU A 1 152 ? -13.106 -23.435 11.292  1.00 11.60 ? 152  LEU A CG    1 
ATOM   966  C  CD1   . LEU A 1 152 ? -12.698 -24.899 11.275  1.00 10.56 ? 152  LEU A CD1   1 
ATOM   967  C  CD2   . LEU A 1 152 ? -13.054 -22.853 9.882   1.00 11.97 ? 152  LEU A CD2   1 
ATOM   968  N  N     . ALA A 1 153 ? -14.068 -22.066 14.739  1.00 10.88 ? 153  ALA A N     1 
ATOM   969  C  CA    . ALA A 1 153 ? -13.201 -21.401 15.715  1.00 12.97 ? 153  ALA A CA    1 
ATOM   970  C  C     . ALA A 1 153 ? -13.182 -22.162 17.042  1.00 13.56 ? 153  ALA A C     1 
ATOM   971  O  O     . ALA A 1 153 ? -12.118 -22.389 17.630  1.00 15.32 ? 153  ALA A O     1 
ATOM   972  C  CB    . ALA A 1 153 ? -13.673 -19.968 15.944  1.00 12.56 ? 153  ALA A CB    1 
ATOM   973  N  N     . VAL A 1 154 ? -14.370 -22.556 17.494  1.00 14.86 ? 154  VAL A N     1 
ATOM   974  C  CA    . VAL A 1 154 ? -14.542 -23.285 18.747  1.00 14.39 ? 154  VAL A CA    1 
ATOM   975  C  C     . VAL A 1 154 ? -13.836 -24.634 18.738  1.00 16.61 ? 154  VAL A C     1 
ATOM   976  O  O     . VAL A 1 154 ? -13.111 -24.970 19.682  1.00 15.43 ? 154  VAL A O     1 
ATOM   977  C  CB    . VAL A 1 154 ? -16.054 -23.501 19.071  1.00 16.24 ? 154  VAL A CB    1 
ATOM   978  C  CG1   . VAL A 1 154 ? -16.219 -24.422 20.268  1.00 17.19 ? 154  VAL A CG1   1 
ATOM   979  C  CG2   . VAL A 1 154 ? -16.745 -22.160 19.340  1.00 14.68 ? 154  VAL A CG2   1 
ATOM   980  N  N     . GLN A 1 155 ? -14.047 -25.411 17.680  1.00 15.37 ? 155  GLN A N     1 
ATOM   981  C  CA    . GLN A 1 155 ? -13.431 -26.730 17.593  1.00 15.60 ? 155  GLN A CA    1 
ATOM   982  C  C     . GLN A 1 155 ? -11.911 -26.681 17.531  1.00 18.63 ? 155  GLN A C     1 
ATOM   983  O  O     . GLN A 1 155 ? -11.240 -27.544 18.103  1.00 16.20 ? 155  GLN A O     1 
ATOM   984  C  CB    . GLN A 1 155 ? -14.004 -27.520 16.422  1.00 14.79 ? 155  GLN A CB    1 
ATOM   985  C  CG    . GLN A 1 155 ? -15.486 -27.812 16.582  1.00 17.50 ? 155  GLN A CG    1 
ATOM   986  C  CD    . GLN A 1 155 ? -16.020 -28.741 15.512  1.00 19.88 ? 155  GLN A CD    1 
ATOM   987  O  OE1   . GLN A 1 155 ? -15.815 -28.517 14.319  1.00 21.08 ? 155  GLN A OE1   1 
ATOM   988  N  NE2   . GLN A 1 155 ? -16.706 -29.796 15.936  1.00 25.53 ? 155  GLN A NE2   1 
ATOM   989  N  N     . ILE A 1 156 ? -11.370 -25.684 16.832  1.00 15.33 ? 156  ILE A N     1 
ATOM   990  C  CA    . ILE A 1 156 ? -9.917  -25.536 16.747  1.00 14.92 ? 156  ILE A CA    1 
ATOM   991  C  C     . ILE A 1 156 ? -9.380  -25.212 18.143  1.00 16.66 ? 156  ILE A C     1 
ATOM   992  O  O     . ILE A 1 156 ? -8.419  -25.831 18.602  1.00 15.98 ? 156  ILE A O     1 
ATOM   993  C  CB    . ILE A 1 156 ? -9.511  -24.425 15.751  1.00 15.72 ? 156  ILE A CB    1 
ATOM   994  C  CG1   . ILE A 1 156 ? -9.850  -24.865 14.322  1.00 16.27 ? 156  ILE A CG1   1 
ATOM   995  C  CG2   . ILE A 1 156 ? -8.013  -24.114 15.867  1.00 14.59 ? 156  ILE A CG2   1 
ATOM   996  C  CD1   . ILE A 1 156 ? -9.657  -23.784 13.273  1.00 20.37 ? 156  ILE A CD1   1 
ATOM   997  N  N     . ALA A 1 157 ? -10.039 -24.281 18.829  1.00 15.77 ? 157  ALA A N     1 
ATOM   998  C  CA    . ALA A 1 157 ? -9.634  -23.884 20.177  1.00 20.07 ? 157  ALA A CA    1 
ATOM   999  C  C     . ALA A 1 157 ? -9.715  -25.042 21.176  1.00 21.32 ? 157  ALA A C     1 
ATOM   1000 O  O     . ALA A 1 157 ? -8.818  -25.214 22.008  1.00 20.32 ? 157  ALA A O     1 
ATOM   1001 C  CB    . ALA A 1 157 ? -10.473 -22.712 20.662  1.00 17.13 ? 157  ALA A CB    1 
ATOM   1002 N  N     . GLU A 1 158 ? -10.777 -25.840 21.083  1.00 19.56 ? 158  GLU A N     1 
ATOM   1003 C  CA    . GLU A 1 158 ? -10.956 -26.975 21.988  1.00 21.70 ? 158  GLU A CA    1 
ATOM   1004 C  C     . GLU A 1 158 ? -9.929  -28.068 21.731  1.00 20.65 ? 158  GLU A C     1 
ATOM   1005 O  O     . GLU A 1 158 ? -9.469  -28.719 22.666  1.00 20.76 ? 158  GLU A O     1 
ATOM   1006 C  CB    . GLU A 1 158 ? -12.381 -27.538 21.896  1.00 19.87 ? 158  GLU A CB    1 
ATOM   1007 C  CG    . GLU A 1 158 ? -13.436 -26.590 22.453  1.00 24.43 ? 158  GLU A CG    1 
ATOM   1008 C  CD    . GLU A 1 158 ? -14.843 -27.178 22.467  1.00 26.84 ? 158  GLU A CD    1 
ATOM   1009 O  OE1   . GLU A 1 158 ? -15.709 -26.595 23.149  1.00 27.35 ? 158  GLU A OE1   1 
ATOM   1010 O  OE2   . GLU A 1 158 ? -15.085 -28.210 21.805  1.00 31.37 ? 158  GLU A OE2   1 
ATOM   1011 N  N     . ALA A 1 159 ? -9.550  -28.244 20.468  1.00 18.09 ? 159  ALA A N     1 
ATOM   1012 C  CA    . ALA A 1 159 ? -8.561  -29.247 20.101  1.00 20.22 ? 159  ALA A CA    1 
ATOM   1013 C  C     . ALA A 1 159 ? -7.201  -28.899 20.708  1.00 20.41 ? 159  ALA A C     1 
ATOM   1014 O  O     . ALA A 1 159 ? -6.502  -29.775 21.228  1.00 19.43 ? 159  ALA A O     1 
ATOM   1015 C  CB    . ALA A 1 159 ? -8.455  -29.354 18.590  1.00 16.81 ? 159  ALA A CB    1 
ATOM   1016 N  N     . ILE A 1 160 ? -6.838  -27.618 20.640  1.00 17.99 ? 160  ILE A N     1 
ATOM   1017 C  CA    . ILE A 1 160 ? -5.572  -27.132 21.185  1.00 21.62 ? 160  ILE A CA    1 
ATOM   1018 C  C     . ILE A 1 160 ? -5.570  -27.265 22.710  1.00 23.24 ? 160  ILE A C     1 
ATOM   1019 O  O     . ILE A 1 160 ? -4.580  -27.701 23.306  1.00 22.29 ? 160  ILE A O     1 
ATOM   1020 C  CB    . ILE A 1 160 ? -5.321  -25.663 20.762  1.00 17.66 ? 160  ILE A CB    1 
ATOM   1021 C  CG1   . ILE A 1 160 ? -5.112  -25.602 19.243  1.00 19.61 ? 160  ILE A CG1   1 
ATOM   1022 C  CG2   . ILE A 1 160 ? -4.115  -25.089 21.497  1.00 20.84 ? 160  ILE A CG2   1 
ATOM   1023 C  CD1   . ILE A 1 160 ? -5.203  -24.215 18.656  1.00 17.91 ? 160  ILE A CD1   1 
ATOM   1024 N  N     . GLN A 1 161 ? -6.691  -26.901 23.326  1.00 23.19 ? 161  GLN A N     1 
ATOM   1025 C  CA    . GLN A 1 161 ? -6.860  -26.990 24.775  1.00 24.75 ? 161  GLN A CA    1 
ATOM   1026 C  C     . GLN A 1 161 ? -6.664  -28.433 25.254  1.00 26.41 ? 161  GLN A C     1 
ATOM   1027 O  O     . GLN A 1 161 ? -6.033  -28.675 26.284  1.00 26.35 ? 161  GLN A O     1 
ATOM   1028 C  CB    . GLN A 1 161 ? -8.260  -26.497 25.163  1.00 28.11 ? 161  GLN A CB    1 
ATOM   1029 C  CG    . GLN A 1 161 ? -8.621  -26.639 26.644  1.00 32.12 ? 161  GLN A CG    1 
ATOM   1030 C  CD    . GLN A 1 161 ? -7.740  -25.804 27.553  1.00 37.16 ? 161  GLN A CD    1 
ATOM   1031 O  OE1   . GLN A 1 161 ? -7.467  -24.635 27.272  1.00 40.23 ? 161  GLN A OE1   1 
ATOM   1032 N  NE2   . GLN A 1 161 ? -7.295  -26.400 28.654  1.00 39.03 ? 161  GLN A NE2   1 
ATOM   1033 N  N     . GLU A 1 162 ? -7.206  -29.382 24.497  1.00 25.31 ? 162  GLU A N     1 
ATOM   1034 C  CA    . GLU A 1 162 ? -7.109  -30.799 24.828  1.00 28.66 ? 162  GLU A CA    1 
ATOM   1035 C  C     . GLU A 1 162 ? -5.682  -31.340 24.695  1.00 30.52 ? 162  GLU A C     1 
ATOM   1036 O  O     . GLU A 1 162 ? -5.199  -32.074 25.562  1.00 26.96 ? 162  GLU A O     1 
ATOM   1037 C  CB    . GLU A 1 162 ? -8.050  -31.601 23.926  1.00 32.08 ? 162  GLU A CB    1 
ATOM   1038 C  CG    . GLU A 1 162 ? -8.132  -33.086 24.250  1.00 39.30 ? 162  GLU A CG    1 
ATOM   1039 C  CD    . GLU A 1 162 ? -8.964  -33.864 23.240  1.00 41.77 ? 162  GLU A CD    1 
ATOM   1040 O  OE1   . GLU A 1 162 ? -8.537  -34.972 22.849  1.00 43.42 ? 162  GLU A OE1   1 
ATOM   1041 O  OE2   . GLU A 1 162 ? -10.041 -33.372 22.835  1.00 44.56 ? 162  GLU A OE2   1 
ATOM   1042 N  N     . VAL A 1 163 ? -5.013  -30.963 23.610  1.00 28.64 ? 163  VAL A N     1 
ATOM   1043 C  CA    . VAL A 1 163 ? -3.654  -31.414 23.327  1.00 27.46 ? 163  VAL A CA    1 
ATOM   1044 C  C     . VAL A 1 163 ? -2.582  -30.841 24.254  1.00 28.71 ? 163  VAL A C     1 
ATOM   1045 O  O     . VAL A 1 163 ? -1.669  -31.559 24.666  1.00 28.01 ? 163  VAL A O     1 
ATOM   1046 C  CB    . VAL A 1 163 ? -3.270  -31.100 21.851  1.00 26.98 ? 163  VAL A CB    1 
ATOM   1047 C  CG1   . VAL A 1 163 ? -1.789  -31.369 21.599  1.00 28.51 ? 163  VAL A CG1   1 
ATOM   1048 C  CG2   . VAL A 1 163 ? -4.118  -31.938 20.905  1.00 28.91 ? 163  VAL A CG2   1 
ATOM   1049 N  N     . LEU A 1 164 ? -2.712  -29.566 24.604  1.00 24.80 ? 164  LEU A N     1 
ATOM   1050 C  CA    . LEU A 1 164 ? -1.717  -28.909 25.440  1.00 27.90 ? 164  LEU A CA    1 
ATOM   1051 C  C     . LEU A 1 164 ? -2.097  -28.594 26.877  1.00 26.20 ? 164  LEU A C     1 
ATOM   1052 O  O     . LEU A 1 164 ? -1.213  -28.426 27.713  1.00 28.26 ? 164  LEU A O     1 
ATOM   1053 C  CB    . LEU A 1 164 ? -1.265  -27.608 24.777  1.00 27.89 ? 164  LEU A CB    1 
ATOM   1054 C  CG    . LEU A 1 164 ? -0.650  -27.686 23.382  1.00 27.76 ? 164  LEU A CG    1 
ATOM   1055 C  CD1   . LEU A 1 164 ? -0.453  -26.281 22.845  1.00 29.76 ? 164  LEU A CD1   1 
ATOM   1056 C  CD2   . LEU A 1 164 ? 0.670   -28.441 23.432  1.00 27.33 ? 164  LEU A CD2   1 
ATOM   1057 N  N     . GLU A 1 165 ? -3.397  -28.516 27.161  1.00 29.01 ? 165  GLU A N     1 
ATOM   1058 C  CA    . GLU A 1 165 ? -3.883  -28.153 28.494  1.00 29.91 ? 165  GLU A CA    1 
ATOM   1059 C  C     . GLU A 1 165 ? -3.147  -26.877 28.912  1.00 30.36 ? 165  GLU A C     1 
ATOM   1060 O  O     . GLU A 1 165 ? -2.535  -26.814 29.981  1.00 29.29 ? 165  GLU A O     1 
ATOM   1061 C  CB    . GLU A 1 165 ? -3.634  -29.280 29.505  1.00 33.62 ? 165  GLU A CB    1 
ATOM   1062 C  CG    . GLU A 1 165 ? -4.446  -30.542 29.236  1.00 39.61 ? 165  GLU A CG    1 
ATOM   1063 C  CD    . GLU A 1 165 ? -4.212  -31.648 30.259  1.00 42.91 ? 165  GLU A CD    1 
ATOM   1064 O  OE1   . GLU A 1 165 ? -3.480  -31.426 31.250  1.00 45.64 ? 165  GLU A OE1   1 
ATOM   1065 O  OE2   . GLU A 1 165 ? -4.771  -32.748 30.069  1.00 42.15 ? 165  GLU A OE2   1 
ATOM   1066 N  N     . PRO A 1 166 ? -3.181  -25.844 28.049  1.00 26.92 ? 166  PRO A N     1 
ATOM   1067 C  CA    . PRO A 1 166 ? -2.506  -24.581 28.340  1.00 23.36 ? 166  PRO A CA    1 
ATOM   1068 C  C     . PRO A 1 166 ? -3.283  -23.746 29.343  1.00 21.74 ? 166  PRO A C     1 
ATOM   1069 O  O     . PRO A 1 166 ? -4.394  -24.106 29.740  1.00 24.18 ? 166  PRO A O     1 
ATOM   1070 C  CB    . PRO A 1 166 ? -2.489  -23.909 26.973  1.00 24.98 ? 166  PRO A CB    1 
ATOM   1071 C  CG    . PRO A 1 166 ? -3.844  -24.256 26.452  1.00 26.90 ? 166  PRO A CG    1 
ATOM   1072 C  CD    . PRO A 1 166 ? -3.962  -25.734 26.798  1.00 26.99 ? 166  PRO A CD    1 
ATOM   1073 N  N     . GLN A 1 167 ? -2.686  -22.640 29.772  1.00 18.65 ? 167  GLN A N     1 
ATOM   1074 C  CA    . GLN A 1 167 ? -3.353  -21.742 30.701  1.00 20.40 ? 167  GLN A CA    1 
ATOM   1075 C  C     . GLN A 1 167 ? -4.571  -21.143 29.994  1.00 20.42 ? 167  GLN A C     1 
ATOM   1076 O  O     . GLN A 1 167 ? -5.589  -20.849 30.620  1.00 17.54 ? 167  GLN A O     1 
ATOM   1077 C  CB    . GLN A 1 167 ? -2.401  -20.632 31.160  1.00 23.47 ? 167  GLN A CB    1 
ATOM   1078 C  CG    . GLN A 1 167 ? -1.270  -21.126 32.065  1.00 30.41 ? 167  GLN A CG    1 
ATOM   1079 C  CD    . GLN A 1 167 ? -0.470  -19.992 32.683  1.00 35.18 ? 167  GLN A CD    1 
ATOM   1080 O  OE1   . GLN A 1 167 ? -1.035  -19.017 33.182  1.00 39.34 ? 167  GLN A OE1   1 
ATOM   1081 N  NE2   . GLN A 1 167 ? 0.853   -20.118 32.656  1.00 37.95 ? 167  GLN A NE2   1 
ATOM   1082 N  N     . GLY A 1 168 ? -4.466  -21.014 28.674  1.00 19.21 ? 168  GLY A N     1 
ATOM   1083 C  CA    . GLY A 1 168 ? -5.557  -20.464 27.891  1.00 18.20 ? 168  GLY A CA    1 
ATOM   1084 C  C     . GLY A 1 168 ? -5.232  -20.480 26.412  1.00 18.54 ? 168  GLY A C     1 
ATOM   1085 O  O     . GLY A 1 168 ? -4.068  -20.590 26.029  1.00 18.92 ? 168  GLY A O     1 
ATOM   1086 N  N     . VAL A 1 169 ? -6.263  -20.389 25.580  1.00 16.60 ? 169  VAL A N     1 
ATOM   1087 C  CA    . VAL A 1 169 ? -6.077  -20.378 24.134  1.00 13.85 ? 169  VAL A CA    1 
ATOM   1088 C  C     . VAL A 1 169 ? -7.140  -19.510 23.475  1.00 15.46 ? 169  VAL A C     1 
ATOM   1089 O  O     . VAL A 1 169 ? -8.285  -19.463 23.926  1.00 18.15 ? 169  VAL A O     1 
ATOM   1090 C  CB    . VAL A 1 169 ? -6.098  -21.814 23.527  1.00 13.23 ? 169  VAL A CB    1 
ATOM   1091 C  CG1   . VAL A 1 169 ? -7.346  -22.562 23.938  1.00 19.44 ? 169  VAL A CG1   1 
ATOM   1092 C  CG2   . VAL A 1 169 ? -5.998  -21.759 22.000  1.00 19.72 ? 169  VAL A CG2   1 
ATOM   1093 N  N     . GLY A 1 170 ? -6.739  -18.795 22.430  1.00 14.09 ? 170  GLY A N     1 
ATOM   1094 C  CA    . GLY A 1 170 ? -7.664  -17.944 21.708  1.00 12.38 ? 170  GLY A CA    1 
ATOM   1095 C  C     . GLY A 1 170 ? -7.513  -18.237 20.231  1.00 13.78 ? 170  GLY A C     1 
ATOM   1096 O  O     . GLY A 1 170 ? -6.398  -18.398 19.746  1.00 13.13 ? 170  GLY A O     1 
ATOM   1097 N  N     . VAL A 1 171 ? -8.637  -18.361 19.530  1.00 13.04 ? 171  VAL A N     1 
ATOM   1098 C  CA    . VAL A 1 171 ? -8.623  -18.641 18.100  1.00 13.00 ? 171  VAL A CA    1 
ATOM   1099 C  C     . VAL A 1 171 ? -9.535  -17.651 17.403  1.00 13.48 ? 171  VAL A C     1 
ATOM   1100 O  O     . VAL A 1 171 ? -10.688 -17.481 17.797  1.00 15.82 ? 171  VAL A O     1 
ATOM   1101 C  CB    . VAL A 1 171 ? -9.139  -20.069 17.787  1.00 15.07 ? 171  VAL A CB    1 
ATOM   1102 C  CG1   . VAL A 1 171 ? -9.280  -20.266 16.278  1.00 13.82 ? 171  VAL A CG1   1 
ATOM   1103 C  CG2   . VAL A 1 171 ? -8.204  -21.113 18.364  1.00 16.00 ? 171  VAL A CG2   1 
ATOM   1104 N  N     . VAL A 1 172 ? -9.007  -16.996 16.374  1.00 13.01 ? 172  VAL A N     1 
ATOM   1105 C  CA    . VAL A 1 172 ? -9.774  -16.033 15.594  1.00 10.82 ? 172  VAL A CA    1 
ATOM   1106 C  C     . VAL A 1 172 ? -9.787  -16.514 14.144  1.00 12.74 ? 172  VAL A C     1 
ATOM   1107 O  O     . VAL A 1 172 ? -8.743  -16.863 13.593  1.00 9.88  ? 172  VAL A O     1 
ATOM   1108 C  CB    . VAL A 1 172 ? -9.137  -14.622 15.643  1.00 12.13 ? 172  VAL A CB    1 
ATOM   1109 C  CG1   . VAL A 1 172 ? -9.856  -13.684 14.681  1.00 10.20 ? 172  VAL A CG1   1 
ATOM   1110 C  CG2   . VAL A 1 172 ? -9.199  -14.062 17.063  1.00 10.92 ? 172  VAL A CG2   1 
ATOM   1111 N  N     . VAL A 1 173 ? -10.978 -16.604 13.559  1.00 11.17 ? 173  VAL A N     1 
ATOM   1112 C  CA    . VAL A 1 173 ? -11.115 -17.030 12.171  1.00 8.55  ? 173  VAL A CA    1 
ATOM   1113 C  C     . VAL A 1 173 ? -11.716 -15.864 11.397  1.00 10.79 ? 173  VAL A C     1 
ATOM   1114 O  O     . VAL A 1 173 ? -12.693 -15.255 11.842  1.00 10.18 ? 173  VAL A O     1 
ATOM   1115 C  CB    . VAL A 1 173 ? -12.069 -18.249 12.022  1.00 8.80  ? 173  VAL A CB    1 
ATOM   1116 C  CG1   . VAL A 1 173 ? -12.154 -18.670 10.562  1.00 9.34  ? 173  VAL A CG1   1 
ATOM   1117 C  CG2   . VAL A 1 173 ? -11.600 -19.417 12.874  1.00 10.70 ? 173  VAL A CG2   1 
ATOM   1118 N  N     . GLU A 1 174 ? -11.100 -15.513 10.275  1.00 9.40  ? 174  GLU A N     1 
ATOM   1119 C  CA    . GLU A 1 174 ? -11.623 -14.430 9.458   1.00 9.91  ? 174  GLU A CA    1 
ATOM   1120 C  C     . GLU A 1 174 ? -11.747 -14.969 8.051   1.00 10.63 ? 174  GLU A C     1 
ATOM   1121 O  O     . GLU A 1 174 ? -10.773 -15.470 7.492   1.00 10.28 ? 174  GLU A O     1 
ATOM   1122 C  CB    . GLU A 1 174 ? -10.697 -13.212 9.480   1.00 12.50 ? 174  GLU A CB    1 
ATOM   1123 C  CG    . GLU A 1 174 ? -11.204 -12.053 8.624   1.00 13.23 ? 174  GLU A CG    1 
ATOM   1124 C  CD    . GLU A 1 174 ? -10.589 -10.718 9.009   1.00 22.03 ? 174  GLU A CD    1 
ATOM   1125 O  OE1   . GLU A 1 174 ? -11.271 -9.685  8.847   1.00 21.19 ? 174  GLU A OE1   1 
ATOM   1126 O  OE2   . GLU A 1 174 ? -9.434  -10.695 9.480   1.00 21.01 ? 174  GLU A OE2   1 
ATOM   1127 N  N     . GLY A 1 175 ? -12.950 -14.906 7.491   1.00 9.80  ? 175  GLY A N     1 
ATOM   1128 C  CA    . GLY A 1 175 ? -13.111 -15.431 6.153   1.00 13.05 ? 175  GLY A CA    1 
ATOM   1129 C  C     . GLY A 1 175 ? -14.162 -14.771 5.297   1.00 10.93 ? 175  GLY A C     1 
ATOM   1130 O  O     . GLY A 1 175 ? -14.943 -13.945 5.768   1.00 11.22 ? 175  GLY A O     1 
ATOM   1131 N  N     . VAL A 1 176 ? -14.118 -15.104 4.013   1.00 10.58 ? 176  VAL A N     1 
ATOM   1132 C  CA    . VAL A 1 176 ? -15.083 -14.608 3.043   1.00 12.91 ? 176  VAL A CA    1 
ATOM   1133 C  C     . VAL A 1 176 ? -15.912 -15.827 2.678   1.00 13.33 ? 176  VAL A C     1 
ATOM   1134 O  O     . VAL A 1 176 ? -15.402 -16.949 2.680   1.00 11.81 ? 176  VAL A O     1 
ATOM   1135 C  CB    . VAL A 1 176 ? -14.401 -14.020 1.794   1.00 14.33 ? 176  VAL A CB    1 
ATOM   1136 C  CG1   . VAL A 1 176 ? -13.612 -12.774 2.177   1.00 18.50 ? 176  VAL A CG1   1 
ATOM   1137 C  CG2   . VAL A 1 176 ? -13.492 -15.052 1.145   1.00 15.81 ? 176  VAL A CG2   1 
ATOM   1138 N  N     . HIS A 1 177 ? -17.198 -15.613 2.426   1.00 11.26 ? 177  HIS A N     1 
ATOM   1139 C  CA    . HIS A 1 177 ? -18.109 -16.701 2.102   1.00 12.08 ? 177  HIS A CA    1 
ATOM   1140 C  C     . HIS A 1 177 ? -18.676 -16.553 0.703   1.00 9.48  ? 177  HIS A C     1 
ATOM   1141 O  O     . HIS A 1 177 ? -19.389 -15.589 0.413   1.00 11.98 ? 177  HIS A O     1 
ATOM   1142 C  CB    . HIS A 1 177 ? -19.247 -16.732 3.122   1.00 16.16 ? 177  HIS A CB    1 
ATOM   1143 C  CG    . HIS A 1 177 ? -18.783 -16.939 4.532   1.00 16.73 ? 177  HIS A CG    1 
ATOM   1144 N  ND1   . HIS A 1 177 ? -19.191 -18.006 5.300   1.00 22.42 ? 177  HIS A ND1   1 
ATOM   1145 C  CD2   . HIS A 1 177 ? -17.921 -16.232 5.299   1.00 19.06 ? 177  HIS A CD2   1 
ATOM   1146 C  CE1   . HIS A 1 177 ? -18.597 -17.952 6.478   1.00 16.89 ? 177  HIS A CE1   1 
ATOM   1147 N  NE2   . HIS A 1 177 ? -17.821 -16.885 6.503   1.00 21.92 ? 177  HIS A NE2   1 
ATOM   1148 N  N     . LEU A 1 178 ? -18.365 -17.510 -0.162  1.00 13.57 ? 178  LEU A N     1 
ATOM   1149 C  CA    . LEU A 1 178 ? -18.861 -17.456 -1.526  1.00 14.32 ? 178  LEU A CA    1 
ATOM   1150 C  C     . LEU A 1 178 ? -20.378 -17.523 -1.627  1.00 15.20 ? 178  LEU A C     1 
ATOM   1151 O  O     . LEU A 1 178 ? -20.950 -17.039 -2.601  1.00 17.34 ? 178  LEU A O     1 
ATOM   1152 C  CB    . LEU A 1 178 ? -18.207 -18.528 -2.391  1.00 13.41 ? 178  LEU A CB    1 
ATOM   1153 C  CG    . LEU A 1 178 ? -16.750 -18.218 -2.739  1.00 15.17 ? 178  LEU A CG    1 
ATOM   1154 C  CD1   . LEU A 1 178 ? -16.199 -19.321 -3.617  1.00 16.10 ? 178  LEU A CD1   1 
ATOM   1155 C  CD2   . LEU A 1 178 ? -16.655 -16.866 -3.456  1.00 17.28 ? 178  LEU A CD2   1 
ATOM   1156 N  N     . CYS A 1 179 ? -21.040 -18.095 -0.622  1.00 16.36 ? 179  CYS A N     1 
ATOM   1157 C  CA    . CYS A 1 179 ? -22.496 -18.169 -0.674  1.00 17.36 ? 179  CYS A CA    1 
ATOM   1158 C  C     . CYS A 1 179 ? -23.106 -16.774 -0.535  1.00 17.26 ? 179  CYS A C     1 
ATOM   1159 O  O     . CYS A 1 179 ? -24.262 -16.559 -0.895  1.00 16.65 ? 179  CYS A O     1 
ATOM   1160 C  CB    . CYS A 1 179 ? -23.057 -19.139 0.370   1.00 18.25 ? 179  CYS A CB    1 
ATOM   1161 S  SG    . CYS A 1 179 ? -22.775 -18.695 2.083   1.00 18.37 ? 179  CYS A SG    1 
ATOM   1162 N  N     . MET A 1 180 ? -22.313 -15.832 -0.024  1.00 16.58 ? 180  MET A N     1 
ATOM   1163 C  CA    . MET A 1 180 ? -22.744 -14.442 0.128   1.00 17.20 ? 180  MET A CA    1 
ATOM   1164 C  C     . MET A 1 180 ? -22.237 -13.591 -1.040  1.00 15.68 ? 180  MET A C     1 
ATOM   1165 O  O     . MET A 1 180 ? -22.763 -12.513 -1.296  1.00 16.39 ? 180  MET A O     1 
ATOM   1166 C  CB    . MET A 1 180 ? -22.197 -13.823 1.428   1.00 19.50 ? 180  MET A CB    1 
ATOM   1167 C  CG    . MET A 1 180 ? -22.810 -14.336 2.716   1.00 23.16 ? 180  MET A CG    1 
ATOM   1168 S  SD    . MET A 1 180 ? -22.431 -13.232 4.114   1.00 29.43 ? 180  MET A SD    1 
ATOM   1169 C  CE    . MET A 1 180 ? -20.834 -13.834 4.603   1.00 26.70 ? 180  MET A CE    1 
ATOM   1170 N  N     . MET A 1 181 ? -21.209 -14.078 -1.732  1.00 15.34 ? 181  MET A N     1 
ATOM   1171 C  CA    . MET A 1 181 ? -20.586 -13.342 -2.835  1.00 14.37 ? 181  MET A CA    1 
ATOM   1172 C  C     . MET A 1 181 ? -21.019 -13.703 -4.254  1.00 14.76 ? 181  MET A C     1 
ATOM   1173 O  O     . MET A 1 181 ? -21.251 -12.815 -5.076  1.00 14.35 ? 181  MET A O     1 
ATOM   1174 C  CB    . MET A 1 181 ? -19.059 -13.459 -2.728  1.00 11.72 ? 181  MET A CB    1 
ATOM   1175 C  CG    . MET A 1 181 ? -18.495 -12.953 -1.401  1.00 19.90 ? 181  MET A CG    1 
ATOM   1176 S  SD    . MET A 1 181 ? -16.813 -13.516 -1.085  1.00 23.50 ? 181  MET A SD    1 
ATOM   1177 C  CE    . MET A 1 181 ? -15.897 -12.574 -2.269  1.00 24.74 ? 181  MET A CE    1 
ATOM   1178 N  N     . MET A 1 182 ? -21.110 -14.995 -4.553  1.00 17.11 ? 182  MET A N     1 
ATOM   1179 C  CA    . MET A 1 182 ? -21.476 -15.418 -5.902  1.00 15.32 ? 182  MET A CA    1 
ATOM   1180 C  C     . MET A 1 182 ? -22.955 -15.722 -6.113  1.00 15.81 ? 182  MET A C     1 
ATOM   1181 O  O     . MET A 1 182 ? -23.353 -16.166 -7.187  1.00 14.82 ? 182  MET A O     1 
ATOM   1182 C  CB    . MET A 1 182 ? -20.613 -16.607 -6.341  1.00 17.60 ? 182  MET A CB    1 
ATOM   1183 C  CG    . MET A 1 182 ? -20.960 -17.956 -5.745  1.00 21.13 ? 182  MET A CG    1 
ATOM   1184 S  SD    . MET A 1 182 ? -19.667 -19.165 -6.138  1.00 22.08 ? 182  MET A SD    1 
ATOM   1185 C  CE    . MET A 1 182 ? -19.851 -19.377 -7.911  1.00 18.78 ? 182  MET A CE    1 
ATOM   1186 N  N     . ARG A 1 183 ? -23.765 -15.446 -5.099  1.00 16.07 ? 183  ARG A N     1 
ATOM   1187 C  CA    . ARG A 1 183 ? -25.198 -15.700 -5.165  1.00 15.79 ? 183  ARG A CA    1 
ATOM   1188 C  C     . ARG A 1 183 ? -25.891 -14.997 -4.007  1.00 17.52 ? 183  ARG A C     1 
ATOM   1189 O  O     . ARG A 1 183 ? -25.236 -14.365 -3.174  1.00 15.34 ? 183  ARG A O     1 
ATOM   1190 C  CB    . ARG A 1 183 ? -25.473 -17.203 -5.074  1.00 15.08 ? 183  ARG A CB    1 
ATOM   1191 C  CG    . ARG A 1 183 ? -24.948 -17.840 -3.789  1.00 14.83 ? 183  ARG A CG    1 
ATOM   1192 C  CD    . ARG A 1 183 ? -25.725 -19.091 -3.423  1.00 17.42 ? 183  ARG A CD    1 
ATOM   1193 N  NE    . ARG A 1 183 ? -27.147 -18.818 -3.215  1.00 17.27 ? 183  ARG A NE    1 
ATOM   1194 C  CZ    . ARG A 1 183 ? -27.660 -18.222 -2.141  1.00 16.12 ? 183  ARG A CZ    1 
ATOM   1195 N  NH1   . ARG A 1 183 ? -26.877 -17.819 -1.145  1.00 15.67 ? 183  ARG A NH1   1 
ATOM   1196 N  NH2   . ARG A 1 183 ? -28.967 -18.012 -2.068  1.00 12.97 ? 183  ARG A NH2   1 
ATOM   1197 N  N     . GLY A 1 184 ? -27.214 -15.125 -3.954  1.00 18.09 ? 184  GLY A N     1 
ATOM   1198 C  CA    . GLY A 1 184 ? -27.983 -14.505 -2.887  1.00 19.82 ? 184  GLY A CA    1 
ATOM   1199 C  C     . GLY A 1 184 ? -27.817 -12.999 -2.827  1.00 19.47 ? 184  GLY A C     1 
ATOM   1200 O  O     . GLY A 1 184 ? -28.068 -12.304 -3.811  1.00 19.71 ? 184  GLY A O     1 
ATOM   1201 N  N     . VAL A 1 185 ? -27.376 -12.498 -1.675  1.00 18.42 ? 185  VAL A N     1 
ATOM   1202 C  CA    . VAL A 1 185 ? -27.180 -11.066 -1.480  1.00 16.23 ? 185  VAL A CA    1 
ATOM   1203 C  C     . VAL A 1 185 ? -26.086 -10.487 -2.373  1.00 16.19 ? 185  VAL A C     1 
ATOM   1204 O  O     . VAL A 1 185 ? -26.073 -9.286  -2.655  1.00 18.23 ? 185  VAL A O     1 
ATOM   1205 C  CB    . VAL A 1 185 ? -26.891 -10.728 0.007   1.00 16.40 ? 185  VAL A CB    1 
ATOM   1206 C  CG1   . VAL A 1 185 ? -28.056 -11.166 0.861   1.00 17.47 ? 185  VAL A CG1   1 
ATOM   1207 C  CG2   . VAL A 1 185 ? -25.605 -11.407 0.492   1.00 13.26 ? 185  VAL A CG2   1 
ATOM   1208 N  N     . GLU A 1 186 ? -25.174 -11.349 -2.816  1.00 16.14 ? 186  GLU A N     1 
ATOM   1209 C  CA    . GLU A 1 186 ? -24.075 -10.951 -3.690  1.00 14.11 ? 186  GLU A CA    1 
ATOM   1210 C  C     . GLU A 1 186 ? -23.268 -9.740  -3.210  1.00 12.92 ? 186  GLU A C     1 
ATOM   1211 O  O     . GLU A 1 186 ? -22.932 -8.861  -4.003  1.00 13.37 ? 186  GLU A O     1 
ATOM   1212 C  CB    . GLU A 1 186 ? -24.586 -10.719 -5.121  1.00 15.56 ? 186  GLU A CB    1 
ATOM   1213 C  CG    . GLU A 1 186 ? -25.240 -11.948 -5.740  1.00 13.98 ? 186  GLU A CG    1 
ATOM   1214 C  CD    . GLU A 1 186 ? -25.613 -11.747 -7.198  1.00 18.61 ? 186  GLU A CD    1 
ATOM   1215 O  OE1   . GLU A 1 186 ? -24.706 -11.537 -8.025  1.00 17.05 ? 186  GLU A OE1   1 
ATOM   1216 O  OE2   . GLU A 1 186 ? -26.817 -11.801 -7.516  1.00 21.72 ? 186  GLU A OE2   1 
ATOM   1217 N  N     . LYS A 1 187 ? -22.999 -9.674  -1.908  1.00 11.60 ? 187  LYS A N     1 
ATOM   1218 C  CA    . LYS A 1 187 ? -22.192 -8.580  -1.353  1.00 10.11 ? 187  LYS A CA    1 
ATOM   1219 C  C     . LYS A 1 187 ? -20.740 -8.937  -1.670  1.00 13.95 ? 187  LYS A C     1 
ATOM   1220 O  O     . LYS A 1 187 ? -20.356 -10.107 -1.584  1.00 13.48 ? 187  LYS A O     1 
ATOM   1221 C  CB    . LYS A 1 187 ? -22.404 -8.449  0.160   1.00 10.65 ? 187  LYS A CB    1 
ATOM   1222 C  CG    . LYS A 1 187 ? -23.794 -7.950  0.582   1.00 11.85 ? 187  LYS A CG    1 
ATOM   1223 C  CD    . LYS A 1 187 ? -24.045 -6.508  0.145   1.00 13.88 ? 187  LYS A CD    1 
ATOM   1224 C  CE    . LYS A 1 187 ? -25.437 -6.035  0.548   1.00 14.30 ? 187  LYS A CE    1 
ATOM   1225 N  NZ    . LYS A 1 187 ? -25.720 -4.637  0.093   1.00 14.74 ? 187  LYS A NZ    1 
ATOM   1226 N  N     . GLN A 1 188 ? -19.934 -7.934  -2.016  1.00 10.32 ? 188  GLN A N     1 
ATOM   1227 C  CA    . GLN A 1 188 ? -18.546 -8.158  -2.404  1.00 12.75 ? 188  GLN A CA    1 
ATOM   1228 C  C     . GLN A 1 188 ? -17.456 -7.763  -1.414  1.00 14.29 ? 188  GLN A C     1 
ATOM   1229 O  O     . GLN A 1 188 ? -16.358 -8.315  -1.457  1.00 14.80 ? 188  GLN A O     1 
ATOM   1230 C  CB    . GLN A 1 188 ? -18.266 -7.435  -3.727  1.00 12.80 ? 188  GLN A CB    1 
ATOM   1231 C  CG    . GLN A 1 188 ? -19.237 -7.783  -4.845  1.00 14.32 ? 188  GLN A CG    1 
ATOM   1232 C  CD    . GLN A 1 188 ? -19.136 -9.236  -5.239  1.00 13.13 ? 188  GLN A CD    1 
ATOM   1233 O  OE1   . GLN A 1 188 ? -18.049 -9.727  -5.525  1.00 13.67 ? 188  GLN A OE1   1 
ATOM   1234 N  NE2   . GLN A 1 188 ? -20.263 -9.939  -5.230  1.00 13.72 ? 188  GLN A NE2   1 
ATOM   1235 N  N     . HIS A 1 189 ? -17.758 -6.827  -0.522  1.00 11.44 ? 189  HIS A N     1 
ATOM   1236 C  CA    . HIS A 1 189 ? -16.763 -6.327  0.418   1.00 12.61 ? 189  HIS A CA    1 
ATOM   1237 C  C     . HIS A 1 189 ? -16.780 -6.910  1.821   1.00 11.20 ? 189  HIS A C     1 
ATOM   1238 O  O     . HIS A 1 189 ? -15.948 -6.539  2.643   1.00 14.24 ? 189  HIS A O     1 
ATOM   1239 C  CB    . HIS A 1 189 ? -16.900 -4.804  0.536   1.00 12.61 ? 189  HIS A CB    1 
ATOM   1240 C  CG    . HIS A 1 189 ? -16.614 -4.069  -0.734  1.00 15.12 ? 189  HIS A CG    1 
ATOM   1241 N  ND1   . HIS A 1 189 ? -15.361 -4.031  -1.305  1.00 18.29 ? 189  HIS A ND1   1 
ATOM   1242 C  CD2   . HIS A 1 189 ? -17.414 -3.322  -1.530  1.00 17.44 ? 189  HIS A CD2   1 
ATOM   1243 C  CE1   . HIS A 1 189 ? -15.400 -3.289  -2.398  1.00 21.38 ? 189  HIS A CE1   1 
ATOM   1244 N  NE2   . HIS A 1 189 ? -16.635 -2.847  -2.556  1.00 17.27 ? 189  HIS A NE2   1 
ATOM   1245 N  N     . SER A 1 190 ? -17.692 -7.839  2.089   1.00 11.64 ? 190  SER A N     1 
ATOM   1246 C  CA    . SER A 1 190 ? -17.819 -8.392  3.430   1.00 12.84 ? 190  SER A CA    1 
ATOM   1247 C  C     . SER A 1 190 ? -16.872 -9.522  3.828   1.00 10.01 ? 190  SER A C     1 
ATOM   1248 O  O     . SER A 1 190 ? -16.493 -10.352 3.008   1.00 15.01 ? 190  SER A O     1 
ATOM   1249 C  CB    . SER A 1 190 ? -19.266 -8.832  3.673   1.00 14.01 ? 190  SER A CB    1 
ATOM   1250 O  OG    . SER A 1 190 ? -19.443 -9.229  5.019   1.00 23.97 ? 190  SER A OG    1 
ATOM   1251 N  N     . ARG A 1 191 ? -16.488 -9.519  5.103   1.00 12.45 ? 191  ARG A N     1 
ATOM   1252 C  CA    . ARG A 1 191 ? -15.622 -10.549 5.687   1.00 15.08 ? 191  ARG A CA    1 
ATOM   1253 C  C     . ARG A 1 191 ? -16.229 -10.815 7.056   1.00 14.06 ? 191  ARG A C     1 
ATOM   1254 O  O     . ARG A 1 191 ? -16.818 -9.914  7.656   1.00 15.35 ? 191  ARG A O     1 
ATOM   1255 C  CB    . ARG A 1 191 ? -14.179 -10.056 5.877   1.00 18.84 ? 191  ARG A CB    1 
ATOM   1256 C  CG    . ARG A 1 191 ? -13.469 -9.605  4.617   1.00 29.46 ? 191  ARG A CG    1 
ATOM   1257 C  CD    . ARG A 1 191 ? -11.955 -9.561  4.823   1.00 32.10 ? 191  ARG A CD    1 
ATOM   1258 N  NE    . ARG A 1 191 ? -11.546 -8.841  6.031   1.00 37.64 ? 191  ARG A NE    1 
ATOM   1259 C  CZ    . ARG A 1 191 ? -11.416 -7.518  6.122   1.00 40.03 ? 191  ARG A CZ    1 
ATOM   1260 N  NH1   . ARG A 1 191 ? -11.673 -6.738  5.079   1.00 38.99 ? 191  ARG A NH1   1 
ATOM   1261 N  NH2   . ARG A 1 191 ? -10.977 -6.973  7.247   1.00 41.92 ? 191  ARG A NH2   1 
ATOM   1262 N  N     . THR A 1 192 ? -16.076 -12.035 7.558   1.00 10.71 ? 192  THR A N     1 
ATOM   1263 C  CA    . THR A 1 192 ? -16.638 -12.380 8.854   1.00 10.64 ? 192  THR A CA    1 
ATOM   1264 C  C     . THR A 1 192 ? -15.578 -12.853 9.824   1.00 9.94  ? 192  THR A C     1 
ATOM   1265 O  O     . THR A 1 192 ? -14.689 -13.615 9.459   1.00 8.62  ? 192  THR A O     1 
ATOM   1266 C  CB    . THR A 1 192 ? -17.724 -13.476 8.721   1.00 10.20 ? 192  THR A CB    1 
ATOM   1267 O  OG1   . THR A 1 192 ? -18.856 -12.938 8.025   1.00 15.86 ? 192  THR A OG1   1 
ATOM   1268 C  CG2   . THR A 1 192 ? -18.176 -13.959 10.111  1.00 11.26 ? 192  THR A CG2   1 
ATOM   1269 N  N     . VAL A 1 193 ? -15.666 -12.365 11.055  1.00 10.85 ? 193  VAL A N     1 
ATOM   1270 C  CA    . VAL A 1 193 ? -14.737 -12.749 12.103  1.00 11.40 ? 193  VAL A CA    1 
ATOM   1271 C  C     . VAL A 1 193 ? -15.476 -13.522 13.191  1.00 10.72 ? 193  VAL A C     1 
ATOM   1272 O  O     . VAL A 1 193 ? -16.535 -13.099 13.659  1.00 11.13 ? 193  VAL A O     1 
ATOM   1273 C  CB    . VAL A 1 193 ? -14.080 -11.513 12.764  1.00 13.21 ? 193  VAL A CB    1 
ATOM   1274 C  CG1   . VAL A 1 193 ? -13.293 -11.927 13.999  1.00 14.71 ? 193  VAL A CG1   1 
ATOM   1275 C  CG2   . VAL A 1 193 ? -13.169 -10.809 11.779  1.00 14.10 ? 193  VAL A CG2   1 
ATOM   1276 N  N     . THR A 1 194 ? -14.951 -14.691 13.539  1.00 12.05 ? 194  THR A N     1 
ATOM   1277 C  CA    . THR A 1 194 ? -15.524 -15.486 14.617  1.00 11.00 ? 194  THR A CA    1 
ATOM   1278 C  C     . THR A 1 194 ? -14.353 -15.852 15.515  1.00 11.83 ? 194  THR A C     1 
ATOM   1279 O  O     . THR A 1 194 ? -13.191 -15.806 15.097  1.00 10.32 ? 194  THR A O     1 
ATOM   1280 C  CB    . THR A 1 194 ? -16.211 -16.784 14.124  1.00 8.96  ? 194  THR A CB    1 
ATOM   1281 O  OG1   . THR A 1 194 ? -15.251 -17.619 13.468  1.00 13.18 ? 194  THR A OG1   1 
ATOM   1282 C  CG2   . THR A 1 194 ? -17.366 -16.464 13.177  1.00 11.33 ? 194  THR A CG2   1 
ATOM   1283 N  N     . SER A 1 195 ? -14.638 -16.194 16.759  1.00 13.25 ? 195  SER A N     1 
ATOM   1284 C  CA    . SER A 1 195 ? -13.545 -16.549 17.648  1.00 14.95 ? 195  SER A CA    1 
ATOM   1285 C  C     . SER A 1 195 ? -14.004 -17.426 18.784  1.00 14.86 ? 195  SER A C     1 
ATOM   1286 O  O     . SER A 1 195 ? -15.200 -17.649 18.962  1.00 13.57 ? 195  SER A O     1 
ATOM   1287 C  CB    . SER A 1 195 ? -12.873 -15.285 18.197  1.00 17.67 ? 195  SER A CB    1 
ATOM   1288 O  OG    . SER A 1 195 ? -13.740 -14.579 19.063  1.00 19.71 ? 195  SER A OG    1 
ATOM   1289 N  N     . ALA A 1 196 ? -13.027 -17.965 19.510  1.00 14.85 ? 196  ALA A N     1 
ATOM   1290 C  CA    . ALA A 1 196 ? -13.261 -18.820 20.665  1.00 15.04 ? 196  ALA A CA    1 
ATOM   1291 C  C     . ALA A 1 196 ? -12.131 -18.522 21.635  1.00 16.17 ? 196  ALA A C     1 
ATOM   1292 O  O     . ALA A 1 196 ? -10.950 -18.524 21.252  1.00 14.92 ? 196  ALA A O     1 
ATOM   1293 C  CB    . ALA A 1 196 ? -13.242 -20.290 20.269  1.00 16.76 ? 196  ALA A CB    1 
ATOM   1294 N  N     . MET A 1 197 ? -12.499 -18.232 22.880  1.00 15.44 ? 197  MET A N     1 
ATOM   1295 C  CA    . MET A 1 197 ? -11.525 -17.904 23.912  1.00 16.80 ? 197  MET A CA    1 
ATOM   1296 C  C     . MET A 1 197 ? -11.692 -18.879 25.070  1.00 17.79 ? 197  MET A C     1 
ATOM   1297 O  O     . MET A 1 197 ? -12.799 -19.055 25.588  1.00 17.52 ? 197  MET A O     1 
ATOM   1298 C  CB    . MET A 1 197 ? -11.739 -16.470 24.407  1.00 17.49 ? 197  MET A CB    1 
ATOM   1299 C  CG    . MET A 1 197 ? -11.608 -15.377 23.352  1.00 19.59 ? 197  MET A CG    1 
ATOM   1300 S  SD    . MET A 1 197 ? -9.948  -15.234 22.656  1.00 19.02 ? 197  MET A SD    1 
ATOM   1301 C  CE    . MET A 1 197 ? -9.139  -14.251 23.811  1.00 28.94 ? 197  MET A CE    1 
ATOM   1302 N  N     . LEU A 1 198 ? -10.599 -19.534 25.447  1.00 17.92 ? 198  LEU A N     1 
ATOM   1303 C  CA    . LEU A 1 198 ? -10.627 -20.508 26.532  1.00 18.95 ? 198  LEU A CA    1 
ATOM   1304 C  C     . LEU A 1 198 ? -9.627  -20.175 27.633  1.00 20.83 ? 198  LEU A C     1 
ATOM   1305 O  O     . LEU A 1 198 ? -8.575  -19.587 27.377  1.00 18.95 ? 198  LEU A O     1 
ATOM   1306 C  CB    . LEU A 1 198 ? -10.342 -21.904 25.983  1.00 21.22 ? 198  LEU A CB    1 
ATOM   1307 C  CG    . LEU A 1 198 ? -11.339 -22.432 24.950  1.00 21.30 ? 198  LEU A CG    1 
ATOM   1308 C  CD1   . LEU A 1 198 ? -10.857 -23.747 24.369  1.00 20.69 ? 198  LEU A CD1   1 
ATOM   1309 C  CD2   . LEU A 1 198 ? -12.708 -22.591 25.602  1.00 25.04 ? 198  LEU A CD2   1 
ATOM   1310 N  N     . GLY A 1 199 ? -9.973  -20.545 28.863  1.00 21.54 ? 199  GLY A N     1 
ATOM   1311 C  CA    . GLY A 1 199 ? -9.091  -20.293 29.992  1.00 20.41 ? 199  GLY A CA    1 
ATOM   1312 C  C     . GLY A 1 199 ? -8.795  -18.829 30.241  1.00 18.72 ? 199  GLY A C     1 
ATOM   1313 O  O     . GLY A 1 199 ? -9.706  -17.997 30.275  1.00 18.69 ? 199  GLY A O     1 
ATOM   1314 N  N     . VAL A 1 200 ? -7.512  -18.503 30.390  1.00 17.04 ? 200  VAL A N     1 
ATOM   1315 C  CA    . VAL A 1 200 ? -7.113  -17.130 30.653  1.00 17.85 ? 200  VAL A CA    1 
ATOM   1316 C  C     . VAL A 1 200 ? -7.479  -16.176 29.521  1.00 16.94 ? 200  VAL A C     1 
ATOM   1317 O  O     . VAL A 1 200 ? -7.571  -14.973 29.734  1.00 14.55 ? 200  VAL A O     1 
ATOM   1318 C  CB    . VAL A 1 200 ? -5.603  -17.014 30.990  1.00 20.72 ? 200  VAL A CB    1 
ATOM   1319 C  CG1   . VAL A 1 200 ? -5.243  -17.975 32.121  1.00 21.90 ? 200  VAL A CG1   1 
ATOM   1320 C  CG2   . VAL A 1 200 ? -4.749  -17.288 29.762  1.00 19.46 ? 200  VAL A CG2   1 
ATOM   1321 N  N     . PHE A 1 201 ? -7.661  -16.706 28.311  1.00 17.45 ? 201  PHE A N     1 
ATOM   1322 C  CA    . PHE A 1 201 ? -8.032  -15.863 27.180  1.00 18.96 ? 201  PHE A CA    1 
ATOM   1323 C  C     . PHE A 1 201 ? -9.486  -15.420 27.306  1.00 21.24 ? 201  PHE A C     1 
ATOM   1324 O  O     . PHE A 1 201 ? -9.859  -14.346 26.838  1.00 21.63 ? 201  PHE A O     1 
ATOM   1325 C  CB    . PHE A 1 201 ? -7.793  -16.588 25.850  1.00 16.72 ? 201  PHE A CB    1 
ATOM   1326 C  CG    . PHE A 1 201 ? -6.368  -16.521 25.374  1.00 17.53 ? 201  PHE A CG    1 
ATOM   1327 C  CD1   . PHE A 1 201 ? -6.054  -15.937 24.151  1.00 17.68 ? 201  PHE A CD1   1 
ATOM   1328 C  CD2   . PHE A 1 201 ? -5.339  -17.032 26.152  1.00 15.48 ? 201  PHE A CD2   1 
ATOM   1329 C  CE1   . PHE A 1 201 ? -4.737  -15.865 23.711  1.00 16.84 ? 201  PHE A CE1   1 
ATOM   1330 C  CE2   . PHE A 1 201 ? -4.016  -16.964 25.723  1.00 17.70 ? 201  PHE A CE2   1 
ATOM   1331 C  CZ    . PHE A 1 201 ? -3.713  -16.381 24.503  1.00 17.04 ? 201  PHE A CZ    1 
ATOM   1332 N  N     . ARG A 1 202 ? -10.303 -16.251 27.946  1.00 20.62 ? 202  ARG A N     1 
ATOM   1333 C  CA    . ARG A 1 202 ? -11.709 -15.918 28.150  1.00 22.50 ? 202  ARG A CA    1 
ATOM   1334 C  C     . ARG A 1 202 ? -11.892 -15.059 29.395  1.00 22.88 ? 202  ARG A C     1 
ATOM   1335 O  O     . ARG A 1 202 ? -12.675 -14.113 29.397  1.00 21.72 ? 202  ARG A O     1 
ATOM   1336 C  CB    . ARG A 1 202 ? -12.540 -17.191 28.287  1.00 22.32 ? 202  ARG A CB    1 
ATOM   1337 C  CG    . ARG A 1 202 ? -14.005 -16.955 28.680  1.00 27.26 ? 202  ARG A CG    1 
ATOM   1338 C  CD    . ARG A 1 202 ? -14.764 -18.271 28.784  1.00 34.20 ? 202  ARG A CD    1 
ATOM   1339 N  NE    . ARG A 1 202 ? -13.944 -19.301 29.415  1.00 39.35 ? 202  ARG A NE    1 
ATOM   1340 C  CZ    . ARG A 1 202 ? -13.885 -20.567 29.014  1.00 43.70 ? 202  ARG A CZ    1 
ATOM   1341 N  NH1   . ARG A 1 202 ? -14.619 -20.975 27.983  1.00 43.27 ? 202  ARG A NH1   1 
ATOM   1342 N  NH2   . ARG A 1 202 ? -13.025 -21.402 29.589  1.00 38.70 ? 202  ARG A NH2   1 
ATOM   1343 N  N     . GLU A 1 203 ? -11.120 -15.357 30.435  1.00 22.10 ? 203  GLU A N     1 
ATOM   1344 C  CA    . GLU A 1 203 ? -11.238 -14.644 31.703  1.00 23.84 ? 203  GLU A CA    1 
ATOM   1345 C  C     . GLU A 1 203 ? -10.426 -13.384 31.923  1.00 25.18 ? 203  GLU A C     1 
ATOM   1346 O  O     . GLU A 1 203 ? -10.886 -12.460 32.599  1.00 26.02 ? 203  GLU A O     1 
ATOM   1347 C  CB    . GLU A 1 203 ? -11.005 -15.615 32.859  1.00 23.86 ? 203  GLU A CB    1 
ATOM   1348 C  CG    . GLU A 1 203 ? -12.095 -16.656 32.976  1.00 30.36 ? 203  GLU A CG    1 
ATOM   1349 C  CD    . GLU A 1 203 ? -13.490 -16.037 32.997  1.00 34.76 ? 203  GLU A CD    1 
ATOM   1350 O  OE1   . GLU A 1 203 ? -14.387 -16.578 32.316  1.00 38.20 ? 203  GLU A OE1   1 
ATOM   1351 O  OE2   . GLU A 1 203 ? -13.693 -15.010 33.687  1.00 33.37 ? 203  GLU A OE2   1 
ATOM   1352 N  N     . ASN A 1 204 ? -9.206  -13.356 31.399  1.00 23.66 ? 204  ASN A N     1 
ATOM   1353 C  CA    . ASN A 1 204 ? -8.348  -12.193 31.572  1.00 25.56 ? 204  ASN A CA    1 
ATOM   1354 C  C     . ASN A 1 204 ? -8.499  -11.234 30.402  1.00 26.17 ? 204  ASN A C     1 
ATOM   1355 O  O     . ASN A 1 204 ? -8.032  -11.503 29.293  1.00 22.17 ? 204  ASN A O     1 
ATOM   1356 C  CB    . ASN A 1 204 ? -6.889  -12.624 31.735  1.00 27.02 ? 204  ASN A CB    1 
ATOM   1357 C  CG    . ASN A 1 204 ? -5.990  -11.488 32.188  1.00 30.83 ? 204  ASN A CG    1 
ATOM   1358 O  OD1   . ASN A 1 204 ? -6.090  -10.357 31.702  1.00 28.23 ? 204  ASN A OD1   1 
ATOM   1359 N  ND2   . ASN A 1 204 ? -5.099  -11.788 33.125  1.00 30.65 ? 204  ASN A ND2   1 
ATOM   1360 N  N     . GLN A 1 205 ? -9.144  -10.106 30.678  1.00 26.86 ? 205  GLN A N     1 
ATOM   1361 C  CA    . GLN A 1 205 ? -9.396  -9.065  29.687  1.00 28.31 ? 205  GLN A CA    1 
ATOM   1362 C  C     . GLN A 1 205 ? -8.130  -8.595  28.973  1.00 26.79 ? 205  GLN A C     1 
ATOM   1363 O  O     . GLN A 1 205 ? -8.099  -8.497  27.745  1.00 26.09 ? 205  GLN A O     1 
ATOM   1364 C  CB    . GLN A 1 205 ? -10.073 -7.872  30.369  1.00 31.24 ? 205  GLN A CB    1 
ATOM   1365 C  CG    . GLN A 1 205 ? -10.344 -6.690  29.458  1.00 35.75 ? 205  GLN A CG    1 
ATOM   1366 C  CD    . GLN A 1 205 ? -11.290 -7.033  28.327  1.00 38.79 ? 205  GLN A CD    1 
ATOM   1367 O  OE1   . GLN A 1 205 ? -11.144 -6.537  27.210  1.00 44.13 ? 205  GLN A OE1   1 
ATOM   1368 N  NE2   . GLN A 1 205 ? -12.271 -7.881  28.612  1.00 43.02 ? 205  GLN A NE2   1 
ATOM   1369 N  N     . LYS A 1 206 ? -7.099  -8.294  29.755  1.00 25.77 ? 206  LYS A N     1 
ATOM   1370 C  CA    . LYS A 1 206 ? -5.834  -7.821  29.212  1.00 26.80 ? 206  LYS A CA    1 
ATOM   1371 C  C     . LYS A 1 206 ? -5.124  -8.865  28.360  1.00 23.47 ? 206  LYS A C     1 
ATOM   1372 O  O     . LYS A 1 206 ? -4.483  -8.523  27.367  1.00 22.56 ? 206  LYS A O     1 
ATOM   1373 C  CB    . LYS A 1 206 ? -4.927  -7.313  30.334  1.00 29.60 ? 206  LYS A CB    1 
ATOM   1374 C  CG    . LYS A 1 206 ? -5.458  -6.053  31.005  1.00 34.13 ? 206  LYS A CG    1 
ATOM   1375 C  CD    . LYS A 1 206 ? -5.617  -4.928  29.991  1.00 37.94 ? 206  LYS A CD    1 
ATOM   1376 C  CE    . LYS A 1 206 ? -6.176  -3.668  30.626  1.00 41.93 ? 206  LYS A CE    1 
ATOM   1377 N  NZ    . LYS A 1 206 ? -6.285  -2.572  29.624  1.00 45.12 ? 206  LYS A NZ    1 
ATOM   1378 N  N     . THR A 1 207 ? -5.247  -10.133 28.738  1.00 21.84 ? 207  THR A N     1 
ATOM   1379 C  CA    . THR A 1 207 ? -4.634  -11.206 27.967  1.00 21.69 ? 207  THR A CA    1 
ATOM   1380 C  C     . THR A 1 207 ? -5.329  -11.272 26.602  1.00 22.51 ? 207  THR A C     1 
ATOM   1381 O  O     . THR A 1 207 ? -4.674  -11.423 25.571  1.00 19.24 ? 207  THR A O     1 
ATOM   1382 C  CB    . THR A 1 207 ? -4.752  -12.565 28.685  1.00 24.26 ? 207  THR A CB    1 
ATOM   1383 O  OG1   . THR A 1 207 ? -4.029  -12.513 29.923  1.00 21.12 ? 207  THR A OG1   1 
ATOM   1384 C  CG2   . THR A 1 207 ? -4.183  -13.688 27.820  1.00 19.19 ? 207  THR A CG2   1 
ATOM   1385 N  N     . ARG A 1 208 ? -6.653  -11.123 26.602  1.00 22.01 ? 208  ARG A N     1 
ATOM   1386 C  CA    . ARG A 1 208 ? -7.418  -11.154 25.356  1.00 20.98 ? 208  ARG A CA    1 
ATOM   1387 C  C     . ARG A 1 208 ? -7.038  -9.967  24.485  1.00 18.86 ? 208  ARG A C     1 
ATOM   1388 O  O     . ARG A 1 208 ? -6.787  -10.125 23.290  1.00 17.88 ? 208  ARG A O     1 
ATOM   1389 C  CB    . ARG A 1 208 ? -8.922  -11.113 25.623  1.00 25.20 ? 208  ARG A CB    1 
ATOM   1390 C  CG    . ARG A 1 208 ? -9.750  -11.165 24.340  1.00 27.51 ? 208  ARG A CG    1 
ATOM   1391 C  CD    . ARG A 1 208 ? -11.230 -11.011 24.611  1.00 35.36 ? 208  ARG A CD    1 
ATOM   1392 N  NE    . ARG A 1 208 ? -11.676 -11.859 25.704  1.00 42.10 ? 208  ARG A NE    1 
ATOM   1393 C  CZ    . ARG A 1 208 ? -12.180 -11.399 26.842  1.00 40.16 ? 208  ARG A CZ    1 
ATOM   1394 N  NH1   . ARG A 1 208 ? -12.315 -10.095 27.039  1.00 42.76 ? 208  ARG A NH1   1 
ATOM   1395 N  NH2   . ARG A 1 208 ? -12.522 -12.246 27.794  1.00 46.04 ? 208  ARG A NH2   1 
ATOM   1396 N  N     . GLU A 1 209 ? -7.013  -8.780  25.091  1.00 19.60 ? 209  GLU A N     1 
ATOM   1397 C  CA    . GLU A 1 209 ? -6.662  -7.554  24.385  1.00 19.20 ? 209  GLU A CA    1 
ATOM   1398 C  C     . GLU A 1 209 ? -5.266  -7.654  23.784  1.00 18.06 ? 209  GLU A C     1 
ATOM   1399 O  O     . GLU A 1 209 ? -5.050  -7.246  22.644  1.00 16.44 ? 209  GLU A O     1 
ATOM   1400 C  CB    . GLU A 1 209 ? -6.741  -6.338  25.314  1.00 24.11 ? 209  GLU A CB    1 
ATOM   1401 C  CG    . GLU A 1 209 ? -8.157  -5.923  25.691  1.00 32.73 ? 209  GLU A CG    1 
ATOM   1402 C  CD    . GLU A 1 209 ? -8.206  -4.655  26.537  1.00 38.21 ? 209  GLU A CD    1 
ATOM   1403 O  OE1   . GLU A 1 209 ? -7.378  -3.744  26.314  1.00 37.43 ? 209  GLU A OE1   1 
ATOM   1404 O  OE2   . GLU A 1 209 ? -9.088  -4.568  27.420  1.00 42.28 ? 209  GLU A OE2   1 
ATOM   1405 N  N     . GLU A 1 210 ? -4.331  -8.226  24.542  1.00 16.25 ? 210  GLU A N     1 
ATOM   1406 C  CA    . GLU A 1 210 ? -2.961  -8.391  24.057  1.00 17.54 ? 210  GLU A CA    1 
ATOM   1407 C  C     . GLU A 1 210 ? -2.930  -9.292  22.822  1.00 15.60 ? 210  GLU A C     1 
ATOM   1408 O  O     . GLU A 1 210 ? -2.275  -8.972  21.833  1.00 14.86 ? 210  GLU A O     1 
ATOM   1409 C  CB    . GLU A 1 210 ? -2.070  -8.970  25.152  1.00 20.31 ? 210  GLU A CB    1 
ATOM   1410 C  CG    . GLU A 1 210 ? -0.632  -9.195  24.721  1.00 17.76 ? 210  GLU A CG    1 
ATOM   1411 C  CD    . GLU A 1 210 ? 0.293   -9.396  25.902  1.00 23.27 ? 210  GLU A CD    1 
ATOM   1412 O  OE1   . GLU A 1 210 ? 0.963   -10.445 25.960  1.00 23.03 ? 210  GLU A OE1   1 
ATOM   1413 O  OE2   . GLU A 1 210 ? 0.351   -8.496  26.765  1.00 20.72 ? 210  GLU A OE2   1 
ATOM   1414 N  N     . PHE A 1 211 ? -3.644  -10.414 22.882  1.00 15.45 ? 211  PHE A N     1 
ATOM   1415 C  CA    . PHE A 1 211 ? -3.703  -11.343 21.753  1.00 15.03 ? 211  PHE A CA    1 
ATOM   1416 C  C     . PHE A 1 211 ? -4.263  -10.639 20.517  1.00 15.89 ? 211  PHE A C     1 
ATOM   1417 O  O     . PHE A 1 211 ? -3.630  -10.628 19.460  1.00 13.88 ? 211  PHE A O     1 
ATOM   1418 C  CB    . PHE A 1 211 ? -4.571  -12.552 22.115  1.00 16.40 ? 211  PHE A CB    1 
ATOM   1419 C  CG    . PHE A 1 211 ? -4.886  -13.465 20.948  1.00 15.81 ? 211  PHE A CG    1 
ATOM   1420 C  CD1   . PHE A 1 211 ? -6.183  -13.929 20.753  1.00 17.40 ? 211  PHE A CD1   1 
ATOM   1421 C  CD2   . PHE A 1 211 ? -3.889  -13.876 20.062  1.00 17.42 ? 211  PHE A CD2   1 
ATOM   1422 C  CE1   . PHE A 1 211 ? -6.488  -14.788 19.699  1.00 18.06 ? 211  PHE A CE1   1 
ATOM   1423 C  CE2   . PHE A 1 211 ? -4.184  -14.736 19.003  1.00 16.99 ? 211  PHE A CE2   1 
ATOM   1424 C  CZ    . PHE A 1 211 ? -5.486  -15.193 18.822  1.00 14.65 ? 211  PHE A CZ    1 
ATOM   1425 N  N     . LEU A 1 212 ? -5.431  -10.021 20.671  1.00 16.80 ? 212  LEU A N     1 
ATOM   1426 C  CA    . LEU A 1 212 ? -6.081  -9.317  19.570  1.00 16.36 ? 212  LEU A CA    1 
ATOM   1427 C  C     . LEU A 1 212 ? -5.238  -8.183  18.989  1.00 18.48 ? 212  LEU A C     1 
ATOM   1428 O  O     . LEU A 1 212 ? -5.261  -7.951  17.781  1.00 14.68 ? 212  LEU A O     1 
ATOM   1429 C  CB    . LEU A 1 212 ? -7.462  -8.810  20.000  1.00 16.18 ? 212  LEU A CB    1 
ATOM   1430 C  CG    . LEU A 1 212 ? -8.467  -9.918  20.333  1.00 17.77 ? 212  LEU A CG    1 
ATOM   1431 C  CD1   . LEU A 1 212 ? -9.804  -9.313  20.731  1.00 15.72 ? 212  LEU A CD1   1 
ATOM   1432 C  CD2   . LEU A 1 212 ? -8.632  -10.847 19.135  1.00 13.69 ? 212  LEU A CD2   1 
ATOM   1433 N  N     . SER A 1 213 ? -4.466  -7.506  19.840  1.00 16.78 ? 213  SER A N     1 
ATOM   1434 C  CA    . SER A 1 213 ? -3.602  -6.420  19.385  1.00 16.89 ? 213  SER A CA    1 
ATOM   1435 C  C     . SER A 1 213 ? -2.463  -6.933  18.503  1.00 15.41 ? 213  SER A C     1 
ATOM   1436 O  O     . SER A 1 213 ? -1.992  -6.220  17.616  1.00 19.76 ? 213  SER A O     1 
ATOM   1437 C  CB    . SER A 1 213 ? -3.040  -5.640  20.576  1.00 18.71 ? 213  SER A CB    1 
ATOM   1438 O  OG    . SER A 1 213 ? -4.051  -4.832  21.164  1.00 23.31 ? 213  SER A OG    1 
ATOM   1439 N  N     . HIS A 1 214 ? -2.018  -8.164  18.751  1.00 15.08 ? 214  HIS A N     1 
ATOM   1440 C  CA    . HIS A 1 214 ? -0.952  -8.762  17.947  1.00 16.90 ? 214  HIS A CA    1 
ATOM   1441 C  C     . HIS A 1 214 ? -1.435  -8.987  16.519  1.00 19.87 ? 214  HIS A C     1 
ATOM   1442 O  O     . HIS A 1 214 ? -0.638  -8.990  15.577  1.00 17.46 ? 214  HIS A O     1 
ATOM   1443 C  CB    . HIS A 1 214 ? -0.491  -10.100 18.540  1.00 14.30 ? 214  HIS A CB    1 
ATOM   1444 C  CG    . HIS A 1 214 ? 0.559   -9.963  19.599  1.00 17.56 ? 214  HIS A CG    1 
ATOM   1445 N  ND1   . HIS A 1 214 ? 1.757   -9.319  19.377  1.00 17.77 ? 214  HIS A ND1   1 
ATOM   1446 C  CD2   . HIS A 1 214 ? 0.589   -10.381 20.887  1.00 17.60 ? 214  HIS A CD2   1 
ATOM   1447 C  CE1   . HIS A 1 214 ? 2.481   -9.346  20.482  1.00 18.80 ? 214  HIS A CE1   1 
ATOM   1448 N  NE2   . HIS A 1 214 ? 1.795   -9.984  21.414  1.00 17.96 ? 214  HIS A NE2   1 
ATOM   1449 N  N     . LEU A 1 215 ? -2.743  -9.179  16.369  1.00 19.99 ? 215  LEU A N     1 
ATOM   1450 C  CA    . LEU A 1 215 ? -3.342  -9.414  15.057  1.00 22.96 ? 215  LEU A CA    1 
ATOM   1451 C  C     . LEU A 1 215 ? -3.535  -8.136  14.242  1.00 26.25 ? 215  LEU A C     1 
ATOM   1452 O  O     . LEU A 1 215 ? -3.838  -8.200  13.047  1.00 27.46 ? 215  LEU A O     1 
ATOM   1453 C  CB    . LEU A 1 215 ? -4.678  -10.153 15.205  1.00 21.07 ? 215  LEU A CB    1 
ATOM   1454 C  CG    . LEU A 1 215 ? -4.655  -11.444 16.026  1.00 21.59 ? 215  LEU A CG    1 
ATOM   1455 C  CD1   . LEU A 1 215 ? -6.000  -12.141 15.907  1.00 20.23 ? 215  LEU A CD1   1 
ATOM   1456 C  CD2   . LEU A 1 215 ? -3.535  -12.365 15.555  1.00 20.34 ? 215  LEU A CD2   1 
ATOM   1457 N  N     . ARG A 1 216 ? -3.396  -6.979  14.891  1.00 28.63 ? 216  ARG A N     1 
ATOM   1458 C  CA    . ARG A 1 216 ? -3.529  -5.689  14.205  1.00 32.36 ? 216  ARG A CA    1 
ATOM   1459 C  C     . ARG A 1 216 ? -2.155  -5.132  13.833  1.00 34.58 ? 216  ARG A C     1 
ATOM   1460 O  O     . ARG A 1 216 ? -1.197  -5.334  14.609  1.00 39.60 ? 216  ARG A O     1 
ATOM   1461 C  CB    . ARG A 1 216 ? -4.272  -4.662  15.068  1.00 32.49 ? 216  ARG A CB    1 
ATOM   1462 C  CG    . ARG A 1 216 ? -5.724  -5.000  15.383  1.00 31.65 ? 216  ARG A CG    1 
ATOM   1463 C  CD    . ARG A 1 216 ? -6.485  -3.762  15.867  1.00 30.33 ? 216  ARG A CD    1 
ATOM   1464 N  NE    . ARG A 1 216 ? -5.802  -3.068  16.960  1.00 30.85 ? 216  ARG A NE    1 
ATOM   1465 C  CZ    . ARG A 1 216 ? -5.846  -3.445  18.235  1.00 29.21 ? 216  ARG A CZ    1 
ATOM   1466 N  NH1   . ARG A 1 216 ? -6.545  -4.515  18.594  1.00 29.02 ? 216  ARG A NH1   1 
ATOM   1467 N  NH2   . ARG A 1 216 ? -5.180  -2.757  19.151  1.00 30.33 ? 216  ARG A NH2   1 
ATOM   1468 N  N     . GLU B 1 32  ? -47.085 -1.892  -3.348  1.00 54.53 ? 32   GLU B N     1 
ATOM   1469 C  CA    . GLU B 1 32  ? -46.999 -1.614  -4.812  1.00 53.78 ? 32   GLU B CA    1 
ATOM   1470 C  C     . GLU B 1 32  ? -46.947 -0.114  -5.101  1.00 50.48 ? 32   GLU B C     1 
ATOM   1471 O  O     . GLU B 1 32  ? -47.738 0.663   -4.561  1.00 52.38 ? 32   GLU B O     1 
ATOM   1472 C  CB    . GLU B 1 32  ? -48.196 -2.235  -5.544  1.00 56.57 ? 32   GLU B CB    1 
ATOM   1473 C  CG    . GLU B 1 32  ? -49.556 -1.691  -5.100  1.00 60.49 ? 32   GLU B CG    1 
ATOM   1474 C  CD    . GLU B 1 32  ? -50.710 -2.232  -5.924  1.00 63.37 ? 32   GLU B CD    1 
ATOM   1475 O  OE1   . GLU B 1 32  ? -50.721 -2.012  -7.156  1.00 64.81 ? 32   GLU B OE1   1 
ATOM   1476 O  OE2   . GLU B 1 32  ? -51.613 -2.870  -5.338  1.00 64.55 ? 32   GLU B OE2   1 
ATOM   1477 N  N     . VAL B 1 33  ? -45.989 0.292   -5.927  1.00 44.92 ? 33   VAL B N     1 
ATOM   1478 C  CA    . VAL B 1 33  ? -45.856 1.695   -6.296  1.00 39.97 ? 33   VAL B CA    1 
ATOM   1479 C  C     . VAL B 1 33  ? -46.478 1.898   -7.670  1.00 36.55 ? 33   VAL B C     1 
ATOM   1480 O  O     . VAL B 1 33  ? -46.450 0.996   -8.513  1.00 34.61 ? 33   VAL B O     1 
ATOM   1481 C  CB    . VAL B 1 33  ? -44.376 2.164   -6.328  1.00 37.68 ? 33   VAL B CB    1 
ATOM   1482 C  CG1   . VAL B 1 33  ? -43.760 2.062   -4.945  1.00 38.98 ? 33   VAL B CG1   1 
ATOM   1483 C  CG2   . VAL B 1 33  ? -43.577 1.347   -7.325  1.00 40.19 ? 33   VAL B CG2   1 
ATOM   1484 N  N     . ASP B 1 34  ? -47.063 3.072   -7.879  1.00 33.10 ? 34   ASP B N     1 
ATOM   1485 C  CA    . ASP B 1 34  ? -47.696 3.400   -9.153  1.00 30.86 ? 34   ASP B CA    1 
ATOM   1486 C  C     . ASP B 1 34  ? -46.614 3.809   -10.152 1.00 28.11 ? 34   ASP B C     1 
ATOM   1487 O  O     . ASP B 1 34  ? -46.261 4.983   -10.249 1.00 26.74 ? 34   ASP B O     1 
ATOM   1488 C  CB    . ASP B 1 34  ? -48.703 4.541   -8.954  1.00 31.66 ? 34   ASP B CB    1 
ATOM   1489 C  CG    . ASP B 1 34  ? -49.635 4.731   -10.148 1.00 33.37 ? 34   ASP B CG    1 
ATOM   1490 O  OD1   . ASP B 1 34  ? -49.259 4.396   -11.294 1.00 32.72 ? 34   ASP B OD1   1 
ATOM   1491 O  OD2   . ASP B 1 34  ? -50.758 5.234   -9.932  1.00 36.05 ? 34   ASP B OD2   1 
ATOM   1492 N  N     . LEU B 1 35  ? -46.097 2.830   -10.890 1.00 28.31 ? 35   LEU B N     1 
ATOM   1493 C  CA    . LEU B 1 35  ? -45.051 3.065   -11.884 1.00 30.00 ? 35   LEU B CA    1 
ATOM   1494 C  C     . LEU B 1 35  ? -45.495 4.018   -12.988 1.00 29.96 ? 35   LEU B C     1 
ATOM   1495 O  O     . LEU B 1 35  ? -44.698 4.809   -13.491 1.00 29.92 ? 35   LEU B O     1 
ATOM   1496 C  CB    . LEU B 1 35  ? -44.594 1.737   -12.496 1.00 31.15 ? 35   LEU B CB    1 
ATOM   1497 C  CG    . LEU B 1 35  ? -43.894 0.764   -11.543 1.00 31.91 ? 35   LEU B CG    1 
ATOM   1498 C  CD1   . LEU B 1 35  ? -43.609 -0.548  -12.249 1.00 34.35 ? 35   LEU B CD1   1 
ATOM   1499 C  CD2   . LEU B 1 35  ? -42.601 1.383   -11.035 1.00 32.75 ? 35   LEU B CD2   1 
ATOM   1500 N  N     . GLU B 1 36  ? -46.768 3.935   -13.362 1.00 30.43 ? 36   GLU B N     1 
ATOM   1501 C  CA    . GLU B 1 36  ? -47.313 4.798   -14.403 1.00 33.73 ? 36   GLU B CA    1 
ATOM   1502 C  C     . GLU B 1 36  ? -47.236 6.255   -13.965 1.00 30.46 ? 36   GLU B C     1 
ATOM   1503 O  O     . GLU B 1 36  ? -46.854 7.125   -14.749 1.00 31.20 ? 36   GLU B O     1 
ATOM   1504 C  CB    . GLU B 1 36  ? -48.764 4.414   -14.720 1.00 37.70 ? 36   GLU B CB    1 
ATOM   1505 C  CG    . GLU B 1 36  ? -48.946 2.960   -15.148 1.00 47.32 ? 36   GLU B CG    1 
ATOM   1506 C  CD    . GLU B 1 36  ? -48.066 2.575   -16.329 1.00 52.80 ? 36   GLU B CD    1 
ATOM   1507 O  OE1   . GLU B 1 36  ? -48.310 3.075   -17.449 1.00 55.28 ? 36   GLU B OE1   1 
ATOM   1508 O  OE2   . GLU B 1 36  ? -47.128 1.770   -16.136 1.00 55.81 ? 36   GLU B OE2   1 
ATOM   1509 N  N     . ARG B 1 37  ? -47.570 6.508   -12.701 1.00 29.97 ? 37   ARG B N     1 
ATOM   1510 C  CA    . ARG B 1 37  ? -47.528 7.861   -12.159 1.00 27.97 ? 37   ARG B CA    1 
ATOM   1511 C  C     . ARG B 1 37  ? -46.085 8.349   -12.027 1.00 27.97 ? 37   ARG B C     1 
ATOM   1512 O  O     . ARG B 1 37  ? -45.798 9.516   -12.288 1.00 25.87 ? 37   ARG B O     1 
ATOM   1513 C  CB    . ARG B 1 37  ? -48.250 7.931   -10.809 1.00 30.00 ? 37   ARG B CB    1 
ATOM   1514 C  CG    . ARG B 1 37  ? -48.403 9.343   -10.266 1.00 32.31 ? 37   ARG B CG    1 
ATOM   1515 C  CD    . ARG B 1 37  ? -49.162 10.225  -11.248 1.00 36.13 ? 37   ARG B CD    1 
ATOM   1516 N  NE    . ARG B 1 37  ? -49.230 11.613  -10.801 1.00 38.13 ? 37   ARG B NE    1 
ATOM   1517 C  CZ    . ARG B 1 37  ? -49.329 12.662  -11.614 1.00 40.78 ? 37   ARG B CZ    1 
ATOM   1518 N  NH1   . ARG B 1 37  ? -49.373 12.489  -12.931 1.00 42.43 ? 37   ARG B NH1   1 
ATOM   1519 N  NH2   . ARG B 1 37  ? -49.374 13.889  -11.111 1.00 39.35 ? 37   ARG B NH2   1 
ATOM   1520 N  N     . LEU B 1 38  ? -45.179 7.459   -11.621 1.00 27.24 ? 38   LEU B N     1 
ATOM   1521 C  CA    . LEU B 1 38  ? -43.767 7.828   -11.495 1.00 25.63 ? 38   LEU B CA    1 
ATOM   1522 C  C     . LEU B 1 38  ? -43.219 8.238   -12.862 1.00 23.94 ? 38   LEU B C     1 
ATOM   1523 O  O     . LEU B 1 38  ? -42.515 9.240   -12.979 1.00 23.86 ? 38   LEU B O     1 
ATOM   1524 C  CB    . LEU B 1 38  ? -42.941 6.673   -10.915 1.00 24.79 ? 38   LEU B CB    1 
ATOM   1525 C  CG    . LEU B 1 38  ? -43.106 6.370   -9.422  1.00 27.07 ? 38   LEU B CG    1 
ATOM   1526 C  CD1   . LEU B 1 38  ? -42.153 5.251   -9.011  1.00 25.42 ? 38   LEU B CD1   1 
ATOM   1527 C  CD2   . LEU B 1 38  ? -42.829 7.620   -8.601  1.00 27.22 ? 38   LEU B CD2   1 
ATOM   1528 N  N     . GLN B 1 39  ? -43.577 7.479   -13.895 1.00 23.88 ? 39   GLN B N     1 
ATOM   1529 C  CA    . GLN B 1 39  ? -43.141 7.772   -15.259 1.00 25.99 ? 39   GLN B CA    1 
ATOM   1530 C  C     . GLN B 1 39  ? -43.620 9.151   -15.706 1.00 26.09 ? 39   GLN B C     1 
ATOM   1531 O  O     . GLN B 1 39  ? -42.861 9.911   -16.311 1.00 23.81 ? 39   GLN B O     1 
ATOM   1532 C  CB    . GLN B 1 39  ? -43.660 6.710   -16.230 1.00 31.01 ? 39   GLN B CB    1 
ATOM   1533 C  CG    . GLN B 1 39  ? -42.962 5.368   -16.108 1.00 34.34 ? 39   GLN B CG    1 
ATOM   1534 C  CD    . GLN B 1 39  ? -43.540 4.309   -17.030 1.00 37.18 ? 39   GLN B CD    1 
ATOM   1535 O  OE1   . GLN B 1 39  ? -43.637 3.139   -16.661 1.00 38.37 ? 39   GLN B OE1   1 
ATOM   1536 N  NE2   . GLN B 1 39  ? -43.919 4.713   -18.236 1.00 37.90 ? 39   GLN B NE2   1 
ATOM   1537 N  N     . ALA B 1 40  ? -44.876 9.471   -15.396 1.00 26.13 ? 40   ALA B N     1 
ATOM   1538 C  CA    . ALA B 1 40  ? -45.456 10.765  -15.754 1.00 26.01 ? 40   ALA B CA    1 
ATOM   1539 C  C     . ALA B 1 40  ? -44.698 11.890  -15.061 1.00 23.52 ? 40   ALA B C     1 
ATOM   1540 O  O     . ALA B 1 40  ? -44.352 12.894  -15.684 1.00 25.71 ? 40   ALA B O     1 
ATOM   1541 C  CB    . ALA B 1 40  ? -46.935 10.809  -15.370 1.00 28.24 ? 40   ALA B CB    1 
ATOM   1542 N  N     . LEU B 1 41  ? -44.414 11.701  -13.775 1.00 22.43 ? 41   LEU B N     1 
ATOM   1543 C  CA    . LEU B 1 41  ? -43.685 12.693  -12.994 1.00 22.36 ? 41   LEU B CA    1 
ATOM   1544 C  C     . LEU B 1 41  ? -42.260 12.880  -13.520 1.00 22.32 ? 41   LEU B C     1 
ATOM   1545 O  O     . LEU B 1 41  ? -41.769 14.007  -13.613 1.00 19.51 ? 41   LEU B O     1 
ATOM   1546 C  CB    . LEU B 1 41  ? -43.653 12.285  -11.518 1.00 24.46 ? 41   LEU B CB    1 
ATOM   1547 C  CG    . LEU B 1 41  ? -44.986 12.278  -10.762 1.00 27.38 ? 41   LEU B CG    1 
ATOM   1548 C  CD1   . LEU B 1 41  ? -44.800 11.657  -9.388  1.00 26.22 ? 41   LEU B CD1   1 
ATOM   1549 C  CD2   . LEU B 1 41  ? -45.529 13.689  -10.641 1.00 26.84 ? 41   LEU B CD2   1 
ATOM   1550 N  N     . ALA B 1 42  ? -41.608 11.770  -13.864 1.00 23.48 ? 42   ALA B N     1 
ATOM   1551 C  CA    . ALA B 1 42  ? -40.241 11.796  -14.387 1.00 23.32 ? 42   ALA B CA    1 
ATOM   1552 C  C     . ALA B 1 42  ? -40.185 12.480  -15.755 1.00 22.73 ? 42   ALA B C     1 
ATOM   1553 O  O     . ALA B 1 42  ? -39.240 13.216  -16.058 1.00 21.80 ? 42   ALA B O     1 
ATOM   1554 C  CB    . ALA B 1 42  ? -39.686 10.376  -14.478 1.00 23.32 ? 42   ALA B CB    1 
ATOM   1555 N  N     . ALA B 1 43  ? -41.202 12.237  -16.577 1.00 22.98 ? 43   ALA B N     1 
ATOM   1556 C  CA    . ALA B 1 43  ? -41.270 12.844  -17.906 1.00 23.71 ? 43   ALA B CA    1 
ATOM   1557 C  C     . ALA B 1 43  ? -41.376 14.359  -17.777 1.00 23.61 ? 43   ALA B C     1 
ATOM   1558 O  O     . ALA B 1 43  ? -40.715 15.102  -18.506 1.00 23.27 ? 43   ALA B O     1 
ATOM   1559 C  CB    . ALA B 1 43  ? -42.457 12.292  -18.684 1.00 21.05 ? 43   ALA B CB    1 
ATOM   1560 N  N     . GLU B 1 44  ? -42.190 14.816  -16.826 1.00 26.40 ? 44   GLU B N     1 
ATOM   1561 C  CA    . GLU B 1 44  ? -42.363 16.247  -16.606 1.00 26.66 ? 44   GLU B CA    1 
ATOM   1562 C  C     . GLU B 1 44  ? -41.099 16.834  -15.985 1.00 25.68 ? 44   GLU B C     1 
ATOM   1563 O  O     . GLU B 1 44  ? -40.762 17.996  -16.221 1.00 25.64 ? 44   GLU B O     1 
ATOM   1564 C  CB    . GLU B 1 44  ? -43.580 16.525  -15.715 1.00 31.80 ? 44   GLU B CB    1 
ATOM   1565 C  CG    . GLU B 1 44  ? -44.060 17.975  -15.787 1.00 37.36 ? 44   GLU B CG    1 
ATOM   1566 C  CD    . GLU B 1 44  ? -45.284 18.256  -14.927 1.00 39.84 ? 44   GLU B CD    1 
ATOM   1567 O  OE1   . GLU B 1 44  ? -46.193 17.398  -14.859 1.00 37.81 ? 44   GLU B OE1   1 
ATOM   1568 O  OE2   . GLU B 1 44  ? -45.337 19.348  -14.321 1.00 41.21 ? 44   GLU B OE2   1 
ATOM   1569 N  N     . TRP B 1 45  ? -40.391 16.019  -15.204 1.00 24.64 ? 45   TRP B N     1 
ATOM   1570 C  CA    . TRP B 1 45  ? -39.154 16.448  -14.561 1.00 23.27 ? 45   TRP B CA    1 
ATOM   1571 C  C     . TRP B 1 45  ? -38.143 16.795  -15.649 1.00 20.34 ? 45   TRP B C     1 
ATOM   1572 O  O     . TRP B 1 45  ? -37.470 17.821  -15.577 1.00 16.82 ? 45   TRP B O     1 
ATOM   1573 C  CB    . TRP B 1 45  ? -38.602 15.328  -13.671 1.00 23.47 ? 45   TRP B CB    1 
ATOM   1574 C  CG    . TRP B 1 45  ? -37.493 15.760  -12.760 1.00 26.05 ? 45   TRP B CG    1 
ATOM   1575 C  CD1   . TRP B 1 45  ? -36.150 15.688  -13.007 1.00 25.11 ? 45   TRP B CD1   1 
ATOM   1576 C  CD2   . TRP B 1 45  ? -37.630 16.309  -11.443 1.00 26.64 ? 45   TRP B CD2   1 
ATOM   1577 N  NE1   . TRP B 1 45  ? -35.444 16.157  -11.924 1.00 25.74 ? 45   TRP B NE1   1 
ATOM   1578 C  CE2   . TRP B 1 45  ? -36.327 16.545  -10.951 1.00 26.31 ? 45   TRP B CE2   1 
ATOM   1579 C  CE3   . TRP B 1 45  ? -38.729 16.624  -10.630 1.00 24.49 ? 45   TRP B CE3   1 
ATOM   1580 C  CZ2   . TRP B 1 45  ? -36.091 17.084  -9.678  1.00 27.46 ? 45   TRP B CZ2   1 
ATOM   1581 C  CZ3   . TRP B 1 45  ? -38.493 17.161  -9.362  1.00 26.57 ? 45   TRP B CZ3   1 
ATOM   1582 C  CH2   . TRP B 1 45  ? -37.183 17.384  -8.902  1.00 25.53 ? 45   TRP B CH2   1 
ATOM   1583 N  N     . LEU B 1 46  ? -38.070 15.943  -16.670 1.00 23.09 ? 46   LEU B N     1 
ATOM   1584 C  CA    . LEU B 1 46  ? -37.160 16.150  -17.796 1.00 23.00 ? 46   LEU B CA    1 
ATOM   1585 C  C     . LEU B 1 46  ? -37.474 17.467  -18.505 1.00 23.31 ? 46   LEU B C     1 
ATOM   1586 O  O     . LEU B 1 46  ? -36.567 18.201  -18.893 1.00 23.53 ? 46   LEU B O     1 
ATOM   1587 C  CB    . LEU B 1 46  ? -37.259 14.993  -18.788 1.00 22.64 ? 46   LEU B CB    1 
ATOM   1588 C  CG    . LEU B 1 46  ? -36.781 13.614  -18.317 1.00 22.46 ? 46   LEU B CG    1 
ATOM   1589 C  CD1   . LEU B 1 46  ? -37.047 12.583  -19.395 1.00 22.98 ? 46   LEU B CD1   1 
ATOM   1590 C  CD2   . LEU B 1 46  ? -35.306 13.658  -17.971 1.00 24.11 ? 46   LEU B CD2   1 
ATOM   1591 N  N     . GLN B 1 47  ? -38.760 17.764  -18.657 1.00 25.00 ? 47   GLN B N     1 
ATOM   1592 C  CA    . GLN B 1 47  ? -39.187 19.001  -19.308 1.00 28.06 ? 47   GLN B CA    1 
ATOM   1593 C  C     . GLN B 1 47  ? -38.802 20.236  -18.503 1.00 26.50 ? 47   GLN B C     1 
ATOM   1594 O  O     . GLN B 1 47  ? -38.198 21.164  -19.035 1.00 27.38 ? 47   GLN B O     1 
ATOM   1595 C  CB    . GLN B 1 47  ? -40.702 19.010  -19.535 1.00 32.60 ? 47   GLN B CB    1 
ATOM   1596 C  CG    . GLN B 1 47  ? -41.184 18.131  -20.673 1.00 41.30 ? 47   GLN B CG    1 
ATOM   1597 C  CD    . GLN B 1 47  ? -42.532 18.571  -21.228 1.00 47.40 ? 47   GLN B CD    1 
ATOM   1598 O  OE1   . GLN B 1 47  ? -43.276 17.767  -21.793 1.00 49.08 ? 47   GLN B OE1   1 
ATOM   1599 N  NE2   . GLN B 1 47  ? -42.844 19.857  -21.082 1.00 48.23 ? 47   GLN B NE2   1 
ATOM   1600 N  N     . VAL B 1 48  ? -39.118 20.222  -17.210 1.00 26.41 ? 48   VAL B N     1 
ATOM   1601 C  CA    . VAL B 1 48  ? -38.834 21.354  -16.329 1.00 27.34 ? 48   VAL B CA    1 
ATOM   1602 C  C     . VAL B 1 48  ? -37.354 21.688  -16.153 1.00 27.80 ? 48   VAL B C     1 
ATOM   1603 O  O     . VAL B 1 48  ? -36.995 22.864  -16.079 1.00 25.46 ? 48   VAL B O     1 
ATOM   1604 C  CB    . VAL B 1 48  ? -39.500 21.168  -14.945 1.00 27.51 ? 48   VAL B CB    1 
ATOM   1605 C  CG1   . VAL B 1 48  ? -39.223 22.369  -14.050 1.00 28.64 ? 48   VAL B CG1   1 
ATOM   1606 C  CG2   . VAL B 1 48  ? -40.992 20.982  -15.116 1.00 25.43 ? 48   VAL B CG2   1 
ATOM   1607 N  N     . ILE B 1 49  ? -36.494 20.671  -16.100 1.00 27.54 ? 49   ILE B N     1 
ATOM   1608 C  CA    . ILE B 1 49  ? -35.062 20.921  -15.934 1.00 28.86 ? 49   ILE B CA    1 
ATOM   1609 C  C     . ILE B 1 49  ? -34.396 21.487  -17.186 1.00 29.92 ? 49   ILE B C     1 
ATOM   1610 O  O     . ILE B 1 49  ? -33.231 21.885  -17.147 1.00 31.39 ? 49   ILE B O     1 
ATOM   1611 C  CB    . ILE B 1 49  ? -34.291 19.671  -15.428 1.00 29.32 ? 49   ILE B CB    1 
ATOM   1612 C  CG1   . ILE B 1 49  ? -34.472 18.492  -16.386 1.00 29.44 ? 49   ILE B CG1   1 
ATOM   1613 C  CG2   . ILE B 1 49  ? -34.749 19.315  -14.021 1.00 29.06 ? 49   ILE B CG2   1 
ATOM   1614 C  CD1   . ILE B 1 49  ? -33.685 17.256  -15.989 1.00 31.01 ? 49   ILE B CD1   1 
ATOM   1615 N  N     . GLY B 1 50  ? -35.140 21.525  -18.289 1.00 30.65 ? 50   GLY B N     1 
ATOM   1616 C  CA    . GLY B 1 50  ? -34.608 22.072  -19.525 1.00 32.61 ? 50   GLY B CA    1 
ATOM   1617 C  C     . GLY B 1 50  ? -34.289 21.077  -20.625 1.00 33.11 ? 50   GLY B C     1 
ATOM   1618 O  O     . GLY B 1 50  ? -33.884 21.475  -21.715 1.00 34.20 ? 50   GLY B O     1 
ATOM   1619 N  N     . GLU B 1 51  ? -34.476 19.791  -20.352 1.00 33.18 ? 51   GLU B N     1 
ATOM   1620 C  CA    . GLU B 1 51  ? -34.194 18.750  -21.337 1.00 31.27 ? 51   GLU B CA    1 
ATOM   1621 C  C     . GLU B 1 51  ? -35.340 18.455  -22.296 1.00 33.19 ? 51   GLU B C     1 
ATOM   1622 O  O     . GLU B 1 51  ? -36.456 18.952  -22.128 1.00 34.37 ? 51   GLU B O     1 
ATOM   1623 C  CB    . GLU B 1 51  ? -33.761 17.458  -20.636 1.00 29.99 ? 51   GLU B CB    1 
ATOM   1624 C  CG    . GLU B 1 51  ? -32.250 17.277  -20.544 1.00 26.40 ? 51   GLU B CG    1 
ATOM   1625 C  CD    . GLU B 1 51  ? -31.602 16.887  -21.871 1.00 27.87 ? 51   GLU B CD    1 
ATOM   1626 O  OE1   . GLU B 1 51  ? -32.305 16.789  -22.900 1.00 24.16 ? 51   GLU B OE1   1 
ATOM   1627 O  OE2   . GLU B 1 51  ? -30.374 16.666  -21.885 1.00 25.43 ? 51   GLU B OE2   1 
ATOM   1628 N  N     . ASP B 1 52  ? -35.044 17.643  -23.309 1.00 33.21 ? 52   ASP B N     1 
ATOM   1629 C  CA    . ASP B 1 52  ? -36.022 17.245  -24.314 1.00 33.24 ? 52   ASP B CA    1 
ATOM   1630 C  C     . ASP B 1 52  ? -36.417 15.780  -24.116 1.00 33.12 ? 52   ASP B C     1 
ATOM   1631 O  O     . ASP B 1 52  ? -35.662 14.871  -24.462 1.00 32.75 ? 52   ASP B O     1 
ATOM   1632 C  CB    . ASP B 1 52  ? -35.446 17.458  -25.723 1.00 33.87 ? 52   ASP B CB    1 
ATOM   1633 C  CG    . ASP B 1 52  ? -36.377 16.967  -26.828 1.00 35.15 ? 52   ASP B CG    1 
ATOM   1634 O  OD1   . ASP B 1 52  ? -37.592 16.813  -26.581 1.00 34.02 ? 52   ASP B OD1   1 
ATOM   1635 O  OD2   . ASP B 1 52  ? -35.886 16.732  -27.953 1.00 37.94 ? 52   ASP B OD2   1 
ATOM   1636 N  N     . PRO B 1 53  ? -37.626 15.537  -23.582 1.00 34.35 ? 53   PRO B N     1 
ATOM   1637 C  CA    . PRO B 1 53  ? -38.141 14.186  -23.333 1.00 35.80 ? 53   PRO B CA    1 
ATOM   1638 C  C     . PRO B 1 53  ? -38.261 13.356  -24.608 1.00 36.70 ? 53   PRO B C     1 
ATOM   1639 O  O     . PRO B 1 53  ? -38.407 12.133  -24.549 1.00 36.77 ? 53   PRO B O     1 
ATOM   1640 C  CB    . PRO B 1 53  ? -39.515 14.457  -22.722 1.00 36.87 ? 53   PRO B CB    1 
ATOM   1641 C  CG    . PRO B 1 53  ? -39.327 15.766  -22.044 1.00 36.50 ? 53   PRO B CG    1 
ATOM   1642 C  CD    . PRO B 1 53  ? -38.570 16.548  -23.079 1.00 35.20 ? 53   PRO B CD    1 
ATOM   1643 N  N     . GLY B 1 54  ? -38.195 14.033  -25.753 1.00 38.63 ? 54   GLY B N     1 
ATOM   1644 C  CA    . GLY B 1 54  ? -38.296 13.367  -27.038 1.00 38.23 ? 54   GLY B CA    1 
ATOM   1645 C  C     . GLY B 1 54  ? -36.985 12.817  -27.575 1.00 38.78 ? 54   GLY B C     1 
ATOM   1646 O  O     . GLY B 1 54  ? -36.995 12.046  -28.539 1.00 37.47 ? 54   GLY B O     1 
ATOM   1647 N  N     . ARG B 1 55  ? -35.863 13.220  -26.973 1.00 37.17 ? 55   ARG B N     1 
ATOM   1648 C  CA    . ARG B 1 55  ? -34.535 12.754  -27.387 1.00 38.48 ? 55   ARG B CA    1 
ATOM   1649 C  C     . ARG B 1 55  ? -34.475 11.236  -27.419 1.00 40.55 ? 55   ARG B C     1 
ATOM   1650 O  O     . ARG B 1 55  ? -35.165 10.570  -26.644 1.00 39.14 ? 55   ARG B O     1 
ATOM   1651 C  CB    . ARG B 1 55  ? -33.446 13.223  -26.410 1.00 36.80 ? 55   ARG B CB    1 
ATOM   1652 C  CG    . ARG B 1 55  ? -33.102 14.686  -26.471 1.00 37.69 ? 55   ARG B CG    1 
ATOM   1653 C  CD    . ARG B 1 55  ? -31.638 14.923  -26.113 1.00 30.96 ? 55   ARG B CD    1 
ATOM   1654 N  NE    . ARG B 1 55  ? -31.333 14.804  -24.687 1.00 27.68 ? 55   ARG B NE    1 
ATOM   1655 C  CZ    . ARG B 1 55  ? -30.570 13.851  -24.157 1.00 26.41 ? 55   ARG B CZ    1 
ATOM   1656 N  NH1   . ARG B 1 55  ? -30.043 12.907  -24.926 1.00 23.04 ? 55   ARG B NH1   1 
ATOM   1657 N  NH2   . ARG B 1 55  ? -30.256 13.894  -22.869 1.00 23.29 ? 55   ARG B NH2   1 
ATOM   1658 N  N     . GLU B 1 56  ? -33.618 10.698  -28.287 1.00 40.18 ? 56   GLU B N     1 
ATOM   1659 C  CA    . GLU B 1 56  ? -33.437 9.253   -28.394 1.00 41.94 ? 56   GLU B CA    1 
ATOM   1660 C  C     . GLU B 1 56  ? -33.085 8.680   -27.027 1.00 38.66 ? 56   GLU B C     1 
ATOM   1661 O  O     . GLU B 1 56  ? -33.767 7.791   -26.522 1.00 39.54 ? 56   GLU B O     1 
ATOM   1662 C  CB    . GLU B 1 56  ? -32.288 8.912   -29.345 1.00 44.81 ? 56   GLU B CB    1 
ATOM   1663 C  CG    . GLU B 1 56  ? -32.604 8.968   -30.820 1.00 50.79 ? 56   GLU B CG    1 
ATOM   1664 C  CD    . GLU B 1 56  ? -31.458 8.423   -31.658 1.00 54.31 ? 56   GLU B CD    1 
ATOM   1665 O  OE1   . GLU B 1 56  ? -31.390 7.188   -31.846 1.00 55.63 ? 56   GLU B OE1   1 
ATOM   1666 O  OE2   . GLU B 1 56  ? -30.614 9.226   -32.112 1.00 56.05 ? 56   GLU B OE2   1 
ATOM   1667 N  N     . GLY B 1 57  ? -32.029 9.231   -26.432 1.00 35.91 ? 57   GLY B N     1 
ATOM   1668 C  CA    . GLY B 1 57  ? -31.551 8.775   -25.138 1.00 33.35 ? 57   GLY B CA    1 
ATOM   1669 C  C     . GLY B 1 57  ? -32.428 9.015   -23.923 1.00 31.53 ? 57   GLY B C     1 
ATOM   1670 O  O     . GLY B 1 57  ? -32.115 8.517   -22.841 1.00 29.90 ? 57   GLY B O     1 
ATOM   1671 N  N     . LEU B 1 58  ? -33.508 9.778   -24.082 1.00 27.99 ? 58   LEU B N     1 
ATOM   1672 C  CA    . LEU B 1 58  ? -34.409 10.059  -22.964 1.00 26.45 ? 58   LEU B CA    1 
ATOM   1673 C  C     . LEU B 1 58  ? -35.779 9.408   -23.101 1.00 25.19 ? 58   LEU B C     1 
ATOM   1674 O  O     . LEU B 1 58  ? -36.562 9.412   -22.156 1.00 22.26 ? 58   LEU B O     1 
ATOM   1675 C  CB    . LEU B 1 58  ? -34.581 11.569  -22.766 1.00 23.68 ? 58   LEU B CB    1 
ATOM   1676 C  CG    . LEU B 1 58  ? -33.382 12.355  -22.236 1.00 24.45 ? 58   LEU B CG    1 
ATOM   1677 C  CD1   . LEU B 1 58  ? -33.764 13.820  -22.093 1.00 24.14 ? 58   LEU B CD1   1 
ATOM   1678 C  CD2   . LEU B 1 58  ? -32.937 11.790  -20.886 1.00 25.17 ? 58   LEU B CD2   1 
ATOM   1679 N  N     . LEU B 1 59  ? -36.060 8.834   -24.267 1.00 27.85 ? 59   LEU B N     1 
ATOM   1680 C  CA    . LEU B 1 59  ? -37.349 8.191   -24.514 1.00 30.46 ? 59   LEU B CA    1 
ATOM   1681 C  C     . LEU B 1 59  ? -37.768 7.174   -23.457 1.00 29.91 ? 59   LEU B C     1 
ATOM   1682 O  O     . LEU B 1 59  ? -38.911 7.193   -22.997 1.00 26.80 ? 59   LEU B O     1 
ATOM   1683 C  CB    . LEU B 1 59  ? -37.375 7.546   -25.902 1.00 35.36 ? 59   LEU B CB    1 
ATOM   1684 C  CG    . LEU B 1 59  ? -37.480 8.509   -27.087 1.00 39.58 ? 59   LEU B CG    1 
ATOM   1685 C  CD1   . LEU B 1 59  ? -37.430 7.736   -28.395 1.00 42.88 ? 59   LEU B CD1   1 
ATOM   1686 C  CD2   . LEU B 1 59  ? -38.769 9.312   -26.990 1.00 42.24 ? 59   LEU B CD2   1 
ATOM   1687 N  N     . LYS B 1 60  ? -36.846 6.295   -23.068 1.00 29.20 ? 60   LYS B N     1 
ATOM   1688 C  CA    . LYS B 1 60  ? -37.145 5.276   -22.065 1.00 29.78 ? 60   LYS B CA    1 
ATOM   1689 C  C     . LYS B 1 60  ? -36.689 5.637   -20.651 1.00 27.36 ? 60   LYS B C     1 
ATOM   1690 O  O     . LYS B 1 60  ? -36.788 4.814   -19.739 1.00 26.70 ? 60   LYS B O     1 
ATOM   1691 C  CB    . LYS B 1 60  ? -36.546 3.928   -22.472 1.00 33.76 ? 60   LYS B CB    1 
ATOM   1692 C  CG    . LYS B 1 60  ? -37.191 3.297   -23.698 1.00 41.18 ? 60   LYS B CG    1 
ATOM   1693 C  CD    . LYS B 1 60  ? -36.639 1.899   -23.939 1.00 45.86 ? 60   LYS B CD    1 
ATOM   1694 C  CE    . LYS B 1 60  ? -37.313 1.225   -25.126 1.00 48.93 ? 60   LYS B CE    1 
ATOM   1695 N  NZ    . LYS B 1 60  ? -36.779 -0.148  -25.358 1.00 48.93 ? 60   LYS B NZ    1 
ATOM   1696 N  N     . THR B 1 61  ? -36.214 6.868   -20.468 1.00 24.64 ? 61   THR B N     1 
ATOM   1697 C  CA    . THR B 1 61  ? -35.743 7.326   -19.163 1.00 22.89 ? 61   THR B CA    1 
ATOM   1698 C  C     . THR B 1 61  ? -36.834 7.358   -18.092 1.00 24.64 ? 61   THR B C     1 
ATOM   1699 O  O     . THR B 1 61  ? -36.611 6.895   -16.973 1.00 24.24 ? 61   THR B O     1 
ATOM   1700 C  CB    . THR B 1 61  ? -35.005 8.682   -19.273 1.00 21.70 ? 61   THR B CB    1 
ATOM   1701 O  OG1   . THR B 1 61  ? -33.790 8.487   -20.007 1.00 24.47 ? 61   THR B OG1   1 
ATOM   1702 C  CG2   . THR B 1 61  ? -34.669 9.253   -17.897 1.00 19.67 ? 61   THR B CG2   1 
ATOM   1703 N  N     . PRO B 1 62  ? -38.034 7.885   -18.416 1.00 23.42 ? 62   PRO B N     1 
ATOM   1704 C  CA    . PRO B 1 62  ? -39.089 7.913   -17.396 1.00 23.26 ? 62   PRO B CA    1 
ATOM   1705 C  C     . PRO B 1 62  ? -39.392 6.504   -16.871 1.00 24.49 ? 62   PRO B C     1 
ATOM   1706 O  O     . PRO B 1 62  ? -39.557 6.300   -15.664 1.00 26.65 ? 62   PRO B O     1 
ATOM   1707 C  CB    . PRO B 1 62  ? -40.277 8.501   -18.158 1.00 24.19 ? 62   PRO B CB    1 
ATOM   1708 C  CG    . PRO B 1 62  ? -39.609 9.450   -19.116 1.00 23.65 ? 62   PRO B CG    1 
ATOM   1709 C  CD    . PRO B 1 62  ? -38.467 8.599   -19.632 1.00 23.84 ? 62   PRO B CD    1 
ATOM   1710 N  N     . GLU B 1 63  ? -39.421 5.534   -17.783 1.00 22.37 ? 63   GLU B N     1 
ATOM   1711 C  CA    . GLU B 1 63  ? -39.687 4.139   -17.436 1.00 24.50 ? 63   GLU B CA    1 
ATOM   1712 C  C     . GLU B 1 63  ? -38.545 3.569   -16.588 1.00 22.41 ? 63   GLU B C     1 
ATOM   1713 O  O     . GLU B 1 63  ? -38.781 2.872   -15.595 1.00 22.11 ? 63   GLU B O     1 
ATOM   1714 C  CB    . GLU B 1 63  ? -39.858 3.304   -18.709 1.00 26.81 ? 63   GLU B CB    1 
ATOM   1715 C  CG    . GLU B 1 63  ? -40.214 1.843   -18.462 1.00 32.48 ? 63   GLU B CG    1 
ATOM   1716 C  CD    . GLU B 1 63  ? -40.183 0.999   -19.732 1.00 36.86 ? 63   GLU B CD    1 
ATOM   1717 O  OE1   . GLU B 1 63  ? -40.541 1.514   -20.815 1.00 40.69 ? 63   GLU B OE1   1 
ATOM   1718 O  OE2   . GLU B 1 63  ? -39.800 -0.187  -19.642 1.00 39.52 ? 63   GLU B OE2   1 
ATOM   1719 N  N     . ARG B 1 64  ? -37.312 3.870   -16.986 1.00 21.79 ? 64   ARG B N     1 
ATOM   1720 C  CA    . ARG B 1 64  ? -36.131 3.404   -16.257 1.00 22.57 ? 64   ARG B CA    1 
ATOM   1721 C  C     . ARG B 1 64  ? -36.073 4.007   -14.854 1.00 23.22 ? 64   ARG B C     1 
ATOM   1722 O  O     . ARG B 1 64  ? -35.754 3.312   -13.889 1.00 24.04 ? 64   ARG B O     1 
ATOM   1723 C  CB    . ARG B 1 64  ? -34.854 3.744   -17.028 1.00 20.86 ? 64   ARG B CB    1 
ATOM   1724 C  CG    . ARG B 1 64  ? -34.614 2.863   -18.238 1.00 21.06 ? 64   ARG B CG    1 
ATOM   1725 C  CD    . ARG B 1 64  ? -33.299 3.190   -18.920 1.00 21.49 ? 64   ARG B CD    1 
ATOM   1726 N  NE    . ARG B 1 64  ? -33.319 4.481   -19.605 1.00 26.34 ? 64   ARG B NE    1 
ATOM   1727 C  CZ    . ARG B 1 64  ? -33.148 4.637   -20.916 1.00 26.70 ? 64   ARG B CZ    1 
ATOM   1728 N  NH1   . ARG B 1 64  ? -32.943 3.580   -21.694 1.00 26.54 ? 64   ARG B NH1   1 
ATOM   1729 N  NH2   . ARG B 1 64  ? -33.181 5.852   -21.452 1.00 24.85 ? 64   ARG B NH2   1 
ATOM   1730 N  N     . VAL B 1 65  ? -36.376 5.301   -14.756 1.00 21.13 ? 65   VAL B N     1 
ATOM   1731 C  CA    . VAL B 1 65  ? -36.375 6.014   -13.481 1.00 21.22 ? 65   VAL B CA    1 
ATOM   1732 C  C     . VAL B 1 65  ? -37.459 5.480   -12.543 1.00 23.81 ? 65   VAL B C     1 
ATOM   1733 O  O     . VAL B 1 65  ? -37.222 5.302   -11.340 1.00 21.49 ? 65   VAL B O     1 
ATOM   1734 C  CB    . VAL B 1 65  ? -36.556 7.540   -13.694 1.00 21.61 ? 65   VAL B CB    1 
ATOM   1735 C  CG1   . VAL B 1 65  ? -36.764 8.248   -12.363 1.00 23.95 ? 65   VAL B CG1   1 
ATOM   1736 C  CG2   . VAL B 1 65  ? -35.334 8.111   -14.388 1.00 19.45 ? 65   VAL B CG2   1 
ATOM   1737 N  N     . ALA B 1 66  ? -38.637 5.200   -13.099 1.00 20.92 ? 66   ALA B N     1 
ATOM   1738 C  CA    . ALA B 1 66  ? -39.749 4.667   -12.318 1.00 24.01 ? 66   ALA B CA    1 
ATOM   1739 C  C     . ALA B 1 66  ? -39.360 3.337   -11.659 1.00 22.77 ? 66   ALA B C     1 
ATOM   1740 O  O     . ALA B 1 66  ? -39.516 3.169   -10.450 1.00 22.78 ? 66   ALA B O     1 
ATOM   1741 C  CB    . ALA B 1 66  ? -40.976 4.477   -13.209 1.00 24.14 ? 66   ALA B CB    1 
ATOM   1742 N  N     . LYS B 1 67  ? -38.838 2.412   -12.465 1.00 21.28 ? 67   LYS B N     1 
ATOM   1743 C  CA    . LYS B 1 67  ? -38.412 1.095   -11.993 1.00 23.88 ? 67   LYS B CA    1 
ATOM   1744 C  C     . LYS B 1 67  ? -37.278 1.187   -10.978 1.00 22.54 ? 67   LYS B C     1 
ATOM   1745 O  O     . LYS B 1 67  ? -37.254 0.439   -10.004 1.00 23.84 ? 67   LYS B O     1 
ATOM   1746 C  CB    . LYS B 1 67  ? -37.968 0.218   -13.169 1.00 26.03 ? 67   LYS B CB    1 
ATOM   1747 C  CG    . LYS B 1 67  ? -39.098 -0.213  -14.099 1.00 33.85 ? 67   LYS B CG    1 
ATOM   1748 C  CD    . LYS B 1 67  ? -38.581 -1.024  -15.283 1.00 38.47 ? 67   LYS B CD    1 
ATOM   1749 C  CE    . LYS B 1 67  ? -37.625 -0.204  -16.153 1.00 45.90 ? 67   LYS B CE    1 
ATOM   1750 N  NZ    . LYS B 1 67  ? -37.123 -0.959  -17.341 1.00 48.64 ? 67   LYS B NZ    1 
ATOM   1751 N  N     . ALA B 1 68  ? -36.337 2.097   -11.223 1.00 22.51 ? 68   ALA B N     1 
ATOM   1752 C  CA    . ALA B 1 68  ? -35.195 2.293   -10.330 1.00 21.34 ? 68   ALA B CA    1 
ATOM   1753 C  C     . ALA B 1 68  ? -35.640 2.727   -8.942  1.00 23.73 ? 68   ALA B C     1 
ATOM   1754 O  O     . ALA B 1 68  ? -35.201 2.162   -7.935  1.00 21.66 ? 68   ALA B O     1 
ATOM   1755 C  CB    . ALA B 1 68  ? -34.241 3.319   -10.915 1.00 19.99 ? 68   ALA B CB    1 
ATOM   1756 N  N     . TRP B 1 69  ? -36.521 3.723   -8.888  1.00 22.90 ? 69   TRP B N     1 
ATOM   1757 C  CA    . TRP B 1 69  ? -37.009 4.221   -7.611  1.00 23.07 ? 69   TRP B CA    1 
ATOM   1758 C  C     . TRP B 1 69  ? -37.884 3.229   -6.861  1.00 21.76 ? 69   TRP B C     1 
ATOM   1759 O  O     . TRP B 1 69  ? -37.908 3.229   -5.628  1.00 22.79 ? 69   TRP B O     1 
ATOM   1760 C  CB    . TRP B 1 69  ? -37.677 5.587   -7.776  1.00 21.25 ? 69   TRP B CB    1 
ATOM   1761 C  CG    . TRP B 1 69  ? -36.659 6.685   -7.790  1.00 19.30 ? 69   TRP B CG    1 
ATOM   1762 C  CD1   . TRP B 1 69  ? -35.956 7.143   -8.870  1.00 20.72 ? 69   TRP B CD1   1 
ATOM   1763 C  CD2   . TRP B 1 69  ? -36.174 7.416   -6.654  1.00 21.50 ? 69   TRP B CD2   1 
ATOM   1764 N  NE1   . TRP B 1 69  ? -35.058 8.110   -8.474  1.00 24.19 ? 69   TRP B NE1   1 
ATOM   1765 C  CE2   . TRP B 1 69  ? -35.171 8.297   -7.121  1.00 21.13 ? 69   TRP B CE2   1 
ATOM   1766 C  CE3   . TRP B 1 69  ? -36.487 7.408   -5.286  1.00 20.71 ? 69   TRP B CE3   1 
ATOM   1767 C  CZ2   . TRP B 1 69  ? -34.478 9.165   -6.267  1.00 21.67 ? 69   TRP B CZ2   1 
ATOM   1768 C  CZ3   . TRP B 1 69  ? -35.799 8.272   -4.437  1.00 23.11 ? 69   TRP B CZ3   1 
ATOM   1769 C  CH2   . TRP B 1 69  ? -34.805 9.138   -4.932  1.00 22.85 ? 69   TRP B CH2   1 
ATOM   1770 N  N     . ALA B 1 70  ? -38.567 2.358   -7.601  1.00 18.65 ? 70   ALA B N     1 
ATOM   1771 C  CA    . ALA B 1 70  ? -39.394 1.327   -6.990  1.00 20.18 ? 70   ALA B CA    1 
ATOM   1772 C  C     . ALA B 1 70  ? -38.441 0.366   -6.258  1.00 21.24 ? 70   ALA B C     1 
ATOM   1773 O  O     . ALA B 1 70  ? -38.712 -0.065  -5.136  1.00 20.72 ? 70   ALA B O     1 
ATOM   1774 C  CB    . ALA B 1 70  ? -40.187 0.582   -8.056  1.00 21.42 ? 70   ALA B CB    1 
ATOM   1775 N  N     . PHE B 1 71  ? -37.306 0.075   -6.891  1.00 20.26 ? 71   PHE B N     1 
ATOM   1776 C  CA    . PHE B 1 71  ? -36.294 -0.807  -6.312  1.00 20.87 ? 71   PHE B CA    1 
ATOM   1777 C  C     . PHE B 1 71  ? -35.563 -0.126  -5.154  1.00 20.23 ? 71   PHE B C     1 
ATOM   1778 O  O     . PHE B 1 71  ? -35.331 -0.737  -4.109  1.00 19.65 ? 71   PHE B O     1 
ATOM   1779 C  CB    . PHE B 1 71  ? -35.274 -1.223  -7.380  1.00 21.87 ? 71   PHE B CB    1 
ATOM   1780 C  CG    . PHE B 1 71  ? -34.159 -2.093  -6.852  1.00 21.88 ? 71   PHE B CG    1 
ATOM   1781 C  CD1   . PHE B 1 71  ? -34.312 -3.477  -6.778  1.00 23.04 ? 71   PHE B CD1   1 
ATOM   1782 C  CD2   . PHE B 1 71  ? -32.961 -1.528  -6.419  1.00 20.32 ? 71   PHE B CD2   1 
ATOM   1783 C  CE1   . PHE B 1 71  ? -33.287 -4.284  -6.280  1.00 21.82 ? 71   PHE B CE1   1 
ATOM   1784 C  CE2   . PHE B 1 71  ? -31.933 -2.327  -5.920  1.00 19.55 ? 71   PHE B CE2   1 
ATOM   1785 C  CZ    . PHE B 1 71  ? -32.098 -3.705  -5.851  1.00 19.10 ? 71   PHE B CZ    1 
ATOM   1786 N  N     . LEU B 1 72  ? -35.200 1.140   -5.350  1.00 17.41 ? 72   LEU B N     1 
ATOM   1787 C  CA    . LEU B 1 72  ? -34.480 1.906   -4.336  1.00 18.83 ? 72   LEU B CA    1 
ATOM   1788 C  C     . LEU B 1 72  ? -35.279 2.199   -3.069  1.00 19.34 ? 72   LEU B C     1 
ATOM   1789 O  O     . LEU B 1 72  ? -34.706 2.611   -2.055  1.00 17.79 ? 72   LEU B O     1 
ATOM   1790 C  CB    . LEU B 1 72  ? -33.935 3.204   -4.934  1.00 17.41 ? 72   LEU B CB    1 
ATOM   1791 C  CG    . LEU B 1 72  ? -32.899 3.045   -6.055  1.00 19.95 ? 72   LEU B CG    1 
ATOM   1792 C  CD1   . LEU B 1 72  ? -32.440 4.412   -6.521  1.00 19.05 ? 72   LEU B CD1   1 
ATOM   1793 C  CD2   . LEU B 1 72  ? -31.706 2.219   -5.577  1.00 19.09 ? 72   LEU B CD2   1 
ATOM   1794 N  N     . THR B 1 73  ? -36.597 2.006   -3.132  1.00 18.62 ? 73   THR B N     1 
ATOM   1795 C  CA    . THR B 1 73  ? -37.469 2.225   -1.975  1.00 17.75 ? 73   THR B CA    1 
ATOM   1796 C  C     . THR B 1 73  ? -38.190 0.931   -1.570  1.00 18.34 ? 73   THR B C     1 
ATOM   1797 O  O     . THR B 1 73  ? -39.117 0.953   -0.760  1.00 20.59 ? 73   THR B O     1 
ATOM   1798 C  CB    . THR B 1 73  ? -38.542 3.318   -2.250  1.00 20.05 ? 73   THR B CB    1 
ATOM   1799 O  OG1   . THR B 1 73  ? -39.318 2.954   -3.396  1.00 18.42 ? 73   THR B OG1   1 
ATOM   1800 C  CG2   . THR B 1 73  ? -37.896 4.666   -2.489  1.00 17.77 ? 73   THR B CG2   1 
ATOM   1801 N  N     . ARG B 1 74  ? -37.732 -0.196  -2.107  1.00 17.58 ? 74   ARG B N     1 
ATOM   1802 C  CA    . ARG B 1 74  ? -38.334 -1.495  -1.822  1.00 20.16 ? 74   ARG B CA    1 
ATOM   1803 C  C     . ARG B 1 74  ? -38.240 -1.900  -0.349  1.00 20.29 ? 74   ARG B C     1 
ATOM   1804 O  O     . ARG B 1 74  ? -38.969 -2.784  0.102   1.00 21.23 ? 74   ARG B O     1 
ATOM   1805 C  CB    . ARG B 1 74  ? -37.703 -2.575  -2.705  1.00 20.37 ? 74   ARG B CB    1 
ATOM   1806 C  CG    . ARG B 1 74  ? -36.348 -3.098  -2.224  1.00 26.25 ? 74   ARG B CG    1 
ATOM   1807 C  CD    . ARG B 1 74  ? -35.678 -3.956  -3.295  1.00 27.18 ? 74   ARG B CD    1 
ATOM   1808 N  NE    . ARG B 1 74  ? -36.576 -4.982  -3.828  1.00 31.57 ? 74   ARG B NE    1 
ATOM   1809 C  CZ    . ARG B 1 74  ? -36.737 -6.195  -3.304  1.00 34.07 ? 74   ARG B CZ    1 
ATOM   1810 N  NH1   . ARG B 1 74  ? -36.061 -6.556  -2.220  1.00 36.15 ? 74   ARG B NH1   1 
ATOM   1811 N  NH2   . ARG B 1 74  ? -37.578 -7.051  -3.869  1.00 34.55 ? 74   ARG B NH2   1 
ATOM   1812 N  N     . GLY B 1 75  ? -37.347 -1.244  0.390   1.00 18.31 ? 75   GLY B N     1 
ATOM   1813 C  CA    . GLY B 1 75  ? -37.172 -1.550  1.802   1.00 20.14 ? 75   GLY B CA    1 
ATOM   1814 C  C     . GLY B 1 75  ? -38.402 -1.315  2.661   1.00 20.43 ? 75   GLY B C     1 
ATOM   1815 O  O     . GLY B 1 75  ? -38.609 -2.017  3.654   1.00 18.65 ? 75   GLY B O     1 
ATOM   1816 N  N     . TYR B 1 76  ? -39.207 -0.320  2.289   1.00 18.76 ? 76   TYR B N     1 
ATOM   1817 C  CA    . TYR B 1 76  ? -40.435 0.012   3.013   1.00 24.35 ? 76   TYR B CA    1 
ATOM   1818 C  C     . TYR B 1 76  ? -41.457 -1.115  2.881   1.00 25.58 ? 76   TYR B C     1 
ATOM   1819 O  O     . TYR B 1 76  ? -42.307 -1.297  3.747   1.00 28.97 ? 76   TYR B O     1 
ATOM   1820 C  CB    . TYR B 1 76  ? -41.089 1.279   2.439   1.00 20.41 ? 76   TYR B CB    1 
ATOM   1821 C  CG    . TYR B 1 76  ? -40.307 2.563   2.574   1.00 20.01 ? 76   TYR B CG    1 
ATOM   1822 C  CD1   . TYR B 1 76  ? -40.017 3.102   3.827   1.00 18.44 ? 76   TYR B CD1   1 
ATOM   1823 C  CD2   . TYR B 1 76  ? -39.902 3.269   1.444   1.00 16.83 ? 76   TYR B CD2   1 
ATOM   1824 C  CE1   . TYR B 1 76  ? -39.343 4.318   3.947   1.00 17.79 ? 76   TYR B CE1   1 
ATOM   1825 C  CE2   . TYR B 1 76  ? -39.231 4.478   1.553   1.00 17.89 ? 76   TYR B CE2   1 
ATOM   1826 C  CZ    . TYR B 1 76  ? -38.954 4.996   2.804   1.00 18.09 ? 76   TYR B CZ    1 
ATOM   1827 O  OH    . TYR B 1 76  ? -38.272 6.182   2.900   1.00 19.05 ? 76   TYR B OH    1 
ATOM   1828 N  N     . ARG B 1 77  ? -41.375 -1.850  1.779   1.00 28.42 ? 77   ARG B N     1 
ATOM   1829 C  CA    . ARG B 1 77  ? -42.308 -2.933  1.495   1.00 28.55 ? 77   ARG B CA    1 
ATOM   1830 C  C     . ARG B 1 77  ? -41.844 -4.330  1.900   1.00 29.83 ? 77   ARG B C     1 
ATOM   1831 O  O     . ARG B 1 77  ? -42.461 -5.330  1.523   1.00 31.19 ? 77   ARG B O     1 
ATOM   1832 C  CB    . ARG B 1 77  ? -42.688 -2.890  0.012   1.00 29.82 ? 77   ARG B CB    1 
ATOM   1833 C  CG    . ARG B 1 77  ? -43.413 -1.601  -0.373  1.00 34.23 ? 77   ARG B CG    1 
ATOM   1834 C  CD    . ARG B 1 77  ? -43.606 -1.461  -1.878  1.00 36.83 ? 77   ARG B CD    1 
ATOM   1835 N  NE    . ARG B 1 77  ? -42.398 -1.012  -2.573  1.00 38.88 ? 77   ARG B NE    1 
ATOM   1836 C  CZ    . ARG B 1 77  ? -41.903 0.224   -2.513  1.00 39.69 ? 77   ARG B CZ    1 
ATOM   1837 N  NH1   . ARG B 1 77  ? -42.497 1.159   -1.779  1.00 38.42 ? 77   ARG B NH1   1 
ATOM   1838 N  NH2   . ARG B 1 77  ? -40.832 0.541   -3.226  1.00 40.57 ? 77   ARG B NH2   1 
ATOM   1839 N  N     . GLN B 1 78  ? -40.773 -4.396  2.687   1.00 26.16 ? 78   GLN B N     1 
ATOM   1840 C  CA    . GLN B 1 78  ? -40.248 -5.677  3.151   1.00 22.42 ? 78   GLN B CA    1 
ATOM   1841 C  C     . GLN B 1 78  ? -40.609 -5.926  4.610   1.00 21.75 ? 78   GLN B C     1 
ATOM   1842 O  O     . GLN B 1 78  ? -40.842 -4.985  5.369   1.00 21.40 ? 78   GLN B O     1 
ATOM   1843 C  CB    . GLN B 1 78  ? -38.726 -5.726  2.989   1.00 20.19 ? 78   GLN B CB    1 
ATOM   1844 C  CG    . GLN B 1 78  ? -38.247 -5.811  1.553   1.00 20.39 ? 78   GLN B CG    1 
ATOM   1845 C  CD    . GLN B 1 78  ? -36.734 -5.864  1.460   1.00 24.18 ? 78   GLN B CD    1 
ATOM   1846 O  OE1   . GLN B 1 78  ? -36.055 -4.854  1.633   1.00 22.90 ? 78   GLN B OE1   1 
ATOM   1847 N  NE2   . GLN B 1 78  ? -36.199 -7.050  1.200   1.00 22.24 ? 78   GLN B NE2   1 
ATOM   1848 N  N     . ARG B 1 79  ? -40.671 -7.201  4.987   1.00 22.57 ? 79   ARG B N     1 
ATOM   1849 C  CA    . ARG B 1 79  ? -40.982 -7.598  6.355   1.00 23.74 ? 79   ARG B CA    1 
ATOM   1850 C  C     . ARG B 1 79  ? -39.768 -8.303  6.943   1.00 21.48 ? 79   ARG B C     1 
ATOM   1851 O  O     . ARG B 1 79  ? -39.213 -9.211  6.322   1.00 20.45 ? 79   ARG B O     1 
ATOM   1852 C  CB    . ARG B 1 79  ? -42.188 -8.541  6.394   1.00 24.76 ? 79   ARG B CB    1 
ATOM   1853 C  CG    . ARG B 1 79  ? -43.516 -7.883  6.073   1.00 33.41 ? 79   ARG B CG    1 
ATOM   1854 C  CD    . ARG B 1 79  ? -44.679 -8.821  6.373   1.00 40.71 ? 79   ARG B CD    1 
ATOM   1855 N  NE    . ARG B 1 79  ? -44.784 -9.131  7.801   1.00 47.97 ? 79   ARG B NE    1 
ATOM   1856 C  CZ    . ARG B 1 79  ? -44.538 -10.324 8.337   1.00 50.59 ? 79   ARG B CZ    1 
ATOM   1857 N  NH1   . ARG B 1 79  ? -44.169 -11.344 7.570   1.00 52.13 ? 79   ARG B NH1   1 
ATOM   1858 N  NH2   . ARG B 1 79  ? -44.654 -10.498 9.647   1.00 50.08 ? 79   ARG B NH2   1 
ATOM   1859 N  N     . LEU B 1 80  ? -39.373 -7.893  8.146   1.00 22.78 ? 80   LEU B N     1 
ATOM   1860 C  CA    . LEU B 1 80  ? -38.211 -8.467  8.818   1.00 21.98 ? 80   LEU B CA    1 
ATOM   1861 C  C     . LEU B 1 80  ? -38.285 -9.989  8.911   1.00 22.82 ? 80   LEU B C     1 
ATOM   1862 O  O     . LEU B 1 80  ? -37.294 -10.677 8.676   1.00 21.38 ? 80   LEU B O     1 
ATOM   1863 C  CB    . LEU B 1 80  ? -38.041 -7.843  10.206  1.00 23.32 ? 80   LEU B CB    1 
ATOM   1864 C  CG    . LEU B 1 80  ? -36.785 -8.193  11.011  1.00 21.65 ? 80   LEU B CG    1 
ATOM   1865 C  CD1   . LEU B 1 80  ? -35.527 -7.829  10.227  1.00 22.30 ? 80   LEU B CD1   1 
ATOM   1866 C  CD2   . LEU B 1 80  ? -36.815 -7.456  12.336  1.00 23.92 ? 80   LEU B CD2   1 
ATOM   1867 N  N     . GLU B 1 81  ? -39.472 -10.512 9.197   1.00 24.69 ? 81   GLU B N     1 
ATOM   1868 C  CA    . GLU B 1 81  ? -39.668 -11.954 9.308   1.00 29.30 ? 81   GLU B CA    1 
ATOM   1869 C  C     . GLU B 1 81  ? -39.331 -12.688 8.010   1.00 27.31 ? 81   GLU B C     1 
ATOM   1870 O  O     . GLU B 1 81  ? -38.731 -13.761 8.034   1.00 28.85 ? 81   GLU B O     1 
ATOM   1871 C  CB    . GLU B 1 81  ? -41.110 -12.266 9.720   1.00 34.78 ? 81   GLU B CB    1 
ATOM   1872 C  CG    . GLU B 1 81  ? -41.497 -11.705 11.086  1.00 46.07 ? 81   GLU B CG    1 
ATOM   1873 C  CD    . GLU B 1 81  ? -42.885 -12.139 11.541  1.00 50.62 ? 81   GLU B CD    1 
ATOM   1874 O  OE1   . GLU B 1 81  ? -43.419 -13.135 11.000  1.00 51.54 ? 81   GLU B OE1   1 
ATOM   1875 O  OE2   . GLU B 1 81  ? -43.442 -11.481 12.447  1.00 55.13 ? 81   GLU B OE2   1 
ATOM   1876 N  N     . GLU B 1 82  ? -39.720 -12.104 6.882   1.00 26.69 ? 82   GLU B N     1 
ATOM   1877 C  CA    . GLU B 1 82  ? -39.452 -12.702 5.577   1.00 27.40 ? 82   GLU B CA    1 
ATOM   1878 C  C     . GLU B 1 82  ? -37.990 -12.527 5.173   1.00 23.89 ? 82   GLU B C     1 
ATOM   1879 O  O     . GLU B 1 82  ? -37.397 -13.415 4.562   1.00 27.55 ? 82   GLU B O     1 
ATOM   1880 C  CB    . GLU B 1 82  ? -40.382 -12.101 4.524   1.00 28.57 ? 82   GLU B CB    1 
ATOM   1881 C  CG    . GLU B 1 82  ? -41.855 -12.420 4.772   1.00 37.74 ? 82   GLU B CG    1 
ATOM   1882 C  CD    . GLU B 1 82  ? -42.810 -11.638 3.881   1.00 44.26 ? 82   GLU B CD    1 
ATOM   1883 O  OE1   . GLU B 1 82  ? -42.361 -11.031 2.882   1.00 46.90 ? 82   GLU B OE1   1 
ATOM   1884 O  OE2   . GLU B 1 82  ? -44.022 -11.630 4.191   1.00 45.98 ? 82   GLU B OE2   1 
ATOM   1885 N  N     . VAL B 1 83  ? -37.409 -11.389 5.544   1.00 22.79 ? 83   VAL B N     1 
ATOM   1886 C  CA    . VAL B 1 83  ? -36.010 -11.089 5.240   1.00 22.15 ? 83   VAL B CA    1 
ATOM   1887 C  C     . VAL B 1 83  ? -35.072 -12.075 5.942   1.00 19.78 ? 83   VAL B C     1 
ATOM   1888 O  O     . VAL B 1 83  ? -34.095 -12.533 5.352   1.00 19.53 ? 83   VAL B O     1 
ATOM   1889 C  CB    . VAL B 1 83  ? -35.654 -9.625  5.631   1.00 27.58 ? 83   VAL B CB    1 
ATOM   1890 C  CG1   . VAL B 1 83  ? -34.151 -9.415  5.632   1.00 25.27 ? 83   VAL B CG1   1 
ATOM   1891 C  CG2   . VAL B 1 83  ? -36.307 -8.647  4.651   1.00 23.34 ? 83   VAL B CG2   1 
ATOM   1892 N  N     . VAL B 1 84  ? -35.379 -12.401 7.197   1.00 19.80 ? 84   VAL B N     1 
ATOM   1893 C  CA    . VAL B 1 84  ? -34.578 -13.341 7.977   1.00 21.98 ? 84   VAL B CA    1 
ATOM   1894 C  C     . VAL B 1 84  ? -34.792 -14.777 7.487   1.00 22.43 ? 84   VAL B C     1 
ATOM   1895 O  O     . VAL B 1 84  ? -33.880 -15.602 7.544   1.00 21.63 ? 84   VAL B O     1 
ATOM   1896 C  CB    . VAL B 1 84  ? -34.899 -13.230 9.492   1.00 21.58 ? 84   VAL B CB    1 
ATOM   1897 C  CG1   . VAL B 1 84  ? -34.180 -14.311 10.280  1.00 25.48 ? 84   VAL B CG1   1 
ATOM   1898 C  CG2   . VAL B 1 84  ? -34.486 -11.857 10.001  1.00 25.45 ? 84   VAL B CG2   1 
ATOM   1899 N  N     . GLY B 1 85  ? -36.004 -15.067 7.022   1.00 23.70 ? 85   GLY B N     1 
ATOM   1900 C  CA    . GLY B 1 85  ? -36.325 -16.389 6.505   1.00 24.64 ? 85   GLY B CA    1 
ATOM   1901 C  C     . GLY B 1 85  ? -36.064 -17.561 7.436   1.00 24.33 ? 85   GLY B C     1 
ATOM   1902 O  O     . GLY B 1 85  ? -35.713 -18.648 6.980   1.00 28.45 ? 85   GLY B O     1 
ATOM   1903 N  N     . GLY B 1 86  ? -36.214 -17.332 8.738   1.00 25.43 ? 86   GLY B N     1 
ATOM   1904 C  CA    . GLY B 1 86  ? -35.995 -18.382 9.718   1.00 26.79 ? 86   GLY B CA    1 
ATOM   1905 C  C     . GLY B 1 86  ? -34.572 -18.913 9.792   1.00 28.19 ? 86   GLY B C     1 
ATOM   1906 O  O     . GLY B 1 86  ? -34.338 -19.968 10.385  1.00 27.03 ? 86   GLY B O     1 
ATOM   1907 N  N     . ALA B 1 87  ? -33.621 -18.201 9.187   1.00 28.68 ? 87   ALA B N     1 
ATOM   1908 C  CA    . ALA B 1 87  ? -32.223 -18.630 9.207   1.00 27.64 ? 87   ALA B CA    1 
ATOM   1909 C  C     . ALA B 1 87  ? -31.560 -18.278 10.534  1.00 26.89 ? 87   ALA B C     1 
ATOM   1910 O  O     . ALA B 1 87  ? -30.593 -17.515 10.587  1.00 25.40 ? 87   ALA B O     1 
ATOM   1911 C  CB    . ALA B 1 87  ? -31.456 -18.021 8.043   1.00 27.28 ? 87   ALA B CB    1 
ATOM   1912 N  N     . VAL B 1 88  ? -32.137 -18.799 11.611  1.00 25.85 ? 88   VAL B N     1 
ATOM   1913 C  CA    . VAL B 1 88  ? -31.627 -18.592 12.958  1.00 26.32 ? 88   VAL B CA    1 
ATOM   1914 C  C     . VAL B 1 88  ? -31.231 -19.979 13.443  1.00 27.04 ? 88   VAL B C     1 
ATOM   1915 O  O     . VAL B 1 88  ? -32.045 -20.906 13.434  1.00 26.58 ? 88   VAL B O     1 
ATOM   1916 C  CB    . VAL B 1 88  ? -32.702 -17.983 13.888  1.00 28.79 ? 88   VAL B CB    1 
ATOM   1917 C  CG1   . VAL B 1 88  ? -32.146 -17.809 15.295  1.00 29.58 ? 88   VAL B CG1   1 
ATOM   1918 C  CG2   . VAL B 1 88  ? -33.167 -16.638 13.341  1.00 25.35 ? 88   VAL B CG2   1 
ATOM   1919 N  N     . PHE B 1 89  ? -29.967 -20.127 13.823  1.00 23.94 ? 89   PHE B N     1 
ATOM   1920 C  CA    . PHE B 1 89  ? -29.445 -21.413 14.268  1.00 22.57 ? 89   PHE B CA    1 
ATOM   1921 C  C     . PHE B 1 89  ? -28.946 -21.344 15.705  1.00 23.51 ? 89   PHE B C     1 
ATOM   1922 O  O     . PHE B 1 89  ? -28.745 -20.258 16.251  1.00 22.33 ? 89   PHE B O     1 
ATOM   1923 C  CB    . PHE B 1 89  ? -28.279 -21.835 13.360  1.00 23.45 ? 89   PHE B CB    1 
ATOM   1924 C  CG    . PHE B 1 89  ? -28.533 -21.607 11.895  1.00 26.21 ? 89   PHE B CG    1 
ATOM   1925 C  CD1   . PHE B 1 89  ? -29.334 -22.480 11.168  1.00 29.38 ? 89   PHE B CD1   1 
ATOM   1926 C  CD2   . PHE B 1 89  ? -27.981 -20.508 11.246  1.00 29.62 ? 89   PHE B CD2   1 
ATOM   1927 C  CE1   . PHE B 1 89  ? -29.584 -22.263 9.813   1.00 30.80 ? 89   PHE B CE1   1 
ATOM   1928 C  CE2   . PHE B 1 89  ? -28.226 -20.282 9.892   1.00 31.06 ? 89   PHE B CE2   1 
ATOM   1929 C  CZ    . PHE B 1 89  ? -29.030 -21.162 9.176   1.00 29.79 ? 89   PHE B CZ    1 
ATOM   1930 N  N     . PRO B 1 90  ? -28.777 -22.508 16.351  1.00 24.85 ? 90   PRO B N     1 
ATOM   1931 C  CA    . PRO B 1 90  ? -28.288 -22.548 17.732  1.00 24.21 ? 90   PRO B CA    1 
ATOM   1932 C  C     . PRO B 1 90  ? -26.861 -22.000 17.756  1.00 22.48 ? 90   PRO B C     1 
ATOM   1933 O  O     . PRO B 1 90  ? -26.096 -22.220 16.813  1.00 23.51 ? 90   PRO B O     1 
ATOM   1934 C  CB    . PRO B 1 90  ? -28.290 -24.044 18.044  1.00 26.95 ? 90   PRO B CB    1 
ATOM   1935 C  CG    . PRO B 1 90  ? -29.411 -24.560 17.210  1.00 30.18 ? 90   PRO B CG    1 
ATOM   1936 C  CD    . PRO B 1 90  ? -29.184 -23.851 15.903  1.00 26.95 ? 90   PRO B CD    1 
ATOM   1937 N  N     . ALA B 1 91  ? -26.520 -21.264 18.809  1.00 22.81 ? 91   ALA B N     1 
ATOM   1938 C  CA    . ALA B 1 91  ? -25.178 -20.698 18.942  1.00 22.69 ? 91   ALA B CA    1 
ATOM   1939 C  C     . ALA B 1 91  ? -24.154 -21.821 19.092  1.00 24.32 ? 91   ALA B C     1 
ATOM   1940 O  O     . ALA B 1 91  ? -24.467 -22.893 19.619  1.00 24.20 ? 91   ALA B O     1 
ATOM   1941 C  CB    . ALA B 1 91  ? -25.117 -19.762 20.139  1.00 23.79 ? 91   ALA B CB    1 
ATOM   1942 N  N     . GLU B 1 92  ? -22.949 -21.588 18.581  1.00 23.66 ? 92   GLU B N     1 
ATOM   1943 C  CA    . GLU B 1 92  ? -21.871 -22.571 18.650  1.00 24.50 ? 92   GLU B CA    1 
ATOM   1944 C  C     . GLU B 1 92  ? -20.916 -22.241 19.790  1.00 26.97 ? 92   GLU B C     1 
ATOM   1945 O  O     . GLU B 1 92  ? -20.135 -23.085 20.231  1.00 25.33 ? 92   GLU B O     1 
ATOM   1946 C  CB    . GLU B 1 92  ? -21.099 -22.595 17.329  1.00 25.29 ? 92   GLU B CB    1 
ATOM   1947 C  CG    . GLU B 1 92  ? -21.914 -23.060 16.129  1.00 27.41 ? 92   GLU B CG    1 
ATOM   1948 C  CD    . GLU B 1 92  ? -22.211 -24.555 16.147  1.00 25.93 ? 92   GLU B CD    1 
ATOM   1949 O  OE1   . GLU B 1 92  ? -21.519 -25.304 16.865  1.00 29.69 ? 92   GLU B OE1   1 
ATOM   1950 O  OE2   . GLU B 1 92  ? -23.126 -24.985 15.421  1.00 30.05 ? 92   GLU B OE2   1 
ATOM   1951 N  N     . GLY B 1 93  ? -20.977 -20.995 20.240  1.00 27.89 ? 93   GLY B N     1 
ATOM   1952 C  CA    . GLY B 1 93  ? -20.128 -20.534 21.319  1.00 29.65 ? 93   GLY B CA    1 
ATOM   1953 C  C     . GLY B 1 93  ? -20.668 -19.228 21.863  1.00 30.62 ? 93   GLY B C     1 
ATOM   1954 O  O     . GLY B 1 93  ? -21.715 -18.747 21.425  1.00 29.17 ? 93   GLY B O     1 
ATOM   1955 N  N     . SER B 1 94  ? -19.937 -18.633 22.797  1.00 30.55 ? 94   SER B N     1 
ATOM   1956 C  CA    . SER B 1 94  ? -20.363 -17.383 23.406  1.00 31.44 ? 94   SER B CA    1 
ATOM   1957 C  C     . SER B 1 94  ? -19.581 -16.155 22.946  1.00 26.87 ? 94   SER B C     1 
ATOM   1958 O  O     . SER B 1 94  ? -19.864 -15.044 23.393  1.00 29.40 ? 94   SER B O     1 
ATOM   1959 C  CB    . SER B 1 94  ? -20.298 -17.507 24.931  1.00 33.37 ? 94   SER B CB    1 
ATOM   1960 O  OG    . SER B 1 94  ? -19.041 -18.021 25.336  1.00 38.46 ? 94   SER B OG    1 
ATOM   1961 N  N     . GLU B 1 95  ? -18.608 -16.345 22.055  1.00 24.93 ? 95   GLU B N     1 
ATOM   1962 C  CA    . GLU B 1 95  ? -17.804 -15.225 21.578  1.00 20.25 ? 95   GLU B CA    1 
ATOM   1963 C  C     . GLU B 1 95  ? -18.479 -14.369 20.511  1.00 20.68 ? 95   GLU B C     1 
ATOM   1964 O  O     . GLU B 1 95  ? -19.391 -14.805 19.805  1.00 17.35 ? 95   GLU B O     1 
ATOM   1965 C  CB    . GLU B 1 95  ? -16.428 -15.691 21.086  1.00 25.14 ? 95   GLU B CB    1 
ATOM   1966 C  CG    . GLU B 1 95  ? -15.531 -16.298 22.173  1.00 25.09 ? 95   GLU B CG    1 
ATOM   1967 C  CD    . GLU B 1 95  ? -15.217 -15.330 23.304  1.00 29.14 ? 95   GLU B CD    1 
ATOM   1968 O  OE1   . GLU B 1 95  ? -14.931 -14.144 23.025  1.00 31.15 ? 95   GLU B OE1   1 
ATOM   1969 O  OE2   . GLU B 1 95  ? -15.245 -15.759 24.478  1.00 29.99 ? 95   GLU B OE2   1 
ATOM   1970 N  N     . MET B 1 96  ? -17.994 -13.142 20.404  1.00 18.73 ? 96   MET B N     1 
ATOM   1971 C  CA    . MET B 1 96  ? -18.497 -12.162 19.455  1.00 17.79 ? 96   MET B CA    1 
ATOM   1972 C  C     . MET B 1 96  ? -18.333 -12.617 18.001  1.00 15.24 ? 96   MET B C     1 
ATOM   1973 O  O     . MET B 1 96  ? -17.380 -13.318 17.655  1.00 13.31 ? 96   MET B O     1 
ATOM   1974 C  CB    . MET B 1 96  ? -17.727 -10.857 19.678  1.00 17.81 ? 96   MET B CB    1 
ATOM   1975 C  CG    . MET B 1 96  ? -18.176 -9.651  18.882  1.00 18.28 ? 96   MET B CG    1 
ATOM   1976 S  SD    . MET B 1 96  ? -17.006 -8.295  19.164  1.00 17.98 ? 96   MET B SD    1 
ATOM   1977 C  CE    . MET B 1 96  ? -17.323 -7.921  20.913  1.00 16.78 ? 96   MET B CE    1 
ATOM   1978 N  N     . VAL B 1 97  ? -19.327 -12.288 17.184  1.00 14.48 ? 97   VAL B N     1 
ATOM   1979 C  CA    . VAL B 1 97  ? -19.300 -12.574 15.754  1.00 12.20 ? 97   VAL B CA    1 
ATOM   1980 C  C     . VAL B 1 97  ? -19.324 -11.191 15.115  1.00 13.85 ? 97   VAL B C     1 
ATOM   1981 O  O     . VAL B 1 97  ? -20.151 -10.352 15.480  1.00 14.82 ? 97   VAL B O     1 
ATOM   1982 C  CB    . VAL B 1 97  ? -20.550 -13.368 15.279  1.00 11.96 ? 97   VAL B CB    1 
ATOM   1983 C  CG1   . VAL B 1 97  ? -20.550 -13.486 13.751  1.00 12.63 ? 97   VAL B CG1   1 
ATOM   1984 C  CG2   . VAL B 1 97  ? -20.559 -14.762 15.907  1.00 14.65 ? 97   VAL B CG2   1 
ATOM   1985 N  N     . VAL B 1 98  ? -18.377 -10.930 14.219  1.00 14.67 ? 98   VAL B N     1 
ATOM   1986 C  CA    . VAL B 1 98  ? -18.305 -9.642  13.545  1.00 14.53 ? 98   VAL B CA    1 
ATOM   1987 C  C     . VAL B 1 98  ? -18.407 -9.833  12.041  1.00 14.76 ? 98   VAL B C     1 
ATOM   1988 O  O     . VAL B 1 98  ? -17.619 -10.565 11.445  1.00 16.01 ? 98   VAL B O     1 
ATOM   1989 C  CB    . VAL B 1 98  ? -16.977 -8.905  13.845  1.00 14.96 ? 98   VAL B CB    1 
ATOM   1990 C  CG1   . VAL B 1 98  ? -16.941 -7.564  13.118  1.00 15.65 ? 98   VAL B CG1   1 
ATOM   1991 C  CG2   . VAL B 1 98  ? -16.799 -8.709  15.353  1.00 15.50 ? 98   VAL B CG2   1 
ATOM   1992 N  N     . VAL B 1 99  ? -19.410 -9.202  11.442  1.00 12.86 ? 99   VAL B N     1 
ATOM   1993 C  CA    . VAL B 1 99  ? -19.598 -9.264  10.001  1.00 13.29 ? 99   VAL B CA    1 
ATOM   1994 C  C     . VAL B 1 99  ? -19.279 -7.859  9.530   1.00 13.21 ? 99   VAL B C     1 
ATOM   1995 O  O     . VAL B 1 99  ? -20.055 -6.936  9.754   1.00 17.14 ? 99   VAL B O     1 
ATOM   1996 C  CB    . VAL B 1 99  ? -21.056 -9.613  9.636   1.00 15.35 ? 99   VAL B CB    1 
ATOM   1997 C  CG1   . VAL B 1 99  ? -21.236 -9.620  8.115   1.00 16.79 ? 99   VAL B CG1   1 
ATOM   1998 C  CG2   . VAL B 1 99  ? -21.435 -10.977 10.232  1.00 16.13 ? 99   VAL B CG2   1 
ATOM   1999 N  N     . LYS B 1 100 ? -18.117 -7.678  8.919   1.00 13.12 ? 100  LYS B N     1 
ATOM   2000 C  CA    . LYS B 1 100 ? -17.757 -6.346  8.472   1.00 15.51 ? 100  LYS B CA    1 
ATOM   2001 C  C     . LYS B 1 100 ? -17.757 -6.130  6.972   1.00 14.53 ? 100  LYS B C     1 
ATOM   2002 O  O     . LYS B 1 100 ? -17.843 -7.077  6.189   1.00 14.50 ? 100  LYS B O     1 
ATOM   2003 C  CB    . LYS B 1 100 ? -16.425 -5.919  9.081   1.00 21.71 ? 100  LYS B CB    1 
ATOM   2004 C  CG    . LYS B 1 100 ? -15.315 -6.915  8.933   1.00 20.19 ? 100  LYS B CG    1 
ATOM   2005 C  CD    . LYS B 1 100 ? -14.214 -6.622  9.941   1.00 23.27 ? 100  LYS B CD    1 
ATOM   2006 C  CE    . LYS B 1 100 ? -13.022 -7.520  9.713   1.00 23.81 ? 100  LYS B CE    1 
ATOM   2007 N  NZ    . LYS B 1 100 ? -12.002 -7.490  10.821  1.00 25.73 ? 100  LYS B NZ    1 
ATOM   2008 N  N     . GLY B 1 101 ? -17.731 -4.859  6.594   1.00 14.41 ? 101  GLY B N     1 
ATOM   2009 C  CA    . GLY B 1 101 ? -17.683 -4.490  5.193   1.00 13.98 ? 101  GLY B CA    1 
ATOM   2010 C  C     . GLY B 1 101 ? -18.894 -4.803  4.346   1.00 12.10 ? 101  GLY B C     1 
ATOM   2011 O  O     . GLY B 1 101 ? -18.742 -5.058  3.155   1.00 14.57 ? 101  GLY B O     1 
ATOM   2012 N  N     . VAL B 1 102 ? -20.085 -4.830  4.938   1.00 12.78 ? 102  VAL B N     1 
ATOM   2013 C  CA    . VAL B 1 102 ? -21.286 -5.074  4.142   1.00 12.99 ? 102  VAL B CA    1 
ATOM   2014 C  C     . VAL B 1 102 ? -21.566 -3.750  3.429   1.00 13.19 ? 102  VAL B C     1 
ATOM   2015 O  O     . VAL B 1 102 ? -22.016 -2.787  4.051   1.00 16.61 ? 102  VAL B O     1 
ATOM   2016 C  CB    . VAL B 1 102 ? -22.508 -5.454  5.013   1.00 12.66 ? 102  VAL B CB    1 
ATOM   2017 C  CG1   . VAL B 1 102 ? -23.739 -5.670  4.121   1.00 14.93 ? 102  VAL B CG1   1 
ATOM   2018 C  CG2   . VAL B 1 102 ? -22.208 -6.720  5.824   1.00 11.57 ? 102  VAL B CG2   1 
ATOM   2019 N  N     . GLU B 1 103 ? -21.257 -3.681  2.136   1.00 13.18 ? 103  GLU B N     1 
ATOM   2020 C  CA    . GLU B 1 103 ? -21.486 -2.444  1.402   1.00 10.30 ? 103  GLU B CA    1 
ATOM   2021 C  C     . GLU B 1 103 ? -22.984 -2.124  1.368   1.00 10.82 ? 103  GLU B C     1 
ATOM   2022 O  O     . GLU B 1 103 ? -23.828 -3.028  1.369   1.00 11.83 ? 103  GLU B O     1 
ATOM   2023 C  CB    . GLU B 1 103 ? -20.908 -2.517  -0.021  1.00 11.79 ? 103  GLU B CB    1 
ATOM   2024 C  CG    . GLU B 1 103 ? -21.621 -3.486  -0.971  1.00 12.02 ? 103  GLU B CG    1 
ATOM   2025 C  CD    . GLU B 1 103 ? -20.946 -4.850  -1.075  1.00 13.95 ? 103  GLU B CD    1 
ATOM   2026 O  OE1   . GLU B 1 103 ? -20.306 -5.297  -0.100  1.00 13.14 ? 103  GLU B OE1   1 
ATOM   2027 O  OE2   . GLU B 1 103 ? -21.060 -5.484  -2.143  1.00 12.36 ? 103  GLU B OE2   1 
ATOM   2028 N  N     . PHE B 1 104 ? -23.308 -0.838  1.397   1.00 11.35 ? 104  PHE B N     1 
ATOM   2029 C  CA    . PHE B 1 104 ? -24.703 -0.407  1.354   1.00 11.90 ? 104  PHE B CA    1 
ATOM   2030 C  C     . PHE B 1 104 ? -24.838 0.838   0.500   1.00 11.62 ? 104  PHE B C     1 
ATOM   2031 O  O     . PHE B 1 104 ? -23.871 1.571   0.276   1.00 14.28 ? 104  PHE B O     1 
ATOM   2032 C  CB    . PHE B 1 104 ? -25.246 -0.102  2.764   1.00 10.67 ? 104  PHE B CB    1 
ATOM   2033 C  CG    . PHE B 1 104 ? -24.863 1.260   3.281   1.00 12.31 ? 104  PHE B CG    1 
ATOM   2034 C  CD1   . PHE B 1 104 ? -23.649 1.454   3.934   1.00 9.28  ? 104  PHE B CD1   1 
ATOM   2035 C  CD2   . PHE B 1 104 ? -25.694 2.363   3.064   1.00 13.44 ? 104  PHE B CD2   1 
ATOM   2036 C  CE1   . PHE B 1 104 ? -23.258 2.722   4.359   1.00 13.09 ? 104  PHE B CE1   1 
ATOM   2037 C  CE2   . PHE B 1 104 ? -25.316 3.641   3.484   1.00 11.70 ? 104  PHE B CE2   1 
ATOM   2038 C  CZ    . PHE B 1 104 ? -24.094 3.823   4.132   1.00 14.61 ? 104  PHE B CZ    1 
ATOM   2039 N  N     . TYR B 1 105 ? -26.057 1.073   0.039   1.00 12.60 ? 105  TYR B N     1 
ATOM   2040 C  CA    . TYR B 1 105 ? -26.377 2.247   -0.758  1.00 11.32 ? 105  TYR B CA    1 
ATOM   2041 C  C     . TYR B 1 105 ? -27.734 2.727   -0.272  1.00 12.28 ? 105  TYR B C     1 
ATOM   2042 O  O     . TYR B 1 105 ? -28.651 1.928   -0.100  1.00 15.45 ? 105  TYR B O     1 
ATOM   2043 C  CB    . TYR B 1 105 ? -26.469 1.889   -2.245  1.00 11.69 ? 105  TYR B CB    1 
ATOM   2044 C  CG    . TYR B 1 105 ? -25.157 1.487   -2.872  1.00 12.73 ? 105  TYR B CG    1 
ATOM   2045 C  CD1   . TYR B 1 105 ? -24.322 2.438   -3.462  1.00 12.18 ? 105  TYR B CD1   1 
ATOM   2046 C  CD2   . TYR B 1 105 ? -24.740 0.156   -2.867  1.00 15.44 ? 105  TYR B CD2   1 
ATOM   2047 C  CE1   . TYR B 1 105 ? -23.099 2.076   -4.028  1.00 13.10 ? 105  TYR B CE1   1 
ATOM   2048 C  CE2   . TYR B 1 105 ? -23.520 -0.219  -3.432  1.00 12.66 ? 105  TYR B CE2   1 
ATOM   2049 C  CZ    . TYR B 1 105 ? -22.707 0.744   -4.008  1.00 15.73 ? 105  TYR B CZ    1 
ATOM   2050 O  OH    . TYR B 1 105 ? -21.498 0.378   -4.559  1.00 15.81 ? 105  TYR B OH    1 
ATOM   2051 N  N     . SER B 1 106 ? -27.851 4.025   -0.024  1.00 13.50 ? 106  SER B N     1 
ATOM   2052 C  CA    . SER B 1 106 ? -29.117 4.585   0.425   1.00 14.93 ? 106  SER B CA    1 
ATOM   2053 C  C     . SER B 1 106 ? -29.313 5.950   -0.220  1.00 16.49 ? 106  SER B C     1 
ATOM   2054 O  O     . SER B 1 106 ? -28.486 6.387   -1.020  1.00 17.60 ? 106  SER B O     1 
ATOM   2055 C  CB    . SER B 1 106 ? -29.147 4.697   1.958   1.00 12.83 ? 106  SER B CB    1 
ATOM   2056 O  OG    . SER B 1 106 ? -30.464 4.969   2.417   1.00 15.08 ? 106  SER B OG    1 
ATOM   2057 N  N     . MET B 1 107 ? -30.445 6.579   0.081   1.00 16.57 ? 107  MET B N     1 
ATOM   2058 C  CA    . MET B 1 107 ? -30.787 7.904   -0.431  1.00 16.80 ? 107  MET B CA    1 
ATOM   2059 C  C     . MET B 1 107 ? -31.031 8.802   0.774   1.00 17.99 ? 107  MET B C     1 
ATOM   2060 O  O     . MET B 1 107 ? -31.781 8.430   1.677   1.00 17.90 ? 107  MET B O     1 
ATOM   2061 C  CB    . MET B 1 107 ? -32.068 7.844   -1.271  1.00 19.55 ? 107  MET B CB    1 
ATOM   2062 C  CG    . MET B 1 107 ? -31.887 7.285   -2.668  1.00 25.59 ? 107  MET B CG    1 
ATOM   2063 S  SD    . MET B 1 107 ? -31.018 8.427   -3.750  1.00 26.36 ? 107  MET B SD    1 
ATOM   2064 C  CE    . MET B 1 107 ? -31.233 7.627   -5.305  1.00 23.28 ? 107  MET B CE    1 
ATOM   2065 N  N     . CYS B 1 108 ? -30.388 9.966   0.811   1.00 16.78 ? 108  CYS B N     1 
ATOM   2066 C  CA    . CYS B 1 108 ? -30.594 10.864  1.938   1.00 19.44 ? 108  CYS B CA    1 
ATOM   2067 C  C     . CYS B 1 108 ? -31.993 11.454  1.800   1.00 19.11 ? 108  CYS B C     1 
ATOM   2068 O  O     . CYS B 1 108 ? -32.412 11.835  0.706   1.00 16.14 ? 108  CYS B O     1 
ATOM   2069 C  CB    . CYS B 1 108 ? -29.511 11.951  2.012   1.00 21.20 ? 108  CYS B CB    1 
ATOM   2070 S  SG    . CYS B 1 108 ? -29.572 13.261  0.766   1.00 22.72 ? 108  CYS B SG    1 
ATOM   2071 N  N     . GLU B 1 109 ? -32.746 11.441  2.894   1.00 17.20 ? 109  GLU B N     1 
ATOM   2072 C  CA    . GLU B 1 109 ? -34.111 11.955  2.863   1.00 18.38 ? 109  GLU B CA    1 
ATOM   2073 C  C     . GLU B 1 109 ? -34.174 13.465  2.675   1.00 18.40 ? 109  GLU B C     1 
ATOM   2074 O  O     . GLU B 1 109 ? -35.208 13.999  2.285   1.00 20.65 ? 109  GLU B O     1 
ATOM   2075 C  CB    . GLU B 1 109 ? -34.874 11.540  4.121   1.00 15.87 ? 109  GLU B CB    1 
ATOM   2076 C  CG    . GLU B 1 109 ? -34.360 12.133  5.420   1.00 19.76 ? 109  GLU B CG    1 
ATOM   2077 C  CD    . GLU B 1 109 ? -35.055 11.536  6.635   1.00 19.32 ? 109  GLU B CD    1 
ATOM   2078 O  OE1   . GLU B 1 109 ? -35.109 12.207  7.679   1.00 21.32 ? 109  GLU B OE1   1 
ATOM   2079 O  OE2   . GLU B 1 109 ? -35.548 10.394  6.544   1.00 21.46 ? 109  GLU B OE2   1 
ATOM   2080 N  N     . HIS B 1 110 ? -33.055 14.140  2.917   1.00 18.39 ? 110  HIS B N     1 
ATOM   2081 C  CA    . HIS B 1 110 ? -32.992 15.589  2.784   1.00 19.70 ? 110  HIS B CA    1 
ATOM   2082 C  C     . HIS B 1 110 ? -32.837 16.110  1.354   1.00 22.14 ? 110  HIS B C     1 
ATOM   2083 O  O     . HIS B 1 110 ? -33.402 17.151  1.010   1.00 22.71 ? 110  HIS B O     1 
ATOM   2084 C  CB    . HIS B 1 110 ? -31.878 16.145  3.671   1.00 20.95 ? 110  HIS B CB    1 
ATOM   2085 C  CG    . HIS B 1 110 ? -32.078 15.867  5.128   1.00 30.20 ? 110  HIS B CG    1 
ATOM   2086 N  ND1   . HIS B 1 110 ? -31.039 15.556  5.977   1.00 34.96 ? 110  HIS B ND1   1 
ATOM   2087 C  CD2   . HIS B 1 110 ? -33.204 15.824  5.880   1.00 35.25 ? 110  HIS B CD2   1 
ATOM   2088 C  CE1   . HIS B 1 110 ? -31.516 15.329  7.188   1.00 35.96 ? 110  HIS B CE1   1 
ATOM   2089 N  NE2   . HIS B 1 110 ? -32.827 15.485  7.156   1.00 35.84 ? 110  HIS B NE2   1 
ATOM   2090 N  N     . HIS B 1 111 ? -32.091 15.391  0.518   1.00 20.80 ? 111  HIS B N     1 
ATOM   2091 C  CA    . HIS B 1 111 ? -31.868 15.833  -0.863  1.00 18.99 ? 111  HIS B CA    1 
ATOM   2092 C  C     . HIS B 1 111 ? -32.186 14.796  -1.932  1.00 16.93 ? 111  HIS B C     1 
ATOM   2093 O  O     . HIS B 1 111 ? -32.104 15.096  -3.122  1.00 18.64 ? 111  HIS B O     1 
ATOM   2094 C  CB    . HIS B 1 111 ? -30.411 16.258  -1.060  1.00 18.29 ? 111  HIS B CB    1 
ATOM   2095 C  CG    . HIS B 1 111 ? -29.942 17.300  -0.096  1.00 20.41 ? 111  HIS B CG    1 
ATOM   2096 N  ND1   . HIS B 1 111 ? -29.482 16.989  1.165   1.00 18.56 ? 111  HIS B ND1   1 
ATOM   2097 C  CD2   . HIS B 1 111 ? -29.836 18.644  -0.216  1.00 19.23 ? 111  HIS B CD2   1 
ATOM   2098 C  CE1   . HIS B 1 111 ? -29.110 18.097  1.780   1.00 22.29 ? 111  HIS B CE1   1 
ATOM   2099 N  NE2   . HIS B 1 111 ? -29.315 19.115  0.964   1.00 24.37 ? 111  HIS B NE2   1 
ATOM   2100 N  N     . LEU B 1 112 ? -32.524 13.582  -1.514  1.00 18.39 ? 112  LEU B N     1 
ATOM   2101 C  CA    . LEU B 1 112 ? -32.807 12.488  -2.442  1.00 19.16 ? 112  LEU B CA    1 
ATOM   2102 C  C     . LEU B 1 112 ? -31.576 12.199  -3.312  1.00 19.94 ? 112  LEU B C     1 
ATOM   2103 O  O     . LEU B 1 112 ? -31.675 11.991  -4.524  1.00 15.86 ? 112  LEU B O     1 
ATOM   2104 C  CB    . LEU B 1 112 ? -34.042 12.774  -3.309  1.00 21.97 ? 112  LEU B CB    1 
ATOM   2105 C  CG    . LEU B 1 112 ? -35.378 12.955  -2.581  1.00 24.58 ? 112  LEU B CG    1 
ATOM   2106 C  CD1   . LEU B 1 112 ? -36.522 12.923  -3.585  1.00 27.23 ? 112  LEU B CD1   1 
ATOM   2107 C  CD2   . LEU B 1 112 ? -35.566 11.865  -1.553  1.00 23.46 ? 112  LEU B CD2   1 
ATOM   2108 N  N     . LEU B 1 113 ? -30.406 12.270  -2.684  1.00 16.68 ? 113  LEU B N     1 
ATOM   2109 C  CA    . LEU B 1 113 ? -29.143 11.974  -3.354  1.00 16.77 ? 113  LEU B CA    1 
ATOM   2110 C  C     . LEU B 1 113 ? -28.534 10.791  -2.610  1.00 16.31 ? 113  LEU B C     1 
ATOM   2111 O  O     . LEU B 1 113 ? -28.688 10.665  -1.399  1.00 15.49 ? 113  LEU B O     1 
ATOM   2112 C  CB    . LEU B 1 113 ? -28.199 13.182  -3.334  1.00 18.75 ? 113  LEU B CB    1 
ATOM   2113 C  CG    . LEU B 1 113 ? -28.553 14.304  -4.316  1.00 16.82 ? 113  LEU B CG    1 
ATOM   2114 C  CD1   . LEU B 1 113 ? -27.558 15.444  -4.195  1.00 15.22 ? 113  LEU B CD1   1 
ATOM   2115 C  CD2   . LEU B 1 113 ? -28.560 13.757  -5.739  1.00 16.16 ? 113  LEU B CD2   1 
ATOM   2116 N  N     . PRO B 1 114 ? -27.844 9.901   -3.330  1.00 16.76 ? 114  PRO B N     1 
ATOM   2117 C  CA    . PRO B 1 114 ? -27.237 8.733   -2.690  1.00 16.46 ? 114  PRO B CA    1 
ATOM   2118 C  C     . PRO B 1 114 ? -26.143 9.004   -1.669  1.00 16.50 ? 114  PRO B C     1 
ATOM   2119 O  O     . PRO B 1 114 ? -25.421 9.999   -1.743  1.00 15.63 ? 114  PRO B O     1 
ATOM   2120 C  CB    . PRO B 1 114 ? -26.639 7.965   -3.876  1.00 16.15 ? 114  PRO B CB    1 
ATOM   2121 C  CG    . PRO B 1 114 ? -27.465 8.407   -5.040  1.00 17.45 ? 114  PRO B CG    1 
ATOM   2122 C  CD    . PRO B 1 114 ? -27.600 9.879   -4.780  1.00 15.93 ? 114  PRO B CD    1 
ATOM   2123 N  N     . PHE B 1 115 ? -26.099 8.137   -0.665  1.00 16.69 ? 115  PHE B N     1 
ATOM   2124 C  CA    . PHE B 1 115 ? -25.035 8.146   0.324   1.00 15.45 ? 115  PHE B CA    1 
ATOM   2125 C  C     . PHE B 1 115 ? -24.737 6.661   0.456   1.00 13.14 ? 115  PHE B C     1 
ATOM   2126 O  O     . PHE B 1 115 ? -25.646 5.828   0.415   1.00 14.73 ? 115  PHE B O     1 
ATOM   2127 C  CB    . PHE B 1 115 ? -25.371 8.897   1.633   1.00 17.52 ? 115  PHE B CB    1 
ATOM   2128 C  CG    . PHE B 1 115 ? -26.330 8.198   2.563   1.00 16.38 ? 115  PHE B CG    1 
ATOM   2129 C  CD1   . PHE B 1 115 ? -25.854 7.374   3.582   1.00 15.60 ? 115  PHE B CD1   1 
ATOM   2130 C  CD2   . PHE B 1 115 ? -27.692 8.478   2.514   1.00 15.16 ? 115  PHE B CD2   1 
ATOM   2131 C  CE1   . PHE B 1 115 ? -26.716 6.850   4.539   1.00 15.10 ? 115  PHE B CE1   1 
ATOM   2132 C  CE2   . PHE B 1 115 ? -28.568 7.958   3.469   1.00 16.30 ? 115  PHE B CE2   1 
ATOM   2133 C  CZ    . PHE B 1 115 ? -28.081 7.144   4.485   1.00 16.23 ? 115  PHE B CZ    1 
ATOM   2134 N  N     . PHE B 1 116 ? -23.457 6.317   0.485   1.00 15.47 ? 116  PHE B N     1 
ATOM   2135 C  CA    . PHE B 1 116 ? -23.091 4.911   0.518   1.00 12.32 ? 116  PHE B CA    1 
ATOM   2136 C  C     . PHE B 1 116 ? -21.778 4.637   1.223   1.00 11.61 ? 116  PHE B C     1 
ATOM   2137 O  O     . PHE B 1 116 ? -20.994 5.545   1.489   1.00 13.91 ? 116  PHE B O     1 
ATOM   2138 C  CB    . PHE B 1 116 ? -23.023 4.383   -0.917  1.00 13.10 ? 116  PHE B CB    1 
ATOM   2139 C  CG    . PHE B 1 116 ? -22.175 5.226   -1.830  1.00 18.98 ? 116  PHE B CG    1 
ATOM   2140 C  CD1   . PHE B 1 116 ? -22.701 6.366   -2.436  1.00 21.47 ? 116  PHE B CD1   1 
ATOM   2141 C  CD2   . PHE B 1 116 ? -20.842 4.906   -2.056  1.00 23.44 ? 116  PHE B CD2   1 
ATOM   2142 C  CE1   . PHE B 1 116 ? -21.909 7.177   -3.251  1.00 21.96 ? 116  PHE B CE1   1 
ATOM   2143 C  CE2   . PHE B 1 116 ? -20.041 5.711   -2.869  1.00 23.44 ? 116  PHE B CE2   1 
ATOM   2144 C  CZ    . PHE B 1 116 ? -20.579 6.848   -3.465  1.00 22.39 ? 116  PHE B CZ    1 
ATOM   2145 N  N     . GLY B 1 117 ? -21.546 3.363   1.503   1.00 13.86 ? 117  GLY B N     1 
ATOM   2146 C  CA    . GLY B 1 117 ? -20.333 2.973   2.186   1.00 14.76 ? 117  GLY B CA    1 
ATOM   2147 C  C     . GLY B 1 117 ? -20.444 1.548   2.664   1.00 11.81 ? 117  GLY B C     1 
ATOM   2148 O  O     . GLY B 1 117 ? -20.846 0.662   1.913   1.00 11.66 ? 117  GLY B O     1 
ATOM   2149 N  N     . LYS B 1 118 ? -20.141 1.335   3.939   1.00 13.02 ? 118  LYS B N     1 
ATOM   2150 C  CA    . LYS B 1 118 ? -20.172 0.003   4.505   1.00 13.36 ? 118  LYS B CA    1 
ATOM   2151 C  C     . LYS B 1 118 ? -20.801 -0.032  5.889   1.00 13.64 ? 118  LYS B C     1 
ATOM   2152 O  O     . LYS B 1 118 ? -20.783 0.964   6.620   1.00 13.17 ? 118  LYS B O     1 
ATOM   2153 C  CB    . LYS B 1 118 ? -18.739 -0.550  4.596   1.00 15.12 ? 118  LYS B CB    1 
ATOM   2154 C  CG    . LYS B 1 118 ? -18.061 -0.766  3.248   1.00 17.85 ? 118  LYS B CG    1 
ATOM   2155 C  CD    . LYS B 1 118 ? -16.584 -1.082  3.414   1.00 26.02 ? 118  LYS B CD    1 
ATOM   2156 C  CE    . LYS B 1 118 ? -15.935 -1.422  2.072   1.00 31.96 ? 118  LYS B CE    1 
ATOM   2157 N  NZ    . LYS B 1 118 ? -16.076 -0.344  1.044   1.00 36.09 ? 118  LYS B NZ    1 
ATOM   2158 N  N     . VAL B 1 119 ? -21.366 -1.188  6.227   1.00 11.90 ? 119  VAL B N     1 
ATOM   2159 C  CA    . VAL B 1 119 ? -21.974 -1.410  7.539   1.00 11.18 ? 119  VAL B CA    1 
ATOM   2160 C  C     . VAL B 1 119 ? -21.206 -2.561  8.193   1.00 11.66 ? 119  VAL B C     1 
ATOM   2161 O  O     . VAL B 1 119 ? -20.943 -3.581  7.556   1.00 11.37 ? 119  VAL B O     1 
ATOM   2162 C  CB    . VAL B 1 119 ? -23.472 -1.802  7.434   1.00 14.14 ? 119  VAL B CB    1 
ATOM   2163 C  CG1   . VAL B 1 119 ? -24.052 -2.065  8.836   1.00 11.91 ? 119  VAL B CG1   1 
ATOM   2164 C  CG2   . VAL B 1 119 ? -24.265 -0.694  6.733   1.00 12.21 ? 119  VAL B CG2   1 
ATOM   2165 N  N     . HIS B 1 120 ? -20.828 -2.382  9.455   1.00 10.43 ? 120  HIS B N     1 
ATOM   2166 C  CA    . HIS B 1 120 ? -20.095 -3.405  10.191  1.00 10.70 ? 120  HIS B CA    1 
ATOM   2167 C  C     . HIS B 1 120 ? -20.992 -3.814  11.351  1.00 12.61 ? 120  HIS B C     1 
ATOM   2168 O  O     . HIS B 1 120 ? -21.521 -2.963  12.066  1.00 11.34 ? 120  HIS B O     1 
ATOM   2169 C  CB    . HIS B 1 120 ? -18.771 -2.841  10.725  1.00 12.20 ? 120  HIS B CB    1 
ATOM   2170 C  CG    . HIS B 1 120 ? -17.979 -2.086  9.706   1.00 14.03 ? 120  HIS B CG    1 
ATOM   2171 N  ND1   . HIS B 1 120 ? -17.370 -2.697  8.630   1.00 11.97 ? 120  HIS B ND1   1 
ATOM   2172 C  CD2   . HIS B 1 120 ? -17.711 -0.762  9.590   1.00 15.04 ? 120  HIS B CD2   1 
ATOM   2173 C  CE1   . HIS B 1 120 ? -16.765 -1.783  7.893   1.00 17.50 ? 120  HIS B CE1   1 
ATOM   2174 N  NE2   . HIS B 1 120 ? -16.957 -0.601  8.453   1.00 14.71 ? 120  HIS B NE2   1 
ATOM   2175 N  N     . ILE B 1 121 ? -21.186 -5.116  11.521  1.00 12.76 ? 121  ILE B N     1 
ATOM   2176 C  CA    . ILE B 1 121 ? -22.050 -5.602  12.585  1.00 12.93 ? 121  ILE B CA    1 
ATOM   2177 C  C     . ILE B 1 121 ? -21.332 -6.522  13.562  1.00 13.13 ? 121  ILE B C     1 
ATOM   2178 O  O     . ILE B 1 121 ? -20.599 -7.422  13.158  1.00 13.84 ? 121  ILE B O     1 
ATOM   2179 C  CB    . ILE B 1 121 ? -23.262 -6.349  11.987  1.00 15.43 ? 121  ILE B CB    1 
ATOM   2180 C  CG1   . ILE B 1 121 ? -24.043 -5.408  11.058  1.00 16.34 ? 121  ILE B CG1   1 
ATOM   2181 C  CG2   . ILE B 1 121 ? -24.167 -6.865  13.092  1.00 15.04 ? 121  ILE B CG2   1 
ATOM   2182 C  CD1   . ILE B 1 121 ? -25.032 -6.112  10.145  1.00 18.45 ? 121  ILE B CD1   1 
ATOM   2183 N  N     . GLY B 1 122 ? -21.558 -6.293  14.852  1.00 13.40 ? 122  GLY B N     1 
ATOM   2184 C  CA    . GLY B 1 122 ? -20.962 -7.145  15.864  1.00 14.44 ? 122  GLY B CA    1 
ATOM   2185 C  C     . GLY B 1 122 ? -22.031 -7.562  16.855  1.00 12.97 ? 122  GLY B C     1 
ATOM   2186 O  O     . GLY B 1 122 ? -22.949 -6.792  17.130  1.00 12.48 ? 122  GLY B O     1 
ATOM   2187 N  N     . TYR B 1 123 ? -21.959 -8.790  17.356  1.00 12.22 ? 123  TYR B N     1 
ATOM   2188 C  CA    . TYR B 1 123 ? -22.936 -9.240  18.343  1.00 11.24 ? 123  TYR B CA    1 
ATOM   2189 C  C     . TYR B 1 123 ? -22.451 -10.445 19.137  1.00 12.23 ? 123  TYR B C     1 
ATOM   2190 O  O     . TYR B 1 123 ? -21.554 -11.167 18.712  1.00 12.63 ? 123  TYR B O     1 
ATOM   2191 C  CB    . TYR B 1 123 ? -24.298 -9.539  17.691  1.00 11.73 ? 123  TYR B CB    1 
ATOM   2192 C  CG    . TYR B 1 123 ? -24.416 -10.896 17.030  1.00 16.36 ? 123  TYR B CG    1 
ATOM   2193 C  CD1   . TYR B 1 123 ? -25.135 -11.926 17.639  1.00 16.17 ? 123  TYR B CD1   1 
ATOM   2194 C  CD2   . TYR B 1 123 ? -23.828 -11.147 15.793  1.00 15.55 ? 123  TYR B CD2   1 
ATOM   2195 C  CE1   . TYR B 1 123 ? -25.270 -13.171 17.029  1.00 17.25 ? 123  TYR B CE1   1 
ATOM   2196 C  CE2   . TYR B 1 123 ? -23.952 -12.394 15.174  1.00 14.38 ? 123  TYR B CE2   1 
ATOM   2197 C  CZ    . TYR B 1 123 ? -24.679 -13.397 15.798  1.00 18.52 ? 123  TYR B CZ    1 
ATOM   2198 O  OH    . TYR B 1 123 ? -24.833 -14.613 15.182  1.00 16.12 ? 123  TYR B OH    1 
ATOM   2199 N  N     . ILE B 1 124 ? -23.017 -10.607 20.324  1.00 12.66 ? 124  ILE B N     1 
ATOM   2200 C  CA    . ILE B 1 124 ? -22.692 -11.727 21.190  1.00 14.66 ? 124  ILE B CA    1 
ATOM   2201 C  C     . ILE B 1 124 ? -24.020 -12.448 21.371  1.00 14.50 ? 124  ILE B C     1 
ATOM   2202 O  O     . ILE B 1 124 ? -24.991 -11.883 21.879  1.00 15.48 ? 124  ILE B O     1 
ATOM   2203 C  CB    . ILE B 1 124 ? -22.087 -11.246 22.529  1.00 11.48 ? 124  ILE B CB    1 
ATOM   2204 C  CG1   . ILE B 1 124 ? -20.702 -10.644 22.263  1.00 12.77 ? 124  ILE B CG1   1 
ATOM   2205 C  CG2   . ILE B 1 124 ? -21.977 -12.412 23.515  1.00 16.98 ? 124  ILE B CG2   1 
ATOM   2206 C  CD1   . ILE B 1 124 ? -20.074 -9.960  23.459  1.00 19.17 ? 124  ILE B CD1   1 
ATOM   2207 N  N     . PRO B 1 125 ? -24.089 -13.701 20.906  1.00 17.63 ? 125  PRO B N     1 
ATOM   2208 C  CA    . PRO B 1 125 ? -25.283 -14.546 20.974  1.00 20.71 ? 125  PRO B CA    1 
ATOM   2209 C  C     . PRO B 1 125 ? -25.749 -14.935 22.370  1.00 21.07 ? 125  PRO B C     1 
ATOM   2210 O  O     . PRO B 1 125 ? -24.972 -14.951 23.321  1.00 22.76 ? 125  PRO B O     1 
ATOM   2211 C  CB    . PRO B 1 125 ? -24.857 -15.808 20.210  1.00 19.17 ? 125  PRO B CB    1 
ATOM   2212 C  CG    . PRO B 1 125 ? -23.640 -15.388 19.426  1.00 25.23 ? 125  PRO B CG    1 
ATOM   2213 C  CD    . PRO B 1 125 ? -22.953 -14.453 20.355  1.00 18.79 ? 125  PRO B CD    1 
ATOM   2214 N  N     . ASP B 1 126 ? -27.043 -15.221 22.469  1.00 24.86 ? 126  ASP B N     1 
ATOM   2215 C  CA    . ASP B 1 126 ? -27.649 -15.708 23.700  1.00 25.82 ? 126  ASP B CA    1 
ATOM   2216 C  C     . ASP B 1 126 ? -28.410 -16.955 23.259  1.00 26.58 ? 126  ASP B C     1 
ATOM   2217 O  O     . ASP B 1 126 ? -29.641 -16.986 23.265  1.00 29.95 ? 126  ASP B O     1 
ATOM   2218 C  CB    . ASP B 1 126 ? -28.610 -14.696 24.337  1.00 24.76 ? 126  ASP B CB    1 
ATOM   2219 C  CG    . ASP B 1 126 ? -29.186 -15.201 25.667  1.00 29.89 ? 126  ASP B CG    1 
ATOM   2220 O  OD1   . ASP B 1 126 ? -28.543 -16.059 26.311  1.00 29.47 ? 126  ASP B OD1   1 
ATOM   2221 O  OD2   . ASP B 1 126 ? -30.284 -14.758 26.060  1.00 28.40 ? 126  ASP B OD2   1 
ATOM   2222 N  N     . GLY B 1 127 ? -27.654 -17.951 22.802  1.00 29.05 ? 127  GLY B N     1 
ATOM   2223 C  CA    . GLY B 1 127 ? -28.239 -19.199 22.347  1.00 30.21 ? 127  GLY B CA    1 
ATOM   2224 C  C     . GLY B 1 127 ? -28.646 -19.248 20.883  1.00 29.62 ? 127  GLY B C     1 
ATOM   2225 O  O     . GLY B 1 127 ? -28.957 -20.323 20.371  1.00 30.66 ? 127  GLY B O     1 
ATOM   2226 N  N     . LYS B 1 128 ? -28.621 -18.108 20.195  1.00 27.64 ? 128  LYS B N     1 
ATOM   2227 C  CA    . LYS B 1 128 ? -29.017 -18.065 18.786  1.00 25.46 ? 128  LYS B CA    1 
ATOM   2228 C  C     . LYS B 1 128 ? -28.106 -17.222 17.895  1.00 23.95 ? 128  LYS B C     1 
ATOM   2229 O  O     . LYS B 1 128 ? -27.733 -16.106 18.256  1.00 21.00 ? 128  LYS B O     1 
ATOM   2230 C  CB    . LYS B 1 128 ? -30.449 -17.531 18.658  1.00 29.97 ? 128  LYS B CB    1 
ATOM   2231 C  CG    . LYS B 1 128 ? -31.535 -18.473 19.161  1.00 34.55 ? 128  LYS B CG    1 
ATOM   2232 C  CD    . LYS B 1 128 ? -32.909 -17.818 19.114  1.00 42.12 ? 128  LYS B CD    1 
ATOM   2233 C  CE    . LYS B 1 128 ? -33.003 -16.642 20.076  1.00 44.97 ? 128  LYS B CE    1 
ATOM   2234 N  NZ    . LYS B 1 128 ? -34.346 -15.992 20.039  1.00 49.45 ? 128  LYS B NZ    1 
ATOM   2235 N  N     . ILE B 1 129 ? -27.757 -17.762 16.729  1.00 21.91 ? 129  ILE B N     1 
ATOM   2236 C  CA    . ILE B 1 129 ? -26.930 -17.038 15.766  1.00 19.47 ? 129  ILE B CA    1 
ATOM   2237 C  C     . ILE B 1 129 ? -27.696 -16.910 14.453  1.00 19.99 ? 129  ILE B C     1 
ATOM   2238 O  O     . ILE B 1 129 ? -28.542 -17.747 14.125  1.00 21.27 ? 129  ILE B O     1 
ATOM   2239 C  CB    . ILE B 1 129 ? -25.535 -17.693 15.524  1.00 19.82 ? 129  ILE B CB    1 
ATOM   2240 C  CG1   . ILE B 1 129 ? -25.668 -19.121 14.998  1.00 19.55 ? 129  ILE B CG1   1 
ATOM   2241 C  CG2   . ILE B 1 129 ? -24.705 -17.647 16.796  1.00 19.95 ? 129  ILE B CG2   1 
ATOM   2242 C  CD1   . ILE B 1 129 ? -24.322 -19.764 14.653  1.00 16.66 ? 129  ILE B CD1   1 
ATOM   2243 N  N     . LEU B 1 130 ? -27.395 -15.856 13.705  1.00 17.49 ? 130  LEU B N     1 
ATOM   2244 C  CA    . LEU B 1 130 ? -28.068 -15.585 12.443  1.00 19.10 ? 130  LEU B CA    1 
ATOM   2245 C  C     . LEU B 1 130 ? -27.253 -15.990 11.227  1.00 19.65 ? 130  LEU B C     1 
ATOM   2246 O  O     . LEU B 1 130 ? -26.023 -15.891 11.236  1.00 18.63 ? 130  LEU B O     1 
ATOM   2247 C  CB    . LEU B 1 130 ? -28.382 -14.087 12.360  1.00 22.22 ? 130  LEU B CB    1 
ATOM   2248 C  CG    . LEU B 1 130 ? -29.178 -13.542 11.175  1.00 23.71 ? 130  LEU B CG    1 
ATOM   2249 C  CD1   . LEU B 1 130 ? -30.596 -14.094 11.206  1.00 25.24 ? 130  LEU B CD1   1 
ATOM   2250 C  CD2   . LEU B 1 130 ? -29.197 -12.028 11.230  1.00 20.76 ? 130  LEU B CD2   1 
ATOM   2251 N  N     . GLY B 1 131 ? -27.943 -16.460 10.185  1.00 16.28 ? 131  GLY B N     1 
ATOM   2252 C  CA    . GLY B 1 131 ? -27.265 -16.815 8.951   1.00 14.84 ? 131  GLY B CA    1 
ATOM   2253 C  C     . GLY B 1 131 ? -26.562 -15.541 8.501   1.00 16.53 ? 131  GLY B C     1 
ATOM   2254 O  O     . GLY B 1 131 ? -27.185 -14.480 8.449   1.00 16.43 ? 131  GLY B O     1 
ATOM   2255 N  N     . LEU B 1 132 ? -25.269 -15.634 8.200   1.00 17.11 ? 132  LEU B N     1 
ATOM   2256 C  CA    . LEU B 1 132 ? -24.475 -14.463 7.810   1.00 15.53 ? 132  LEU B CA    1 
ATOM   2257 C  C     . LEU B 1 132 ? -25.081 -13.539 6.757   1.00 16.14 ? 132  LEU B C     1 
ATOM   2258 O  O     . LEU B 1 132 ? -25.072 -12.319 6.922   1.00 16.30 ? 132  LEU B O     1 
ATOM   2259 C  CB    . LEU B 1 132 ? -23.066 -14.884 7.389   1.00 17.39 ? 132  LEU B CB    1 
ATOM   2260 C  CG    . LEU B 1 132 ? -22.227 -15.563 8.471   1.00 17.07 ? 132  LEU B CG    1 
ATOM   2261 C  CD1   . LEU B 1 132 ? -20.895 -15.964 7.880   1.00 20.21 ? 132  LEU B CD1   1 
ATOM   2262 C  CD2   . LEU B 1 132 ? -22.041 -14.648 9.686   1.00 16.71 ? 132  LEU B CD2   1 
ATOM   2263 N  N     . SER B 1 133 ? -25.642 -14.117 5.701   1.00 16.25 ? 133  SER B N     1 
ATOM   2264 C  CA    . SER B 1 133 ? -26.236 -13.323 4.631   1.00 15.99 ? 133  SER B CA    1 
ATOM   2265 C  C     . SER B 1 133 ? -27.445 -12.507 5.084   1.00 16.39 ? 133  SER B C     1 
ATOM   2266 O  O     . SER B 1 133 ? -27.759 -11.475 4.479   1.00 16.72 ? 133  SER B O     1 
ATOM   2267 C  CB    . SER B 1 133 ? -26.651 -14.219 3.467   1.00 17.87 ? 133  SER B CB    1 
ATOM   2268 O  OG    . SER B 1 133 ? -27.800 -14.969 3.813   1.00 18.89 ? 133  SER B OG    1 
ATOM   2269 N  N     . LYS B 1 134 ? -28.126 -12.962 6.135   1.00 16.78 ? 134  LYS B N     1 
ATOM   2270 C  CA    . LYS B 1 134 ? -29.301 -12.245 6.621   1.00 16.08 ? 134  LYS B CA    1 
ATOM   2271 C  C     . LYS B 1 134 ? -28.936 -10.859 7.139   1.00 17.84 ? 134  LYS B C     1 
ATOM   2272 O  O     . LYS B 1 134 ? -29.757 -9.940  7.090   1.00 16.83 ? 134  LYS B O     1 
ATOM   2273 C  CB    . LYS B 1 134 ? -30.062 -13.054 7.673   1.00 15.99 ? 134  LYS B CB    1 
ATOM   2274 C  CG    . LYS B 1 134 ? -30.487 -14.435 7.201   1.00 19.18 ? 134  LYS B CG    1 
ATOM   2275 C  CD    . LYS B 1 134 ? -31.072 -14.406 5.786   1.00 18.44 ? 134  LYS B CD    1 
ATOM   2276 C  CE    . LYS B 1 134 ? -31.427 -15.812 5.326   1.00 19.59 ? 134  LYS B CE    1 
ATOM   2277 N  NZ    . LYS B 1 134 ? -31.983 -15.881 3.952   1.00 18.57 ? 134  LYS B NZ    1 
ATOM   2278 N  N     . PHE B 1 135 ? -27.705 -10.693 7.618   1.00 15.33 ? 135  PHE B N     1 
ATOM   2279 C  CA    . PHE B 1 135 ? -27.274 -9.373  8.075   1.00 16.30 ? 135  PHE B CA    1 
ATOM   2280 C  C     . PHE B 1 135 ? -27.297 -8.419  6.886   1.00 14.22 ? 135  PHE B C     1 
ATOM   2281 O  O     . PHE B 1 135 ? -27.759 -7.283  7.000   1.00 16.30 ? 135  PHE B O     1 
ATOM   2282 C  CB    . PHE B 1 135 ? -25.873 -9.423  8.676   1.00 15.78 ? 135  PHE B CB    1 
ATOM   2283 C  CG    . PHE B 1 135 ? -25.826 -10.065 10.028  1.00 15.22 ? 135  PHE B CG    1 
ATOM   2284 C  CD1   . PHE B 1 135 ? -26.330 -9.402  11.140  1.00 15.66 ? 135  PHE B CD1   1 
ATOM   2285 C  CD2   . PHE B 1 135 ? -25.282 -11.337 10.190  1.00 14.75 ? 135  PHE B CD2   1 
ATOM   2286 C  CE1   . PHE B 1 135 ? -26.293 -9.994  12.401  1.00 19.05 ? 135  PHE B CE1   1 
ATOM   2287 C  CE2   . PHE B 1 135 ? -25.243 -11.937 11.443  1.00 17.17 ? 135  PHE B CE2   1 
ATOM   2288 C  CZ    . PHE B 1 135 ? -25.748 -11.266 12.552  1.00 17.04 ? 135  PHE B CZ    1 
ATOM   2289 N  N     . ALA B 1 136 ? -26.820 -8.903  5.740   1.00 14.76 ? 136  ALA B N     1 
ATOM   2290 C  CA    . ALA B 1 136 ? -26.799 -8.109  4.512   1.00 15.58 ? 136  ALA B CA    1 
ATOM   2291 C  C     . ALA B 1 136 ? -28.222 -7.807  4.044   1.00 15.80 ? 136  ALA B C     1 
ATOM   2292 O  O     . ALA B 1 136 ? -28.503 -6.710  3.560   1.00 12.75 ? 136  ALA B O     1 
ATOM   2293 C  CB    . ALA B 1 136 ? -26.028 -8.840  3.424   1.00 16.21 ? 136  ALA B CB    1 
ATOM   2294 N  N     . ARG B 1 137 ? -29.115 -8.787  4.174   1.00 14.56 ? 137  ARG B N     1 
ATOM   2295 C  CA    . ARG B 1 137 ? -30.511 -8.588  3.783   1.00 17.74 ? 137  ARG B CA    1 
ATOM   2296 C  C     . ARG B 1 137 ? -31.193 -7.552  4.683   1.00 16.36 ? 137  ARG B C     1 
ATOM   2297 O  O     . ARG B 1 137 ? -32.019 -6.768  4.212   1.00 16.83 ? 137  ARG B O     1 
ATOM   2298 C  CB    . ARG B 1 137 ? -31.277 -9.914  3.784   1.00 15.29 ? 137  ARG B CB    1 
ATOM   2299 C  CG    . ARG B 1 137 ? -30.803 -10.873 2.708   1.00 18.59 ? 137  ARG B CG    1 
ATOM   2300 C  CD    . ARG B 1 137 ? -31.683 -12.110 2.605   1.00 21.80 ? 137  ARG B CD    1 
ATOM   2301 N  NE    . ARG B 1 137 ? -31.206 -13.031 1.571   1.00 24.21 ? 137  ARG B NE    1 
ATOM   2302 C  CZ    . ARG B 1 137 ? -31.363 -12.849 0.261   1.00 22.62 ? 137  ARG B CZ    1 
ATOM   2303 N  NH1   . ARG B 1 137 ? -31.994 -11.776 -0.200  1.00 22.60 ? 137  ARG B NH1   1 
ATOM   2304 N  NH2   . ARG B 1 137 ? -30.862 -13.730 -0.594  1.00 22.76 ? 137  ARG B NH2   1 
ATOM   2305 N  N     . ILE B 1 138 ? -30.838 -7.546  5.969   1.00 15.10 ? 138  ILE B N     1 
ATOM   2306 C  CA    . ILE B 1 138 ? -31.383 -6.577  6.922   1.00 15.52 ? 138  ILE B CA    1 
ATOM   2307 C  C     . ILE B 1 138 ? -30.833 -5.186  6.577   1.00 14.73 ? 138  ILE B C     1 
ATOM   2308 O  O     . ILE B 1 138 ? -31.562 -4.188  6.609   1.00 13.82 ? 138  ILE B O     1 
ATOM   2309 C  CB    . ILE B 1 138 ? -31.012 -6.948  8.389   1.00 14.94 ? 138  ILE B CB    1 
ATOM   2310 C  CG1   . ILE B 1 138 ? -31.793 -8.194  8.824   1.00 17.06 ? 138  ILE B CG1   1 
ATOM   2311 C  CG2   . ILE B 1 138 ? -31.284 -5.773  9.330   1.00 16.69 ? 138  ILE B CG2   1 
ATOM   2312 C  CD1   . ILE B 1 138 ? -31.432 -8.705  10.208  1.00 14.05 ? 138  ILE B CD1   1 
ATOM   2313 N  N     . VAL B 1 139 ? -29.550 -5.128  6.229   1.00 13.10 ? 139  VAL B N     1 
ATOM   2314 C  CA    . VAL B 1 139 ? -28.919 -3.862  5.850   1.00 12.21 ? 139  VAL B CA    1 
ATOM   2315 C  C     . VAL B 1 139 ? -29.670 -3.262  4.654   1.00 12.94 ? 139  VAL B C     1 
ATOM   2316 O  O     . VAL B 1 139 ? -30.069 -2.099  4.688   1.00 14.03 ? 139  VAL B O     1 
ATOM   2317 C  CB    . VAL B 1 139 ? -27.426 -4.072  5.477   1.00 13.94 ? 139  VAL B CB    1 
ATOM   2318 C  CG1   . VAL B 1 139 ? -26.877 -2.871  4.701   1.00 14.19 ? 139  VAL B CG1   1 
ATOM   2319 C  CG2   . VAL B 1 139 ? -26.603 -4.293  6.739   1.00 11.10 ? 139  VAL B CG2   1 
ATOM   2320 N  N     . ASP B 1 140 ? -29.908 -4.080  3.631   1.00 14.18 ? 140  ASP B N     1 
ATOM   2321 C  CA    . ASP B 1 140 ? -30.602 -3.627  2.428   1.00 14.83 ? 140  ASP B CA    1 
ATOM   2322 C  C     . ASP B 1 140 ? -32.040 -3.185  2.684   1.00 14.30 ? 140  ASP B C     1 
ATOM   2323 O  O     . ASP B 1 140 ? -32.508 -2.224  2.082   1.00 16.45 ? 140  ASP B O     1 
ATOM   2324 C  CB    . ASP B 1 140 ? -30.566 -4.707  1.349   1.00 14.83 ? 140  ASP B CB    1 
ATOM   2325 C  CG    . ASP B 1 140 ? -29.179 -4.883  0.740   1.00 18.45 ? 140  ASP B CG    1 
ATOM   2326 O  OD1   . ASP B 1 140 ? -28.305 -4.014  0.945   1.00 19.88 ? 140  ASP B OD1   1 
ATOM   2327 O  OD2   . ASP B 1 140 ? -28.966 -5.894  0.051   1.00 19.45 ? 140  ASP B OD2   1 
ATOM   2328 N  N     . MET B 1 141 ? -32.733 -3.886  3.575   1.00 15.72 ? 141  MET B N     1 
ATOM   2329 C  CA    . MET B 1 141 ? -34.116 -3.554  3.913   1.00 17.03 ? 141  MET B CA    1 
ATOM   2330 C  C     . MET B 1 141 ? -34.236 -2.123  4.437   1.00 19.04 ? 141  MET B C     1 
ATOM   2331 O  O     . MET B 1 141 ? -35.179 -1.401  4.107   1.00 16.35 ? 141  MET B O     1 
ATOM   2332 C  CB    . MET B 1 141 ? -34.652 -4.527  4.967   1.00 17.74 ? 141  MET B CB    1 
ATOM   2333 C  CG    . MET B 1 141 ? -36.026 -4.152  5.502   1.00 18.67 ? 141  MET B CG    1 
ATOM   2334 S  SD    . MET B 1 141 ? -36.652 -5.368  6.657   1.00 22.40 ? 141  MET B SD    1 
ATOM   2335 C  CE    . MET B 1 141 ? -37.992 -4.438  7.459   1.00 18.47 ? 141  MET B CE    1 
ATOM   2336 N  N     . PHE B 1 142 ? -33.283 -1.723  5.271   1.00 16.97 ? 142  PHE B N     1 
ATOM   2337 C  CA    . PHE B 1 142 ? -33.299 -0.384  5.827   1.00 14.08 ? 142  PHE B CA    1 
ATOM   2338 C  C     . PHE B 1 142 ? -32.570 0.645   4.983   1.00 16.02 ? 142  PHE B C     1 
ATOM   2339 O  O     . PHE B 1 142 ? -32.882 1.834   5.049   1.00 15.23 ? 142  PHE B O     1 
ATOM   2340 C  CB    . PHE B 1 142 ? -32.798 -0.412  7.272   1.00 13.63 ? 142  PHE B CB    1 
ATOM   2341 C  CG    . PHE B 1 142 ? -33.728 -1.141  8.196   1.00 16.33 ? 142  PHE B CG    1 
ATOM   2342 C  CD1   . PHE B 1 142 ? -34.920 -0.549  8.602   1.00 16.28 ? 142  PHE B CD1   1 
ATOM   2343 C  CD2   . PHE B 1 142 ? -33.466 -2.452  8.581   1.00 15.52 ? 142  PHE B CD2   1 
ATOM   2344 C  CE1   . PHE B 1 142 ? -35.843 -1.255  9.372   1.00 17.82 ? 142  PHE B CE1   1 
ATOM   2345 C  CE2   . PHE B 1 142 ? -34.379 -3.164  9.349   1.00 18.72 ? 142  PHE B CE2   1 
ATOM   2346 C  CZ    . PHE B 1 142 ? -35.571 -2.566  9.744   1.00 20.79 ? 142  PHE B CZ    1 
ATOM   2347 N  N     . ALA B 1 143 ? -31.646 0.182   4.144   1.00 13.04 ? 143  ALA B N     1 
ATOM   2348 C  CA    . ALA B 1 143 ? -30.888 1.077   3.281   1.00 14.94 ? 143  ALA B CA    1 
ATOM   2349 C  C     . ALA B 1 143 ? -31.703 1.536   2.065   1.00 14.39 ? 143  ALA B C     1 
ATOM   2350 O  O     . ALA B 1 143 ? -31.577 2.675   1.626   1.00 14.66 ? 143  ALA B O     1 
ATOM   2351 C  CB    . ALA B 1 143 ? -29.596 0.398   2.825   1.00 17.09 ? 143  ALA B CB    1 
ATOM   2352 N  N     . ARG B 1 144 ? -32.548 0.654   1.543   1.00 14.04 ? 144  ARG B N     1 
ATOM   2353 C  CA    . ARG B 1 144 ? -33.361 0.979   0.370   1.00 14.94 ? 144  ARG B CA    1 
ATOM   2354 C  C     . ARG B 1 144 ? -34.641 1.712   0.765   1.00 14.40 ? 144  ARG B C     1 
ATOM   2355 O  O     . ARG B 1 144 ? -35.762 1.218   0.601   1.00 17.49 ? 144  ARG B O     1 
ATOM   2356 C  CB    . ARG B 1 144 ? -33.631 -0.285  -0.448  1.00 18.32 ? 144  ARG B CB    1 
ATOM   2357 C  CG    . ARG B 1 144 ? -32.346 -0.824  -1.089  1.00 19.82 ? 144  ARG B CG    1 
ATOM   2358 C  CD    . ARG B 1 144 ? -32.505 -2.179  -1.750  1.00 22.74 ? 144  ARG B CD    1 
ATOM   2359 N  NE    . ARG B 1 144 ? -31.237 -2.589  -2.352  1.00 23.50 ? 144  ARG B NE    1 
ATOM   2360 C  CZ    . ARG B 1 144 ? -30.886 -3.844  -2.620  1.00 22.23 ? 144  ARG B CZ    1 
ATOM   2361 N  NH1   . ARG B 1 144 ? -31.705 -4.852  -2.350  1.00 21.83 ? 144  ARG B NH1   1 
ATOM   2362 N  NH2   . ARG B 1 144 ? -29.699 -4.090  -3.158  1.00 22.03 ? 144  ARG B NH2   1 
ATOM   2363 N  N     . ARG B 1 145 ? -34.423 2.903   1.310   1.00 14.92 ? 145  ARG B N     1 
ATOM   2364 C  CA    . ARG B 1 145 ? -35.458 3.807   1.789   1.00 16.09 ? 145  ARG B CA    1 
ATOM   2365 C  C     . ARG B 1 145 ? -34.817 5.188   1.773   1.00 18.54 ? 145  ARG B C     1 
ATOM   2366 O  O     . ARG B 1 145 ? -33.663 5.338   1.362   1.00 17.69 ? 145  ARG B O     1 
ATOM   2367 C  CB    . ARG B 1 145 ? -35.790 3.492   3.257   1.00 15.95 ? 145  ARG B CB    1 
ATOM   2368 C  CG    . ARG B 1 145 ? -36.263 2.084   3.546   1.00 16.46 ? 145  ARG B CG    1 
ATOM   2369 C  CD    . ARG B 1 145 ? -36.507 1.880   5.036   1.00 16.58 ? 145  ARG B CD    1 
ATOM   2370 N  NE    . ARG B 1 145 ? -37.035 0.548   5.285   1.00 15.16 ? 145  ARG B NE    1 
ATOM   2371 C  CZ    . ARG B 1 145 ? -37.776 0.208   6.333   1.00 16.66 ? 145  ARG B CZ    1 
ATOM   2372 N  NH1   . ARG B 1 145 ? -38.083 1.106   7.262   1.00 16.47 ? 145  ARG B NH1   1 
ATOM   2373 N  NH2   . ARG B 1 145 ? -38.253 -1.027  6.422   1.00 15.12 ? 145  ARG B NH2   1 
ATOM   2374 N  N     . LEU B 1 146 ? -35.575 6.199   2.192   1.00 14.94 ? 146  LEU B N     1 
ATOM   2375 C  CA    . LEU B 1 146 ? -35.039 7.545   2.317   1.00 17.88 ? 146  LEU B CA    1 
ATOM   2376 C  C     . LEU B 1 146 ? -34.531 7.510   3.756   1.00 18.84 ? 146  LEU B C     1 
ATOM   2377 O  O     . LEU B 1 146 ? -35.265 7.103   4.664   1.00 20.29 ? 146  LEU B O     1 
ATOM   2378 C  CB    . LEU B 1 146 ? -36.136 8.593   2.153   1.00 17.79 ? 146  LEU B CB    1 
ATOM   2379 C  CG    . LEU B 1 146 ? -36.817 8.568   0.787   1.00 16.36 ? 146  LEU B CG    1 
ATOM   2380 C  CD1   . LEU B 1 146 ? -37.709 9.790   0.646   1.00 15.73 ? 146  LEU B CD1   1 
ATOM   2381 C  CD2   . LEU B 1 146 ? -35.780 8.545   -0.316  1.00 15.49 ? 146  LEU B CD2   1 
ATOM   2382 N  N     . GLN B 1 147 ? -33.301 7.959   3.977   1.00 17.35 ? 147  GLN B N     1 
ATOM   2383 C  CA    . GLN B 1 147 ? -32.712 7.857   5.305   1.00 14.93 ? 147  GLN B CA    1 
ATOM   2384 C  C     . GLN B 1 147 ? -31.799 8.982   5.747   1.00 14.10 ? 147  GLN B C     1 
ATOM   2385 O  O     . GLN B 1 147 ? -31.504 9.911   5.001   1.00 16.71 ? 147  GLN B O     1 
ATOM   2386 C  CB    . GLN B 1 147 ? -31.857 6.572   5.346   1.00 16.62 ? 147  GLN B CB    1 
ATOM   2387 C  CG    . GLN B 1 147 ? -32.612 5.260   5.512   1.00 15.36 ? 147  GLN B CG    1 
ATOM   2388 C  CD    . GLN B 1 147 ? -32.975 4.990   6.957   1.00 14.81 ? 147  GLN B CD    1 
ATOM   2389 O  OE1   . GLN B 1 147 ? -32.789 5.844   7.820   1.00 17.53 ? 147  GLN B OE1   1 
ATOM   2390 N  NE2   . GLN B 1 147 ? -33.490 3.798   7.228   1.00 16.59 ? 147  GLN B NE2   1 
ATOM   2391 N  N     . VAL B 1 148 ? -31.396 8.879   7.012   1.00 17.78 ? 148  VAL B N     1 
ATOM   2392 C  CA    . VAL B 1 148 ? -30.394 9.744   7.632   1.00 16.96 ? 148  VAL B CA    1 
ATOM   2393 C  C     . VAL B 1 148 ? -29.482 8.639   8.185   1.00 15.56 ? 148  VAL B C     1 
ATOM   2394 O  O     . VAL B 1 148 ? -29.979 7.625   8.681   1.00 17.87 ? 148  VAL B O     1 
ATOM   2395 C  CB    . VAL B 1 148 ? -30.935 10.665  8.764   1.00 21.93 ? 148  VAL B CB    1 
ATOM   2396 C  CG1   . VAL B 1 148 ? -31.751 11.802  8.167   1.00 23.47 ? 148  VAL B CG1   1 
ATOM   2397 C  CG2   . VAL B 1 148 ? -31.758 9.890   9.765   1.00 22.43 ? 148  VAL B CG2   1 
ATOM   2398 N  N     . GLN B 1 149 ? -28.170 8.784   8.027   1.00 14.91 ? 149  GLN B N     1 
ATOM   2399 C  CA    . GLN B 1 149 ? -27.236 7.743   8.467   1.00 15.30 ? 149  GLN B CA    1 
ATOM   2400 C  C     . GLN B 1 149 ? -27.349 7.350   9.940   1.00 14.92 ? 149  GLN B C     1 
ATOM   2401 O  O     . GLN B 1 149 ? -27.168 6.181   10.298  1.00 13.68 ? 149  GLN B O     1 
ATOM   2402 C  CB    . GLN B 1 149 ? -25.799 8.128   8.126   1.00 14.48 ? 149  GLN B CB    1 
ATOM   2403 C  CG    . GLN B 1 149 ? -24.842 6.935   8.113   1.00 14.64 ? 149  GLN B CG    1 
ATOM   2404 C  CD    . GLN B 1 149 ? -23.418 7.329   7.785   1.00 17.40 ? 149  GLN B CD    1 
ATOM   2405 O  OE1   . GLN B 1 149 ? -23.165 8.045   6.814   1.00 17.87 ? 149  GLN B OE1   1 
ATOM   2406 N  NE2   . GLN B 1 149 ? -22.478 6.859   8.592   1.00 12.18 ? 149  GLN B NE2   1 
ATOM   2407 N  N     . GLU B 1 150 ? -27.676 8.321   10.783  1.00 14.92 ? 150  GLU B N     1 
ATOM   2408 C  CA    . GLU B 1 150 ? -27.835 8.082   12.213  1.00 16.34 ? 150  GLU B CA    1 
ATOM   2409 C  C     . GLU B 1 150 ? -28.956 7.085   12.484  1.00 17.24 ? 150  GLU B C     1 
ATOM   2410 O  O     . GLU B 1 150 ? -28.852 6.266   13.395  1.00 16.50 ? 150  GLU B O     1 
ATOM   2411 C  CB    . GLU B 1 150 ? -28.139 9.391   12.957  1.00 19.03 ? 150  GLU B CB    1 
ATOM   2412 C  CG    . GLU B 1 150 ? -26.990 10.399  13.016  1.00 19.58 ? 150  GLU B CG    1 
ATOM   2413 C  CD    . GLU B 1 150 ? -26.861 11.270  11.771  1.00 22.45 ? 150  GLU B CD    1 
ATOM   2414 O  OE1   . GLU B 1 150 ? -27.465 10.957  10.724  1.00 21.64 ? 150  GLU B OE1   1 
ATOM   2415 O  OE2   . GLU B 1 150 ? -26.139 12.284  11.845  1.00 26.18 ? 150  GLU B OE2   1 
ATOM   2416 N  N     . ARG B 1 151 ? -30.034 7.171   11.702  1.00 15.59 ? 151  ARG B N     1 
ATOM   2417 C  CA    . ARG B 1 151 ? -31.182 6.276   11.864  1.00 14.06 ? 151  ARG B CA    1 
ATOM   2418 C  C     . ARG B 1 151 ? -30.892 4.888   11.314  1.00 15.19 ? 151  ARG B C     1 
ATOM   2419 O  O     . ARG B 1 151 ? -31.314 3.882   11.883  1.00 13.47 ? 151  ARG B O     1 
ATOM   2420 C  CB    . ARG B 1 151 ? -32.414 6.846   11.146  1.00 16.08 ? 151  ARG B CB    1 
ATOM   2421 C  CG    . ARG B 1 151 ? -33.687 6.020   11.323  1.00 17.97 ? 151  ARG B CG    1 
ATOM   2422 C  CD    . ARG B 1 151 ? -34.833 6.562   10.465  1.00 19.91 ? 151  ARG B CD    1 
ATOM   2423 N  NE    . ARG B 1 151 ? -35.012 7.996   10.668  1.00 19.81 ? 151  ARG B NE    1 
ATOM   2424 C  CZ    . ARG B 1 151 ? -35.223 8.869   9.690   1.00 18.49 ? 151  ARG B CZ    1 
ATOM   2425 N  NH1   . ARG B 1 151 ? -35.294 8.458   8.428   1.00 19.60 ? 151  ARG B NH1   1 
ATOM   2426 N  NH2   . ARG B 1 151 ? -35.297 10.163  9.970   1.00 23.12 ? 151  ARG B NH2   1 
ATOM   2427 N  N     . LEU B 1 152 ? -30.192 4.847   10.184  1.00 15.54 ? 152  LEU B N     1 
ATOM   2428 C  CA    . LEU B 1 152 ? -29.852 3.594   9.531   1.00 15.14 ? 152  LEU B CA    1 
ATOM   2429 C  C     . LEU B 1 152 ? -29.131 2.637   10.487  1.00 14.36 ? 152  LEU B C     1 
ATOM   2430 O  O     . LEU B 1 152 ? -29.509 1.468   10.598  1.00 13.27 ? 152  LEU B O     1 
ATOM   2431 C  CB    . LEU B 1 152 ? -29.012 3.871   8.280   1.00 12.60 ? 152  LEU B CB    1 
ATOM   2432 C  CG    . LEU B 1 152 ? -28.630 2.682   7.407   1.00 12.40 ? 152  LEU B CG    1 
ATOM   2433 C  CD1   . LEU B 1 152 ? -29.875 1.944   6.948   1.00 14.55 ? 152  LEU B CD1   1 
ATOM   2434 C  CD2   . LEU B 1 152 ? -27.829 3.161   6.213   1.00 10.37 ? 152  LEU B CD2   1 
ATOM   2435 N  N     . ALA B 1 153 ? -28.152 3.152   11.227  1.00 12.99 ? 153  ALA B N     1 
ATOM   2436 C  CA    . ALA B 1 153 ? -27.404 2.331   12.178  1.00 12.47 ? 153  ALA B CA    1 
ATOM   2437 C  C     . ALA B 1 153 ? -28.324 1.783   13.269  1.00 13.51 ? 153  ALA B C     1 
ATOM   2438 O  O     . ALA B 1 153 ? -28.260 0.596   13.610  1.00 13.95 ? 153  ALA B O     1 
ATOM   2439 C  CB    . ALA B 1 153 ? -26.277 3.139   12.803  1.00 15.68 ? 153  ALA B CB    1 
ATOM   2440 N  N     . VAL B 1 154 ? -29.184 2.651   13.798  1.00 13.67 ? 154  VAL B N     1 
ATOM   2441 C  CA    . VAL B 1 154 ? -30.124 2.284   14.859  1.00 15.22 ? 154  VAL B CA    1 
ATOM   2442 C  C     . VAL B 1 154 ? -31.124 1.206   14.443  1.00 12.72 ? 154  VAL B C     1 
ATOM   2443 O  O     . VAL B 1 154 ? -31.320 0.224   15.162  1.00 14.46 ? 154  VAL B O     1 
ATOM   2444 C  CB    . VAL B 1 154 ? -30.895 3.531   15.383  1.00 16.99 ? 154  VAL B CB    1 
ATOM   2445 C  CG1   . VAL B 1 154 ? -31.982 3.114   16.370  1.00 17.64 ? 154  VAL B CG1   1 
ATOM   2446 C  CG2   . VAL B 1 154 ? -29.924 4.518   16.045  1.00 18.30 ? 154  VAL B CG2   1 
ATOM   2447 N  N     . GLN B 1 155 ? -31.760 1.390   13.290  1.00 13.58 ? 155  GLN B N     1 
ATOM   2448 C  CA    . GLN B 1 155 ? -32.744 0.422   12.806  1.00 13.40 ? 155  GLN B CA    1 
ATOM   2449 C  C     . GLN B 1 155 ? -32.149 -0.953  12.513  1.00 14.92 ? 155  GLN B C     1 
ATOM   2450 O  O     . GLN B 1 155 ? -32.803 -1.976  12.730  1.00 16.35 ? 155  GLN B O     1 
ATOM   2451 C  CB    . GLN B 1 155 ? -33.477 0.968   11.579  1.00 17.22 ? 155  GLN B CB    1 
ATOM   2452 C  CG    . GLN B 1 155 ? -34.312 2.213   11.878  1.00 20.75 ? 155  GLN B CG    1 
ATOM   2453 C  CD    . GLN B 1 155 ? -35.137 2.672   10.684  1.00 21.22 ? 155  GLN B CD    1 
ATOM   2454 O  OE1   . GLN B 1 155 ? -34.605 2.915   9.607   1.00 23.17 ? 155  GLN B OE1   1 
ATOM   2455 N  NE2   . GLN B 1 155 ? -36.445 2.795   10.879  1.00 26.75 ? 155  GLN B NE2   1 
ATOM   2456 N  N     . ILE B 1 156 ? -30.926 -0.981  11.986  1.00 14.38 ? 156  ILE B N     1 
ATOM   2457 C  CA    . ILE B 1 156 ? -30.265 -2.254  11.704  1.00 13.82 ? 156  ILE B CA    1 
ATOM   2458 C  C     . ILE B 1 156 ? -30.009 -2.970  13.032  1.00 12.93 ? 156  ILE B C     1 
ATOM   2459 O  O     . ILE B 1 156 ? -30.312 -4.155  13.187  1.00 13.64 ? 156  ILE B O     1 
ATOM   2460 C  CB    . ILE B 1 156 ? -28.934 -2.050  10.936  1.00 12.50 ? 156  ILE B CB    1 
ATOM   2461 C  CG1   . ILE B 1 156 ? -29.230 -1.515  9.523   1.00 16.69 ? 156  ILE B CG1   1 
ATOM   2462 C  CG2   . ILE B 1 156 ? -28.162 -3.378  10.847  1.00 14.91 ? 156  ILE B CG2   1 
ATOM   2463 C  CD1   . ILE B 1 156 ? -27.990 -1.071  8.735   1.00 11.39 ? 156  ILE B CD1   1 
ATOM   2464 N  N     . ALA B 1 157 ? -29.495 -2.227  14.005  1.00 14.96 ? 157  ALA B N     1 
ATOM   2465 C  CA    . ALA B 1 157 ? -29.206 -2.787  15.321  1.00 15.62 ? 157  ALA B CA    1 
ATOM   2466 C  C     . ALA B 1 157 ? -30.479 -3.296  16.009  1.00 16.87 ? 157  ALA B C     1 
ATOM   2467 O  O     . ALA B 1 157 ? -30.492 -4.400  16.553  1.00 15.94 ? 157  ALA B O     1 
ATOM   2468 C  CB    . ALA B 1 157 ? -28.513 -1.748  16.183  1.00 11.91 ? 157  ALA B CB    1 
ATOM   2469 N  N     . GLU B 1 158 ? -31.551 -2.508  15.955  1.00 17.35 ? 158  GLU B N     1 
ATOM   2470 C  CA    . GLU B 1 158 ? -32.817 -2.899  16.579  1.00 18.23 ? 158  GLU B CA    1 
ATOM   2471 C  C     . GLU B 1 158 ? -33.419 -4.121  15.902  1.00 19.50 ? 158  GLU B C     1 
ATOM   2472 O  O     . GLU B 1 158 ? -34.020 -4.970  16.560  1.00 20.17 ? 158  GLU B O     1 
ATOM   2473 C  CB    . GLU B 1 158 ? -33.819 -1.743  16.560  1.00 21.90 ? 158  GLU B CB    1 
ATOM   2474 C  CG    . GLU B 1 158 ? -33.421 -0.581  17.459  1.00 26.15 ? 158  GLU B CG    1 
ATOM   2475 C  CD    . GLU B 1 158 ? -34.461 0.528   17.506  1.00 31.51 ? 158  GLU B CD    1 
ATOM   2476 O  OE1   . GLU B 1 158 ? -34.512 1.235   18.532  1.00 34.53 ? 158  GLU B OE1   1 
ATOM   2477 O  OE2   . GLU B 1 158 ? -35.214 0.707   16.523  1.00 36.38 ? 158  GLU B OE2   1 
ATOM   2478 N  N     . ALA B 1 159 ? -33.233 -4.215  14.588  1.00 15.74 ? 159  ALA B N     1 
ATOM   2479 C  CA    . ALA B 1 159 ? -33.747 -5.343  13.829  1.00 15.37 ? 159  ALA B CA    1 
ATOM   2480 C  C     . ALA B 1 159 ? -33.045 -6.630  14.267  1.00 17.18 ? 159  ALA B C     1 
ATOM   2481 O  O     . ALA B 1 159 ? -33.693 -7.650  14.495  1.00 18.21 ? 159  ALA B O     1 
ATOM   2482 C  CB    . ALA B 1 159 ? -33.547 -5.105  12.345  1.00 15.00 ? 159  ALA B CB    1 
ATOM   2483 N  N     . ILE B 1 160 ? -31.721 -6.574  14.388  1.00 15.81 ? 160  ILE B N     1 
ATOM   2484 C  CA    . ILE B 1 160 ? -30.941 -7.733  14.813  1.00 15.59 ? 160  ILE B CA    1 
ATOM   2485 C  C     . ILE B 1 160 ? -31.342 -8.125  16.236  1.00 16.84 ? 160  ILE B C     1 
ATOM   2486 O  O     . ILE B 1 160 ? -31.508 -9.306  16.542  1.00 18.36 ? 160  ILE B O     1 
ATOM   2487 C  CB    . ILE B 1 160 ? -29.426 -7.437  14.747  1.00 14.15 ? 160  ILE B CB    1 
ATOM   2488 C  CG1   . ILE B 1 160 ? -29.002 -7.258  13.290  1.00 12.56 ? 160  ILE B CG1   1 
ATOM   2489 C  CG2   . ILE B 1 160 ? -28.636 -8.575  15.387  1.00 13.72 ? 160  ILE B CG2   1 
ATOM   2490 C  CD1   . ILE B 1 160 ? -27.690 -6.516  13.118  1.00 15.52 ? 160  ILE B CD1   1 
ATOM   2491 N  N     . GLN B 1 161 ? -31.512 -7.122  17.091  1.00 16.47 ? 161  GLN B N     1 
ATOM   2492 C  CA    . GLN B 1 161 ? -31.918 -7.347  18.475  1.00 19.14 ? 161  GLN B CA    1 
ATOM   2493 C  C     . GLN B 1 161 ? -33.245 -8.110  18.528  1.00 20.58 ? 161  GLN B C     1 
ATOM   2494 O  O     . GLN B 1 161 ? -33.367 -9.110  19.239  1.00 20.85 ? 161  GLN B O     1 
ATOM   2495 C  CB    . GLN B 1 161 ? -32.043 -6.007  19.209  1.00 20.77 ? 161  GLN B CB    1 
ATOM   2496 C  CG    . GLN B 1 161 ? -32.610 -6.085  20.629  1.00 29.77 ? 161  GLN B CG    1 
ATOM   2497 C  CD    . GLN B 1 161 ? -31.772 -6.943  21.558  1.00 34.90 ? 161  GLN B CD    1 
ATOM   2498 O  OE1   . GLN B 1 161 ? -32.302 -7.663  22.408  1.00 39.55 ? 161  GLN B OE1   1 
ATOM   2499 N  NE2   . GLN B 1 161 ? -30.456 -6.870  21.402  1.00 36.80 ? 161  GLN B NE2   1 
ATOM   2500 N  N     . GLU B 1 162 ? -34.217 -7.663  17.738  1.00 20.62 ? 162  GLU B N     1 
ATOM   2501 C  CA    . GLU B 1 162 ? -35.531 -8.298  17.711  1.00 23.35 ? 162  GLU B CA    1 
ATOM   2502 C  C     . GLU B 1 162 ? -35.474 -9.742  17.219  1.00 24.26 ? 162  GLU B C     1 
ATOM   2503 O  O     . GLU B 1 162 ? -36.114 -10.625 17.793  1.00 23.73 ? 162  GLU B O     1 
ATOM   2504 C  CB    . GLU B 1 162 ? -36.496 -7.488  16.839  1.00 26.60 ? 162  GLU B CB    1 
ATOM   2505 C  CG    . GLU B 1 162 ? -37.922 -8.030  16.830  1.00 36.28 ? 162  GLU B CG    1 
ATOM   2506 C  CD    . GLU B 1 162 ? -38.848 -7.250  15.913  1.00 38.87 ? 162  GLU B CD    1 
ATOM   2507 O  OE1   . GLU B 1 162 ? -39.430 -7.865  14.995  1.00 42.25 ? 162  GLU B OE1   1 
ATOM   2508 O  OE2   . GLU B 1 162 ? -38.994 -6.024  16.108  1.00 42.05 ? 162  GLU B OE2   1 
ATOM   2509 N  N     . VAL B 1 163 ? -34.680 -9.980  16.180  1.00 22.22 ? 163  VAL B N     1 
ATOM   2510 C  CA    . VAL B 1 163 ? -34.540 -11.306 15.584  1.00 21.93 ? 163  VAL B CA    1 
ATOM   2511 C  C     . VAL B 1 163 ? -33.780 -12.329 16.431  1.00 22.72 ? 163  VAL B C     1 
ATOM   2512 O  O     . VAL B 1 163 ? -34.175 -13.493 16.511  1.00 24.37 ? 163  VAL B O     1 
ATOM   2513 C  CB    . VAL B 1 163 ? -33.838 -11.210 14.197  1.00 22.52 ? 163  VAL B CB    1 
ATOM   2514 C  CG1   . VAL B 1 163 ? -33.576 -12.599 13.619  1.00 23.80 ? 163  VAL B CG1   1 
ATOM   2515 C  CG2   . VAL B 1 163 ? -34.687 -10.395 13.237  1.00 24.69 ? 163  VAL B CG2   1 
ATOM   2516 N  N     . LEU B 1 164 ? -32.712 -11.889 17.085  1.00 17.82 ? 164  LEU B N     1 
ATOM   2517 C  CA    . LEU B 1 164 ? -31.883 -12.799 17.860  1.00 21.06 ? 164  LEU B CA    1 
ATOM   2518 C  C     . LEU B 1 164 ? -31.933 -12.683 19.371  1.00 20.83 ? 164  LEU B C     1 
ATOM   2519 O  O     . LEU B 1 164 ? -31.553 -13.629 20.064  1.00 21.25 ? 164  LEU B O     1 
ATOM   2520 C  CB    . LEU B 1 164 ? -30.421 -12.655 17.422  1.00 19.73 ? 164  LEU B CB    1 
ATOM   2521 C  CG    . LEU B 1 164 ? -30.070 -12.933 15.963  1.00 20.34 ? 164  LEU B CG    1 
ATOM   2522 C  CD1   . LEU B 1 164 ? -28.601 -12.609 15.729  1.00 21.18 ? 164  LEU B CD1   1 
ATOM   2523 C  CD2   . LEU B 1 164 ? -30.366 -14.389 15.619  1.00 19.13 ? 164  LEU B CD2   1 
ATOM   2524 N  N     . GLU B 1 165 ? -32.391 -11.539 19.880  1.00 21.22 ? 165  GLU B N     1 
ATOM   2525 C  CA    . GLU B 1 165 ? -32.412 -11.290 21.325  1.00 24.81 ? 165  GLU B CA    1 
ATOM   2526 C  C     . GLU B 1 165 ? -31.038 -11.700 21.879  1.00 24.29 ? 165  GLU B C     1 
ATOM   2527 O  O     . GLU B 1 165 ? -30.935 -12.521 22.793  1.00 24.17 ? 165  GLU B O     1 
ATOM   2528 C  CB    . GLU B 1 165 ? -33.549 -12.064 22.009  1.00 26.89 ? 165  GLU B CB    1 
ATOM   2529 C  CG    . GLU B 1 165 ? -34.946 -11.559 21.636  1.00 31.82 ? 165  GLU B CG    1 
ATOM   2530 C  CD    . GLU B 1 165 ? -36.076 -12.237 22.411  1.00 38.17 ? 165  GLU B CD    1 
ATOM   2531 O  OE1   . GLU B 1 165 ? -37.243 -12.090 21.991  1.00 39.66 ? 165  GLU B OE1   1 
ATOM   2532 O  OE2   . GLU B 1 165 ? -35.814 -12.900 23.439  1.00 40.68 ? 165  GLU B OE2   1 
ATOM   2533 N  N     . PRO B 1 166 ? -29.956 -11.152 21.293  1.00 21.46 ? 166  PRO B N     1 
ATOM   2534 C  CA    . PRO B 1 166 ? -28.595 -11.471 21.724  1.00 18.54 ? 166  PRO B CA    1 
ATOM   2535 C  C     . PRO B 1 166 ? -28.232 -10.782 23.031  1.00 20.04 ? 166  PRO B C     1 
ATOM   2536 O  O     . PRO B 1 166 ? -29.010 -9.978  23.560  1.00 20.70 ? 166  PRO B O     1 
ATOM   2537 C  CB    . PRO B 1 166 ? -27.757 -10.929 20.568  1.00 20.57 ? 166  PRO B CB    1 
ATOM   2538 C  CG    . PRO B 1 166 ? -28.471 -9.656  20.243  1.00 19.55 ? 166  PRO B CG    1 
ATOM   2539 C  CD    . PRO B 1 166 ? -29.939 -10.077 20.277  1.00 21.45 ? 166  PRO B CD    1 
ATOM   2540 N  N     . GLN B 1 167 ? -27.066 -11.120 23.574  1.00 19.23 ? 167  GLN B N     1 
ATOM   2541 C  CA    . GLN B 1 167 ? -26.607 -10.476 24.799  1.00 18.14 ? 167  GLN B CA    1 
ATOM   2542 C  C     . GLN B 1 167 ? -26.348 -9.010  24.453  1.00 17.95 ? 167  GLN B C     1 
ATOM   2543 O  O     . GLN B 1 167 ? -26.517 -8.117  25.279  1.00 14.41 ? 167  GLN B O     1 
ATOM   2544 C  CB    . GLN B 1 167 ? -25.325 -11.134 25.316  1.00 20.52 ? 167  GLN B CB    1 
ATOM   2545 C  CG    . GLN B 1 167 ? -25.514 -12.575 25.768  1.00 25.18 ? 167  GLN B CG    1 
ATOM   2546 C  CD    . GLN B 1 167 ? -24.262 -13.163 26.402  1.00 27.91 ? 167  GLN B CD    1 
ATOM   2547 O  OE1   . GLN B 1 167 ? -23.558 -12.490 27.154  1.00 29.12 ? 167  GLN B OE1   1 
ATOM   2548 N  NE2   . GLN B 1 167 ? -23.985 -14.429 26.103  1.00 27.91 ? 167  GLN B NE2   1 
ATOM   2549 N  N     . GLY B 1 168 ? -25.961 -8.776  23.202  1.00 17.16 ? 168  GLY B N     1 
ATOM   2550 C  CA    . GLY B 1 168 ? -25.707 -7.428  22.745  1.00 16.21 ? 168  GLY B CA    1 
ATOM   2551 C  C     . GLY B 1 168 ? -25.428 -7.401  21.257  1.00 14.41 ? 168  GLY B C     1 
ATOM   2552 O  O     . GLY B 1 168 ? -25.167 -8.438  20.645  1.00 15.05 ? 168  GLY B O     1 
ATOM   2553 N  N     . VAL B 1 169 ? -25.543 -6.214  20.675  1.00 11.40 ? 169  VAL B N     1 
ATOM   2554 C  CA    . VAL B 1 169 ? -25.279 -6.007  19.253  1.00 11.90 ? 169  VAL B CA    1 
ATOM   2555 C  C     . VAL B 1 169 ? -24.793 -4.577  19.022  1.00 14.16 ? 169  VAL B C     1 
ATOM   2556 O  O     . VAL B 1 169 ? -25.240 -3.644  19.688  1.00 13.60 ? 169  VAL B O     1 
ATOM   2557 C  CB    . VAL B 1 169 ? -26.530 -6.312  18.371  1.00 10.62 ? 169  VAL B CB    1 
ATOM   2558 C  CG1   . VAL B 1 169 ? -27.755 -5.538  18.865  1.00 17.53 ? 169  VAL B CG1   1 
ATOM   2559 C  CG2   . VAL B 1 169 ? -26.242 -5.991  16.901  1.00 12.93 ? 169  VAL B CG2   1 
ATOM   2560 N  N     . GLY B 1 170 ? -23.832 -4.427  18.113  1.00 13.49 ? 170  GLY B N     1 
ATOM   2561 C  CA    . GLY B 1 170 ? -23.301 -3.117  17.790  1.00 10.41 ? 170  GLY B CA    1 
ATOM   2562 C  C     . GLY B 1 170 ? -23.273 -2.978  16.279  1.00 11.78 ? 170  GLY B C     1 
ATOM   2563 O  O     . GLY B 1 170 ? -22.990 -3.939  15.577  1.00 11.72 ? 170  GLY B O     1 
ATOM   2564 N  N     . VAL B 1 171 ? -23.622 -1.798  15.782  1.00 11.47 ? 171  VAL B N     1 
ATOM   2565 C  CA    . VAL B 1 171 ? -23.630 -1.542  14.346  1.00 13.56 ? 171  VAL B CA    1 
ATOM   2566 C  C     . VAL B 1 171 ? -22.907 -0.236  14.070  1.00 13.44 ? 171  VAL B C     1 
ATOM   2567 O  O     . VAL B 1 171 ? -23.159 0.770   14.729  1.00 18.73 ? 171  VAL B O     1 
ATOM   2568 C  CB    . VAL B 1 171 ? -25.079 -1.439  13.790  1.00 13.22 ? 171  VAL B CB    1 
ATOM   2569 C  CG1   . VAL B 1 171 ? -25.055 -1.035  12.308  1.00 12.85 ? 171  VAL B CG1   1 
ATOM   2570 C  CG2   . VAL B 1 171 ? -25.800 -2.768  13.948  1.00 10.08 ? 171  VAL B CG2   1 
ATOM   2571 N  N     . VAL B 1 172 ? -21.982 -0.273  13.118  1.00 13.08 ? 172  VAL B N     1 
ATOM   2572 C  CA    . VAL B 1 172 ? -21.227 0.904   12.722  1.00 12.46 ? 172  VAL B CA    1 
ATOM   2573 C  C     . VAL B 1 172 ? -21.469 1.114   11.228  1.00 12.94 ? 172  VAL B C     1 
ATOM   2574 O  O     . VAL B 1 172 ? -21.349 0.178   10.439  1.00 12.24 ? 172  VAL B O     1 
ATOM   2575 C  CB    . VAL B 1 172 ? -19.714 0.707   12.966  1.00 9.74  ? 172  VAL B CB    1 
ATOM   2576 C  CG1   . VAL B 1 172 ? -18.914 1.853   12.349  1.00 12.73 ? 172  VAL B CG1   1 
ATOM   2577 C  CG2   . VAL B 1 172 ? -19.434 0.628   14.470  1.00 13.73 ? 172  VAL B CG2   1 
ATOM   2578 N  N     . VAL B 1 173 ? -21.879 2.322   10.859  1.00 13.00 ? 173  VAL B N     1 
ATOM   2579 C  CA    . VAL B 1 173 ? -22.127 2.649   9.456   1.00 10.92 ? 173  VAL B CA    1 
ATOM   2580 C  C     . VAL B 1 173 ? -21.153 3.741   9.056   1.00 11.60 ? 173  VAL B C     1 
ATOM   2581 O  O     . VAL B 1 173 ? -21.026 4.757   9.743   1.00 14.93 ? 173  VAL B O     1 
ATOM   2582 C  CB    . VAL B 1 173 ? -23.577 3.163   9.220   1.00 10.16 ? 173  VAL B CB    1 
ATOM   2583 C  CG1   . VAL B 1 173 ? -23.796 3.458   7.733   1.00 10.75 ? 173  VAL B CG1   1 
ATOM   2584 C  CG2   . VAL B 1 173 ? -24.598 2.127   9.710   1.00 10.22 ? 173  VAL B CG2   1 
ATOM   2585 N  N     . GLU B 1 174 ? -20.424 3.513   7.973   1.00 11.28 ? 174  GLU B N     1 
ATOM   2586 C  CA    . GLU B 1 174 ? -19.488 4.520   7.518   1.00 13.42 ? 174  GLU B CA    1 
ATOM   2587 C  C     . GLU B 1 174 ? -19.794 4.807   6.067   1.00 14.02 ? 174  GLU B C     1 
ATOM   2588 O  O     . GLU B 1 174 ? -19.788 3.900   5.236   1.00 12.54 ? 174  GLU B O     1 
ATOM   2589 C  CB    . GLU B 1 174 ? -18.050 4.043   7.677   1.00 14.37 ? 174  GLU B CB    1 
ATOM   2590 C  CG    . GLU B 1 174 ? -17.050 5.113   7.310   1.00 17.57 ? 174  GLU B CG    1 
ATOM   2591 C  CD    . GLU B 1 174 ? -15.651 4.815   7.797   1.00 20.89 ? 174  GLU B CD    1 
ATOM   2592 O  OE1   . GLU B 1 174 ? -15.251 3.634   7.828   1.00 23.37 ? 174  GLU B OE1   1 
ATOM   2593 O  OE2   . GLU B 1 174 ? -14.946 5.775   8.153   1.00 23.75 ? 174  GLU B OE2   1 
ATOM   2594 N  N     . GLY B 1 175 ? -20.083 6.065   5.765   1.00 14.02 ? 175  GLY B N     1 
ATOM   2595 C  CA    . GLY B 1 175 ? -20.409 6.392   4.394   1.00 18.09 ? 175  GLY B CA    1 
ATOM   2596 C  C     . GLY B 1 175 ? -20.059 7.780   3.920   1.00 15.48 ? 175  GLY B C     1 
ATOM   2597 O  O     . GLY B 1 175 ? -19.655 8.643   4.700   1.00 16.58 ? 175  GLY B O     1 
ATOM   2598 N  N     . VAL B 1 176 ? -20.157 7.954   2.606   1.00 16.79 ? 176  VAL B N     1 
ATOM   2599 C  CA    . VAL B 1 176 ? -19.902 9.231   1.959   1.00 18.13 ? 176  VAL B CA    1 
ATOM   2600 C  C     . VAL B 1 176 ? -21.251 9.692   1.412   1.00 18.04 ? 176  VAL B C     1 
ATOM   2601 O  O     . VAL B 1 176 ? -22.064 8.876   0.983   1.00 15.62 ? 176  VAL B O     1 
ATOM   2602 C  CB    . VAL B 1 176 ? -18.864 9.110   0.816   1.00 19.47 ? 176  VAL B CB    1 
ATOM   2603 C  CG1   . VAL B 1 176 ? -17.498 8.755   1.391   1.00 22.01 ? 176  VAL B CG1   1 
ATOM   2604 C  CG2   . VAL B 1 176 ? -19.298 8.061   -0.198  1.00 18.58 ? 176  VAL B CG2   1 
ATOM   2605 N  N     . HIS B 1 177 ? -21.488 10.997  1.458   1.00 16.28 ? 177  HIS B N     1 
ATOM   2606 C  CA    . HIS B 1 177 ? -22.750 11.572  1.005   1.00 16.11 ? 177  HIS B CA    1 
ATOM   2607 C  C     . HIS B 1 177 ? -22.558 12.455  -0.214  1.00 13.61 ? 177  HIS B C     1 
ATOM   2608 O  O     . HIS B 1 177 ? -21.839 13.458  -0.161  1.00 16.31 ? 177  HIS B O     1 
ATOM   2609 C  CB    . HIS B 1 177 ? -23.383 12.389  2.135   1.00 20.55 ? 177  HIS B CB    1 
ATOM   2610 C  CG    . HIS B 1 177 ? -23.720 11.583  3.352   1.00 20.82 ? 177  HIS B CG    1 
ATOM   2611 N  ND1   . HIS B 1 177 ? -25.002 11.485  3.845   1.00 23.87 ? 177  HIS B ND1   1 
ATOM   2612 C  CD2   . HIS B 1 177 ? -22.945 10.824  4.163   1.00 24.19 ? 177  HIS B CD2   1 
ATOM   2613 C  CE1   . HIS B 1 177 ? -25.004 10.698  4.907   1.00 24.49 ? 177  HIS B CE1   1 
ATOM   2614 N  NE2   . HIS B 1 177 ? -23.768 10.284  5.121   1.00 23.46 ? 177  HIS B NE2   1 
ATOM   2615 N  N     . LEU B 1 178 ? -23.192 12.072  -1.318  1.00 16.43 ? 178  LEU B N     1 
ATOM   2616 C  CA    . LEU B 1 178 ? -23.089 12.843  -2.544  1.00 17.03 ? 178  LEU B CA    1 
ATOM   2617 C  C     . LEU B 1 178 ? -23.659 14.248  -2.397  1.00 19.46 ? 178  LEU B C     1 
ATOM   2618 O  O     . LEU B 1 178 ? -23.197 15.169  -3.068  1.00 23.87 ? 178  LEU B O     1 
ATOM   2619 C  CB    . LEU B 1 178 ? -23.739 12.102  -3.720  1.00 18.55 ? 178  LEU B CB    1 
ATOM   2620 C  CG    . LEU B 1 178 ? -22.915 10.900  -4.191  1.00 17.15 ? 178  LEU B CG    1 
ATOM   2621 C  CD1   . LEU B 1 178 ? -23.490 10.335  -5.467  1.00 18.91 ? 178  LEU B CD1   1 
ATOM   2622 C  CD2   . LEU B 1 178 ? -21.465 11.331  -4.410  1.00 22.41 ? 178  LEU B CD2   1 
ATOM   2623 N  N     . CYS B 1 179 ? -24.614 14.432  -1.485  1.00 20.62 ? 179  CYS B N     1 
ATOM   2624 C  CA    . CYS B 1 179 ? -25.196 15.759  -1.285  1.00 20.73 ? 179  CYS B CA    1 
ATOM   2625 C  C     . CYS B 1 179 ? -24.172 16.715  -0.667  1.00 20.59 ? 179  CYS B C     1 
ATOM   2626 O  O     . CYS B 1 179 ? -24.387 17.925  -0.634  1.00 19.88 ? 179  CYS B O     1 
ATOM   2627 C  CB    . CYS B 1 179 ? -26.466 15.689  -0.432  1.00 20.65 ? 179  CYS B CB    1 
ATOM   2628 S  SG    . CYS B 1 179 ? -26.199 15.217  1.272   1.00 20.97 ? 179  CYS B SG    1 
ATOM   2629 N  N     . MET B 1 180 ? -23.062 16.159  -0.177  1.00 19.58 ? 180  MET B N     1 
ATOM   2630 C  CA    . MET B 1 180 ? -21.981 16.952  0.404   1.00 18.74 ? 180  MET B CA    1 
ATOM   2631 C  C     . MET B 1 180 ? -20.829 17.045  -0.588  1.00 18.42 ? 180  MET B C     1 
ATOM   2632 O  O     . MET B 1 180 ? -19.998 17.944  -0.503  1.00 18.35 ? 180  MET B O     1 
ATOM   2633 C  CB    . MET B 1 180 ? -21.439 16.303  1.687   1.00 21.74 ? 180  MET B CB    1 
ATOM   2634 C  CG    . MET B 1 180 ? -22.214 16.611  2.953   1.00 28.93 ? 180  MET B CG    1 
ATOM   2635 S  SD    . MET B 1 180 ? -21.352 15.989  4.430   1.00 33.10 ? 180  MET B SD    1 
ATOM   2636 C  CE    . MET B 1 180 ? -19.717 16.731  4.232   1.00 32.35 ? 180  MET B CE    1 
ATOM   2637 N  N     . MET B 1 181 ? -20.795 16.109  -1.532  1.00 17.47 ? 181  MET B N     1 
ATOM   2638 C  CA    . MET B 1 181 ? -19.717 16.035  -2.511  1.00 17.45 ? 181  MET B CA    1 
ATOM   2639 C  C     . MET B 1 181 ? -19.984 16.637  -3.885  1.00 18.09 ? 181  MET B C     1 
ATOM   2640 O  O     . MET B 1 181 ? -19.123 17.331  -4.433  1.00 16.82 ? 181  MET B O     1 
ATOM   2641 C  CB    . MET B 1 181 ? -19.288 14.579  -2.670  1.00 16.54 ? 181  MET B CB    1 
ATOM   2642 C  CG    . MET B 1 181 ? -18.928 13.922  -1.345  1.00 20.39 ? 181  MET B CG    1 
ATOM   2643 S  SD    . MET B 1 181 ? -18.671 12.161  -1.498  1.00 23.66 ? 181  MET B SD    1 
ATOM   2644 C  CE    . MET B 1 181 ? -17.012 12.139  -2.202  1.00 23.04 ? 181  MET B CE    1 
ATOM   2645 N  N     . MET B 1 182 ? -21.149 16.347  -4.456  1.00 19.61 ? 182  MET B N     1 
ATOM   2646 C  CA    . MET B 1 182 ? -21.464 16.853  -5.789  1.00 20.24 ? 182  MET B CA    1 
ATOM   2647 C  C     . MET B 1 182 ? -22.262 18.154  -5.815  1.00 22.15 ? 182  MET B C     1 
ATOM   2648 O  O     . MET B 1 182 ? -22.616 18.648  -6.881  1.00 22.88 ? 182  MET B O     1 
ATOM   2649 C  CB    . MET B 1 182 ? -22.141 15.767  -6.638  1.00 20.64 ? 182  MET B CB    1 
ATOM   2650 C  CG    . MET B 1 182 ? -23.594 15.482  -6.342  1.00 19.09 ? 182  MET B CG    1 
ATOM   2651 S  SD    . MET B 1 182 ? -24.176 14.020  -7.252  1.00 22.40 ? 182  MET B SD    1 
ATOM   2652 C  CE    . MET B 1 182 ? -24.269 14.600  -8.950  1.00 20.33 ? 182  MET B CE    1 
ATOM   2653 N  N     . ARG B 1 183 ? -22.495 18.724  -4.639  1.00 23.36 ? 183  ARG B N     1 
ATOM   2654 C  CA    . ARG B 1 183 ? -23.239 19.972  -4.509  1.00 23.21 ? 183  ARG B CA    1 
ATOM   2655 C  C     . ARG B 1 183 ? -22.999 20.561  -3.122  1.00 23.71 ? 183  ARG B C     1 
ATOM   2656 O  O     . ARG B 1 183 ? -22.260 19.987  -2.321  1.00 19.83 ? 183  ARG B O     1 
ATOM   2657 C  CB    . ARG B 1 183 ? -24.738 19.724  -4.707  1.00 22.16 ? 183  ARG B CB    1 
ATOM   2658 C  CG    . ARG B 1 183 ? -25.349 18.780  -3.676  1.00 21.39 ? 183  ARG B CG    1 
ATOM   2659 C  CD    . ARG B 1 183 ? -26.825 19.066  -3.457  1.00 24.90 ? 183  ARG B CD    1 
ATOM   2660 N  NE    . ARG B 1 183 ? -27.048 20.434  -2.992  1.00 21.79 ? 183  ARG B NE    1 
ATOM   2661 C  CZ    . ARG B 1 183 ? -26.847 20.857  -1.746  1.00 26.16 ? 183  ARG B CZ    1 
ATOM   2662 N  NH1   . ARG B 1 183 ? -26.418 20.021  -0.805  1.00 21.08 ? 183  ARG B NH1   1 
ATOM   2663 N  NH2   . ARG B 1 183 ? -27.043 22.135  -1.449  1.00 24.06 ? 183  ARG B NH2   1 
ATOM   2664 N  N     . GLY B 1 184 ? -23.613 21.712  -2.852  1.00 24.42 ? 184  GLY B N     1 
ATOM   2665 C  CA    . GLY B 1 184 ? -23.467 22.361  -1.557  1.00 22.77 ? 184  GLY B CA    1 
ATOM   2666 C  C     . GLY B 1 184 ? -22.037 22.715  -1.194  1.00 23.45 ? 184  GLY B C     1 
ATOM   2667 O  O     . GLY B 1 184 ? -21.374 23.455  -1.921  1.00 21.40 ? 184  GLY B O     1 
ATOM   2668 N  N     . VAL B 1 185 ? -21.561 22.185  -0.069  1.00 21.24 ? 185  VAL B N     1 
ATOM   2669 C  CA    . VAL B 1 185 ? -20.198 22.446  0.390   1.00 22.80 ? 185  VAL B CA    1 
ATOM   2670 C  C     . VAL B 1 185 ? -19.140 21.860  -0.542  1.00 22.27 ? 185  VAL B C     1 
ATOM   2671 O  O     . VAL B 1 185 ? -18.007 22.334  -0.577  1.00 23.33 ? 185  VAL B O     1 
ATOM   2672 C  CB    . VAL B 1 185 ? -19.956 21.915  1.823   1.00 24.22 ? 185  VAL B CB    1 
ATOM   2673 C  CG1   . VAL B 1 185 ? -20.814 22.678  2.809   1.00 28.47 ? 185  VAL B CG1   1 
ATOM   2674 C  CG2   . VAL B 1 185 ? -20.244 20.419  1.907   1.00 22.23 ? 185  VAL B CG2   1 
ATOM   2675 N  N     . GLU B 1 186 ? -19.522 20.829  -1.289  1.00 21.47 ? 186  GLU B N     1 
ATOM   2676 C  CA    . GLU B 1 186 ? -18.627 20.165  -2.234  1.00 21.71 ? 186  GLU B CA    1 
ATOM   2677 C  C     . GLU B 1 186 ? -17.310 19.661  -1.639  1.00 21.06 ? 186  GLU B C     1 
ATOM   2678 O  O     . GLU B 1 186 ? -16.265 19.722  -2.290  1.00 18.63 ? 186  GLU B O     1 
ATOM   2679 C  CB    . GLU B 1 186 ? -18.354 21.066  -3.444  1.00 23.06 ? 186  GLU B CB    1 
ATOM   2680 C  CG    . GLU B 1 186 ? -19.592 21.365  -4.270  1.00 23.47 ? 186  GLU B CG    1 
ATOM   2681 C  CD    . GLU B 1 186 ? -19.282 22.164  -5.518  1.00 25.99 ? 186  GLU B CD    1 
ATOM   2682 O  OE1   . GLU B 1 186 ? -18.582 21.636  -6.405  1.00 24.47 ? 186  GLU B OE1   1 
ATOM   2683 O  OE2   . GLU B 1 186 ? -19.743 23.321  -5.616  1.00 26.50 ? 186  GLU B OE2   1 
ATOM   2684 N  N     . LYS B 1 187 ? -17.355 19.200  -0.389  1.00 19.67 ? 187  LYS B N     1 
ATOM   2685 C  CA    . LYS B 1 187 ? -16.162 18.657  0.262   1.00 18.31 ? 187  LYS B CA    1 
ATOM   2686 C  C     . LYS B 1 187 ? -15.919 17.283  -0.360  1.00 18.74 ? 187  LYS B C     1 
ATOM   2687 O  O     . LYS B 1 187 ? -16.868 16.533  -0.599  1.00 18.38 ? 187  LYS B O     1 
ATOM   2688 C  CB    . LYS B 1 187 ? -16.372 18.539  1.773   1.00 20.59 ? 187  LYS B CB    1 
ATOM   2689 C  CG    . LYS B 1 187 ? -16.450 19.877  2.505   1.00 21.79 ? 187  LYS B CG    1 
ATOM   2690 C  CD    . LYS B 1 187 ? -15.126 20.632  2.464   1.00 23.19 ? 187  LYS B CD    1 
ATOM   2691 C  CE    . LYS B 1 187 ? -15.243 21.981  3.163   1.00 24.80 ? 187  LYS B CE    1 
ATOM   2692 N  NZ    . LYS B 1 187 ? -13.956 22.747  3.174   1.00 20.12 ? 187  LYS B NZ    1 
ATOM   2693 N  N     . GLN B 1 188 ? -14.651 16.946  -0.590  1.00 17.12 ? 188  GLN B N     1 
ATOM   2694 C  CA    . GLN B 1 188 ? -14.288 15.688  -1.240  1.00 16.87 ? 188  GLN B CA    1 
ATOM   2695 C  C     . GLN B 1 188 ? -13.699 14.576  -0.375  1.00 17.31 ? 188  GLN B C     1 
ATOM   2696 O  O     . GLN B 1 188 ? -13.849 13.396  -0.697  1.00 18.23 ? 188  GLN B O     1 
ATOM   2697 C  CB    . GLN B 1 188 ? -13.303 15.984  -2.381  1.00 17.18 ? 188  GLN B CB    1 
ATOM   2698 C  CG    . GLN B 1 188 ? -13.805 17.026  -3.366  1.00 19.34 ? 188  GLN B CG    1 
ATOM   2699 C  CD    . GLN B 1 188 ? -15.061 16.576  -4.076  1.00 21.70 ? 188  GLN B CD    1 
ATOM   2700 O  OE1   . GLN B 1 188 ? -15.075 15.528  -4.718  1.00 22.11 ? 188  GLN B OE1   1 
ATOM   2701 N  NE2   . GLN B 1 188 ? -16.128 17.363  -3.960  1.00 20.52 ? 188  GLN B NE2   1 
ATOM   2702 N  N     . HIS B 1 189 ? -13.054 14.946  0.725   1.00 16.61 ? 189  HIS B N     1 
ATOM   2703 C  CA    . HIS B 1 189 ? -12.397 13.974  1.594   1.00 17.44 ? 189  HIS B CA    1 
ATOM   2704 C  C     . HIS B 1 189 ? -13.177 13.483  2.806   1.00 16.50 ? 189  HIS B C     1 
ATOM   2705 O  O     . HIS B 1 189 ? -12.721 12.577  3.505   1.00 17.04 ? 189  HIS B O     1 
ATOM   2706 C  CB    . HIS B 1 189 ? -11.064 14.550  2.074   1.00 17.70 ? 189  HIS B CB    1 
ATOM   2707 C  CG    . HIS B 1 189 ? -10.088 14.819  0.972   1.00 21.58 ? 189  HIS B CG    1 
ATOM   2708 N  ND1   . HIS B 1 189 ? -9.501  13.813  0.237   1.00 24.74 ? 189  HIS B ND1   1 
ATOM   2709 C  CD2   . HIS B 1 189 ? -9.596  15.981  0.481   1.00 23.06 ? 189  HIS B CD2   1 
ATOM   2710 C  CE1   . HIS B 1 189 ? -8.690  14.343  -0.662  1.00 26.96 ? 189  HIS B CE1   1 
ATOM   2711 N  NE2   . HIS B 1 189 ? -8.730  15.657  -0.534  1.00 23.62 ? 189  HIS B NE2   1 
ATOM   2712 N  N     . SER B 1 190 ? -14.352 14.058  3.039   1.00 16.39 ? 190  SER B N     1 
ATOM   2713 C  CA    . SER B 1 190 ? -15.165 13.713  4.199   1.00 16.33 ? 190  SER B CA    1 
ATOM   2714 C  C     . SER B 1 190 ? -15.892 12.369  4.170   1.00 15.27 ? 190  SER B C     1 
ATOM   2715 O  O     . SER B 1 190 ? -16.345 11.903  3.129   1.00 16.68 ? 190  SER B O     1 
ATOM   2716 C  CB    . SER B 1 190 ? -16.158 14.841  4.508   1.00 17.15 ? 190  SER B CB    1 
ATOM   2717 O  OG    . SER B 1 190 ? -16.839 14.577  5.723   1.00 26.54 ? 190  SER B OG    1 
ATOM   2718 N  N     . ARG B 1 191 ? -16.019 11.780  5.354   1.00 15.15 ? 191  ARG B N     1 
ATOM   2719 C  CA    . ARG B 1 191 ? -16.670 10.489  5.538   1.00 16.29 ? 191  ARG B CA    1 
ATOM   2720 C  C     . ARG B 1 191 ? -17.371 10.573  6.890   1.00 14.29 ? 191  ARG B C     1 
ATOM   2721 O  O     . ARG B 1 191 ? -16.867 11.220  7.804   1.00 16.37 ? 191  ARG B O     1 
ATOM   2722 C  CB    . ARG B 1 191 ? -15.592 9.404   5.555   1.00 23.39 ? 191  ARG B CB    1 
ATOM   2723 C  CG    . ARG B 1 191 ? -16.072 7.998   5.358   1.00 33.24 ? 191  ARG B CG    1 
ATOM   2724 C  CD    . ARG B 1 191 ? -14.893 7.095   4.999   1.00 39.27 ? 191  ARG B CD    1 
ATOM   2725 N  NE    . ARG B 1 191 ? -13.757 7.279   5.901   1.00 42.68 ? 191  ARG B NE    1 
ATOM   2726 C  CZ    . ARG B 1 191 ? -12.641 6.556   5.860   1.00 47.29 ? 191  ARG B CZ    1 
ATOM   2727 N  NH1   . ARG B 1 191 ? -12.502 5.587   4.962   1.00 50.89 ? 191  ARG B NH1   1 
ATOM   2728 N  NH2   . ARG B 1 191 ? -11.653 6.809   6.708   1.00 47.11 ? 191  ARG B NH2   1 
ATOM   2729 N  N     . THR B 1 192 ? -18.529 9.932   7.014   1.00 12.59 ? 192  THR B N     1 
ATOM   2730 C  CA    . THR B 1 192 ? -19.286 9.977   8.261   1.00 14.88 ? 192  THR B CA    1 
ATOM   2731 C  C     . THR B 1 192 ? -19.493 8.614   8.909   1.00 12.59 ? 192  THR B C     1 
ATOM   2732 O  O     . THR B 1 192 ? -19.867 7.646   8.249   1.00 11.54 ? 192  THR B O     1 
ATOM   2733 C  CB    . THR B 1 192 ? -20.673 10.636  8.041   1.00 14.73 ? 192  THR B CB    1 
ATOM   2734 O  OG1   . THR B 1 192 ? -20.493 11.976  7.566   1.00 17.42 ? 192  THR B OG1   1 
ATOM   2735 C  CG2   . THR B 1 192 ? -21.469 10.678  9.347   1.00 14.96 ? 192  THR B CG2   1 
ATOM   2736 N  N     . VAL B 1 193 ? -19.273 8.562   10.217  1.00 13.99 ? 193  VAL B N     1 
ATOM   2737 C  CA    . VAL B 1 193 ? -19.453 7.338   10.979  1.00 15.38 ? 193  VAL B CA    1 
ATOM   2738 C  C     . VAL B 1 193 ? -20.585 7.525   11.984  1.00 14.05 ? 193  VAL B C     1 
ATOM   2739 O  O     . VAL B 1 193 ? -20.635 8.527   12.696  1.00 16.23 ? 193  VAL B O     1 
ATOM   2740 C  CB    . VAL B 1 193 ? -18.170 6.955   11.762  1.00 16.14 ? 193  VAL B CB    1 
ATOM   2741 C  CG1   . VAL B 1 193 ? -18.437 5.759   12.664  1.00 16.72 ? 193  VAL B CG1   1 
ATOM   2742 C  CG2   . VAL B 1 193 ? -17.037 6.647   10.798  1.00 19.10 ? 193  VAL B CG2   1 
ATOM   2743 N  N     . THR B 1 194 ? -21.527 6.590   11.979  1.00 13.48 ? 194  THR B N     1 
ATOM   2744 C  CA    . THR B 1 194 ? -22.637 6.602   12.927  1.00 13.25 ? 194  THR B CA    1 
ATOM   2745 C  C     . THR B 1 194 ? -22.679 5.197   13.509  1.00 13.10 ? 194  THR B C     1 
ATOM   2746 O  O     . THR B 1 194 ? -22.143 4.264   12.919  1.00 13.16 ? 194  THR B O     1 
ATOM   2747 C  CB    . THR B 1 194 ? -23.997 6.905   12.262  1.00 10.22 ? 194  THR B CB    1 
ATOM   2748 O  OG1   . THR B 1 194 ? -24.275 5.923   11.258  1.00 12.53 ? 194  THR B OG1   1 
ATOM   2749 C  CG2   . THR B 1 194 ? -24.007 8.308   11.637  1.00 9.66  ? 194  THR B CG2   1 
ATOM   2750 N  N     . SER B 1 195 ? -23.319 5.032   14.659  1.00 14.12 ? 195  SER B N     1 
ATOM   2751 C  CA    . SER B 1 195 ? -23.384 3.711   15.252  1.00 15.32 ? 195  SER B CA    1 
ATOM   2752 C  C     . SER B 1 195 ? -24.546 3.563   16.209  1.00 14.99 ? 195  SER B C     1 
ATOM   2753 O  O     . SER B 1 195 ? -25.219 4.536   16.537  1.00 16.94 ? 195  SER B O     1 
ATOM   2754 C  CB    . SER B 1 195 ? -22.072 3.385   15.971  1.00 18.28 ? 195  SER B CB    1 
ATOM   2755 O  OG    . SER B 1 195 ? -21.831 4.284   17.038  1.00 15.30 ? 195  SER B OG    1 
ATOM   2756 N  N     . ALA B 1 196 ? -24.795 2.320   16.607  1.00 13.68 ? 196  ALA B N     1 
ATOM   2757 C  CA    . ALA B 1 196 ? -25.856 1.984   17.546  1.00 13.78 ? 196  ALA B CA    1 
ATOM   2758 C  C     . ALA B 1 196 ? -25.322 0.820   18.376  1.00 14.82 ? 196  ALA B C     1 
ATOM   2759 O  O     . ALA B 1 196 ? -24.789 -0.138  17.827  1.00 13.86 ? 196  ALA B O     1 
ATOM   2760 C  CB    . ALA B 1 196 ? -27.112 1.570   16.797  1.00 15.86 ? 196  ALA B CB    1 
ATOM   2761 N  N     . MET B 1 197 ? -25.434 0.926   19.697  1.00 16.42 ? 197  MET B N     1 
ATOM   2762 C  CA    . MET B 1 197 ? -24.946 -0.118  20.593  1.00 17.62 ? 197  MET B CA    1 
ATOM   2763 C  C     . MET B 1 197 ? -26.076 -0.554  21.520  1.00 16.22 ? 197  MET B C     1 
ATOM   2764 O  O     . MET B 1 197 ? -26.712 0.277   22.164  1.00 18.86 ? 197  MET B O     1 
ATOM   2765 C  CB    . MET B 1 197 ? -23.765 0.406   21.408  1.00 15.35 ? 197  MET B CB    1 
ATOM   2766 C  CG    . MET B 1 197 ? -22.585 0.891   20.572  1.00 17.74 ? 197  MET B CG    1 
ATOM   2767 S  SD    . MET B 1 197 ? -21.674 -0.452  19.791  1.00 17.50 ? 197  MET B SD    1 
ATOM   2768 C  CE    . MET B 1 197 ? -20.640 0.450   18.648  1.00 20.53 ? 197  MET B CE    1 
ATOM   2769 N  N     . LEU B 1 198 ? -26.335 -1.855  21.566  1.00 17.58 ? 198  LEU B N     1 
ATOM   2770 C  CA    . LEU B 1 198 ? -27.411 -2.390  22.400  1.00 16.50 ? 198  LEU B CA    1 
ATOM   2771 C  C     . LEU B 1 198 ? -26.932 -3.508  23.315  1.00 17.11 ? 198  LEU B C     1 
ATOM   2772 O  O     . LEU B 1 198 ? -26.001 -4.240  22.976  1.00 15.90 ? 198  LEU B O     1 
ATOM   2773 C  CB    . LEU B 1 198 ? -28.541 -2.915  21.516  1.00 17.37 ? 198  LEU B CB    1 
ATOM   2774 C  CG    . LEU B 1 198 ? -29.159 -1.908  20.546  1.00 17.84 ? 198  LEU B CG    1 
ATOM   2775 C  CD1   . LEU B 1 198 ? -30.096 -2.622  19.595  1.00 16.28 ? 198  LEU B CD1   1 
ATOM   2776 C  CD2   . LEU B 1 198 ? -29.891 -0.817  21.317  1.00 17.84 ? 198  LEU B CD2   1 
ATOM   2777 N  N     . GLY B 1 199 ? -27.579 -3.635  24.474  1.00 14.74 ? 199  GLY B N     1 
ATOM   2778 C  CA    . GLY B 1 199 ? -27.212 -4.680  25.417  1.00 16.87 ? 199  GLY B CA    1 
ATOM   2779 C  C     . GLY B 1 199 ? -25.784 -4.547  25.895  1.00 14.93 ? 199  GLY B C     1 
ATOM   2780 O  O     . GLY B 1 199 ? -25.348 -3.444  26.226  1.00 14.92 ? 199  GLY B O     1 
ATOM   2781 N  N     . VAL B 1 200 ? -25.040 -5.655  25.906  1.00 17.13 ? 200  VAL B N     1 
ATOM   2782 C  CA    . VAL B 1 200 ? -23.651 -5.625  26.362  1.00 17.34 ? 200  VAL B CA    1 
ATOM   2783 C  C     . VAL B 1 200 ? -22.751 -4.686  25.563  1.00 18.34 ? 200  VAL B C     1 
ATOM   2784 O  O     . VAL B 1 200 ? -21.747 -4.206  26.086  1.00 16.22 ? 200  VAL B O     1 
ATOM   2785 C  CB    . VAL B 1 200 ? -23.003 -7.035  26.416  1.00 18.71 ? 200  VAL B CB    1 
ATOM   2786 C  CG1   . VAL B 1 200 ? -23.741 -7.917  27.404  1.00 18.11 ? 200  VAL B CG1   1 
ATOM   2787 C  CG2   . VAL B 1 200 ? -22.959 -7.665  25.037  1.00 15.02 ? 200  VAL B CG2   1 
ATOM   2788 N  N     . PHE B 1 201 ? -23.100 -4.416  24.304  1.00 16.06 ? 201  PHE B N     1 
ATOM   2789 C  CA    . PHE B 1 201 ? -22.289 -3.507  23.505  1.00 16.24 ? 201  PHE B CA    1 
ATOM   2790 C  C     . PHE B 1 201 ? -22.418 -2.087  24.045  1.00 16.26 ? 201  PHE B C     1 
ATOM   2791 O  O     . PHE B 1 201 ? -21.520 -1.273  23.878  1.00 18.10 ? 201  PHE B O     1 
ATOM   2792 C  CB    . PHE B 1 201 ? -22.659 -3.578  22.014  1.00 13.61 ? 201  PHE B CB    1 
ATOM   2793 C  CG    . PHE B 1 201 ? -22.037 -4.746  21.298  1.00 16.62 ? 201  PHE B CG    1 
ATOM   2794 C  CD1   . PHE B 1 201 ? -21.100 -4.543  20.285  1.00 15.96 ? 201  PHE B CD1   1 
ATOM   2795 C  CD2   . PHE B 1 201 ? -22.367 -6.048  21.649  1.00 14.97 ? 201  PHE B CD2   1 
ATOM   2796 C  CE1   . PHE B 1 201 ? -20.504 -5.620  19.637  1.00 15.17 ? 201  PHE B CE1   1 
ATOM   2797 C  CE2   . PHE B 1 201 ? -21.779 -7.134  21.009  1.00 14.49 ? 201  PHE B CE2   1 
ATOM   2798 C  CZ    . PHE B 1 201 ? -20.842 -6.920  19.998  1.00 15.61 ? 201  PHE B CZ    1 
ATOM   2799 N  N     . ARG B 1 202 ? -23.543 -1.802  24.697  1.00 16.29 ? 202  ARG B N     1 
ATOM   2800 C  CA    . ARG B 1 202 ? -23.779 -0.489  25.293  1.00 19.38 ? 202  ARG B CA    1 
ATOM   2801 C  C     . ARG B 1 202 ? -23.332 -0.480  26.754  1.00 20.05 ? 202  ARG B C     1 
ATOM   2802 O  O     . ARG B 1 202 ? -22.715 0.480   27.218  1.00 19.33 ? 202  ARG B O     1 
ATOM   2803 C  CB    . ARG B 1 202 ? -25.269 -0.135  25.241  1.00 20.58 ? 202  ARG B CB    1 
ATOM   2804 C  CG    . ARG B 1 202 ? -25.614 1.207   25.890  1.00 25.24 ? 202  ARG B CG    1 
ATOM   2805 C  CD    . ARG B 1 202 ? -27.114 1.372   26.098  1.00 30.58 ? 202  ARG B CD    1 
ATOM   2806 N  NE    . ARG B 1 202 ? -27.861 1.393   24.841  1.00 41.83 ? 202  ARG B NE    1 
ATOM   2807 C  CZ    . ARG B 1 202 ? -28.332 2.495   24.263  1.00 45.94 ? 202  ARG B CZ    1 
ATOM   2808 N  NH1   . ARG B 1 202 ? -28.137 3.683   24.825  1.00 45.61 ? 202  ARG B NH1   1 
ATOM   2809 N  NH2   . ARG B 1 202 ? -29.007 2.410   23.123  1.00 45.94 ? 202  ARG B NH2   1 
ATOM   2810 N  N     . GLU B 1 203 ? -23.616 -1.579  27.451  1.00 17.48 ? 203  GLU B N     1 
ATOM   2811 C  CA    . GLU B 1 203 ? -23.319 -1.717  28.878  1.00 18.51 ? 203  GLU B CA    1 
ATOM   2812 C  C     . GLU B 1 203 ? -21.894 -2.106  29.282  1.00 20.57 ? 203  GLU B C     1 
ATOM   2813 O  O     . GLU B 1 203 ? -21.459 -1.799  30.398  1.00 20.50 ? 203  GLU B O     1 
ATOM   2814 C  CB    . GLU B 1 203 ? -24.315 -2.700  29.504  1.00 14.93 ? 203  GLU B CB    1 
ATOM   2815 C  CG    . GLU B 1 203 ? -25.790 -2.329  29.297  1.00 16.14 ? 203  GLU B CG    1 
ATOM   2816 C  CD    . GLU B 1 203 ? -26.146 -0.942  29.816  1.00 21.21 ? 203  GLU B CD    1 
ATOM   2817 O  OE1   . GLU B 1 203 ? -25.614 -0.531  30.870  1.00 20.00 ? 203  GLU B OE1   1 
ATOM   2818 O  OE2   . GLU B 1 203 ? -26.976 -0.263  29.174  1.00 19.39 ? 203  GLU B OE2   1 
ATOM   2819 N  N     . ASN B 1 204 ? -21.186 -2.808  28.401  1.00 21.78 ? 204  ASN B N     1 
ATOM   2820 C  CA    . ASN B 1 204 ? -19.823 -3.247  28.690  1.00 20.66 ? 204  ASN B CA    1 
ATOM   2821 C  C     . ASN B 1 204 ? -18.830 -2.493  27.814  1.00 23.24 ? 204  ASN B C     1 
ATOM   2822 O  O     . ASN B 1 204 ? -18.753 -2.711  26.604  1.00 21.00 ? 204  ASN B O     1 
ATOM   2823 C  CB    . ASN B 1 204 ? -19.703 -4.764  28.476  1.00 21.89 ? 204  ASN B CB    1 
ATOM   2824 C  CG    . ASN B 1 204 ? -18.369 -5.333  28.953  1.00 26.46 ? 204  ASN B CG    1 
ATOM   2825 O  OD1   . ASN B 1 204 ? -17.316 -4.712  28.799  1.00 26.06 ? 204  ASN B OD1   1 
ATOM   2826 N  ND2   . ASN B 1 204 ? -18.411 -6.536  29.514  1.00 27.44 ? 204  ASN B ND2   1 
ATOM   2827 N  N     . GLN B 1 205 ? -18.064 -1.614  28.451  1.00 22.86 ? 205  GLN B N     1 
ATOM   2828 C  CA    . GLN B 1 205 ? -17.062 -0.788  27.786  1.00 23.83 ? 205  GLN B CA    1 
ATOM   2829 C  C     . GLN B 1 205 ? -16.046 -1.605  26.987  1.00 21.35 ? 205  GLN B C     1 
ATOM   2830 O  O     . GLN B 1 205 ? -15.737 -1.280  25.836  1.00 19.07 ? 205  GLN B O     1 
ATOM   2831 C  CB    . GLN B 1 205 ? -16.331 0.053   28.836  1.00 29.10 ? 205  GLN B CB    1 
ATOM   2832 C  CG    . GLN B 1 205 ? -15.255 0.963   28.283  1.00 34.41 ? 205  GLN B CG    1 
ATOM   2833 C  CD    . GLN B 1 205 ? -15.810 2.016   27.355  1.00 38.64 ? 205  GLN B CD    1 
ATOM   2834 O  OE1   . GLN B 1 205 ? -16.782 2.697   27.683  1.00 44.29 ? 205  GLN B OE1   1 
ATOM   2835 N  NE2   . GLN B 1 205 ? -15.195 2.160   26.187  1.00 39.57 ? 205  GLN B NE2   1 
ATOM   2836 N  N     . LYS B 1 206 ? -15.531 -2.660  27.612  1.00 19.46 ? 206  LYS B N     1 
ATOM   2837 C  CA    . LYS B 1 206 ? -14.541 -3.529  26.989  1.00 20.74 ? 206  LYS B CA    1 
ATOM   2838 C  C     . LYS B 1 206 ? -15.081 -4.273  25.773  1.00 17.65 ? 206  LYS B C     1 
ATOM   2839 O  O     . LYS B 1 206 ? -14.359 -4.480  24.797  1.00 15.24 ? 206  LYS B O     1 
ATOM   2840 C  CB    . LYS B 1 206 ? -13.981 -4.513  28.019  1.00 23.30 ? 206  LYS B CB    1 
ATOM   2841 C  CG    . LYS B 1 206 ? -13.169 -3.837  29.115  1.00 31.37 ? 206  LYS B CG    1 
ATOM   2842 C  CD    . LYS B 1 206 ? -12.032 -3.026  28.515  1.00 33.44 ? 206  LYS B CD    1 
ATOM   2843 C  CE    . LYS B 1 206 ? -11.204 -2.337  29.585  1.00 39.71 ? 206  LYS B CE    1 
ATOM   2844 N  NZ    . LYS B 1 206 ? -10.158 -1.469  28.974  1.00 39.54 ? 206  LYS B NZ    1 
ATOM   2845 N  N     . THR B 1 207 ? -16.348 -4.672  25.838  1.00 18.12 ? 207  THR B N     1 
ATOM   2846 C  CA    . THR B 1 207 ? -16.991 -5.372  24.732  1.00 17.77 ? 207  THR B CA    1 
ATOM   2847 C  C     . THR B 1 207 ? -17.070 -4.442  23.521  1.00 16.88 ? 207  THR B C     1 
ATOM   2848 O  O     . THR B 1 207 ? -16.716 -4.833  22.404  1.00 14.09 ? 207  THR B O     1 
ATOM   2849 C  CB    . THR B 1 207 ? -18.403 -5.843  25.125  1.00 20.48 ? 207  THR B CB    1 
ATOM   2850 O  OG1   . THR B 1 207 ? -18.299 -6.779  26.204  1.00 20.62 ? 207  THR B OG1   1 
ATOM   2851 C  CG2   . THR B 1 207 ? -19.106 -6.510  23.949  1.00 15.89 ? 207  THR B CG2   1 
ATOM   2852 N  N     . ARG B 1 208 ? -17.512 -3.206  23.751  1.00 15.31 ? 208  ARG B N     1 
ATOM   2853 C  CA    . ARG B 1 208 ? -17.614 -2.226  22.671  1.00 16.60 ? 208  ARG B CA    1 
ATOM   2854 C  C     . ARG B 1 208 ? -16.239 -1.948  22.059  1.00 16.16 ? 208  ARG B C     1 
ATOM   2855 O  O     . ARG B 1 208 ? -16.097 -1.906  20.839  1.00 13.78 ? 208  ARG B O     1 
ATOM   2856 C  CB    . ARG B 1 208 ? -18.243 -0.923  23.175  1.00 20.45 ? 208  ARG B CB    1 
ATOM   2857 C  CG    . ARG B 1 208 ? -18.482 0.100   22.071  1.00 23.40 ? 208  ARG B CG    1 
ATOM   2858 C  CD    . ARG B 1 208 ? -19.366 1.251   22.528  1.00 28.84 ? 208  ARG B CD    1 
ATOM   2859 N  NE    . ARG B 1 208 ? -18.788 2.003   23.637  1.00 27.76 ? 208  ARG B NE    1 
ATOM   2860 C  CZ    . ARG B 1 208 ? -19.185 1.898   24.900  1.00 28.67 ? 208  ARG B CZ    1 
ATOM   2861 N  NH1   . ARG B 1 208 ? -20.166 1.067   25.229  1.00 29.27 ? 208  ARG B NH1   1 
ATOM   2862 N  NH2   . ARG B 1 208 ? -18.607 2.634   25.836  1.00 30.71 ? 208  ARG B NH2   1 
ATOM   2863 N  N     . GLU B 1 209 ? -15.230 -1.761  22.911  1.00 17.70 ? 209  GLU B N     1 
ATOM   2864 C  CA    . GLU B 1 209 ? -13.866 -1.503  22.444  1.00 17.30 ? 209  GLU B CA    1 
ATOM   2865 C  C     . GLU B 1 209 ? -13.341 -2.663  21.603  1.00 16.05 ? 209  GLU B C     1 
ATOM   2866 O  O     . GLU B 1 209 ? -12.682 -2.449  20.588  1.00 16.32 ? 209  GLU B O     1 
ATOM   2867 C  CB    . GLU B 1 209 ? -12.917 -1.268  23.623  1.00 19.47 ? 209  GLU B CB    1 
ATOM   2868 C  CG    . GLU B 1 209 ? -13.166 0.023   24.385  1.00 27.77 ? 209  GLU B CG    1 
ATOM   2869 C  CD    . GLU B 1 209 ? -12.243 0.197   25.588  1.00 32.02 ? 209  GLU B CD    1 
ATOM   2870 O  OE1   . GLU B 1 209 ? -11.164 -0.434  25.627  1.00 32.81 ? 209  GLU B OE1   1 
ATOM   2871 O  OE2   . GLU B 1 209 ? -12.600 0.975   26.499  1.00 34.87 ? 209  GLU B OE2   1 
ATOM   2872 N  N     . GLU B 1 210 ? -13.622 -3.886  22.046  1.00 15.01 ? 210  GLU B N     1 
ATOM   2873 C  CA    . GLU B 1 210 ? -13.194 -5.086  21.338  1.00 15.21 ? 210  GLU B CA    1 
ATOM   2874 C  C     . GLU B 1 210 ? -13.790 -5.137  19.934  1.00 16.32 ? 210  GLU B C     1 
ATOM   2875 O  O     . GLU B 1 210 ? -13.100 -5.495  18.981  1.00 13.94 ? 210  GLU B O     1 
ATOM   2876 C  CB    . GLU B 1 210 ? -13.589 -6.336  22.123  1.00 20.08 ? 210  GLU B CB    1 
ATOM   2877 C  CG    . GLU B 1 210 ? -13.289 -7.644  21.411  1.00 17.18 ? 210  GLU B CG    1 
ATOM   2878 C  CD    . GLU B 1 210 ? -13.295 -8.829  22.353  1.00 22.72 ? 210  GLU B CD    1 
ATOM   2879 O  OE1   . GLU B 1 210 ? -12.686 -8.719  23.434  1.00 19.77 ? 210  GLU B OE1   1 
ATOM   2880 O  OE2   . GLU B 1 210 ? -13.903 -9.863  22.018  1.00 18.42 ? 210  GLU B OE2   1 
ATOM   2881 N  N     . PHE B 1 211 ? -15.072 -4.789  19.824  1.00 15.11 ? 211  PHE B N     1 
ATOM   2882 C  CA    . PHE B 1 211 ? -15.775 -4.763  18.541  1.00 13.40 ? 211  PHE B CA    1 
ATOM   2883 C  C     . PHE B 1 211 ? -15.159 -3.697  17.637  1.00 14.65 ? 211  PHE B C     1 
ATOM   2884 O  O     . PHE B 1 211 ? -14.830 -3.968  16.482  1.00 15.31 ? 211  PHE B O     1 
ATOM   2885 C  CB    . PHE B 1 211 ? -17.263 -4.471  18.785  1.00 13.84 ? 211  PHE B CB    1 
ATOM   2886 C  CG    . PHE B 1 211 ? -18.042 -4.088  17.549  1.00 12.12 ? 211  PHE B CG    1 
ATOM   2887 C  CD1   . PHE B 1 211 ? -18.875 -2.966  17.567  1.00 12.12 ? 211  PHE B CD1   1 
ATOM   2888 C  CD2   . PHE B 1 211 ? -17.967 -4.846  16.384  1.00 14.04 ? 211  PHE B CD2   1 
ATOM   2889 C  CE1   . PHE B 1 211 ? -19.621 -2.605  16.445  1.00 16.79 ? 211  PHE B CE1   1 
ATOM   2890 C  CE2   . PHE B 1 211 ? -18.716 -4.494  15.246  1.00 16.40 ? 211  PHE B CE2   1 
ATOM   2891 C  CZ    . PHE B 1 211 ? -19.543 -3.372  15.281  1.00 16.15 ? 211  PHE B CZ    1 
ATOM   2892 N  N     . LEU B 1 212 ? -14.979 -2.494  18.176  1.00 15.33 ? 212  LEU B N     1 
ATOM   2893 C  CA    . LEU B 1 212 ? -14.412 -1.393  17.403  1.00 16.89 ? 212  LEU B CA    1 
ATOM   2894 C  C     . LEU B 1 212 ? -12.971 -1.663  16.975  1.00 15.77 ? 212  LEU B C     1 
ATOM   2895 O  O     . LEU B 1 212 ? -12.555 -1.249  15.894  1.00 14.24 ? 212  LEU B O     1 
ATOM   2896 C  CB    . LEU B 1 212 ? -14.518 -0.077  18.181  1.00 16.07 ? 212  LEU B CB    1 
ATOM   2897 C  CG    . LEU B 1 212 ? -15.957 0.415   18.408  1.00 19.89 ? 212  LEU B CG    1 
ATOM   2898 C  CD1   . LEU B 1 212 ? -15.958 1.706   19.208  1.00 17.86 ? 212  LEU B CD1   1 
ATOM   2899 C  CD2   . LEU B 1 212 ? -16.661 0.618   17.071  1.00 17.33 ? 212  LEU B CD2   1 
ATOM   2900 N  N     . SER B 1 213 ? -12.219 -2.374  17.815  1.00 16.10 ? 213  SER B N     1 
ATOM   2901 C  CA    . SER B 1 213 ? -10.832 -2.710  17.493  1.00 17.04 ? 213  SER B CA    1 
ATOM   2902 C  C     . SER B 1 213 ? -10.757 -3.708  16.341  1.00 15.06 ? 213  SER B C     1 
ATOM   2903 O  O     . SER B 1 213 ? -9.812  -3.683  15.553  1.00 18.76 ? 213  SER B O     1 
ATOM   2904 C  CB    . SER B 1 213 ? -10.094 -3.240  18.722  1.00 18.98 ? 213  SER B CB    1 
ATOM   2905 O  OG    . SER B 1 213 ? -9.831  -2.181  19.627  1.00 21.11 ? 213  SER B OG    1 
ATOM   2906 N  N     . HIS B 1 214 ? -11.756 -4.582  16.243  1.00 14.35 ? 214  HIS B N     1 
ATOM   2907 C  CA    . HIS B 1 214 ? -11.815 -5.555  15.154  1.00 15.81 ? 214  HIS B CA    1 
ATOM   2908 C  C     . HIS B 1 214 ? -11.987 -4.819  13.826  1.00 15.94 ? 214  HIS B C     1 
ATOM   2909 O  O     . HIS B 1 214 ? -11.582 -5.314  12.777  1.00 15.79 ? 214  HIS B O     1 
ATOM   2910 C  CB    . HIS B 1 214 ? -12.985 -6.532  15.342  1.00 13.62 ? 214  HIS B CB    1 
ATOM   2911 C  CG    . HIS B 1 214 ? -12.645 -7.739  16.160  1.00 15.98 ? 214  HIS B CG    1 
ATOM   2912 N  ND1   . HIS B 1 214 ? -11.574 -8.555  15.868  1.00 15.68 ? 214  HIS B ND1   1 
ATOM   2913 C  CD2   . HIS B 1 214 ? -13.233 -8.268  17.261  1.00 15.69 ? 214  HIS B CD2   1 
ATOM   2914 C  CE1   . HIS B 1 214 ? -11.513 -9.533  16.755  1.00 12.79 ? 214  HIS B CE1   1 
ATOM   2915 N  NE2   . HIS B 1 214 ? -12.508 -9.382  17.611  1.00 15.37 ? 214  HIS B NE2   1 
ATOM   2916 N  N     . LEU B 1 215 ? -12.575 -3.626  13.879  1.00 17.61 ? 215  LEU B N     1 
ATOM   2917 C  CA    . LEU B 1 215 ? -12.799 -2.837  12.666  1.00 20.98 ? 215  LEU B CA    1 
ATOM   2918 C  C     . LEU B 1 215 ? -11.568 -2.061  12.200  1.00 25.03 ? 215  LEU B C     1 
ATOM   2919 O  O     . LEU B 1 215 ? -11.570 -1.478  11.112  1.00 23.65 ? 215  LEU B O     1 
ATOM   2920 C  CB    . LEU B 1 215 ? -13.979 -1.880  12.855  1.00 19.35 ? 215  LEU B CB    1 
ATOM   2921 C  CG    . LEU B 1 215 ? -15.293 -2.517  13.303  1.00 18.52 ? 215  LEU B CG    1 
ATOM   2922 C  CD1   . LEU B 1 215 ? -16.386 -1.455  13.307  1.00 18.67 ? 215  LEU B CD1   1 
ATOM   2923 C  CD2   . LEU B 1 215 ? -15.675 -3.662  12.391  1.00 16.12 ? 215  LEU B CD2   1 
ATOM   2924 N  N     . ARG B 1 216 ? -10.527 -2.032  13.029  1.00 26.28 ? 216  ARG B N     1 
ATOM   2925 C  CA    . ARG B 1 216 ? -9.295  -1.335  12.670  1.00 30.46 ? 216  ARG B CA    1 
ATOM   2926 C  C     . ARG B 1 216 ? -8.240  -2.309  12.148  1.00 32.39 ? 216  ARG B C     1 
ATOM   2927 O  O     . ARG B 1 216 ? -8.086  -3.400  12.735  1.00 35.19 ? 216  ARG B O     1 
ATOM   2928 C  CB    . ARG B 1 216 ? -8.736  -0.541  13.857  1.00 29.79 ? 216  ARG B CB    1 
ATOM   2929 C  CG    . ARG B 1 216 ? -9.641  0.575   14.368  1.00 31.53 ? 216  ARG B CG    1 
ATOM   2930 C  CD    . ARG B 1 216 ? -8.861  1.610   15.187  1.00 29.44 ? 216  ARG B CD    1 
ATOM   2931 N  NE    . ARG B 1 216 ? -8.138  1.025   16.316  1.00 28.48 ? 216  ARG B NE    1 
ATOM   2932 C  CZ    . ARG B 1 216 ? -8.694  0.691   17.478  1.00 29.05 ? 216  ARG B CZ    1 
ATOM   2933 N  NH1   . ARG B 1 216 ? -9.993  0.880   17.681  1.00 29.42 ? 216  ARG B NH1   1 
ATOM   2934 N  NH2   . ARG B 1 216 ? -7.949  0.170   18.441  1.00 27.94 ? 216  ARG B NH2   1 
ATOM   2935 N  N     . GLU C 1 32  ? -18.178 46.338  2.349   1.00 58.96 ? 32   GLU C N     1 
ATOM   2936 C  CA    . GLU C 1 32  ? -17.263 45.728  3.354   1.00 58.58 ? 32   GLU C CA    1 
ATOM   2937 C  C     . GLU C 1 32  ? -15.794 45.923  2.985   1.00 57.58 ? 32   GLU C C     1 
ATOM   2938 O  O     . GLU C 1 32  ? -15.202 46.959  3.295   1.00 58.35 ? 32   GLU C O     1 
ATOM   2939 C  CB    . GLU C 1 32  ? -17.577 44.238  3.522   1.00 60.57 ? 32   GLU C CB    1 
ATOM   2940 C  CG    . GLU C 1 32  ? -18.871 43.952  4.279   1.00 61.89 ? 32   GLU C CG    1 
ATOM   2941 C  CD    . GLU C 1 32  ? -18.816 44.399  5.733   1.00 62.87 ? 32   GLU C CD    1 
ATOM   2942 O  OE1   . GLU C 1 32  ? -17.782 44.170  6.399   1.00 62.55 ? 32   GLU C OE1   1 
ATOM   2943 O  OE2   . GLU C 1 32  ? -19.814 44.979  6.212   1.00 63.49 ? 32   GLU C OE2   1 
ATOM   2944 N  N     . VAL C 1 33  ? -15.209 44.925  2.326   1.00 54.95 ? 33   VAL C N     1 
ATOM   2945 C  CA    . VAL C 1 33  ? -13.810 44.988  1.918   1.00 51.78 ? 33   VAL C CA    1 
ATOM   2946 C  C     . VAL C 1 33  ? -13.636 45.873  0.689   1.00 49.64 ? 33   VAL C C     1 
ATOM   2947 O  O     . VAL C 1 33  ? -14.284 45.666  -0.338  1.00 48.81 ? 33   VAL C O     1 
ATOM   2948 C  CB    . VAL C 1 33  ? -13.237 43.575  1.627   1.00 52.29 ? 33   VAL C CB    1 
ATOM   2949 C  CG1   . VAL C 1 33  ? -11.792 43.672  1.156   1.00 52.19 ? 33   VAL C CG1   1 
ATOM   2950 C  CG2   . VAL C 1 33  ? -13.313 42.712  2.872   1.00 52.01 ? 33   VAL C CG2   1 
ATOM   2951 N  N     . ASP C 1 34  ? -12.763 46.868  0.812   1.00 48.59 ? 34   ASP C N     1 
ATOM   2952 C  CA    . ASP C 1 34  ? -12.482 47.793  -0.280  1.00 46.50 ? 34   ASP C CA    1 
ATOM   2953 C  C     . ASP C 1 34  ? -11.553 47.122  -1.292  1.00 45.31 ? 34   ASP C C     1 
ATOM   2954 O  O     . ASP C 1 34  ? -10.329 47.171  -1.156  1.00 44.18 ? 34   ASP C O     1 
ATOM   2955 C  CB    . ASP C 1 34  ? -11.840 49.073  0.274   1.00 47.26 ? 34   ASP C CB    1 
ATOM   2956 C  CG    . ASP C 1 34  ? -11.719 50.181  -0.768  1.00 47.40 ? 34   ASP C CG    1 
ATOM   2957 O  OD1   . ASP C 1 34  ? -12.114 49.981  -1.939  1.00 46.26 ? 34   ASP C OD1   1 
ATOM   2958 O  OD2   . ASP C 1 34  ? -11.221 51.267  -0.403  1.00 47.77 ? 34   ASP C OD2   1 
ATOM   2959 N  N     . LEU C 1 35  ? -12.150 46.507  -2.310  1.00 44.81 ? 35   LEU C N     1 
ATOM   2960 C  CA    . LEU C 1 35  ? -11.400 45.817  -3.355  1.00 45.54 ? 35   LEU C CA    1 
ATOM   2961 C  C     . LEU C 1 35  ? -10.447 46.740  -4.105  1.00 46.88 ? 35   LEU C C     1 
ATOM   2962 O  O     . LEU C 1 35  ? -9.324  46.351  -4.426  1.00 46.62 ? 35   LEU C O     1 
ATOM   2963 C  CB    . LEU C 1 35  ? -12.358 45.152  -4.346  1.00 45.13 ? 35   LEU C CB    1 
ATOM   2964 C  CG    . LEU C 1 35  ? -13.268 44.058  -3.784  1.00 45.69 ? 35   LEU C CG    1 
ATOM   2965 C  CD1   . LEU C 1 35  ? -14.170 43.525  -4.884  1.00 45.78 ? 35   LEU C CD1   1 
ATOM   2966 C  CD2   . LEU C 1 35  ? -12.425 42.935  -3.191  1.00 47.34 ? 35   LEU C CD2   1 
ATOM   2967 N  N     . GLU C 1 36  ? -10.898 47.965  -4.371  1.00 47.62 ? 36   GLU C N     1 
ATOM   2968 C  CA    . GLU C 1 36  ? -10.093 48.956  -5.083  1.00 47.67 ? 36   GLU C CA    1 
ATOM   2969 C  C     . GLU C 1 36  ? -8.790  49.244  -4.343  1.00 45.11 ? 36   GLU C C     1 
ATOM   2970 O  O     . GLU C 1 36  ? -7.722  49.304  -4.952  1.00 44.50 ? 36   GLU C O     1 
ATOM   2971 C  CB    . GLU C 1 36  ? -10.883 50.257  -5.259  1.00 51.76 ? 36   GLU C CB    1 
ATOM   2972 C  CG    . GLU C 1 36  ? -12.221 50.096  -5.975  1.00 55.89 ? 36   GLU C CG    1 
ATOM   2973 C  CD    . GLU C 1 36  ? -12.080 49.537  -7.380  1.00 58.69 ? 36   GLU C CD    1 
ATOM   2974 O  OE1   . GLU C 1 36  ? -11.267 50.077  -8.161  1.00 60.07 ? 36   GLU C OE1   1 
ATOM   2975 O  OE2   . GLU C 1 36  ? -12.789 48.559  -7.704  1.00 59.42 ? 36   GLU C OE2   1 
ATOM   2976 N  N     . ARG C 1 37  ? -8.888  49.397  -3.025  1.00 43.60 ? 37   ARG C N     1 
ATOM   2977 C  CA    . ARG C 1 37  ? -7.729  49.676  -2.187  1.00 43.79 ? 37   ARG C CA    1 
ATOM   2978 C  C     . ARG C 1 37  ? -6.755  48.497  -2.208  1.00 43.92 ? 37   ARG C C     1 
ATOM   2979 O  O     . ARG C 1 37  ? -5.539  48.693  -2.256  1.00 44.42 ? 37   ARG C O     1 
ATOM   2980 C  CB    . ARG C 1 37  ? -8.182  49.983  -0.759  1.00 44.81 ? 37   ARG C CB    1 
ATOM   2981 C  CG    . ARG C 1 37  ? -7.109  50.565  0.142   1.00 48.14 ? 37   ARG C CG    1 
ATOM   2982 C  CD    . ARG C 1 37  ? -7.720  51.076  1.437   1.00 52.12 ? 37   ARG C CD    1 
ATOM   2983 N  NE    . ARG C 1 37  ? -6.709  51.556  2.375   1.00 54.73 ? 37   ARG C NE    1 
ATOM   2984 C  CZ    . ARG C 1 37  ? -6.979  52.095  3.560   1.00 55.80 ? 37   ARG C CZ    1 
ATOM   2985 N  NH1   . ARG C 1 37  ? -8.237  52.229  3.963   1.00 58.19 ? 37   ARG C NH1   1 
ATOM   2986 N  NH2   . ARG C 1 37  ? -5.990  52.494  4.348   1.00 57.02 ? 37   ARG C NH2   1 
ATOM   2987 N  N     . LEU C 1 38  ? -7.294  47.279  -2.193  1.00 43.60 ? 38   LEU C N     1 
ATOM   2988 C  CA    . LEU C 1 38  ? -6.470  46.071  -2.230  1.00 41.36 ? 38   LEU C CA    1 
ATOM   2989 C  C     . LEU C 1 38  ? -5.722  45.967  -3.555  1.00 40.68 ? 38   LEU C C     1 
ATOM   2990 O  O     . LEU C 1 38  ? -4.550  45.590  -3.582  1.00 41.23 ? 38   LEU C O     1 
ATOM   2991 C  CB    . LEU C 1 38  ? -7.325  44.816  -2.017  1.00 40.41 ? 38   LEU C CB    1 
ATOM   2992 C  CG    . LEU C 1 38  ? -7.921  44.577  -0.628  1.00 37.13 ? 38   LEU C CG    1 
ATOM   2993 C  CD1   . LEU C 1 38  ? -8.687  43.264  -0.626  1.00 37.27 ? 38   LEU C CD1   1 
ATOM   2994 C  CD2   . LEU C 1 38  ? -6.819  44.541  0.414   1.00 35.55 ? 38   LEU C CD2   1 
ATOM   2995 N  N     . GLN C 1 39  ? -6.402  46.305  -4.650  1.00 39.55 ? 39   GLN C N     1 
ATOM   2996 C  CA    . GLN C 1 39  ? -5.795  46.264  -5.977  1.00 41.00 ? 39   GLN C CA    1 
ATOM   2997 C  C     . GLN C 1 39  ? -4.595  47.199  -6.034  1.00 42.03 ? 39   GLN C C     1 
ATOM   2998 O  O     . GLN C 1 39  ? -3.536  46.831  -6.544  1.00 41.53 ? 39   GLN C O     1 
ATOM   2999 C  CB    . GLN C 1 39  ? -6.812  46.660  -7.051  1.00 41.07 ? 39   GLN C CB    1 
ATOM   3000 C  CG    . GLN C 1 39  ? -7.919  45.644  -7.249  1.00 44.72 ? 39   GLN C CG    1 
ATOM   3001 C  CD    . GLN C 1 39  ? -8.927  46.059  -8.303  1.00 46.56 ? 39   GLN C CD    1 
ATOM   3002 O  OE1   . GLN C 1 39  ? -10.128 45.840  -8.144  1.00 49.15 ? 39   GLN C OE1   1 
ATOM   3003 N  NE2   . GLN C 1 39  ? -8.443  46.646  -9.394  1.00 48.29 ? 39   GLN C NE2   1 
ATOM   3004 N  N     . ALA C 1 40  ? -4.764  48.400  -5.485  1.00 42.92 ? 40   ALA C N     1 
ATOM   3005 C  CA    . ALA C 1 40  ? -3.700  49.400  -5.456  1.00 42.78 ? 40   ALA C CA    1 
ATOM   3006 C  C     . ALA C 1 40  ? -2.523  48.892  -4.631  1.00 42.36 ? 40   ALA C C     1 
ATOM   3007 O  O     . ALA C 1 40  ? -1.364  49.053  -5.020  1.00 43.23 ? 40   ALA C O     1 
ATOM   3008 C  CB    . ALA C 1 40  ? -4.227  50.710  -4.879  1.00 44.53 ? 40   ALA C CB    1 
ATOM   3009 N  N     . LEU C 1 41  ? -2.830  48.276  -3.492  1.00 41.24 ? 41   LEU C N     1 
ATOM   3010 C  CA    . LEU C 1 41  ? -1.806  47.727  -2.611  1.00 41.11 ? 41   LEU C CA    1 
ATOM   3011 C  C     . LEU C 1 41  ? -1.065  46.577  -3.289  1.00 40.39 ? 41   LEU C C     1 
ATOM   3012 O  O     . LEU C 1 41  ? 0.158   46.476  -3.195  1.00 41.58 ? 41   LEU C O     1 
ATOM   3013 C  CB    . LEU C 1 41  ? -2.435  47.247  -1.301  1.00 40.45 ? 41   LEU C CB    1 
ATOM   3014 C  CG    . LEU C 1 41  ? -3.038  48.332  -0.405  1.00 40.61 ? 41   LEU C CG    1 
ATOM   3015 C  CD1   . LEU C 1 41  ? -3.707  47.699  0.804   1.00 39.67 ? 41   LEU C CD1   1 
ATOM   3016 C  CD2   . LEU C 1 41  ? -1.950  49.306  0.026   1.00 41.99 ? 41   LEU C CD2   1 
ATOM   3017 N  N     . ALA C 1 42  ? -1.814  45.725  -3.984  1.00 40.96 ? 42   ALA C N     1 
ATOM   3018 C  CA    . ALA C 1 42  ? -1.240  44.583  -4.688  1.00 40.97 ? 42   ALA C CA    1 
ATOM   3019 C  C     . ALA C 1 42  ? -0.368  45.051  -5.850  1.00 41.32 ? 42   ALA C C     1 
ATOM   3020 O  O     . ALA C 1 42  ? 0.663   44.444  -6.146  1.00 41.32 ? 42   ALA C O     1 
ATOM   3021 C  CB    . ALA C 1 42  ? -2.345  43.667  -5.190  1.00 40.46 ? 42   ALA C CB    1 
ATOM   3022 N  N     . ALA C 1 43  ? -0.784  46.137  -6.499  1.00 42.11 ? 43   ALA C N     1 
ATOM   3023 C  CA    . ALA C 1 43  ? -0.038  46.701  -7.621  1.00 41.34 ? 43   ALA C CA    1 
ATOM   3024 C  C     . ALA C 1 43  ? 1.315   47.227  -7.147  1.00 40.93 ? 43   ALA C C     1 
ATOM   3025 O  O     . ALA C 1 43  ? 2.336   47.026  -7.807  1.00 40.43 ? 43   ALA C O     1 
ATOM   3026 C  CB    . ALA C 1 43  ? -0.840  47.817  -8.281  1.00 42.85 ? 43   ALA C CB    1 
ATOM   3027 N  N     . GLU C 1 44  ? 1.320   47.885  -5.990  1.00 41.25 ? 44   GLU C N     1 
ATOM   3028 C  CA    . GLU C 1 44  ? 2.553   48.423  -5.428  1.00 41.64 ? 44   GLU C CA    1 
ATOM   3029 C  C     . GLU C 1 44  ? 3.419   47.277  -4.917  1.00 40.71 ? 44   GLU C C     1 
ATOM   3030 O  O     . GLU C 1 44  ? 4.646   47.359  -4.943  1.00 40.29 ? 44   GLU C O     1 
ATOM   3031 C  CB    . GLU C 1 44  ? 2.254   49.412  -4.294  1.00 43.05 ? 44   GLU C CB    1 
ATOM   3032 C  CG    . GLU C 1 44  ? 3.466   50.238  -3.854  1.00 46.72 ? 44   GLU C CG    1 
ATOM   3033 C  CD    . GLU C 1 44  ? 3.126   51.314  -2.829  1.00 48.82 ? 44   GLU C CD    1 
ATOM   3034 O  OE1   . GLU C 1 44  ? 2.078   51.982  -2.974  1.00 49.97 ? 44   GLU C OE1   1 
ATOM   3035 O  OE2   . GLU C 1 44  ? 3.912   51.494  -1.875  1.00 49.84 ? 44   GLU C OE2   1 
ATOM   3036 N  N     . TRP C 1 45  ? 2.774   46.200  -4.473  1.00 39.39 ? 45   TRP C N     1 
ATOM   3037 C  CA    . TRP C 1 45  ? 3.488   45.031  -3.967  1.00 37.49 ? 45   TRP C CA    1 
ATOM   3038 C  C     . TRP C 1 45  ? 4.321   44.404  -5.082  1.00 33.68 ? 45   TRP C C     1 
ATOM   3039 O  O     . TRP C 1 45  ? 5.472   44.024  -4.868  1.00 32.98 ? 45   TRP C O     1 
ATOM   3040 C  CB    . TRP C 1 45  ? 2.502   43.999  -3.407  1.00 37.49 ? 45   TRP C CB    1 
ATOM   3041 C  CG    . TRP C 1 45  ? 3.164   42.915  -2.610  1.00 37.44 ? 45   TRP C CG    1 
ATOM   3042 C  CD1   . TRP C 1 45  ? 3.650   41.728  -3.082  1.00 38.65 ? 45   TRP C CD1   1 
ATOM   3043 C  CD2   . TRP C 1 45  ? 3.433   42.927  -1.202  1.00 39.05 ? 45   TRP C CD2   1 
ATOM   3044 N  NE1   . TRP C 1 45  ? 4.206   41.003  -2.055  1.00 38.81 ? 45   TRP C NE1   1 
ATOM   3045 C  CE2   . TRP C 1 45  ? 4.086   41.715  -0.891  1.00 38.36 ? 45   TRP C CE2   1 
ATOM   3046 C  CE3   . TRP C 1 45  ? 3.187   43.846  -0.173  1.00 40.27 ? 45   TRP C CE3   1 
ATOM   3047 C  CZ2   . TRP C 1 45  ? 4.497   41.396  0.408   1.00 38.32 ? 45   TRP C CZ2   1 
ATOM   3048 C  CZ3   . TRP C 1 45  ? 3.597   43.529  1.121   1.00 38.56 ? 45   TRP C CZ3   1 
ATOM   3049 C  CH2   . TRP C 1 45  ? 4.245   42.314  1.397   1.00 39.54 ? 45   TRP C CH2   1 
ATOM   3050 N  N     . LEU C 1 46  ? 3.734   44.332  -6.274  1.00 33.31 ? 46   LEU C N     1 
ATOM   3051 C  CA    . LEU C 1 46  ? 4.391   43.764  -7.443  1.00 34.02 ? 46   LEU C CA    1 
ATOM   3052 C  C     . LEU C 1 46  ? 5.663   44.510  -7.844  1.00 37.14 ? 46   LEU C C     1 
ATOM   3053 O  O     . LEU C 1 46  ? 6.668   43.884  -8.178  1.00 37.54 ? 46   LEU C O     1 
ATOM   3054 C  CB    . LEU C 1 46  ? 3.421   43.709  -8.628  1.00 32.04 ? 46   LEU C CB    1 
ATOM   3055 C  CG    . LEU C 1 46  ? 2.248   42.726  -8.528  1.00 33.17 ? 46   LEU C CG    1 
ATOM   3056 C  CD1   . LEU C 1 46  ? 1.355   42.839  -9.748  1.00 30.38 ? 46   LEU C CD1   1 
ATOM   3057 C  CD2   . LEU C 1 46  ? 2.777   41.306  -8.390  1.00 34.13 ? 46   LEU C CD2   1 
ATOM   3058 N  N     . GLN C 1 47  ? 5.631   45.842  -7.797  1.00 39.06 ? 47   GLN C N     1 
ATOM   3059 C  CA    . GLN C 1 47  ? 6.808   46.626  -8.170  1.00 41.26 ? 47   GLN C CA    1 
ATOM   3060 C  C     . GLN C 1 47  ? 7.911   46.588  -7.114  1.00 39.33 ? 47   GLN C C     1 
ATOM   3061 O  O     . GLN C 1 47  ? 9.089   46.480  -7.452  1.00 39.30 ? 47   GLN C O     1 
ATOM   3062 C  CB    . GLN C 1 47  ? 6.437   48.079  -8.497  1.00 44.46 ? 47   GLN C CB    1 
ATOM   3063 C  CG    . GLN C 1 47  ? 6.010   48.923  -7.308  1.00 50.03 ? 47   GLN C CG    1 
ATOM   3064 C  CD    . GLN C 1 47  ? 6.056   50.413  -7.604  1.00 54.32 ? 47   GLN C CD    1 
ATOM   3065 O  OE1   . GLN C 1 47  ? 5.211   50.944  -8.328  1.00 55.44 ? 47   GLN C OE1   1 
ATOM   3066 N  NE2   . GLN C 1 47  ? 7.050   51.096  -7.043  1.00 53.86 ? 47   GLN C NE2   1 
ATOM   3067 N  N     . VAL C 1 48  ? 7.524   46.640  -5.840  1.00 38.54 ? 48   VAL C N     1 
ATOM   3068 C  CA    . VAL C 1 48  ? 8.483   46.620  -4.739  1.00 38.71 ? 48   VAL C CA    1 
ATOM   3069 C  C     . VAL C 1 48  ? 9.305   45.332  -4.690  1.00 40.11 ? 48   VAL C C     1 
ATOM   3070 O  O     . VAL C 1 48  ? 10.506  45.374  -4.415  1.00 40.25 ? 48   VAL C O     1 
ATOM   3071 C  CB    . VAL C 1 48  ? 7.790   46.841  -3.372  1.00 37.63 ? 48   VAL C CB    1 
ATOM   3072 C  CG1   . VAL C 1 48  ? 8.817   46.839  -2.248  1.00 36.83 ? 48   VAL C CG1   1 
ATOM   3073 C  CG2   . VAL C 1 48  ? 7.037   48.156  -3.375  1.00 37.34 ? 48   VAL C CG2   1 
ATOM   3074 N  N     . ILE C 1 49  ? 8.667   44.194  -4.968  1.00 40.85 ? 49   ILE C N     1 
ATOM   3075 C  CA    . ILE C 1 49  ? 9.370   42.910  -4.947  1.00 41.57 ? 49   ILE C CA    1 
ATOM   3076 C  C     . ILE C 1 49  ? 10.290  42.719  -6.153  1.00 41.56 ? 49   ILE C C     1 
ATOM   3077 O  O     . ILE C 1 49  ? 11.081  41.777  -6.194  1.00 42.91 ? 49   ILE C O     1 
ATOM   3078 C  CB    . ILE C 1 49  ? 8.401   41.699  -4.816  1.00 40.94 ? 49   ILE C CB    1 
ATOM   3079 C  CG1   . ILE C 1 49  ? 7.437   41.638  -6.002  1.00 39.73 ? 49   ILE C CG1   1 
ATOM   3080 C  CG2   . ILE C 1 49  ? 7.644   41.777  -3.496  1.00 42.03 ? 49   ILE C CG2   1 
ATOM   3081 C  CD1   . ILE C 1 49  ? 6.497   40.447  -5.969  1.00 41.65 ? 49   ILE C CD1   1 
ATOM   3082 N  N     . GLY C 1 50  ? 10.185  43.620  -7.127  1.00 41.81 ? 50   GLY C N     1 
ATOM   3083 C  CA    . GLY C 1 50  ? 11.034  43.543  -8.302  1.00 41.87 ? 50   GLY C CA    1 
ATOM   3084 C  C     . GLY C 1 50  ? 10.376  43.130  -9.603  1.00 41.30 ? 50   GLY C C     1 
ATOM   3085 O  O     . GLY C 1 50  ? 11.072  42.893  -10.591 1.00 44.04 ? 50   GLY C O     1 
ATOM   3086 N  N     . GLU C 1 51  ? 9.051   43.034  -9.618  1.00 39.75 ? 51   GLU C N     1 
ATOM   3087 C  CA    . GLU C 1 51  ? 8.335   42.646  -10.831 1.00 40.69 ? 51   GLU C CA    1 
ATOM   3088 C  C     . GLU C 1 51  ? 7.802   43.834  -11.626 1.00 41.60 ? 51   GLU C C     1 
ATOM   3089 O  O     . GLU C 1 51  ? 7.818   44.970  -11.154 1.00 42.76 ? 51   GLU C O     1 
ATOM   3090 C  CB    . GLU C 1 51  ? 7.189   41.685  -10.499 1.00 40.12 ? 51   GLU C CB    1 
ATOM   3091 C  CG    . GLU C 1 51  ? 7.539   40.210  -10.667 1.00 38.27 ? 51   GLU C CG    1 
ATOM   3092 C  CD    . GLU C 1 51  ? 7.517   39.739  -12.121 1.00 39.69 ? 51   GLU C CD    1 
ATOM   3093 O  OE1   . GLU C 1 51  ? 7.484   40.579  -13.048 1.00 37.84 ? 51   GLU C OE1   1 
ATOM   3094 O  OE2   . GLU C 1 51  ? 7.522   38.510  -12.338 1.00 39.71 ? 51   GLU C OE2   1 
ATOM   3095 N  N     . ASP C 1 52  ? 7.351   43.559  -12.846 1.00 42.10 ? 52   ASP C N     1 
ATOM   3096 C  CA    . ASP C 1 52  ? 6.803   44.586  -13.723 1.00 43.75 ? 52   ASP C CA    1 
ATOM   3097 C  C     . ASP C 1 52  ? 5.281   44.496  -13.749 1.00 42.83 ? 52   ASP C C     1 
ATOM   3098 O  O     . ASP C 1 52  ? 4.714   43.644  -14.431 1.00 42.59 ? 52   ASP C O     1 
ATOM   3099 C  CB    . ASP C 1 52  ? 7.368   44.431  -15.143 1.00 45.47 ? 52   ASP C CB    1 
ATOM   3100 C  CG    . ASP C 1 52  ? 6.748   45.408  -16.139 1.00 48.41 ? 52   ASP C CG    1 
ATOM   3101 O  OD1   . ASP C 1 52  ? 6.285   46.492  -15.724 1.00 48.58 ? 52   ASP C OD1   1 
ATOM   3102 O  OD2   . ASP C 1 52  ? 6.728   45.089  -17.348 1.00 48.41 ? 52   ASP C OD2   1 
ATOM   3103 N  N     . PRO C 1 53  ? 4.600   45.392  -13.017 1.00 43.27 ? 53   PRO C N     1 
ATOM   3104 C  CA    . PRO C 1 53  ? 3.135   45.429  -12.944 1.00 42.87 ? 53   PRO C CA    1 
ATOM   3105 C  C     . PRO C 1 53  ? 2.476   45.604  -14.310 1.00 43.83 ? 53   PRO C C     1 
ATOM   3106 O  O     . PRO C 1 53  ? 1.311   45.247  -14.493 1.00 45.16 ? 53   PRO C O     1 
ATOM   3107 C  CB    . PRO C 1 53  ? 2.876   46.638  -12.046 1.00 43.41 ? 53   PRO C CB    1 
ATOM   3108 C  CG    . PRO C 1 53  ? 4.068   46.647  -11.148 1.00 43.77 ? 53   PRO C CG    1 
ATOM   3109 C  CD    . PRO C 1 53  ? 5.186   46.408  -12.127 1.00 43.49 ? 53   PRO C CD    1 
ATOM   3110 N  N     . GLY C 1 54  ? 3.229   46.154  -15.261 1.00 45.07 ? 54   GLY C N     1 
ATOM   3111 C  CA    . GLY C 1 54  ? 2.709   46.370  -16.600 1.00 46.15 ? 54   GLY C CA    1 
ATOM   3112 C  C     . GLY C 1 54  ? 2.865   45.165  -17.508 1.00 47.34 ? 54   GLY C C     1 
ATOM   3113 O  O     . GLY C 1 54  ? 2.374   45.164  -18.641 1.00 47.07 ? 54   GLY C O     1 
ATOM   3114 N  N     . ARG C 1 55  ? 3.550   44.140  -17.007 1.00 46.89 ? 55   ARG C N     1 
ATOM   3115 C  CA    . ARG C 1 55  ? 3.783   42.910  -17.757 1.00 46.43 ? 55   ARG C CA    1 
ATOM   3116 C  C     . ARG C 1 55  ? 2.466   42.213  -18.079 1.00 46.84 ? 55   ARG C C     1 
ATOM   3117 O  O     . ARG C 1 55  ? 1.526   42.243  -17.282 1.00 46.51 ? 55   ARG C O     1 
ATOM   3118 C  CB    . ARG C 1 55  ? 4.703   41.979  -16.958 1.00 46.66 ? 55   ARG C CB    1 
ATOM   3119 C  CG    . ARG C 1 55  ? 5.082   40.697  -17.671 1.00 44.58 ? 55   ARG C CG    1 
ATOM   3120 C  CD    . ARG C 1 55  ? 6.303   40.041  -17.037 1.00 41.17 ? 55   ARG C CD    1 
ATOM   3121 N  NE    . ARG C 1 55  ? 6.068   39.523  -15.689 1.00 41.28 ? 55   ARG C NE    1 
ATOM   3122 C  CZ    . ARG C 1 55  ? 5.316   38.462  -15.405 1.00 37.37 ? 55   ARG C CZ    1 
ATOM   3123 N  NH1   . ARG C 1 55  ? 4.700   37.795  -16.371 1.00 36.14 ? 55   ARG C NH1   1 
ATOM   3124 N  NH2   . ARG C 1 55  ? 5.240   38.021  -14.158 1.00 36.91 ? 55   ARG C NH2   1 
ATOM   3125 N  N     . GLU C 1 56  ? 2.415   41.597  -19.257 1.00 47.30 ? 56   GLU C N     1 
ATOM   3126 C  CA    . GLU C 1 56  ? 1.238   40.883  -19.747 1.00 47.51 ? 56   GLU C CA    1 
ATOM   3127 C  C     . GLU C 1 56  ? 0.525   40.022  -18.703 1.00 47.12 ? 56   GLU C C     1 
ATOM   3128 O  O     . GLU C 1 56  ? -0.654  40.237  -18.417 1.00 47.04 ? 56   GLU C O     1 
ATOM   3129 C  CB    . GLU C 1 56  ? 1.626   40.021  -20.956 1.00 49.40 ? 56   GLU C CB    1 
ATOM   3130 C  CG    . GLU C 1 56  ? 0.560   39.026  -21.420 1.00 53.37 ? 56   GLU C CG    1 
ATOM   3131 C  CD    . GLU C 1 56  ? -0.637  39.687  -22.081 1.00 56.29 ? 56   GLU C CD    1 
ATOM   3132 O  OE1   . GLU C 1 56  ? -1.380  40.422  -21.393 1.00 56.57 ? 56   GLU C OE1   1 
ATOM   3133 O  OE2   . GLU C 1 56  ? -0.841  39.456  -23.292 1.00 57.07 ? 56   GLU C OE2   1 
ATOM   3134 N  N     . GLY C 1 57  ? 1.250   39.067  -18.125 1.00 45.28 ? 57   GLY C N     1 
ATOM   3135 C  CA    . GLY C 1 57  ? 0.668   38.172  -17.140 1.00 44.21 ? 57   GLY C CA    1 
ATOM   3136 C  C     . GLY C 1 57  ? 0.352   38.743  -15.770 1.00 43.47 ? 57   GLY C C     1 
ATOM   3137 O  O     . GLY C 1 57  ? -0.242  38.051  -14.940 1.00 44.48 ? 57   GLY C O     1 
ATOM   3138 N  N     . LEU C 1 58  ? 0.738   39.992  -15.521 1.00 40.49 ? 58   LEU C N     1 
ATOM   3139 C  CA    . LEU C 1 58  ? 0.480   40.621  -14.228 1.00 37.92 ? 58   LEU C CA    1 
ATOM   3140 C  C     . LEU C 1 58  ? -0.564  41.735  -14.263 1.00 38.18 ? 58   LEU C C     1 
ATOM   3141 O  O     . LEU C 1 58  ? -0.967  42.233  -13.212 1.00 36.78 ? 58   LEU C O     1 
ATOM   3142 C  CB    . LEU C 1 58  ? 1.780   41.156  -13.620 1.00 34.42 ? 58   LEU C CB    1 
ATOM   3143 C  CG    . LEU C 1 58  ? 2.812   40.137  -13.131 1.00 35.52 ? 58   LEU C CG    1 
ATOM   3144 C  CD1   . LEU C 1 58  ? 4.070   40.859  -12.690 1.00 34.69 ? 58   LEU C CD1   1 
ATOM   3145 C  CD2   . LEU C 1 58  ? 2.243   39.318  -11.986 1.00 33.70 ? 58   LEU C CD2   1 
ATOM   3146 N  N     . LEU C 1 59  ? -1.014  42.106  -15.461 1.00 39.47 ? 59   LEU C N     1 
ATOM   3147 C  CA    . LEU C 1 59  ? -2.006  43.174  -15.618 1.00 40.85 ? 59   LEU C CA    1 
ATOM   3148 C  C     . LEU C 1 59  ? -3.256  43.009  -14.756 1.00 40.16 ? 59   LEU C C     1 
ATOM   3149 O  O     . LEU C 1 59  ? -3.659  43.941  -14.056 1.00 39.40 ? 59   LEU C O     1 
ATOM   3150 C  CB    . LEU C 1 59  ? -2.407  43.336  -17.089 1.00 41.11 ? 59   LEU C CB    1 
ATOM   3151 C  CG    . LEU C 1 59  ? -1.379  43.996  -18.014 1.00 42.95 ? 59   LEU C CG    1 
ATOM   3152 C  CD1   . LEU C 1 59  ? -1.950  44.128  -19.418 1.00 42.33 ? 59   LEU C CD1   1 
ATOM   3153 C  CD2   . LEU C 1 59  ? -0.991  45.365  -17.468 1.00 42.97 ? 59   LEU C CD2   1 
ATOM   3154 N  N     . LYS C 1 60  ? -3.856  41.822  -14.798 1.00 39.61 ? 60   LYS C N     1 
ATOM   3155 C  CA    . LYS C 1 60  ? -5.059  41.550  -14.018 1.00 39.12 ? 60   LYS C CA    1 
ATOM   3156 C  C     . LYS C 1 60  ? -4.789  40.925  -12.651 1.00 37.80 ? 60   LYS C C     1 
ATOM   3157 O  O     . LYS C 1 60  ? -5.727  40.572  -11.935 1.00 36.34 ? 60   LYS C O     1 
ATOM   3158 C  CB    . LYS C 1 60  ? -6.020  40.662  -14.810 1.00 40.49 ? 60   LYS C CB    1 
ATOM   3159 C  CG    . LYS C 1 60  ? -6.635  41.336  -16.026 1.00 45.52 ? 60   LYS C CG    1 
ATOM   3160 C  CD    . LYS C 1 60  ? -7.789  40.515  -16.587 1.00 49.37 ? 60   LYS C CD    1 
ATOM   3161 C  CE    . LYS C 1 60  ? -8.919  40.376  -15.570 1.00 50.81 ? 60   LYS C CE    1 
ATOM   3162 N  NZ    . LYS C 1 60  ? -10.038 39.529  -16.079 1.00 51.75 ? 60   LYS C NZ    1 
ATOM   3163 N  N     . THR C 1 61  ? -3.516  40.820  -12.276 1.00 37.15 ? 61   THR C N     1 
ATOM   3164 C  CA    . THR C 1 61  ? -3.139  40.227  -10.993 1.00 36.80 ? 61   THR C CA    1 
ATOM   3165 C  C     . THR C 1 61  ? -3.683  40.965  -9.767  1.00 37.07 ? 61   THR C C     1 
ATOM   3166 O  O     . THR C 1 61  ? -4.330  40.353  -8.920  1.00 36.12 ? 61   THR C O     1 
ATOM   3167 C  CB    . THR C 1 61  ? -1.608  40.032  -10.881 1.00 37.06 ? 61   THR C CB    1 
ATOM   3168 O  OG1   . THR C 1 61  ? -1.185  39.055  -11.840 1.00 35.35 ? 61   THR C OG1   1 
ATOM   3169 C  CG2   . THR C 1 61  ? -1.214  39.564  -9.486  1.00 35.62 ? 61   THR C CG2   1 
ATOM   3170 N  N     . PRO C 1 62  ? -3.447  42.288  -9.659  1.00 37.68 ? 62   PRO C N     1 
ATOM   3171 C  CA    . PRO C 1 62  ? -3.962  43.015  -8.491  1.00 36.29 ? 62   PRO C CA    1 
ATOM   3172 C  C     . PRO C 1 62  ? -5.472  42.845  -8.302  1.00 34.62 ? 62   PRO C C     1 
ATOM   3173 O  O     . PRO C 1 62  ? -5.960  42.836  -7.174  1.00 33.31 ? 62   PRO C O     1 
ATOM   3174 C  CB    . PRO C 1 62  ? -3.568  44.466  -8.787  1.00 38.40 ? 62   PRO C CB    1 
ATOM   3175 C  CG    . PRO C 1 62  ? -3.438  44.504  -10.285 1.00 41.10 ? 62   PRO C CG    1 
ATOM   3176 C  CD    . PRO C 1 62  ? -2.746  43.206  -10.572 1.00 38.78 ? 62   PRO C CD    1 
ATOM   3177 N  N     . GLU C 1 63  ? -6.190  42.666  -9.408  1.00 33.38 ? 63   GLU C N     1 
ATOM   3178 C  CA    . GLU C 1 63  ? -7.638  42.468  -9.382  1.00 34.88 ? 63   GLU C CA    1 
ATOM   3179 C  C     . GLU C 1 63  ? -7.965  41.060  -8.875  1.00 35.19 ? 63   GLU C C     1 
ATOM   3180 O  O     . GLU C 1 63  ? -8.854  40.880  -8.035  1.00 33.88 ? 63   GLU C O     1 
ATOM   3181 C  CB    . GLU C 1 63  ? -8.219  42.660  -10.785 1.00 37.06 ? 63   GLU C CB    1 
ATOM   3182 C  CG    . GLU C 1 63  ? -9.738  42.552  -10.861 1.00 43.39 ? 63   GLU C CG    1 
ATOM   3183 C  CD    . GLU C 1 63  ? -10.275 42.784  -12.264 1.00 46.47 ? 63   GLU C CD    1 
ATOM   3184 O  OE1   . GLU C 1 63  ? -11.185 42.038  -12.684 1.00 50.33 ? 63   GLU C OE1   1 
ATOM   3185 O  OE2   . GLU C 1 63  ? -9.792  43.713  -12.948 1.00 50.41 ? 63   GLU C OE2   1 
ATOM   3186 N  N     . ARG C 1 64  ? -7.243  40.071  -9.399  1.00 32.64 ? 64   ARG C N     1 
ATOM   3187 C  CA    . ARG C 1 64  ? -7.426  38.672  -9.012  1.00 33.92 ? 64   ARG C CA    1 
ATOM   3188 C  C     . ARG C 1 64  ? -7.077  38.439  -7.544  1.00 30.38 ? 64   ARG C C     1 
ATOM   3189 O  O     . ARG C 1 64  ? -7.766  37.691  -6.850  1.00 30.62 ? 64   ARG C O     1 
ATOM   3190 C  CB    . ARG C 1 64  ? -6.580  37.756  -9.903  1.00 33.51 ? 64   ARG C CB    1 
ATOM   3191 C  CG    . ARG C 1 64  ? -7.109  37.620  -11.318 1.00 36.57 ? 64   ARG C CG    1 
ATOM   3192 C  CD    . ARG C 1 64  ? -6.279  36.646  -12.138 1.00 36.12 ? 64   ARG C CD    1 
ATOM   3193 N  NE    . ARG C 1 64  ? -4.953  37.167  -12.450 1.00 35.48 ? 64   ARG C NE    1 
ATOM   3194 C  CZ    . ARG C 1 64  ? -4.490  37.345  -13.683 1.00 36.80 ? 64   ARG C CZ    1 
ATOM   3195 N  NH1   . ARG C 1 64  ? -5.247  37.044  -14.732 1.00 34.97 ? 64   ARG C NH1   1 
ATOM   3196 N  NH2   . ARG C 1 64  ? -3.269  37.830  -13.868 1.00 35.95 ? 64   ARG C NH2   1 
ATOM   3197 N  N     . VAL C 1 65  ? -6.013  39.092  -7.082  1.00 28.25 ? 65   VAL C N     1 
ATOM   3198 C  CA    . VAL C 1 65  ? -5.555  38.983  -5.700  1.00 29.73 ? 65   VAL C CA    1 
ATOM   3199 C  C     . VAL C 1 65  ? -6.558  39.617  -4.734  1.00 32.29 ? 65   VAL C C     1 
ATOM   3200 O  O     . VAL C 1 65  ? -6.811  39.086  -3.648  1.00 29.83 ? 65   VAL C O     1 
ATOM   3201 C  CB    . VAL C 1 65  ? -4.176  39.661  -5.514  1.00 27.29 ? 65   VAL C CB    1 
ATOM   3202 C  CG1   . VAL C 1 65  ? -3.762  39.640  -4.054  1.00 30.63 ? 65   VAL C CG1   1 
ATOM   3203 C  CG2   . VAL C 1 65  ? -3.127  38.964  -6.366  1.00 28.82 ? 65   VAL C CG2   1 
ATOM   3204 N  N     . ALA C 1 66  ? -7.129  40.750  -5.140  1.00 31.79 ? 66   ALA C N     1 
ATOM   3205 C  CA    . ALA C 1 66  ? -8.106  41.467  -4.322  1.00 31.81 ? 66   ALA C CA    1 
ATOM   3206 C  C     . ALA C 1 66  ? -9.325  40.599  -4.029  1.00 29.84 ? 66   ALA C C     1 
ATOM   3207 O  O     . ALA C 1 66  ? -9.710  40.428  -2.871  1.00 30.04 ? 66   ALA C O     1 
ATOM   3208 C  CB    . ALA C 1 66  ? -8.535  42.756  -5.018  1.00 32.94 ? 66   ALA C CB    1 
ATOM   3209 N  N     . LYS C 1 67  ? -9.925  40.061  -5.088  1.00 30.57 ? 67   LYS C N     1 
ATOM   3210 C  CA    . LYS C 1 67  ? -11.100 39.204  -4.965  1.00 32.88 ? 67   LYS C CA    1 
ATOM   3211 C  C     . LYS C 1 67  ? -10.748 37.930  -4.203  1.00 32.65 ? 67   LYS C C     1 
ATOM   3212 O  O     . LYS C 1 67  ? -11.554 37.425  -3.420  1.00 32.35 ? 67   LYS C O     1 
ATOM   3213 C  CB    . LYS C 1 67  ? -11.645 38.842  -6.350  1.00 35.24 ? 67   LYS C CB    1 
ATOM   3214 C  CG    . LYS C 1 67  ? -12.089 40.033  -7.190  1.00 40.74 ? 67   LYS C CG    1 
ATOM   3215 C  CD    . LYS C 1 67  ? -12.647 39.571  -8.533  1.00 45.07 ? 67   LYS C CD    1 
ATOM   3216 C  CE    . LYS C 1 67  ? -12.988 40.744  -9.446  1.00 49.37 ? 67   LYS C CE    1 
ATOM   3217 N  NZ    . LYS C 1 67  ? -14.064 41.613  -8.892  1.00 51.57 ? 67   LYS C NZ    1 
ATOM   3218 N  N     . ALA C 1 68  ? -9.536  37.428  -4.433  1.00 32.04 ? 68   ALA C N     1 
ATOM   3219 C  CA    . ALA C 1 68  ? -9.054  36.219  -3.773  1.00 32.21 ? 68   ALA C CA    1 
ATOM   3220 C  C     . ALA C 1 68  ? -9.059  36.391  -2.260  1.00 31.47 ? 68   ALA C C     1 
ATOM   3221 O  O     . ALA C 1 68  ? -9.667  35.595  -1.546  1.00 30.99 ? 68   ALA C O     1 
ATOM   3222 C  CB    . ALA C 1 68  ? -7.648  35.871  -4.259  1.00 31.60 ? 68   ALA C CB    1 
ATOM   3223 N  N     . TRP C 1 69  ? -8.411  37.450  -1.779  1.00 30.55 ? 69   TRP C N     1 
ATOM   3224 C  CA    . TRP C 1 69  ? -8.344  37.714  -0.349  1.00 30.35 ? 69   TRP C CA    1 
ATOM   3225 C  C     . TRP C 1 69  ? -9.684  38.050  0.289   1.00 31.39 ? 69   TRP C C     1 
ATOM   3226 O  O     . TRP C 1 69  ? -9.878  37.821  1.484   1.00 31.79 ? 69   TRP C O     1 
ATOM   3227 C  CB    . TRP C 1 69  ? -7.300  38.781  -0.043  1.00 29.59 ? 69   TRP C CB    1 
ATOM   3228 C  CG    . TRP C 1 69  ? -5.934  38.201  0.045   1.00 29.36 ? 69   TRP C CG    1 
ATOM   3229 C  CD1   . TRP C 1 69  ? -5.087  37.934  -0.992  1.00 29.88 ? 69   TRP C CD1   1 
ATOM   3230 C  CD2   . TRP C 1 69  ? -5.266  37.767  1.234   1.00 29.80 ? 69   TRP C CD2   1 
ATOM   3231 N  NE1   . TRP C 1 69  ? -3.932  37.357  -0.521  1.00 28.93 ? 69   TRP C NE1   1 
ATOM   3232 C  CE2   . TRP C 1 69  ? -4.015  37.243  0.842   1.00 29.62 ? 69   TRP C CE2   1 
ATOM   3233 C  CE3   . TRP C 1 69  ? -5.603  37.768  2.594   1.00 30.41 ? 69   TRP C CE3   1 
ATOM   3234 C  CZ2   . TRP C 1 69  ? -3.097  36.725  1.761   1.00 32.73 ? 69   TRP C CZ2   1 
ATOM   3235 C  CZ3   . TRP C 1 69  ? -4.690  37.253  3.510   1.00 34.09 ? 69   TRP C CZ3   1 
ATOM   3236 C  CH2   . TRP C 1 69  ? -3.452  36.738  3.087   1.00 31.10 ? 69   TRP C CH2   1 
ATOM   3237 N  N     . ALA C 1 70  ? -10.606 38.581  -0.508  1.00 30.43 ? 70   ALA C N     1 
ATOM   3238 C  CA    . ALA C 1 70  ? -11.940 38.904  -0.017  1.00 30.61 ? 70   ALA C CA    1 
ATOM   3239 C  C     . ALA C 1 70  ? -12.634 37.577  0.300   1.00 31.88 ? 70   ALA C C     1 
ATOM   3240 O  O     . ALA C 1 70  ? -13.328 37.446  1.308   1.00 29.93 ? 70   ALA C O     1 
ATOM   3241 C  CB    . ALA C 1 70  ? -12.721 39.672  -1.074  1.00 31.93 ? 70   ALA C CB    1 
ATOM   3242 N  N     . PHE C 1 71  ? -12.419 36.593  -0.568  1.00 29.95 ? 71   PHE C N     1 
ATOM   3243 C  CA    . PHE C 1 71  ? -12.991 35.264  -0.398  1.00 29.63 ? 71   PHE C CA    1 
ATOM   3244 C  C     . PHE C 1 71  ? -12.309 34.537  0.764   1.00 28.32 ? 71   PHE C C     1 
ATOM   3245 O  O     . PHE C 1 71  ? -12.975 33.921  1.595   1.00 27.75 ? 71   PHE C O     1 
ATOM   3246 C  CB    . PHE C 1 71  ? -12.831 34.458  -1.693  1.00 30.65 ? 71   PHE C CB    1 
ATOM   3247 C  CG    . PHE C 1 71  ? -13.297 33.030  -1.588  1.00 30.64 ? 71   PHE C CG    1 
ATOM   3248 C  CD1   . PHE C 1 71  ? -14.645 32.714  -1.713  1.00 32.04 ? 71   PHE C CD1   1 
ATOM   3249 C  CD2   . PHE C 1 71  ? -12.386 32.001  -1.364  1.00 32.00 ? 71   PHE C CD2   1 
ATOM   3250 C  CE1   . PHE C 1 71  ? -15.081 31.393  -1.615  1.00 31.84 ? 71   PHE C CE1   1 
ATOM   3251 C  CE2   . PHE C 1 71  ? -12.812 30.679  -1.265  1.00 31.98 ? 71   PHE C CE2   1 
ATOM   3252 C  CZ    . PHE C 1 71  ? -14.160 30.375  -1.390  1.00 31.01 ? 71   PHE C CZ    1 
ATOM   3253 N  N     . LEU C 1 72  ? -10.984 34.645  0.832   1.00 27.39 ? 72   LEU C N     1 
ATOM   3254 C  CA    . LEU C 1 72  ? -10.194 33.988  1.872   1.00 25.95 ? 72   LEU C CA    1 
ATOM   3255 C  C     . LEU C 1 72  ? -10.405 34.537  3.280   1.00 27.48 ? 72   LEU C C     1 
ATOM   3256 O  O     . LEU C 1 72  ? -9.949  33.942  4.258   1.00 26.12 ? 72   LEU C O     1 
ATOM   3257 C  CB    . LEU C 1 72  ? -8.706  34.034  1.512   1.00 26.32 ? 72   LEU C CB    1 
ATOM   3258 C  CG    . LEU C 1 72  ? -8.316  33.331  0.207   1.00 25.20 ? 72   LEU C CG    1 
ATOM   3259 C  CD1   . LEU C 1 72  ? -6.827  33.490  -0.041  1.00 22.54 ? 72   LEU C CD1   1 
ATOM   3260 C  CD2   . LEU C 1 72  ? -8.697  31.852  0.269   1.00 25.01 ? 72   LEU C CD2   1 
ATOM   3261 N  N     . THR C 1 73  ? -11.077 35.681  3.378   1.00 29.11 ? 73   THR C N     1 
ATOM   3262 C  CA    . THR C 1 73  ? -11.350 36.306  4.668   1.00 30.52 ? 73   THR C CA    1 
ATOM   3263 C  C     . THR C 1 73  ? -12.852 36.478  4.896   1.00 30.93 ? 73   THR C C     1 
ATOM   3264 O  O     . THR C 1 73  ? -13.266 37.142  5.846   1.00 31.78 ? 73   THR C O     1 
ATOM   3265 C  CB    . THR C 1 73  ? -10.657 37.690  4.792   1.00 31.37 ? 73   THR C CB    1 
ATOM   3266 O  OG1   . THR C 1 73  ? -11.097 38.548  3.732   1.00 31.56 ? 73   THR C OG1   1 
ATOM   3267 C  CG2   . THR C 1 73  ? -9.143  37.543  4.731   1.00 32.71 ? 73   THR C CG2   1 
ATOM   3268 N  N     . ARG C 1 74  ? -13.658 35.840  4.048   1.00 30.56 ? 74   ARG C N     1 
ATOM   3269 C  CA    . ARG C 1 74  ? -15.116 35.924  4.136   1.00 31.36 ? 74   ARG C CA    1 
ATOM   3270 C  C     . ARG C 1 74  ? -15.686 35.353  5.435   1.00 32.57 ? 74   ARG C C     1 
ATOM   3271 O  O     . ARG C 1 74  ? -16.831 35.638  5.793   1.00 31.58 ? 74   ARG C O     1 
ATOM   3272 C  CB    . ARG C 1 74  ? -15.762 35.227  2.932   1.00 32.45 ? 74   ARG C CB    1 
ATOM   3273 C  CG    . ARG C 1 74  ? -15.779 33.703  3.010   1.00 33.24 ? 74   ARG C CG    1 
ATOM   3274 C  CD    . ARG C 1 74  ? -16.169 33.067  1.676   1.00 37.58 ? 74   ARG C CD    1 
ATOM   3275 N  NE    . ARG C 1 74  ? -17.393 33.627  1.102   1.00 39.94 ? 74   ARG C NE    1 
ATOM   3276 C  CZ    . ARG C 1 74  ? -18.626 33.349  1.519   1.00 43.81 ? 74   ARG C CZ    1 
ATOM   3277 N  NH1   . ARG C 1 74  ? -18.825 32.509  2.528   1.00 44.88 ? 74   ARG C NH1   1 
ATOM   3278 N  NH2   . ARG C 1 74  ? -19.667 33.916  0.923   1.00 43.82 ? 74   ARG C NH2   1 
ATOM   3279 N  N     . GLY C 1 75  ? -14.884 34.550  6.132   1.00 29.54 ? 75   GLY C N     1 
ATOM   3280 C  CA    . GLY C 1 75  ? -15.319 33.948  7.380   1.00 30.79 ? 75   GLY C CA    1 
ATOM   3281 C  C     . GLY C 1 75  ? -15.620 34.948  8.483   1.00 32.02 ? 75   GLY C C     1 
ATOM   3282 O  O     . GLY C 1 75  ? -16.435 34.676  9.366   1.00 29.26 ? 75   GLY C O     1 
ATOM   3283 N  N     . TYR C 1 76  ? -14.942 36.093  8.443   1.00 33.01 ? 76   TYR C N     1 
ATOM   3284 C  CA    . TYR C 1 76  ? -15.138 37.156  9.426   1.00 35.43 ? 76   TYR C CA    1 
ATOM   3285 C  C     . TYR C 1 76  ? -16.526 37.773  9.288   1.00 35.66 ? 76   TYR C C     1 
ATOM   3286 O  O     . TYR C 1 76  ? -17.094 38.260  10.264  1.00 36.62 ? 76   TYR C O     1 
ATOM   3287 C  CB    . TYR C 1 76  ? -14.111 38.274  9.225   1.00 32.54 ? 76   TYR C CB    1 
ATOM   3288 C  CG    . TYR C 1 76  ? -12.686 37.921  9.571   1.00 30.36 ? 76   TYR C CG    1 
ATOM   3289 C  CD1   . TYR C 1 76  ? -12.330 37.567  10.872  1.00 29.48 ? 76   TYR C CD1   1 
ATOM   3290 C  CD2   . TYR C 1 76  ? -11.683 37.980  8.606   1.00 27.57 ? 76   TYR C CD2   1 
ATOM   3291 C  CE1   . TYR C 1 76  ? -11.010 37.283  11.203  1.00 29.08 ? 76   TYR C CE1   1 
ATOM   3292 C  CE2   . TYR C 1 76  ? -10.362 37.697  8.926   1.00 27.57 ? 76   TYR C CE2   1 
ATOM   3293 C  CZ    . TYR C 1 76  ? -10.034 37.350  10.225  1.00 28.12 ? 76   TYR C CZ    1 
ATOM   3294 O  OH    . TYR C 1 76  ? -8.731  37.065  10.542  1.00 29.88 ? 76   TYR C OH    1 
ATOM   3295 N  N     . ARG C 1 77  ? -17.055 37.749  8.068   1.00 37.75 ? 77   ARG C N     1 
ATOM   3296 C  CA    . ARG C 1 77  ? -18.358 38.333  7.763   1.00 38.68 ? 77   ARG C CA    1 
ATOM   3297 C  C     . ARG C 1 77  ? -19.555 37.387  7.810   1.00 37.35 ? 77   ARG C C     1 
ATOM   3298 O  O     . ARG C 1 77  ? -20.689 37.812  7.589   1.00 38.04 ? 77   ARG C O     1 
ATOM   3299 C  CB    . ARG C 1 77  ? -18.299 39.034  6.405   1.00 40.67 ? 77   ARG C CB    1 
ATOM   3300 C  CG    . ARG C 1 77  ? -17.328 40.206  6.374   1.00 44.91 ? 77   ARG C CG    1 
ATOM   3301 C  CD    . ARG C 1 77  ? -17.250 40.848  4.999   1.00 46.22 ? 77   ARG C CD    1 
ATOM   3302 N  NE    . ARG C 1 77  ? -16.523 40.033  4.028   1.00 47.46 ? 77   ARG C NE    1 
ATOM   3303 C  CZ    . ARG C 1 77  ? -15.203 39.858  4.027   1.00 49.33 ? 77   ARG C CZ    1 
ATOM   3304 N  NH1   . ARG C 1 77  ? -14.445 40.437  4.952   1.00 49.19 ? 77   ARG C NH1   1 
ATOM   3305 N  NH2   . ARG C 1 77  ? -14.637 39.122  3.081   1.00 48.70 ? 77   ARG C NH2   1 
ATOM   3306 N  N     . GLN C 1 78  ? -19.310 36.112  8.089   1.00 36.51 ? 78   GLN C N     1 
ATOM   3307 C  CA    . GLN C 1 78  ? -20.395 35.137  8.162   1.00 34.52 ? 78   GLN C CA    1 
ATOM   3308 C  C     . GLN C 1 78  ? -21.018 35.097  9.551   1.00 33.84 ? 78   GLN C C     1 
ATOM   3309 O  O     . GLN C 1 78  ? -20.398 35.511  10.532  1.00 32.68 ? 78   GLN C O     1 
ATOM   3310 C  CB    . GLN C 1 78  ? -19.896 33.741  7.784   1.00 33.62 ? 78   GLN C CB    1 
ATOM   3311 C  CG    . GLN C 1 78  ? -19.533 33.584  6.320   1.00 33.41 ? 78   GLN C CG    1 
ATOM   3312 C  CD    . GLN C 1 78  ? -19.012 32.197  6.006   1.00 33.52 ? 78   GLN C CD    1 
ATOM   3313 O  OE1   . GLN C 1 78  ? -17.868 31.868  6.317   1.00 35.05 ? 78   GLN C OE1   1 
ATOM   3314 N  NE2   . GLN C 1 78  ? -19.854 31.371  5.396   1.00 34.12 ? 78   GLN C NE2   1 
ATOM   3315 N  N     . ARG C 1 79  ? -22.254 34.611  9.622   1.00 33.23 ? 79   ARG C N     1 
ATOM   3316 C  CA    . ARG C 1 79  ? -22.967 34.499  10.890  1.00 37.31 ? 79   ARG C CA    1 
ATOM   3317 C  C     . ARG C 1 79  ? -23.298 33.033  11.131  1.00 35.41 ? 79   ARG C C     1 
ATOM   3318 O  O     . ARG C 1 79  ? -23.889 32.374  10.275  1.00 34.96 ? 79   ARG C O     1 
ATOM   3319 C  CB    . ARG C 1 79  ? -24.255 35.325  10.867  1.00 41.06 ? 79   ARG C CB    1 
ATOM   3320 C  CG    . ARG C 1 79  ? -24.061 36.779  10.467  1.00 48.44 ? 79   ARG C CG    1 
ATOM   3321 C  CD    . ARG C 1 79  ? -25.351 37.571  10.610  1.00 54.03 ? 79   ARG C CD    1 
ATOM   3322 N  NE    . ARG C 1 79  ? -25.742 37.723  12.010  1.00 58.72 ? 79   ARG C NE    1 
ATOM   3323 C  CZ    . ARG C 1 79  ? -26.599 38.638  12.455  1.00 61.12 ? 79   ARG C CZ    1 
ATOM   3324 N  NH1   . ARG C 1 79  ? -27.167 39.491  11.611  1.00 61.51 ? 79   ARG C NH1   1 
ATOM   3325 N  NH2   . ARG C 1 79  ? -26.873 38.716  13.751  1.00 63.09 ? 79   ARG C NH2   1 
ATOM   3326 N  N     . LEU C 1 80  ? -22.931 32.537  12.309  1.00 36.36 ? 80   LEU C N     1 
ATOM   3327 C  CA    . LEU C 1 80  ? -23.163 31.144  12.681  1.00 35.30 ? 80   LEU C CA    1 
ATOM   3328 C  C     . LEU C 1 80  ? -24.598 30.680  12.444  1.00 36.22 ? 80   LEU C C     1 
ATOM   3329 O  O     . LEU C 1 80  ? -24.824 29.567  11.973  1.00 35.16 ? 80   LEU C O     1 
ATOM   3330 C  CB    . LEU C 1 80  ? -22.770 30.926  14.142  1.00 34.86 ? 80   LEU C CB    1 
ATOM   3331 C  CG    . LEU C 1 80  ? -22.803 29.503  14.703  1.00 33.35 ? 80   LEU C CG    1 
ATOM   3332 C  CD1   . LEU C 1 80  ? -21.974 28.556  13.834  1.00 33.26 ? 80   LEU C CD1   1 
ATOM   3333 C  CD2   . LEU C 1 80  ? -22.275 29.528  16.126  1.00 34.26 ? 80   LEU C CD2   1 
ATOM   3334 N  N     . GLU C 1 81  ? -25.556 31.556  12.729  1.00 36.66 ? 81   GLU C N     1 
ATOM   3335 C  CA    . GLU C 1 81  ? -26.974 31.248  12.559  1.00 37.21 ? 81   GLU C CA    1 
ATOM   3336 C  C     . GLU C 1 81  ? -27.339 30.990  11.098  1.00 35.25 ? 81   GLU C C     1 
ATOM   3337 O  O     . GLU C 1 81  ? -28.123 30.091  10.800  1.00 33.44 ? 81   GLU C O     1 
ATOM   3338 C  CB    . GLU C 1 81  ? -27.841 32.388  13.114  1.00 41.93 ? 81   GLU C CB    1 
ATOM   3339 C  CG    . GLU C 1 81  ? -27.660 32.675  14.612  1.00 48.37 ? 81   GLU C CG    1 
ATOM   3340 C  CD    . GLU C 1 81  ? -26.278 33.218  14.966  1.00 51.02 ? 81   GLU C CD    1 
ATOM   3341 O  OE1   . GLU C 1 81  ? -25.831 34.197  14.327  1.00 50.80 ? 81   GLU C OE1   1 
ATOM   3342 O  OE2   . GLU C 1 81  ? -25.639 32.661  15.886  1.00 53.57 ? 81   GLU C OE2   1 
ATOM   3343 N  N     . GLU C 1 82  ? -26.763 31.780  10.196  1.00 34.94 ? 82   GLU C N     1 
ATOM   3344 C  CA    . GLU C 1 82  ? -27.026 31.650  8.762   1.00 36.61 ? 82   GLU C CA    1 
ATOM   3345 C  C     . GLU C 1 82  ? -26.290 30.454  8.158   1.00 34.59 ? 82   GLU C C     1 
ATOM   3346 O  O     . GLU C 1 82  ? -26.804 29.785  7.261   1.00 33.75 ? 82   GLU C O     1 
ATOM   3347 C  CB    . GLU C 1 82  ? -26.618 32.933  8.030   1.00 40.50 ? 82   GLU C CB    1 
ATOM   3348 C  CG    . GLU C 1 82  ? -27.305 34.193  8.556   1.00 46.88 ? 82   GLU C CG    1 
ATOM   3349 C  CD    . GLU C 1 82  ? -26.870 35.462  7.837   1.00 51.34 ? 82   GLU C CD    1 
ATOM   3350 O  OE1   . GLU C 1 82  ? -25.687 35.559  7.436   1.00 53.13 ? 82   GLU C OE1   1 
ATOM   3351 O  OE2   . GLU C 1 82  ? -27.713 36.371  7.682   1.00 52.50 ? 82   GLU C OE2   1 
ATOM   3352 N  N     . VAL C 1 83  ? -25.083 30.201  8.658   1.00 34.75 ? 83   VAL C N     1 
ATOM   3353 C  CA    . VAL C 1 83  ? -24.250 29.093  8.193   1.00 33.13 ? 83   VAL C CA    1 
ATOM   3354 C  C     . VAL C 1 83  ? -24.908 27.748  8.505   1.00 32.30 ? 83   VAL C C     1 
ATOM   3355 O  O     . VAL C 1 83  ? -24.946 26.856  7.658   1.00 32.81 ? 83   VAL C O     1 
ATOM   3356 C  CB    . VAL C 1 83  ? -22.839 29.177  8.827   1.00 32.67 ? 83   VAL C CB    1 
ATOM   3357 C  CG1   . VAL C 1 83  ? -22.064 27.893  8.605   1.00 33.99 ? 83   VAL C CG1   1 
ATOM   3358 C  CG2   . VAL C 1 83  ? -22.079 30.346  8.230   1.00 31.23 ? 83   VAL C CG2   1 
ATOM   3359 N  N     . VAL C 1 84  ? -25.437 27.618  9.718   1.00 31.44 ? 84   VAL C N     1 
ATOM   3360 C  CA    . VAL C 1 84  ? -26.109 26.393  10.136  1.00 30.96 ? 84   VAL C CA    1 
ATOM   3361 C  C     . VAL C 1 84  ? -27.504 26.333  9.520   1.00 32.81 ? 84   VAL C C     1 
ATOM   3362 O  O     . VAL C 1 84  ? -28.010 25.254  9.197   1.00 32.58 ? 84   VAL C O     1 
ATOM   3363 C  CB    . VAL C 1 84  ? -26.224 26.316  11.678  1.00 33.10 ? 84   VAL C CB    1 
ATOM   3364 C  CG1   . VAL C 1 84  ? -27.087 25.131  12.097  1.00 32.14 ? 84   VAL C CG1   1 
ATOM   3365 C  CG2   . VAL C 1 84  ? -24.842 26.202  12.293  1.00 33.45 ? 84   VAL C CG2   1 
ATOM   3366 N  N     . GLY C 1 85  ? -28.099 27.503  9.309   1.00 31.74 ? 85   GLY C N     1 
ATOM   3367 C  CA    . GLY C 1 85  ? -29.436 27.558  8.751   1.00 36.11 ? 85   GLY C CA    1 
ATOM   3368 C  C     . GLY C 1 85  ? -30.383 26.939  9.757   1.00 35.19 ? 85   GLY C C     1 
ATOM   3369 O  O     . GLY C 1 85  ? -30.255 27.171  10.963  1.00 39.90 ? 85   GLY C O     1 
ATOM   3370 N  N     . GLY C 1 86  ? -31.316 26.128  9.277   1.00 36.15 ? 86   GLY C N     1 
ATOM   3371 C  CA    . GLY C 1 86  ? -32.247 25.487  10.188  1.00 38.19 ? 86   GLY C CA    1 
ATOM   3372 C  C     . GLY C 1 86  ? -32.012 23.991  10.275  1.00 38.58 ? 86   GLY C C     1 
ATOM   3373 O  O     . GLY C 1 86  ? -32.830 23.269  10.845  1.00 36.81 ? 86   GLY C O     1 
ATOM   3374 N  N     . ALA C 1 87  ? -30.871 23.539  9.752   1.00 37.65 ? 87   ALA C N     1 
ATOM   3375 C  CA    . ALA C 1 87  ? -30.521 22.121  9.726   1.00 37.45 ? 87   ALA C CA    1 
ATOM   3376 C  C     . ALA C 1 87  ? -30.163 21.471  11.060  1.00 37.51 ? 87   ALA C C     1 
ATOM   3377 O  O     . ALA C 1 87  ? -29.068 20.924  11.231  1.00 37.77 ? 87   ALA C O     1 
ATOM   3378 C  CB    . ALA C 1 87  ? -29.425 21.870  8.701   1.00 37.21 ? 87   ALA C CB    1 
ATOM   3379 N  N     . VAL C 1 88  ? -31.095 21.538  12.003  1.00 34.44 ? 88   VAL C N     1 
ATOM   3380 C  CA    . VAL C 1 88  ? -30.937 20.926  13.316  1.00 34.57 ? 88   VAL C CA    1 
ATOM   3381 C  C     . VAL C 1 88  ? -32.132 19.988  13.451  1.00 33.92 ? 88   VAL C C     1 
ATOM   3382 O  O     . VAL C 1 88  ? -33.279 20.430  13.532  1.00 32.42 ? 88   VAL C O     1 
ATOM   3383 C  CB    . VAL C 1 88  ? -30.907 21.976  14.459  1.00 36.23 ? 88   VAL C CB    1 
ATOM   3384 C  CG1   . VAL C 1 88  ? -29.561 22.683  14.481  1.00 36.49 ? 88   VAL C CG1   1 
ATOM   3385 C  CG2   . VAL C 1 88  ? -32.023 23.000  14.281  1.00 40.64 ? 88   VAL C CG2   1 
ATOM   3386 N  N     . PHE C 1 89  ? -31.854 18.690  13.399  1.00 32.55 ? 89   PHE C N     1 
ATOM   3387 C  CA    . PHE C 1 89  ? -32.887 17.663  13.462  1.00 31.47 ? 89   PHE C CA    1 
ATOM   3388 C  C     . PHE C 1 89  ? -32.900 16.915  14.794  1.00 30.89 ? 89   PHE C C     1 
ATOM   3389 O  O     . PHE C 1 89  ? -31.961 17.024  15.585  1.00 29.14 ? 89   PHE C O     1 
ATOM   3390 C  CB    . PHE C 1 89  ? -32.674 16.670  12.311  1.00 33.08 ? 89   PHE C CB    1 
ATOM   3391 C  CG    . PHE C 1 89  ? -32.399 17.328  10.984  1.00 35.39 ? 89   PHE C CG    1 
ATOM   3392 C  CD1   . PHE C 1 89  ? -33.411 17.993  10.298  1.00 36.05 ? 89   PHE C CD1   1 
ATOM   3393 C  CD2   . PHE C 1 89  ? -31.124 17.294  10.427  1.00 36.33 ? 89   PHE C CD2   1 
ATOM   3394 C  CE1   . PHE C 1 89  ? -33.156 18.617  9.076   1.00 36.15 ? 89   PHE C CE1   1 
ATOM   3395 C  CE2   . PHE C 1 89  ? -30.860 17.915  9.205   1.00 34.71 ? 89   PHE C CE2   1 
ATOM   3396 C  CZ    . PHE C 1 89  ? -31.879 18.577  8.531   1.00 37.06 ? 89   PHE C CZ    1 
ATOM   3397 N  N     . PRO C 1 90  ? -33.996 16.189  15.086  1.00 32.59 ? 90   PRO C N     1 
ATOM   3398 C  CA    . PRO C 1 90  ? -34.108 15.425  16.335  1.00 32.15 ? 90   PRO C CA    1 
ATOM   3399 C  C     . PRO C 1 90  ? -33.118 14.262  16.295  1.00 31.55 ? 90   PRO C C     1 
ATOM   3400 O  O     . PRO C 1 90  ? -32.912 13.659  15.239  1.00 29.84 ? 90   PRO C O     1 
ATOM   3401 C  CB    . PRO C 1 90  ? -35.547 14.903  16.288  1.00 33.53 ? 90   PRO C CB    1 
ATOM   3402 C  CG    . PRO C 1 90  ? -36.260 15.914  15.453  1.00 34.98 ? 90   PRO C CG    1 
ATOM   3403 C  CD    . PRO C 1 90  ? -35.273 16.170  14.351  1.00 32.14 ? 90   PRO C CD    1 
ATOM   3404 N  N     . ALA C 1 91  ? -32.509 13.949  17.435  1.00 31.54 ? 91   ALA C N     1 
ATOM   3405 C  CA    . ALA C 1 91  ? -31.541 12.856  17.507  1.00 31.65 ? 91   ALA C CA    1 
ATOM   3406 C  C     . ALA C 1 91  ? -32.183 11.496  17.242  1.00 32.12 ? 91   ALA C C     1 
ATOM   3407 O  O     . ALA C 1 91  ? -33.276 11.204  17.736  1.00 31.65 ? 91   ALA C O     1 
ATOM   3408 C  CB    . ALA C 1 91  ? -30.843 12.853  18.860  1.00 29.91 ? 91   ALA C CB    1 
ATOM   3409 N  N     . GLU C 1 92  ? -31.503 10.675  16.445  1.00 31.28 ? 92   GLU C N     1 
ATOM   3410 C  CA    . GLU C 1 92  ? -31.991 9.339   16.108  1.00 31.67 ? 92   GLU C CA    1 
ATOM   3411 C  C     . GLU C 1 92  ? -31.529 8.312   17.135  1.00 32.91 ? 92   GLU C C     1 
ATOM   3412 O  O     . GLU C 1 92  ? -32.065 7.205   17.207  1.00 33.82 ? 92   GLU C O     1 
ATOM   3413 C  CB    . GLU C 1 92  ? -31.494 8.932   14.719  1.00 31.08 ? 92   GLU C CB    1 
ATOM   3414 C  CG    . GLU C 1 92  ? -32.010 9.809   13.585  1.00 30.74 ? 92   GLU C CG    1 
ATOM   3415 C  CD    . GLU C 1 92  ? -33.502 9.644   13.325  1.00 32.47 ? 92   GLU C CD    1 
ATOM   3416 O  OE1   . GLU C 1 92  ? -34.065 8.579   13.660  1.00 30.95 ? 92   GLU C OE1   1 
ATOM   3417 O  OE2   . GLU C 1 92  ? -34.111 10.579  12.763  1.00 32.54 ? 92   GLU C OE2   1 
ATOM   3418 N  N     . GLY C 1 93  ? -30.525 8.692   17.919  1.00 35.29 ? 93   GLY C N     1 
ATOM   3419 C  CA    . GLY C 1 93  ? -29.976 7.812   18.934  1.00 36.44 ? 93   GLY C CA    1 
ATOM   3420 C  C     . GLY C 1 93  ? -29.021 8.567   19.840  1.00 36.43 ? 93   GLY C C     1 
ATOM   3421 O  O     . GLY C 1 93  ? -28.844 9.776   19.689  1.00 36.49 ? 93   GLY C O     1 
ATOM   3422 N  N     . SER C 1 94  ? -28.379 7.850   20.759  1.00 36.62 ? 94   SER C N     1 
ATOM   3423 C  CA    . SER C 1 94  ? -27.457 8.470   21.706  1.00 36.08 ? 94   SER C CA    1 
ATOM   3424 C  C     . SER C 1 94  ? -25.977 8.251   21.405  1.00 32.65 ? 94   SER C C     1 
ATOM   3425 O  O     . SER C 1 94  ? -25.115 8.823   22.079  1.00 33.01 ? 94   SER C O     1 
ATOM   3426 C  CB    . SER C 1 94  ? -27.763 7.984   23.127  1.00 39.32 ? 94   SER C CB    1 
ATOM   3427 O  OG    . SER C 1 94  ? -27.624 6.574   23.223  1.00 45.49 ? 94   SER C OG    1 
ATOM   3428 N  N     . GLU C 1 95  ? -25.678 7.432   20.400  1.00 28.59 ? 95   GLU C N     1 
ATOM   3429 C  CA    . GLU C 1 95  ? -24.293 7.150   20.055  1.00 27.31 ? 95   GLU C CA    1 
ATOM   3430 C  C     . GLU C 1 95  ? -23.568 8.305   19.375  1.00 24.71 ? 95   GLU C C     1 
ATOM   3431 O  O     . GLU C 1 95  ? -24.181 9.200   18.794  1.00 21.74 ? 95   GLU C O     1 
ATOM   3432 C  CB    . GLU C 1 95  ? -24.179 5.876   19.210  1.00 30.78 ? 95   GLU C CB    1 
ATOM   3433 C  CG    . GLU C 1 95  ? -24.549 4.586   19.949  1.00 29.20 ? 95   GLU C CG    1 
ATOM   3434 C  CD    . GLU C 1 95  ? -23.719 4.357   21.205  1.00 35.53 ? 95   GLU C CD    1 
ATOM   3435 O  OE1   . GLU C 1 95  ? -22.478 4.523   21.146  1.00 36.46 ? 95   GLU C OE1   1 
ATOM   3436 O  OE2   . GLU C 1 95  ? -24.309 4.005   22.252  1.00 32.00 ? 95   GLU C OE2   1 
ATOM   3437 N  N     . MET C 1 96  ? -22.247 8.265   19.470  1.00 23.44 ? 96   MET C N     1 
ATOM   3438 C  CA    . MET C 1 96  ? -21.373 9.277   18.899  1.00 23.04 ? 96   MET C CA    1 
ATOM   3439 C  C     . MET C 1 96  ? -21.495 9.362   17.375  1.00 20.65 ? 96   MET C C     1 
ATOM   3440 O  O     . MET C 1 96  ? -21.707 8.356   16.699  1.00 19.88 ? 96   MET C O     1 
ATOM   3441 C  CB    . MET C 1 96  ? -19.932 8.937   19.281  1.00 24.70 ? 96   MET C CB    1 
ATOM   3442 C  CG    . MET C 1 96  ? -18.881 9.951   18.881  1.00 23.99 ? 96   MET C CG    1 
ATOM   3443 S  SD    . MET C 1 96  ? -17.235 9.269   19.188  1.00 25.00 ? 96   MET C SD    1 
ATOM   3444 C  CE    . MET C 1 96  ? -17.248 9.149   20.988  1.00 24.32 ? 96   MET C CE    1 
ATOM   3445 N  N     . VAL C 1 97  ? -21.435 10.584  16.854  1.00 19.99 ? 97   VAL C N     1 
ATOM   3446 C  CA    . VAL C 1 97  ? -21.480 10.812  15.413  1.00 18.93 ? 97   VAL C CA    1 
ATOM   3447 C  C     . VAL C 1 97  ? -20.117 11.397  15.067  1.00 17.72 ? 97   VAL C C     1 
ATOM   3448 O  O     . VAL C 1 97  ? -19.684 12.370  15.690  1.00 18.70 ? 97   VAL C O     1 
ATOM   3449 C  CB    . VAL C 1 97  ? -22.572 11.827  15.003  1.00 17.73 ? 97   VAL C CB    1 
ATOM   3450 C  CG1   . VAL C 1 97  ? -22.516 12.074  13.491  1.00 18.50 ? 97   VAL C CG1   1 
ATOM   3451 C  CG2   . VAL C 1 97  ? -23.945 11.317  15.399  1.00 18.44 ? 97   VAL C CG2   1 
ATOM   3452 N  N     . VAL C 1 98  ? -19.438 10.800  14.089  1.00 19.46 ? 98   VAL C N     1 
ATOM   3453 C  CA    . VAL C 1 98  ? -18.115 11.269  13.688  1.00 16.95 ? 98   VAL C CA    1 
ATOM   3454 C  C     . VAL C 1 98  ? -18.065 11.671  12.215  1.00 19.59 ? 98   VAL C C     1 
ATOM   3455 O  O     . VAL C 1 98  ? -18.375 10.873  11.330  1.00 20.35 ? 98   VAL C O     1 
ATOM   3456 C  CB    . VAL C 1 98  ? -17.027 10.190  13.969  1.00 16.39 ? 98   VAL C CB    1 
ATOM   3457 C  CG1   . VAL C 1 98  ? -15.646 10.691  13.558  1.00 15.36 ? 98   VAL C CG1   1 
ATOM   3458 C  CG2   . VAL C 1 98  ? -17.031 9.811   15.449  1.00 17.14 ? 98   VAL C CG2   1 
ATOM   3459 N  N     . VAL C 1 99  ? -17.724 12.931  11.969  1.00 17.40 ? 99   VAL C N     1 
ATOM   3460 C  CA    . VAL C 1 99  ? -17.595 13.450  10.614  1.00 17.51 ? 99   VAL C CA    1 
ATOM   3461 C  C     . VAL C 1 99  ? -16.110 13.709  10.413  1.00 19.48 ? 99   VAL C C     1 
ATOM   3462 O  O     . VAL C 1 99  ? -15.563 14.706  10.895  1.00 22.20 ? 99   VAL C O     1 
ATOM   3463 C  CB    . VAL C 1 99  ? -18.382 14.766  10.425  1.00 17.37 ? 99   VAL C CB    1 
ATOM   3464 C  CG1   . VAL C 1 99  ? -18.195 15.293  8.995   1.00 17.02 ? 99   VAL C CG1   1 
ATOM   3465 C  CG2   . VAL C 1 99  ? -19.857 14.541  10.720  1.00 19.92 ? 99   VAL C CG2   1 
ATOM   3466 N  N     . LYS C 1 100 ? -15.446 12.803  9.708   1.00 19.36 ? 100  LYS C N     1 
ATOM   3467 C  CA    . LYS C 1 100 ? -14.023 12.958  9.496   1.00 18.81 ? 100  LYS C CA    1 
ATOM   3468 C  C     . LYS C 1 100 ? -13.596 13.371  8.103   1.00 17.62 ? 100  LYS C C     1 
ATOM   3469 O  O     . LYS C 1 100 ? -14.386 13.349  7.161   1.00 17.43 ? 100  LYS C O     1 
ATOM   3470 C  CB    . LYS C 1 100 ? -13.283 11.696  9.942   1.00 23.40 ? 100  LYS C CB    1 
ATOM   3471 C  CG    . LYS C 1 100 ? -13.781 10.402  9.353   1.00 25.67 ? 100  LYS C CG    1 
ATOM   3472 C  CD    . LYS C 1 100 ? -13.276 9.230   10.190  1.00 27.38 ? 100  LYS C CD    1 
ATOM   3473 C  CE    . LYS C 1 100 ? -13.461 7.914   9.471   1.00 28.91 ? 100  LYS C CE    1 
ATOM   3474 N  NZ    . LYS C 1 100 ? -13.256 6.722   10.364  1.00 32.80 ? 100  LYS C NZ    1 
ATOM   3475 N  N     . GLY C 1 101 ? -12.365 13.855  8.016   1.00 16.34 ? 101  GLY C N     1 
ATOM   3476 C  CA    . GLY C 1 101 ? -11.800 14.245  6.742   1.00 16.70 ? 101  GLY C CA    1 
ATOM   3477 C  C     . GLY C 1 101 ? -12.364 15.473  6.064   1.00 16.17 ? 101  GLY C C     1 
ATOM   3478 O  O     . GLY C 1 101 ? -12.365 15.534  4.839   1.00 15.89 ? 101  GLY C O     1 
ATOM   3479 N  N     . VAL C 1 102 ? -12.863 16.438  6.830   1.00 16.90 ? 102  VAL C N     1 
ATOM   3480 C  CA    . VAL C 1 102 ? -13.371 17.663  6.213   1.00 15.31 ? 102  VAL C CA    1 
ATOM   3481 C  C     . VAL C 1 102 ? -12.140 18.508  5.886   1.00 14.98 ? 102  VAL C C     1 
ATOM   3482 O  O     . VAL C 1 102 ? -11.507 19.068  6.782   1.00 15.78 ? 102  VAL C O     1 
ATOM   3483 C  CB    . VAL C 1 102 ? -14.311 18.450  7.156   1.00 15.80 ? 102  VAL C CB    1 
ATOM   3484 C  CG1   . VAL C 1 102 ? -14.734 19.772  6.494   1.00 15.94 ? 102  VAL C CG1   1 
ATOM   3485 C  CG2   . VAL C 1 102 ? -15.544 17.617  7.476   1.00 14.70 ? 102  VAL C CG2   1 
ATOM   3486 N  N     . GLU C 1 103 ? -11.766 18.564  4.608   1.00 14.94 ? 103  GLU C N     1 
ATOM   3487 C  CA    . GLU C 1 103 ? -10.591 19.341  4.230   1.00 17.32 ? 103  GLU C CA    1 
ATOM   3488 C  C     . GLU C 1 103 ? -10.807 20.819  4.540   1.00 17.23 ? 103  GLU C C     1 
ATOM   3489 O  O     . GLU C 1 103 ? -11.941 21.298  4.563   1.00 19.60 ? 103  GLU C O     1 
ATOM   3490 C  CB    . GLU C 1 103 ? -10.234 19.145  2.748   1.00 16.13 ? 103  GLU C CB    1 
ATOM   3491 C  CG    . GLU C 1 103 ? -11.262 19.673  1.752   1.00 16.80 ? 103  GLU C CG    1 
ATOM   3492 C  CD    . GLU C 1 103 ? -12.224 18.608  1.245   1.00 20.41 ? 103  GLU C CD    1 
ATOM   3493 O  OE1   . GLU C 1 103 ? -12.661 18.725  0.081   1.00 16.04 ? 103  GLU C OE1   1 
ATOM   3494 O  OE2   . GLU C 1 103 ? -12.540 17.656  1.997   1.00 18.47 ? 103  GLU C OE2   1 
ATOM   3495 N  N     . PHE C 1 104 ? -9.722  21.522  4.836   1.00 18.59 ? 104  PHE C N     1 
ATOM   3496 C  CA    . PHE C 1 104 ? -9.808  22.942  5.143   1.00 21.40 ? 104  PHE C CA    1 
ATOM   3497 C  C     . PHE C 1 104 ? -8.561  23.650  4.653   1.00 21.41 ? 104  PHE C C     1 
ATOM   3498 O  O     . PHE C 1 104 ? -7.510  23.032  4.472   1.00 20.21 ? 104  PHE C O     1 
ATOM   3499 C  CB    . PHE C 1 104 ? -9.951  23.168  6.657   1.00 20.35 ? 104  PHE C CB    1 
ATOM   3500 C  CG    . PHE C 1 104 ? -8.648  23.112  7.404   1.00 18.74 ? 104  PHE C CG    1 
ATOM   3501 C  CD1   . PHE C 1 104 ? -7.919  24.276  7.646   1.00 20.69 ? 104  PHE C CD1   1 
ATOM   3502 C  CD2   . PHE C 1 104 ? -8.118  21.895  7.816   1.00 14.72 ? 104  PHE C CD2   1 
ATOM   3503 C  CE1   . PHE C 1 104 ? -6.685  24.225  8.281   1.00 17.60 ? 104  PHE C CE1   1 
ATOM   3504 C  CE2   . PHE C 1 104 ? -6.886  21.835  8.452   1.00 18.95 ? 104  PHE C CE2   1 
ATOM   3505 C  CZ    . PHE C 1 104 ? -6.165  23.004  8.684   1.00 21.80 ? 104  PHE C CZ    1 
ATOM   3506 N  N     . TYR C 1 105 ? -8.688  24.956  4.456   1.00 20.32 ? 105  TYR C N     1 
ATOM   3507 C  CA    . TYR C 1 105 ? -7.581  25.799  4.027   1.00 19.63 ? 105  TYR C CA    1 
ATOM   3508 C  C     . TYR C 1 105 ? -7.705  27.096  4.814   1.00 21.22 ? 105  TYR C C     1 
ATOM   3509 O  O     . TYR C 1 105 ? -8.800  27.638  4.958   1.00 19.26 ? 105  TYR C O     1 
ATOM   3510 C  CB    . TYR C 1 105 ? -7.661  26.098  2.530   1.00 20.84 ? 105  TYR C CB    1 
ATOM   3511 C  CG    . TYR C 1 105 ? -7.507  24.885  1.643   1.00 21.99 ? 105  TYR C CG    1 
ATOM   3512 C  CD1   . TYR C 1 105 ? -6.260  24.534  1.117   1.00 23.02 ? 105  TYR C CD1   1 
ATOM   3513 C  CD2   . TYR C 1 105 ? -8.609  24.095  1.315   1.00 20.47 ? 105  TYR C CD2   1 
ATOM   3514 C  CE1   . TYR C 1 105 ? -6.119  23.422  0.283   1.00 21.05 ? 105  TYR C CE1   1 
ATOM   3515 C  CE2   . TYR C 1 105 ? -8.478  22.989  0.488   1.00 21.68 ? 105  TYR C CE2   1 
ATOM   3516 C  CZ    . TYR C 1 105 ? -7.234  22.658  -0.024  1.00 23.59 ? 105  TYR C CZ    1 
ATOM   3517 O  OH    . TYR C 1 105 ? -7.113  21.561  -0.848  1.00 23.77 ? 105  TYR C OH    1 
ATOM   3518 N  N     . SER C 1 106 ? -6.585  27.569  5.342   1.00 21.20 ? 106  SER C N     1 
ATOM   3519 C  CA    . SER C 1 106 ? -6.567  28.798  6.120   1.00 23.68 ? 106  SER C CA    1 
ATOM   3520 C  C     . SER C 1 106 ? -5.252  29.532  5.880   1.00 23.17 ? 106  SER C C     1 
ATOM   3521 O  O     . SER C 1 106 ? -4.397  29.065  5.128   1.00 23.99 ? 106  SER C O     1 
ATOM   3522 C  CB    . SER C 1 106 ? -6.737  28.475  7.609   1.00 22.71 ? 106  SER C CB    1 
ATOM   3523 O  OG    . SER C 1 106 ? -6.908  29.654  8.379   1.00 23.25 ? 106  SER C OG    1 
ATOM   3524 N  N     . MET C 1 107 ? -5.108  30.692  6.510   1.00 25.55 ? 107  MET C N     1 
ATOM   3525 C  CA    . MET C 1 107 ? -3.901  31.504  6.385   1.00 24.44 ? 107  MET C CA    1 
ATOM   3526 C  C     . MET C 1 107 ? -3.346  31.772  7.779   1.00 23.78 ? 107  MET C C     1 
ATOM   3527 O  O     . MET C 1 107 ? -4.098  32.142  8.682   1.00 21.90 ? 107  MET C O     1 
ATOM   3528 C  CB    . MET C 1 107 ? -4.240  32.834  5.707   1.00 27.96 ? 107  MET C CB    1 
ATOM   3529 C  CG    . MET C 1 107 ? -4.552  32.727  4.226   1.00 31.74 ? 107  MET C CG    1 
ATOM   3530 S  SD    . MET C 1 107 ? -3.048  32.564  3.256   1.00 35.19 ? 107  MET C SD    1 
ATOM   3531 C  CE    . MET C 1 107 ? -3.626  33.039  1.642   1.00 33.81 ? 107  MET C CE    1 
ATOM   3532 N  N     . CYS C 1 108 ? -2.048  31.549  7.973   1.00 22.43 ? 108  CYS C N     1 
ATOM   3533 C  CA    . CYS C 1 108 ? -1.452  31.803  9.279   1.00 26.80 ? 108  CYS C CA    1 
ATOM   3534 C  C     . CYS C 1 108 ? -1.355  33.313  9.475   1.00 28.21 ? 108  CYS C C     1 
ATOM   3535 O  O     . CYS C 1 108 ? -0.882  34.032  8.594   1.00 27.27 ? 108  CYS C O     1 
ATOM   3536 C  CB    . CYS C 1 108 ? -0.076  31.137  9.424   1.00 25.42 ? 108  CYS C CB    1 
ATOM   3537 S  SG    . CYS C 1 108 ? 1.301   31.852  8.489   1.00 31.55 ? 108  CYS C SG    1 
ATOM   3538 N  N     . GLU C 1 109 ? -1.862  33.792  10.607  1.00 28.29 ? 109  GLU C N     1 
ATOM   3539 C  CA    . GLU C 1 109 ? -1.845  35.220  10.910  1.00 29.96 ? 109  GLU C CA    1 
ATOM   3540 C  C     . GLU C 1 109 ? -0.430  35.779  11.032  1.00 29.31 ? 109  GLU C C     1 
ATOM   3541 O  O     . GLU C 1 109 ? -0.216  36.974  10.850  1.00 31.03 ? 109  GLU C O     1 
ATOM   3542 C  CB    . GLU C 1 109 ? -2.640  35.510  12.188  1.00 28.45 ? 109  GLU C CB    1 
ATOM   3543 C  CG    . GLU C 1 109 ? -2.031  34.952  13.470  1.00 27.30 ? 109  GLU C CG    1 
ATOM   3544 C  CD    . GLU C 1 109 ? -2.926  35.160  14.683  1.00 29.22 ? 109  GLU C CD    1 
ATOM   3545 O  OE1   . GLU C 1 109 ? -2.394  35.267  15.806  1.00 31.03 ? 109  GLU C OE1   1 
ATOM   3546 O  OE2   . GLU C 1 109 ? -4.164  35.202  14.516  1.00 34.65 ? 109  GLU C OE2   1 
ATOM   3547 N  N     . HIS C 1 110 ? 0.534   34.903  11.291  1.00 30.38 ? 110  HIS C N     1 
ATOM   3548 C  CA    . HIS C 1 110 ? 1.926   35.308  11.442  1.00 31.92 ? 110  HIS C CA    1 
ATOM   3549 C  C     . HIS C 1 110 ? 2.670   35.596  10.137  1.00 32.40 ? 110  HIS C C     1 
ATOM   3550 O  O     . HIS C 1 110 ? 3.485   36.518  10.087  1.00 31.74 ? 110  HIS C O     1 
ATOM   3551 C  CB    . HIS C 1 110 ? 2.693   34.256  12.248  1.00 35.01 ? 110  HIS C CB    1 
ATOM   3552 C  CG    . HIS C 1 110 ? 2.127   34.009  13.613  1.00 40.49 ? 110  HIS C CG    1 
ATOM   3553 N  ND1   . HIS C 1 110 ? 1.938   32.741  14.120  1.00 42.85 ? 110  HIS C ND1   1 
ATOM   3554 C  CD2   . HIS C 1 110 ? 1.714   34.865  14.576  1.00 43.37 ? 110  HIS C CD2   1 
ATOM   3555 C  CE1   . HIS C 1 110 ? 1.432   32.828  15.337  1.00 44.63 ? 110  HIS C CE1   1 
ATOM   3556 N  NE2   . HIS C 1 110 ? 1.287   34.105  15.638  1.00 45.63 ? 110  HIS C NE2   1 
ATOM   3557 N  N     . HIS C 1 111 ? 2.392   34.822  9.087   1.00 30.34 ? 111  HIS C N     1 
ATOM   3558 C  CA    . HIS C 1 111 ? 3.076   35.000  7.800   1.00 29.41 ? 111  HIS C CA    1 
ATOM   3559 C  C     . HIS C 1 111 ? 2.171   35.231  6.596   1.00 27.52 ? 111  HIS C C     1 
ATOM   3560 O  O     . HIS C 1 111 ? 2.661   35.511  5.500   1.00 27.82 ? 111  HIS C O     1 
ATOM   3561 C  CB    . HIS C 1 111 ? 3.959   33.786  7.492   1.00 29.50 ? 111  HIS C CB    1 
ATOM   3562 C  CG    . HIS C 1 111 ? 5.043   33.552  8.492   1.00 28.36 ? 111  HIS C CG    1 
ATOM   3563 N  ND1   . HIS C 1 111 ? 4.873   32.746  9.596   1.00 30.20 ? 111  HIS C ND1   1 
ATOM   3564 C  CD2   . HIS C 1 111 ? 6.314   34.014  8.553   1.00 29.08 ? 111  HIS C CD2   1 
ATOM   3565 C  CE1   . HIS C 1 111 ? 5.992   32.723  10.297  1.00 31.73 ? 111  HIS C CE1   1 
ATOM   3566 N  NE2   . HIS C 1 111 ? 6.882   33.484  9.686   1.00 30.91 ? 111  HIS C NE2   1 
ATOM   3567 N  N     . LEU C 1 112 ? 0.864   35.095  6.787   1.00 27.05 ? 112  LEU C N     1 
ATOM   3568 C  CA    . LEU C 1 112 ? -0.094  35.263  5.695   1.00 28.56 ? 112  LEU C CA    1 
ATOM   3569 C  C     . LEU C 1 112 ? 0.164   34.252  4.573   1.00 26.58 ? 112  LEU C C     1 
ATOM   3570 O  O     . LEU C 1 112 ? 0.058   34.568  3.383   1.00 26.38 ? 112  LEU C O     1 
ATOM   3571 C  CB    . LEU C 1 112 ? -0.081  36.703  5.160   1.00 30.76 ? 112  LEU C CB    1 
ATOM   3572 C  CG    . LEU C 1 112 ? -1.059  37.686  5.816   1.00 34.31 ? 112  LEU C CG    1 
ATOM   3573 C  CD1   . LEU C 1 112 ? -0.977  37.617  7.333   1.00 33.27 ? 112  LEU C CD1   1 
ATOM   3574 C  CD2   . LEU C 1 112 ? -0.780  39.094  5.315   1.00 34.21 ? 112  LEU C CD2   1 
ATOM   3575 N  N     . LEU C 1 113 ? 0.570   33.051  4.977   1.00 24.37 ? 113  LEU C N     1 
ATOM   3576 C  CA    . LEU C 1 113 ? 0.824   31.946  4.058   1.00 22.65 ? 113  LEU C CA    1 
ATOM   3577 C  C     . LEU C 1 113 ? -0.175  30.852  4.427   1.00 22.07 ? 113  LEU C C     1 
ATOM   3578 O  O     . LEU C 1 113 ? -0.532  30.692  5.594   1.00 23.28 ? 113  LEU C O     1 
ATOM   3579 C  CB    . LEU C 1 113 ? 2.265   31.441  4.195   1.00 24.03 ? 113  LEU C CB    1 
ATOM   3580 C  CG    . LEU C 1 113 ? 3.337   32.347  3.581   1.00 24.25 ? 113  LEU C CG    1 
ATOM   3581 C  CD1   . LEU C 1 113 ? 4.720   31.839  3.934   1.00 26.65 ? 113  LEU C CD1   1 
ATOM   3582 C  CD2   . LEU C 1 113 ? 3.161   32.403  2.071   1.00 26.46 ? 113  LEU C CD2   1 
ATOM   3583 N  N     . PRO C 1 114 ? -0.652  30.093  3.437   1.00 22.45 ? 114  PRO C N     1 
ATOM   3584 C  CA    . PRO C 1 114 ? -1.620  29.032  3.716   1.00 23.35 ? 114  PRO C CA    1 
ATOM   3585 C  C     . PRO C 1 114 ? -1.150  27.860  4.576   1.00 21.94 ? 114  PRO C C     1 
ATOM   3586 O  O     . PRO C 1 114 ? 0.035   27.526  4.619   1.00 21.35 ? 114  PRO C O     1 
ATOM   3587 C  CB    . PRO C 1 114 ? -1.991  28.534  2.315   1.00 23.78 ? 114  PRO C CB    1 
ATOM   3588 C  CG    . PRO C 1 114 ? -1.728  29.720  1.438   1.00 24.31 ? 114  PRO C CG    1 
ATOM   3589 C  CD    . PRO C 1 114 ? -0.428  30.221  1.988   1.00 22.17 ? 114  PRO C CD    1 
ATOM   3590 N  N     . PHE C 1 115 ? -2.098  27.302  5.321   1.00 21.54 ? 115  PHE C N     1 
ATOM   3591 C  CA    . PHE C 1 115 ? -1.879  26.097  6.107   1.00 21.25 ? 115  PHE C CA    1 
ATOM   3592 C  C     . PHE C 1 115 ? -3.180  25.339  5.888   1.00 20.60 ? 115  PHE C C     1 
ATOM   3593 O  O     . PHE C 1 115 ? -4.261  25.939  5.852   1.00 20.03 ? 115  PHE C O     1 
ATOM   3594 C  CB    . PHE C 1 115 ? -1.486  26.351  7.580   1.00 21.57 ? 115  PHE C CB    1 
ATOM   3595 C  CG    . PHE C 1 115 ? -2.595  26.823  8.478   1.00 23.36 ? 115  PHE C CG    1 
ATOM   3596 C  CD1   . PHE C 1 115 ? -2.771  28.181  8.728   1.00 23.45 ? 115  PHE C CD1   1 
ATOM   3597 C  CD2   . PHE C 1 115 ? -3.382  25.906  9.175   1.00 23.38 ? 115  PHE C CD2   1 
ATOM   3598 C  CE1   . PHE C 1 115 ? -3.706  28.622  9.664   1.00 24.57 ? 115  PHE C CE1   1 
ATOM   3599 C  CE2   . PHE C 1 115 ? -4.321  26.334  10.113  1.00 23.56 ? 115  PHE C CE2   1 
ATOM   3600 C  CZ    . PHE C 1 115 ? -4.482  27.698  10.360  1.00 23.89 ? 115  PHE C CZ    1 
ATOM   3601 N  N     . PHE C 1 116 ? -3.065  24.045  5.607   1.00 18.41 ? 116  PHE C N     1 
ATOM   3602 C  CA    . PHE C 1 116 ? -4.240  23.247  5.285   1.00 17.80 ? 116  PHE C CA    1 
ATOM   3603 C  C     . PHE C 1 116 ? -4.140  21.785  5.672   1.00 18.37 ? 116  PHE C C     1 
ATOM   3604 O  O     . PHE C 1 116 ? -3.060  21.274  5.961   1.00 17.22 ? 116  PHE C O     1 
ATOM   3605 C  CB    . PHE C 1 116 ? -4.495  23.344  3.778   1.00 19.87 ? 116  PHE C CB    1 
ATOM   3606 C  CG    . PHE C 1 116 ? -3.307  22.959  2.938   1.00 23.79 ? 116  PHE C CG    1 
ATOM   3607 C  CD1   . PHE C 1 116 ? -2.299  23.882  2.668   1.00 24.13 ? 116  PHE C CD1   1 
ATOM   3608 C  CD2   . PHE C 1 116 ? -3.180  21.666  2.440   1.00 26.44 ? 116  PHE C CD2   1 
ATOM   3609 C  CE1   . PHE C 1 116 ? -1.181  23.522  1.916   1.00 26.13 ? 116  PHE C CE1   1 
ATOM   3610 C  CE2   . PHE C 1 116 ? -2.064  21.297  1.686   1.00 29.01 ? 116  PHE C CE2   1 
ATOM   3611 C  CZ    . PHE C 1 116 ? -1.064  22.227  1.425   1.00 26.58 ? 116  PHE C CZ    1 
ATOM   3612 N  N     . GLY C 1 117 ? -5.282  21.109  5.625   1.00 19.44 ? 117  GLY C N     1 
ATOM   3613 C  CA    . GLY C 1 117 ? -5.336  19.704  5.970   1.00 18.67 ? 117  GLY C CA    1 
ATOM   3614 C  C     . GLY C 1 117 ? -6.768  19.245  6.134   1.00 16.56 ? 117  GLY C C     1 
ATOM   3615 O  O     . GLY C 1 117 ? -7.614  19.492  5.274   1.00 14.88 ? 117  GLY C O     1 
ATOM   3616 N  N     . LYS C 1 118 ? -7.055  18.607  7.263   1.00 17.22 ? 118  LYS C N     1 
ATOM   3617 C  CA    . LYS C 1 118 ? -8.392  18.100  7.515   1.00 17.03 ? 118  LYS C CA    1 
ATOM   3618 C  C     . LYS C 1 118 ? -8.856  18.325  8.945   1.00 17.22 ? 118  LYS C C     1 
ATOM   3619 O  O     . LYS C 1 118 ? -8.048  18.435  9.870   1.00 16.94 ? 118  LYS C O     1 
ATOM   3620 C  CB    . LYS C 1 118 ? -8.467  16.601  7.178   1.00 21.96 ? 118  LYS C CB    1 
ATOM   3621 C  CG    . LYS C 1 118 ? -8.212  16.276  5.707   1.00 24.13 ? 118  LYS C CG    1 
ATOM   3622 C  CD    . LYS C 1 118 ? -8.358  14.796  5.401   1.00 32.08 ? 118  LYS C CD    1 
ATOM   3623 C  CE    . LYS C 1 118 ? -7.293  13.964  6.097   1.00 37.18 ? 118  LYS C CE    1 
ATOM   3624 N  NZ    . LYS C 1 118 ? -7.355  12.527  5.683   1.00 44.63 ? 118  LYS C NZ    1 
ATOM   3625 N  N     . VAL C 1 119 ? -10.171 18.423  9.098   1.00 16.24 ? 119  VAL C N     1 
ATOM   3626 C  CA    . VAL C 1 119 ? -10.793 18.606  10.401  1.00 15.11 ? 119  VAL C CA    1 
ATOM   3627 C  C     . VAL C 1 119 ? -11.690 17.396  10.623  1.00 16.81 ? 119  VAL C C     1 
ATOM   3628 O  O     . VAL C 1 119 ? -12.427 16.986  9.723   1.00 15.14 ? 119  VAL C O     1 
ATOM   3629 C  CB    . VAL C 1 119 ? -11.660 19.891  10.463  1.00 14.34 ? 119  VAL C CB    1 
ATOM   3630 C  CG1   . VAL C 1 119 ? -12.293 20.035  11.859  1.00 15.27 ? 119  VAL C CG1   1 
ATOM   3631 C  CG2   . VAL C 1 119 ? -10.812 21.117  10.141  1.00 14.86 ? 119  VAL C CG2   1 
ATOM   3632 N  N     . HIS C 1 120 ? -11.598 16.821  11.817  1.00 15.79 ? 120  HIS C N     1 
ATOM   3633 C  CA    . HIS C 1 120 ? -12.390 15.658  12.188  1.00 13.99 ? 120  HIS C CA    1 
ATOM   3634 C  C     . HIS C 1 120 ? -13.250 16.100  13.363  1.00 19.03 ? 120  HIS C C     1 
ATOM   3635 O  O     . HIS C 1 120 ? -12.746 16.688  14.322  1.00 16.25 ? 120  HIS C O     1 
ATOM   3636 C  CB    . HIS C 1 120 ? -11.470 14.511  12.607  1.00 16.75 ? 120  HIS C CB    1 
ATOM   3637 C  CG    . HIS C 1 120 ? -10.355 14.252  11.644  1.00 15.23 ? 120  HIS C CG    1 
ATOM   3638 N  ND1   . HIS C 1 120 ? -10.566 13.742  10.381  1.00 16.11 ? 120  HIS C ND1   1 
ATOM   3639 C  CD2   . HIS C 1 120 ? -9.021  14.455  11.750  1.00 18.46 ? 120  HIS C CD2   1 
ATOM   3640 C  CE1   . HIS C 1 120 ? -9.410  13.644  9.749   1.00 16.45 ? 120  HIS C CE1   1 
ATOM   3641 N  NE2   . HIS C 1 120 ? -8.456  14.070  10.558  1.00 16.78 ? 120  HIS C NE2   1 
ATOM   3642 N  N     . ILE C 1 121 ? -14.545 15.818  13.281  1.00 17.42 ? 121  ILE C N     1 
ATOM   3643 C  CA    . ILE C 1 121 ? -15.482 16.219  14.318  1.00 21.00 ? 121  ILE C CA    1 
ATOM   3644 C  C     . ILE C 1 121 ? -16.253 15.042  14.896  1.00 19.15 ? 121  ILE C C     1 
ATOM   3645 O  O     . ILE C 1 121 ? -16.705 14.161  14.170  1.00 22.87 ? 121  ILE C O     1 
ATOM   3646 C  CB    . ILE C 1 121 ? -16.476 17.263  13.756  1.00 20.47 ? 121  ILE C CB    1 
ATOM   3647 C  CG1   . ILE C 1 121 ? -15.705 18.497  13.271  1.00 20.08 ? 121  ILE C CG1   1 
ATOM   3648 C  CG2   . ILE C 1 121 ? -17.519 17.635  14.803  1.00 22.31 ? 121  ILE C CG2   1 
ATOM   3649 C  CD1   . ILE C 1 121 ? -16.542 19.490  12.494  1.00 23.73 ? 121  ILE C CD1   1 
ATOM   3650 N  N     . GLY C 1 122 ? -16.383 15.035  16.217  1.00 20.31 ? 122  GLY C N     1 
ATOM   3651 C  CA    . GLY C 1 122 ? -17.119 13.984  16.886  1.00 18.95 ? 122  GLY C CA    1 
ATOM   3652 C  C     . GLY C 1 122 ? -17.989 14.590  17.967  1.00 19.71 ? 122  GLY C C     1 
ATOM   3653 O  O     . GLY C 1 122 ? -17.595 15.555  18.617  1.00 19.39 ? 122  GLY C O     1 
ATOM   3654 N  N     . TYR C 1 123 ? -19.185 14.045  18.150  1.00 19.36 ? 123  TYR C N     1 
ATOM   3655 C  CA    . TYR C 1 123 ? -20.074 14.562  19.174  1.00 22.47 ? 123  TYR C CA    1 
ATOM   3656 C  C     . TYR C 1 123 ? -21.145 13.569  19.576  1.00 22.35 ? 123  TYR C C     1 
ATOM   3657 O  O     . TYR C 1 123 ? -21.491 12.661  18.818  1.00 21.64 ? 123  TYR C O     1 
ATOM   3658 C  CB    . TYR C 1 123 ? -20.729 15.873  18.717  1.00 20.55 ? 123  TYR C CB    1 
ATOM   3659 C  CG    . TYR C 1 123 ? -21.905 15.712  17.779  1.00 21.11 ? 123  TYR C CG    1 
ATOM   3660 C  CD1   . TYR C 1 123 ? -23.216 15.825  18.252  1.00 22.56 ? 123  TYR C CD1   1 
ATOM   3661 C  CD2   . TYR C 1 123 ? -21.715 15.471  16.418  1.00 19.35 ? 123  TYR C CD2   1 
ATOM   3662 C  CE1   . TYR C 1 123 ? -24.299 15.706  17.401  1.00 21.68 ? 123  TYR C CE1   1 
ATOM   3663 C  CE2   . TYR C 1 123 ? -22.797 15.350  15.555  1.00 20.16 ? 123  TYR C CE2   1 
ATOM   3664 C  CZ    . TYR C 1 123 ? -24.085 15.470  16.052  1.00 22.38 ? 123  TYR C CZ    1 
ATOM   3665 O  OH    . TYR C 1 123 ? -25.159 15.370  15.206  1.00 20.39 ? 123  TYR C OH    1 
ATOM   3666 N  N     . ILE C 1 124 ? -21.637 13.735  20.797  1.00 22.30 ? 124  ILE C N     1 
ATOM   3667 C  CA    . ILE C 1 124 ? -22.705 12.899  21.320  1.00 24.17 ? 124  ILE C CA    1 
ATOM   3668 C  C     . ILE C 1 124 ? -23.873 13.857  21.511  1.00 24.44 ? 124  ILE C C     1 
ATOM   3669 O  O     . ILE C 1 124 ? -23.795 14.801  22.297  1.00 23.90 ? 124  ILE C O     1 
ATOM   3670 C  CB    . ILE C 1 124 ? -22.303 12.234  22.649  1.00 24.85 ? 124  ILE C CB    1 
ATOM   3671 C  CG1   . ILE C 1 124 ? -21.151 11.257  22.396  1.00 26.94 ? 124  ILE C CG1   1 
ATOM   3672 C  CG2   . ILE C 1 124 ? -23.501 11.514  23.265  1.00 25.57 ? 124  ILE C CG2   1 
ATOM   3673 C  CD1   . ILE C 1 124 ? -20.610 10.592  23.639  1.00 29.10 ? 124  ILE C CD1   1 
ATOM   3674 N  N     . PRO C 1 125 ? -24.957 13.652  20.753  1.00 26.59 ? 125  PRO C N     1 
ATOM   3675 C  CA    . PRO C 1 125 ? -26.130 14.522  20.849  1.00 28.57 ? 125  PRO C CA    1 
ATOM   3676 C  C     . PRO C 1 125 ? -26.884 14.474  22.169  1.00 30.76 ? 125  PRO C C     1 
ATOM   3677 O  O     . PRO C 1 125 ? -26.698 13.569  22.984  1.00 30.39 ? 125  PRO C O     1 
ATOM   3678 C  CB    . PRO C 1 125 ? -27.001 14.039  19.695  1.00 28.50 ? 125  PRO C CB    1 
ATOM   3679 C  CG    . PRO C 1 125 ? -26.693 12.575  19.645  1.00 30.82 ? 125  PRO C CG    1 
ATOM   3680 C  CD    . PRO C 1 125 ? -25.190 12.560  19.791  1.00 28.53 ? 125  PRO C CD    1 
ATOM   3681 N  N     . ASP C 1 126 ? -27.687 15.510  22.386  1.00 32.92 ? 126  ASP C N     1 
ATOM   3682 C  CA    . ASP C 1 126 ? -28.532 15.629  23.563  1.00 34.01 ? 126  ASP C CA    1 
ATOM   3683 C  C     . ASP C 1 126 ? -29.887 16.026  22.988  1.00 35.58 ? 126  ASP C C     1 
ATOM   3684 O  O     . ASP C 1 126 ? -30.363 17.144  23.187  1.00 36.81 ? 126  ASP C O     1 
ATOM   3685 C  CB    . ASP C 1 126 ? -28.007 16.709  24.520  1.00 35.84 ? 126  ASP C CB    1 
ATOM   3686 C  CG    . ASP C 1 126 ? -28.722 16.701  25.876  1.00 39.18 ? 126  ASP C CG    1 
ATOM   3687 O  OD1   . ASP C 1 126 ? -28.286 17.447  26.780  1.00 41.21 ? 126  ASP C OD1   1 
ATOM   3688 O  OD2   . ASP C 1 126 ? -29.711 15.954  26.043  1.00 33.93 ? 126  ASP C OD2   1 
ATOM   3689 N  N     . GLY C 1 127 ? -30.449 15.122  22.189  1.00 35.36 ? 127  GLY C N     1 
ATOM   3690 C  CA    . GLY C 1 127 ? -31.738 15.360  21.568  1.00 35.02 ? 127  GLY C CA    1 
ATOM   3691 C  C     . GLY C 1 127 ? -31.709 16.031  20.204  1.00 35.80 ? 127  GLY C C     1 
ATOM   3692 O  O     . GLY C 1 127 ? -32.719 16.023  19.501  1.00 35.47 ? 127  GLY C O     1 
ATOM   3693 N  N     . LYS C 1 128 ? -30.565 16.591  19.811  1.00 34.65 ? 128  LYS C N     1 
ATOM   3694 C  CA    . LYS C 1 128 ? -30.463 17.271  18.519  1.00 34.56 ? 128  LYS C CA    1 
ATOM   3695 C  C     . LYS C 1 128 ? -29.211 16.920  17.719  1.00 33.34 ? 128  LYS C C     1 
ATOM   3696 O  O     . LYS C 1 128 ? -28.101 16.923  18.253  1.00 32.90 ? 128  LYS C O     1 
ATOM   3697 C  CB    . LYS C 1 128 ? -30.503 18.791  18.717  1.00 37.97 ? 128  LYS C CB    1 
ATOM   3698 C  CG    . LYS C 1 128 ? -31.792 19.328  19.321  1.00 41.98 ? 128  LYS C CG    1 
ATOM   3699 C  CD    . LYS C 1 128 ? -31.617 20.753  19.832  1.00 46.09 ? 128  LYS C CD    1 
ATOM   3700 C  CE    . LYS C 1 128 ? -31.290 21.729  18.711  1.00 48.95 ? 128  LYS C CE    1 
ATOM   3701 N  NZ    . LYS C 1 128 ? -31.152 23.125  19.221  1.00 53.27 ? 128  LYS C NZ    1 
ATOM   3702 N  N     . ILE C 1 129 ? -29.399 16.623  16.436  1.00 32.03 ? 129  ILE C N     1 
ATOM   3703 C  CA    . ILE C 1 129 ? -28.282 16.312  15.546  1.00 30.57 ? 129  ILE C CA    1 
ATOM   3704 C  C     . ILE C 1 129 ? -28.195 17.368  14.450  1.00 29.41 ? 129  ILE C C     1 
ATOM   3705 O  O     . ILE C 1 129 ? -29.200 17.974  14.076  1.00 31.04 ? 129  ILE C O     1 
ATOM   3706 C  CB    . ILE C 1 129 ? -28.391 14.908  14.913  1.00 27.00 ? 129  ILE C CB    1 
ATOM   3707 C  CG1   . ILE C 1 129 ? -29.730 14.734  14.196  1.00 26.65 ? 129  ILE C CG1   1 
ATOM   3708 C  CG2   . ILE C 1 129 ? -28.168 13.839  15.973  1.00 27.25 ? 129  ILE C CG2   1 
ATOM   3709 C  CD1   . ILE C 1 129 ? -29.854 13.417  13.447  1.00 23.07 ? 129  ILE C CD1   1 
ATOM   3710 N  N     . LEU C 1 130 ? -26.985 17.597  13.953  1.00 28.66 ? 130  LEU C N     1 
ATOM   3711 C  CA    . LEU C 1 130 ? -26.758 18.596  12.916  1.00 28.41 ? 130  LEU C CA    1 
ATOM   3712 C  C     . LEU C 1 130 ? -26.689 18.002  11.514  1.00 28.49 ? 130  LEU C C     1 
ATOM   3713 O  O     . LEU C 1 130 ? -26.282 16.848  11.334  1.00 28.61 ? 130  LEU C O     1 
ATOM   3714 C  CB    . LEU C 1 130 ? -25.458 19.352  13.206  1.00 27.57 ? 130  LEU C CB    1 
ATOM   3715 C  CG    . LEU C 1 130 ? -25.099 20.553  12.325  1.00 29.25 ? 130  LEU C CG    1 
ATOM   3716 C  CD1   . LEU C 1 130 ? -26.128 21.659  12.511  1.00 28.81 ? 130  LEU C CD1   1 
ATOM   3717 C  CD2   . LEU C 1 130 ? -23.712 21.060  12.677  1.00 27.46 ? 130  LEU C CD2   1 
ATOM   3718 N  N     . GLY C 1 131 ? -27.122 18.787  10.528  1.00 25.00 ? 131  GLY C N     1 
ATOM   3719 C  CA    . GLY C 1 131 ? -27.051 18.349  9.146   1.00 25.52 ? 131  GLY C CA    1 
ATOM   3720 C  C     . GLY C 1 131 ? -25.565 18.226  8.853   1.00 25.44 ? 131  GLY C C     1 
ATOM   3721 O  O     . GLY C 1 131 ? -24.813 19.165  9.105   1.00 26.15 ? 131  GLY C O     1 
ATOM   3722 N  N     . LEU C 1 132 ? -25.143 17.074  8.336   1.00 23.18 ? 132  LEU C N     1 
ATOM   3723 C  CA    . LEU C 1 132 ? -23.730 16.809  8.057   1.00 22.66 ? 132  LEU C CA    1 
ATOM   3724 C  C     . LEU C 1 132 ? -22.926 17.912  7.369   1.00 23.77 ? 132  LEU C C     1 
ATOM   3725 O  O     . LEU C 1 132 ? -21.828 18.252  7.815   1.00 21.54 ? 132  LEU C O     1 
ATOM   3726 C  CB    . LEU C 1 132 ? -23.576 15.488  7.296   1.00 24.35 ? 132  LEU C CB    1 
ATOM   3727 C  CG    . LEU C 1 132 ? -24.113 14.245  8.012   1.00 22.64 ? 132  LEU C CG    1 
ATOM   3728 C  CD1   . LEU C 1 132 ? -23.904 13.025  7.150   1.00 26.28 ? 132  LEU C CD1   1 
ATOM   3729 C  CD2   . LEU C 1 132 ? -23.450 14.062  9.372   1.00 24.30 ? 132  LEU C CD2   1 
ATOM   3730 N  N     . SER C 1 133 ? -23.481 18.492  6.307   1.00 23.08 ? 133  SER C N     1 
ATOM   3731 C  CA    . SER C 1 133 ? -22.788 19.541  5.568   1.00 24.21 ? 133  SER C CA    1 
ATOM   3732 C  C     . SER C 1 133 ? -22.540 20.808  6.387   1.00 23.78 ? 133  SER C C     1 
ATOM   3733 O  O     . SER C 1 133 ? -21.610 21.564  6.102   1.00 23.34 ? 133  SER C O     1 
ATOM   3734 C  CB    . SER C 1 133 ? -23.561 19.893  4.297   1.00 27.89 ? 133  SER C CB    1 
ATOM   3735 O  OG    . SER C 1 133 ? -24.799 20.498  4.614   1.00 30.76 ? 133  SER C OG    1 
ATOM   3736 N  N     . LYS C 1 134 ? -23.357 21.036  7.412   1.00 24.05 ? 134  LYS C N     1 
ATOM   3737 C  CA    . LYS C 1 134 ? -23.200 22.229  8.238   1.00 24.02 ? 134  LYS C CA    1 
ATOM   3738 C  C     . LYS C 1 134 ? -21.883 22.231  9.001   1.00 22.95 ? 134  LYS C C     1 
ATOM   3739 O  O     . LYS C 1 134 ? -21.346 23.294  9.322   1.00 23.06 ? 134  LYS C O     1 
ATOM   3740 C  CB    . LYS C 1 134 ? -24.392 22.406  9.185   1.00 23.24 ? 134  LYS C CB    1 
ATOM   3741 C  CG    . LYS C 1 134 ? -25.740 22.409  8.477   1.00 25.86 ? 134  LYS C CG    1 
ATOM   3742 C  CD    . LYS C 1 134 ? -25.763 23.355  7.275   1.00 23.17 ? 134  LYS C CD    1 
ATOM   3743 C  CE    . LYS C 1 134 ? -27.073 23.241  6.513   1.00 27.74 ? 134  LYS C CE    1 
ATOM   3744 N  NZ    . LYS C 1 134 ? -27.106 24.065  5.273   1.00 24.30 ? 134  LYS C NZ    1 
ATOM   3745 N  N     . PHE C 1 135 ? -21.346 21.041  9.270   1.00 23.87 ? 135  PHE C N     1 
ATOM   3746 C  CA    . PHE C 1 135 ? -20.063 20.930  9.959   1.00 23.30 ? 135  PHE C CA    1 
ATOM   3747 C  C     . PHE C 1 135 ? -18.987 21.529  9.065   1.00 19.92 ? 135  PHE C C     1 
ATOM   3748 O  O     . PHE C 1 135 ? -18.108 22.251  9.533   1.00 20.50 ? 135  PHE C O     1 
ATOM   3749 C  CB    . PHE C 1 135 ? -19.731 19.468  10.268  1.00 22.65 ? 135  PHE C CB    1 
ATOM   3750 C  CG    . PHE C 1 135 ? -20.507 18.907  11.419  1.00 22.99 ? 135  PHE C CG    1 
ATOM   3751 C  CD1   . PHE C 1 135 ? -20.231 19.314  12.719  1.00 23.15 ? 135  PHE C CD1   1 
ATOM   3752 C  CD2   . PHE C 1 135 ? -21.530 17.990  11.205  1.00 23.03 ? 135  PHE C CD2   1 
ATOM   3753 C  CE1   . PHE C 1 135 ? -20.966 18.817  13.793  1.00 20.99 ? 135  PHE C CE1   1 
ATOM   3754 C  CE2   . PHE C 1 135 ? -22.268 17.490  12.269  1.00 23.94 ? 135  PHE C CE2   1 
ATOM   3755 C  CZ    . PHE C 1 135 ? -21.984 17.907  13.567  1.00 22.48 ? 135  PHE C CZ    1 
ATOM   3756 N  N     . ALA C 1 136 ? -19.081 21.237  7.771   1.00 19.48 ? 136  ALA C N     1 
ATOM   3757 C  CA    . ALA C 1 136 ? -18.129 21.747  6.793   1.00 19.66 ? 136  ALA C CA    1 
ATOM   3758 C  C     . ALA C 1 136 ? -18.272 23.265  6.665   1.00 20.29 ? 136  ALA C C     1 
ATOM   3759 O  O     . ALA C 1 136 ? -17.276 23.989  6.576   1.00 16.62 ? 136  ALA C O     1 
ATOM   3760 C  CB    . ALA C 1 136 ? -18.351 21.077  5.451   1.00 18.31 ? 136  ALA C CB    1 
ATOM   3761 N  N     . ARG C 1 137 ? -19.516 23.739  6.679   1.00 20.60 ? 137  ARG C N     1 
ATOM   3762 C  CA    . ARG C 1 137 ? -19.789 25.173  6.581   1.00 21.46 ? 137  ARG C CA    1 
ATOM   3763 C  C     . ARG C 1 137 ? -19.229 25.914  7.798   1.00 20.52 ? 137  ARG C C     1 
ATOM   3764 O  O     . ARG C 1 137 ? -18.740 27.036  7.674   1.00 22.95 ? 137  ARG C O     1 
ATOM   3765 C  CB    . ARG C 1 137 ? -21.292 25.427  6.420   1.00 20.53 ? 137  ARG C CB    1 
ATOM   3766 C  CG    . ARG C 1 137 ? -21.858 24.892  5.114   1.00 24.91 ? 137  ARG C CG    1 
ATOM   3767 C  CD    . ARG C 1 137 ? -23.305 25.305  4.889   1.00 27.59 ? 137  ARG C CD    1 
ATOM   3768 N  NE    . ARG C 1 137 ? -23.812 24.840  3.596   1.00 26.30 ? 137  ARG C NE    1 
ATOM   3769 C  CZ    . ARG C 1 137 ? -23.494 25.377  2.421   1.00 28.36 ? 137  ARG C CZ    1 
ATOM   3770 N  NH1   . ARG C 1 137 ? -22.667 26.410  2.356   1.00 30.45 ? 137  ARG C NH1   1 
ATOM   3771 N  NH2   . ARG C 1 137 ? -23.990 24.862  1.302   1.00 31.59 ? 137  ARG C NH2   1 
ATOM   3772 N  N     . ILE C 1 138 ? -19.276 25.276  8.966   1.00 20.80 ? 138  ILE C N     1 
ATOM   3773 C  CA    . ILE C 1 138 ? -18.733 25.877  10.182  1.00 21.55 ? 138  ILE C CA    1 
ATOM   3774 C  C     . ILE C 1 138 ? -17.202 25.895  10.081  1.00 22.43 ? 138  ILE C C     1 
ATOM   3775 O  O     . ILE C 1 138 ? -16.558 26.874  10.466  1.00 24.39 ? 138  ILE C O     1 
ATOM   3776 C  CB    . ILE C 1 138 ? -19.186 25.114  11.452  1.00 20.34 ? 138  ILE C CB    1 
ATOM   3777 C  CG1   . ILE C 1 138 ? -20.688 25.324  11.680  1.00 22.78 ? 138  ILE C CG1   1 
ATOM   3778 C  CG2   . ILE C 1 138 ? -18.383 25.570  12.669  1.00 22.24 ? 138  ILE C CG2   1 
ATOM   3779 C  CD1   . ILE C 1 138 ? -21.257 24.534  12.844  1.00 24.42 ? 138  ILE C CD1   1 
ATOM   3780 N  N     . VAL C 1 139 ? -16.624 24.817  9.550   1.00 22.10 ? 139  VAL C N     1 
ATOM   3781 C  CA    . VAL C 1 139 ? -15.174 24.738  9.377   1.00 20.50 ? 139  VAL C CA    1 
ATOM   3782 C  C     . VAL C 1 139 ? -14.707 25.880  8.472   1.00 19.10 ? 139  VAL C C     1 
ATOM   3783 O  O     . VAL C 1 139 ? -13.779 26.606  8.820   1.00 22.06 ? 139  VAL C O     1 
ATOM   3784 C  CB    . VAL C 1 139 ? -14.739 23.380  8.763   1.00 22.23 ? 139  VAL C CB    1 
ATOM   3785 C  CG1   . VAL C 1 139 ? -13.291 23.445  8.281   1.00 19.98 ? 139  VAL C CG1   1 
ATOM   3786 C  CG2   . VAL C 1 139 ? -14.885 22.272  9.791   1.00 20.23 ? 139  VAL C CG2   1 
ATOM   3787 N  N     . ASP C 1 140 ? -15.375 26.054  7.333   1.00 20.72 ? 140  ASP C N     1 
ATOM   3788 C  CA    . ASP C 1 140 ? -15.023 27.115  6.391   1.00 23.62 ? 140  ASP C CA    1 
ATOM   3789 C  C     . ASP C 1 140 ? -15.185 28.512  6.998   1.00 24.88 ? 140  ASP C C     1 
ATOM   3790 O  O     . ASP C 1 140 ? -14.389 29.408  6.722   1.00 24.79 ? 140  ASP C O     1 
ATOM   3791 C  CB    . ASP C 1 140 ? -15.851 27.002  5.103   1.00 24.24 ? 140  ASP C CB    1 
ATOM   3792 C  CG    . ASP C 1 140 ? -15.412 25.839  4.208   1.00 23.29 ? 140  ASP C CG    1 
ATOM   3793 O  OD1   . ASP C 1 140 ? -14.354 25.229  4.462   1.00 22.28 ? 140  ASP C OD1   1 
ATOM   3794 O  OD2   . ASP C 1 140 ? -16.128 25.539  3.235   1.00 24.39 ? 140  ASP C OD2   1 
ATOM   3795 N  N     . MET C 1 141 ? -16.193 28.683  7.850   1.00 27.25 ? 141  MET C N     1 
ATOM   3796 C  CA    . MET C 1 141 ? -16.449 29.970  8.491   1.00 26.58 ? 141  MET C CA    1 
ATOM   3797 C  C     . MET C 1 141 ? -15.263 30.448  9.321   1.00 26.61 ? 141  MET C C     1 
ATOM   3798 O  O     . MET C 1 141 ? -14.914 31.628  9.296   1.00 27.32 ? 141  MET C O     1 
ATOM   3799 C  CB    . MET C 1 141 ? -17.697 29.893  9.377   1.00 27.61 ? 141  MET C CB    1 
ATOM   3800 C  CG    . MET C 1 141 ? -18.073 31.223  10.015  1.00 30.28 ? 141  MET C CG    1 
ATOM   3801 S  SD    . MET C 1 141 ? -19.540 31.123  11.053  1.00 30.80 ? 141  MET C SD    1 
ATOM   3802 C  CE    . MET C 1 141 ? -19.079 32.238  12.379  1.00 30.11 ? 141  MET C CE    1 
ATOM   3803 N  N     . PHE C 1 142 ? -14.646 29.531  10.058  1.00 25.06 ? 142  PHE C N     1 
ATOM   3804 C  CA    . PHE C 1 142 ? -13.505 29.883  10.887  1.00 23.70 ? 142  PHE C CA    1 
ATOM   3805 C  C     . PHE C 1 142 ? -12.162 29.717  10.185  1.00 23.76 ? 142  PHE C C     1 
ATOM   3806 O  O     . PHE C 1 142 ? -11.186 30.367  10.550  1.00 22.64 ? 142  PHE C O     1 
ATOM   3807 C  CB    . PHE C 1 142 ? -13.558 29.110  12.204  1.00 23.03 ? 142  PHE C CB    1 
ATOM   3808 C  CG    . PHE C 1 142 ? -14.733 29.487  13.061  1.00 26.18 ? 142  PHE C CG    1 
ATOM   3809 C  CD1   . PHE C 1 142 ? -14.684 30.625  13.861  1.00 26.43 ? 142  PHE C CD1   1 
ATOM   3810 C  CD2   . PHE C 1 142 ? -15.910 28.745  13.022  1.00 24.35 ? 142  PHE C CD2   1 
ATOM   3811 C  CE1   . PHE C 1 142 ? -15.792 31.026  14.607  1.00 24.94 ? 142  PHE C CE1   1 
ATOM   3812 C  CE2   . PHE C 1 142 ? -17.025 29.136  13.764  1.00 25.93 ? 142  PHE C CE2   1 
ATOM   3813 C  CZ    . PHE C 1 142 ? -16.964 30.280  14.557  1.00 26.61 ? 142  PHE C CZ    1 
ATOM   3814 N  N     . ALA C 1 143 ? -12.132 28.892  9.141   1.00 22.79 ? 143  ALA C N     1 
ATOM   3815 C  CA    . ALA C 1 143 ? -10.905 28.655  8.385   1.00 24.59 ? 143  ALA C CA    1 
ATOM   3816 C  C     . ALA C 1 143 ? -10.583 29.809  7.438   1.00 24.25 ? 143  ALA C C     1 
ATOM   3817 O  O     . ALA C 1 143 ? -9.417  30.133  7.224   1.00 26.65 ? 143  ALA C O     1 
ATOM   3818 C  CB    . ALA C 1 143 ? -11.003 27.338  7.608   1.00 21.62 ? 143  ALA C CB    1 
ATOM   3819 N  N     . ARG C 1 144 ? -11.616 30.431  6.877   1.00 25.33 ? 144  ARG C N     1 
ATOM   3820 C  CA    . ARG C 1 144 ? -11.418 31.546  5.957   1.00 24.97 ? 144  ARG C CA    1 
ATOM   3821 C  C     . ARG C 1 144 ? -11.242 32.857  6.715   1.00 26.37 ? 144  ARG C C     1 
ATOM   3822 O  O     . ARG C 1 144 ? -12.056 33.783  6.628   1.00 24.86 ? 144  ARG C O     1 
ATOM   3823 C  CB    . ARG C 1 144 ? -12.550 31.601  4.935   1.00 23.80 ? 144  ARG C CB    1 
ATOM   3824 C  CG    . ARG C 1 144 ? -12.528 30.378  4.038   1.00 27.91 ? 144  ARG C CG    1 
ATOM   3825 C  CD    . ARG C 1 144 ? -13.667 30.306  3.054   1.00 30.22 ? 144  ARG C CD    1 
ATOM   3826 N  NE    . ARG C 1 144 ? -13.495 29.135  2.196   1.00 33.93 ? 144  ARG C NE    1 
ATOM   3827 C  CZ    . ARG C 1 144 ? -14.480 28.501  1.568   1.00 33.36 ? 144  ARG C CZ    1 
ATOM   3828 N  NH1   . ARG C 1 144 ? -15.732 28.920  1.685   1.00 33.13 ? 144  ARG C NH1   1 
ATOM   3829 N  NH2   . ARG C 1 144 ? -14.211 27.423  0.845   1.00 35.48 ? 144  ARG C NH2   1 
ATOM   3830 N  N     . ARG C 1 145 ? -10.152 32.889  7.473   1.00 26.02 ? 145  ARG C N     1 
ATOM   3831 C  CA    . ARG C 1 145 ? -9.748  34.015  8.303   1.00 27.88 ? 145  ARG C CA    1 
ATOM   3832 C  C     . ARG C 1 145 ? -8.237  33.884  8.486   1.00 29.58 ? 145  ARG C C     1 
ATOM   3833 O  O     . ARG C 1 145 ? -7.616  32.961  7.945   1.00 28.31 ? 145  ARG C O     1 
ATOM   3834 C  CB    . ARG C 1 145 ? -10.398 33.896  9.694   1.00 26.77 ? 145  ARG C CB    1 
ATOM   3835 C  CG    . ARG C 1 145 ? -11.921 33.858  9.717   1.00 26.36 ? 145  ARG C CG    1 
ATOM   3836 C  CD    . ARG C 1 145 ? -12.450 33.671  11.139  1.00 25.56 ? 145  ARG C CD    1 
ATOM   3837 N  NE    . ARG C 1 145 ? -13.909 33.658  11.176  1.00 23.98 ? 145  ARG C NE    1 
ATOM   3838 C  CZ    . ARG C 1 145 ? -14.642 33.992  12.236  1.00 26.76 ? 145  ARG C CZ    1 
ATOM   3839 N  NH1   . ARG C 1 145 ? -14.060 34.369  13.368  1.00 29.06 ? 145  ARG C NH1   1 
ATOM   3840 N  NH2   . ARG C 1 145 ? -15.964 33.958  12.160  1.00 26.98 ? 145  ARG C NH2   1 
ATOM   3841 N  N     . LEU C 1 146 ? -7.635  34.835  9.193   1.00 25.17 ? 146  LEU C N     1 
ATOM   3842 C  CA    . LEU C 1 146 ? -6.216  34.740  9.503   1.00 27.08 ? 146  LEU C CA    1 
ATOM   3843 C  C     . LEU C 1 146 ? -6.286  33.917  10.783  1.00 28.47 ? 146  LEU C C     1 
ATOM   3844 O  O     . LEU C 1 146 ? -7.054  34.241  11.693  1.00 29.39 ? 146  LEU C O     1 
ATOM   3845 C  CB    . LEU C 1 146 ? -5.595  36.115  9.757   1.00 27.21 ? 146  LEU C CB    1 
ATOM   3846 C  CG    . LEU C 1 146 ? -5.524  37.050  8.545   1.00 27.68 ? 146  LEU C CG    1 
ATOM   3847 C  CD1   . LEU C 1 146 ? -4.668  38.255  8.897   1.00 28.79 ? 146  LEU C CD1   1 
ATOM   3848 C  CD2   . LEU C 1 146 ? -4.931  36.328  7.338   1.00 26.72 ? 146  LEU C CD2   1 
ATOM   3849 N  N     . GLN C 1 147 ? -5.514  32.839  10.851  1.00 27.02 ? 147  GLN C N     1 
ATOM   3850 C  CA    . GLN C 1 147 ? -5.592  31.957  12.004  1.00 24.02 ? 147  GLN C CA    1 
ATOM   3851 C  C     . GLN C 1 147 ? -4.308  31.441  12.625  1.00 24.05 ? 147  GLN C C     1 
ATOM   3852 O  O     . GLN C 1 147 ? -3.194  31.732  12.191  1.00 24.00 ? 147  GLN C O     1 
ATOM   3853 C  CB    . GLN C 1 147 ? -6.453  30.734  11.636  1.00 25.01 ? 147  GLN C CB    1 
ATOM   3854 C  CG    . GLN C 1 147 ? -7.959  30.943  11.673  1.00 24.39 ? 147  GLN C CG    1 
ATOM   3855 C  CD    . GLN C 1 147 ? -8.526  30.887  13.079  1.00 22.35 ? 147  GLN C CD    1 
ATOM   3856 O  OE1   . GLN C 1 147 ? -7.785  30.868  14.062  1.00 24.34 ? 147  GLN C OE1   1 
ATOM   3857 N  NE2   . GLN C 1 147 ? -9.849  30.851  13.180  1.00 26.43 ? 147  GLN C NE2   1 
ATOM   3858 N  N     . VAL C 1 148 ? -4.534  30.667  13.679  1.00 26.10 ? 148  VAL C N     1 
ATOM   3859 C  CA    . VAL C 1 148 ? -3.541  29.961  14.472  1.00 27.56 ? 148  VAL C CA    1 
ATOM   3860 C  C     . VAL C 1 148 ? -4.277  28.622  14.568  1.00 27.43 ? 148  VAL C C     1 
ATOM   3861 O  O     . VAL C 1 148 ? -5.470  28.605  14.883  1.00 27.88 ? 148  VAL C O     1 
ATOM   3862 C  CB    . VAL C 1 148 ? -3.396  30.589  15.879  1.00 29.33 ? 148  VAL C CB    1 
ATOM   3863 C  CG1   . VAL C 1 148 ? -2.609  29.679  16.793  1.00 30.74 ? 148  VAL C CG1   1 
ATOM   3864 C  CG2   . VAL C 1 148 ? -2.695  31.931  15.776  1.00 33.88 ? 148  VAL C CG2   1 
ATOM   3865 N  N     . GLN C 1 149 ? -3.607  27.516  14.252  1.00 25.80 ? 149  GLN C N     1 
ATOM   3866 C  CA    . GLN C 1 149 ? -4.277  26.212  14.271  1.00 24.68 ? 149  GLN C CA    1 
ATOM   3867 C  C     . GLN C 1 149 ? -4.894  25.817  15.610  1.00 23.43 ? 149  GLN C C     1 
ATOM   3868 O  O     . GLN C 1 149 ? -5.917  25.131  15.650  1.00 22.16 ? 149  GLN C O     1 
ATOM   3869 C  CB    . GLN C 1 149 ? -3.356  25.102  13.769  1.00 20.99 ? 149  GLN C CB    1 
ATOM   3870 C  CG    . GLN C 1 149 ? -4.130  23.872  13.308  1.00 17.36 ? 149  GLN C CG    1 
ATOM   3871 C  CD    . GLN C 1 149 ? -3.231  22.722  12.894  1.00 22.29 ? 149  GLN C CD    1 
ATOM   3872 O  OE1   . GLN C 1 149 ? -2.316  22.889  12.090  1.00 25.96 ? 149  GLN C OE1   1 
ATOM   3873 N  NE2   . GLN C 1 149 ? -3.494  21.545  13.442  1.00 17.05 ? 149  GLN C NE2   1 
ATOM   3874 N  N     . GLU C 1 150 ? -4.261  26.235  16.701  1.00 24.10 ? 150  GLU C N     1 
ATOM   3875 C  CA    . GLU C 1 150 ? -4.763  25.934  18.035  1.00 24.43 ? 150  GLU C CA    1 
ATOM   3876 C  C     . GLU C 1 150 ? -6.123  26.598  18.241  1.00 25.83 ? 150  GLU C C     1 
ATOM   3877 O  O     . GLU C 1 150 ? -7.020  26.011  18.843  1.00 25.43 ? 150  GLU C O     1 
ATOM   3878 C  CB    . GLU C 1 150 ? -3.776  26.412  19.106  1.00 25.83 ? 150  GLU C CB    1 
ATOM   3879 C  CG    . GLU C 1 150 ? -2.462  25.626  19.172  1.00 28.21 ? 150  GLU C CG    1 
ATOM   3880 C  CD    . GLU C 1 150 ? -1.376  26.130  18.221  1.00 30.27 ? 150  GLU C CD    1 
ATOM   3881 O  OE1   . GLU C 1 150 ? -1.685  26.747  17.178  1.00 28.37 ? 150  GLU C OE1   1 
ATOM   3882 O  OE2   . GLU C 1 150 ? -0.190  25.896  18.526  1.00 31.05 ? 150  GLU C OE2   1 
ATOM   3883 N  N     . ARG C 1 151 ? -6.278  27.806  17.701  1.00 25.95 ? 151  ARG C N     1 
ATOM   3884 C  CA    . ARG C 1 151 ? -7.526  28.558  17.819  1.00 24.97 ? 151  ARG C CA    1 
ATOM   3885 C  C     . ARG C 1 151 ? -8.626  27.997  16.926  1.00 25.00 ? 151  ARG C C     1 
ATOM   3886 O  O     . ARG C 1 151 ? -9.796  27.963  17.314  1.00 23.19 ? 151  ARG C O     1 
ATOM   3887 C  CB    . ARG C 1 151 ? -7.293  30.026  17.459  1.00 26.29 ? 151  ARG C CB    1 
ATOM   3888 C  CG    . ARG C 1 151 ? -8.519  30.911  17.647  1.00 27.14 ? 151  ARG C CG    1 
ATOM   3889 C  CD    . ARG C 1 151 ? -8.258  32.322  17.147  1.00 30.42 ? 151  ARG C CD    1 
ATOM   3890 N  NE    . ARG C 1 151 ? -7.014  32.866  17.686  1.00 28.60 ? 151  ARG C NE    1 
ATOM   3891 C  CZ    . ARG C 1 151 ? -6.156  33.603  16.989  1.00 29.67 ? 151  ARG C CZ    1 
ATOM   3892 N  NH1   . ARG C 1 151 ? -6.401  33.896  15.719  1.00 30.40 ? 151  ARG C NH1   1 
ATOM   3893 N  NH2   . ARG C 1 151 ? -5.035  34.027  17.557  1.00 32.32 ? 151  ARG C NH2   1 
ATOM   3894 N  N     . LEU C 1 152 ? -8.246  27.596  15.716  1.00 21.22 ? 152  LEU C N     1 
ATOM   3895 C  CA    . LEU C 1 152 ? -9.185  27.040  14.749  1.00 21.69 ? 152  LEU C CA    1 
ATOM   3896 C  C     . LEU C 1 152 ? -9.981  25.873  15.331  1.00 20.21 ? 152  LEU C C     1 
ATOM   3897 O  O     . LEU C 1 152 ? -11.204 25.835  15.212  1.00 21.99 ? 152  LEU C O     1 
ATOM   3898 C  CB    . LEU C 1 152 ? -8.436  26.603  13.485  1.00 21.10 ? 152  LEU C CB    1 
ATOM   3899 C  CG    . LEU C 1 152 ? -9.259  26.045  12.325  1.00 19.35 ? 152  LEU C CG    1 
ATOM   3900 C  CD1   . LEU C 1 152 ? -10.298 27.057  11.869  1.00 21.33 ? 152  LEU C CD1   1 
ATOM   3901 C  CD2   . LEU C 1 152 ? -8.327  25.688  11.179  1.00 20.60 ? 152  LEU C CD2   1 
ATOM   3902 N  N     . ALA C 1 153 ? -9.290  24.953  16.000  1.00 20.92 ? 153  ALA C N     1 
ATOM   3903 C  CA    . ALA C 1 153 ? -9.933  23.792  16.612  1.00 20.77 ? 153  ALA C CA    1 
ATOM   3904 C  C     . ALA C 1 153 ? -10.908 24.211  17.715  1.00 23.76 ? 153  ALA C C     1 
ATOM   3905 O  O     . ALA C 1 153 ? -12.008 23.676  17.819  1.00 19.85 ? 153  ALA C O     1 
ATOM   3906 C  CB    . ALA C 1 153 ? -8.879  22.852  17.179  1.00 22.36 ? 153  ALA C CB    1 
ATOM   3907 N  N     . VAL C 1 154 ? -10.492 25.176  18.530  1.00 26.77 ? 154  VAL C N     1 
ATOM   3908 C  CA    . VAL C 1 154 ? -11.316 25.677  19.627  1.00 26.91 ? 154  VAL C CA    1 
ATOM   3909 C  C     . VAL C 1 154 ? -12.594 26.351  19.124  1.00 26.79 ? 154  VAL C C     1 
ATOM   3910 O  O     . VAL C 1 154 ? -13.689 26.045  19.597  1.00 25.76 ? 154  VAL C O     1 
ATOM   3911 C  CB    . VAL C 1 154 ? -10.520 26.669  20.514  1.00 27.11 ? 154  VAL C CB    1 
ATOM   3912 C  CG1   . VAL C 1 154 ? -11.436 27.321  21.551  1.00 30.14 ? 154  VAL C CG1   1 
ATOM   3913 C  CG2   . VAL C 1 154 ? -9.378  25.943  21.210  1.00 26.09 ? 154  VAL C CG2   1 
ATOM   3914 N  N     . GLN C 1 155 ? -12.451 27.249  18.152  1.00 26.70 ? 155  GLN C N     1 
ATOM   3915 C  CA    . GLN C 1 155 ? -13.599 27.963  17.598  1.00 26.49 ? 155  GLN C CA    1 
ATOM   3916 C  C     . GLN C 1 155 ? -14.625 27.049  16.939  1.00 26.69 ? 155  GLN C C     1 
ATOM   3917 O  O     . GLN C 1 155 ? -15.830 27.271  17.062  1.00 25.72 ? 155  GLN C O     1 
ATOM   3918 C  CB    . GLN C 1 155 ? -13.141 29.041  16.615  1.00 30.18 ? 155  GLN C CB    1 
ATOM   3919 C  CG    . GLN C 1 155 ? -12.352 30.163  17.267  1.00 33.10 ? 155  GLN C CG    1 
ATOM   3920 C  CD    . GLN C 1 155 ? -12.141 31.342  16.340  1.00 38.60 ? 155  GLN C CD    1 
ATOM   3921 O  OE1   . GLN C 1 155 ? -11.565 31.202  15.263  1.00 39.27 ? 155  GLN C OE1   1 
ATOM   3922 N  NE2   . GLN C 1 155 ? -12.615 32.513  16.754  1.00 40.05 ? 155  GLN C NE2   1 
ATOM   3923 N  N     . ILE C 1 156 ? -14.147 26.029  16.232  1.00 23.98 ? 156  ILE C N     1 
ATOM   3924 C  CA    . ILE C 1 156 ? -15.038 25.078  15.574  1.00 22.63 ? 156  ILE C CA    1 
ATOM   3925 C  C     . ILE C 1 156 ? -15.832 24.313  16.633  1.00 20.36 ? 156  ILE C C     1 
ATOM   3926 O  O     . ILE C 1 156 ? -17.045 24.151  16.511  1.00 22.09 ? 156  ILE C O     1 
ATOM   3927 C  CB    . ILE C 1 156 ? -14.246 24.080  14.680  1.00 21.09 ? 156  ILE C CB    1 
ATOM   3928 C  CG1   . ILE C 1 156 ? -13.640 24.819  13.483  1.00 22.44 ? 156  ILE C CG1   1 
ATOM   3929 C  CG2   . ILE C 1 156 ? -15.165 22.955  14.186  1.00 19.70 ? 156  ILE C CG2   1 
ATOM   3930 C  CD1   . ILE C 1 156 ? -12.616 23.998  12.704  1.00 20.98 ? 156  ILE C CD1   1 
ATOM   3931 N  N     . ALA C 1 157 ? -15.146 23.878  17.687  1.00 21.73 ? 157  ALA C N     1 
ATOM   3932 C  CA    . ALA C 1 157 ? -15.788 23.136  18.764  1.00 22.02 ? 157  ALA C CA    1 
ATOM   3933 C  C     . ALA C 1 157 ? -16.837 23.985  19.483  1.00 24.44 ? 157  ALA C C     1 
ATOM   3934 O  O     . ALA C 1 157 ? -17.949 23.518  19.735  1.00 24.25 ? 157  ALA C O     1 
ATOM   3935 C  CB    . ALA C 1 157 ? -14.747 22.629  19.747  1.00 20.86 ? 157  ALA C CB    1 
ATOM   3936 N  N     . GLU C 1 158 ? -16.493 25.235  19.781  1.00 22.19 ? 158  GLU C N     1 
ATOM   3937 C  CA    . GLU C 1 158 ? -17.418 26.140  20.465  1.00 26.70 ? 158  GLU C CA    1 
ATOM   3938 C  C     . GLU C 1 158 ? -18.662 26.407  19.632  1.00 25.68 ? 158  GLU C C     1 
ATOM   3939 O  O     . GLU C 1 158 ? -19.773 26.445  20.161  1.00 26.99 ? 158  GLU C O     1 
ATOM   3940 C  CB    . GLU C 1 158 ? -16.736 27.466  20.810  1.00 26.69 ? 158  GLU C CB    1 
ATOM   3941 C  CG    . GLU C 1 158 ? -15.639 27.345  21.855  1.00 34.40 ? 158  GLU C CG    1 
ATOM   3942 C  CD    . GLU C 1 158 ? -15.027 28.687  22.239  1.00 38.11 ? 158  GLU C CD    1 
ATOM   3943 O  OE1   . GLU C 1 158 ? -15.097 29.643  21.433  1.00 43.49 ? 158  GLU C OE1   1 
ATOM   3944 O  OE2   . GLU C 1 158 ? -14.464 28.781  23.349  1.00 39.10 ? 158  GLU C OE2   1 
ATOM   3945 N  N     . ALA C 1 159 ? -18.472 26.578  18.325  1.00 24.58 ? 159  ALA C N     1 
ATOM   3946 C  CA    . ALA C 1 159 ? -19.579 26.833  17.415  1.00 24.07 ? 159  ALA C CA    1 
ATOM   3947 C  C     . ALA C 1 159 ? -20.570 25.671  17.448  1.00 26.03 ? 159  ALA C C     1 
ATOM   3948 O  O     . ALA C 1 159 ? -21.776 25.878  17.581  1.00 25.75 ? 159  ALA C O     1 
ATOM   3949 C  CB    . ALA C 1 159 ? -19.058 27.045  16.001  1.00 23.55 ? 159  ALA C CB    1 
ATOM   3950 N  N     . ILE C 1 160 ? -20.048 24.450  17.367  1.00 23.89 ? 160  ILE C N     1 
ATOM   3951 C  CA    . ILE C 1 160 ? -20.882 23.249  17.392  1.00 25.07 ? 160  ILE C CA    1 
ATOM   3952 C  C     . ILE C 1 160 ? -21.615 23.130  18.730  1.00 25.84 ? 160  ILE C C     1 
ATOM   3953 O  O     . ILE C 1 160 ? -22.802 22.800  18.767  1.00 24.59 ? 160  ILE C O     1 
ATOM   3954 C  CB    . ILE C 1 160 ? -20.036 21.976  17.140  1.00 26.09 ? 160  ILE C CB    1 
ATOM   3955 C  CG1   . ILE C 1 160 ? -19.408 22.039  15.744  1.00 26.90 ? 160  ILE C CG1   1 
ATOM   3956 C  CG2   . ILE C 1 160 ? -20.907 20.726  17.252  1.00 25.75 ? 160  ILE C CG2   1 
ATOM   3957 C  CD1   . ILE C 1 160 ? -18.394 20.948  15.474  1.00 24.41 ? 160  ILE C CD1   1 
ATOM   3958 N  N     . GLN C 1 161 ? -20.897 23.408  19.815  1.00 27.15 ? 161  GLN C N     1 
ATOM   3959 C  CA    . GLN C 1 161 ? -21.448 23.354  21.166  1.00 31.98 ? 161  GLN C CA    1 
ATOM   3960 C  C     . GLN C 1 161 ? -22.610 24.334  21.314  1.00 32.86 ? 161  GLN C C     1 
ATOM   3961 O  O     . GLN C 1 161 ? -23.649 23.995  21.883  1.00 33.17 ? 161  GLN C O     1 
ATOM   3962 C  CB    . GLN C 1 161 ? -20.350 23.678  22.187  1.00 35.62 ? 161  GLN C CB    1 
ATOM   3963 C  CG    . GLN C 1 161 ? -20.813 23.773  23.641  1.00 39.83 ? 161  GLN C CG    1 
ATOM   3964 C  CD    . GLN C 1 161 ? -21.406 22.479  24.165  1.00 43.46 ? 161  GLN C CD    1 
ATOM   3965 O  OE1   . GLN C 1 161 ? -20.725 21.454  24.239  1.00 45.81 ? 161  GLN C OE1   1 
ATOM   3966 N  NE2   . GLN C 1 161 ? -22.680 22.522  24.543  1.00 45.50 ? 161  GLN C NE2   1 
ATOM   3967 N  N     . GLU C 1 162 ? -22.437 25.531  20.761  1.00 33.69 ? 162  GLU C N     1 
ATOM   3968 C  CA    . GLU C 1 162 ? -23.448 26.581  20.819  1.00 36.42 ? 162  GLU C CA    1 
ATOM   3969 C  C     . GLU C 1 162 ? -24.701 26.239  20.010  1.00 36.29 ? 162  GLU C C     1 
ATOM   3970 O  O     . GLU C 1 162 ? -25.823 26.514  20.443  1.00 34.38 ? 162  GLU C O     1 
ATOM   3971 C  CB    . GLU C 1 162 ? -22.848 27.900  20.320  1.00 39.72 ? 162  GLU C CB    1 
ATOM   3972 C  CG    . GLU C 1 162 ? -23.788 29.096  20.379  1.00 45.00 ? 162  GLU C CG    1 
ATOM   3973 C  CD    . GLU C 1 162 ? -23.146 30.368  19.852  1.00 49.05 ? 162  GLU C CD    1 
ATOM   3974 O  OE1   . GLU C 1 162 ? -22.052 30.733  20.336  1.00 53.16 ? 162  GLU C OE1   1 
ATOM   3975 O  OE2   . GLU C 1 162 ? -23.736 31.004  18.952  1.00 50.62 ? 162  GLU C OE2   1 
ATOM   3976 N  N     . VAL C 1 163 ? -24.501 25.618  18.850  1.00 34.16 ? 163  VAL C N     1 
ATOM   3977 C  CA    . VAL C 1 163 ? -25.599 25.246  17.959  1.00 33.38 ? 163  VAL C CA    1 
ATOM   3978 C  C     . VAL C 1 163 ? -26.408 24.020  18.389  1.00 32.66 ? 163  VAL C C     1 
ATOM   3979 O  O     . VAL C 1 163 ? -27.634 24.013  18.282  1.00 33.50 ? 163  VAL C O     1 
ATOM   3980 C  CB    . VAL C 1 163 ? -25.081 25.021  16.510  1.00 34.97 ? 163  VAL C CB    1 
ATOM   3981 C  CG1   . VAL C 1 163 ? -26.187 24.469  15.611  1.00 33.81 ? 163  VAL C CG1   1 
ATOM   3982 C  CG2   . VAL C 1 163 ? -24.550 26.321  15.942  1.00 35.92 ? 163  VAL C CG2   1 
ATOM   3983 N  N     . LEU C 1 164 ? -25.731 22.991  18.885  1.00 31.27 ? 164  LEU C N     1 
ATOM   3984 C  CA    . LEU C 1 164 ? -26.414 21.762  19.279  1.00 31.65 ? 164  LEU C CA    1 
ATOM   3985 C  C     . LEU C 1 164 ? -26.565 21.516  20.770  1.00 31.85 ? 164  LEU C C     1 
ATOM   3986 O  O     . LEU C 1 164 ? -27.433 20.743  21.179  1.00 32.84 ? 164  LEU C O     1 
ATOM   3987 C  CB    . LEU C 1 164 ? -25.705 20.551  18.667  1.00 29.95 ? 164  LEU C CB    1 
ATOM   3988 C  CG    . LEU C 1 164 ? -25.682 20.403  17.147  1.00 30.21 ? 164  LEU C CG    1 
ATOM   3989 C  CD1   . LEU C 1 164 ? -24.760 19.251  16.782  1.00 31.30 ? 164  LEU C CD1   1 
ATOM   3990 C  CD2   . LEU C 1 164 ? -27.094 20.170  16.611  1.00 26.84 ? 164  LEU C CD2   1 
ATOM   3991 N  N     . GLU C 1 165 ? -25.709 22.143  21.573  1.00 32.33 ? 165  GLU C N     1 
ATOM   3992 C  CA    . GLU C 1 165 ? -25.719 21.951  23.025  1.00 33.30 ? 165  GLU C CA    1 
ATOM   3993 C  C     . GLU C 1 165 ? -25.736 20.441  23.292  1.00 31.83 ? 165  GLU C C     1 
ATOM   3994 O  O     . GLU C 1 165 ? -26.592 19.928  24.017  1.00 29.27 ? 165  GLU C O     1 
ATOM   3995 C  CB    . GLU C 1 165 ? -26.939 22.637  23.654  1.00 36.85 ? 165  GLU C CB    1 
ATOM   3996 C  CG    . GLU C 1 165 ? -26.979 24.143  23.423  1.00 42.42 ? 165  GLU C CG    1 
ATOM   3997 C  CD    . GLU C 1 165 ? -28.281 24.777  23.880  1.00 48.83 ? 165  GLU C CD    1 
ATOM   3998 O  OE1   . GLU C 1 165 ? -29.295 24.655  23.156  1.00 51.36 ? 165  GLU C OE1   1 
ATOM   3999 O  OE2   . GLU C 1 165 ? -28.290 25.401  24.961  1.00 49.54 ? 165  GLU C OE2   1 
ATOM   4000 N  N     . PRO C 1 166 ? -24.799 19.703  22.667  1.00 29.95 ? 166  PRO C N     1 
ATOM   4001 C  CA    . PRO C 1 166 ? -24.729 18.254  22.844  1.00 29.83 ? 166  PRO C CA    1 
ATOM   4002 C  C     . PRO C 1 166 ? -24.071 17.899  24.168  1.00 29.92 ? 166  PRO C C     1 
ATOM   4003 O  O     . PRO C 1 166 ? -23.622 18.782  24.905  1.00 29.51 ? 166  PRO C O     1 
ATOM   4004 C  CB    . PRO C 1 166 ? -23.867 17.829  21.661  1.00 28.98 ? 166  PRO C CB    1 
ATOM   4005 C  CG    . PRO C 1 166 ? -22.865 18.904  21.610  1.00 28.81 ? 166  PRO C CG    1 
ATOM   4006 C  CD    . PRO C 1 166 ? -23.679 20.172  21.829  1.00 30.28 ? 166  PRO C CD    1 
ATOM   4007 N  N     . GLN C 1 167 ? -24.018 16.609  24.475  1.00 30.00 ? 167  GLN C N     1 
ATOM   4008 C  CA    . GLN C 1 167 ? -23.389 16.170  25.710  1.00 32.22 ? 167  GLN C CA    1 
ATOM   4009 C  C     . GLN C 1 167 ? -21.895 16.484  25.680  1.00 29.99 ? 167  GLN C C     1 
ATOM   4010 O  O     . GLN C 1 167 ? -21.266 16.650  26.723  1.00 30.53 ? 167  GLN C O     1 
ATOM   4011 C  CB    . GLN C 1 167 ? -23.625 14.678  25.931  1.00 35.15 ? 167  GLN C CB    1 
ATOM   4012 C  CG    . GLN C 1 167 ? -25.093 14.322  26.103  1.00 41.75 ? 167  GLN C CG    1 
ATOM   4013 C  CD    . GLN C 1 167 ? -25.295 13.003  26.816  1.00 46.31 ? 167  GLN C CD    1 
ATOM   4014 O  OE1   . GLN C 1 167 ? -25.939 12.092  26.293  1.00 48.18 ? 167  GLN C OE1   1 
ATOM   4015 N  NE2   . GLN C 1 167 ? -24.751 12.895  28.024  1.00 49.37 ? 167  GLN C NE2   1 
ATOM   4016 N  N     . GLY C 1 168 ? -21.347 16.595  24.473  1.00 28.13 ? 168  GLY C N     1 
ATOM   4017 C  CA    . GLY C 1 168 ? -19.937 16.899  24.313  1.00 24.47 ? 168  GLY C CA    1 
ATOM   4018 C  C     . GLY C 1 168 ? -19.542 16.941  22.849  1.00 24.05 ? 168  GLY C C     1 
ATOM   4019 O  O     . GLY C 1 168 ? -20.225 16.369  22.000  1.00 23.07 ? 168  GLY C O     1 
ATOM   4020 N  N     . VAL C 1 169 ? -18.459 17.652  22.552  1.00 23.83 ? 169  VAL C N     1 
ATOM   4021 C  CA    . VAL C 1 169 ? -17.962 17.774  21.182  1.00 23.16 ? 169  VAL C CA    1 
ATOM   4022 C  C     . VAL C 1 169 ? -16.451 17.652  21.188  1.00 22.82 ? 169  VAL C C     1 
ATOM   4023 O  O     . VAL C 1 169 ? -15.782 18.135  22.107  1.00 23.32 ? 169  VAL C O     1 
ATOM   4024 C  CB    . VAL C 1 169 ? -18.286 19.154  20.545  1.00 24.61 ? 169  VAL C CB    1 
ATOM   4025 C  CG1   . VAL C 1 169 ? -18.041 19.106  19.039  1.00 24.96 ? 169  VAL C CG1   1 
ATOM   4026 C  CG2   . VAL C 1 169 ? -19.699 19.576  20.840  1.00 30.72 ? 169  VAL C CG2   1 
ATOM   4027 N  N     . GLY C 1 170 ? -15.916 17.022  20.145  1.00 21.94 ? 170  GLY C N     1 
ATOM   4028 C  CA    . GLY C 1 170 ? -14.482 16.863  20.023  1.00 19.14 ? 170  GLY C CA    1 
ATOM   4029 C  C     . GLY C 1 170 ? -14.064 17.267  18.624  1.00 18.61 ? 170  GLY C C     1 
ATOM   4030 O  O     . GLY C 1 170 ? -14.685 16.853  17.650  1.00 18.64 ? 170  GLY C O     1 
ATOM   4031 N  N     . VAL C 1 171 ? -13.049 18.115  18.525  1.00 19.79 ? 171  VAL C N     1 
ATOM   4032 C  CA    . VAL C 1 171 ? -12.561 18.569  17.230  1.00 20.41 ? 171  VAL C CA    1 
ATOM   4033 C  C     . VAL C 1 171 ? -11.058 18.363  17.131  1.00 21.81 ? 171  VAL C C     1 
ATOM   4034 O  O     . VAL C 1 171 ? -10.315 18.733  18.036  1.00 24.41 ? 171  VAL C O     1 
ATOM   4035 C  CB    . VAL C 1 171 ? -12.884 20.066  16.992  1.00 20.40 ? 171  VAL C CB    1 
ATOM   4036 C  CG1   . VAL C 1 171 ? -12.294 20.537  15.663  1.00 22.19 ? 171  VAL C CG1   1 
ATOM   4037 C  CG2   . VAL C 1 171 ? -14.389 20.286  16.999  1.00 18.05 ? 171  VAL C CG2   1 
ATOM   4038 N  N     . VAL C 1 172 ? -10.624 17.733  16.044  1.00 21.82 ? 172  VAL C N     1 
ATOM   4039 C  CA    . VAL C 1 172 ? -9.206  17.494  15.806  1.00 20.29 ? 172  VAL C CA    1 
ATOM   4040 C  C     . VAL C 1 172 ? -8.852  18.114  14.458  1.00 20.38 ? 172  VAL C C     1 
ATOM   4041 O  O     . VAL C 1 172 ? -9.536  17.879  13.466  1.00 19.57 ? 172  VAL C O     1 
ATOM   4042 C  CB    . VAL C 1 172 ? -8.871  15.977  15.770  1.00 20.63 ? 172  VAL C CB    1 
ATOM   4043 C  CG1   . VAL C 1 172 ? -7.441  15.762  15.292  1.00 17.12 ? 172  VAL C CG1   1 
ATOM   4044 C  CG2   . VAL C 1 172 ? -9.051  15.364  17.147  1.00 20.90 ? 172  VAL C CG2   1 
ATOM   4045 N  N     . VAL C 1 173 ? -7.840  18.976  14.452  1.00 20.90 ? 173  VAL C N     1 
ATOM   4046 C  CA    . VAL C 1 173 ? -7.390  19.617  13.224  1.00 17.93 ? 173  VAL C CA    1 
ATOM   4047 C  C     . VAL C 1 173 ? -5.964  19.158  12.938  1.00 18.23 ? 173  VAL C C     1 
ATOM   4048 O  O     . VAL C 1 173 ? -5.107  19.182  13.818  1.00 18.56 ? 173  VAL C O     1 
ATOM   4049 C  CB    . VAL C 1 173 ? -7.413  21.159  13.330  1.00 16.51 ? 173  VAL C CB    1 
ATOM   4050 C  CG1   . VAL C 1 173 ? -6.934  21.781  12.025  1.00 15.82 ? 173  VAL C CG1   1 
ATOM   4051 C  CG2   . VAL C 1 173 ? -8.822  21.644  13.657  1.00 15.00 ? 173  VAL C CG2   1 
ATOM   4052 N  N     . GLU C 1 174 ? -5.730  18.685  11.720  1.00 16.59 ? 174  GLU C N     1 
ATOM   4053 C  CA    . GLU C 1 174 ? -4.404  18.238  11.338  1.00 16.93 ? 174  GLU C CA    1 
ATOM   4054 C  C     . GLU C 1 174 ? -4.026  18.929  10.042  1.00 15.91 ? 174  GLU C C     1 
ATOM   4055 O  O     . GLU C 1 174 ? -4.725  18.804  9.043   1.00 17.66 ? 174  GLU C O     1 
ATOM   4056 C  CB    . GLU C 1 174 ? -4.367  16.717  11.167  1.00 18.34 ? 174  GLU C CB    1 
ATOM   4057 C  CG    . GLU C 1 174 ? -2.990  16.202  10.779  1.00 22.08 ? 174  GLU C CG    1 
ATOM   4058 C  CD    . GLU C 1 174 ? -2.828  14.703  10.957  1.00 27.86 ? 174  GLU C CD    1 
ATOM   4059 O  OE1   . GLU C 1 174 ? -1.668  14.248  11.005  1.00 31.76 ? 174  GLU C OE1   1 
ATOM   4060 O  OE2   . GLU C 1 174 ? -3.839  13.977  11.049  1.00 29.18 ? 174  GLU C OE2   1 
ATOM   4061 N  N     . GLY C 1 175 ? -2.937  19.688  10.063  1.00 18.14 ? 175  GLY C N     1 
ATOM   4062 C  CA    . GLY C 1 175 ? -2.546  20.381  8.852   1.00 21.19 ? 175  GLY C CA    1 
ATOM   4063 C  C     . GLY C 1 175 ? -1.064  20.573  8.632   1.00 18.80 ? 175  GLY C C     1 
ATOM   4064 O  O     . GLY C 1 175 ? -0.242  20.296  9.505   1.00 19.37 ? 175  GLY C O     1 
ATOM   4065 N  N     . VAL C 1 176 ? -0.729  20.985  7.415   1.00 19.87 ? 176  VAL C N     1 
ATOM   4066 C  CA    . VAL C 1 176 ? 0.649   21.264  7.036   1.00 20.04 ? 176  VAL C CA    1 
ATOM   4067 C  C     . VAL C 1 176 ? 0.726   22.775  6.827   1.00 21.01 ? 176  VAL C C     1 
ATOM   4068 O  O     . VAL C 1 176 ? -0.206  23.380  6.297   1.00 20.74 ? 176  VAL C O     1 
ATOM   4069 C  CB    . VAL C 1 176 ? 1.069   20.516  5.755   1.00 22.43 ? 176  VAL C CB    1 
ATOM   4070 C  CG1   . VAL C 1 176 ? 1.130   19.015  6.024   1.00 22.34 ? 176  VAL C CG1   1 
ATOM   4071 C  CG2   . VAL C 1 176 ? 0.106   20.814  4.624   1.00 22.86 ? 176  VAL C CG2   1 
ATOM   4072 N  N     . HIS C 1 177 ? 1.818   23.378  7.281   1.00 21.55 ? 177  HIS C N     1 
ATOM   4073 C  CA    . HIS C 1 177 ? 1.995   24.823  7.183   1.00 19.72 ? 177  HIS C CA    1 
ATOM   4074 C  C     . HIS C 1 177 ? 3.085   25.203  6.198   1.00 18.21 ? 177  HIS C C     1 
ATOM   4075 O  O     . HIS C 1 177 ? 4.254   24.857  6.382   1.00 18.33 ? 177  HIS C O     1 
ATOM   4076 C  CB    . HIS C 1 177 ? 2.309   25.390  8.571   1.00 25.20 ? 177  HIS C CB    1 
ATOM   4077 C  CG    . HIS C 1 177 ? 1.273   25.059  9.601   1.00 29.62 ? 177  HIS C CG    1 
ATOM   4078 N  ND1   . HIS C 1 177 ? 0.577   26.025  10.296  1.00 30.71 ? 177  HIS C ND1   1 
ATOM   4079 C  CD2   . HIS C 1 177 ? 0.794   23.868  10.034  1.00 29.36 ? 177  HIS C CD2   1 
ATOM   4080 C  CE1   . HIS C 1 177 ? -0.287  25.444  11.109  1.00 30.75 ? 177  HIS C CE1   1 
ATOM   4081 N  NE2   . HIS C 1 177 ? -0.176  24.136  10.969  1.00 31.93 ? 177  HIS C NE2   1 
ATOM   4082 N  N     . LEU C 1 178 ? 2.697   25.919  5.148   1.00 19.50 ? 178  LEU C N     1 
ATOM   4083 C  CA    . LEU C 1 178 ? 3.654   26.338  4.135   1.00 20.10 ? 178  LEU C CA    1 
ATOM   4084 C  C     . LEU C 1 178 ? 4.710   27.294  4.667   1.00 21.19 ? 178  LEU C C     1 
ATOM   4085 O  O     . LEU C 1 178 ? 5.820   27.338  4.139   1.00 23.90 ? 178  LEU C O     1 
ATOM   4086 C  CB    . LEU C 1 178 ? 2.939   26.946  2.932   1.00 21.81 ? 178  LEU C CB    1 
ATOM   4087 C  CG    . LEU C 1 178 ? 2.175   25.934  2.077   1.00 21.94 ? 178  LEU C CG    1 
ATOM   4088 C  CD1   . LEU C 1 178 ? 1.473   26.652  0.956   1.00 22.06 ? 178  LEU C CD1   1 
ATOM   4089 C  CD2   . LEU C 1 178 ? 3.136   24.884  1.524   1.00 23.62 ? 178  LEU C CD2   1 
ATOM   4090 N  N     . CYS C 1 179 ? 4.387   28.021  5.735   1.00 23.60 ? 179  CYS C N     1 
ATOM   4091 C  CA    . CYS C 1 179 ? 5.341   28.964  6.312   1.00 25.53 ? 179  CYS C CA    1 
ATOM   4092 C  C     . CYS C 1 179 ? 6.574   28.246  6.857   1.00 27.14 ? 179  CYS C C     1 
ATOM   4093 O  O     . CYS C 1 179 ? 7.624   28.864  7.037   1.00 26.41 ? 179  CYS C O     1 
ATOM   4094 C  CB    . CYS C 1 179 ? 4.686   29.833  7.393   1.00 25.64 ? 179  CYS C CB    1 
ATOM   4095 S  SG    . CYS C 1 179 ? 4.176   28.961  8.868   1.00 27.64 ? 179  CYS C SG    1 
ATOM   4096 N  N     . MET C 1 180 ? 6.448   26.950  7.140   1.00 27.08 ? 180  MET C N     1 
ATOM   4097 C  CA    . MET C 1 180 ? 7.599   26.192  7.617   1.00 27.30 ? 180  MET C CA    1 
ATOM   4098 C  C     . MET C 1 180 ? 8.070   25.151  6.601   1.00 25.64 ? 180  MET C C     1 
ATOM   4099 O  O     . MET C 1 180 ? 9.021   24.411  6.852   1.00 27.92 ? 180  MET C O     1 
ATOM   4100 C  CB    . MET C 1 180 ? 7.364   25.582  9.009   1.00 32.00 ? 180  MET C CB    1 
ATOM   4101 C  CG    . MET C 1 180 ? 6.205   24.616  9.160   1.00 35.51 ? 180  MET C CG    1 
ATOM   4102 S  SD    . MET C 1 180 ? 6.077   24.047  10.895  1.00 38.23 ? 180  MET C SD    1 
ATOM   4103 C  CE    . MET C 1 180 ? 7.295   22.727  10.904  1.00 33.91 ? 180  MET C CE    1 
ATOM   4104 N  N     . MET C 1 181 ? 7.433   25.147  5.432   1.00 25.25 ? 181  MET C N     1 
ATOM   4105 C  CA    . MET C 1 181 ? 7.774   24.221  4.355   1.00 24.95 ? 181  MET C CA    1 
ATOM   4106 C  C     . MET C 1 181 ? 8.450   24.928  3.186   1.00 25.05 ? 181  MET C C     1 
ATOM   4107 O  O     . MET C 1 181 ? 9.480   24.464  2.687   1.00 21.74 ? 181  MET C O     1 
ATOM   4108 C  CB    . MET C 1 181 ? 6.524   23.493  3.861   1.00 25.17 ? 181  MET C CB    1 
ATOM   4109 C  CG    . MET C 1 181 ? 5.914   22.553  4.890   1.00 26.64 ? 181  MET C CG    1 
ATOM   4110 S  SD    . MET C 1 181 ? 4.353   21.853  4.342   1.00 29.95 ? 181  MET C SD    1 
ATOM   4111 C  CE    . MET C 1 181 ? 4.940   20.498  3.300   1.00 30.96 ? 181  MET C CE    1 
ATOM   4112 N  N     . MET C 1 182 ? 7.872   26.049  2.752   1.00 25.09 ? 182  MET C N     1 
ATOM   4113 C  CA    . MET C 1 182 ? 8.425   26.802  1.627   1.00 25.02 ? 182  MET C CA    1 
ATOM   4114 C  C     . MET C 1 182 ? 9.355   27.940  2.039   1.00 23.96 ? 182  MET C C     1 
ATOM   4115 O  O     . MET C 1 182 ? 9.851   28.683  1.192   1.00 23.10 ? 182  MET C O     1 
ATOM   4116 C  CB    . MET C 1 182 ? 7.309   27.313  0.706   1.00 25.98 ? 182  MET C CB    1 
ATOM   4117 C  CG    . MET C 1 182 ? 6.499   28.481  1.211   1.00 26.24 ? 182  MET C CG    1 
ATOM   4118 S  SD    . MET C 1 182 ? 5.110   28.820  0.118   1.00 29.65 ? 182  MET C SD    1 
ATOM   4119 C  CE    . MET C 1 182 ? 5.927   29.422  -1.361  1.00 26.22 ? 182  MET C CE    1 
ATOM   4120 N  N     . ARG C 1 183 ? 9.597   28.056  3.340   1.00 25.85 ? 183  ARG C N     1 
ATOM   4121 C  CA    . ARG C 1 183 ? 10.482  29.083  3.878   1.00 26.85 ? 183  ARG C CA    1 
ATOM   4122 C  C     . ARG C 1 183 ? 10.862  28.753  5.315   1.00 28.07 ? 183  ARG C C     1 
ATOM   4123 O  O     . ARG C 1 183 ? 10.441  27.726  5.857   1.00 24.61 ? 183  ARG C O     1 
ATOM   4124 C  CB    . ARG C 1 183 ? 9.823   30.465  3.812   1.00 28.69 ? 183  ARG C CB    1 
ATOM   4125 C  CG    . ARG C 1 183 ? 8.519   30.584  4.584   1.00 28.19 ? 183  ARG C CG    1 
ATOM   4126 C  CD    . ARG C 1 183 ? 8.299   32.012  5.049   1.00 28.48 ? 183  ARG C CD    1 
ATOM   4127 N  NE    . ARG C 1 183 ? 9.419   32.488  5.858   1.00 28.01 ? 183  ARG C NE    1 
ATOM   4128 C  CZ    . ARG C 1 183 ? 9.599   32.200  7.144   1.00 28.69 ? 183  ARG C CZ    1 
ATOM   4129 N  NH1   . ARG C 1 183 ? 8.728   31.436  7.792   1.00 26.58 ? 183  ARG C NH1   1 
ATOM   4130 N  NH2   . ARG C 1 183 ? 10.665  32.665  7.779   1.00 30.69 ? 183  ARG C NH2   1 
ATOM   4131 N  N     . GLY C 1 184 ? 11.675  29.617  5.922   1.00 26.17 ? 184  GLY C N     1 
ATOM   4132 C  CA    . GLY C 1 184 ? 12.101  29.403  7.294   1.00 24.94 ? 184  GLY C CA    1 
ATOM   4133 C  C     . GLY C 1 184 ? 12.895  28.122  7.458   1.00 24.79 ? 184  GLY C C     1 
ATOM   4134 O  O     . GLY C 1 184 ? 13.909  27.927  6.789   1.00 25.82 ? 184  GLY C O     1 
ATOM   4135 N  N     . VAL C 1 185 ? 12.423  27.241  8.335   1.00 25.16 ? 185  VAL C N     1 
ATOM   4136 C  CA    . VAL C 1 185 ? 13.093  25.967  8.588   1.00 24.98 ? 185  VAL C CA    1 
ATOM   4137 C  C     . VAL C 1 185 ? 13.045  25.029  7.384   1.00 24.29 ? 185  VAL C C     1 
ATOM   4138 O  O     . VAL C 1 185 ? 13.886  24.139  7.246   1.00 24.12 ? 185  VAL C O     1 
ATOM   4139 C  CB    . VAL C 1 185 ? 12.492  25.240  9.807   1.00 25.17 ? 185  VAL C CB    1 
ATOM   4140 C  CG1   . VAL C 1 185 ? 12.741  26.044  11.066  1.00 29.08 ? 185  VAL C CG1   1 
ATOM   4141 C  CG2   . VAL C 1 185 ? 10.999  25.008  9.610   1.00 21.72 ? 185  VAL C CG2   1 
ATOM   4142 N  N     . GLU C 1 186 ? 12.065  25.246  6.512   1.00 23.59 ? 186  GLU C N     1 
ATOM   4143 C  CA    . GLU C 1 186 ? 11.890  24.434  5.311   1.00 24.76 ? 186  GLU C CA    1 
ATOM   4144 C  C     . GLU C 1 186 ? 11.796  22.927  5.582   1.00 24.69 ? 186  GLU C C     1 
ATOM   4145 O  O     . GLU C 1 186 ? 12.357  22.115  4.843   1.00 22.47 ? 186  GLU C O     1 
ATOM   4146 C  CB    . GLU C 1 186 ? 12.994  24.736  4.290   1.00 22.68 ? 186  GLU C CB    1 
ATOM   4147 C  CG    . GLU C 1 186 ? 12.985  26.174  3.788   1.00 24.01 ? 186  GLU C CG    1 
ATOM   4148 C  CD    . GLU C 1 186 ? 14.033  26.430  2.726   1.00 25.96 ? 186  GLU C CD    1 
ATOM   4149 O  OE1   . GLU C 1 186 ? 13.889  25.897  1.609   1.00 23.94 ? 186  GLU C OE1   1 
ATOM   4150 O  OE2   . GLU C 1 186 ? 15.001  27.164  3.007   1.00 25.55 ? 186  GLU C OE2   1 
ATOM   4151 N  N     . LYS C 1 187 ? 11.106  22.563  6.660   1.00 20.37 ? 187  LYS C N     1 
ATOM   4152 C  CA    . LYS C 1 187 ? 10.913  21.154  6.998   1.00 22.22 ? 187  LYS C CA    1 
ATOM   4153 C  C     . LYS C 1 187 ? 9.852   20.623  6.045   1.00 20.21 ? 187  LYS C C     1 
ATOM   4154 O  O     . LYS C 1 187 ? 8.882   21.321  5.740   1.00 21.08 ? 187  LYS C O     1 
ATOM   4155 C  CB    . LYS C 1 187 ? 10.472  20.991  8.452   1.00 21.46 ? 187  LYS C CB    1 
ATOM   4156 C  CG    . LYS C 1 187 ? 11.573  21.271  9.471   1.00 21.77 ? 187  LYS C CG    1 
ATOM   4157 C  CD    . LYS C 1 187 ? 12.744  20.301  9.346   1.00 21.09 ? 187  LYS C CD    1 
ATOM   4158 C  CE    . LYS C 1 187 ? 13.825  20.610  10.370  1.00 24.78 ? 187  LYS C CE    1 
ATOM   4159 N  NZ    . LYS C 1 187 ? 15.041  19.755  10.221  1.00 25.13 ? 187  LYS C NZ    1 
ATOM   4160 N  N     . GLN C 1 188 ? 10.031  19.388  5.585   1.00 18.96 ? 188  GLN C N     1 
ATOM   4161 C  CA    . GLN C 1 188 ? 9.119   18.790  4.615   1.00 19.20 ? 188  GLN C CA    1 
ATOM   4162 C  C     . GLN C 1 188 ? 8.143   17.709  5.085   1.00 19.10 ? 188  GLN C C     1 
ATOM   4163 O  O     . GLN C 1 188 ? 7.059   17.570  4.519   1.00 18.27 ? 188  GLN C O     1 
ATOM   4164 C  CB    . GLN C 1 188 ? 9.937   18.238  3.444   1.00 18.31 ? 188  GLN C CB    1 
ATOM   4165 C  CG    . GLN C 1 188 ? 10.867  19.261  2.809   1.00 19.11 ? 188  GLN C CG    1 
ATOM   4166 C  CD    . GLN C 1 188 ? 10.106  20.417  2.194   1.00 20.88 ? 188  GLN C CD    1 
ATOM   4167 O  OE1   . GLN C 1 188 ? 9.207   20.212  1.386   1.00 19.52 ? 188  GLN C OE1   1 
ATOM   4168 N  NE2   . GLN C 1 188 ? 10.455  21.639  2.585   1.00 23.31 ? 188  GLN C NE2   1 
ATOM   4169 N  N     . HIS C 1 189 ? 8.518   16.950  6.109   1.00 18.20 ? 189  HIS C N     1 
ATOM   4170 C  CA    . HIS C 1 189 ? 7.677   15.852  6.586   1.00 18.72 ? 189  HIS C CA    1 
ATOM   4171 C  C     . HIS C 1 189 ? 6.765   16.154  7.769   1.00 18.44 ? 189  HIS C C     1 
ATOM   4172 O  O     . HIS C 1 189 ? 6.008   15.283  8.198   1.00 18.72 ? 189  HIS C O     1 
ATOM   4173 C  CB    . HIS C 1 189 ? 8.560   14.653  6.956   1.00 20.31 ? 189  HIS C CB    1 
ATOM   4174 C  CG    . HIS C 1 189 ? 9.357   14.106  5.815   1.00 23.87 ? 189  HIS C CG    1 
ATOM   4175 N  ND1   . HIS C 1 189 ? 8.781   13.427  4.762   1.00 26.81 ? 189  HIS C ND1   1 
ATOM   4176 C  CD2   . HIS C 1 189 ? 10.690  14.112  5.575   1.00 24.76 ? 189  HIS C CD2   1 
ATOM   4177 C  CE1   . HIS C 1 189 ? 9.726   13.037  3.924   1.00 27.17 ? 189  HIS C CE1   1 
ATOM   4178 N  NE2   . HIS C 1 189 ? 10.893  13.440  4.394   1.00 24.82 ? 189  HIS C NE2   1 
ATOM   4179 N  N     . SER C 1 190 ? 6.812   17.379  8.281   1.00 17.48 ? 190  SER C N     1 
ATOM   4180 C  CA    . SER C 1 190 ? 6.016   17.736  9.456   1.00 18.54 ? 190  SER C CA    1 
ATOM   4181 C  C     . SER C 1 190 ? 4.532   18.048  9.262   1.00 16.69 ? 190  SER C C     1 
ATOM   4182 O  O     . SER C 1 190 ? 4.129   18.635  8.259   1.00 17.27 ? 190  SER C O     1 
ATOM   4183 C  CB    . SER C 1 190 ? 6.693   18.885  10.211  1.00 19.50 ? 190  SER C CB    1 
ATOM   4184 O  OG    . SER C 1 190 ? 6.021   19.142  11.429  1.00 25.45 ? 190  SER C OG    1 
ATOM   4185 N  N     . ARG C 1 191 ? 3.731   17.627  10.241  1.00 17.42 ? 191  ARG C N     1 
ATOM   4186 C  CA    . ARG C 1 191 ? 2.284   17.869  10.261  1.00 19.83 ? 191  ARG C CA    1 
ATOM   4187 C  C     . ARG C 1 191 ? 1.937   18.232  11.700  1.00 19.12 ? 191  ARG C C     1 
ATOM   4188 O  O     . ARG C 1 191 ? 2.525   17.693  12.632  1.00 18.74 ? 191  ARG C O     1 
ATOM   4189 C  CB    . ARG C 1 191 ? 1.489   16.618  9.869   1.00 24.09 ? 191  ARG C CB    1 
ATOM   4190 C  CG    . ARG C 1 191 ? 1.819   16.043  8.505   1.00 32.32 ? 191  ARG C CG    1 
ATOM   4191 C  CD    . ARG C 1 191 ? 0.699   15.130  8.010   1.00 38.20 ? 191  ARG C CD    1 
ATOM   4192 N  NE    . ARG C 1 191 ? 0.342   14.080  8.965   1.00 42.87 ? 191  ARG C NE    1 
ATOM   4193 C  CZ    . ARG C 1 191 ? 1.013   12.940  9.123   1.00 46.19 ? 191  ARG C CZ    1 
ATOM   4194 N  NH1   . ARG C 1 191 ? 2.094   12.690  8.393   1.00 43.64 ? 191  ARG C NH1   1 
ATOM   4195 N  NH2   . ARG C 1 191 ? 0.584   12.034  9.992   1.00 46.15 ? 191  ARG C NH2   1 
ATOM   4196 N  N     . THR C 1 192 ? 0.971   19.124  11.880  1.00 20.01 ? 192  THR C N     1 
ATOM   4197 C  CA    . THR C 1 192 ? 0.581   19.535  13.218  1.00 20.19 ? 192  THR C CA    1 
ATOM   4198 C  C     . THR C 1 192 ? -0.852  19.178  13.550  1.00 18.26 ? 192  THR C C     1 
ATOM   4199 O  O     . THR C 1 192 ? -1.760  19.394  12.751  1.00 19.52 ? 192  THR C O     1 
ATOM   4200 C  CB    . THR C 1 192 ? 0.759   21.051  13.419  1.00 21.44 ? 192  THR C CB    1 
ATOM   4201 O  OG1   . THR C 1 192 ? 2.136   21.400  13.230  1.00 20.29 ? 192  THR C OG1   1 
ATOM   4202 C  CG2   . THR C 1 192 ? 0.319   21.461  14.831  1.00 21.11 ? 192  THR C CG2   1 
ATOM   4203 N  N     . VAL C 1 193 ? -1.041  18.646  14.753  1.00 18.68 ? 193  VAL C N     1 
ATOM   4204 C  CA    . VAL C 1 193 ? -2.356  18.271  15.237  1.00 18.07 ? 193  VAL C CA    1 
ATOM   4205 C  C     . VAL C 1 193 ? -2.719  19.129  16.442  1.00 17.54 ? 193  VAL C C     1 
ATOM   4206 O  O     . VAL C 1 193 ? -1.915  19.314  17.359  1.00 17.44 ? 193  VAL C O     1 
ATOM   4207 C  CB    . VAL C 1 193 ? -2.407  16.781  15.655  1.00 19.62 ? 193  VAL C CB    1 
ATOM   4208 C  CG1   . VAL C 1 193 ? -3.754  16.449  16.297  1.00 20.59 ? 193  VAL C CG1   1 
ATOM   4209 C  CG2   . VAL C 1 193 ? -2.182  15.890  14.442  1.00 19.97 ? 193  VAL C CG2   1 
ATOM   4210 N  N     . THR C 1 194 ? -3.906  19.714  16.388  1.00 19.67 ? 194  THR C N     1 
ATOM   4211 C  CA    . THR C 1 194 ? -4.424  20.522  17.485  1.00 20.41 ? 194  THR C CA    1 
ATOM   4212 C  C     . THR C 1 194 ? -5.832  20.000  17.720  1.00 21.79 ? 194  THR C C     1 
ATOM   4213 O  O     . THR C 1 194 ? -6.427  19.392  16.833  1.00 20.64 ? 194  THR C O     1 
ATOM   4214 C  CB    . THR C 1 194 ? -4.489  22.023  17.137  1.00 18.14 ? 194  THR C CB    1 
ATOM   4215 O  OG1   . THR C 1 194 ? -5.314  22.214  15.984  1.00 20.18 ? 194  THR C OG1   1 
ATOM   4216 C  CG2   . THR C 1 194 ? -3.089  22.578  16.867  1.00 19.82 ? 194  THR C CG2   1 
ATOM   4217 N  N     . SER C 1 195 ? -6.371  20.233  18.908  1.00 22.06 ? 195  SER C N     1 
ATOM   4218 C  CA    . SER C 1 195 ? -7.709  19.751  19.195  1.00 22.75 ? 195  SER C CA    1 
ATOM   4219 C  C     . SER C 1 195 ? -8.422  20.569  20.249  1.00 21.84 ? 195  SER C C     1 
ATOM   4220 O  O     . SER C 1 195 ? -7.838  21.458  20.875  1.00 20.91 ? 195  SER C O     1 
ATOM   4221 C  CB    . SER C 1 195 ? -7.666  18.284  19.630  1.00 24.43 ? 195  SER C CB    1 
ATOM   4222 O  OG    . SER C 1 195 ? -6.897  18.126  20.805  1.00 25.83 ? 195  SER C OG    1 
ATOM   4223 N  N     . ALA C 1 196 ? -9.700  20.258  20.419  1.00 20.03 ? 196  ALA C N     1 
ATOM   4224 C  CA    . ALA C 1 196 ? -10.550 20.920  21.396  1.00 23.22 ? 196  ALA C CA    1 
ATOM   4225 C  C     . ALA C 1 196 ? -11.592 19.906  21.830  1.00 22.17 ? 196  ALA C C     1 
ATOM   4226 O  O     . ALA C 1 196 ? -12.271 19.309  20.998  1.00 21.72 ? 196  ALA C O     1 
ATOM   4227 C  CB    . ALA C 1 196 ? -11.217 22.140  20.782  1.00 18.71 ? 196  ALA C CB    1 
ATOM   4228 N  N     . MET C 1 197 ? -11.688 19.695  23.138  1.00 24.80 ? 197  MET C N     1 
ATOM   4229 C  CA    . MET C 1 197 ? -12.635 18.742  23.699  1.00 26.25 ? 197  MET C CA    1 
ATOM   4230 C  C     . MET C 1 197 ? -13.544 19.459  24.687  1.00 26.52 ? 197  MET C C     1 
ATOM   4231 O  O     . MET C 1 197 ? -13.068 20.104  25.620  1.00 29.62 ? 197  MET C O     1 
ATOM   4232 C  CB    . MET C 1 197 ? -11.883 17.618  24.413  1.00 26.35 ? 197  MET C CB    1 
ATOM   4233 C  CG    . MET C 1 197 ? -10.912 16.845  23.536  1.00 26.21 ? 197  MET C CG    1 
ATOM   4234 S  SD    . MET C 1 197 ? -11.742 15.798  22.334  1.00 24.64 ? 197  MET C SD    1 
ATOM   4235 C  CE    . MET C 1 197 ? -10.388 15.477  21.182  1.00 27.80 ? 197  MET C CE    1 
ATOM   4236 N  N     . LEU C 1 198 ? -14.850 19.345  24.469  1.00 27.96 ? 198  LEU C N     1 
ATOM   4237 C  CA    . LEU C 1 198 ? -15.847 19.983  25.324  1.00 26.40 ? 198  LEU C CA    1 
ATOM   4238 C  C     . LEU C 1 198 ? -16.843 18.952  25.843  1.00 27.08 ? 198  LEU C C     1 
ATOM   4239 O  O     . LEU C 1 198 ? -17.067 17.922  25.207  1.00 25.79 ? 198  LEU C O     1 
ATOM   4240 C  CB    . LEU C 1 198 ? -16.601 21.059  24.538  1.00 26.79 ? 198  LEU C CB    1 
ATOM   4241 C  CG    . LEU C 1 198 ? -15.782 22.193  23.920  1.00 29.91 ? 198  LEU C CG    1 
ATOM   4242 C  CD1   . LEU C 1 198 ? -16.689 23.104  23.111  1.00 26.82 ? 198  LEU C CD1   1 
ATOM   4243 C  CD2   . LEU C 1 198 ? -15.064 22.974  25.012  1.00 31.26 ? 198  LEU C CD2   1 
ATOM   4244 N  N     . GLY C 1 199 ? -17.438 19.238  27.001  1.00 28.61 ? 199  GLY C N     1 
ATOM   4245 C  CA    . GLY C 1 199 ? -18.412 18.335  27.590  1.00 27.43 ? 199  GLY C CA    1 
ATOM   4246 C  C     . GLY C 1 199 ? -17.859 16.963  27.921  1.00 27.25 ? 199  GLY C C     1 
ATOM   4247 O  O     . GLY C 1 199 ? -16.774 16.846  28.492  1.00 27.30 ? 199  GLY C O     1 
ATOM   4248 N  N     . VAL C 1 200 ? -18.597 15.923  27.544  1.00 28.95 ? 200  VAL C N     1 
ATOM   4249 C  CA    . VAL C 1 200 ? -18.181 14.548  27.806  1.00 29.60 ? 200  VAL C CA    1 
ATOM   4250 C  C     . VAL C 1 200 ? -16.873 14.166  27.113  1.00 30.52 ? 200  VAL C C     1 
ATOM   4251 O  O     . VAL C 1 200 ? -16.212 13.213  27.519  1.00 31.68 ? 200  VAL C O     1 
ATOM   4252 C  CB    . VAL C 1 200 ? -19.284 13.526  27.435  1.00 30.92 ? 200  VAL C CB    1 
ATOM   4253 C  CG1   . VAL C 1 200 ? -20.506 13.733  28.313  1.00 34.27 ? 200  VAL C CG1   1 
ATOM   4254 C  CG2   . VAL C 1 200 ? -19.658 13.640  25.968  1.00 29.67 ? 200  VAL C CG2   1 
ATOM   4255 N  N     . PHE C 1 201 ? -16.511 14.896  26.062  1.00 28.01 ? 201  PHE C N     1 
ATOM   4256 C  CA    . PHE C 1 201 ? -15.266 14.625  25.353  1.00 29.95 ? 201  PHE C CA    1 
ATOM   4257 C  C     . PHE C 1 201 ? -14.057 15.077  26.170  1.00 32.52 ? 201  PHE C C     1 
ATOM   4258 O  O     . PHE C 1 201 ? -12.949 14.572  25.984  1.00 33.80 ? 201  PHE C O     1 
ATOM   4259 C  CB    . PHE C 1 201 ? -15.272 15.283  23.969  1.00 24.59 ? 201  PHE C CB    1 
ATOM   4260 C  CG    . PHE C 1 201 ? -16.035 14.503  22.938  1.00 25.33 ? 201  PHE C CG    1 
ATOM   4261 C  CD1   . PHE C 1 201 ? -15.382 13.963  21.833  1.00 23.86 ? 201  PHE C CD1   1 
ATOM   4262 C  CD2   . PHE C 1 201 ? -17.401 14.288  23.078  1.00 22.64 ? 201  PHE C CD2   1 
ATOM   4263 C  CE1   . PHE C 1 201 ? -16.081 13.219  20.885  1.00 23.68 ? 201  PHE C CE1   1 
ATOM   4264 C  CE2   . PHE C 1 201 ? -18.108 13.547  22.136  1.00 25.91 ? 201  PHE C CE2   1 
ATOM   4265 C  CZ    . PHE C 1 201 ? -17.445 13.011  21.036  1.00 23.34 ? 201  PHE C CZ    1 
ATOM   4266 N  N     . ARG C 1 202 ? -14.275 16.028  27.075  1.00 34.34 ? 202  ARG C N     1 
ATOM   4267 C  CA    . ARG C 1 202 ? -13.207 16.521  27.938  1.00 36.84 ? 202  ARG C CA    1 
ATOM   4268 C  C     . ARG C 1 202 ? -13.227 15.752  29.257  1.00 37.95 ? 202  ARG C C     1 
ATOM   4269 O  O     . ARG C 1 202 ? -12.181 15.355  29.771  1.00 36.87 ? 202  ARG C O     1 
ATOM   4270 C  CB    . ARG C 1 202 ? -13.381 18.018  28.213  1.00 39.30 ? 202  ARG C CB    1 
ATOM   4271 C  CG    . ARG C 1 202 ? -12.357 18.596  29.188  1.00 43.51 ? 202  ARG C CG    1 
ATOM   4272 C  CD    . ARG C 1 202 ? -12.618 20.068  29.487  1.00 48.62 ? 202  ARG C CD    1 
ATOM   4273 N  NE    . ARG C 1 202 ? -12.302 20.933  28.352  1.00 53.59 ? 202  ARG C NE    1 
ATOM   4274 C  CZ    . ARG C 1 202 ? -12.748 22.179  28.206  1.00 55.32 ? 202  ARG C CZ    1 
ATOM   4275 N  NH1   . ARG C 1 202 ? -13.539 22.722  29.123  1.00 56.30 ? 202  ARG C NH1   1 
ATOM   4276 N  NH2   . ARG C 1 202 ? -12.399 22.887  27.139  1.00 55.37 ? 202  ARG C NH2   1 
ATOM   4277 N  N     . GLU C 1 203 ? -14.434 15.523  29.768  1.00 39.93 ? 203  GLU C N     1 
ATOM   4278 C  CA    . GLU C 1 203 ? -14.659 14.823  31.031  1.00 42.19 ? 203  GLU C CA    1 
ATOM   4279 C  C     . GLU C 1 203 ? -14.373 13.327  30.989  1.00 42.81 ? 203  GLU C C     1 
ATOM   4280 O  O     . GLU C 1 203 ? -13.547 12.820  31.751  1.00 43.21 ? 203  GLU C O     1 
ATOM   4281 C  CB    . GLU C 1 203 ? -16.111 15.017  31.480  1.00 44.46 ? 203  GLU C CB    1 
ATOM   4282 C  CG    . GLU C 1 203 ? -16.530 16.457  31.684  1.00 48.43 ? 203  GLU C CG    1 
ATOM   4283 C  CD    . GLU C 1 203 ? -15.752 17.131  32.790  1.00 51.43 ? 203  GLU C CD    1 
ATOM   4284 O  OE1   . GLU C 1 203 ? -14.969 18.056  32.483  1.00 55.23 ? 203  GLU C OE1   1 
ATOM   4285 O  OE2   . GLU C 1 203 ? -15.920 16.732  33.964  1.00 53.76 ? 203  GLU C OE2   1 
ATOM   4286 N  N     . ASN C 1 204 ? -15.100 12.628  30.122  1.00 40.76 ? 204  ASN C N     1 
ATOM   4287 C  CA    . ASN C 1 204 ? -14.984 11.184  29.980  1.00 39.44 ? 204  ASN C CA    1 
ATOM   4288 C  C     . ASN C 1 204 ? -13.774 10.743  29.156  1.00 38.22 ? 204  ASN C C     1 
ATOM   4289 O  O     . ASN C 1 204 ? -13.694 10.992  27.953  1.00 34.68 ? 204  ASN C O     1 
ATOM   4290 C  CB    . ASN C 1 204 ? -16.280 10.627  29.380  1.00 40.80 ? 204  ASN C CB    1 
ATOM   4291 C  CG    . ASN C 1 204 ? -16.388 9.118   29.500  1.00 45.02 ? 204  ASN C CG    1 
ATOM   4292 O  OD1   . ASN C 1 204 ? -15.399 8.394   29.380  1.00 45.20 ? 204  ASN C OD1   1 
ATOM   4293 N  ND2   . ASN C 1 204 ? -17.604 8.633   29.723  1.00 47.44 ? 204  ASN C ND2   1 
ATOM   4294 N  N     . GLN C 1 205 ? -12.857 10.051  29.825  1.00 37.29 ? 205  GLN C N     1 
ATOM   4295 C  CA    . GLN C 1 205 ? -11.636 9.535   29.219  1.00 36.50 ? 205  GLN C CA    1 
ATOM   4296 C  C     . GLN C 1 205 ? -11.938 8.549   28.088  1.00 34.70 ? 205  GLN C C     1 
ATOM   4297 O  O     . GLN C 1 205 ? -11.353 8.637   27.008  1.00 32.15 ? 205  GLN C O     1 
ATOM   4298 C  CB    . GLN C 1 205 ? -10.793 8.849   30.302  1.00 39.79 ? 205  GLN C CB    1 
ATOM   4299 C  CG    . GLN C 1 205 ? -9.530  8.158   29.810  1.00 44.01 ? 205  GLN C CG    1 
ATOM   4300 C  CD    . GLN C 1 205 ? -8.519  9.120   29.225  1.00 45.75 ? 205  GLN C CD    1 
ATOM   4301 O  OE1   . GLN C 1 205 ? -7.922  8.849   28.185  1.00 46.82 ? 205  GLN C OE1   1 
ATOM   4302 N  NE2   . GLN C 1 205 ? -8.315  10.249  29.896  1.00 48.17 ? 205  GLN C NE2   1 
ATOM   4303 N  N     . LYS C 1 206 ? -12.864 7.626   28.348  1.00 31.95 ? 206  LYS C N     1 
ATOM   4304 C  CA    . LYS C 1 206 ? -13.264 6.602   27.385  1.00 31.23 ? 206  LYS C CA    1 
ATOM   4305 C  C     . LYS C 1 206 ? -13.926 7.182   26.140  1.00 28.05 ? 206  LYS C C     1 
ATOM   4306 O  O     . LYS C 1 206 ? -13.774 6.646   25.042  1.00 22.78 ? 206  LYS C O     1 
ATOM   4307 C  CB    . LYS C 1 206 ? -14.216 5.597   28.042  1.00 34.38 ? 206  LYS C CB    1 
ATOM   4308 C  CG    . LYS C 1 206 ? -13.637 4.865   29.249  1.00 39.39 ? 206  LYS C CG    1 
ATOM   4309 C  CD    . LYS C 1 206 ? -12.473 3.971   28.859  1.00 42.48 ? 206  LYS C CD    1 
ATOM   4310 C  CE    . LYS C 1 206 ? -11.967 3.166   30.050  1.00 46.54 ? 206  LYS C CE    1 
ATOM   4311 N  NZ    . LYS C 1 206 ? -11.462 4.040   31.149  1.00 47.92 ? 206  LYS C NZ    1 
ATOM   4312 N  N     . THR C 1 207 ? -14.688 8.256   26.318  1.00 27.61 ? 207  THR C N     1 
ATOM   4313 C  CA    . THR C 1 207 ? -15.363 8.889   25.192  1.00 26.51 ? 207  THR C CA    1 
ATOM   4314 C  C     . THR C 1 207 ? -14.348 9.520   24.245  1.00 25.27 ? 207  THR C C     1 
ATOM   4315 O  O     . THR C 1 207 ? -14.433 9.337   23.031  1.00 23.94 ? 207  THR C O     1 
ATOM   4316 C  CB    . THR C 1 207 ? -16.383 9.952   25.662  1.00 28.83 ? 207  THR C CB    1 
ATOM   4317 O  OG1   . THR C 1 207 ? -17.418 9.313   26.419  1.00 30.05 ? 207  THR C OG1   1 
ATOM   4318 C  CG2   . THR C 1 207 ? -17.011 10.658  24.470  1.00 26.20 ? 207  THR C CG2   1 
ATOM   4319 N  N     . ARG C 1 208 ? -13.390 10.255  24.804  1.00 23.60 ? 208  ARG C N     1 
ATOM   4320 C  CA    . ARG C 1 208 ? -12.358 10.898  24.001  1.00 24.89 ? 208  ARG C CA    1 
ATOM   4321 C  C     . ARG C 1 208 ? -11.539 9.844   23.260  1.00 23.87 ? 208  ARG C C     1 
ATOM   4322 O  O     . ARG C 1 208 ? -11.258 9.999   22.073  1.00 22.70 ? 208  ARG C O     1 
ATOM   4323 C  CB    . ARG C 1 208 ? -11.449 11.770  24.879  1.00 26.10 ? 208  ARG C CB    1 
ATOM   4324 C  CG    . ARG C 1 208 ? -10.392 12.546  24.093  1.00 29.77 ? 208  ARG C CG    1 
ATOM   4325 C  CD    . ARG C 1 208 ? -9.729  13.641  24.924  1.00 32.13 ? 208  ARG C CD    1 
ATOM   4326 N  NE    . ARG C 1 208 ? -8.975  13.119  26.062  1.00 33.62 ? 208  ARG C NE    1 
ATOM   4327 C  CZ    . ARG C 1 208 ? -9.402  13.141  27.322  1.00 34.96 ? 208  ARG C CZ    1 
ATOM   4328 N  NH1   . ARG C 1 208 ? -10.587 13.658  27.620  1.00 35.70 ? 208  ARG C NH1   1 
ATOM   4329 N  NH2   . ARG C 1 208 ? -8.639  12.648  28.288  1.00 36.08 ? 208  ARG C NH2   1 
ATOM   4330 N  N     . GLU C 1 209 ? -11.193 8.764   23.959  1.00 24.17 ? 209  GLU C N     1 
ATOM   4331 C  CA    . GLU C 1 209 ? -10.417 7.672   23.373  1.00 26.08 ? 209  GLU C CA    1 
ATOM   4332 C  C     . GLU C 1 209 ? -11.158 7.046   22.200  1.00 23.67 ? 209  GLU C C     1 
ATOM   4333 O  O     . GLU C 1 209 ? -10.580 6.829   21.131  1.00 21.09 ? 209  GLU C O     1 
ATOM   4334 C  CB    . GLU C 1 209 ? -10.122 6.589   24.416  1.00 32.09 ? 209  GLU C CB    1 
ATOM   4335 C  CG    . GLU C 1 209 ? -9.100  6.976   25.469  1.00 39.57 ? 209  GLU C CG    1 
ATOM   4336 C  CD    . GLU C 1 209 ? -8.678  5.801   26.336  1.00 43.14 ? 209  GLU C CD    1 
ATOM   4337 O  OE1   . GLU C 1 209 ? -8.478  6.001   27.554  1.00 44.47 ? 209  GLU C OE1   1 
ATOM   4338 O  OE2   . GLU C 1 209 ? -8.537  4.680   25.799  1.00 43.29 ? 209  GLU C OE2   1 
ATOM   4339 N  N     . GLU C 1 210 ? -12.441 6.759   22.405  1.00 20.28 ? 210  GLU C N     1 
ATOM   4340 C  CA    . GLU C 1 210 ? -13.268 6.161   21.365  1.00 20.65 ? 210  GLU C CA    1 
ATOM   4341 C  C     . GLU C 1 210 ? -13.314 7.052   20.120  1.00 21.14 ? 210  GLU C C     1 
ATOM   4342 O  O     . GLU C 1 210 ? -13.241 6.558   18.994  1.00 20.20 ? 210  GLU C O     1 
ATOM   4343 C  CB    . GLU C 1 210 ? -14.681 5.906   21.894  1.00 21.91 ? 210  GLU C CB    1 
ATOM   4344 C  CG    . GLU C 1 210 ? -15.607 5.245   20.890  1.00 23.93 ? 210  GLU C CG    1 
ATOM   4345 C  CD    . GLU C 1 210 ? -16.931 4.841   21.503  1.00 26.25 ? 210  GLU C CD    1 
ATOM   4346 O  OE1   . GLU C 1 210 ? -16.926 4.004   22.426  1.00 25.48 ? 210  GLU C OE1   1 
ATOM   4347 O  OE2   . GLU C 1 210 ? -17.976 5.360   21.063  1.00 28.42 ? 210  GLU C OE2   1 
ATOM   4348 N  N     . PHE C 1 211 ? -13.428 8.364   20.329  1.00 21.72 ? 211  PHE C N     1 
ATOM   4349 C  CA    . PHE C 1 211 ? -13.465 9.328   19.226  1.00 21.73 ? 211  PHE C CA    1 
ATOM   4350 C  C     . PHE C 1 211 ? -12.141 9.303   18.466  1.00 22.07 ? 211  PHE C C     1 
ATOM   4351 O  O     . PHE C 1 211 ? -12.119 9.185   17.240  1.00 21.80 ? 211  PHE C O     1 
ATOM   4352 C  CB    . PHE C 1 211 ? -13.736 10.739  19.774  1.00 23.10 ? 211  PHE C CB    1 
ATOM   4353 C  CG    . PHE C 1 211 ? -13.490 11.854  18.782  1.00 19.97 ? 211  PHE C CG    1 
ATOM   4354 C  CD1   . PHE C 1 211 ? -12.723 12.961  19.148  1.00 19.41 ? 211  PHE C CD1   1 
ATOM   4355 C  CD2   . PHE C 1 211 ? -14.035 11.814  17.500  1.00 20.49 ? 211  PHE C CD2   1 
ATOM   4356 C  CE1   . PHE C 1 211 ? -12.502 14.013  18.251  1.00 20.02 ? 211  PHE C CE1   1 
ATOM   4357 C  CE2   . PHE C 1 211 ? -13.821 12.858  16.593  1.00 16.93 ? 211  PHE C CE2   1 
ATOM   4358 C  CZ    . PHE C 1 211 ? -13.051 13.963  16.972  1.00 15.79 ? 211  PHE C CZ    1 
ATOM   4359 N  N     . LEU C 1 212 ? -11.040 9.395   19.205  1.00 22.51 ? 212  LEU C N     1 
ATOM   4360 C  CA    . LEU C 1 212 ? -9.714  9.390   18.601  1.00 23.65 ? 212  LEU C CA    1 
ATOM   4361 C  C     . LEU C 1 212 ? -9.400  8.075   17.882  1.00 24.17 ? 212  LEU C C     1 
ATOM   4362 O  O     . LEU C 1 212 ? -8.717  8.078   16.858  1.00 23.98 ? 212  LEU C O     1 
ATOM   4363 C  CB    . LEU C 1 212 ? -8.649  9.723   19.650  1.00 22.64 ? 212  LEU C CB    1 
ATOM   4364 C  CG    . LEU C 1 212 ? -8.821  11.125  20.257  1.00 24.59 ? 212  LEU C CG    1 
ATOM   4365 C  CD1   . LEU C 1 212 ? -7.770  11.394  21.322  1.00 19.91 ? 212  LEU C CD1   1 
ATOM   4366 C  CD2   . LEU C 1 212 ? -8.762  12.182  19.160  1.00 21.36 ? 212  LEU C CD2   1 
ATOM   4367 N  N     . SER C 1 213 ? -9.930  6.965   18.397  1.00 22.12 ? 213  SER C N     1 
ATOM   4368 C  CA    . SER C 1 213 ? -9.716  5.652   17.788  1.00 23.74 ? 213  SER C CA    1 
ATOM   4369 C  C     . SER C 1 213 ? -10.412 5.547   16.436  1.00 22.12 ? 213  SER C C     1 
ATOM   4370 O  O     . SER C 1 213 ? -9.922  4.875   15.531  1.00 22.57 ? 213  SER C O     1 
ATOM   4371 C  CB    . SER C 1 213 ? -10.194 4.530   18.711  1.00 23.18 ? 213  SER C CB    1 
ATOM   4372 O  OG    . SER C 1 213 ? -9.286  4.330   19.780  1.00 26.93 ? 213  SER C OG    1 
ATOM   4373 N  N     . HIS C 1 214 ? -11.556 6.216   16.302  1.00 22.74 ? 214  HIS C N     1 
ATOM   4374 C  CA    . HIS C 1 214 ? -12.298 6.208   15.042  1.00 19.20 ? 214  HIS C CA    1 
ATOM   4375 C  C     . HIS C 1 214 ? -11.500 6.891   13.938  1.00 21.79 ? 214  HIS C C     1 
ATOM   4376 O  O     . HIS C 1 214 ? -11.649 6.562   12.764  1.00 18.96 ? 214  HIS C O     1 
ATOM   4377 C  CB    . HIS C 1 214 ? -13.649 6.914   15.198  1.00 16.12 ? 214  HIS C CB    1 
ATOM   4378 C  CG    . HIS C 1 214 ? -14.755 6.017   15.661  1.00 16.71 ? 214  HIS C CG    1 
ATOM   4379 N  ND1   . HIS C 1 214 ? -15.129 4.884   14.973  1.00 15.58 ? 214  HIS C ND1   1 
ATOM   4380 C  CD2   . HIS C 1 214 ? -15.578 6.094   16.734  1.00 16.78 ? 214  HIS C CD2   1 
ATOM   4381 C  CE1   . HIS C 1 214 ? -16.135 4.300   15.600  1.00 18.47 ? 214  HIS C CE1   1 
ATOM   4382 N  NE2   . HIS C 1 214 ? -16.426 5.014   16.673  1.00 18.44 ? 214  HIS C NE2   1 
ATOM   4383 N  N     . LEU C 1 215 ? -10.656 7.846   14.321  1.00 22.83 ? 215  LEU C N     1 
ATOM   4384 C  CA    . LEU C 1 215 ? -9.840  8.585   13.359  1.00 26.05 ? 215  LEU C CA    1 
ATOM   4385 C  C     . LEU C 1 215 ? -8.660  7.767   12.856  1.00 29.33 ? 215  LEU C C     1 
ATOM   4386 O  O     . LEU C 1 215 ? -8.134  8.021   11.771  1.00 32.35 ? 215  LEU C O     1 
ATOM   4387 C  CB    . LEU C 1 215 ? -9.339  9.892   13.981  1.00 25.06 ? 215  LEU C CB    1 
ATOM   4388 C  CG    . LEU C 1 215 ? -10.437 10.812  14.525  1.00 23.87 ? 215  LEU C CG    1 
ATOM   4389 C  CD1   . LEU C 1 215 ? -9.824  12.128  14.985  1.00 22.15 ? 215  LEU C CD1   1 
ATOM   4390 C  CD2   . LEU C 1 215 ? -11.488 11.056  13.457  1.00 22.51 ? 215  LEU C CD2   1 
ATOM   4391 N  N     . ARG C 1 216 ? -8.254  6.784   13.654  1.00 31.16 ? 216  ARG C N     1 
ATOM   4392 C  CA    . ARG C 1 216 ? -7.138  5.913   13.311  1.00 33.89 ? 216  ARG C CA    1 
ATOM   4393 C  C     . ARG C 1 216 ? -7.582  4.864   12.288  1.00 35.64 ? 216  ARG C C     1 
ATOM   4394 O  O     . ARG C 1 216 ? -7.934  3.735   12.688  1.00 37.63 ? 216  ARG C O     1 
ATOM   4395 C  CB    . ARG C 1 216 ? -6.593  5.256   14.582  1.00 34.07 ? 216  ARG C CB    1 
ATOM   4396 C  CG    . ARG C 1 216 ? -5.098  5.426   14.781  1.00 37.45 ? 216  ARG C CG    1 
ATOM   4397 C  CD    . ARG C 1 216 ? -4.739  5.611   16.255  1.00 33.44 ? 216  ARG C CD    1 
ATOM   4398 N  NE    . ARG C 1 216 ? -5.213  4.512   17.094  1.00 33.95 ? 216  ARG C NE    1 
ATOM   4399 C  CZ    . ARG C 1 216 ? -5.927  4.672   18.205  1.00 33.81 ? 216  ARG C CZ    1 
ATOM   4400 N  NH1   . ARG C 1 216 ? -6.255  5.889   18.620  1.00 31.82 ? 216  ARG C NH1   1 
ATOM   4401 N  NH2   . ARG C 1 216 ? -6.322  3.614   18.901  1.00 34.15 ? 216  ARG C NH2   1 
ATOM   4402 N  N     . GLU D 1 32  ? 34.300  30.618  14.110  1.00 53.14 ? 32   GLU D N     1 
ATOM   4403 C  CA    . GLU D 1 32  ? 34.270  29.739  15.315  1.00 52.41 ? 32   GLU D CA    1 
ATOM   4404 C  C     . GLU D 1 32  ? 35.244  28.566  15.185  1.00 49.81 ? 32   GLU D C     1 
ATOM   4405 O  O     . GLU D 1 32  ? 36.270  28.527  15.868  1.00 49.81 ? 32   GLU D O     1 
ATOM   4406 C  CB    . GLU D 1 32  ? 32.840  29.246  15.597  1.00 55.52 ? 32   GLU D CB    1 
ATOM   4407 C  CG    . GLU D 1 32  ? 32.115  28.563  14.427  1.00 59.36 ? 32   GLU D CG    1 
ATOM   4408 C  CD    . GLU D 1 32  ? 31.724  29.519  13.308  1.00 61.26 ? 32   GLU D CD    1 
ATOM   4409 O  OE1   . GLU D 1 32  ? 31.228  30.628  13.605  1.00 61.52 ? 32   GLU D OE1   1 
ATOM   4410 O  OE2   . GLU D 1 32  ? 31.909  29.153  12.126  1.00 61.61 ? 32   GLU D OE2   1 
ATOM   4411 N  N     . VAL D 1 33  ? 34.925  27.617  14.310  1.00 44.69 ? 33   VAL D N     1 
ATOM   4412 C  CA    . VAL D 1 33  ? 35.789  26.463  14.092  1.00 40.01 ? 33   VAL D CA    1 
ATOM   4413 C  C     . VAL D 1 33  ? 36.860  26.815  13.063  1.00 35.63 ? 33   VAL D C     1 
ATOM   4414 O  O     . VAL D 1 33  ? 36.596  27.541  12.100  1.00 35.56 ? 33   VAL D O     1 
ATOM   4415 C  CB    . VAL D 1 33  ? 34.988  25.224  13.614  1.00 41.36 ? 33   VAL D CB    1 
ATOM   4416 C  CG1   . VAL D 1 33  ? 34.002  24.790  14.687  1.00 41.07 ? 33   VAL D CG1   1 
ATOM   4417 C  CG2   . VAL D 1 33  ? 34.259  25.527  12.318  1.00 42.13 ? 33   VAL D CG2   1 
ATOM   4418 N  N     . ASP D 1 34  ? 38.074  26.326  13.291  1.00 32.86 ? 34   ASP D N     1 
ATOM   4419 C  CA    . ASP D 1 34  ? 39.194  26.590  12.394  1.00 29.13 ? 34   ASP D CA    1 
ATOM   4420 C  C     . ASP D 1 34  ? 39.069  25.757  11.116  1.00 26.64 ? 34   ASP D C     1 
ATOM   4421 O  O     . ASP D 1 34  ? 39.483  24.601  11.078  1.00 26.85 ? 34   ASP D O     1 
ATOM   4422 C  CB    . ASP D 1 34  ? 40.513  26.279  13.110  1.00 30.85 ? 34   ASP D CB    1 
ATOM   4423 C  CG    . ASP D 1 34  ? 41.740  26.754  12.340  1.00 33.49 ? 34   ASP D CG    1 
ATOM   4424 O  OD1   . ASP D 1 34  ? 41.619  27.157  11.162  1.00 31.64 ? 34   ASP D OD1   1 
ATOM   4425 O  OD2   . ASP D 1 34  ? 42.842  26.718  12.928  1.00 37.31 ? 34   ASP D OD2   1 
ATOM   4426 N  N     . LEU D 1 35  ? 38.524  26.368  10.069  1.00 24.06 ? 35   LEU D N     1 
ATOM   4427 C  CA    . LEU D 1 35  ? 38.340  25.697  8.787   1.00 23.71 ? 35   LEU D CA    1 
ATOM   4428 C  C     . LEU D 1 35  ? 39.660  25.272  8.148   1.00 24.63 ? 35   LEU D C     1 
ATOM   4429 O  O     . LEU D 1 35  ? 39.706  24.271  7.442   1.00 22.78 ? 35   LEU D O     1 
ATOM   4430 C  CB    . LEU D 1 35  ? 37.571  26.597  7.818   1.00 25.02 ? 35   LEU D CB    1 
ATOM   4431 C  CG    . LEU D 1 35  ? 36.155  27.025  8.216   1.00 25.86 ? 35   LEU D CG    1 
ATOM   4432 C  CD1   . LEU D 1 35  ? 35.615  27.994  7.178   1.00 26.49 ? 35   LEU D CD1   1 
ATOM   4433 C  CD2   . LEU D 1 35  ? 35.249  25.811  8.341   1.00 24.26 ? 35   LEU D CD2   1 
ATOM   4434 N  N     . GLU D 1 36  ? 40.728  26.029  8.399   1.00 24.43 ? 36   GLU D N     1 
ATOM   4435 C  CA    . GLU D 1 36  ? 42.039  25.706  7.839   1.00 23.61 ? 36   GLU D CA    1 
ATOM   4436 C  C     . GLU D 1 36  ? 42.607  24.424  8.434   1.00 22.89 ? 36   GLU D C     1 
ATOM   4437 O  O     . GLU D 1 36  ? 43.212  23.622  7.724   1.00 21.96 ? 36   GLU D O     1 
ATOM   4438 C  CB    . GLU D 1 36  ? 43.026  26.859  8.050   1.00 26.11 ? 36   GLU D CB    1 
ATOM   4439 C  CG    . GLU D 1 36  ? 42.669  28.135  7.299   1.00 30.76 ? 36   GLU D CG    1 
ATOM   4440 C  CD    . GLU D 1 36  ? 42.687  27.976  5.780   1.00 31.94 ? 36   GLU D CD    1 
ATOM   4441 O  OE1   . GLU D 1 36  ? 43.380  27.069  5.266   1.00 32.18 ? 36   GLU D OE1   1 
ATOM   4442 O  OE2   . GLU D 1 36  ? 42.015  28.779  5.095   1.00 33.65 ? 36   GLU D OE2   1 
ATOM   4443 N  N     . ARG D 1 37  ? 42.413  24.228  9.736   1.00 21.68 ? 37   ARG D N     1 
ATOM   4444 C  CA    . ARG D 1 37  ? 42.913  23.022  10.378  1.00 23.87 ? 37   ARG D CA    1 
ATOM   4445 C  C     . ARG D 1 37  ? 42.086  21.813  9.932   1.00 21.81 ? 37   ARG D C     1 
ATOM   4446 O  O     . ARG D 1 37  ? 42.632  20.732  9.705   1.00 22.86 ? 37   ARG D O     1 
ATOM   4447 C  CB    . ARG D 1 37  ? 42.915  23.171  11.902  1.00 26.95 ? 37   ARG D CB    1 
ATOM   4448 C  CG    . ARG D 1 37  ? 43.632  22.034  12.625  1.00 34.97 ? 37   ARG D CG    1 
ATOM   4449 C  CD    . ARG D 1 37  ? 43.991  22.404  14.059  1.00 37.60 ? 37   ARG D CD    1 
ATOM   4450 N  NE    . ARG D 1 37  ? 45.030  23.430  14.125  1.00 46.50 ? 37   ARG D NE    1 
ATOM   4451 C  CZ    . ARG D 1 37  ? 46.338  23.184  14.089  1.00 47.64 ? 37   ARG D CZ    1 
ATOM   4452 N  NH1   . ARG D 1 37  ? 46.785  21.938  13.988  1.00 49.80 ? 37   ARG D NH1   1 
ATOM   4453 N  NH2   . ARG D 1 37  ? 47.203  24.188  14.161  1.00 47.32 ? 37   ARG D NH2   1 
ATOM   4454 N  N     . LEU D 1 38  ? 40.776  22.002  9.792   1.00 21.04 ? 38   LEU D N     1 
ATOM   4455 C  CA    . LEU D 1 38  ? 39.903  20.922  9.336   1.00 22.05 ? 38   LEU D CA    1 
ATOM   4456 C  C     . LEU D 1 38  ? 40.304  20.501  7.921   1.00 21.10 ? 38   LEU D C     1 
ATOM   4457 O  O     . LEU D 1 38  ? 40.393  19.312  7.626   1.00 22.71 ? 38   LEU D O     1 
ATOM   4458 C  CB    . LEU D 1 38  ? 38.436  21.358  9.352   1.00 18.93 ? 38   LEU D CB    1 
ATOM   4459 C  CG    . LEU D 1 38  ? 37.769  21.496  10.722  1.00 23.33 ? 38   LEU D CG    1 
ATOM   4460 C  CD1   . LEU D 1 38  ? 36.299  21.867  10.546  1.00 22.68 ? 38   LEU D CD1   1 
ATOM   4461 C  CD2   . LEU D 1 38  ? 37.893  20.194  11.488  1.00 22.67 ? 38   LEU D CD2   1 
ATOM   4462 N  N     . GLN D 1 39  ? 40.580  21.482  7.065   1.00 22.60 ? 39   GLN D N     1 
ATOM   4463 C  CA    . GLN D 1 39  ? 40.987  21.203  5.690   1.00 24.82 ? 39   GLN D CA    1 
ATOM   4464 C  C     . GLN D 1 39  ? 42.271  20.390  5.642   1.00 24.88 ? 39   GLN D C     1 
ATOM   4465 O  O     . GLN D 1 39  ? 42.376  19.424  4.884   1.00 24.77 ? 39   GLN D O     1 
ATOM   4466 C  CB    . GLN D 1 39  ? 41.160  22.500  4.898   1.00 28.24 ? 39   GLN D CB    1 
ATOM   4467 C  CG    . GLN D 1 39  ? 39.854  23.201  4.569   1.00 31.43 ? 39   GLN D CG    1 
ATOM   4468 C  CD    . GLN D 1 39  ? 40.053  24.482  3.779   1.00 33.93 ? 39   GLN D CD    1 
ATOM   4469 O  OE1   . GLN D 1 39  ? 41.023  24.626  3.035   1.00 35.84 ? 39   GLN D OE1   1 
ATOM   4470 N  NE2   . GLN D 1 39  ? 39.125  25.422  3.936   1.00 34.25 ? 39   GLN D NE2   1 
ATOM   4471 N  N     . ALA D 1 40  ? 43.237  20.766  6.476   1.00 25.72 ? 40   ALA D N     1 
ATOM   4472 C  CA    . ALA D 1 40  ? 44.518  20.067  6.531   1.00 25.12 ? 40   ALA D CA    1 
ATOM   4473 C  C     . ALA D 1 40  ? 44.335  18.636  7.032   1.00 22.65 ? 40   ALA D C     1 
ATOM   4474 O  O     . ALA D 1 40  ? 44.984  17.708  6.541   1.00 21.48 ? 40   ALA D O     1 
ATOM   4475 C  CB    . ALA D 1 40  ? 45.502  20.832  7.429   1.00 25.98 ? 40   ALA D CB    1 
ATOM   4476 N  N     . LEU D 1 41  ? 43.457  18.464  8.017   1.00 22.54 ? 41   LEU D N     1 
ATOM   4477 C  CA    . LEU D 1 41  ? 43.184  17.142  8.573   1.00 22.88 ? 41   LEU D CA    1 
ATOM   4478 C  C     . LEU D 1 41  ? 42.487  16.267  7.534   1.00 23.05 ? 41   LEU D C     1 
ATOM   4479 O  O     . LEU D 1 41  ? 42.810  15.085  7.391   1.00 22.79 ? 41   LEU D O     1 
ATOM   4480 C  CB    . LEU D 1 41  ? 42.320  17.257  9.832   1.00 22.40 ? 41   LEU D CB    1 
ATOM   4481 C  CG    . LEU D 1 41  ? 42.981  17.921  11.046  1.00 27.06 ? 41   LEU D CG    1 
ATOM   4482 C  CD1   . LEU D 1 41  ? 41.944  18.216  12.117  1.00 27.95 ? 41   LEU D CD1   1 
ATOM   4483 C  CD2   . LEU D 1 41  ? 44.081  17.026  11.593  1.00 27.30 ? 41   LEU D CD2   1 
ATOM   4484 N  N     . ALA D 1 42  ? 41.547  16.863  6.801   1.00 22.38 ? 42   ALA D N     1 
ATOM   4485 C  CA    . ALA D 1 42  ? 40.797  16.152  5.767   1.00 23.76 ? 42   ALA D CA    1 
ATOM   4486 C  C     . ALA D 1 42  ? 41.686  15.760  4.590   1.00 23.03 ? 42   ALA D C     1 
ATOM   4487 O  O     . ALA D 1 42  ? 41.555  14.667  4.043   1.00 21.56 ? 42   ALA D O     1 
ATOM   4488 C  CB    . ALA D 1 42  ? 39.624  17.001  5.287   1.00 23.90 ? 42   ALA D CB    1 
ATOM   4489 N  N     . ALA D 1 43  ? 42.602  16.649  4.213   1.00 23.27 ? 43   ALA D N     1 
ATOM   4490 C  CA    . ALA D 1 43  ? 43.519  16.383  3.110   1.00 22.36 ? 43   ALA D CA    1 
ATOM   4491 C  C     . ALA D 1 43  ? 44.395  15.177  3.431   1.00 23.30 ? 43   ALA D C     1 
ATOM   4492 O  O     . ALA D 1 43  ? 44.647  14.335  2.574   1.00 25.02 ? 43   ALA D O     1 
ATOM   4493 C  CB    . ALA D 1 43  ? 44.388  17.612  2.832   1.00 25.45 ? 43   ALA D CB    1 
ATOM   4494 N  N     . GLU D 1 44  ? 44.851  15.093  4.676   1.00 23.96 ? 44   GLU D N     1 
ATOM   4495 C  CA    . GLU D 1 44  ? 45.688  13.980  5.087   1.00 24.18 ? 44   GLU D CA    1 
ATOM   4496 C  C     . GLU D 1 44  ? 44.856  12.708  5.220   1.00 24.80 ? 44   GLU D C     1 
ATOM   4497 O  O     . GLU D 1 44  ? 45.343  11.610  4.943   1.00 25.04 ? 44   GLU D O     1 
ATOM   4498 C  CB    . GLU D 1 44  ? 46.410  14.290  6.398   1.00 25.33 ? 44   GLU D CB    1 
ATOM   4499 C  CG    . GLU D 1 44  ? 47.414  13.209  6.771   1.00 29.69 ? 44   GLU D CG    1 
ATOM   4500 C  CD    . GLU D 1 44  ? 48.329  13.588  7.916   1.00 35.11 ? 44   GLU D CD    1 
ATOM   4501 O  OE1   . GLU D 1 44  ? 48.299  14.752  8.378   1.00 34.98 ? 44   GLU D OE1   1 
ATOM   4502 O  OE2   . GLU D 1 44  ? 49.096  12.702  8.346   1.00 36.77 ? 44   GLU D OE2   1 
ATOM   4503 N  N     . TRP D 1 45  ? 43.596  12.868  5.625   1.00 22.94 ? 45   TRP D N     1 
ATOM   4504 C  CA    . TRP D 1 45  ? 42.687  11.739  5.778   1.00 22.11 ? 45   TRP D CA    1 
ATOM   4505 C  C     . TRP D 1 45  ? 42.579  11.035  4.423   1.00 20.45 ? 45   TRP D C     1 
ATOM   4506 O  O     . TRP D 1 45  ? 42.689  9.814   4.340   1.00 22.47 ? 45   TRP D O     1 
ATOM   4507 C  CB    . TRP D 1 45  ? 41.308  12.225  6.244   1.00 21.45 ? 45   TRP D CB    1 
ATOM   4508 C  CG    . TRP D 1 45  ? 40.413  11.122  6.740   1.00 24.67 ? 45   TRP D CG    1 
ATOM   4509 C  CD1   . TRP D 1 45  ? 39.520  10.392  6.004   1.00 26.20 ? 45   TRP D CD1   1 
ATOM   4510 C  CD2   . TRP D 1 45  ? 40.335  10.619  8.078   1.00 25.81 ? 45   TRP D CD2   1 
ATOM   4511 N  NE1   . TRP D 1 45  ? 38.894  9.463   6.803   1.00 26.33 ? 45   TRP D NE1   1 
ATOM   4512 C  CE2   . TRP D 1 45  ? 39.375  9.581   8.081   1.00 26.63 ? 45   TRP D CE2   1 
ATOM   4513 C  CE3   . TRP D 1 45  ? 40.984  10.942  9.280   1.00 25.22 ? 45   TRP D CE3   1 
ATOM   4514 C  CZ2   . TRP D 1 45  ? 39.050  8.861   9.240   1.00 25.11 ? 45   TRP D CZ2   1 
ATOM   4515 C  CZ3   . TRP D 1 45  ? 40.661  10.227  10.431  1.00 22.61 ? 45   TRP D CZ3   1 
ATOM   4516 C  CH2   . TRP D 1 45  ? 39.702  9.197   10.401  1.00 27.26 ? 45   TRP D CH2   1 
ATOM   4517 N  N     . LEU D 1 46  ? 42.430  11.827  3.364   1.00 20.10 ? 46   LEU D N     1 
ATOM   4518 C  CA    . LEU D 1 46  ? 42.331  11.300  2.006   1.00 21.14 ? 46   LEU D CA    1 
ATOM   4519 C  C     . LEU D 1 46  ? 43.559  10.460  1.655   1.00 22.20 ? 46   LEU D C     1 
ATOM   4520 O  O     . LEU D 1 46  ? 43.435  9.375   1.088   1.00 20.28 ? 46   LEU D O     1 
ATOM   4521 C  CB    . LEU D 1 46  ? 42.177  12.442  0.998   1.00 21.03 ? 46   LEU D CB    1 
ATOM   4522 C  CG    . LEU D 1 46  ? 40.907  13.294  1.076   1.00 19.97 ? 46   LEU D CG    1 
ATOM   4523 C  CD1   . LEU D 1 46  ? 40.925  14.352  -0.016  1.00 18.78 ? 46   LEU D CD1   1 
ATOM   4524 C  CD2   . LEU D 1 46  ? 39.679  12.398  0.931   1.00 23.81 ? 46   LEU D CD2   1 
ATOM   4525 N  N     . GLN D 1 47  ? 44.739  10.948  2.028   1.00 22.02 ? 47   GLN D N     1 
ATOM   4526 C  CA    . GLN D 1 47  ? 45.981  10.233  1.751   1.00 26.01 ? 47   GLN D CA    1 
ATOM   4527 C  C     . GLN D 1 47  ? 46.082  8.907   2.491   1.00 24.34 ? 47   GLN D C     1 
ATOM   4528 O  O     . GLN D 1 47  ? 46.343  7.873   1.879   1.00 26.13 ? 47   GLN D O     1 
ATOM   4529 C  CB    . GLN D 1 47  ? 47.190  11.101  2.106   1.00 29.28 ? 47   GLN D CB    1 
ATOM   4530 C  CG    . GLN D 1 47  ? 47.215  12.426  1.383   1.00 36.11 ? 47   GLN D CG    1 
ATOM   4531 C  CD    . GLN D 1 47  ? 48.364  13.309  1.817   1.00 39.85 ? 47   GLN D CD    1 
ATOM   4532 O  OE1   . GLN D 1 47  ? 48.403  13.787  2.953   1.00 41.40 ? 47   GLN D OE1   1 
ATOM   4533 N  NE2   . GLN D 1 47  ? 49.307  13.537  0.912   1.00 39.81 ? 47   GLN D NE2   1 
ATOM   4534 N  N     . VAL D 1 48  ? 45.848  8.939   3.801   1.00 25.28 ? 48   VAL D N     1 
ATOM   4535 C  CA    . VAL D 1 48  ? 45.940  7.748   4.644   1.00 25.18 ? 48   VAL D CA    1 
ATOM   4536 C  C     . VAL D 1 48  ? 45.000  6.603   4.250   1.00 26.22 ? 48   VAL D C     1 
ATOM   4537 O  O     . VAL D 1 48  ? 45.390  5.436   4.307   1.00 26.09 ? 48   VAL D O     1 
ATOM   4538 C  CB    . VAL D 1 48  ? 45.739  8.104   6.144   1.00 25.31 ? 48   VAL D CB    1 
ATOM   4539 C  CG1   . VAL D 1 48  ? 45.925  6.869   7.016   1.00 23.35 ? 48   VAL D CG1   1 
ATOM   4540 C  CG2   . VAL D 1 48  ? 46.732  9.187   6.562   1.00 24.70 ? 48   VAL D CG2   1 
ATOM   4541 N  N     . ILE D 1 49  ? 43.778  6.928   3.830   1.00 25.80 ? 49   ILE D N     1 
ATOM   4542 C  CA    . ILE D 1 49  ? 42.823  5.890   3.441   1.00 27.18 ? 49   ILE D CA    1 
ATOM   4543 C  C     . ILE D 1 49  ? 43.116  5.295   2.063   1.00 28.25 ? 49   ILE D C     1 
ATOM   4544 O  O     . ILE D 1 49  ? 42.412  4.389   1.609   1.00 29.16 ? 49   ILE D O     1 
ATOM   4545 C  CB    . ILE D 1 49  ? 41.363  6.385   3.506   1.00 24.74 ? 49   ILE D CB    1 
ATOM   4546 C  CG1   . ILE D 1 49  ? 41.164  7.577   2.567   1.00 26.67 ? 49   ILE D CG1   1 
ATOM   4547 C  CG2   . ILE D 1 49  ? 40.992  6.710   4.954   1.00 24.12 ? 49   ILE D CG2   1 
ATOM   4548 C  CD1   . ILE D 1 49  ? 39.752  8.124   2.540   1.00 27.48 ? 49   ILE D CD1   1 
ATOM   4549 N  N     . GLY D 1 50  ? 44.152  5.816   1.407   1.00 28.65 ? 50   GLY D N     1 
ATOM   4550 C  CA    . GLY D 1 50  ? 44.548  5.313   0.104   1.00 28.75 ? 50   GLY D CA    1 
ATOM   4551 C  C     . GLY D 1 50  ? 44.178  6.139   -1.115  1.00 28.78 ? 50   GLY D C     1 
ATOM   4552 O  O     . GLY D 1 50  ? 44.367  5.678   -2.241  1.00 30.44 ? 50   GLY D O     1 
ATOM   4553 N  N     . GLU D 1 51  ? 43.671  7.352   -0.913  1.00 24.81 ? 51   GLU D N     1 
ATOM   4554 C  CA    . GLU D 1 51  ? 43.292  8.196   -2.042  1.00 24.50 ? 51   GLU D CA    1 
ATOM   4555 C  C     . GLU D 1 51  ? 44.338  9.223   -2.468  1.00 25.98 ? 51   GLU D C     1 
ATOM   4556 O  O     . GLU D 1 51  ? 45.393  9.364   -1.840  1.00 28.26 ? 51   GLU D O     1 
ATOM   4557 C  CB    . GLU D 1 51  ? 41.942  8.870   -1.790  1.00 23.26 ? 51   GLU D CB    1 
ATOM   4558 C  CG    . GLU D 1 51  ? 40.744  8.114   -2.384  1.00 21.82 ? 51   GLU D CG    1 
ATOM   4559 C  CD    . GLU D 1 51  ? 40.618  8.263   -3.902  1.00 21.33 ? 51   GLU D CD    1 
ATOM   4560 O  OE1   . GLU D 1 51  ? 41.482  8.904   -4.539  1.00 20.29 ? 51   GLU D OE1   1 
ATOM   4561 O  OE2   . GLU D 1 51  ? 39.631  7.748   -4.468  1.00 21.34 ? 51   GLU D OE2   1 
ATOM   4562 N  N     . ASP D 1 52  ? 44.036  9.924   -3.557  1.00 26.36 ? 52   ASP D N     1 
ATOM   4563 C  CA    . ASP D 1 52  ? 44.922  10.935  -4.120  1.00 24.92 ? 52   ASP D CA    1 
ATOM   4564 C  C     . ASP D 1 52  ? 44.278  12.320  -4.062  1.00 24.73 ? 52   ASP D C     1 
ATOM   4565 O  O     . ASP D 1 52  ? 43.422  12.650  -4.881  1.00 23.05 ? 52   ASP D O     1 
ATOM   4566 C  CB    . ASP D 1 52  ? 45.254  10.561  -5.572  1.00 27.84 ? 52   ASP D CB    1 
ATOM   4567 C  CG    . ASP D 1 52  ? 46.160  11.573  -6.261  1.00 29.77 ? 52   ASP D CG    1 
ATOM   4568 O  OD1   . ASP D 1 52  ? 46.199  11.568  -7.512  1.00 29.84 ? 52   ASP D OD1   1 
ATOM   4569 O  OD2   . ASP D 1 52  ? 46.833  12.364  -5.567  1.00 29.31 ? 52   ASP D OD2   1 
ATOM   4570 N  N     . PRO D 1 53  ? 44.704  13.160  -3.099  1.00 26.67 ? 53   PRO D N     1 
ATOM   4571 C  CA    . PRO D 1 53  ? 44.178  14.519  -2.925  1.00 25.36 ? 53   PRO D CA    1 
ATOM   4572 C  C     . PRO D 1 53  ? 44.356  15.354  -4.187  1.00 25.21 ? 53   PRO D C     1 
ATOM   4573 O  O     . PRO D 1 53  ? 43.680  16.371  -4.374  1.00 26.51 ? 53   PRO D O     1 
ATOM   4574 C  CB    . PRO D 1 53  ? 45.028  15.066  -1.778  1.00 24.92 ? 53   PRO D CB    1 
ATOM   4575 C  CG    . PRO D 1 53  ? 45.331  13.855  -0.982  1.00 27.19 ? 53   PRO D CG    1 
ATOM   4576 C  CD    . PRO D 1 53  ? 45.687  12.849  -2.047  1.00 25.39 ? 53   PRO D CD    1 
ATOM   4577 N  N     . GLY D 1 54  ? 45.277  14.916  -5.043  1.00 25.50 ? 54   GLY D N     1 
ATOM   4578 C  CA    . GLY D 1 54  ? 45.542  15.603  -6.295  1.00 27.77 ? 54   GLY D CA    1 
ATOM   4579 C  C     . GLY D 1 54  ? 44.541  15.301  -7.399  1.00 29.42 ? 54   GLY D C     1 
ATOM   4580 O  O     . GLY D 1 54  ? 44.547  15.981  -8.430  1.00 27.69 ? 54   GLY D O     1 
ATOM   4581 N  N     . ARG D 1 55  ? 43.714  14.268  -7.201  1.00 28.61 ? 55   ARG D N     1 
ATOM   4582 C  CA    . ARG D 1 55  ? 42.678  13.871  -8.164  1.00 28.32 ? 55   ARG D CA    1 
ATOM   4583 C  C     . ARG D 1 55  ? 41.752  15.042  -8.444  1.00 28.04 ? 55   ARG D C     1 
ATOM   4584 O  O     . ARG D 1 55  ? 41.409  15.791  -7.532  1.00 29.20 ? 55   ARG D O     1 
ATOM   4585 C  CB    . ARG D 1 55  ? 41.782  12.753  -7.598  1.00 29.51 ? 55   ARG D CB    1 
ATOM   4586 C  CG    . ARG D 1 55  ? 42.310  11.346  -7.687  1.00 33.30 ? 55   ARG D CG    1 
ATOM   4587 C  CD    . ARG D 1 55  ? 41.171  10.350  -7.938  1.00 26.08 ? 55   ARG D CD    1 
ATOM   4588 N  NE    . ARG D 1 55  ? 40.278  10.113  -6.797  1.00 22.47 ? 55   ARG D NE    1 
ATOM   4589 C  CZ    . ARG D 1 55  ? 38.984  10.432  -6.767  1.00 18.59 ? 55   ARG D CZ    1 
ATOM   4590 N  NH1   . ARG D 1 55  ? 38.411  11.028  -7.804  1.00 17.97 ? 55   ARG D NH1   1 
ATOM   4591 N  NH2   . ARG D 1 55  ? 38.239  10.089  -5.722  1.00 23.95 ? 55   ARG D NH2   1 
ATOM   4592 N  N     . GLU D 1 56  ? 41.285  15.141  -9.685  1.00 28.33 ? 56   GLU D N     1 
ATOM   4593 C  CA    . GLU D 1 56  ? 40.361  16.197  -10.092 1.00 28.41 ? 56   GLU D CA    1 
ATOM   4594 C  C     . GLU D 1 56  ? 39.128  16.217  -9.183  1.00 28.47 ? 56   GLU D C     1 
ATOM   4595 O  O     . GLU D 1 56  ? 38.697  17.279  -8.725  1.00 26.49 ? 56   GLU D O     1 
ATOM   4596 C  CB    . GLU D 1 56  ? 39.930  15.967  -11.549 1.00 33.02 ? 56   GLU D CB    1 
ATOM   4597 C  CG    . GLU D 1 56  ? 38.711  16.771  -12.017 1.00 39.74 ? 56   GLU D CG    1 
ATOM   4598 C  CD    . GLU D 1 56  ? 39.005  18.231  -12.331 1.00 45.00 ? 56   GLU D CD    1 
ATOM   4599 O  OE1   . GLU D 1 56  ? 40.186  18.642  -12.310 1.00 49.01 ? 56   GLU D OE1   1 
ATOM   4600 O  OE2   . GLU D 1 56  ? 38.038  18.972  -12.614 1.00 48.34 ? 56   GLU D OE2   1 
ATOM   4601 N  N     . GLY D 1 57  ? 38.590  15.031  -8.903  1.00 23.47 ? 57   GLY D N     1 
ATOM   4602 C  CA    . GLY D 1 57  ? 37.407  14.922  -8.069  1.00 22.68 ? 57   GLY D CA    1 
ATOM   4603 C  C     . GLY D 1 57  ? 37.602  15.190  -6.590  1.00 21.90 ? 57   GLY D C     1 
ATOM   4604 O  O     . GLY D 1 57  ? 36.623  15.368  -5.869  1.00 21.14 ? 57   GLY D O     1 
ATOM   4605 N  N     . LEU D 1 58  ? 38.853  15.228  -6.135  1.00 18.60 ? 58   LEU D N     1 
ATOM   4606 C  CA    . LEU D 1 58  ? 39.140  15.464  -4.722  1.00 18.47 ? 58   LEU D CA    1 
ATOM   4607 C  C     . LEU D 1 58  ? 39.793  16.813  -4.424  1.00 22.44 ? 58   LEU D C     1 
ATOM   4608 O  O     . LEU D 1 58  ? 39.987  17.159  -3.259  1.00 20.68 ? 58   LEU D O     1 
ATOM   4609 C  CB    . LEU D 1 58  ? 40.021  14.342  -4.160  1.00 14.63 ? 58   LEU D CB    1 
ATOM   4610 C  CG    . LEU D 1 58  ? 39.427  12.936  -4.015  1.00 16.88 ? 58   LEU D CG    1 
ATOM   4611 C  CD1   . LEU D 1 58  ? 40.488  11.989  -3.471  1.00 16.19 ? 58   LEU D CD1   1 
ATOM   4612 C  CD2   . LEU D 1 58  ? 38.237  12.965  -3.077  1.00 16.00 ? 58   LEU D CD2   1 
ATOM   4613 N  N     . LEU D 1 59  ? 40.111  17.578  -5.466  1.00 23.29 ? 59   LEU D N     1 
ATOM   4614 C  CA    . LEU D 1 59  ? 40.768  18.877  -5.297  1.00 25.57 ? 59   LEU D CA    1 
ATOM   4615 C  C     . LEU D 1 59  ? 40.118  19.827  -4.286  1.00 27.99 ? 59   LEU D C     1 
ATOM   4616 O  O     . LEU D 1 59  ? 40.811  20.399  -3.440  1.00 28.94 ? 59   LEU D O     1 
ATOM   4617 C  CB    . LEU D 1 59  ? 40.945  19.571  -6.652  1.00 25.20 ? 59   LEU D CB    1 
ATOM   4618 C  CG    . LEU D 1 59  ? 41.915  18.883  -7.621  1.00 26.96 ? 59   LEU D CG    1 
ATOM   4619 C  CD1   . LEU D 1 59  ? 41.900  19.578  -8.977  1.00 25.17 ? 59   LEU D CD1   1 
ATOM   4620 C  CD2   . LEU D 1 59  ? 43.321  18.868  -7.036  1.00 27.81 ? 59   LEU D CD2   1 
ATOM   4621 N  N     . LYS D 1 60  ? 38.801  19.995  -4.363  1.00 26.38 ? 60   LYS D N     1 
ATOM   4622 C  CA    . LYS D 1 60  ? 38.106  20.883  -3.431  1.00 26.63 ? 60   LYS D CA    1 
ATOM   4623 C  C     . LYS D 1 60  ? 37.462  20.158  -2.252  1.00 25.58 ? 60   LYS D C     1 
ATOM   4624 O  O     . LYS D 1 60  ? 36.787  20.784  -1.436  1.00 23.09 ? 60   LYS D O     1 
ATOM   4625 C  CB    . LYS D 1 60  ? 37.040  21.710  -4.156  1.00 31.27 ? 60   LYS D CB    1 
ATOM   4626 C  CG    . LYS D 1 60  ? 37.580  22.855  -5.000  1.00 38.17 ? 60   LYS D CG    1 
ATOM   4627 C  CD    . LYS D 1 60  ? 36.883  24.170  -4.649  1.00 43.97 ? 60   LYS D CD    1 
ATOM   4628 C  CE    . LYS D 1 60  ? 35.368  24.076  -4.808  1.00 46.31 ? 60   LYS D CE    1 
ATOM   4629 N  NZ    . LYS D 1 60  ? 34.674  25.324  -4.369  1.00 48.54 ? 60   LYS D NZ    1 
ATOM   4630 N  N     . THR D 1 61  ? 37.699  18.853  -2.139  1.00 23.11 ? 61   THR D N     1 
ATOM   4631 C  CA    . THR D 1 61  ? 37.111  18.067  -1.059  1.00 22.67 ? 61   THR D CA    1 
ATOM   4632 C  C     . THR D 1 61  ? 37.478  18.516  0.365   1.00 23.34 ? 61   THR D C     1 
ATOM   4633 O  O     . THR D 1 61  ? 36.590  18.699  1.196   1.00 21.18 ? 61   THR D O     1 
ATOM   4634 C  CB    . THR D 1 61  ? 37.362  16.549  -1.263  1.00 22.14 ? 61   THR D CB    1 
ATOM   4635 O  OG1   . THR D 1 61  ? 36.720  16.128  -2.475  1.00 20.60 ? 61   THR D OG1   1 
ATOM   4636 C  CG2   . THR D 1 61  ? 36.795  15.737  -0.107  1.00 17.69 ? 61   THR D CG2   1 
ATOM   4637 N  N     . PRO D 1 62  ? 38.777  18.726  0.660   1.00 24.25 ? 62   PRO D N     1 
ATOM   4638 C  CA    . PRO D 1 62  ? 39.136  19.159  2.019   1.00 22.76 ? 62   PRO D CA    1 
ATOM   4639 C  C     . PRO D 1 62  ? 38.358  20.406  2.437   1.00 22.40 ? 62   PRO D C     1 
ATOM   4640 O  O     . PRO D 1 62  ? 37.880  20.501  3.569   1.00 22.13 ? 62   PRO D O     1 
ATOM   4641 C  CB    . PRO D 1 62  ? 40.631  19.438  1.895   1.00 22.90 ? 62   PRO D CB    1 
ATOM   4642 C  CG    . PRO D 1 62  ? 41.067  18.406  0.910   1.00 25.24 ? 62   PRO D CG    1 
ATOM   4643 C  CD    . PRO D 1 62  ? 39.989  18.517  -0.152  1.00 23.60 ? 62   PRO D CD    1 
ATOM   4644 N  N     . GLU D 1 63  ? 38.201  21.334  1.495   1.00 20.39 ? 63   GLU D N     1 
ATOM   4645 C  CA    . GLU D 1 63  ? 37.475  22.575  1.719   1.00 21.99 ? 63   GLU D CA    1 
ATOM   4646 C  C     . GLU D 1 63  ? 35.985  22.304  1.952   1.00 22.07 ? 63   GLU D C     1 
ATOM   4647 O  O     . GLU D 1 63  ? 35.389  22.845  2.886   1.00 21.05 ? 63   GLU D O     1 
ATOM   4648 C  CB    . GLU D 1 63  ? 37.653  23.505  0.518   1.00 25.45 ? 63   GLU D CB    1 
ATOM   4649 C  CG    . GLU D 1 63  ? 36.924  24.836  0.634   1.00 30.80 ? 63   GLU D CG    1 
ATOM   4650 C  CD    . GLU D 1 63  ? 37.039  25.672  -0.626  1.00 36.58 ? 63   GLU D CD    1 
ATOM   4651 O  OE1   . GLU D 1 63  ? 35.995  26.137  -1.133  1.00 41.83 ? 63   GLU D OE1   1 
ATOM   4652 O  OE2   . GLU D 1 63  ? 38.173  25.857  -1.116  1.00 38.24 ? 63   GLU D OE2   1 
ATOM   4653 N  N     . ARG D 1 64  ? 35.391  21.478  1.090   1.00 20.20 ? 64   ARG D N     1 
ATOM   4654 C  CA    . ARG D 1 64  ? 33.974  21.125  1.204   1.00 20.88 ? 64   ARG D CA    1 
ATOM   4655 C  C     . ARG D 1 64  ? 33.678  20.379  2.506   1.00 18.04 ? 64   ARG D C     1 
ATOM   4656 O  O     . ARG D 1 64  ? 32.638  20.596  3.123   1.00 21.58 ? 64   ARG D O     1 
ATOM   4657 C  CB    . ARG D 1 64  ? 33.524  20.277  0.005   1.00 20.28 ? 64   ARG D CB    1 
ATOM   4658 C  CG    . ARG D 1 64  ? 33.411  21.044  -1.310  1.00 19.47 ? 64   ARG D CG    1 
ATOM   4659 C  CD    . ARG D 1 64  ? 32.895  20.165  -2.453  1.00 21.88 ? 64   ARG D CD    1 
ATOM   4660 N  NE    . ARG D 1 64  ? 33.867  19.154  -2.866  1.00 21.52 ? 64   ARG D NE    1 
ATOM   4661 C  CZ    . ARG D 1 64  ? 34.376  19.054  -4.092  1.00 22.10 ? 64   ARG D CZ    1 
ATOM   4662 N  NH1   . ARG D 1 64  ? 34.009  19.901  -5.048  1.00 23.08 ? 64   ARG D NH1   1 
ATOM   4663 N  NH2   . ARG D 1 64  ? 35.275  18.116  -4.358  1.00 21.51 ? 64   ARG D NH2   1 
ATOM   4664 N  N     . VAL D 1 65  ? 34.590  19.497  2.911   1.00 19.34 ? 65   VAL D N     1 
ATOM   4665 C  CA    . VAL D 1 65  ? 34.424  18.721  4.136   1.00 18.19 ? 65   VAL D CA    1 
ATOM   4666 C  C     . VAL D 1 65  ? 34.498  19.613  5.380   1.00 21.07 ? 65   VAL D C     1 
ATOM   4667 O  O     . VAL D 1 65  ? 33.711  19.454  6.313   1.00 17.18 ? 65   VAL D O     1 
ATOM   4668 C  CB    . VAL D 1 65  ? 35.480  17.590  4.232   1.00 21.10 ? 65   VAL D CB    1 
ATOM   4669 C  CG1   . VAL D 1 65  ? 35.365  16.856  5.564   1.00 20.13 ? 65   VAL D CG1   1 
ATOM   4670 C  CG2   . VAL D 1 65  ? 35.292  16.611  3.091   1.00 21.35 ? 65   VAL D CG2   1 
ATOM   4671 N  N     . ALA D 1 66  ? 35.419  20.575  5.379   1.00 19.95 ? 66   ALA D N     1 
ATOM   4672 C  CA    . ALA D 1 66  ? 35.563  21.486  6.518   1.00 20.84 ? 66   ALA D CA    1 
ATOM   4673 C  C     . ALA D 1 66  ? 34.309  22.332  6.725   1.00 19.48 ? 66   ALA D C     1 
ATOM   4674 O  O     . ALA D 1 66  ? 33.825  22.467  7.846   1.00 19.63 ? 66   ALA D O     1 
ATOM   4675 C  CB    . ALA D 1 66  ? 36.784  22.387  6.332   1.00 21.82 ? 66   ALA D CB    1 
ATOM   4676 N  N     . LYS D 1 67  ? 33.786  22.901  5.645   1.00 19.42 ? 67   LYS D N     1 
ATOM   4677 C  CA    . LYS D 1 67  ? 32.587  23.725  5.728   1.00 22.47 ? 67   LYS D CA    1 
ATOM   4678 C  C     . LYS D 1 67  ? 31.387  22.891  6.168   1.00 23.91 ? 67   LYS D C     1 
ATOM   4679 O  O     . LYS D 1 67  ? 30.569  23.341  6.975   1.00 23.66 ? 67   LYS D O     1 
ATOM   4680 C  CB    . LYS D 1 67  ? 32.290  24.389  4.381   1.00 27.47 ? 67   LYS D CB    1 
ATOM   4681 C  CG    . LYS D 1 67  ? 33.381  25.341  3.898   1.00 34.47 ? 67   LYS D CG    1 
ATOM   4682 C  CD    . LYS D 1 67  ? 32.923  26.161  2.692   1.00 39.32 ? 67   LYS D CD    1 
ATOM   4683 C  CE    . LYS D 1 67  ? 32.518  25.285  1.509   1.00 47.42 ? 67   LYS D CE    1 
ATOM   4684 N  NZ    . LYS D 1 67  ? 33.665  24.536  0.925   1.00 50.25 ? 67   LYS D NZ    1 
ATOM   4685 N  N     . ALA D 1 68  ? 31.314  21.662  5.658   1.00 22.35 ? 68   ALA D N     1 
ATOM   4686 C  CA    . ALA D 1 68  ? 30.225  20.749  5.992   1.00 22.30 ? 68   ALA D CA    1 
ATOM   4687 C  C     . ALA D 1 68  ? 30.183  20.472  7.492   1.00 21.02 ? 68   ALA D C     1 
ATOM   4688 O  O     . ALA D 1 68  ? 29.131  20.608  8.118   1.00 20.53 ? 68   ALA D O     1 
ATOM   4689 C  CB    . ALA D 1 68  ? 30.371  19.448  5.217   1.00 20.26 ? 68   ALA D CB    1 
ATOM   4690 N  N     . TRP D 1 69  ? 31.328  20.107  8.066   1.00 23.27 ? 69   TRP D N     1 
ATOM   4691 C  CA    . TRP D 1 69  ? 31.398  19.818  9.496   1.00 24.52 ? 69   TRP D CA    1 
ATOM   4692 C  C     . TRP D 1 69  ? 31.160  21.036  10.373  1.00 25.17 ? 69   TRP D C     1 
ATOM   4693 O  O     . TRP D 1 69  ? 30.698  20.905  11.508  1.00 23.31 ? 69   TRP D O     1 
ATOM   4694 C  CB    . TRP D 1 69  ? 32.706  19.115  9.851   1.00 24.18 ? 69   TRP D CB    1 
ATOM   4695 C  CG    . TRP D 1 69  ? 32.614  17.653  9.581   1.00 24.69 ? 69   TRP D CG    1 
ATOM   4696 C  CD1   . TRP D 1 69  ? 32.778  17.027  8.375   1.00 24.86 ? 69   TRP D CD1   1 
ATOM   4697 C  CD2   . TRP D 1 69  ? 32.257  16.631  10.519  1.00 22.53 ? 69   TRP D CD2   1 
ATOM   4698 N  NE1   . TRP D 1 69  ? 32.540  15.681  8.506   1.00 23.52 ? 69   TRP D NE1   1 
ATOM   4699 C  CE2   . TRP D 1 69  ? 32.218  15.409  9.810   1.00 24.32 ? 69   TRP D CE2   1 
ATOM   4700 C  CE3   . TRP D 1 69  ? 31.961  16.630  11.891  1.00 23.09 ? 69   TRP D CE3   1 
ATOM   4701 C  CZ2   . TRP D 1 69  ? 31.895  14.193  10.427  1.00 24.87 ? 69   TRP D CZ2   1 
ATOM   4702 C  CZ3   . TRP D 1 69  ? 31.638  15.420  12.506  1.00 26.56 ? 69   TRP D CZ3   1 
ATOM   4703 C  CH2   . TRP D 1 69  ? 31.609  14.219  11.772  1.00 24.03 ? 69   TRP D CH2   1 
ATOM   4704 N  N     . ALA D 1 70  ? 31.465  22.216  9.840   1.00 24.23 ? 70   ALA D N     1 
ATOM   4705 C  CA    . ALA D 1 70  ? 31.236  23.463  10.564  1.00 26.56 ? 70   ALA D CA    1 
ATOM   4706 C  C     . ALA D 1 70  ? 29.721  23.623  10.689  1.00 23.94 ? 70   ALA D C     1 
ATOM   4707 O  O     . ALA D 1 70  ? 29.206  24.015  11.738  1.00 23.28 ? 70   ALA D O     1 
ATOM   4708 C  CB    . ALA D 1 70  ? 31.831  24.642  9.793   1.00 25.26 ? 70   ALA D CB    1 
ATOM   4709 N  N     . PHE D 1 71  ? 29.017  23.287  9.611   1.00 22.05 ? 71   PHE D N     1 
ATOM   4710 C  CA    . PHE D 1 71  ? 27.559  23.366  9.573   1.00 20.74 ? 71   PHE D CA    1 
ATOM   4711 C  C     . PHE D 1 71  ? 26.945  22.258  10.425  1.00 19.98 ? 71   PHE D C     1 
ATOM   4712 O  O     . PHE D 1 71  ? 26.007  22.502  11.183  1.00 23.73 ? 71   PHE D O     1 
ATOM   4713 C  CB    . PHE D 1 71  ? 27.057  23.247  8.124   1.00 22.26 ? 71   PHE D CB    1 
ATOM   4714 C  CG    . PHE D 1 71  ? 25.558  23.279  7.992   1.00 20.63 ? 71   PHE D CG    1 
ATOM   4715 C  CD1   . PHE D 1 71  ? 24.871  24.489  7.995   1.00 20.34 ? 71   PHE D CD1   1 
ATOM   4716 C  CD2   . PHE D 1 71  ? 24.831  22.098  7.871   1.00 22.11 ? 71   PHE D CD2   1 
ATOM   4717 C  CE1   . PHE D 1 71  ? 23.482  24.524  7.883   1.00 22.64 ? 71   PHE D CE1   1 
ATOM   4718 C  CE2   . PHE D 1 71  ? 23.439  22.122  7.759   1.00 19.23 ? 71   PHE D CE2   1 
ATOM   4719 C  CZ    . PHE D 1 71  ? 22.764  23.336  7.766   1.00 19.51 ? 71   PHE D CZ    1 
ATOM   4720 N  N     . LEU D 1 72  ? 27.506  21.053  10.328  1.00 18.66 ? 72   LEU D N     1 
ATOM   4721 C  CA    . LEU D 1 72  ? 26.998  19.898  11.073  1.00 20.93 ? 72   LEU D CA    1 
ATOM   4722 C  C     . LEU D 1 72  ? 27.193  19.962  12.587  1.00 22.37 ? 72   LEU D C     1 
ATOM   4723 O  O     . LEU D 1 72  ? 26.580  19.190  13.326  1.00 20.09 ? 72   LEU D O     1 
ATOM   4724 C  CB    . LEU D 1 72  ? 27.586  18.594  10.516  1.00 18.72 ? 72   LEU D CB    1 
ATOM   4725 C  CG    . LEU D 1 72  ? 27.226  18.272  9.058   1.00 19.17 ? 72   LEU D CG    1 
ATOM   4726 C  CD1   . LEU D 1 72  ? 27.921  16.985  8.622   1.00 18.46 ? 72   LEU D CD1   1 
ATOM   4727 C  CD2   . LEU D 1 72  ? 25.716  18.146  8.896   1.00 18.14 ? 72   LEU D CD2   1 
ATOM   4728 N  N     . THR D 1 73  ? 28.054  20.866  13.048  1.00 22.06 ? 73   THR D N     1 
ATOM   4729 C  CA    . THR D 1 73  ? 28.296  21.028  14.480  1.00 22.76 ? 73   THR D CA    1 
ATOM   4730 C  C     . THR D 1 73  ? 27.853  22.411  14.956  1.00 24.51 ? 73   THR D C     1 
ATOM   4731 O  O     . THR D 1 73  ? 28.114  22.793  16.099  1.00 25.41 ? 73   THR D O     1 
ATOM   4732 C  CB    . THR D 1 73  ? 29.787  20.846  14.844  1.00 22.39 ? 73   THR D CB    1 
ATOM   4733 O  OG1   . THR D 1 73  ? 30.581  21.761  14.080  1.00 22.35 ? 73   THR D OG1   1 
ATOM   4734 C  CG2   . THR D 1 73  ? 30.243  19.416  14.577  1.00 18.79 ? 73   THR D CG2   1 
ATOM   4735 N  N     . ARG D 1 74  ? 27.150  23.136  14.089  1.00 24.24 ? 74   ARG D N     1 
ATOM   4736 C  CA    . ARG D 1 74  ? 26.676  24.486  14.392  1.00 25.62 ? 74   ARG D CA    1 
ATOM   4737 C  C     . ARG D 1 74  ? 25.746  24.559  15.601  1.00 26.49 ? 74   ARG D C     1 
ATOM   4738 O  O     . ARG D 1 74  ? 25.579  25.626  16.198  1.00 24.76 ? 74   ARG D O     1 
ATOM   4739 C  CB    . ARG D 1 74  ? 25.992  25.100  13.164  1.00 26.77 ? 74   ARG D CB    1 
ATOM   4740 C  CG    . ARG D 1 74  ? 24.550  24.646  12.926  1.00 31.56 ? 74   ARG D CG    1 
ATOM   4741 C  CD    . ARG D 1 74  ? 24.030  25.092  11.558  1.00 34.34 ? 74   ARG D CD    1 
ATOM   4742 N  NE    . ARG D 1 74  ? 24.222  26.521  11.311  1.00 36.26 ? 74   ARG D NE    1 
ATOM   4743 C  CZ    . ARG D 1 74  ? 23.438  27.486  11.787  1.00 39.40 ? 74   ARG D CZ    1 
ATOM   4744 N  NH1   . ARG D 1 74  ? 22.389  27.189  12.543  1.00 38.76 ? 74   ARG D NH1   1 
ATOM   4745 N  NH2   . ARG D 1 74  ? 23.711  28.756  11.513  1.00 40.60 ? 74   ARG D NH2   1 
ATOM   4746 N  N     . GLY D 1 75  ? 25.154  23.422  15.962  1.00 23.06 ? 75   GLY D N     1 
ATOM   4747 C  CA    . GLY D 1 75  ? 24.249  23.375  17.098  1.00 26.12 ? 75   GLY D CA    1 
ATOM   4748 C  C     . GLY D 1 75  ? 24.911  23.689  18.429  1.00 26.27 ? 75   GLY D C     1 
ATOM   4749 O  O     . GLY D 1 75  ? 24.255  24.170  19.354  1.00 24.63 ? 75   GLY D O     1 
ATOM   4750 N  N     . TYR D 1 76  ? 26.201  23.383  18.538  1.00 28.34 ? 76   TYR D N     1 
ATOM   4751 C  CA    . TYR D 1 76  ? 26.957  23.648  19.761  1.00 31.39 ? 76   TYR D CA    1 
ATOM   4752 C  C     . TYR D 1 76  ? 27.052  25.152  20.022  1.00 32.80 ? 76   TYR D C     1 
ATOM   4753 O  O     . TYR D 1 76  ? 27.099  25.584  21.174  1.00 32.77 ? 76   TYR D O     1 
ATOM   4754 C  CB    . TYR D 1 76  ? 28.382  23.095  19.651  1.00 29.48 ? 76   TYR D CB    1 
ATOM   4755 C  CG    . TYR D 1 76  ? 28.513  21.588  19.670  1.00 27.32 ? 76   TYR D CG    1 
ATOM   4756 C  CD1   . TYR D 1 76  ? 28.188  20.849  20.811  1.00 26.09 ? 76   TYR D CD1   1 
ATOM   4757 C  CD2   . TYR D 1 76  ? 29.020  20.904  18.567  1.00 23.98 ? 76   TYR D CD2   1 
ATOM   4758 C  CE1   . TYR D 1 76  ? 28.373  19.465  20.850  1.00 24.30 ? 76   TYR D CE1   1 
ATOM   4759 C  CE2   . TYR D 1 76  ? 29.209  19.525  18.597  1.00 22.97 ? 76   TYR D CE2   1 
ATOM   4760 C  CZ    . TYR D 1 76  ? 28.884  18.813  19.739  1.00 21.87 ? 76   TYR D CZ    1 
ATOM   4761 O  OH    . TYR D 1 76  ? 29.076  17.450  19.767  1.00 22.57 ? 76   TYR D OH    1 
ATOM   4762 N  N     . ARG D 1 77  ? 27.087  25.939  18.948  1.00 33.75 ? 77   ARG D N     1 
ATOM   4763 C  CA    . ARG D 1 77  ? 27.210  27.392  19.053  1.00 35.99 ? 77   ARG D CA    1 
ATOM   4764 C  C     . ARG D 1 77  ? 25.911  28.193  19.031  1.00 35.30 ? 77   ARG D C     1 
ATOM   4765 O  O     . ARG D 1 77  ? 25.948  29.423  18.948  1.00 35.42 ? 77   ARG D O     1 
ATOM   4766 C  CB    . ARG D 1 77  ? 28.150  27.933  17.967  1.00 38.01 ? 77   ARG D CB    1 
ATOM   4767 C  CG    . ARG D 1 77  ? 29.629  27.633  18.189  1.00 42.60 ? 77   ARG D CG    1 
ATOM   4768 C  CD    . ARG D 1 77  ? 30.028  26.272  17.647  1.00 46.11 ? 77   ARG D CD    1 
ATOM   4769 N  NE    . ARG D 1 77  ? 29.931  26.215  16.190  1.00 47.43 ? 77   ARG D NE    1 
ATOM   4770 C  CZ    . ARG D 1 77  ? 30.380  25.209  15.446  1.00 47.97 ? 77   ARG D CZ    1 
ATOM   4771 N  NH1   . ARG D 1 77  ? 30.964  24.162  16.017  1.00 45.76 ? 77   ARG D NH1   1 
ATOM   4772 N  NH2   . ARG D 1 77  ? 30.239  25.247  14.127  1.00 46.71 ? 77   ARG D NH2   1 
ATOM   4773 N  N     . GLN D 1 78  ? 24.767  27.517  19.090  1.00 31.43 ? 78   GLN D N     1 
ATOM   4774 C  CA    . GLN D 1 78  ? 23.486  28.221  19.071  1.00 29.86 ? 78   GLN D CA    1 
ATOM   4775 C  C     . GLN D 1 78  ? 22.934  28.505  20.462  1.00 27.87 ? 78   GLN D C     1 
ATOM   4776 O  O     . GLN D 1 78  ? 23.242  27.800  21.419  1.00 28.64 ? 78   GLN D O     1 
ATOM   4777 C  CB    . GLN D 1 78  ? 22.450  27.446  18.253  1.00 28.52 ? 78   GLN D CB    1 
ATOM   4778 C  CG    . GLN D 1 78  ? 22.672  27.508  16.752  1.00 29.91 ? 78   GLN D CG    1 
ATOM   4779 C  CD    . GLN D 1 78  ? 21.647  26.703  15.977  1.00 30.72 ? 78   GLN D CD    1 
ATOM   4780 O  OE1   . GLN D 1 78  ? 21.758  25.481  15.863  1.00 31.52 ? 78   GLN D OE1   1 
ATOM   4781 N  NE2   . GLN D 1 78  ? 20.645  27.385  15.434  1.00 29.19 ? 78   GLN D NE2   1 
ATOM   4782 N  N     . ARG D 1 79  ? 22.119  29.549  20.564  1.00 31.03 ? 79   ARG D N     1 
ATOM   4783 C  CA    . ARG D 1 79  ? 21.509  29.925  21.835  1.00 33.83 ? 79   ARG D CA    1 
ATOM   4784 C  C     . ARG D 1 79  ? 20.002  29.738  21.757  1.00 31.08 ? 79   ARG D C     1 
ATOM   4785 O  O     . ARG D 1 79  ? 19.343  30.292  20.875  1.00 32.95 ? 79   ARG D O     1 
ATOM   4786 C  CB    . ARG D 1 79  ? 21.846  31.376  22.189  1.00 37.03 ? 79   ARG D CB    1 
ATOM   4787 C  CG    . ARG D 1 79  ? 23.319  31.612  22.489  1.00 46.21 ? 79   ARG D CG    1 
ATOM   4788 C  CD    . ARG D 1 79  ? 23.591  33.069  22.837  1.00 51.65 ? 79   ARG D CD    1 
ATOM   4789 N  NE    . ARG D 1 79  ? 24.987  33.292  23.208  1.00 56.41 ? 79   ARG D NE    1 
ATOM   4790 C  CZ    . ARG D 1 79  ? 25.488  33.068  24.421  1.00 59.66 ? 79   ARG D CZ    1 
ATOM   4791 N  NH1   . ARG D 1 79  ? 24.709  32.612  25.395  1.00 61.32 ? 79   ARG D NH1   1 
ATOM   4792 N  NH2   . ARG D 1 79  ? 26.773  33.297  24.660  1.00 61.42 ? 79   ARG D NH2   1 
ATOM   4793 N  N     . LEU D 1 80  ? 19.461  28.972  22.698  1.00 32.06 ? 80   LEU D N     1 
ATOM   4794 C  CA    . LEU D 1 80  ? 18.034  28.686  22.745  1.00 31.42 ? 80   LEU D CA    1 
ATOM   4795 C  C     . LEU D 1 80  ? 17.159  29.934  22.647  1.00 32.83 ? 80   LEU D C     1 
ATOM   4796 O  O     . LEU D 1 80  ? 16.179  29.944  21.904  1.00 32.94 ? 80   LEU D O     1 
ATOM   4797 C  CB    . LEU D 1 80  ? 17.696  27.892  24.008  1.00 32.17 ? 80   LEU D CB    1 
ATOM   4798 C  CG    . LEU D 1 80  ? 16.258  27.390  24.150  1.00 33.53 ? 80   LEU D CG    1 
ATOM   4799 C  CD1   . LEU D 1 80  ? 15.873  26.562  22.927  1.00 32.89 ? 80   LEU D CD1   1 
ATOM   4800 C  CD2   . LEU D 1 80  ? 16.120  26.568  25.426  1.00 33.71 ? 80   LEU D CD2   1 
ATOM   4801 N  N     . GLU D 1 81  ? 17.533  30.993  23.363  1.00 34.10 ? 81   GLU D N     1 
ATOM   4802 C  CA    . GLU D 1 81  ? 16.766  32.236  23.339  1.00 37.01 ? 81   GLU D CA    1 
ATOM   4803 C  C     . GLU D 1 81  ? 16.671  32.829  21.933  1.00 36.16 ? 81   GLU D C     1 
ATOM   4804 O  O     . GLU D 1 81  ? 15.628  33.357  21.544  1.00 34.55 ? 81   GLU D O     1 
ATOM   4805 C  CB    . GLU D 1 81  ? 17.355  33.268  24.317  1.00 42.01 ? 81   GLU D CB    1 
ATOM   4806 C  CG    . GLU D 1 81  ? 18.809  33.672  24.050  1.00 48.39 ? 81   GLU D CG    1 
ATOM   4807 C  CD    . GLU D 1 81  ? 19.823  32.906  24.896  1.00 52.72 ? 81   GLU D CD    1 
ATOM   4808 O  OE1   . GLU D 1 81  ? 19.598  31.710  25.197  1.00 53.38 ? 81   GLU D OE1   1 
ATOM   4809 O  OE2   . GLU D 1 81  ? 20.859  33.509  25.256  1.00 52.44 ? 81   GLU D OE2   1 
ATOM   4810 N  N     . GLU D 1 82  ? 17.758  32.724  21.171  1.00 36.34 ? 82   GLU D N     1 
ATOM   4811 C  CA    . GLU D 1 82  ? 17.802  33.244  19.805  1.00 37.48 ? 82   GLU D CA    1 
ATOM   4812 C  C     . GLU D 1 82  ? 17.073  32.314  18.841  1.00 35.21 ? 82   GLU D C     1 
ATOM   4813 O  O     . GLU D 1 82  ? 16.474  32.764  17.864  1.00 33.88 ? 82   GLU D O     1 
ATOM   4814 C  CB    . GLU D 1 82  ? 19.253  33.438  19.357  1.00 40.88 ? 82   GLU D CB    1 
ATOM   4815 C  CG    . GLU D 1 82  ? 19.992  34.517  20.147  1.00 46.08 ? 82   GLU D CG    1 
ATOM   4816 C  CD    . GLU D 1 82  ? 21.467  34.635  19.790  1.00 49.73 ? 82   GLU D CD    1 
ATOM   4817 O  OE1   . GLU D 1 82  ? 21.879  34.156  18.709  1.00 51.19 ? 82   GLU D OE1   1 
ATOM   4818 O  OE2   . GLU D 1 82  ? 22.219  35.221  20.600  1.00 49.89 ? 82   GLU D OE2   1 
ATOM   4819 N  N     . VAL D 1 83  ? 17.138  31.016  19.126  1.00 34.09 ? 83   VAL D N     1 
ATOM   4820 C  CA    . VAL D 1 83  ? 16.481  29.998  18.311  1.00 33.19 ? 83   VAL D CA    1 
ATOM   4821 C  C     . VAL D 1 83  ? 14.962  30.201  18.342  1.00 31.91 ? 83   VAL D C     1 
ATOM   4822 O  O     . VAL D 1 83  ? 14.299  30.147  17.306  1.00 33.06 ? 83   VAL D O     1 
ATOM   4823 C  CB    . VAL D 1 83  ? 16.852  28.572  18.812  1.00 33.77 ? 83   VAL D CB    1 
ATOM   4824 C  CG1   . VAL D 1 83  ? 15.994  27.518  18.139  1.00 34.59 ? 83   VAL D CG1   1 
ATOM   4825 C  CG2   . VAL D 1 83  ? 18.322  28.291  18.536  1.00 33.06 ? 83   VAL D CG2   1 
ATOM   4826 N  N     . VAL D 1 84  ? 14.429  30.471  19.532  1.00 32.48 ? 84   VAL D N     1 
ATOM   4827 C  CA    . VAL D 1 84  ? 12.995  30.694  19.719  1.00 32.61 ? 84   VAL D CA    1 
ATOM   4828 C  C     . VAL D 1 84  ? 12.550  32.030  19.125  1.00 34.61 ? 84   VAL D C     1 
ATOM   4829 O  O     . VAL D 1 84  ? 11.406  32.170  18.684  1.00 32.91 ? 84   VAL D O     1 
ATOM   4830 C  CB    . VAL D 1 84  ? 12.616  30.635  21.219  1.00 32.86 ? 84   VAL D CB    1 
ATOM   4831 C  CG1   . VAL D 1 84  ? 11.137  30.925  21.418  1.00 34.64 ? 84   VAL D CG1   1 
ATOM   4832 C  CG2   . VAL D 1 84  ? 12.958  29.271  21.780  1.00 34.22 ? 84   VAL D CG2   1 
ATOM   4833 N  N     . GLY D 1 85  ? 13.460  33.005  19.122  1.00 35.20 ? 85   GLY D N     1 
ATOM   4834 C  CA    . GLY D 1 85  ? 13.168  34.319  18.572  1.00 36.71 ? 85   GLY D CA    1 
ATOM   4835 C  C     . GLY D 1 85  ? 11.938  35.000  19.143  1.00 36.99 ? 85   GLY D C     1 
ATOM   4836 O  O     . GLY D 1 85  ? 11.216  35.688  18.421  1.00 38.71 ? 85   GLY D O     1 
ATOM   4837 N  N     . GLY D 1 86  ? 11.693  34.793  20.435  1.00 37.67 ? 86   GLY D N     1 
ATOM   4838 C  CA    . GLY D 1 86  ? 10.544  35.394  21.092  1.00 40.74 ? 86   GLY D CA    1 
ATOM   4839 C  C     . GLY D 1 86  ? 9.197   34.994  20.512  1.00 41.11 ? 86   GLY D C     1 
ATOM   4840 O  O     . GLY D 1 86  ? 8.211   35.712  20.682  1.00 41.28 ? 86   GLY D O     1 
ATOM   4841 N  N     . ALA D 1 87  ? 9.149   33.850  19.831  1.00 41.32 ? 87   ALA D N     1 
ATOM   4842 C  CA    . ALA D 1 87  ? 7.910   33.370  19.225  1.00 40.02 ? 87   ALA D CA    1 
ATOM   4843 C  C     . ALA D 1 87  ? 7.080   32.522  20.186  1.00 40.42 ? 87   ALA D C     1 
ATOM   4844 O  O     . ALA D 1 87  ? 6.741   31.371  19.896  1.00 39.58 ? 87   ALA D O     1 
ATOM   4845 C  CB    . ALA D 1 87  ? 8.208   32.598  17.946  1.00 41.33 ? 87   ALA D CB    1 
ATOM   4846 N  N     . VAL D 1 88  ? 6.780   33.101  21.344  1.00 39.73 ? 88   VAL D N     1 
ATOM   4847 C  CA    . VAL D 1 88  ? 5.975   32.452  22.371  1.00 39.47 ? 88   VAL D CA    1 
ATOM   4848 C  C     . VAL D 1 88  ? 4.691   33.274  22.467  1.00 41.02 ? 88   VAL D C     1 
ATOM   4849 O  O     . VAL D 1 88  ? 4.729   34.467  22.771  1.00 41.19 ? 88   VAL D O     1 
ATOM   4850 C  CB    . VAL D 1 88  ? 6.708   32.441  23.730  1.00 38.79 ? 88   VAL D CB    1 
ATOM   4851 C  CG1   . VAL D 1 88  ? 5.866   31.740  24.783  1.00 39.57 ? 88   VAL D CG1   1 
ATOM   4852 C  CG2   . VAL D 1 88  ? 8.052   31.751  23.591  1.00 39.15 ? 88   VAL D CG2   1 
ATOM   4853 N  N     . PHE D 1 89  ? 3.562   32.639  22.169  1.00 41.56 ? 89   PHE D N     1 
ATOM   4854 C  CA    . PHE D 1 89  ? 2.267   33.314  22.181  1.00 41.76 ? 89   PHE D CA    1 
ATOM   4855 C  C     . PHE D 1 89  ? 1.342   32.773  23.271  1.00 40.73 ? 89   PHE D C     1 
ATOM   4856 O  O     . PHE D 1 89  ? 1.598   31.714  23.846  1.00 41.03 ? 89   PHE D O     1 
ATOM   4857 C  CB    . PHE D 1 89  ? 1.592   33.152  20.811  1.00 42.00 ? 89   PHE D CB    1 
ATOM   4858 C  CG    . PHE D 1 89  ? 2.510   33.398  19.647  1.00 43.53 ? 89   PHE D CG    1 
ATOM   4859 C  CD1   . PHE D 1 89  ? 2.821   34.693  19.248  1.00 46.24 ? 89   PHE D CD1   1 
ATOM   4860 C  CD2   . PHE D 1 89  ? 3.080   32.330  18.959  1.00 44.38 ? 89   PHE D CD2   1 
ATOM   4861 C  CE1   . PHE D 1 89  ? 3.689   34.923  18.181  1.00 46.61 ? 89   PHE D CE1   1 
ATOM   4862 C  CE2   . PHE D 1 89  ? 3.948   32.548  17.892  1.00 45.09 ? 89   PHE D CE2   1 
ATOM   4863 C  CZ    . PHE D 1 89  ? 4.254   33.847  17.503  1.00 47.01 ? 89   PHE D CZ    1 
ATOM   4864 N  N     . PRO D 1 90  ? 0.268   33.516  23.594  1.00 40.86 ? 90   PRO D N     1 
ATOM   4865 C  CA    . PRO D 1 90  ? -0.675  33.069  24.623  1.00 40.02 ? 90   PRO D CA    1 
ATOM   4866 C  C     . PRO D 1 90  ? -1.468  31.858  24.138  1.00 39.48 ? 90   PRO D C     1 
ATOM   4867 O  O     . PRO D 1 90  ? -1.823  31.770  22.959  1.00 39.34 ? 90   PRO D O     1 
ATOM   4868 C  CB    . PRO D 1 90  ? -1.571  34.294  24.816  1.00 41.78 ? 90   PRO D CB    1 
ATOM   4869 C  CG    . PRO D 1 90  ? -1.556  34.941  23.461  1.00 41.69 ? 90   PRO D CG    1 
ATOM   4870 C  CD    . PRO D 1 90  ? -0.098  34.856  23.097  1.00 41.48 ? 90   PRO D CD    1 
ATOM   4871 N  N     . ALA D 1 91  ? -1.723  30.921  25.046  1.00 38.34 ? 91   ALA D N     1 
ATOM   4872 C  CA    . ALA D 1 91  ? -2.465  29.705  24.724  1.00 39.18 ? 91   ALA D CA    1 
ATOM   4873 C  C     . ALA D 1 91  ? -3.878  29.999  24.228  1.00 39.18 ? 91   ALA D C     1 
ATOM   4874 O  O     . ALA D 1 91  ? -4.510  30.971  24.652  1.00 38.67 ? 91   ALA D O     1 
ATOM   4875 C  CB    . ALA D 1 91  ? -2.510  28.781  25.936  1.00 39.16 ? 91   ALA D CB    1 
ATOM   4876 N  N     . GLU D 1 92  ? -4.357  29.161  23.313  1.00 38.72 ? 92   GLU D N     1 
ATOM   4877 C  CA    . GLU D 1 92  ? -5.694  29.308  22.740  1.00 37.95 ? 92   GLU D CA    1 
ATOM   4878 C  C     . GLU D 1 92  ? -6.655  28.281  23.334  1.00 38.53 ? 92   GLU D C     1 
ATOM   4879 O  O     . GLU D 1 92  ? -7.872  28.462  23.294  1.00 37.05 ? 92   GLU D O     1 
ATOM   4880 C  CB    . GLU D 1 92  ? -5.640  29.136  21.219  1.00 36.72 ? 92   GLU D CB    1 
ATOM   4881 C  CG    . GLU D 1 92  ? -4.763  30.149  20.487  1.00 37.39 ? 92   GLU D CG    1 
ATOM   4882 C  CD    . GLU D 1 92  ? -5.372  31.548  20.404  1.00 37.75 ? 92   GLU D CD    1 
ATOM   4883 O  OE1   . GLU D 1 92  ? -4.610  32.505  20.147  1.00 39.52 ? 92   GLU D OE1   1 
ATOM   4884 O  OE2   . GLU D 1 92  ? -6.603  31.692  20.572  1.00 36.36 ? 92   GLU D OE2   1 
ATOM   4885 N  N     . GLY D 1 93  ? -6.094  27.201  23.872  1.00 40.23 ? 93   GLY D N     1 
ATOM   4886 C  CA    . GLY D 1 93  ? -6.891  26.142  24.467  1.00 39.64 ? 93   GLY D CA    1 
ATOM   4887 C  C     . GLY D 1 93  ? -6.085  25.345  25.476  1.00 41.10 ? 93   GLY D C     1 
ATOM   4888 O  O     . GLY D 1 93  ? -4.940  25.691  25.779  1.00 40.73 ? 93   GLY D O     1 
ATOM   4889 N  N     . SER D 1 94  ? -6.672  24.266  25.984  1.00 41.11 ? 94   SER D N     1 
ATOM   4890 C  CA    . SER D 1 94  ? -6.010  23.424  26.980  1.00 41.16 ? 94   SER D CA    1 
ATOM   4891 C  C     . SER D 1 94  ? -5.529  22.081  26.440  1.00 38.78 ? 94   SER D C     1 
ATOM   4892 O  O     . SER D 1 94  ? -4.713  21.411  27.076  1.00 37.44 ? 94   SER D O     1 
ATOM   4893 C  CB    . SER D 1 94  ? -6.950  23.180  28.164  1.00 42.28 ? 94   SER D CB    1 
ATOM   4894 O  OG    . SER D 1 94  ? -8.137  22.528  27.742  1.00 43.84 ? 94   SER D OG    1 
ATOM   4895 N  N     . GLU D 1 95  ? -6.045  21.682  25.280  1.00 36.66 ? 95   GLU D N     1 
ATOM   4896 C  CA    . GLU D 1 95  ? -5.676  20.405  24.678  1.00 35.66 ? 95   GLU D CA    1 
ATOM   4897 C  C     . GLU D 1 95  ? -4.229  20.367  24.202  1.00 31.22 ? 95   GLU D C     1 
ATOM   4898 O  O     . GLU D 1 95  ? -3.622  21.405  23.941  1.00 29.52 ? 95   GLU D O     1 
ATOM   4899 C  CB    . GLU D 1 95  ? -6.625  20.060  23.528  1.00 37.20 ? 95   GLU D CB    1 
ATOM   4900 C  CG    . GLU D 1 95  ? -8.089  19.941  23.945  1.00 39.82 ? 95   GLU D CG    1 
ATOM   4901 C  CD    . GLU D 1 95  ? -8.321  18.913  25.039  1.00 43.44 ? 95   GLU D CD    1 
ATOM   4902 O  OE1   . GLU D 1 95  ? -7.755  17.801  24.954  1.00 46.12 ? 95   GLU D OE1   1 
ATOM   4903 O  OE2   . GLU D 1 95  ? -9.081  19.216  25.984  1.00 45.57 ? 95   GLU D OE2   1 
ATOM   4904 N  N     . MET D 1 96  ? -3.670  19.164  24.114  1.00 30.18 ? 96   MET D N     1 
ATOM   4905 C  CA    . MET D 1 96  ? -2.294  19.029  23.678  1.00 28.47 ? 96   MET D CA    1 
ATOM   4906 C  C     . MET D 1 96  ? -2.115  19.375  22.208  1.00 26.94 ? 96   MET D C     1 
ATOM   4907 O  O     . MET D 1 96  ? -3.042  19.254  21.404  1.00 25.83 ? 96   MET D O     1 
ATOM   4908 C  CB    . MET D 1 96  ? -1.741  17.624  23.961  1.00 30.10 ? 96   MET D CB    1 
ATOM   4909 C  CG    . MET D 1 96  ? -2.244  16.513  23.051  1.00 31.83 ? 96   MET D CG    1 
ATOM   4910 S  SD    . MET D 1 96  ? -1.190  15.039  23.163  1.00 28.38 ? 96   MET D SD    1 
ATOM   4911 C  CE    . MET D 1 96  ? -1.562  14.478  24.842  1.00 24.65 ? 96   MET D CE    1 
ATOM   4912 N  N     . VAL D 1 97  ? -0.934  19.897  21.901  1.00 24.92 ? 97   VAL D N     1 
ATOM   4913 C  CA    . VAL D 1 97  ? -0.550  20.260  20.547  1.00 22.78 ? 97   VAL D CA    1 
ATOM   4914 C  C     . VAL D 1 97  ? 0.490   19.212  20.166  1.00 23.65 ? 97   VAL D C     1 
ATOM   4915 O  O     . VAL D 1 97  ? 1.384   18.912  20.957  1.00 23.29 ? 97   VAL D O     1 
ATOM   4916 C  CB    . VAL D 1 97  ? 0.106   21.664  20.505  1.00 22.44 ? 97   VAL D CB    1 
ATOM   4917 C  CG1   . VAL D 1 97  ? 0.632   21.964  19.102  1.00 22.60 ? 97   VAL D CG1   1 
ATOM   4918 C  CG2   . VAL D 1 97  ? -0.896  22.732  20.937  1.00 19.84 ? 97   VAL D CG2   1 
ATOM   4919 N  N     . VAL D 1 98  ? 0.334   18.611  18.990  1.00 21.89 ? 98   VAL D N     1 
ATOM   4920 C  CA    . VAL D 1 98  ? 1.272   17.597  18.526  1.00 18.42 ? 98   VAL D CA    1 
ATOM   4921 C  C     . VAL D 1 98  ? 1.882   18.024  17.204  1.00 20.27 ? 98   VAL D C     1 
ATOM   4922 O  O     . VAL D 1 98  ? 1.168   18.286  16.237  1.00 24.15 ? 98   VAL D O     1 
ATOM   4923 C  CB    . VAL D 1 98  ? 0.586   16.204  18.341  1.00 20.68 ? 98   VAL D CB    1 
ATOM   4924 C  CG1   . VAL D 1 98  ? 1.608   15.161  17.876  1.00 19.24 ? 98   VAL D CG1   1 
ATOM   4925 C  CG2   . VAL D 1 98  ? -0.057  15.748  19.648  1.00 18.41 ? 98   VAL D CG2   1 
ATOM   4926 N  N     . VAL D 1 99  ? 3.202   18.172  17.197  1.00 18.16 ? 99   VAL D N     1 
ATOM   4927 C  CA    . VAL D 1 99  ? 3.931   18.537  15.993  1.00 22.24 ? 99   VAL D CA    1 
ATOM   4928 C  C     . VAL D 1 99  ? 4.738   17.291  15.640  1.00 21.87 ? 99   VAL D C     1 
ATOM   4929 O  O     . VAL D 1 99  ? 5.744   16.991  16.278  1.00 24.56 ? 99   VAL D O     1 
ATOM   4930 C  CB    . VAL D 1 99  ? 4.881   19.736  16.236  1.00 22.29 ? 99   VAL D CB    1 
ATOM   4931 C  CG1   . VAL D 1 99  ? 5.666   20.045  14.975  1.00 22.93 ? 99   VAL D CG1   1 
ATOM   4932 C  CG2   . VAL D 1 99  ? 4.074   20.968  16.661  1.00 24.01 ? 99   VAL D CG2   1 
ATOM   4933 N  N     . LYS D 1 100 ? 4.266   16.537  14.656  1.00 21.54 ? 100  LYS D N     1 
ATOM   4934 C  CA    . LYS D 1 100 ? 4.956   15.315  14.268  1.00 21.32 ? 100  LYS D CA    1 
ATOM   4935 C  C     . LYS D 1 100 ? 5.687   15.368  12.936  1.00 18.17 ? 100  LYS D C     1 
ATOM   4936 O  O     . LYS D 1 100 ? 5.515   16.295  12.152  1.00 14.50 ? 100  LYS D O     1 
ATOM   4937 C  CB    . LYS D 1 100 ? 3.978   14.139  14.290  1.00 26.24 ? 100  LYS D CB    1 
ATOM   4938 C  CG    . LYS D 1 100 ? 2.684   14.372  13.541  1.00 27.77 ? 100  LYS D CG    1 
ATOM   4939 C  CD    . LYS D 1 100 ? 1.663   13.302  13.896  1.00 29.92 ? 100  LYS D CD    1 
ATOM   4940 C  CE    . LYS D 1 100 ? 0.397   13.452  13.085  1.00 31.82 ? 100  LYS D CE    1 
ATOM   4941 N  NZ    . LYS D 1 100 ? -0.707  12.556  13.563  1.00 34.55 ? 100  LYS D NZ    1 
ATOM   4942 N  N     . GLY D 1 101 ? 6.548   14.379  12.717  1.00 16.88 ? 101  GLY D N     1 
ATOM   4943 C  CA    . GLY D 1 101 ? 7.283   14.295  11.470  1.00 15.97 ? 101  GLY D CA    1 
ATOM   4944 C  C     . GLY D 1 101 ? 8.364   15.327  11.217  1.00 14.75 ? 101  GLY D C     1 
ATOM   4945 O  O     . GLY D 1 101 ? 8.641   15.636  10.064  1.00 14.17 ? 101  GLY D O     1 
ATOM   4946 N  N     . VAL D 1 102 ? 8.934   15.913  12.266  1.00 14.65 ? 102  VAL D N     1 
ATOM   4947 C  CA    . VAL D 1 102 ? 10.012  16.877  12.053  1.00 14.45 ? 102  VAL D CA    1 
ATOM   4948 C  C     . VAL D 1 102 ? 11.275  16.074  11.741  1.00 12.93 ? 102  VAL D C     1 
ATOM   4949 O  O     . VAL D 1 102 ? 11.851  15.440  12.627  1.00 16.18 ? 102  VAL D O     1 
ATOM   4950 C  CB    . VAL D 1 102 ? 10.255  17.777  13.282  1.00 16.60 ? 102  VAL D CB    1 
ATOM   4951 C  CG1   . VAL D 1 102 ? 11.457  18.703  13.026  1.00 15.93 ? 102  VAL D CG1   1 
ATOM   4952 C  CG2   . VAL D 1 102 ? 9.014   18.600  13.576  1.00 14.62 ? 102  VAL D CG2   1 
ATOM   4953 N  N     . GLU D 1 103 ? 11.677  16.064  10.472  1.00 12.93 ? 103  GLU D N     1 
ATOM   4954 C  CA    . GLU D 1 103 ? 12.862  15.314  10.075  1.00 15.54 ? 103  GLU D CA    1 
ATOM   4955 C  C     . GLU D 1 103 ? 14.115  15.883  10.729  1.00 16.57 ? 103  GLU D C     1 
ATOM   4956 O  O     . GLU D 1 103 ? 14.226  17.093  10.926  1.00 18.17 ? 103  GLU D O     1 
ATOM   4957 C  CB    . GLU D 1 103 ? 13.018  15.271  8.545   1.00 16.30 ? 103  GLU D CB    1 
ATOM   4958 C  CG    . GLU D 1 103 ? 13.317  16.609  7.866   1.00 16.35 ? 103  GLU D CG    1 
ATOM   4959 C  CD    . GLU D 1 103 ? 12.088  17.272  7.262   1.00 17.12 ? 103  GLU D CD    1 
ATOM   4960 O  OE1   . GLU D 1 103 ? 12.236  17.938  6.217   1.00 18.66 ? 103  GLU D OE1   1 
ATOM   4961 O  OE2   . GLU D 1 103 ? 10.975  17.127  7.813   1.00 19.32 ? 103  GLU D OE2   1 
ATOM   4962 N  N     . PHE D 1 104 ? 15.031  14.999  11.108  1.00 17.38 ? 104  PHE D N     1 
ATOM   4963 C  CA    . PHE D 1 104 ? 16.282  15.419  11.736  1.00 18.05 ? 104  PHE D CA    1 
ATOM   4964 C  C     . PHE D 1 104 ? 17.449  14.609  11.194  1.00 16.91 ? 104  PHE D C     1 
ATOM   4965 O  O     . PHE D 1 104 ? 17.275  13.483  10.729  1.00 16.50 ? 104  PHE D O     1 
ATOM   4966 C  CB    . PHE D 1 104 ? 16.223  15.244  13.266  1.00 14.01 ? 104  PHE D CB    1 
ATOM   4967 C  CG    . PHE D 1 104 ? 16.530  13.842  13.735  1.00 14.20 ? 104  PHE D CG    1 
ATOM   4968 C  CD1   . PHE D 1 104 ? 17.835  13.466  14.051  1.00 15.06 ? 104  PHE D CD1   1 
ATOM   4969 C  CD2   . PHE D 1 104 ? 15.521  12.881  13.807  1.00 14.62 ? 104  PHE D CD2   1 
ATOM   4970 C  CE1   . PHE D 1 104 ? 18.136  12.159  14.423  1.00 14.69 ? 104  PHE D CE1   1 
ATOM   4971 C  CE2   . PHE D 1 104 ? 15.808  11.573  14.178  1.00 15.20 ? 104  PHE D CE2   1 
ATOM   4972 C  CZ    . PHE D 1 104 ? 17.119  11.206  14.487  1.00 16.88 ? 104  PHE D CZ    1 
ATOM   4973 N  N     . TYR D 1 105 ? 18.639  15.193  11.270  1.00 14.43 ? 105  TYR D N     1 
ATOM   4974 C  CA    . TYR D 1 105 ? 19.860  14.531  10.845  1.00 15.77 ? 105  TYR D CA    1 
ATOM   4975 C  C     . TYR D 1 105 ? 20.907  14.847  11.904  1.00 17.34 ? 105  TYR D C     1 
ATOM   4976 O  O     . TYR D 1 105 ? 21.044  15.997  12.322  1.00 16.69 ? 105  TYR D O     1 
ATOM   4977 C  CB    . TYR D 1 105 ? 20.328  15.044  9.483   1.00 15.19 ? 105  TYR D CB    1 
ATOM   4978 C  CG    . TYR D 1 105 ? 19.407  14.713  8.330   1.00 14.75 ? 105  TYR D CG    1 
ATOM   4979 C  CD1   . TYR D 1 105 ? 19.611  13.573  7.554   1.00 18.31 ? 105  TYR D CD1   1 
ATOM   4980 C  CD2   . TYR D 1 105 ? 18.342  15.552  8.001   1.00 16.56 ? 105  TYR D CD2   1 
ATOM   4981 C  CE1   . TYR D 1 105 ? 18.775  13.273  6.472   1.00 15.71 ? 105  TYR D CE1   1 
ATOM   4982 C  CE2   . TYR D 1 105 ? 17.501  15.264  6.924   1.00 17.36 ? 105  TYR D CE2   1 
ATOM   4983 C  CZ    . TYR D 1 105 ? 17.726  14.123  6.166   1.00 18.89 ? 105  TYR D CZ    1 
ATOM   4984 O  OH    . TYR D 1 105 ? 16.902  13.836  5.103   1.00 18.47 ? 105  TYR D OH    1 
ATOM   4985 N  N     . SER D 1 106 ? 21.622  13.824  12.356  1.00 16.94 ? 106  SER D N     1 
ATOM   4986 C  CA    . SER D 1 106 ? 22.651  14.016  13.371  1.00 19.30 ? 106  SER D CA    1 
ATOM   4987 C  C     . SER D 1 106 ? 23.840  13.101  13.088  1.00 20.31 ? 106  SER D C     1 
ATOM   4988 O  O     . SER D 1 106 ? 23.871  12.393  12.080  1.00 21.59 ? 106  SER D O     1 
ATOM   4989 C  CB    . SER D 1 106 ? 22.078  13.749  14.773  1.00 19.71 ? 106  SER D CB    1 
ATOM   4990 O  OG    . SER D 1 106 ? 22.978  14.156  15.799  1.00 20.24 ? 106  SER D OG    1 
ATOM   4991 N  N     . MET D 1 107 ? 24.838  13.159  13.958  1.00 19.34 ? 107  MET D N     1 
ATOM   4992 C  CA    . MET D 1 107 ? 26.037  12.344  13.825  1.00 19.86 ? 107  MET D CA    1 
ATOM   4993 C  C     . MET D 1 107 ? 26.231  11.604  15.138  1.00 18.71 ? 107  MET D C     1 
ATOM   4994 O  O     . MET D 1 107 ? 26.132  12.209  16.204  1.00 20.12 ? 107  MET D O     1 
ATOM   4995 C  CB    . MET D 1 107 ? 27.251  13.244  13.558  1.00 21.75 ? 107  MET D CB    1 
ATOM   4996 C  CG    . MET D 1 107 ? 27.331  13.795  12.148  1.00 27.33 ? 107  MET D CG    1 
ATOM   4997 S  SD    . MET D 1 107 ? 27.902  12.534  10.998  1.00 28.04 ? 107  MET D SD    1 
ATOM   4998 C  CE    . MET D 1 107 ? 28.412  13.525  9.622   1.00 28.79 ? 107  MET D CE    1 
ATOM   4999 N  N     . CYS D 1 108 ? 26.470  10.297  15.081  1.00 18.20 ? 108  CYS D N     1 
ATOM   5000 C  CA    . CYS D 1 108 ? 26.670  9.542   16.316  1.00 20.50 ? 108  CYS D CA    1 
ATOM   5001 C  C     . CYS D 1 108 ? 28.066  9.843   16.851  1.00 20.81 ? 108  CYS D C     1 
ATOM   5002 O  O     . CYS D 1 108 ? 29.046  9.789   16.112  1.00 18.30 ? 108  CYS D O     1 
ATOM   5003 C  CB    . CYS D 1 108 ? 26.494  8.038   16.099  1.00 21.99 ? 108  CYS D CB    1 
ATOM   5004 S  SG    . CYS D 1 108 ? 27.813  7.240   15.165  1.00 25.66 ? 108  CYS D SG    1 
ATOM   5005 N  N     . GLU D 1 109 ? 28.150  10.177  18.134  1.00 19.20 ? 109  GLU D N     1 
ATOM   5006 C  CA    . GLU D 1 109 ? 29.437  10.500  18.741  1.00 20.08 ? 109  GLU D CA    1 
ATOM   5007 C  C     . GLU D 1 109 ? 30.412  9.327   18.774  1.00 21.54 ? 109  GLU D C     1 
ATOM   5008 O  O     . GLU D 1 109 ? 31.620  9.526   18.900  1.00 21.30 ? 109  GLU D O     1 
ATOM   5009 C  CB    . GLU D 1 109 ? 29.238  11.051  20.153  1.00 21.66 ? 109  GLU D CB    1 
ATOM   5010 C  CG    . GLU D 1 109 ? 28.660  10.063  21.148  1.00 19.40 ? 109  GLU D CG    1 
ATOM   5011 C  CD    . GLU D 1 109 ? 28.456  10.687  22.523  1.00 25.12 ? 109  GLU D CD    1 
ATOM   5012 O  OE1   . GLU D 1 109 ? 28.616  9.975   23.534  1.00 22.32 ? 109  GLU D OE1   1 
ATOM   5013 O  OE2   . GLU D 1 109 ? 28.128  11.891  22.592  1.00 26.04 ? 109  GLU D OE2   1 
ATOM   5014 N  N     . HIS D 1 110 ? 29.893  8.110   18.629  1.00 21.05 ? 110  HIS D N     1 
ATOM   5015 C  CA    . HIS D 1 110 ? 30.730  6.912   18.653  1.00 21.96 ? 110  HIS D CA    1 
ATOM   5016 C  C     . HIS D 1 110 ? 31.502  6.636   17.359  1.00 22.87 ? 110  HIS D C     1 
ATOM   5017 O  O     . HIS D 1 110 ? 32.670  6.237   17.405  1.00 23.43 ? 110  HIS D O     1 
ATOM   5018 C  CB    . HIS D 1 110 ? 29.886  5.688   19.006  1.00 23.97 ? 110  HIS D CB    1 
ATOM   5019 C  CG    . HIS D 1 110 ? 29.108  5.838   20.273  1.00 29.14 ? 110  HIS D CG    1 
ATOM   5020 N  ND1   . HIS D 1 110 ? 27.764  6.143   20.289  1.00 33.50 ? 110  HIS D ND1   1 
ATOM   5021 C  CD2   . HIS D 1 110 ? 29.486  5.737   21.569  1.00 32.66 ? 110  HIS D CD2   1 
ATOM   5022 C  CE1   . HIS D 1 110 ? 27.348  6.224   21.540  1.00 32.81 ? 110  HIS D CE1   1 
ATOM   5023 N  NE2   . HIS D 1 110 ? 28.374  5.982   22.336  1.00 31.18 ? 110  HIS D NE2   1 
ATOM   5024 N  N     . HIS D 1 111 ? 30.858  6.849   16.214  1.00 22.30 ? 111  HIS D N     1 
ATOM   5025 C  CA    . HIS D 1 111 ? 31.492  6.585   14.917  1.00 20.89 ? 111  HIS D CA    1 
ATOM   5026 C  C     . HIS D 1 111 ? 31.567  7.782   13.978  1.00 19.54 ? 111  HIS D C     1 
ATOM   5027 O  O     . HIS D 1 111 ? 32.155  7.685   12.898  1.00 21.55 ? 111  HIS D O     1 
ATOM   5028 C  CB    . HIS D 1 111 ? 30.746  5.468   14.180  1.00 21.19 ? 111  HIS D CB    1 
ATOM   5029 C  CG    . HIS D 1 111 ? 30.654  4.188   14.946  1.00 20.36 ? 111  HIS D CG    1 
ATOM   5030 N  ND1   . HIS D 1 111 ? 29.605  3.903   15.791  1.00 22.01 ? 111  HIS D ND1   1 
ATOM   5031 C  CD2   . HIS D 1 111 ? 31.475  3.113   14.987  1.00 21.14 ? 111  HIS D CD2   1 
ATOM   5032 C  CE1   . HIS D 1 111 ? 29.783  2.706   16.320  1.00 22.75 ? 111  HIS D CE1   1 
ATOM   5033 N  NE2   . HIS D 1 111 ? 30.911  2.206   15.849  1.00 23.90 ? 111  HIS D NE2   1 
ATOM   5034 N  N     . LEU D 1 112 ? 30.948  8.892   14.362  1.00 19.06 ? 112  LEU D N     1 
ATOM   5035 C  CA    . LEU D 1 112 ? 30.928  10.092  13.524  1.00 19.52 ? 112  LEU D CA    1 
ATOM   5036 C  C     . LEU D 1 112 ? 30.267  9.800   12.168  1.00 19.94 ? 112  LEU D C     1 
ATOM   5037 O  O     . LEU D 1 112 ? 30.700  10.290  11.117  1.00 18.93 ? 112  LEU D O     1 
ATOM   5038 C  CB    . LEU D 1 112 ? 32.340  10.677  13.340  1.00 21.47 ? 112  LEU D CB    1 
ATOM   5039 C  CG    . LEU D 1 112 ? 33.091  11.087  14.611  1.00 24.37 ? 112  LEU D CG    1 
ATOM   5040 C  CD1   . LEU D 1 112 ? 34.265  11.990  14.249  1.00 25.17 ? 112  LEU D CD1   1 
ATOM   5041 C  CD2   . LEU D 1 112 ? 32.168  11.804  15.565  1.00 23.86 ? 112  LEU D CD2   1 
ATOM   5042 N  N     . LEU D 1 113 ? 29.249  8.943   12.209  1.00 17.53 ? 113  LEU D N     1 
ATOM   5043 C  CA    . LEU D 1 113 ? 28.467  8.580   11.030  1.00 16.95 ? 113  LEU D CA    1 
ATOM   5044 C  C     . LEU D 1 113 ? 27.050  9.075   11.294  1.00 15.09 ? 113  LEU D C     1 
ATOM   5045 O  O     . LEU D 1 113 ? 26.579  9.067   12.432  1.00 15.50 ? 113  LEU D O     1 
ATOM   5046 C  CB    . LEU D 1 113 ? 28.477  7.065   10.806  1.00 17.90 ? 113  LEU D CB    1 
ATOM   5047 C  CG    . LEU D 1 113 ? 29.811  6.493   10.319  1.00 18.15 ? 113  LEU D CG    1 
ATOM   5048 C  CD1   . LEU D 1 113 ? 29.764  4.980   10.303  1.00 18.10 ? 113  LEU D CD1   1 
ATOM   5049 C  CD2   . LEU D 1 113 ? 30.137  7.040   8.939   1.00 19.09 ? 113  LEU D CD2   1 
ATOM   5050 N  N     . PRO D 1 114 ? 26.345  9.499   10.244  1.00 14.99 ? 114  PRO D N     1 
ATOM   5051 C  CA    . PRO D 1 114 ? 24.982  10.003  10.390  1.00 15.62 ? 114  PRO D CA    1 
ATOM   5052 C  C     . PRO D 1 114 ? 23.920  9.018   10.866  1.00 16.89 ? 114  PRO D C     1 
ATOM   5053 O  O     . PRO D 1 114 ? 24.012  7.809   10.639  1.00 17.51 ? 114  PRO D O     1 
ATOM   5054 C  CB    . PRO D 1 114 ? 24.639  10.483  8.972   1.00 17.72 ? 114  PRO D CB    1 
ATOM   5055 C  CG    . PRO D 1 114 ? 25.975  10.734  8.337   1.00 13.60 ? 114  PRO D CG    1 
ATOM   5056 C  CD    . PRO D 1 114 ? 26.784  9.579   8.841   1.00 13.87 ? 114  PRO D CD    1 
ATOM   5057 N  N     . PHE D 1 115 ? 22.964  9.558   11.613  1.00 17.02 ? 115  PHE D N     1 
ATOM   5058 C  CA    . PHE D 1 115 ? 21.789  8.822   12.058  1.00 16.70 ? 115  PHE D CA    1 
ATOM   5059 C  C     . PHE D 1 115 ? 20.688  9.850   11.857  1.00 16.27 ? 115  PHE D C     1 
ATOM   5060 O  O     . PHE D 1 115 ? 20.891  11.043  12.090  1.00 15.62 ? 115  PHE D O     1 
ATOM   5061 C  CB    . PHE D 1 115 ? 21.896  8.226   13.477  1.00 17.94 ? 115  PHE D CB    1 
ATOM   5062 C  CG    . PHE D 1 115 ? 21.797  9.212   14.609  1.00 19.64 ? 115  PHE D CG    1 
ATOM   5063 C  CD1   . PHE D 1 115 ? 22.947  9.765   15.167  1.00 19.09 ? 115  PHE D CD1   1 
ATOM   5064 C  CD2   . PHE D 1 115 ? 20.567  9.486   15.203  1.00 16.04 ? 115  PHE D CD2   1 
ATOM   5065 C  CE1   . PHE D 1 115 ? 22.875  10.572  16.308  1.00 18.41 ? 115  PHE D CE1   1 
ATOM   5066 C  CE2   . PHE D 1 115 ? 20.482  10.293  16.346  1.00 21.54 ? 115  PHE D CE2   1 
ATOM   5067 C  CZ    . PHE D 1 115 ? 21.642  10.834  16.898  1.00 18.59 ? 115  PHE D CZ    1 
ATOM   5068 N  N     . PHE D 1 116 ? 19.568  9.416   11.294  1.00 15.26 ? 116  PHE D N     1 
ATOM   5069 C  CA    . PHE D 1 116 ? 18.502  10.356  10.983  1.00 14.57 ? 116  PHE D CA    1 
ATOM   5070 C  C     . PHE D 1 116 ? 17.119  9.737   11.012  1.00 12.84 ? 116  PHE D C     1 
ATOM   5071 O  O     . PHE D 1 116 ? 16.975  8.516   11.034  1.00 14.22 ? 116  PHE D O     1 
ATOM   5072 C  CB    . PHE D 1 116 ? 18.766  10.940  9.596   1.00 16.32 ? 116  PHE D CB    1 
ATOM   5073 C  CG    . PHE D 1 116 ? 18.922  9.893   8.524   1.00 20.70 ? 116  PHE D CG    1 
ATOM   5074 C  CD1   . PHE D 1 116 ? 20.151  9.270   8.313   1.00 18.34 ? 116  PHE D CD1   1 
ATOM   5075 C  CD2   . PHE D 1 116 ? 17.830  9.507   7.748   1.00 24.14 ? 116  PHE D CD2   1 
ATOM   5076 C  CE1   . PHE D 1 116 ? 20.292  8.275   7.348   1.00 21.90 ? 116  PHE D CE1   1 
ATOM   5077 C  CE2   . PHE D 1 116 ? 17.959  8.507   6.776   1.00 23.01 ? 116  PHE D CE2   1 
ATOM   5078 C  CZ    . PHE D 1 116 ? 19.192  7.892   6.580   1.00 19.40 ? 116  PHE D CZ    1 
ATOM   5079 N  N     . GLY D 1 117 ? 16.108  10.598  10.989  1.00 12.31 ? 117  GLY D N     1 
ATOM   5080 C  CA    . GLY D 1 117 ? 14.735  10.140  11.021  1.00 13.85 ? 117  GLY D CA    1 
ATOM   5081 C  C     . GLY D 1 117 ? 13.785  11.283  11.293  1.00 13.33 ? 117  GLY D C     1 
ATOM   5082 O  O     . GLY D 1 117 ? 13.856  12.332  10.651  1.00 14.74 ? 117  GLY D O     1 
ATOM   5083 N  N     . LYS D 1 118 ? 12.888  11.085  12.251  1.00 15.80 ? 118  LYS D N     1 
ATOM   5084 C  CA    . LYS D 1 118 ? 11.913  12.106  12.588  1.00 14.92 ? 118  LYS D CA    1 
ATOM   5085 C  C     . LYS D 1 118 ? 11.785  12.285  14.089  1.00 16.23 ? 118  LYS D C     1 
ATOM   5086 O  O     . LYS D 1 118 ? 12.093  11.376  14.873  1.00 16.02 ? 118  LYS D O     1 
ATOM   5087 C  CB    . LYS D 1 118 ? 10.531  11.751  12.023  1.00 16.46 ? 118  LYS D CB    1 
ATOM   5088 C  CG    . LYS D 1 118 ? 10.479  11.508  10.520  1.00 20.53 ? 118  LYS D CG    1 
ATOM   5089 C  CD    . LYS D 1 118 ? 9.090   11.046  10.111  1.00 27.11 ? 118  LYS D CD    1 
ATOM   5090 C  CE    . LYS D 1 118 ? 9.083   10.435  8.713   1.00 35.71 ? 118  LYS D CE    1 
ATOM   5091 N  NZ    . LYS D 1 118 ? 9.622   11.359  7.679   1.00 39.85 ? 118  LYS D NZ    1 
ATOM   5092 N  N     . VAL D 1 119 ? 11.338  13.477  14.470  1.00 16.36 ? 119  VAL D N     1 
ATOM   5093 C  CA    . VAL D 1 119 ? 11.115  13.826  15.869  1.00 16.54 ? 119  VAL D CA    1 
ATOM   5094 C  C     . VAL D 1 119 ? 9.655   14.247  15.978  1.00 16.18 ? 119  VAL D C     1 
ATOM   5095 O  O     . VAL D 1 119 ? 9.165   15.037  15.165  1.00 14.22 ? 119  VAL D O     1 
ATOM   5096 C  CB    . VAL D 1 119 ? 12.000  15.014  16.325  1.00 18.04 ? 119  VAL D CB    1 
ATOM   5097 C  CG1   . VAL D 1 119 ? 11.748  15.327  17.805  1.00 18.23 ? 119  VAL D CG1   1 
ATOM   5098 C  CG2   . VAL D 1 119 ? 13.471  14.705  16.093  1.00 17.91 ? 119  VAL D CG2   1 
ATOM   5099 N  N     . HIS D 1 120 ? 8.956   13.687  16.960  1.00 15.65 ? 120  HIS D N     1 
ATOM   5100 C  CA    . HIS D 1 120 ? 7.555   14.013  17.184  1.00 15.53 ? 120  HIS D CA    1 
ATOM   5101 C  C     . HIS D 1 120 ? 7.487   14.689  18.542  1.00 17.88 ? 120  HIS D C     1 
ATOM   5102 O  O     . HIS D 1 120 ? 8.084   14.210  19.504  1.00 17.37 ? 120  HIS D O     1 
ATOM   5103 C  CB    . HIS D 1 120 ? 6.706   12.741  17.181  1.00 16.59 ? 120  HIS D CB    1 
ATOM   5104 C  CG    . HIS D 1 120 ? 6.973   11.848  16.011  1.00 16.35 ? 120  HIS D CG    1 
ATOM   5105 N  ND1   . HIS D 1 120 ? 6.662   12.205  14.717  1.00 17.15 ? 120  HIS D ND1   1 
ATOM   5106 C  CD2   . HIS D 1 120 ? 7.570   10.636  15.934  1.00 18.34 ? 120  HIS D CD2   1 
ATOM   5107 C  CE1   . HIS D 1 120 ? 7.061   11.253  13.893  1.00 18.46 ? 120  HIS D CE1   1 
ATOM   5108 N  NE2   . HIS D 1 120 ? 7.616   10.290  14.606  1.00 17.15 ? 120  HIS D NE2   1 
ATOM   5109 N  N     . ILE D 1 121 ? 6.775   15.808  18.607  1.00 19.03 ? 121  ILE D N     1 
ATOM   5110 C  CA    . ILE D 1 121 ? 6.657   16.570  19.843  1.00 21.39 ? 121  ILE D CA    1 
ATOM   5111 C  C     . ILE D 1 121 ? 5.214   16.807  20.251  1.00 19.77 ? 121  ILE D C     1 
ATOM   5112 O  O     . ILE D 1 121 ? 4.386   17.220  19.442  1.00 22.78 ? 121  ILE D O     1 
ATOM   5113 C  CB    . ILE D 1 121 ? 7.358   17.940  19.707  1.00 23.48 ? 121  ILE D CB    1 
ATOM   5114 C  CG1   . ILE D 1 121 ? 8.846   17.737  19.406  1.00 21.28 ? 121  ILE D CG1   1 
ATOM   5115 C  CG2   . ILE D 1 121 ? 7.162   18.767  20.980  1.00 23.73 ? 121  ILE D CG2   1 
ATOM   5116 C  CD1   . ILE D 1 121 ? 9.581   18.997  19.010  1.00 25.62 ? 121  ILE D CD1   1 
ATOM   5117 N  N     . GLY D 1 122 ? 4.929   16.559  21.523  1.00 21.83 ? 122  GLY D N     1 
ATOM   5118 C  CA    . GLY D 1 122 ? 3.594   16.781  22.039  1.00 21.78 ? 122  GLY D CA    1 
ATOM   5119 C  C     . GLY D 1 122 ? 3.682   17.548  23.344  1.00 22.03 ? 122  GLY D C     1 
ATOM   5120 O  O     . GLY D 1 122 ? 4.594   17.314  24.138  1.00 23.09 ? 122  GLY D O     1 
ATOM   5121 N  N     . TYR D 1 123 ? 2.771   18.492  23.552  1.00 21.92 ? 123  TYR D N     1 
ATOM   5122 C  CA    . TYR D 1 123 ? 2.766   19.256  24.794  1.00 24.19 ? 123  TYR D CA    1 
ATOM   5123 C  C     . TYR D 1 123 ? 1.408   19.853  25.122  1.00 24.27 ? 123  TYR D C     1 
ATOM   5124 O  O     . TYR D 1 123 ? 0.575   20.079  24.241  1.00 24.39 ? 123  TYR D O     1 
ATOM   5125 C  CB    . TYR D 1 123 ? 3.828   20.369  24.771  1.00 21.34 ? 123  TYR D CB    1 
ATOM   5126 C  CG    . TYR D 1 123 ? 3.422   21.620  24.026  1.00 25.61 ? 123  TYR D CG    1 
ATOM   5127 C  CD1   . TYR D 1 123 ? 3.004   22.760  24.717  1.00 26.29 ? 123  TYR D CD1   1 
ATOM   5128 C  CD2   . TYR D 1 123 ? 3.483   21.681  22.637  1.00 23.05 ? 123  TYR D CD2   1 
ATOM   5129 C  CE1   . TYR D 1 123 ? 2.662   23.926  24.042  1.00 27.00 ? 123  TYR D CE1   1 
ATOM   5130 C  CE2   . TYR D 1 123 ? 3.143   22.842  21.954  1.00 24.03 ? 123  TYR D CE2   1 
ATOM   5131 C  CZ    . TYR D 1 123 ? 2.737   23.960  22.663  1.00 26.75 ? 123  TYR D CZ    1 
ATOM   5132 O  OH    . TYR D 1 123 ? 2.432   25.117  21.992  1.00 27.17 ? 123  TYR D OH    1 
ATOM   5133 N  N     . ILE D 1 124 ? 1.197   20.073  26.414  1.00 25.36 ? 124  ILE D N     1 
ATOM   5134 C  CA    . ILE D 1 124 ? -0.019  20.675  26.931  1.00 26.05 ? 124  ILE D CA    1 
ATOM   5135 C  C     . ILE D 1 124 ? 0.460   21.994  27.523  1.00 25.66 ? 124  ILE D C     1 
ATOM   5136 O  O     . ILE D 1 124 ? 1.264   22.013  28.455  1.00 26.05 ? 124  ILE D O     1 
ATOM   5137 C  CB    . ILE D 1 124 ? -0.672  19.798  28.019  1.00 25.95 ? 124  ILE D CB    1 
ATOM   5138 C  CG1   . ILE D 1 124 ? -1.178  18.497  27.394  1.00 25.57 ? 124  ILE D CG1   1 
ATOM   5139 C  CG2   . ILE D 1 124 ? -1.822  20.551  28.691  1.00 27.63 ? 124  ILE D CG2   1 
ATOM   5140 C  CD1   . ILE D 1 124 ? -1.831  17.545  28.365  1.00 30.49 ? 124  ILE D CD1   1 
ATOM   5141 N  N     . PRO D 1 125 ? 0.000   23.114  26.957  1.00 26.57 ? 125  PRO D N     1 
ATOM   5142 C  CA    . PRO D 1 125 ? 0.395   24.442  27.426  1.00 28.98 ? 125  PRO D CA    1 
ATOM   5143 C  C     . PRO D 1 125 ? -0.144  24.834  28.791  1.00 30.19 ? 125  PRO D C     1 
ATOM   5144 O  O     . PRO D 1 125 ? -1.026  24.182  29.348  1.00 25.92 ? 125  PRO D O     1 
ATOM   5145 C  CB    . PRO D 1 125 ? -0.158  25.358  26.339  1.00 27.66 ? 125  PRO D CB    1 
ATOM   5146 C  CG    . PRO D 1 125 ? -1.413  24.653  25.935  1.00 29.88 ? 125  PRO D CG    1 
ATOM   5147 C  CD    . PRO D 1 125 ? -0.961  23.216  25.843  1.00 27.97 ? 125  PRO D CD    1 
ATOM   5148 N  N     . ASP D 1 126 ? 0.450   25.889  29.332  1.00 32.71 ? 126  ASP D N     1 
ATOM   5149 C  CA    . ASP D 1 126 ? 0.046   26.458  30.606  1.00 35.37 ? 126  ASP D CA    1 
ATOM   5150 C  C     . ASP D 1 126 ? 0.123   27.958  30.356  1.00 36.80 ? 126  ASP D C     1 
ATOM   5151 O  O     . ASP D 1 126 ? 1.008   28.649  30.865  1.00 37.84 ? 126  ASP D O     1 
ATOM   5152 C  CB    . ASP D 1 126 ? 0.995   26.035  31.728  1.00 36.84 ? 126  ASP D CB    1 
ATOM   5153 C  CG    . ASP D 1 126 ? 0.520   26.492  33.100  1.00 39.99 ? 126  ASP D CG    1 
ATOM   5154 O  OD1   . ASP D 1 126 ? -0.678  26.315  33.412  1.00 39.37 ? 126  ASP D OD1   1 
ATOM   5155 O  OD2   . ASP D 1 126 ? 1.349   27.026  33.867  1.00 39.51 ? 126  ASP D OD2   1 
ATOM   5156 N  N     . GLY D 1 127 ? -0.755  28.421  29.470  1.00 37.56 ? 127  GLY D N     1 
ATOM   5157 C  CA    . GLY D 1 127 ? -0.810  29.828  29.117  1.00 39.50 ? 127  GLY D CA    1 
ATOM   5158 C  C     . GLY D 1 127 ? 0.132   30.249  28.003  1.00 39.27 ? 127  GLY D C     1 
ATOM   5159 O  O     . GLY D 1 127 ? 0.015   31.365  27.490  1.00 39.48 ? 127  GLY D O     1 
ATOM   5160 N  N     . LYS D 1 128 ? 1.044   29.361  27.608  1.00 37.69 ? 128  LYS D N     1 
ATOM   5161 C  CA    . LYS D 1 128 ? 2.012   29.672  26.558  1.00 38.17 ? 128  LYS D CA    1 
ATOM   5162 C  C     . LYS D 1 128 ? 2.161   28.593  25.483  1.00 36.77 ? 128  LYS D C     1 
ATOM   5163 O  O     . LYS D 1 128 ? 2.323   27.414  25.794  1.00 36.16 ? 128  LYS D O     1 
ATOM   5164 C  CB    . LYS D 1 128 ? 3.393   29.920  27.173  1.00 40.90 ? 128  LYS D CB    1 
ATOM   5165 C  CG    . LYS D 1 128 ? 3.566   31.235  27.918  1.00 44.38 ? 128  LYS D CG    1 
ATOM   5166 C  CD    . LYS D 1 128 ? 4.930   31.266  28.605  1.00 46.35 ? 128  LYS D CD    1 
ATOM   5167 C  CE    . LYS D 1 128 ? 5.268   32.641  29.165  1.00 48.85 ? 128  LYS D CE    1 
ATOM   5168 N  NZ    . LYS D 1 128 ? 5.507   33.649  28.091  1.00 51.06 ? 128  LYS D NZ    1 
ATOM   5169 N  N     . ILE D 1 129 ? 2.117   29.013  24.221  1.00 35.35 ? 129  ILE D N     1 
ATOM   5170 C  CA    . ILE D 1 129 ? 2.298   28.110  23.086  1.00 33.16 ? 129  ILE D CA    1 
ATOM   5171 C  C     . ILE D 1 129 ? 3.464   28.633  22.248  1.00 34.10 ? 129  ILE D C     1 
ATOM   5172 O  O     . ILE D 1 129 ? 3.687   29.844  22.163  1.00 34.58 ? 129  ILE D O     1 
ATOM   5173 C  CB    . ILE D 1 129 ? 1.033   27.991  22.190  1.00 33.46 ? 129  ILE D CB    1 
ATOM   5174 C  CG1   . ILE D 1 129 ? 0.609   29.361  21.657  1.00 32.82 ? 129  ILE D CG1   1 
ATOM   5175 C  CG2   . ILE D 1 129 ? -0.092  27.306  22.949  1.00 30.47 ? 129  ILE D CG2   1 
ATOM   5176 C  CD1   . ILE D 1 129 ? -0.546  29.299  20.677  1.00 32.98 ? 129  ILE D CD1   1 
ATOM   5177 N  N     . LEU D 1 130 ? 4.208   27.715  21.639  1.00 31.22 ? 130  LEU D N     1 
ATOM   5178 C  CA    . LEU D 1 130 ? 5.366   28.070  20.827  1.00 29.14 ? 130  LEU D CA    1 
ATOM   5179 C  C     . LEU D 1 130 ? 5.046   28.158  19.337  1.00 29.03 ? 130  LEU D C     1 
ATOM   5180 O  O     . LEU D 1 130 ? 4.110   27.518  18.852  1.00 29.73 ? 130  LEU D O     1 
ATOM   5181 C  CB    . LEU D 1 130 ? 6.477   27.035  21.050  1.00 28.67 ? 130  LEU D CB    1 
ATOM   5182 C  CG    . LEU D 1 130 ? 7.847   27.274  20.409  1.00 31.28 ? 130  LEU D CG    1 
ATOM   5183 C  CD1   . LEU D 1 130 ? 8.486   28.522  21.008  1.00 28.33 ? 130  LEU D CD1   1 
ATOM   5184 C  CD2   . LEU D 1 130 ? 8.743   26.063  20.631  1.00 27.16 ? 130  LEU D CD2   1 
ATOM   5185 N  N     . GLY D 1 131 ? 5.807   28.980  18.619  1.00 25.80 ? 131  GLY D N     1 
ATOM   5186 C  CA    . GLY D 1 131 ? 5.617   29.090  17.184  1.00 27.54 ? 131  GLY D CA    1 
ATOM   5187 C  C     . GLY D 1 131 ? 5.988   27.722  16.638  1.00 26.50 ? 131  GLY D C     1 
ATOM   5188 O  O     . GLY D 1 131 ? 7.016   27.168  17.027  1.00 27.35 ? 131  GLY D O     1 
ATOM   5189 N  N     . LEU D 1 132 ? 5.149   27.162  15.772  1.00 27.23 ? 132  LEU D N     1 
ATOM   5190 C  CA    . LEU D 1 132 ? 5.396   25.826  15.226  1.00 27.67 ? 132  LEU D CA    1 
ATOM   5191 C  C     . LEU D 1 132 ? 6.802   25.579  14.678  1.00 27.49 ? 132  LEU D C     1 
ATOM   5192 O  O     . LEU D 1 132 ? 7.445   24.590  15.033  1.00 27.15 ? 132  LEU D O     1 
ATOM   5193 C  CB    . LEU D 1 132 ? 4.349   25.477  14.166  1.00 25.26 ? 132  LEU D CB    1 
ATOM   5194 C  CG    . LEU D 1 132 ? 2.898   25.425  14.646  1.00 26.78 ? 132  LEU D CG    1 
ATOM   5195 C  CD1   . LEU D 1 132 ? 2.006   25.026  13.497  1.00 26.43 ? 132  LEU D CD1   1 
ATOM   5196 C  CD2   . LEU D 1 132 ? 2.740   24.453  15.805  1.00 24.72 ? 132  LEU D CD2   1 
ATOM   5197 N  N     . SER D 1 133 ? 7.294   26.495  13.852  1.00 28.13 ? 133  SER D N     1 
ATOM   5198 C  CA    . SER D 1 133 ? 8.619   26.345  13.259  1.00 28.73 ? 133  SER D CA    1 
ATOM   5199 C  C     . SER D 1 133 ? 9.744   26.329  14.290  1.00 28.00 ? 133  SER D C     1 
ATOM   5200 O  O     . SER D 1 133 ? 10.801  25.746  14.049  1.00 28.05 ? 133  SER D O     1 
ATOM   5201 C  CB    . SER D 1 133 ? 8.876   27.449  12.234  1.00 31.59 ? 133  SER D CB    1 
ATOM   5202 O  OG    . SER D 1 133 ? 9.015   28.705  12.872  1.00 33.00 ? 133  SER D OG    1 
ATOM   5203 N  N     . LYS D 1 134 ? 9.514   26.946  15.447  1.00 27.49 ? 134  LYS D N     1 
ATOM   5204 C  CA    . LYS D 1 134 ? 10.539  26.988  16.485  1.00 26.99 ? 134  LYS D CA    1 
ATOM   5205 C  C     . LYS D 1 134 ? 10.855  25.603  17.039  1.00 24.85 ? 134  LYS D C     1 
ATOM   5206 O  O     . LYS D 1 134 ? 11.946  25.373  17.553  1.00 26.21 ? 134  LYS D O     1 
ATOM   5207 C  CB    . LYS D 1 134 ? 10.155  27.964  17.603  1.00 26.42 ? 134  LYS D CB    1 
ATOM   5208 C  CG    . LYS D 1 134 ? 9.849   29.372  17.104  1.00 26.96 ? 134  LYS D CG    1 
ATOM   5209 C  CD    . LYS D 1 134 ? 10.963  29.923  16.214  1.00 27.09 ? 134  LYS D CD    1 
ATOM   5210 C  CE    . LYS D 1 134 ? 10.567  31.268  15.611  1.00 27.16 ? 134  LYS D CE    1 
ATOM   5211 N  NZ    . LYS D 1 134 ? 11.617  31.853  14.735  1.00 28.74 ? 134  LYS D NZ    1 
ATOM   5212 N  N     . PHE D 1 135 ? 9.909   24.674  16.920  1.00 23.95 ? 135  PHE D N     1 
ATOM   5213 C  CA    . PHE D 1 135 ? 10.145  23.307  17.380  1.00 22.13 ? 135  PHE D CA    1 
ATOM   5214 C  C     . PHE D 1 135 ? 11.217  22.676  16.499  1.00 20.33 ? 135  PHE D C     1 
ATOM   5215 O  O     . PHE D 1 135 ? 12.095  21.967  16.985  1.00 23.77 ? 135  PHE D O     1 
ATOM   5216 C  CB    . PHE D 1 135 ? 8.863   22.477  17.311  1.00 23.20 ? 135  PHE D CB    1 
ATOM   5217 C  CG    . PHE D 1 135 ? 7.926   22.721  18.452  1.00 23.30 ? 135  PHE D CG    1 
ATOM   5218 C  CD1   . PHE D 1 135 ? 8.234   22.260  19.727  1.00 24.95 ? 135  PHE D CD1   1 
ATOM   5219 C  CD2   . PHE D 1 135 ? 6.734   23.407  18.255  1.00 24.54 ? 135  PHE D CD2   1 
ATOM   5220 C  CE1   . PHE D 1 135 ? 7.364   22.478  20.794  1.00 26.13 ? 135  PHE D CE1   1 
ATOM   5221 C  CE2   . PHE D 1 135 ? 5.860   23.630  19.312  1.00 24.80 ? 135  PHE D CE2   1 
ATOM   5222 C  CZ    . PHE D 1 135 ? 6.176   23.164  20.585  1.00 24.78 ? 135  PHE D CZ    1 
ATOM   5223 N  N     . ALA D 1 136 ? 11.132  22.948  15.201  1.00 19.73 ? 136  ALA D N     1 
ATOM   5224 C  CA    . ALA D 1 136 ? 12.092  22.438  14.229  1.00 20.30 ? 136  ALA D CA    1 
ATOM   5225 C  C     . ALA D 1 136 ? 13.468  23.062  14.473  1.00 22.09 ? 136  ALA D C     1 
ATOM   5226 O  O     . ALA D 1 136 ? 14.495  22.384  14.390  1.00 20.07 ? 136  ALA D O     1 
ATOM   5227 C  CB    . ALA D 1 136 ? 11.607  22.742  12.819  1.00 23.84 ? 136  ALA D CB    1 
ATOM   5228 N  N     . ARG D 1 137 ? 13.484  24.356  14.790  1.00 21.68 ? 137  ARG D N     1 
ATOM   5229 C  CA    . ARG D 1 137 ? 14.739  25.047  15.067  1.00 22.74 ? 137  ARG D CA    1 
ATOM   5230 C  C     . ARG D 1 137 ? 15.408  24.469  16.315  1.00 21.17 ? 137  ARG D C     1 
ATOM   5231 O  O     . ARG D 1 137 ? 16.634  24.354  16.366  1.00 22.19 ? 137  ARG D O     1 
ATOM   5232 C  CB    . ARG D 1 137 ? 14.514  26.560  15.203  1.00 22.61 ? 137  ARG D CB    1 
ATOM   5233 C  CG    . ARG D 1 137 ? 14.071  27.219  13.911  1.00 23.40 ? 137  ARG D CG    1 
ATOM   5234 C  CD    . ARG D 1 137 ? 14.082  28.742  13.988  1.00 26.25 ? 137  ARG D CD    1 
ATOM   5235 N  NE    . ARG D 1 137 ? 13.600  29.356  12.748  1.00 25.15 ? 137  ARG D NE    1 
ATOM   5236 C  CZ    . ARG D 1 137 ? 14.331  29.521  11.648  1.00 25.43 ? 137  ARG D CZ    1 
ATOM   5237 N  NH1   . ARG D 1 137 ? 15.597  29.121  11.614  1.00 30.25 ? 137  ARG D NH1   1 
ATOM   5238 N  NH2   . ARG D 1 137 ? 13.792  30.081  10.572  1.00 27.09 ? 137  ARG D NH2   1 
ATOM   5239 N  N     . ILE D 1 138 ? 14.605  24.076  17.303  1.00 18.26 ? 138  ILE D N     1 
ATOM   5240 C  CA    . ILE D 1 138 ? 15.142  23.479  18.526  1.00 20.33 ? 138  ILE D CA    1 
ATOM   5241 C  C     . ILE D 1 138 ? 15.709  22.097  18.198  1.00 20.80 ? 138  ILE D C     1 
ATOM   5242 O  O     . ILE D 1 138 ? 16.766  21.712  18.705  1.00 20.63 ? 138  ILE D O     1 
ATOM   5243 C  CB    . ILE D 1 138 ? 14.064  23.364  19.640  1.00 21.94 ? 138  ILE D CB    1 
ATOM   5244 C  CG1   . ILE D 1 138 ? 13.663  24.763  20.125  1.00 24.23 ? 138  ILE D CG1   1 
ATOM   5245 C  CG2   . ILE D 1 138 ? 14.592  22.544  20.821  1.00 22.24 ? 138  ILE D CG2   1 
ATOM   5246 C  CD1   . ILE D 1 138 ? 12.551  24.762  21.151  1.00 18.74 ? 138  ILE D CD1   1 
ATOM   5247 N  N     . VAL D 1 139 ? 14.998  21.355  17.348  1.00 22.26 ? 139  VAL D N     1 
ATOM   5248 C  CA    . VAL D 1 139 ? 15.441  20.030  16.928  1.00 20.06 ? 139  VAL D CA    1 
ATOM   5249 C  C     . VAL D 1 139 ? 16.814  20.149  16.254  1.00 17.48 ? 139  VAL D C     1 
ATOM   5250 O  O     . VAL D 1 139 ? 17.759  19.473  16.648  1.00 18.43 ? 139  VAL D O     1 
ATOM   5251 C  CB    . VAL D 1 139 ? 14.425  19.378  15.947  1.00 19.22 ? 139  VAL D CB    1 
ATOM   5252 C  CG1   . VAL D 1 139 ? 15.026  18.152  15.283  1.00 16.56 ? 139  VAL D CG1   1 
ATOM   5253 C  CG2   . VAL D 1 139 ? 13.153  18.998  16.688  1.00 14.26 ? 139  VAL D CG2   1 
ATOM   5254 N  N     . ASP D 1 140 ? 16.928  21.050  15.281  1.00 19.24 ? 140  ASP D N     1 
ATOM   5255 C  CA    . ASP D 1 140 ? 18.190  21.252  14.566  1.00 20.96 ? 140  ASP D CA    1 
ATOM   5256 C  C     . ASP D 1 140 ? 19.325  21.698  15.484  1.00 21.56 ? 140  ASP D C     1 
ATOM   5257 O  O     . ASP D 1 140 ? 20.472  21.291  15.305  1.00 21.00 ? 140  ASP D O     1 
ATOM   5258 C  CB    . ASP D 1 140 ? 18.014  22.261  13.427  1.00 21.99 ? 140  ASP D CB    1 
ATOM   5259 C  CG    . ASP D 1 140 ? 17.204  21.702  12.266  1.00 21.14 ? 140  ASP D CG    1 
ATOM   5260 O  OD1   . ASP D 1 140 ? 17.037  20.468  12.181  1.00 22.84 ? 140  ASP D OD1   1 
ATOM   5261 O  OD2   . ASP D 1 140 ? 16.735  22.500  11.434  1.00 24.36 ? 140  ASP D OD2   1 
ATOM   5262 N  N     . MET D 1 141 ? 18.993  22.498  16.492  1.00 23.08 ? 141  MET D N     1 
ATOM   5263 C  CA    . MET D 1 141 ? 19.993  22.996  17.433  1.00 22.08 ? 141  MET D CA    1 
ATOM   5264 C  C     . MET D 1 141 ? 20.698  21.853  18.154  1.00 22.84 ? 141  MET D C     1 
ATOM   5265 O  O     . MET D 1 141 ? 21.919  21.873  18.322  1.00 22.02 ? 141  MET D O     1 
ATOM   5266 C  CB    . MET D 1 141 ? 19.344  23.933  18.456  1.00 23.45 ? 141  MET D CB    1 
ATOM   5267 C  CG    . MET D 1 141 ? 20.323  24.561  19.426  1.00 28.55 ? 141  MET D CG    1 
ATOM   5268 S  SD    . MET D 1 141 ? 19.504  25.590  20.657  1.00 28.63 ? 141  MET D SD    1 
ATOM   5269 C  CE    . MET D 1 141 ? 20.565  25.285  22.078  1.00 27.54 ? 141  MET D CE    1 
ATOM   5270 N  N     . PHE D 1 142 ? 19.933  20.840  18.552  1.00 21.44 ? 142  PHE D N     1 
ATOM   5271 C  CA    . PHE D 1 142 ? 20.508  19.703  19.258  1.00 19.30 ? 142  PHE D CA    1 
ATOM   5272 C  C     . PHE D 1 142 ? 20.966  18.556  18.366  1.00 20.44 ? 142  PHE D C     1 
ATOM   5273 O  O     . PHE D 1 142 ? 21.864  17.802  18.740  1.00 20.92 ? 142  PHE D O     1 
ATOM   5274 C  CB    . PHE D 1 142 ? 19.556  19.224  20.356  1.00 19.44 ? 142  PHE D CB    1 
ATOM   5275 C  CG    . PHE D 1 142 ? 19.398  20.217  21.477  1.00 24.69 ? 142  PHE D CG    1 
ATOM   5276 C  CD1   . PHE D 1 142 ? 20.426  20.412  22.396  1.00 25.45 ? 142  PHE D CD1   1 
ATOM   5277 C  CD2   . PHE D 1 142 ? 18.250  20.993  21.584  1.00 22.70 ? 142  PHE D CD2   1 
ATOM   5278 C  CE1   . PHE D 1 142 ? 20.313  21.373  23.406  1.00 26.95 ? 142  PHE D CE1   1 
ATOM   5279 C  CE2   . PHE D 1 142 ? 18.126  21.956  22.589  1.00 29.43 ? 142  PHE D CE2   1 
ATOM   5280 C  CZ    . PHE D 1 142 ? 19.161  22.146  23.500  1.00 26.40 ? 142  PHE D CZ    1 
ATOM   5281 N  N     . ALA D 1 143 ? 20.363  18.437  17.184  1.00 20.59 ? 143  ALA D N     1 
ATOM   5282 C  CA    . ALA D 1 143 ? 20.731  17.388  16.237  1.00 19.57 ? 143  ALA D CA    1 
ATOM   5283 C  C     . ALA D 1 143 ? 22.079  17.680  15.572  1.00 19.83 ? 143  ALA D C     1 
ATOM   5284 O  O     . ALA D 1 143 ? 22.866  16.772  15.328  1.00 18.33 ? 143  ALA D O     1 
ATOM   5285 C  CB    . ALA D 1 143 ? 19.642  17.230  15.175  1.00 17.76 ? 143  ALA D CB    1 
ATOM   5286 N  N     . ARG D 1 144 ? 22.348  18.953  15.299  1.00 21.16 ? 144  ARG D N     1 
ATOM   5287 C  CA    . ARG D 1 144 ? 23.600  19.339  14.654  1.00 19.69 ? 144  ARG D CA    1 
ATOM   5288 C  C     . ARG D 1 144 ? 24.760  19.431  15.638  1.00 22.21 ? 144  ARG D C     1 
ATOM   5289 O  O     . ARG D 1 144 ? 25.370  20.487  15.843  1.00 21.66 ? 144  ARG D O     1 
ATOM   5290 C  CB    . ARG D 1 144 ? 23.400  20.624  13.849  1.00 21.98 ? 144  ARG D CB    1 
ATOM   5291 C  CG    . ARG D 1 144 ? 22.514  20.385  12.629  1.00 23.03 ? 144  ARG D CG    1 
ATOM   5292 C  CD    . ARG D 1 144 ? 22.049  21.658  11.953  1.00 27.87 ? 144  ARG D CD    1 
ATOM   5293 N  NE    . ARG D 1 144 ? 21.312  21.355  10.726  1.00 28.61 ? 144  ARG D NE    1 
ATOM   5294 C  CZ    . ARG D 1 144 ? 20.473  22.189  10.119  1.00 30.25 ? 144  ARG D CZ    1 
ATOM   5295 N  NH1   . ARG D 1 144 ? 20.244  23.397  10.615  1.00 32.10 ? 144  ARG D NH1   1 
ATOM   5296 N  NH2   . ARG D 1 144 ? 19.872  21.818  8.999   1.00 33.17 ? 144  ARG D NH2   1 
ATOM   5297 N  N     . ARG D 1 145 ? 25.059  18.273  16.218  1.00 20.13 ? 145  ARG D N     1 
ATOM   5298 C  CA    . ARG D 1 145 ? 26.113  18.079  17.201  1.00 19.50 ? 145  ARG D CA    1 
ATOM   5299 C  C     . ARG D 1 145 ? 26.466  16.601  17.104  1.00 19.73 ? 145  ARG D C     1 
ATOM   5300 O  O     . ARG D 1 145 ? 25.895  15.876  16.283  1.00 20.10 ? 145  ARG D O     1 
ATOM   5301 C  CB    . ARG D 1 145 ? 25.559  18.314  18.618  1.00 19.53 ? 145  ARG D CB    1 
ATOM   5302 C  CG    . ARG D 1 145 ? 24.903  19.668  18.868  1.00 21.61 ? 145  ARG D CG    1 
ATOM   5303 C  CD    . ARG D 1 145 ? 24.409  19.793  20.312  1.00 20.05 ? 145  ARG D CD    1 
ATOM   5304 N  NE    . ARG D 1 145 ? 23.837  21.112  20.565  1.00 19.10 ? 145  ARG D NE    1 
ATOM   5305 C  CZ    . ARG D 1 145 ? 23.681  21.651  21.774  1.00 23.35 ? 145  ARG D CZ    1 
ATOM   5306 N  NH1   . ARG D 1 145 ? 24.044  20.986  22.864  1.00 21.45 ? 145  ARG D NH1   1 
ATOM   5307 N  NH2   . ARG D 1 145 ? 23.192  22.878  21.889  1.00 22.09 ? 145  ARG D NH2   1 
ATOM   5308 N  N     . LEU D 1 146 ? 27.427  16.165  17.914  1.00 17.99 ? 146  LEU D N     1 
ATOM   5309 C  CA    . LEU D 1 146 ? 27.770  14.751  17.980  1.00 17.43 ? 146  LEU D CA    1 
ATOM   5310 C  C     . LEU D 1 146 ? 26.766  14.289  19.033  1.00 20.44 ? 146  LEU D C     1 
ATOM   5311 O  O     . LEU D 1 146 ? 26.645  14.916  20.092  1.00 21.65 ? 146  LEU D O     1 
ATOM   5312 C  CB    . LEU D 1 146 ? 29.204  14.537  18.459  1.00 16.19 ? 146  LEU D CB    1 
ATOM   5313 C  CG    . LEU D 1 146 ? 30.324  15.065  17.561  1.00 17.37 ? 146  LEU D CG    1 
ATOM   5314 C  CD1   . LEU D 1 146 ? 31.639  14.518  18.063  1.00 18.43 ? 146  LEU D CD1   1 
ATOM   5315 C  CD2   . LEU D 1 146 ? 30.102  14.641  16.108  1.00 15.76 ? 146  LEU D CD2   1 
ATOM   5316 N  N     . GLN D 1 147 ? 26.048  13.204  18.759  1.00 19.96 ? 147  GLN D N     1 
ATOM   5317 C  CA    . GLN D 1 147 ? 24.999  12.755  19.678  1.00 18.45 ? 147  GLN D CA    1 
ATOM   5318 C  C     . GLN D 1 147 ? 24.825  11.258  19.894  1.00 17.98 ? 147  GLN D C     1 
ATOM   5319 O  O     . GLN D 1 147 ? 25.532  10.432  19.320  1.00 18.76 ? 147  GLN D O     1 
ATOM   5320 C  CB    . GLN D 1 147 ? 23.651  13.271  19.150  1.00 20.42 ? 147  GLN D CB    1 
ATOM   5321 C  CG    . GLN D 1 147 ? 23.322  14.722  19.437  1.00 22.98 ? 147  GLN D CG    1 
ATOM   5322 C  CD    . GLN D 1 147 ? 22.774  14.915  20.834  1.00 19.12 ? 147  GLN D CD    1 
ATOM   5323 O  OE1   . GLN D 1 147 ? 22.814  14.004  21.658  1.00 21.24 ? 147  GLN D OE1   1 
ATOM   5324 N  NE2   . GLN D 1 147 ? 22.245  16.101  21.103  1.00 21.03 ? 147  GLN D NE2   1 
ATOM   5325 N  N     . VAL D 1 148 ? 23.896  10.953  20.800  1.00 20.55 ? 148  VAL D N     1 
ATOM   5326 C  CA    . VAL D 1 148 ? 23.433  9.599   21.109  1.00 23.00 ? 148  VAL D CA    1 
ATOM   5327 C  C     . VAL D 1 148 ? 21.920  9.865   21.057  1.00 21.78 ? 148  VAL D C     1 
ATOM   5328 O  O     . VAL D 1 148 ? 21.455  10.887  21.572  1.00 21.03 ? 148  VAL D O     1 
ATOM   5329 C  CB    . VAL D 1 148 ? 23.878  9.064   22.508  1.00 27.60 ? 148  VAL D CB    1 
ATOM   5330 C  CG1   . VAL D 1 148 ? 25.390  8.926   22.568  1.00 30.05 ? 148  VAL D CG1   1 
ATOM   5331 C  CG2   . VAL D 1 148 ? 23.393  9.948   23.616  1.00 28.42 ? 148  VAL D CG2   1 
ATOM   5332 N  N     . GLN D 1 149 ? 21.160  9.005   20.382  1.00 20.94 ? 149  GLN D N     1 
ATOM   5333 C  CA    . GLN D 1 149 ? 19.722  9.236   20.231  1.00 19.75 ? 149  GLN D CA    1 
ATOM   5334 C  C     . GLN D 1 149 ? 18.945  9.392   21.535  1.00 15.65 ? 149  GLN D C     1 
ATOM   5335 O  O     . GLN D 1 149 ? 17.959  10.125  21.590  1.00 16.41 ? 149  GLN D O     1 
ATOM   5336 C  CB    . GLN D 1 149 ? 19.076  8.165   19.348  1.00 16.90 ? 149  GLN D CB    1 
ATOM   5337 C  CG    . GLN D 1 149 ? 17.722  8.598   18.789  1.00 16.65 ? 149  GLN D CG    1 
ATOM   5338 C  CD    . GLN D 1 149 ? 17.054  7.531   17.938  1.00 19.12 ? 149  GLN D CD    1 
ATOM   5339 O  OE1   . GLN D 1 149 ? 17.659  6.985   17.019  1.00 19.51 ? 149  GLN D OE1   1 
ATOM   5340 N  NE2   . GLN D 1 149 ? 15.796  7.238   18.240  1.00 16.81 ? 149  GLN D NE2   1 
ATOM   5341 N  N     . GLU D 1 150 ? 19.394  8.701   22.576  1.00 19.72 ? 150  GLU D N     1 
ATOM   5342 C  CA    . GLU D 1 150 ? 18.757  8.772   23.888  1.00 20.91 ? 150  GLU D CA    1 
ATOM   5343 C  C     . GLU D 1 150 ? 18.868  10.174  24.492  1.00 21.62 ? 150  GLU D C     1 
ATOM   5344 O  O     . GLU D 1 150 ? 17.932  10.653  25.135  1.00 22.38 ? 150  GLU D O     1 
ATOM   5345 C  CB    . GLU D 1 150 ? 19.376  7.745   24.842  1.00 21.72 ? 150  GLU D CB    1 
ATOM   5346 C  CG    . GLU D 1 150 ? 19.067  6.287   24.506  1.00 23.13 ? 150  GLU D CG    1 
ATOM   5347 C  CD    . GLU D 1 150 ? 20.015  5.668   23.485  1.00 23.45 ? 150  GLU D CD    1 
ATOM   5348 O  OE1   . GLU D 1 150 ? 20.724  6.400   22.756  1.00 21.86 ? 150  GLU D OE1   1 
ATOM   5349 O  OE2   . GLU D 1 150 ? 20.047  4.423   23.414  1.00 24.84 ? 150  GLU D OE2   1 
ATOM   5350 N  N     . ARG D 1 151 ? 20.013  10.823  24.276  1.00 20.78 ? 151  ARG D N     1 
ATOM   5351 C  CA    . ARG D 1 151 ? 20.259  12.178  24.782  1.00 19.85 ? 151  ARG D CA    1 
ATOM   5352 C  C     . ARG D 1 151 ? 19.506  13.218  23.970  1.00 19.65 ? 151  ARG D C     1 
ATOM   5353 O  O     . ARG D 1 151 ? 18.939  14.159  24.525  1.00 21.29 ? 151  ARG D O     1 
ATOM   5354 C  CB    . ARG D 1 151 ? 21.753  12.504  24.725  1.00 20.25 ? 151  ARG D CB    1 
ATOM   5355 C  CG    . ARG D 1 151 ? 22.126  13.920  25.164  1.00 20.44 ? 151  ARG D CG    1 
ATOM   5356 C  CD    . ARG D 1 151 ? 23.588  14.212  24.845  1.00 20.33 ? 151  ARG D CD    1 
ATOM   5357 N  NE    . ARG D 1 151 ? 24.458  13.170  25.376  1.00 21.69 ? 151  ARG D NE    1 
ATOM   5358 C  CZ    . ARG D 1 151 ? 25.541  12.706  24.763  1.00 22.08 ? 151  ARG D CZ    1 
ATOM   5359 N  NH1   . ARG D 1 151 ? 25.909  13.196  23.586  1.00 24.40 ? 151  ARG D NH1   1 
ATOM   5360 N  NH2   . ARG D 1 151 ? 26.226  11.711  25.306  1.00 24.32 ? 151  ARG D NH2   1 
ATOM   5361 N  N     . LEU D 1 152 ? 19.516  13.049  22.648  1.00 19.32 ? 152  LEU D N     1 
ATOM   5362 C  CA    . LEU D 1 152 ? 18.847  13.970  21.744  1.00 17.71 ? 152  LEU D CA    1 
ATOM   5363 C  C     . LEU D 1 152 ? 17.394  14.204  22.139  1.00 19.41 ? 152  LEU D C     1 
ATOM   5364 O  O     . LEU D 1 152 ? 16.929  15.345  22.157  1.00 17.61 ? 152  LEU D O     1 
ATOM   5365 C  CB    . LEU D 1 152 ? 18.931  13.454  20.301  1.00 17.64 ? 152  LEU D CB    1 
ATOM   5366 C  CG    . LEU D 1 152 ? 18.264  14.300  19.219  1.00 18.33 ? 152  LEU D CG    1 
ATOM   5367 C  CD1   . LEU D 1 152 ? 18.882  15.695  19.182  1.00 15.37 ? 152  LEU D CD1   1 
ATOM   5368 C  CD2   . LEU D 1 152 ? 18.421  13.610  17.866  1.00 15.02 ? 152  LEU D CD2   1 
ATOM   5369 N  N     . ALA D 1 153 ? 16.690  13.128  22.488  1.00 18.68 ? 153  ALA D N     1 
ATOM   5370 C  CA    . ALA D 1 153 ? 15.291  13.230  22.885  1.00 21.41 ? 153  ALA D CA    1 
ATOM   5371 C  C     . ALA D 1 153 ? 15.145  14.032  24.173  1.00 22.11 ? 153  ALA D C     1 
ATOM   5372 O  O     . ALA D 1 153 ? 14.269  14.887  24.280  1.00 21.54 ? 153  ALA D O     1 
ATOM   5373 C  CB    . ALA D 1 153 ? 14.689  11.847  23.059  1.00 23.07 ? 153  ALA D CB    1 
ATOM   5374 N  N     . VAL D 1 154 ? 16.013  13.749  25.142  1.00 24.17 ? 154  VAL D N     1 
ATOM   5375 C  CA    . VAL D 1 154 ? 15.987  14.439  26.433  1.00 24.43 ? 154  VAL D CA    1 
ATOM   5376 C  C     . VAL D 1 154 ? 16.276  15.938  26.308  1.00 23.12 ? 154  VAL D C     1 
ATOM   5377 O  O     . VAL D 1 154 ? 15.553  16.760  26.878  1.00 23.51 ? 154  VAL D O     1 
ATOM   5378 C  CB    . VAL D 1 154 ? 16.985  13.804  27.434  1.00 24.82 ? 154  VAL D CB    1 
ATOM   5379 C  CG1   . VAL D 1 154 ? 16.984  14.574  28.752  1.00 27.40 ? 154  VAL D CG1   1 
ATOM   5380 C  CG2   . VAL D 1 154 ? 16.621  12.348  27.689  1.00 23.53 ? 154  VAL D CG2   1 
ATOM   5381 N  N     . GLN D 1 155 ? 17.304  16.294  25.538  1.00 22.28 ? 155  GLN D N     1 
ATOM   5382 C  CA    . GLN D 1 155 ? 17.668  17.699  25.367  1.00 22.50 ? 155  GLN D CA    1 
ATOM   5383 C  C     . GLN D 1 155 ? 16.601  18.522  24.648  1.00 24.45 ? 155  GLN D C     1 
ATOM   5384 O  O     . GLN D 1 155 ? 16.418  19.702  24.950  1.00 24.93 ? 155  GLN D O     1 
ATOM   5385 C  CB    . GLN D 1 155 ? 19.016  17.835  24.658  1.00 23.02 ? 155  GLN D CB    1 
ATOM   5386 C  CG    . GLN D 1 155 ? 20.187  17.255  25.442  1.00 22.35 ? 155  GLN D CG    1 
ATOM   5387 C  CD    . GLN D 1 155 ? 21.535  17.604  24.834  1.00 28.42 ? 155  GLN D CD    1 
ATOM   5388 O  OE1   . GLN D 1 155 ? 22.375  18.238  25.476  1.00 33.38 ? 155  GLN D OE1   1 
ATOM   5389 N  NE2   . GLN D 1 155 ? 21.749  17.188  23.597  1.00 26.45 ? 155  GLN D NE2   1 
ATOM   5390 N  N     . ILE D 1 156 ? 15.908  17.908  23.690  1.00 21.10 ? 156  ILE D N     1 
ATOM   5391 C  CA    . ILE D 1 156 ? 14.848  18.601  22.959  1.00 20.26 ? 156  ILE D CA    1 
ATOM   5392 C  C     . ILE D 1 156 ? 13.685  18.902  23.904  1.00 21.10 ? 156  ILE D C     1 
ATOM   5393 O  O     . ILE D 1 156 ? 13.183  20.028  23.948  1.00 19.34 ? 156  ILE D O     1 
ATOM   5394 C  CB    . ILE D 1 156 ? 14.333  17.760  21.756  1.00 22.40 ? 156  ILE D CB    1 
ATOM   5395 C  CG1   . ILE D 1 156 ? 15.410  17.688  20.669  1.00 22.56 ? 156  ILE D CG1   1 
ATOM   5396 C  CG2   . ILE D 1 156 ? 13.045  18.363  21.188  1.00 22.54 ? 156  ILE D CG2   1 
ATOM   5397 C  CD1   . ILE D 1 156 ? 15.022  16.838  19.471  1.00 24.64 ? 156  ILE D CD1   1 
ATOM   5398 N  N     . ALA D 1 157 ? 13.291  17.899  24.685  1.00 22.35 ? 157  ALA D N     1 
ATOM   5399 C  CA    . ALA D 1 157 ? 12.194  18.046  25.635  1.00 23.80 ? 157  ALA D CA    1 
ATOM   5400 C  C     . ALA D 1 157 ? 12.505  19.078  26.721  1.00 25.62 ? 157  ALA D C     1 
ATOM   5401 O  O     . ALA D 1 157 ? 11.639  19.875  27.087  1.00 28.68 ? 157  ALA D O     1 
ATOM   5402 C  CB    . ALA D 1 157 ? 11.864  16.706  26.265  1.00 19.68 ? 157  ALA D CB    1 
ATOM   5403 N  N     . GLU D 1 158 ? 13.738  19.064  27.223  1.00 26.83 ? 158  GLU D N     1 
ATOM   5404 C  CA    . GLU D 1 158 ? 14.153  20.004  28.269  1.00 29.17 ? 158  GLU D CA    1 
ATOM   5405 C  C     . GLU D 1 158 ? 14.184  21.440  27.767  1.00 29.54 ? 158  GLU D C     1 
ATOM   5406 O  O     . GLU D 1 158 ? 13.894  22.375  28.516  1.00 28.72 ? 158  GLU D O     1 
ATOM   5407 C  CB    . GLU D 1 158 ? 15.514  19.609  28.844  1.00 30.89 ? 158  GLU D CB    1 
ATOM   5408 C  CG    . GLU D 1 158 ? 15.473  18.338  29.690  1.00 32.43 ? 158  GLU D CG    1 
ATOM   5409 C  CD    . GLU D 1 158 ? 16.821  17.964  30.293  1.00 35.34 ? 158  GLU D CD    1 
ATOM   5410 O  OE1   . GLU D 1 158 ? 17.866  18.463  29.815  1.00 37.18 ? 158  GLU D OE1   1 
ATOM   5411 O  OE2   . GLU D 1 158 ? 16.831  17.156  31.245  1.00 33.89 ? 158  GLU D OE2   1 
ATOM   5412 N  N     . ALA D 1 159 ? 14.523  21.605  26.491  1.00 28.04 ? 159  ALA D N     1 
ATOM   5413 C  CA    . ALA D 1 159 ? 14.570  22.922  25.871  1.00 28.31 ? 159  ALA D CA    1 
ATOM   5414 C  C     . ALA D 1 159 ? 13.153  23.484  25.767  1.00 28.60 ? 159  ALA D C     1 
ATOM   5415 O  O     . ALA D 1 159 ? 12.911  24.648  26.087  1.00 30.39 ? 159  ALA D O     1 
ATOM   5416 C  CB    . ALA D 1 159 ? 15.208  22.830  24.493  1.00 25.54 ? 159  ALA D CB    1 
ATOM   5417 N  N     . ILE D 1 160 ? 12.217  22.644  25.335  1.00 28.84 ? 160  ILE D N     1 
ATOM   5418 C  CA    . ILE D 1 160 ? 10.817  23.046  25.200  1.00 28.90 ? 160  ILE D CA    1 
ATOM   5419 C  C     . ILE D 1 160 ? 10.239  23.375  26.579  1.00 30.06 ? 160  ILE D C     1 
ATOM   5420 O  O     . ILE D 1 160 ? 9.477   24.333  26.735  1.00 30.43 ? 160  ILE D O     1 
ATOM   5421 C  CB    . ILE D 1 160 ? 9.984   21.925  24.532  1.00 28.68 ? 160  ILE D CB    1 
ATOM   5422 C  CG1   . ILE D 1 160 ? 10.511  21.669  23.115  1.00 28.49 ? 160  ILE D CG1   1 
ATOM   5423 C  CG2   . ILE D 1 160 ? 8.504   22.307  24.498  1.00 25.99 ? 160  ILE D CG2   1 
ATOM   5424 C  CD1   . ILE D 1 160 ? 9.907   20.464  22.433  1.00 27.77 ? 160  ILE D CD1   1 
ATOM   5425 N  N     . GLN D 1 161 ? 10.643  22.591  27.573  1.00 31.61 ? 161  GLN D N     1 
ATOM   5426 C  CA    . GLN D 1 161 ? 10.201  22.770  28.952  1.00 34.56 ? 161  GLN D CA    1 
ATOM   5427 C  C     . GLN D 1 161 ? 10.705  24.098  29.525  1.00 36.37 ? 161  GLN D C     1 
ATOM   5428 O  O     . GLN D 1 161 ? 10.041  24.708  30.363  1.00 38.49 ? 161  GLN D O     1 
ATOM   5429 C  CB    . GLN D 1 161 ? 10.708  21.608  29.813  1.00 35.77 ? 161  GLN D CB    1 
ATOM   5430 C  CG    . GLN D 1 161 ? 10.303  21.667  31.285  1.00 42.13 ? 161  GLN D CG    1 
ATOM   5431 C  CD    . GLN D 1 161 ? 8.804   21.545  31.488  1.00 44.73 ? 161  GLN D CD    1 
ATOM   5432 O  OE1   . GLN D 1 161 ? 8.092   22.548  31.551  1.00 49.28 ? 161  GLN D OE1   1 
ATOM   5433 N  NE2   . GLN D 1 161 ? 8.319   20.314  31.600  1.00 46.96 ? 161  GLN D NE2   1 
ATOM   5434 N  N     . GLU D 1 162 ? 11.880  24.533  29.075  1.00 35.00 ? 162  GLU D N     1 
ATOM   5435 C  CA    . GLU D 1 162 ? 12.472  25.782  29.544  1.00 35.98 ? 162  GLU D CA    1 
ATOM   5436 C  C     . GLU D 1 162 ? 11.838  27.005  28.882  1.00 35.78 ? 162  GLU D C     1 
ATOM   5437 O  O     . GLU D 1 162 ? 11.486  27.971  29.566  1.00 32.53 ? 162  GLU D O     1 
ATOM   5438 C  CB    . GLU D 1 162 ? 13.984  25.783  29.301  1.00 37.15 ? 162  GLU D CB    1 
ATOM   5439 C  CG    . GLU D 1 162 ? 14.703  26.975  29.912  1.00 45.07 ? 162  GLU D CG    1 
ATOM   5440 C  CD    . GLU D 1 162 ? 16.166  27.056  29.517  1.00 47.89 ? 162  GLU D CD    1 
ATOM   5441 O  OE1   . GLU D 1 162 ? 16.553  28.069  28.896  1.00 51.65 ? 162  GLU D OE1   1 
ATOM   5442 O  OE2   . GLU D 1 162 ? 16.928  26.116  29.829  1.00 49.14 ? 162  GLU D OE2   1 
ATOM   5443 N  N     . VAL D 1 163 ? 11.702  26.955  27.556  1.00 33.06 ? 163  VAL D N     1 
ATOM   5444 C  CA    . VAL D 1 163 ? 11.117  28.047  26.772  1.00 34.28 ? 163  VAL D CA    1 
ATOM   5445 C  C     . VAL D 1 163 ? 9.678   28.306  27.198  1.00 35.92 ? 163  VAL D C     1 
ATOM   5446 O  O     . VAL D 1 163 ? 9.314   29.425  27.561  1.00 35.86 ? 163  VAL D O     1 
ATOM   5447 C  CB    . VAL D 1 163 ? 11.157  27.733  25.259  1.00 34.11 ? 163  VAL D CB    1 
ATOM   5448 C  CG1   . VAL D 1 163 ? 10.446  28.823  24.464  1.00 35.35 ? 163  VAL D CG1   1 
ATOM   5449 C  CG2   . VAL D 1 163 ? 12.595  27.609  24.802  1.00 33.83 ? 163  VAL D CG2   1 
ATOM   5450 N  N     . LEU D 1 164 ? 8.851   27.276  27.099  1.00 35.65 ? 164  LEU D N     1 
ATOM   5451 C  CA    . LEU D 1 164 ? 7.467   27.380  27.516  1.00 36.74 ? 164  LEU D CA    1 
ATOM   5452 C  C     . LEU D 1 164 ? 7.483   26.831  28.931  1.00 38.58 ? 164  LEU D C     1 
ATOM   5453 O  O     . LEU D 1 164 ? 8.487   26.277  29.373  1.00 41.60 ? 164  LEU D O     1 
ATOM   5454 C  CB    . LEU D 1 164 ? 6.573   26.495  26.642  1.00 36.78 ? 164  LEU D CB    1 
ATOM   5455 C  CG    . LEU D 1 164 ? 6.590   26.709  25.129  1.00 35.17 ? 164  LEU D CG    1 
ATOM   5456 C  CD1   . LEU D 1 164 ? 5.771   25.621  24.451  1.00 35.59 ? 164  LEU D CD1   1 
ATOM   5457 C  CD2   . LEU D 1 164 ? 6.046   28.085  24.788  1.00 33.62 ? 164  LEU D CD2   1 
ATOM   5458 N  N     . GLU D 1 165 ? 6.393   27.007  29.657  1.00 38.56 ? 165  GLU D N     1 
ATOM   5459 C  CA    . GLU D 1 165 ? 6.301   26.467  31.007  1.00 41.49 ? 165  GLU D CA    1 
ATOM   5460 C  C     . GLU D 1 165 ? 5.037   25.628  30.922  1.00 40.09 ? 165  GLU D C     1 
ATOM   5461 O  O     . GLU D 1 165 ? 4.064   25.878  31.632  1.00 41.01 ? 165  GLU D O     1 
ATOM   5462 C  CB    . GLU D 1 165 ? 6.144   27.597  32.036  1.00 45.77 ? 165  GLU D CB    1 
ATOM   5463 C  CG    . GLU D 1 165 ? 7.320   28.581  32.106  1.00 50.81 ? 165  GLU D CG    1 
ATOM   5464 C  CD    . GLU D 1 165 ? 8.515   28.051  32.892  1.00 52.07 ? 165  GLU D CD    1 
ATOM   5465 O  OE1   . GLU D 1 165 ? 9.081   27.005  32.508  1.00 51.58 ? 165  GLU D OE1   1 
ATOM   5466 O  OE2   . GLU D 1 165 ? 8.897   28.697  33.894  1.00 50.66 ? 165  GLU D OE2   1 
ATOM   5467 N  N     . PRO D 1 166 ? 5.046   24.600  30.050  1.00 38.14 ? 166  PRO D N     1 
ATOM   5468 C  CA    . PRO D 1 166 ? 3.892   23.726  29.858  1.00 35.95 ? 166  PRO D CA    1 
ATOM   5469 C  C     . PRO D 1 166 ? 3.641   22.780  31.016  1.00 34.09 ? 166  PRO D C     1 
ATOM   5470 O  O     . PRO D 1 166 ? 4.509   22.565  31.867  1.00 33.37 ? 166  PRO D O     1 
ATOM   5471 C  CB    . PRO D 1 166 ? 4.278   22.958  28.600  1.00 35.72 ? 166  PRO D CB    1 
ATOM   5472 C  CG    . PRO D 1 166 ? 5.712   22.701  28.840  1.00 37.58 ? 166  PRO D CG    1 
ATOM   5473 C  CD    . PRO D 1 166 ? 6.223   24.038  29.356  1.00 36.66 ? 166  PRO D CD    1 
ATOM   5474 N  N     . GLN D 1 167 ? 2.436   22.223  31.036  1.00 31.78 ? 167  GLN D N     1 
ATOM   5475 C  CA    . GLN D 1 167 ? 2.051   21.269  32.061  1.00 31.40 ? 167  GLN D CA    1 
ATOM   5476 C  C     . GLN D 1 167 ? 2.847   19.989  31.824  1.00 29.73 ? 167  GLN D C     1 
ATOM   5477 O  O     . GLN D 1 167 ? 3.174   19.264  32.762  1.00 28.03 ? 167  GLN D O     1 
ATOM   5478 C  CB    . GLN D 1 167 ? 0.548   20.993  31.983  1.00 33.01 ? 167  GLN D CB    1 
ATOM   5479 C  CG    . GLN D 1 167 ? -0.311  22.243  32.146  1.00 37.67 ? 167  GLN D CG    1 
ATOM   5480 C  CD    . GLN D 1 167 ? -1.798  21.942  32.216  1.00 39.22 ? 167  GLN D CD    1 
ATOM   5481 O  OE1   . GLN D 1 167 ? -2.217  20.950  32.814  1.00 42.71 ? 167  GLN D OE1   1 
ATOM   5482 N  NE2   . GLN D 1 167 ? -2.605  22.805  31.608  1.00 39.66 ? 167  GLN D NE2   1 
ATOM   5483 N  N     . GLY D 1 168 ? 3.201   19.752  30.562  1.00 28.31 ? 168  GLY D N     1 
ATOM   5484 C  CA    . GLY D 1 168 ? 3.968   18.574  30.208  1.00 26.16 ? 168  GLY D CA    1 
ATOM   5485 C  C     . GLY D 1 168 ? 4.450   18.602  28.769  1.00 24.32 ? 168  GLY D C     1 
ATOM   5486 O  O     . GLY D 1 168 ? 3.893   19.316  27.934  1.00 23.15 ? 168  GLY D O     1 
ATOM   5487 N  N     . VAL D 1 169 ? 5.513   17.849  28.495  1.00 25.44 ? 169  VAL D N     1 
ATOM   5488 C  CA    . VAL D 1 169 ? 6.086   17.765  27.154  1.00 24.30 ? 169  VAL D CA    1 
ATOM   5489 C  C     . VAL D 1 169 ? 6.495   16.330  26.873  1.00 22.98 ? 169  VAL D C     1 
ATOM   5490 O  O     . VAL D 1 169 ? 7.023   15.644  27.746  1.00 23.63 ? 169  VAL D O     1 
ATOM   5491 C  CB    . VAL D 1 169 ? 7.378   18.609  26.993  1.00 25.02 ? 169  VAL D CB    1 
ATOM   5492 C  CG1   . VAL D 1 169 ? 7.700   18.780  25.513  1.00 25.50 ? 169  VAL D CG1   1 
ATOM   5493 C  CG2   . VAL D 1 169 ? 7.261   19.950  27.684  1.00 30.44 ? 169  VAL D CG2   1 
ATOM   5494 N  N     . GLY D 1 170 ? 6.283   15.900  25.632  1.00 23.33 ? 170  GLY D N     1 
ATOM   5495 C  CA    . GLY D 1 170 ? 6.662   14.561  25.230  1.00 19.89 ? 170  GLY D CA    1 
ATOM   5496 C  C     . GLY D 1 170 ? 7.393   14.650  23.902  1.00 18.00 ? 170  GLY D C     1 
ATOM   5497 O  O     . GLY D 1 170 ? 6.950   15.349  22.999  1.00 17.18 ? 170  GLY D O     1 
ATOM   5498 N  N     . VAL D 1 171 ? 8.545   13.996  23.812  1.00 20.46 ? 171  VAL D N     1 
ATOM   5499 C  CA    . VAL D 1 171 ? 9.342   13.994  22.589  1.00 19.61 ? 171  VAL D CA    1 
ATOM   5500 C  C     . VAL D 1 171 ? 9.721   12.564  22.242  1.00 19.66 ? 171  VAL D C     1 
ATOM   5501 O  O     . VAL D 1 171 ? 10.244  11.833  23.080  1.00 21.18 ? 171  VAL D O     1 
ATOM   5502 C  CB    . VAL D 1 171 ? 10.643  14.830  22.749  1.00 18.08 ? 171  VAL D CB    1 
ATOM   5503 C  CG1   . VAL D 1 171 ? 11.525  14.694  21.508  1.00 19.11 ? 171  VAL D CG1   1 
ATOM   5504 C  CG2   . VAL D 1 171 ? 10.302  16.297  22.969  1.00 19.00 ? 171  VAL D CG2   1 
ATOM   5505 N  N     . VAL D 1 172 ? 9.428   12.166  21.007  1.00 19.13 ? 172  VAL D N     1 
ATOM   5506 C  CA    . VAL D 1 172 ? 9.755   10.828  20.522  1.00 17.43 ? 172  VAL D CA    1 
ATOM   5507 C  C     . VAL D 1 172 ? 10.670  10.995  19.310  1.00 15.53 ? 172  VAL D C     1 
ATOM   5508 O  O     . VAL D 1 172 ? 10.371  11.770  18.408  1.00 16.34 ? 172  VAL D O     1 
ATOM   5509 C  CB    . VAL D 1 172 ? 8.483   10.049  20.081  1.00 17.47 ? 172  VAL D CB    1 
ATOM   5510 C  CG1   . VAL D 1 172 ? 8.870   8.751   19.371  1.00 14.64 ? 172  VAL D CG1   1 
ATOM   5511 C  CG2   . VAL D 1 172 ? 7.598   9.743   21.286  1.00 16.29 ? 172  VAL D CG2   1 
ATOM   5512 N  N     . VAL D 1 173 ? 11.813  10.318  19.332  1.00 15.43 ? 173  VAL D N     1 
ATOM   5513 C  CA    . VAL D 1 173 ? 12.758  10.380  18.226  1.00 15.60 ? 173  VAL D CA    1 
ATOM   5514 C  C     . VAL D 1 173 ? 12.864  8.982   17.640  1.00 15.30 ? 173  VAL D C     1 
ATOM   5515 O  O     . VAL D 1 173 ? 13.051  8.010   18.366  1.00 16.56 ? 173  VAL D O     1 
ATOM   5516 C  CB    . VAL D 1 173 ? 14.165  10.848  18.679  1.00 16.04 ? 173  VAL D CB    1 
ATOM   5517 C  CG1   . VAL D 1 173 ? 15.114  10.920  17.476  1.00 15.27 ? 173  VAL D CG1   1 
ATOM   5518 C  CG2   . VAL D 1 173 ? 14.075  12.211  19.355  1.00 16.38 ? 173  VAL D CG2   1 
ATOM   5519 N  N     . GLU D 1 174 ? 12.668  8.877   16.333  1.00 14.63 ? 174  GLU D N     1 
ATOM   5520 C  CA    . GLU D 1 174 ? 12.771  7.594   15.667  1.00 12.68 ? 174  GLU D CA    1 
ATOM   5521 C  C     . GLU D 1 174 ? 13.764  7.746   14.527  1.00 12.74 ? 174  GLU D C     1 
ATOM   5522 O  O     . GLU D 1 174 ? 13.588  8.591   13.648  1.00 16.37 ? 174  GLU D O     1 
ATOM   5523 C  CB    . GLU D 1 174 ? 11.407  7.142   15.144  1.00 17.73 ? 174  GLU D CB    1 
ATOM   5524 C  CG    . GLU D 1 174 ? 11.460  5.815   14.419  1.00 19.24 ? 174  GLU D CG    1 
ATOM   5525 C  CD    . GLU D 1 174 ? 10.103  5.139   14.319  1.00 24.19 ? 174  GLU D CD    1 
ATOM   5526 O  OE1   . GLU D 1 174 ? 10.069  3.901   14.410  1.00 27.43 ? 174  GLU D OE1   1 
ATOM   5527 O  OE2   . GLU D 1 174 ? 9.078   5.831   14.158  1.00 24.26 ? 174  GLU D OE2   1 
ATOM   5528 N  N     . GLY D 1 175 ? 14.814  6.938   14.547  1.00 13.76 ? 175  GLY D N     1 
ATOM   5529 C  CA    . GLY D 1 175 ? 15.801  7.056   13.495  1.00 18.27 ? 175  GLY D CA    1 
ATOM   5530 C  C     . GLY D 1 175 ? 16.558  5.808   13.114  1.00 17.61 ? 175  GLY D C     1 
ATOM   5531 O  O     . GLY D 1 175 ? 16.483  4.777   13.779  1.00 17.07 ? 175  GLY D O     1 
ATOM   5532 N  N     . VAL D 1 176 ? 17.231  5.894   11.973  1.00 15.89 ? 176  VAL D N     1 
ATOM   5533 C  CA    . VAL D 1 176 ? 18.051  4.803   11.484  1.00 17.49 ? 176  VAL D CA    1 
ATOM   5534 C  C     . VAL D 1 176 ? 19.495  5.255   11.654  1.00 17.85 ? 176  VAL D C     1 
ATOM   5535 O  O     . VAL D 1 176 ? 19.803  6.444   11.518  1.00 14.85 ? 176  VAL D O     1 
ATOM   5536 C  CB    . VAL D 1 176 ? 17.754  4.477   10.009  1.00 18.65 ? 176  VAL D CB    1 
ATOM   5537 C  CG1   . VAL D 1 176 ? 16.321  3.980   9.874   1.00 21.15 ? 176  VAL D CG1   1 
ATOM   5538 C  CG2   . VAL D 1 176 ? 17.985  5.700   9.138   1.00 19.91 ? 176  VAL D CG2   1 
ATOM   5539 N  N     . HIS D 1 177 ? 20.368  4.308   11.970  1.00 18.56 ? 177  HIS D N     1 
ATOM   5540 C  CA    . HIS D 1 177 ? 21.773  4.606   12.200  1.00 16.81 ? 177  HIS D CA    1 
ATOM   5541 C  C     . HIS D 1 177 ? 22.685  3.977   11.164  1.00 15.12 ? 177  HIS D C     1 
ATOM   5542 O  O     . HIS D 1 177 ? 22.764  2.756   11.058  1.00 17.68 ? 177  HIS D O     1 
ATOM   5543 C  CB    . HIS D 1 177 ? 22.173  4.132   13.601  1.00 20.64 ? 177  HIS D CB    1 
ATOM   5544 C  CG    . HIS D 1 177 ? 21.418  4.811   14.702  1.00 23.46 ? 177  HIS D CG    1 
ATOM   5545 N  ND1   . HIS D 1 177 ? 22.040  5.551   15.683  1.00 27.53 ? 177  HIS D ND1   1 
ATOM   5546 C  CD2   . HIS D 1 177 ? 20.090  4.887   14.958  1.00 23.86 ? 177  HIS D CD2   1 
ATOM   5547 C  CE1   . HIS D 1 177 ? 21.129  6.057   16.494  1.00 24.62 ? 177  HIS D CE1   1 
ATOM   5548 N  NE2   . HIS D 1 177 ? 19.938  5.669   16.076  1.00 26.02 ? 177  HIS D NE2   1 
ATOM   5549 N  N     . LEU D 1 178 ? 23.391  4.813   10.408  1.00 17.74 ? 178  LEU D N     1 
ATOM   5550 C  CA    . LEU D 1 178 ? 24.298  4.296   9.393   1.00 16.72 ? 178  LEU D CA    1 
ATOM   5551 C  C     . LEU D 1 178 ? 25.443  3.463   9.962   1.00 16.99 ? 178  LEU D C     1 
ATOM   5552 O  O     . LEU D 1 178 ? 25.941  2.560   9.289   1.00 17.98 ? 178  LEU D O     1 
ATOM   5553 C  CB    . LEU D 1 178 ? 24.817  5.416   8.487   1.00 16.66 ? 178  LEU D CB    1 
ATOM   5554 C  CG    . LEU D 1 178 ? 23.751  5.971   7.538   1.00 17.11 ? 178  LEU D CG    1 
ATOM   5555 C  CD1   . LEU D 1 178 ? 24.374  6.984   6.602   1.00 16.64 ? 178  LEU D CD1   1 
ATOM   5556 C  CD2   . LEU D 1 178 ? 23.106  4.836   6.732   1.00 17.34 ? 178  LEU D CD2   1 
ATOM   5557 N  N     . CYS D 1 179 ? 25.822  3.706   11.218  1.00 17.06 ? 179  CYS D N     1 
ATOM   5558 C  CA    . CYS D 1 179 ? 26.906  2.924   11.813  1.00 15.30 ? 179  CYS D CA    1 
ATOM   5559 C  C     . CYS D 1 179 ? 26.473  1.465   12.005  1.00 14.93 ? 179  CYS D C     1 
ATOM   5560 O  O     . CYS D 1 179 ? 27.312  0.581   12.183  1.00 16.50 ? 179  CYS D O     1 
ATOM   5561 C  CB    . CYS D 1 179 ? 27.388  3.541   13.134  1.00 15.88 ? 179  CYS D CB    1 
ATOM   5562 S  SG    . CYS D 1 179 ? 26.191  3.514   14.445  1.00 19.88 ? 179  CYS D SG    1 
ATOM   5563 N  N     . MET D 1 180 ? 25.161  1.227   11.969  1.00 15.95 ? 180  MET D N     1 
ATOM   5564 C  CA    . MET D 1 180 ? 24.597  -0.116  12.098  1.00 17.31 ? 180  MET D CA    1 
ATOM   5565 C  C     . MET D 1 180 ? 24.263  -0.689  10.723  1.00 16.90 ? 180  MET D C     1 
ATOM   5566 O  O     . MET D 1 180 ? 24.194  -1.902  10.551  1.00 18.12 ? 180  MET D O     1 
ATOM   5567 C  CB    . MET D 1 180 ? 23.297  -0.092  12.914  1.00 21.16 ? 180  MET D CB    1 
ATOM   5568 C  CG    . MET D 1 180 ? 23.463  0.006   14.416  1.00 29.32 ? 180  MET D CG    1 
ATOM   5569 S  SD    . MET D 1 180 ? 21.860  -0.096  15.260  1.00 32.23 ? 180  MET D SD    1 
ATOM   5570 C  CE    . MET D 1 180 ? 21.290  -1.727  14.742  1.00 31.53 ? 180  MET D CE    1 
ATOM   5571 N  N     . MET D 1 181 ? 24.063  0.197   9.752   1.00 17.63 ? 181  MET D N     1 
ATOM   5572 C  CA    . MET D 1 181 ? 23.676  -0.196  8.398   1.00 16.94 ? 181  MET D CA    1 
ATOM   5573 C  C     . MET D 1 181 ? 24.781  -0.365  7.355   1.00 18.02 ? 181  MET D C     1 
ATOM   5574 O  O     . MET D 1 181 ? 24.779  -1.350  6.615   1.00 17.21 ? 181  MET D O     1 
ATOM   5575 C  CB    . MET D 1 181 ? 22.623  0.784   7.882   1.00 16.02 ? 181  MET D CB    1 
ATOM   5576 C  CG    . MET D 1 181 ? 21.385  0.846   8.768   1.00 18.05 ? 181  MET D CG    1 
ATOM   5577 S  SD    . MET D 1 181 ? 20.270  2.182   8.349   1.00 22.58 ? 181  MET D SD    1 
ATOM   5578 C  CE    . MET D 1 181 ? 19.274  1.388   7.094   1.00 26.99 ? 181  MET D CE    1 
ATOM   5579 N  N     . MET D 1 182 ? 25.710  0.586   7.285   1.00 16.73 ? 182  MET D N     1 
ATOM   5580 C  CA    . MET D 1 182 ? 26.782  0.518   6.289   1.00 17.63 ? 182  MET D CA    1 
ATOM   5581 C  C     . MET D 1 182 ? 28.089  -0.102  6.768   1.00 15.99 ? 182  MET D C     1 
ATOM   5582 O  O     . MET D 1 182 ? 29.065  -0.172  6.019   1.00 16.84 ? 182  MET D O     1 
ATOM   5583 C  CB    . MET D 1 182 ? 27.029  1.898   5.658   1.00 20.52 ? 182  MET D CB    1 
ATOM   5584 C  CG    . MET D 1 182 ? 27.749  2.927   6.513   1.00 23.11 ? 182  MET D CG    1 
ATOM   5585 S  SD    . MET D 1 182 ? 27.716  4.586   5.752   1.00 22.33 ? 182  MET D SD    1 
ATOM   5586 C  CE    . MET D 1 182 ? 28.703  4.377   4.280   1.00 20.37 ? 182  MET D CE    1 
ATOM   5587 N  N     . ARG D 1 183 ? 28.093  -0.575  8.008   1.00 17.31 ? 183  ARG D N     1 
ATOM   5588 C  CA    . ARG D 1 183 ? 29.275  -1.199  8.597   1.00 17.47 ? 183  ARG D CA    1 
ATOM   5589 C  C     . ARG D 1 183 ? 28.855  -1.990  9.829   1.00 17.76 ? 183  ARG D C     1 
ATOM   5590 O  O     . ARG D 1 183 ? 27.670  -2.042  10.165  1.00 16.09 ? 183  ARG D O     1 
ATOM   5591 C  CB    . ARG D 1 183 ? 30.289  -0.130  9.009   1.00 17.31 ? 183  ARG D CB    1 
ATOM   5592 C  CG    . ARG D 1 183 ? 29.740  0.865   10.025  1.00 21.91 ? 183  ARG D CG    1 
ATOM   5593 C  CD    . ARG D 1 183 ? 30.847  1.458   10.877  1.00 22.66 ? 183  ARG D CD    1 
ATOM   5594 N  NE    . ARG D 1 183 ? 31.575  0.423   11.610  1.00 21.98 ? 183  ARG D NE    1 
ATOM   5595 C  CZ    . ARG D 1 183 ? 31.146  -0.153  12.731  1.00 20.50 ? 183  ARG D CZ    1 
ATOM   5596 N  NH1   . ARG D 1 183 ? 29.985  0.202   13.267  1.00 19.29 ? 183  ARG D NH1   1 
ATOM   5597 N  NH2   . ARG D 1 183 ? 31.862  -1.115  13.296  1.00 20.23 ? 183  ARG D NH2   1 
ATOM   5598 N  N     . GLY D 1 184 ? 29.833  -2.597  10.499  1.00 18.53 ? 184  GLY D N     1 
ATOM   5599 C  CA    . GLY D 1 184 ? 29.551  -3.371  11.699  1.00 18.84 ? 184  GLY D CA    1 
ATOM   5600 C  C     . GLY D 1 184 ? 28.561  -4.499  11.480  1.00 18.12 ? 184  GLY D C     1 
ATOM   5601 O  O     . GLY D 1 184 ? 28.785  -5.364  10.634  1.00 20.38 ? 184  GLY D O     1 
ATOM   5602 N  N     . VAL D 1 185 ? 27.453  -4.477  12.218  1.00 19.05 ? 185  VAL D N     1 
ATOM   5603 C  CA    . VAL D 1 185 ? 26.439  -5.519  12.093  1.00 19.30 ? 185  VAL D CA    1 
ATOM   5604 C  C     . VAL D 1 185 ? 25.714  -5.523  10.748  1.00 18.31 ? 185  VAL D C     1 
ATOM   5605 O  O     . VAL D 1 185 ? 25.145  -6.541  10.353  1.00 20.69 ? 185  VAL D O     1 
ATOM   5606 C  CB    . VAL D 1 185 ? 25.406  -5.471  13.247  1.00 18.72 ? 185  VAL D CB    1 
ATOM   5607 C  CG1   . VAL D 1 185 ? 26.104  -5.720  14.569  1.00 22.70 ? 185  VAL D CG1   1 
ATOM   5608 C  CG2   . VAL D 1 185 ? 24.664  -4.136  13.270  1.00 15.12 ? 185  VAL D CG2   1 
ATOM   5609 N  N     . GLU D 1 186 ? 25.748  -4.388  10.053  1.00 16.07 ? 186  GLU D N     1 
ATOM   5610 C  CA    . GLU D 1 186 ? 25.114  -4.242  8.747   1.00 17.48 ? 186  GLU D CA    1 
ATOM   5611 C  C     . GLU D 1 186 ? 23.655  -4.700  8.682   1.00 16.58 ? 186  GLU D C     1 
ATOM   5612 O  O     . GLU D 1 186 ? 23.246  -5.364  7.731   1.00 17.91 ? 186  GLU D O     1 
ATOM   5613 C  CB    . GLU D 1 186 ? 25.942  -4.949  7.667   1.00 15.93 ? 186  GLU D CB    1 
ATOM   5614 C  CG    . GLU D 1 186 ? 27.350  -4.383  7.523   1.00 15.68 ? 186  GLU D CG    1 
ATOM   5615 C  CD    . GLU D 1 186 ? 28.097  -4.981  6.355   1.00 17.95 ? 186  GLU D CD    1 
ATOM   5616 O  OE1   . GLU D 1 186 ? 29.096  -5.688  6.591   1.00 19.93 ? 186  GLU D OE1   1 
ATOM   5617 O  OE2   . GLU D 1 186 ? 27.686  -4.739  5.201   1.00 17.85 ? 186  GLU D OE2   1 
ATOM   5618 N  N     . LYS D 1 187 ? 22.880  -4.360  9.707   1.00 15.92 ? 187  LYS D N     1 
ATOM   5619 C  CA    . LYS D 1 187 ? 21.462  -4.708  9.740   1.00 15.07 ? 187  LYS D CA    1 
ATOM   5620 C  C     . LYS D 1 187 ? 20.738  -3.651  8.911   1.00 17.60 ? 187  LYS D C     1 
ATOM   5621 O  O     . LYS D 1 187 ? 21.017  -2.458  9.038   1.00 16.32 ? 187  LYS D O     1 
ATOM   5622 C  CB    . LYS D 1 187 ? 20.937  -4.725  11.176  1.00 15.31 ? 187  LYS D CB    1 
ATOM   5623 C  CG    . LYS D 1 187 ? 21.449  -5.890  12.019  1.00 15.29 ? 187  LYS D CG    1 
ATOM   5624 C  CD    . LYS D 1 187 ? 20.981  -7.244  11.487  1.00 17.31 ? 187  LYS D CD    1 
ATOM   5625 C  CE    . LYS D 1 187 ? 21.430  -8.378  12.397  1.00 16.33 ? 187  LYS D CE    1 
ATOM   5626 N  NZ    . LYS D 1 187 ? 21.089  -9.746  11.866  1.00 15.74 ? 187  LYS D NZ    1 
ATOM   5627 N  N     . GLN D 1 188 ? 19.803  -4.092  8.076   1.00 13.90 ? 188  GLN D N     1 
ATOM   5628 C  CA    . GLN D 1 188 ? 19.078  -3.198  7.175   1.00 14.38 ? 188  GLN D CA    1 
ATOM   5629 C  C     . GLN D 1 188 ? 17.662  -2.765  7.550   1.00 16.24 ? 188  GLN D C     1 
ATOM   5630 O  O     . GLN D 1 188 ? 17.196  -1.714  7.104   1.00 17.13 ? 188  GLN D O     1 
ATOM   5631 C  CB    . GLN D 1 188 ? 19.031  -3.832  5.779   1.00 13.93 ? 188  GLN D CB    1 
ATOM   5632 C  CG    . GLN D 1 188 ? 20.374  -4.324  5.286   1.00 15.89 ? 188  GLN D CG    1 
ATOM   5633 C  CD    . GLN D 1 188 ? 21.384  -3.202  5.200   1.00 18.31 ? 188  GLN D CD    1 
ATOM   5634 O  OE1   . GLN D 1 188 ? 22.453  -3.252  5.824   1.00 21.44 ? 188  GLN D OE1   1 
ATOM   5635 N  NE2   . GLN D 1 188 ? 21.045  -2.173  4.441   1.00 13.43 ? 188  GLN D NE2   1 
ATOM   5636 N  N     . HIS D 1 189 ? 16.962  -3.578  8.329   1.00 15.16 ? 189  HIS D N     1 
ATOM   5637 C  CA    . HIS D 1 189 ? 15.575  -3.272  8.680   1.00 14.41 ? 189  HIS D CA    1 
ATOM   5638 C  C     . HIS D 1 189 ? 15.336  -2.590  10.016  1.00 14.67 ? 189  HIS D C     1 
ATOM   5639 O  O     . HIS D 1 189 ? 14.200  -2.241  10.341  1.00 16.48 ? 189  HIS D O     1 
ATOM   5640 C  CB    . HIS D 1 189 ? 14.744  -4.556  8.633   1.00 17.24 ? 189  HIS D CB    1 
ATOM   5641 C  CG    . HIS D 1 189 ? 14.611  -5.136  7.263   1.00 18.68 ? 189  HIS D CG    1 
ATOM   5642 N  ND1   . HIS D 1 189 ? 15.216  -6.318  6.892   1.00 20.97 ? 189  HIS D ND1   1 
ATOM   5643 C  CD2   . HIS D 1 189 ? 13.949  -4.693  6.170   1.00 16.83 ? 189  HIS D CD2   1 
ATOM   5644 C  CE1   . HIS D 1 189 ? 14.933  -6.577  5.628   1.00 16.33 ? 189  HIS D CE1   1 
ATOM   5645 N  NE2   . HIS D 1 189 ? 14.166  -5.607  5.166   1.00 23.28 ? 189  HIS D NE2   1 
ATOM   5646 N  N     . SER D 1 190 ? 16.402  -2.334  10.757  1.00 15.40 ? 190  SER D N     1 
ATOM   5647 C  CA    . SER D 1 190 ? 16.255  -1.749  12.081  1.00 17.14 ? 190  SER D CA    1 
ATOM   5648 C  C     . SER D 1 190 ? 16.146  -0.238  12.188  1.00 15.57 ? 190  SER D C     1 
ATOM   5649 O  O     . SER D 1 190 ? 16.697  0.501   11.376  1.00 14.46 ? 190  SER D O     1 
ATOM   5650 C  CB    . SER D 1 190 ? 17.389  -2.238  12.984  1.00 16.13 ? 190  SER D CB    1 
ATOM   5651 O  OG    . SER D 1 190 ? 17.160  -1.846  14.327  1.00 24.24 ? 190  SER D OG    1 
ATOM   5652 N  N     . ARG D 1 191 ? 15.380  0.199   13.184  1.00 16.63 ? 191  ARG D N     1 
ATOM   5653 C  CA    . ARG D 1 191 ? 15.223  1.614   13.499  1.00 14.49 ? 191  ARG D CA    1 
ATOM   5654 C  C     . ARG D 1 191 ? 15.048  1.714   15.011  1.00 17.11 ? 191  ARG D C     1 
ATOM   5655 O  O     . ARG D 1 191 ? 14.572  0.774   15.649  1.00 15.12 ? 191  ARG D O     1 
ATOM   5656 C  CB    . ARG D 1 191 ? 14.087  2.283   12.718  1.00 19.55 ? 191  ARG D CB    1 
ATOM   5657 C  CG    . ARG D 1 191 ? 12.691  1.787   12.968  1.00 23.78 ? 191  ARG D CG    1 
ATOM   5658 C  CD    . ARG D 1 191 ? 11.748  2.491   11.995  1.00 29.09 ? 191  ARG D CD    1 
ATOM   5659 N  NE    . ARG D 1 191 ? 10.342  2.206   12.266  1.00 34.53 ? 191  ARG D NE    1 
ATOM   5660 C  CZ    . ARG D 1 191 ? 9.614   1.304   11.613  1.00 37.26 ? 191  ARG D CZ    1 
ATOM   5661 N  NH1   . ARG D 1 191 ? 10.153  0.584   10.637  1.00 37.54 ? 191  ARG D NH1   1 
ATOM   5662 N  NH2   . ARG D 1 191 ? 8.344   1.117   11.947  1.00 39.78 ? 191  ARG D NH2   1 
ATOM   5663 N  N     . THR D 1 192 ? 15.488  2.827   15.585  1.00 14.47 ? 192  THR D N     1 
ATOM   5664 C  CA    . THR D 1 192 ? 15.422  3.003   17.029  1.00 15.71 ? 192  THR D CA    1 
ATOM   5665 C  C     . THR D 1 192 ? 14.525  4.138   17.475  1.00 14.29 ? 192  THR D C     1 
ATOM   5666 O  O     . THR D 1 192 ? 14.505  5.210   16.871  1.00 17.54 ? 192  THR D O     1 
ATOM   5667 C  CB    . THR D 1 192 ? 16.835  3.220   17.600  1.00 16.40 ? 192  THR D CB    1 
ATOM   5668 O  OG1   . THR D 1 192 ? 17.643  2.076   17.302  1.00 16.64 ? 192  THR D OG1   1 
ATOM   5669 C  CG2   . THR D 1 192 ? 16.796  3.442   19.122  1.00 15.51 ? 192  THR D CG2   1 
ATOM   5670 N  N     . VAL D 1 193 ? 13.773  3.874   18.537  1.00 14.66 ? 193  VAL D N     1 
ATOM   5671 C  CA    . VAL D 1 193 ? 12.873  4.845   19.126  1.00 13.62 ? 193  VAL D CA    1 
ATOM   5672 C  C     . VAL D 1 193 ? 13.374  5.188   20.525  1.00 13.67 ? 193  VAL D C     1 
ATOM   5673 O  O     . VAL D 1 193 ? 13.727  4.302   21.298  1.00 15.06 ? 193  VAL D O     1 
ATOM   5674 C  CB    . VAL D 1 193 ? 11.433  4.280   19.255  1.00 16.08 ? 193  VAL D CB    1 
ATOM   5675 C  CG1   . VAL D 1 193 ? 10.552  5.229   20.065  1.00 17.94 ? 193  VAL D CG1   1 
ATOM   5676 C  CG2   . VAL D 1 193 ? 10.833  4.048   17.874  1.00 17.72 ? 193  VAL D CG2   1 
ATOM   5677 N  N     . THR D 1 194 ? 13.504  6.484   20.788  1.00 14.54 ? 194  THR D N     1 
ATOM   5678 C  CA    . THR D 1 194 ? 13.909  6.982   22.095  1.00 13.76 ? 194  THR D CA    1 
ATOM   5679 C  C     . THR D 1 194 ? 12.902  8.075   22.413  1.00 16.26 ? 194  THR D C     1 
ATOM   5680 O  O     . THR D 1 194 ? 12.247  8.614   21.515  1.00 16.06 ? 194  THR D O     1 
ATOM   5681 C  CB    . THR D 1 194 ? 15.338  7.586   22.111  1.00 14.14 ? 194  THR D CB    1 
ATOM   5682 O  OG1   . THR D 1 194 ? 15.433  8.645   21.152  1.00 18.60 ? 194  THR D OG1   1 
ATOM   5683 C  CG2   . THR D 1 194 ? 16.390  6.516   21.832  1.00 15.86 ? 194  THR D CG2   1 
ATOM   5684 N  N     . SER D 1 195 ? 12.757  8.396   23.690  1.00 18.89 ? 195  SER D N     1 
ATOM   5685 C  CA    . SER D 1 195 ? 11.807  9.422   24.073  1.00 20.45 ? 195  SER D CA    1 
ATOM   5686 C  C     . SER D 1 195 ? 12.158  10.040  25.411  1.00 18.52 ? 195  SER D C     1 
ATOM   5687 O  O     . SER D 1 195 ? 13.052  9.567   26.109  1.00 20.09 ? 195  SER D O     1 
ATOM   5688 C  CB    . SER D 1 195 ? 10.394  8.834   24.142  1.00 22.14 ? 195  SER D CB    1 
ATOM   5689 O  OG    . SER D 1 195 ? 10.324  7.816   25.123  1.00 23.39 ? 195  SER D OG    1 
ATOM   5690 N  N     . ALA D 1 196 ? 11.443  11.109  25.739  1.00 19.16 ? 196  ALA D N     1 
ATOM   5691 C  CA    . ALA D 1 196 ? 11.613  11.830  26.993  1.00 20.95 ? 196  ALA D CA    1 
ATOM   5692 C  C     . ALA D 1 196 ? 10.238  12.396  27.320  1.00 20.83 ? 196  ALA D C     1 
ATOM   5693 O  O     . ALA D 1 196 ? 9.592   13.006  26.466  1.00 21.60 ? 196  ALA D O     1 
ATOM   5694 C  CB    . ALA D 1 196 ? 12.634  12.948  26.832  1.00 19.64 ? 196  ALA D CB    1 
ATOM   5695 N  N     . MET D 1 197 ? 9.774   12.139  28.540  1.00 19.99 ? 197  MET D N     1 
ATOM   5696 C  CA    . MET D 1 197 ? 8.466   12.599  28.986  1.00 22.23 ? 197  MET D CA    1 
ATOM   5697 C  C     . MET D 1 197 ? 8.640   13.489  30.216  1.00 23.38 ? 197  MET D C     1 
ATOM   5698 O  O     . MET D 1 197 ? 9.292   13.099  31.182  1.00 24.73 ? 197  MET D O     1 
ATOM   5699 C  CB    . MET D 1 197 ? 7.580   11.396  29.330  1.00 23.01 ? 197  MET D CB    1 
ATOM   5700 C  CG    . MET D 1 197 ? 7.331   10.429  28.176  1.00 22.45 ? 197  MET D CG    1 
ATOM   5701 S  SD    . MET D 1 197 ? 6.294   11.121  26.885  1.00 23.97 ? 197  MET D SD    1 
ATOM   5702 C  CE    . MET D 1 197 ? 6.788   10.135  25.476  1.00 26.90 ? 197  MET D CE    1 
ATOM   5703 N  N     . LEU D 1 198 ? 8.057   14.682  30.171  1.00 25.72 ? 198  LEU D N     1 
ATOM   5704 C  CA    . LEU D 1 198 ? 8.168   15.630  31.277  1.00 26.40 ? 198  LEU D CA    1 
ATOM   5705 C  C     . LEU D 1 198 ? 6.803   16.146  31.701  1.00 26.30 ? 198  LEU D C     1 
ATOM   5706 O  O     . LEU D 1 198 ? 5.871   16.202  30.898  1.00 25.50 ? 198  LEU D O     1 
ATOM   5707 C  CB    . LEU D 1 198 ? 9.050   16.816  30.872  1.00 27.08 ? 198  LEU D CB    1 
ATOM   5708 C  CG    . LEU D 1 198 ? 10.480  16.544  30.399  1.00 26.17 ? 198  LEU D CG    1 
ATOM   5709 C  CD1   . LEU D 1 198 ? 11.092  17.835  29.881  1.00 26.18 ? 198  LEU D CD1   1 
ATOM   5710 C  CD2   . LEU D 1 198 ? 11.321  15.965  31.529  1.00 30.07 ? 198  LEU D CD2   1 
ATOM   5711 N  N     . GLY D 1 199 ? 6.696   16.544  32.968  1.00 26.95 ? 199  GLY D N     1 
ATOM   5712 C  CA    . GLY D 1 199 ? 5.438   17.056  33.475  1.00 24.17 ? 199  GLY D CA    1 
ATOM   5713 C  C     . GLY D 1 199 ? 4.351   15.998  33.443  1.00 23.49 ? 199  GLY D C     1 
ATOM   5714 O  O     . GLY D 1 199 ? 4.600   14.839  33.773  1.00 23.36 ? 199  GLY D O     1 
ATOM   5715 N  N     . VAL D 1 200 ? 3.157   16.386  33.007  1.00 23.48 ? 200  VAL D N     1 
ATOM   5716 C  CA    . VAL D 1 200 ? 2.028   15.463  32.939  1.00 27.05 ? 200  VAL D CA    1 
ATOM   5717 C  C     . VAL D 1 200 ? 2.220   14.295  31.970  1.00 29.56 ? 200  VAL D C     1 
ATOM   5718 O  O     . VAL D 1 200 ? 1.553   13.268  32.099  1.00 28.34 ? 200  VAL D O     1 
ATOM   5719 C  CB    . VAL D 1 200 ? 0.704   16.198  32.629  1.00 29.13 ? 200  VAL D CB    1 
ATOM   5720 C  CG1   . VAL D 1 200 ? 0.420   17.228  33.715  1.00 29.31 ? 200  VAL D CG1   1 
ATOM   5721 C  CG2   . VAL D 1 200 ? 0.756   16.858  31.253  1.00 26.46 ? 200  VAL D CG2   1 
ATOM   5722 N  N     . PHE D 1 201 ? 3.138   14.443  31.014  1.00 29.93 ? 201  PHE D N     1 
ATOM   5723 C  CA    . PHE D 1 201 ? 3.409   13.370  30.057  1.00 31.71 ? 201  PHE D CA    1 
ATOM   5724 C  C     . PHE D 1 201 ? 4.099   12.202  30.755  1.00 33.06 ? 201  PHE D C     1 
ATOM   5725 O  O     . PHE D 1 201 ? 4.003   11.056  30.312  1.00 34.34 ? 201  PHE D O     1 
ATOM   5726 C  CB    . PHE D 1 201 ? 4.261   13.877  28.887  1.00 28.52 ? 201  PHE D CB    1 
ATOM   5727 C  CG    . PHE D 1 201 ? 3.464   14.565  27.811  1.00 27.41 ? 201  PHE D CG    1 
ATOM   5728 C  CD1   . PHE D 1 201 ? 3.469   14.080  26.506  1.00 26.23 ? 201  PHE D CD1   1 
ATOM   5729 C  CD2   . PHE D 1 201 ? 2.700   15.690  28.101  1.00 26.56 ? 201  PHE D CD2   1 
ATOM   5730 C  CE1   . PHE D 1 201 ? 2.725   14.707  25.509  1.00 25.66 ? 201  PHE D CE1   1 
ATOM   5731 C  CE2   . PHE D 1 201 ? 1.954   16.323  27.114  1.00 25.06 ? 201  PHE D CE2   1 
ATOM   5732 C  CZ    . PHE D 1 201 ? 1.966   15.830  25.812  1.00 27.13 ? 201  PHE D CZ    1 
ATOM   5733 N  N     . ARG D 1 202 ? 4.803   12.505  31.843  1.00 32.15 ? 202  ARG D N     1 
ATOM   5734 C  CA    . ARG D 1 202 ? 5.491   11.486  32.628  1.00 36.05 ? 202  ARG D CA    1 
ATOM   5735 C  C     . ARG D 1 202 ? 4.557   11.019  33.742  1.00 36.69 ? 202  ARG D C     1 
ATOM   5736 O  O     . ARG D 1 202 ? 4.448   9.825   34.018  1.00 36.47 ? 202  ARG D O     1 
ATOM   5737 C  CB    . ARG D 1 202 ? 6.774   12.061  33.241  1.00 37.27 ? 202  ARG D CB    1 
ATOM   5738 C  CG    . ARG D 1 202 ? 7.665   11.022  33.917  1.00 42.37 ? 202  ARG D CG    1 
ATOM   5739 C  CD    . ARG D 1 202 ? 8.949   11.647  34.455  1.00 47.90 ? 202  ARG D CD    1 
ATOM   5740 N  NE    . ARG D 1 202 ? 9.942   10.636  34.821  1.00 53.07 ? 202  ARG D NE    1 
ATOM   5741 C  CZ    . ARG D 1 202 ? 10.046  10.075  36.024  1.00 56.19 ? 202  ARG D CZ    1 
ATOM   5742 N  NH1   . ARG D 1 202 ? 9.217   10.422  37.002  1.00 56.96 ? 202  ARG D NH1   1 
ATOM   5743 N  NH2   . ARG D 1 202 ? 10.977  9.156   36.249  1.00 56.28 ? 202  ARG D NH2   1 
ATOM   5744 N  N     . GLU D 1 203 ? 3.861   11.982  34.342  1.00 39.01 ? 203  GLU D N     1 
ATOM   5745 C  CA    . GLU D 1 203 ? 2.931   11.744  35.446  1.00 42.44 ? 203  GLU D CA    1 
ATOM   5746 C  C     . GLU D 1 203 ? 1.698   10.924  35.079  1.00 41.70 ? 203  GLU D C     1 
ATOM   5747 O  O     . GLU D 1 203 ? 1.434   9.886   35.689  1.00 41.81 ? 203  GLU D O     1 
ATOM   5748 C  CB    . GLU D 1 203 ? 2.484   13.084  36.045  1.00 44.13 ? 203  GLU D CB    1 
ATOM   5749 C  CG    . GLU D 1 203 ? 3.616   13.922  36.653  1.00 48.29 ? 203  GLU D CG    1 
ATOM   5750 C  CD    . GLU D 1 203 ? 3.234   15.386  36.886  1.00 49.72 ? 203  GLU D CD    1 
ATOM   5751 O  OE1   . GLU D 1 203 ? 2.027   15.718  36.882  1.00 50.41 ? 203  GLU D OE1   1 
ATOM   5752 O  OE2   . GLU D 1 203 ? 4.154   16.213  37.067  1.00 51.74 ? 203  GLU D OE2   1 
ATOM   5753 N  N     . ASN D 1 204 ? 0.936   11.408  34.102  1.00 41.03 ? 204  ASN D N     1 
ATOM   5754 C  CA    . ASN D 1 204 ? -0.288  10.742  33.667  1.00 40.34 ? 204  ASN D CA    1 
ATOM   5755 C  C     . ASN D 1 204 ? -0.088  9.815   32.466  1.00 39.46 ? 204  ASN D C     1 
ATOM   5756 O  O     . ASN D 1 204 ? 0.244   10.261  31.364  1.00 35.16 ? 204  ASN D O     1 
ATOM   5757 C  CB    . ASN D 1 204 ? -1.369  11.785  33.365  1.00 43.05 ? 204  ASN D CB    1 
ATOM   5758 C  CG    . ASN D 1 204 ? -2.704  11.159  32.986  1.00 48.58 ? 204  ASN D CG    1 
ATOM   5759 O  OD1   . ASN D 1 204 ? -3.485  11.747  32.234  1.00 47.71 ? 204  ASN D OD1   1 
ATOM   5760 N  ND2   . ASN D 1 204 ? -2.975  9.965   33.512  1.00 49.44 ? 204  ASN D ND2   1 
ATOM   5761 N  N     . GLN D 1 205 ? -0.346  8.530   32.688  1.00 36.82 ? 205  GLN D N     1 
ATOM   5762 C  CA    . GLN D 1 205 ? -0.203  7.506   31.658  1.00 37.06 ? 205  GLN D CA    1 
ATOM   5763 C  C     . GLN D 1 205 ? -1.181  7.698   30.494  1.00 33.98 ? 205  GLN D C     1 
ATOM   5764 O  O     . GLN D 1 205 ? -0.850  7.398   29.346  1.00 32.15 ? 205  GLN D O     1 
ATOM   5765 C  CB    . GLN D 1 205 ? -0.367  6.116   32.291  1.00 40.13 ? 205  GLN D CB    1 
ATOM   5766 C  CG    . GLN D 1 205 ? -0.114  4.934   31.361  1.00 45.63 ? 205  GLN D CG    1 
ATOM   5767 C  CD    . GLN D 1 205 ? -1.358  4.505   30.601  1.00 47.42 ? 205  GLN D CD    1 
ATOM   5768 O  OE1   . GLN D 1 205 ? -2.452  4.451   31.160  1.00 49.31 ? 205  GLN D OE1   1 
ATOM   5769 N  NE2   . GLN D 1 205 ? -1.193  4.195   29.322  1.00 49.61 ? 205  GLN D NE2   1 
ATOM   5770 N  N     . LYS D 1 206 ? -2.373  8.210   30.792  1.00 31.46 ? 206  LYS D N     1 
ATOM   5771 C  CA    . LYS D 1 206 ? -3.393  8.439   29.771  1.00 30.88 ? 206  LYS D CA    1 
ATOM   5772 C  C     . LYS D 1 206 ? -3.007  9.570   28.826  1.00 28.66 ? 206  LYS D C     1 
ATOM   5773 O  O     . LYS D 1 206 ? -3.372  9.560   27.649  1.00 24.72 ? 206  LYS D O     1 
ATOM   5774 C  CB    . LYS D 1 206 ? -4.747  8.736   30.419  1.00 36.25 ? 206  LYS D CB    1 
ATOM   5775 C  CG    . LYS D 1 206 ? -5.308  7.581   31.240  1.00 41.22 ? 206  LYS D CG    1 
ATOM   5776 C  CD    . LYS D 1 206 ? -5.582  6.361   30.371  1.00 43.78 ? 206  LYS D CD    1 
ATOM   5777 C  CE    . LYS D 1 206 ? -6.046  5.172   31.204  1.00 47.20 ? 206  LYS D CE    1 
ATOM   5778 N  NZ    . LYS D 1 206 ? -7.286  5.470   31.975  1.00 48.72 ? 206  LYS D NZ    1 
ATOM   5779 N  N     . THR D 1 207 ? -2.290  10.557  29.350  1.00 26.82 ? 207  THR D N     1 
ATOM   5780 C  CA    . THR D 1 207 ? -1.850  11.679  28.534  1.00 25.29 ? 207  THR D CA    1 
ATOM   5781 C  C     . THR D 1 207 ? -0.765  11.184  27.582  1.00 23.58 ? 207  THR D C     1 
ATOM   5782 O  O     . THR D 1 207 ? -0.813  11.464  26.384  1.00 24.05 ? 207  THR D O     1 
ATOM   5783 C  CB    . THR D 1 207 ? -1.318  12.834  29.409  1.00 24.12 ? 207  THR D CB    1 
ATOM   5784 O  OG1   . THR D 1 207 ? -2.401  13.382  30.169  1.00 24.96 ? 207  THR D OG1   1 
ATOM   5785 C  CG2   . THR D 1 207 ? -0.711  13.932  28.546  1.00 22.96 ? 207  THR D CG2   1 
ATOM   5786 N  N     . ARG D 1 208 ? 0.186   10.425  28.123  1.00 22.85 ? 208  ARG D N     1 
ATOM   5787 C  CA    . ARG D 1 208 ? 1.284   9.865   27.341  1.00 25.08 ? 208  ARG D CA    1 
ATOM   5788 C  C     . ARG D 1 208 ? 0.729   8.937   26.263  1.00 25.14 ? 208  ARG D C     1 
ATOM   5789 O  O     . ARG D 1 208 ? 1.112   9.029   25.099  1.00 22.57 ? 208  ARG D O     1 
ATOM   5790 C  CB    . ARG D 1 208 ? 2.253   9.093   28.246  1.00 27.18 ? 208  ARG D CB    1 
ATOM   5791 C  CG    . ARG D 1 208 ? 3.427   8.456   27.504  1.00 28.01 ? 208  ARG D CG    1 
ATOM   5792 C  CD    . ARG D 1 208 ? 4.510   7.941   28.443  1.00 30.16 ? 208  ARG D CD    1 
ATOM   5793 N  NE    . ARG D 1 208 ? 4.042   6.858   29.306  1.00 32.18 ? 208  ARG D NE    1 
ATOM   5794 C  CZ    . ARG D 1 208 ? 3.735   7.001   30.592  1.00 32.74 ? 208  ARG D CZ    1 
ATOM   5795 N  NH1   . ARG D 1 208 ? 3.846   8.185   31.180  1.00 32.98 ? 208  ARG D NH1   1 
ATOM   5796 N  NH2   . ARG D 1 208 ? 3.304   5.958   31.288  1.00 34.39 ? 208  ARG D NH2   1 
ATOM   5797 N  N     . GLU D 1 209 ? -0.200  8.071   26.662  1.00 24.77 ? 209  GLU D N     1 
ATOM   5798 C  CA    . GLU D 1 209 ? -0.827  7.116   25.753  1.00 26.28 ? 209  GLU D CA    1 
ATOM   5799 C  C     . GLU D 1 209 ? -1.551  7.831   24.613  1.00 25.64 ? 209  GLU D C     1 
ATOM   5800 O  O     . GLU D 1 209 ? -1.505  7.388   23.460  1.00 25.01 ? 209  GLU D O     1 
ATOM   5801 C  CB    . GLU D 1 209 ? -1.806  6.235   26.529  1.00 29.42 ? 209  GLU D CB    1 
ATOM   5802 C  CG    . GLU D 1 209 ? -2.436  5.123   25.717  1.00 37.05 ? 209  GLU D CG    1 
ATOM   5803 C  CD    . GLU D 1 209 ? -3.524  4.403   26.486  1.00 40.40 ? 209  GLU D CD    1 
ATOM   5804 O  OE1   . GLU D 1 209 ? -3.202  3.431   27.200  1.00 43.08 ? 209  GLU D OE1   1 
ATOM   5805 O  OE2   . GLU D 1 209 ? -4.699  4.819   26.382  1.00 44.92 ? 209  GLU D OE2   1 
ATOM   5806 N  N     . GLU D 1 210 ? -2.218  8.936   24.938  1.00 22.26 ? 210  GLU D N     1 
ATOM   5807 C  CA    . GLU D 1 210 ? -2.935  9.718   23.935  1.00 23.67 ? 210  GLU D CA    1 
ATOM   5808 C  C     . GLU D 1 210 ? -1.953  10.355  22.946  1.00 22.65 ? 210  GLU D C     1 
ATOM   5809 O  O     . GLU D 1 210 ? -2.209  10.400  21.743  1.00 22.09 ? 210  GLU D O     1 
ATOM   5810 C  CB    . GLU D 1 210 ? -3.793  10.787  24.609  1.00 25.77 ? 210  GLU D CB    1 
ATOM   5811 C  CG    . GLU D 1 210 ? -4.583  11.654  23.646  1.00 25.83 ? 210  GLU D CG    1 
ATOM   5812 C  CD    . GLU D 1 210 ? -5.541  12.586  24.361  1.00 28.94 ? 210  GLU D CD    1 
ATOM   5813 O  OE1   . GLU D 1 210 ? -6.408  12.086  25.105  1.00 27.68 ? 210  GLU D OE1   1 
ATOM   5814 O  OE2   . GLU D 1 210 ? -5.432  13.815  24.176  1.00 29.00 ? 210  GLU D OE2   1 
ATOM   5815 N  N     . PHE D 1 211 ? -0.827  10.843  23.464  1.00 21.19 ? 211  PHE D N     1 
ATOM   5816 C  CA    . PHE D 1 211 ? 0.206   11.450  22.631  1.00 22.60 ? 211  PHE D CA    1 
ATOM   5817 C  C     . PHE D 1 211 ? 0.753   10.393  21.670  1.00 20.99 ? 211  PHE D C     1 
ATOM   5818 O  O     . PHE D 1 211 ? 0.830   10.621  20.466  1.00 21.85 ? 211  PHE D O     1 
ATOM   5819 C  CB    . PHE D 1 211 ? 1.335   12.004  23.518  1.00 18.80 ? 211  PHE D CB    1 
ATOM   5820 C  CG    . PHE D 1 211 ? 2.607   12.338  22.773  1.00 17.87 ? 211  PHE D CG    1 
ATOM   5821 C  CD1   . PHE D 1 211 ? 3.836   11.883  23.245  1.00 18.85 ? 211  PHE D CD1   1 
ATOM   5822 C  CD2   . PHE D 1 211 ? 2.583   13.106  21.614  1.00 18.31 ? 211  PHE D CD2   1 
ATOM   5823 C  CE1   . PHE D 1 211 ? 5.026   12.188  22.573  1.00 17.10 ? 211  PHE D CE1   1 
ATOM   5824 C  CE2   . PHE D 1 211 ? 3.764   13.416  20.936  1.00 17.56 ? 211  PHE D CE2   1 
ATOM   5825 C  CZ    . PHE D 1 211 ? 4.986   12.955  21.419  1.00 17.14 ? 211  PHE D CZ    1 
ATOM   5826 N  N     . LEU D 1 212 ? 1.094   9.230   22.214  1.00 23.04 ? 212  LEU D N     1 
ATOM   5827 C  CA    . LEU D 1 212 ? 1.643   8.135   21.423  1.00 22.84 ? 212  LEU D CA    1 
ATOM   5828 C  C     . LEU D 1 212 ? 0.662   7.596   20.380  1.00 24.07 ? 212  LEU D C     1 
ATOM   5829 O  O     . LEU D 1 212 ? 1.070   7.226   19.281  1.00 21.26 ? 212  LEU D O     1 
ATOM   5830 C  CB    . LEU D 1 212 ? 2.147   7.016   22.344  1.00 23.39 ? 212  LEU D CB    1 
ATOM   5831 C  CG    . LEU D 1 212 ? 3.315   7.408   23.266  1.00 20.99 ? 212  LEU D CG    1 
ATOM   5832 C  CD1   . LEU D 1 212 ? 3.699   6.254   24.180  1.00 23.04 ? 212  LEU D CD1   1 
ATOM   5833 C  CD2   . LEU D 1 212 ? 4.520   7.847   22.437  1.00 21.33 ? 212  LEU D CD2   1 
ATOM   5834 N  N     . SER D 1 213 ? -0.629  7.594   20.713  1.00 22.72 ? 213  SER D N     1 
ATOM   5835 C  CA    . SER D 1 213 ? -1.663  7.118   19.793  1.00 23.93 ? 213  SER D CA    1 
ATOM   5836 C  C     . SER D 1 213 ? -1.781  8.032   18.578  1.00 22.98 ? 213  SER D C     1 
ATOM   5837 O  O     . SER D 1 213 ? -2.083  7.575   17.475  1.00 23.20 ? 213  SER D O     1 
ATOM   5838 C  CB    . SER D 1 213 ? -3.017  7.012   20.500  1.00 23.16 ? 213  SER D CB    1 
ATOM   5839 O  OG    . SER D 1 213 ? -3.036  5.916   21.396  1.00 27.56 ? 213  SER D OG    1 
ATOM   5840 N  N     . HIS D 1 214 ? -1.553  9.327   18.791  1.00 21.40 ? 214  HIS D N     1 
ATOM   5841 C  CA    . HIS D 1 214 ? -1.605  10.307  17.709  1.00 21.13 ? 214  HIS D CA    1 
ATOM   5842 C  C     . HIS D 1 214 ? -0.498  10.060  16.687  1.00 22.22 ? 214  HIS D C     1 
ATOM   5843 O  O     . HIS D 1 214 ? -0.604  10.486  15.537  1.00 22.05 ? 214  HIS D O     1 
ATOM   5844 C  CB    . HIS D 1 214 ? -1.460  11.731  18.258  1.00 19.61 ? 214  HIS D CB    1 
ATOM   5845 C  CG    . HIS D 1 214 ? -2.759  12.372  18.634  1.00 21.48 ? 214  HIS D CG    1 
ATOM   5846 N  ND1   . HIS D 1 214 ? -3.780  12.566  17.730  1.00 23.77 ? 214  HIS D ND1   1 
ATOM   5847 C  CD2   . HIS D 1 214 ? -3.195  12.881  19.810  1.00 22.54 ? 214  HIS D CD2   1 
ATOM   5848 C  CE1   . HIS D 1 214 ? -4.790  13.168  18.333  1.00 26.97 ? 214  HIS D CE1   1 
ATOM   5849 N  NE2   . HIS D 1 214 ? -4.461  13.370  19.596  1.00 24.92 ? 214  HIS D NE2   1 
ATOM   5850 N  N     . LEU D 1 215 ? 0.562   9.372   17.108  1.00 23.80 ? 215  LEU D N     1 
ATOM   5851 C  CA    . LEU D 1 215 ? 1.687   9.091   16.218  1.00 26.90 ? 215  LEU D CA    1 
ATOM   5852 C  C     . LEU D 1 215 ? 1.490   7.849   15.353  1.00 29.52 ? 215  LEU D C     1 
ATOM   5853 O  O     . LEU D 1 215 ? 2.176   7.681   14.344  1.00 30.70 ? 215  LEU D O     1 
ATOM   5854 C  CB    . LEU D 1 215 ? 2.994   8.987   17.013  1.00 25.94 ? 215  LEU D CB    1 
ATOM   5855 C  CG    . LEU D 1 215 ? 3.353   10.197  17.882  1.00 22.54 ? 215  LEU D CG    1 
ATOM   5856 C  CD1   . LEU D 1 215 ? 4.742   10.008  18.478  1.00 20.92 ? 215  LEU D CD1   1 
ATOM   5857 C  CD2   . LEU D 1 215 ? 3.293   11.478  17.059  1.00 22.20 ? 215  LEU D CD2   1 
ATOM   5858 N  N     . ARG D 1 216 ? 0.566   6.977   15.750  1.00 31.53 ? 216  ARG D N     1 
ATOM   5859 C  CA    . ARG D 1 216 ? 0.291   5.766   14.982  1.00 34.30 ? 216  ARG D CA    1 
ATOM   5860 C  C     . ARG D 1 216 ? -0.712  6.049   13.867  1.00 36.44 ? 216  ARG D C     1 
ATOM   5861 O  O     . ARG D 1 216 ? -1.880  6.362   14.181  1.00 37.55 ? 216  ARG D O     1 
ATOM   5862 C  CB    . ARG D 1 216 ? -0.223  4.637   15.881  1.00 33.47 ? 216  ARG D CB    1 
ATOM   5863 C  CG    . ARG D 1 216 ? 0.794   4.131   16.893  1.00 33.34 ? 216  ARG D CG    1 
ATOM   5864 C  CD    . ARG D 1 216 ? 0.438   2.742   17.422  1.00 28.91 ? 216  ARG D CD    1 
ATOM   5865 N  NE    . ARG D 1 216 ? -0.870  2.678   18.076  1.00 31.38 ? 216  ARG D NE    1 
ATOM   5866 C  CZ    . ARG D 1 216 ? -1.142  3.179   19.279  1.00 30.40 ? 216  ARG D CZ    1 
ATOM   5867 N  NH1   . ARG D 1 216 ? -0.200  3.797   19.979  1.00 31.35 ? 216  ARG D NH1   1 
ATOM   5868 N  NH2   . ARG D 1 216 ? -2.359  3.051   19.790  1.00 33.05 ? 216  ARG D NH2   1 
ATOM   5869 N  N     . VAL E 1 33  ? 34.814  -26.387 14.791  1.00 32.47 ? 33   VAL E N     1 
ATOM   5870 C  CA    . VAL E 1 33  ? 34.065  -27.260 13.841  1.00 28.70 ? 33   VAL E CA    1 
ATOM   5871 C  C     . VAL E 1 33  ? 34.995  -27.842 12.781  1.00 27.50 ? 33   VAL E C     1 
ATOM   5872 O  O     . VAL E 1 33  ? 35.761  -27.119 12.139  1.00 25.15 ? 33   VAL E O     1 
ATOM   5873 C  CB    . VAL E 1 33  ? 32.903  -26.488 13.159  1.00 30.28 ? 33   VAL E CB    1 
ATOM   5874 C  CG1   . VAL E 1 33  ? 32.281  -27.324 12.049  1.00 28.16 ? 33   VAL E CG1   1 
ATOM   5875 C  CG2   . VAL E 1 33  ? 31.845  -26.137 14.186  1.00 30.56 ? 33   VAL E CG2   1 
ATOM   5876 N  N     . ASP E 1 34  ? 34.919  -29.158 12.608  1.00 24.97 ? 34   ASP E N     1 
ATOM   5877 C  CA    . ASP E 1 34  ? 35.748  -29.857 11.637  1.00 24.87 ? 34   ASP E CA    1 
ATOM   5878 C  C     . ASP E 1 34  ? 35.149  -29.721 10.238  1.00 23.21 ? 34   ASP E C     1 
ATOM   5879 O  O     . ASP E 1 34  ? 34.323  -30.537 9.825   1.00 22.72 ? 34   ASP E O     1 
ATOM   5880 C  CB    . ASP E 1 34  ? 35.866  -31.333 12.023  1.00 26.68 ? 34   ASP E CB    1 
ATOM   5881 C  CG    . ASP E 1 34  ? 36.987  -32.048 11.292  1.00 27.94 ? 34   ASP E CG    1 
ATOM   5882 O  OD1   . ASP E 1 34  ? 37.288  -31.700 10.129  1.00 27.24 ? 34   ASP E OD1   1 
ATOM   5883 O  OD2   . ASP E 1 34  ? 37.574  -32.970 11.893  1.00 32.10 ? 34   ASP E OD2   1 
ATOM   5884 N  N     . LEU E 1 35  ? 35.599  -28.703 9.511   1.00 22.55 ? 35   LEU E N     1 
ATOM   5885 C  CA    . LEU E 1 35  ? 35.121  -28.430 8.157   1.00 25.10 ? 35   LEU E CA    1 
ATOM   5886 C  C     . LEU E 1 35  ? 35.327  -29.607 7.214   1.00 25.44 ? 35   LEU E C     1 
ATOM   5887 O  O     . LEU E 1 35  ? 34.478  -29.884 6.368   1.00 21.69 ? 35   LEU E O     1 
ATOM   5888 C  CB    . LEU E 1 35  ? 35.820  -27.196 7.585   1.00 26.39 ? 35   LEU E CB    1 
ATOM   5889 C  CG    . LEU E 1 35  ? 35.562  -25.859 8.286   1.00 30.70 ? 35   LEU E CG    1 
ATOM   5890 C  CD1   . LEU E 1 35  ? 36.414  -24.765 7.650   1.00 30.54 ? 35   LEU E CD1   1 
ATOM   5891 C  CD2   . LEU E 1 35  ? 34.083  -25.504 8.201   1.00 29.15 ? 35   LEU E CD2   1 
ATOM   5892 N  N     . GLU E 1 36  ? 36.450  -30.303 7.377   1.00 25.43 ? 36   GLU E N     1 
ATOM   5893 C  CA    . GLU E 1 36  ? 36.776  -31.452 6.536   1.00 26.26 ? 36   GLU E CA    1 
ATOM   5894 C  C     . GLU E 1 36  ? 35.760  -32.576 6.702   1.00 23.31 ? 36   GLU E C     1 
ATOM   5895 O  O     . GLU E 1 36  ? 35.361  -33.209 5.726   1.00 22.42 ? 36   GLU E O     1 
ATOM   5896 C  CB    . GLU E 1 36  ? 38.183  -31.960 6.860   1.00 29.49 ? 36   GLU E CB    1 
ATOM   5897 C  CG    . GLU E 1 36  ? 39.278  -30.907 6.710   1.00 32.62 ? 36   GLU E CG    1 
ATOM   5898 C  CD    . GLU E 1 36  ? 39.505  -30.472 5.268   1.00 38.02 ? 36   GLU E CD    1 
ATOM   5899 O  OE1   . GLU E 1 36  ? 39.139  -31.226 4.337   1.00 39.26 ? 36   GLU E OE1   1 
ATOM   5900 O  OE2   . GLU E 1 36  ? 40.064  -29.373 5.066   1.00 40.72 ? 36   GLU E OE2   1 
ATOM   5901 N  N     . ARG E 1 37  ? 35.338  -32.819 7.939   1.00 22.94 ? 37   ARG E N     1 
ATOM   5902 C  CA    . ARG E 1 37  ? 34.358  -33.865 8.198   1.00 25.49 ? 37   ARG E CA    1 
ATOM   5903 C  C     . ARG E 1 37  ? 32.984  -33.461 7.656   1.00 23.32 ? 37   ARG E C     1 
ATOM   5904 O  O     . ARG E 1 37  ? 32.272  -34.287 7.085   1.00 23.08 ? 37   ARG E O     1 
ATOM   5905 C  CB    . ARG E 1 37  ? 34.290  -34.194 9.693   1.00 27.73 ? 37   ARG E CB    1 
ATOM   5906 C  CG    . ARG E 1 37  ? 33.397  -35.383 10.007  1.00 36.89 ? 37   ARG E CG    1 
ATOM   5907 C  CD    . ARG E 1 37  ? 33.986  -36.270 11.096  1.00 43.46 ? 37   ARG E CD    1 
ATOM   5908 N  NE    . ARG E 1 37  ? 34.166  -35.562 12.360  1.00 48.25 ? 37   ARG E NE    1 
ATOM   5909 C  CZ    . ARG E 1 37  ? 33.793  -36.039 13.545  1.00 51.17 ? 37   ARG E CZ    1 
ATOM   5910 N  NH1   . ARG E 1 37  ? 33.212  -37.230 13.636  1.00 52.17 ? 37   ARG E NH1   1 
ATOM   5911 N  NH2   . ARG E 1 37  ? 34.000  -35.323 14.643  1.00 52.17 ? 37   ARG E NH2   1 
ATOM   5912 N  N     . LEU E 1 38  ? 32.623  -32.189 7.810   1.00 22.78 ? 38   LEU E N     1 
ATOM   5913 C  CA    . LEU E 1 38  ? 31.340  -31.714 7.293   1.00 23.26 ? 38   LEU E CA    1 
ATOM   5914 C  C     . LEU E 1 38  ? 31.299  -31.915 5.778   1.00 20.89 ? 38   LEU E C     1 
ATOM   5915 O  O     . LEU E 1 38  ? 30.290  -32.368 5.236   1.00 22.38 ? 38   LEU E O     1 
ATOM   5916 C  CB    . LEU E 1 38  ? 31.118  -30.237 7.628   1.00 22.78 ? 38   LEU E CB    1 
ATOM   5917 C  CG    . LEU E 1 38  ? 30.800  -29.848 9.073   1.00 22.28 ? 38   LEU E CG    1 
ATOM   5918 C  CD1   . LEU E 1 38  ? 30.516  -28.358 9.127   1.00 22.34 ? 38   LEU E CD1   1 
ATOM   5919 C  CD2   . LEU E 1 38  ? 29.597  -30.621 9.589   1.00 25.34 ? 38   LEU E CD2   1 
ATOM   5920 N  N     . GLN E 1 39  ? 32.415  -31.619 5.112   1.00 18.92 ? 39   GLN E N     1 
ATOM   5921 C  CA    . GLN E 1 39  ? 32.518  -31.782 3.662   1.00 21.99 ? 39   GLN E CA    1 
ATOM   5922 C  C     . GLN E 1 39  ? 32.259  -33.226 3.243   1.00 22.03 ? 39   GLN E C     1 
ATOM   5923 O  O     . GLN E 1 39  ? 31.509  -33.477 2.304   1.00 19.21 ? 39   GLN E O     1 
ATOM   5924 C  CB    . GLN E 1 39  ? 33.892  -31.331 3.158   1.00 24.27 ? 39   GLN E CB    1 
ATOM   5925 C  CG    . GLN E 1 39  ? 34.096  -29.833 3.222   1.00 30.44 ? 39   GLN E CG    1 
ATOM   5926 C  CD    . GLN E 1 39  ? 35.466  -29.389 2.757   1.00 31.04 ? 39   GLN E CD    1 
ATOM   5927 O  OE1   . GLN E 1 39  ? 36.034  -29.949 1.818   1.00 32.21 ? 39   GLN E OE1   1 
ATOM   5928 N  NE2   . GLN E 1 39  ? 36.000  -28.360 3.409   1.00 30.97 ? 39   GLN E NE2   1 
ATOM   5929 N  N     . ALA E 1 40  ? 32.864  -34.173 3.959   1.00 21.49 ? 40   ALA E N     1 
ATOM   5930 C  CA    . ALA E 1 40  ? 32.683  -35.590 3.659   1.00 22.08 ? 40   ALA E CA    1 
ATOM   5931 C  C     . ALA E 1 40  ? 31.221  -36.002 3.840   1.00 21.30 ? 40   ALA E C     1 
ATOM   5932 O  O     . ALA E 1 40  ? 30.673  -36.749 3.026   1.00 21.27 ? 40   ALA E O     1 
ATOM   5933 C  CB    . ALA E 1 40  ? 33.596  -36.443 4.551   1.00 21.94 ? 40   ALA E CB    1 
ATOM   5934 N  N     . LEU E 1 41  ? 30.593  -35.509 4.905   1.00 20.03 ? 41   LEU E N     1 
ATOM   5935 C  CA    . LEU E 1 41  ? 29.192  -35.822 5.179   1.00 21.35 ? 41   LEU E CA    1 
ATOM   5936 C  C     . LEU E 1 41  ? 28.297  -35.234 4.084   1.00 21.31 ? 41   LEU E C     1 
ATOM   5937 O  O     . LEU E 1 41  ? 27.361  -35.884 3.613   1.00 19.33 ? 41   LEU E O     1 
ATOM   5938 C  CB    . LEU E 1 41  ? 28.791  -35.270 6.548   1.00 20.44 ? 41   LEU E CB    1 
ATOM   5939 C  CG    . LEU E 1 41  ? 29.516  -35.884 7.753   1.00 22.43 ? 41   LEU E CG    1 
ATOM   5940 C  CD1   . LEU E 1 41  ? 29.285  -35.051 9.006   1.00 19.21 ? 41   LEU E CD1   1 
ATOM   5941 C  CD2   . LEU E 1 41  ? 29.034  -37.312 7.961   1.00 24.47 ? 41   LEU E CD2   1 
ATOM   5942 N  N     . ALA E 1 42  ? 28.627  -34.017 3.657   1.00 21.39 ? 42   ALA E N     1 
ATOM   5943 C  CA    . ALA E 1 42  ? 27.872  -33.323 2.616   1.00 21.66 ? 42   ALA E CA    1 
ATOM   5944 C  C     . ALA E 1 42  ? 28.009  -34.026 1.267   1.00 21.66 ? 42   ALA E C     1 
ATOM   5945 O  O     . ALA E 1 42  ? 27.038  -34.136 0.518   1.00 19.19 ? 42   ALA E O     1 
ATOM   5946 C  CB    . ALA E 1 42  ? 28.329  -31.874 2.511   1.00 19.30 ? 42   ALA E CB    1 
ATOM   5947 N  N     . ALA E 1 43  ? 29.210  -34.516 0.968   1.00 20.57 ? 43   ALA E N     1 
ATOM   5948 C  CA    . ALA E 1 43  ? 29.454  -35.222 -0.285  1.00 20.49 ? 43   ALA E CA    1 
ATOM   5949 C  C     . ALA E 1 43  ? 28.595  -36.481 -0.358  1.00 21.49 ? 43   ALA E C     1 
ATOM   5950 O  O     . ALA E 1 43  ? 28.003  -36.776 -1.393  1.00 21.50 ? 43   ALA E O     1 
ATOM   5951 C  CB    . ALA E 1 43  ? 30.938  -35.579 -0.416  1.00 21.77 ? 43   ALA E CB    1 
ATOM   5952 N  N     . GLU E 1 44  ? 28.511  -37.211 0.750   1.00 21.07 ? 44   GLU E N     1 
ATOM   5953 C  CA    . GLU E 1 44  ? 27.713  -38.428 0.778   1.00 22.46 ? 44   GLU E CA    1 
ATOM   5954 C  C     . GLU E 1 44  ? 26.222  -38.100 0.753   1.00 21.65 ? 44   GLU E C     1 
ATOM   5955 O  O     . GLU E 1 44  ? 25.427  -38.839 0.172   1.00 22.68 ? 44   GLU E O     1 
ATOM   5956 C  CB    . GLU E 1 44  ? 28.052  -39.284 2.003   1.00 24.76 ? 44   GLU E CB    1 
ATOM   5957 C  CG    . GLU E 1 44  ? 27.504  -40.706 1.894   1.00 29.07 ? 44   GLU E CG    1 
ATOM   5958 C  CD    . GLU E 1 44  ? 27.859  -41.603 3.071   1.00 32.04 ? 44   GLU E CD    1 
ATOM   5959 O  OE1   . GLU E 1 44  ? 28.726  -41.237 3.897   1.00 34.17 ? 44   GLU E OE1   1 
ATOM   5960 O  OE2   . GLU E 1 44  ? 27.259  -42.691 3.163   1.00 33.51 ? 44   GLU E OE2   1 
ATOM   5961 N  N     . TRP E 1 45  ? 25.850  -36.982 1.373   1.00 22.37 ? 45   TRP E N     1 
ATOM   5962 C  CA    . TRP E 1 45  ? 24.454  -36.559 1.402   1.00 21.54 ? 45   TRP E CA    1 
ATOM   5963 C  C     . TRP E 1 45  ? 23.980  -36.381 -0.038  1.00 19.61 ? 45   TRP E C     1 
ATOM   5964 O  O     . TRP E 1 45  ? 22.909  -36.863 -0.412  1.00 21.99 ? 45   TRP E O     1 
ATOM   5965 C  CB    . TRP E 1 45  ? 24.313  -35.249 2.181   1.00 22.00 ? 45   TRP E CB    1 
ATOM   5966 C  CG    . TRP E 1 45  ? 22.893  -34.879 2.508   1.00 22.09 ? 45   TRP E CG    1 
ATOM   5967 C  CD1   . TRP E 1 45  ? 22.044  -34.117 1.750   1.00 25.03 ? 45   TRP E CD1   1 
ATOM   5968 C  CD2   . TRP E 1 45  ? 22.166  -35.235 3.688   1.00 24.45 ? 45   TRP E CD2   1 
ATOM   5969 N  NE1   . TRP E 1 45  ? 20.833  -33.979 2.389   1.00 23.13 ? 45   TRP E NE1   1 
ATOM   5970 C  CE2   . TRP E 1 45  ? 20.881  -34.655 3.580   1.00 24.51 ? 45   TRP E CE2   1 
ATOM   5971 C  CE3   . TRP E 1 45  ? 22.473  -35.990 4.829   1.00 24.93 ? 45   TRP E CE3   1 
ATOM   5972 C  CZ2   . TRP E 1 45  ? 19.907  -34.807 4.570   1.00 26.39 ? 45   TRP E CZ2   1 
ATOM   5973 C  CZ3   . TRP E 1 45  ? 21.506  -36.140 5.811   1.00 25.25 ? 45   TRP E CZ3   1 
ATOM   5974 C  CH2   . TRP E 1 45  ? 20.237  -35.551 5.675   1.00 28.26 ? 45   TRP E CH2   1 
ATOM   5975 N  N     . LEU E 1 46  ? 24.816  -35.734 -0.848  1.00 18.63 ? 46   LEU E N     1 
ATOM   5976 C  CA    . LEU E 1 46  ? 24.523  -35.494 -2.257  1.00 21.89 ? 46   LEU E CA    1 
ATOM   5977 C  C     . LEU E 1 46  ? 24.259  -36.805 -3.005  1.00 25.01 ? 46   LEU E C     1 
ATOM   5978 O  O     . LEU E 1 46  ? 23.322  -36.896 -3.796  1.00 24.25 ? 46   LEU E O     1 
ATOM   5979 C  CB    . LEU E 1 46  ? 25.677  -34.738 -2.919  1.00 19.85 ? 46   LEU E CB    1 
ATOM   5980 C  CG    . LEU E 1 46  ? 25.937  -33.299 -2.455  1.00 20.41 ? 46   LEU E CG    1 
ATOM   5981 C  CD1   . LEU E 1 46  ? 27.165  -32.753 -3.144  1.00 17.21 ? 46   LEU E CD1   1 
ATOM   5982 C  CD2   . LEU E 1 46  ? 24.728  -32.419 -2.761  1.00 23.23 ? 46   LEU E CD2   1 
ATOM   5983 N  N     . GLN E 1 47  ? 25.075  -37.819 -2.731  1.00 23.33 ? 47   GLN E N     1 
ATOM   5984 C  CA    . GLN E 1 47  ? 24.928  -39.128 -3.368  1.00 26.03 ? 47   GLN E CA    1 
ATOM   5985 C  C     . GLN E 1 47  ? 23.649  -39.862 -2.964  1.00 24.75 ? 47   GLN E C     1 
ATOM   5986 O  O     . GLN E 1 47  ? 22.939  -40.405 -3.814  1.00 23.78 ? 47   GLN E O     1 
ATOM   5987 C  CB    . GLN E 1 47  ? 26.127  -40.015 -3.036  1.00 25.43 ? 47   GLN E CB    1 
ATOM   5988 C  CG    . GLN E 1 47  ? 27.452  -39.459 -3.489  1.00 31.51 ? 47   GLN E CG    1 
ATOM   5989 C  CD    . GLN E 1 47  ? 28.611  -40.345 -3.097  1.00 35.22 ? 47   GLN E CD    1 
ATOM   5990 O  OE1   . GLN E 1 47  ? 29.383  -40.789 -3.947  1.00 37.36 ? 47   GLN E OE1   1 
ATOM   5991 N  NE2   . GLN E 1 47  ? 28.739  -40.612 -1.802  1.00 35.58 ? 47   GLN E NE2   1 
ATOM   5992 N  N     . VAL E 1 48  ? 23.366  -39.886 -1.666  1.00 22.38 ? 48   VAL E N     1 
ATOM   5993 C  CA    . VAL E 1 48  ? 22.186  -40.571 -1.150  1.00 25.29 ? 48   VAL E CA    1 
ATOM   5994 C  C     . VAL E 1 48  ? 20.861  -40.008 -1.673  1.00 26.97 ? 48   VAL E C     1 
ATOM   5995 O  O     . VAL E 1 48  ? 19.902  -40.756 -1.864  1.00 27.06 ? 48   VAL E O     1 
ATOM   5996 C  CB    . VAL E 1 48  ? 22.189  -40.609 0.401   1.00 26.87 ? 48   VAL E CB    1 
ATOM   5997 C  CG1   . VAL E 1 48  ? 20.934  -41.298 0.924   1.00 25.51 ? 48   VAL E CG1   1 
ATOM   5998 C  CG2   . VAL E 1 48  ? 23.429  -41.346 0.897   1.00 25.74 ? 48   VAL E CG2   1 
ATOM   5999 N  N     . ILE E 1 49  ? 20.805  -38.702 -1.928  1.00 24.64 ? 49   ILE E N     1 
ATOM   6000 C  CA    . ILE E 1 49  ? 19.574  -38.107 -2.446  1.00 26.03 ? 49   ILE E CA    1 
ATOM   6001 C  C     . ILE E 1 49  ? 19.459  -38.277 -3.961  1.00 26.63 ? 49   ILE E C     1 
ATOM   6002 O  O     . ILE E 1 49  ? 18.493  -37.820 -4.572  1.00 30.18 ? 49   ILE E O     1 
ATOM   6003 C  CB    . ILE E 1 49  ? 19.429  -36.614 -2.057  1.00 23.26 ? 49   ILE E CB    1 
ATOM   6004 C  CG1   . ILE E 1 49  ? 20.578  -35.789 -2.639  1.00 26.62 ? 49   ILE E CG1   1 
ATOM   6005 C  CG2   . ILE E 1 49  ? 19.355  -36.480 -0.543  1.00 24.31 ? 49   ILE E CG2   1 
ATOM   6006 C  CD1   . ILE E 1 49  ? 20.490  -34.306 -2.337  1.00 21.73 ? 49   ILE E CD1   1 
ATOM   6007 N  N     . GLY E 1 50  ? 20.457  -38.926 -4.558  1.00 27.03 ? 50   GLY E N     1 
ATOM   6008 C  CA    . GLY E 1 50  ? 20.441  -39.181 -5.988  1.00 26.66 ? 50   GLY E CA    1 
ATOM   6009 C  C     . GLY E 1 50  ? 21.199  -38.222 -6.884  1.00 28.19 ? 50   GLY E C     1 
ATOM   6010 O  O     . GLY E 1 50  ? 21.002  -38.236 -8.102  1.00 29.77 ? 50   GLY E O     1 
ATOM   6011 N  N     . GLU E 1 51  ? 22.062  -37.393 -6.301  1.00 25.51 ? 51   GLU E N     1 
ATOM   6012 C  CA    . GLU E 1 51  ? 22.844  -36.441 -7.085  1.00 24.15 ? 51   GLU E CA    1 
ATOM   6013 C  C     . GLU E 1 51  ? 24.261  -36.927 -7.382  1.00 27.01 ? 51   GLU E C     1 
ATOM   6014 O  O     . GLU E 1 51  ? 24.689  -37.973 -6.891  1.00 27.45 ? 51   GLU E O     1 
ATOM   6015 C  CB    . GLU E 1 51  ? 22.868  -35.064 -6.411  1.00 23.04 ? 51   GLU E CB    1 
ATOM   6016 C  CG    . GLU E 1 51  ? 21.833  -34.083 -6.977  1.00 20.13 ? 51   GLU E CG    1 
ATOM   6017 C  CD    . GLU E 1 51  ? 22.164  -33.601 -8.388  1.00 20.84 ? 51   GLU E CD    1 
ATOM   6018 O  OE1   . GLU E 1 51  ? 23.183  -34.041 -8.972  1.00 18.42 ? 51   GLU E OE1   1 
ATOM   6019 O  OE2   . GLU E 1 51  ? 21.403  -32.764 -8.924  1.00 18.47 ? 51   GLU E OE2   1 
ATOM   6020 N  N     . ASP E 1 52  ? 24.985  -36.150 -8.182  1.00 25.52 ? 52   ASP E N     1 
ATOM   6021 C  CA    . ASP E 1 52  ? 26.346  -36.491 -8.587  1.00 25.21 ? 52   ASP E CA    1 
ATOM   6022 C  C     . ASP E 1 52  ? 27.357  -35.432 -8.138  1.00 22.40 ? 52   ASP E C     1 
ATOM   6023 O  O     . ASP E 1 52  ? 27.517  -34.406 -8.792  1.00 21.03 ? 52   ASP E O     1 
ATOM   6024 C  CB    . ASP E 1 52  ? 26.373  -36.654 -10.116 1.00 27.52 ? 52   ASP E CB    1 
ATOM   6025 C  CG    . ASP E 1 52  ? 27.747  -37.026 -10.660 1.00 31.21 ? 52   ASP E CG    1 
ATOM   6026 O  OD1   . ASP E 1 52  ? 28.630  -37.444 -9.879  1.00 30.79 ? 52   ASP E OD1   1 
ATOM   6027 O  OD2   . ASP E 1 52  ? 27.937  -36.897 -11.891 1.00 31.13 ? 52   ASP E OD2   1 
ATOM   6028 N  N     . PRO E 1 53  ? 28.089  -35.696 -7.038  1.00 23.68 ? 53   PRO E N     1 
ATOM   6029 C  CA    . PRO E 1 53  ? 29.096  -34.775 -6.490  1.00 22.67 ? 53   PRO E CA    1 
ATOM   6030 C  C     . PRO E 1 53  ? 30.176  -34.414 -7.504  1.00 23.04 ? 53   PRO E C     1 
ATOM   6031 O  O     . PRO E 1 53  ? 30.863  -33.399 -7.364  1.00 24.77 ? 53   PRO E O     1 
ATOM   6032 C  CB    . PRO E 1 53  ? 29.691  -35.570 -5.326  1.00 25.39 ? 53   PRO E CB    1 
ATOM   6033 C  CG    . PRO E 1 53  ? 28.564  -36.439 -4.897  1.00 25.66 ? 53   PRO E CG    1 
ATOM   6034 C  CD    . PRO E 1 53  ? 27.987  -36.906 -6.206  1.00 24.18 ? 53   PRO E CD    1 
ATOM   6035 N  N     . GLY E 1 54  ? 30.304  -35.249 -8.532  1.00 23.07 ? 54   GLY E N     1 
ATOM   6036 C  CA    . GLY E 1 54  ? 31.293  -35.025 -9.565  1.00 22.81 ? 54   GLY E CA    1 
ATOM   6037 C  C     . GLY E 1 54  ? 30.901  -34.073 -10.679 1.00 24.29 ? 54   GLY E C     1 
ATOM   6038 O  O     . GLY E 1 54  ? 31.772  -33.647 -11.442 1.00 23.37 ? 54   GLY E O     1 
ATOM   6039 N  N     . ARG E 1 55  ? 29.613  -33.745 -10.804 1.00 23.46 ? 55   ARG E N     1 
ATOM   6040 C  CA    . ARG E 1 55  ? 29.192  -32.822 -11.857 1.00 23.88 ? 55   ARG E CA    1 
ATOM   6041 C  C     . ARG E 1 55  ? 29.638  -31.410 -11.514 1.00 23.19 ? 55   ARG E C     1 
ATOM   6042 O  O     . ARG E 1 55  ? 29.727  -31.045 -10.337 1.00 20.94 ? 55   ARG E O     1 
ATOM   6043 C  CB    . ARG E 1 55  ? 27.678  -32.892 -12.125 1.00 22.08 ? 55   ARG E CB    1 
ATOM   6044 C  CG    . ARG E 1 55  ? 26.755  -32.315 -11.054 1.00 20.07 ? 55   ARG E CG    1 
ATOM   6045 C  CD    . ARG E 1 55  ? 25.306  -32.450 -11.525 1.00 17.76 ? 55   ARG E CD    1 
ATOM   6046 N  NE    . ARG E 1 55  ? 24.320  -31.958 -10.566 1.00 17.41 ? 55   ARG E NE    1 
ATOM   6047 C  CZ    . ARG E 1 55  ? 24.012  -30.676 -10.384 1.00 14.33 ? 55   ARG E CZ    1 
ATOM   6048 N  NH1   . ARG E 1 55  ? 24.619  -29.730 -11.087 1.00 13.99 ? 55   ARG E NH1   1 
ATOM   6049 N  NH2   . ARG E 1 55  ? 23.070  -30.344 -9.509  1.00 17.99 ? 55   ARG E NH2   1 
ATOM   6050 N  N     . GLU E 1 56  ? 29.933  -30.631 -12.552 1.00 24.80 ? 56   GLU E N     1 
ATOM   6051 C  CA    . GLU E 1 56  ? 30.427  -29.263 -12.411 1.00 27.09 ? 56   GLU E CA    1 
ATOM   6052 C  C     . GLU E 1 56  ? 29.755  -28.367 -11.371 1.00 27.26 ? 56   GLU E C     1 
ATOM   6053 O  O     . GLU E 1 56  ? 30.441  -27.728 -10.573 1.00 28.27 ? 56   GLU E O     1 
ATOM   6054 C  CB    . GLU E 1 56  ? 30.452  -28.564 -13.775 1.00 28.49 ? 56   GLU E CB    1 
ATOM   6055 C  CG    . GLU E 1 56  ? 31.055  -27.165 -13.739 1.00 32.25 ? 56   GLU E CG    1 
ATOM   6056 C  CD    . GLU E 1 56  ? 31.470  -26.647 -15.110 1.00 36.22 ? 56   GLU E CD    1 
ATOM   6057 O  OE1   . GLU E 1 56  ? 32.196  -25.629 -15.155 1.00 37.55 ? 56   GLU E OE1   1 
ATOM   6058 O  OE2   . GLU E 1 56  ? 31.081  -27.247 -16.138 1.00 35.67 ? 56   GLU E OE2   1 
ATOM   6059 N  N     . GLY E 1 57  ? 28.426  -28.322 -11.377 1.00 25.58 ? 57   GLY E N     1 
ATOM   6060 C  CA    . GLY E 1 57  ? 27.709  -27.482 -10.430 1.00 23.78 ? 57   GLY E CA    1 
ATOM   6061 C  C     . GLY E 1 57  ? 27.824  -27.873 -8.967  1.00 23.46 ? 57   GLY E C     1 
ATOM   6062 O  O     . GLY E 1 57  ? 27.526  -27.068 -8.084  1.00 24.28 ? 57   GLY E O     1 
ATOM   6063 N  N     . LEU E 1 58  ? 28.261  -29.101 -8.701  1.00 21.37 ? 58   LEU E N     1 
ATOM   6064 C  CA    . LEU E 1 58  ? 28.398  -29.582 -7.329  1.00 17.92 ? 58   LEU E CA    1 
ATOM   6065 C  C     . LEU E 1 58  ? 29.832  -29.793 -6.845  1.00 20.51 ? 58   LEU E C     1 
ATOM   6066 O  O     . LEU E 1 58  ? 30.041  -30.127 -5.680  1.00 17.82 ? 58   LEU E O     1 
ATOM   6067 C  CB    . LEU E 1 58  ? 27.605  -30.879 -7.144  1.00 18.02 ? 58   LEU E CB    1 
ATOM   6068 C  CG    . LEU E 1 58  ? 26.084  -30.785 -7.289  1.00 18.46 ? 58   LEU E CG    1 
ATOM   6069 C  CD1   . LEU E 1 58  ? 25.465  -32.167 -7.169  1.00 13.98 ? 58   LEU E CD1   1 
ATOM   6070 C  CD2   . LEU E 1 58  ? 25.527  -29.852 -6.229  1.00 19.48 ? 58   LEU E CD2   1 
ATOM   6071 N  N     . LEU E 1 59  ? 30.816  -29.579 -7.718  1.00 21.11 ? 59   LEU E N     1 
ATOM   6072 C  CA    . LEU E 1 59  ? 32.220  -29.774 -7.341  1.00 22.83 ? 59   LEU E CA    1 
ATOM   6073 C  C     . LEU E 1 59  ? 32.617  -29.144 -6.002  1.00 24.04 ? 59   LEU E C     1 
ATOM   6074 O  O     . LEU E 1 59  ? 33.123  -29.838 -5.115  1.00 23.45 ? 59   LEU E O     1 
ATOM   6075 C  CB    . LEU E 1 59  ? 33.159  -29.283 -8.452  1.00 22.31 ? 59   LEU E CB    1 
ATOM   6076 C  CG    . LEU E 1 59  ? 33.190  -30.131 -9.728  1.00 24.39 ? 59   LEU E CG    1 
ATOM   6077 C  CD1   . LEU E 1 59  ? 34.136  -29.510 -10.747 1.00 23.27 ? 59   LEU E CD1   1 
ATOM   6078 C  CD2   . LEU E 1 59  ? 33.622  -31.555 -9.399  1.00 24.07 ? 59   LEU E CD2   1 
ATOM   6079 N  N     . LYS E 1 60  ? 32.365  -27.846 -5.843  1.00 21.88 ? 60   LYS E N     1 
ATOM   6080 C  CA    . LYS E 1 60  ? 32.721  -27.156 -4.602  1.00 23.03 ? 60   LYS E CA    1 
ATOM   6081 C  C     . LYS E 1 60  ? 31.606  -27.091 -3.562  1.00 19.44 ? 60   LYS E C     1 
ATOM   6082 O  O     . LYS E 1 60  ? 31.760  -26.440 -2.531  1.00 19.53 ? 60   LYS E O     1 
ATOM   6083 C  CB    . LYS E 1 60  ? 33.201  -25.733 -4.894  1.00 24.85 ? 60   LYS E CB    1 
ATOM   6084 C  CG    . LYS E 1 60  ? 34.554  -25.644 -5.565  1.00 32.49 ? 60   LYS E CG    1 
ATOM   6085 C  CD    . LYS E 1 60  ? 35.068  -24.209 -5.561  1.00 35.48 ? 60   LYS E CD    1 
ATOM   6086 C  CE    . LYS E 1 60  ? 35.263  -23.688 -4.140  1.00 37.44 ? 60   LYS E CE    1 
ATOM   6087 N  NZ    . LYS E 1 60  ? 35.691  -22.257 -4.115  1.00 39.39 ? 60   LYS E NZ    1 
ATOM   6088 N  N     . THR E 1 61  ? 30.495  -27.772 -3.820  1.00 17.77 ? 61   THR E N     1 
ATOM   6089 C  CA    . THR E 1 61  ? 29.365  -27.748 -2.893  1.00 17.35 ? 61   THR E CA    1 
ATOM   6090 C  C     . THR E 1 61  ? 29.672  -28.295 -1.496  1.00 17.94 ? 61   THR E C     1 
ATOM   6091 O  O     . THR E 1 61  ? 29.347  -27.651 -0.502  1.00 17.47 ? 61   THR E O     1 
ATOM   6092 C  CB    . THR E 1 61  ? 28.114  -28.418 -3.506  1.00 17.44 ? 61   THR E CB    1 
ATOM   6093 O  OG1   . THR E 1 61  ? 27.716  -27.681 -4.671  1.00 17.53 ? 61   THR E OG1   1 
ATOM   6094 C  CG2   . THR E 1 61  ? 26.950  -28.436 -2.507  1.00 15.04 ? 61   THR E CG2   1 
ATOM   6095 N  N     . PRO E 1 62  ? 30.302  -29.482 -1.394  1.00 17.22 ? 62   PRO E N     1 
ATOM   6096 C  CA    . PRO E 1 62  ? 30.588  -29.976 -0.040  1.00 17.00 ? 62   PRO E CA    1 
ATOM   6097 C  C     . PRO E 1 62  ? 31.379  -28.957 0.783   1.00 16.42 ? 62   PRO E C     1 
ATOM   6098 O  O     . PRO E 1 62  ? 31.087  -28.750 1.961   1.00 20.50 ? 62   PRO E O     1 
ATOM   6099 C  CB    . PRO E 1 62  ? 31.385  -31.245 -0.308  1.00 17.50 ? 62   PRO E CB    1 
ATOM   6100 C  CG    . PRO E 1 62  ? 30.713  -31.771 -1.553  1.00 18.13 ? 62   PRO E CG    1 
ATOM   6101 C  CD    . PRO E 1 62  ? 30.604  -30.516 -2.401  1.00 16.21 ? 62   PRO E CD    1 
ATOM   6102 N  N     . GLU E 1 63  ? 32.335  -28.286 0.142   1.00 17.58 ? 63   GLU E N     1 
ATOM   6103 C  CA    . GLU E 1 63  ? 33.148  -27.271 0.812   1.00 18.50 ? 63   GLU E CA    1 
ATOM   6104 C  C     . GLU E 1 63  ? 32.300  -26.064 1.212   1.00 18.71 ? 63   GLU E C     1 
ATOM   6105 O  O     . GLU E 1 63  ? 32.418  -25.557 2.333   1.00 17.90 ? 63   GLU E O     1 
ATOM   6106 C  CB    . GLU E 1 63  ? 34.294  -26.801 -0.086  1.00 18.38 ? 63   GLU E CB    1 
ATOM   6107 C  CG    . GLU E 1 63  ? 35.171  -25.730 0.567   1.00 23.71 ? 63   GLU E CG    1 
ATOM   6108 C  CD    . GLU E 1 63  ? 36.272  -25.206 -0.343  1.00 28.28 ? 63   GLU E CD    1 
ATOM   6109 O  OE1   . GLU E 1 63  ? 36.833  -25.993 -1.131  1.00 32.73 ? 63   GLU E OE1   1 
ATOM   6110 O  OE2   . GLU E 1 63  ? 36.580  -23.998 -0.266  1.00 35.00 ? 63   GLU E OE2   1 
ATOM   6111 N  N     . ARG E 1 64  ? 31.484  -25.584 0.275   1.00 17.78 ? 64   ARG E N     1 
ATOM   6112 C  CA    . ARG E 1 64  ? 30.605  -24.442 0.526   1.00 18.62 ? 64   ARG E CA    1 
ATOM   6113 C  C     . ARG E 1 64  ? 29.617  -24.728 1.652   1.00 17.64 ? 64   ARG E C     1 
ATOM   6114 O  O     . ARG E 1 64  ? 29.404  -23.884 2.526   1.00 20.05 ? 64   ARG E O     1 
ATOM   6115 C  CB    . ARG E 1 64  ? 29.851  -24.050 -0.753  1.00 17.87 ? 64   ARG E CB    1 
ATOM   6116 C  CG    . ARG E 1 64  ? 30.731  -23.416 -1.822  1.00 16.64 ? 64   ARG E CG    1 
ATOM   6117 C  CD    . ARG E 1 64  ? 29.929  -22.929 -3.024  1.00 17.94 ? 64   ARG E CD    1 
ATOM   6118 N  NE    . ARG E 1 64  ? 29.416  -24.030 -3.838  1.00 18.45 ? 64   ARG E NE    1 
ATOM   6119 C  CZ    . ARG E 1 64  ? 29.742  -24.234 -5.111  1.00 19.44 ? 64   ARG E CZ    1 
ATOM   6120 N  NH1   . ARG E 1 64  ? 30.582  -23.409 -5.725  1.00 17.72 ? 64   ARG E NH1   1 
ATOM   6121 N  NH2   . ARG E 1 64  ? 29.238  -25.275 -5.769  1.00 19.16 ? 64   ARG E NH2   1 
ATOM   6122 N  N     . VAL E 1 65  ? 29.015  -25.916 1.629   1.00 15.21 ? 65   VAL E N     1 
ATOM   6123 C  CA    . VAL E 1 65  ? 28.053  -26.313 2.659   1.00 16.16 ? 65   VAL E CA    1 
ATOM   6124 C  C     . VAL E 1 65  ? 28.719  -26.385 4.029   1.00 16.71 ? 65   VAL E C     1 
ATOM   6125 O  O     . VAL E 1 65  ? 28.146  -25.955 5.033   1.00 14.75 ? 65   VAL E O     1 
ATOM   6126 C  CB    . VAL E 1 65  ? 27.411  -27.682 2.333   1.00 17.17 ? 65   VAL E CB    1 
ATOM   6127 C  CG1   . VAL E 1 65  ? 26.505  -28.138 3.474   1.00 17.40 ? 65   VAL E CG1   1 
ATOM   6128 C  CG2   . VAL E 1 65  ? 26.617  -27.586 1.042   1.00 17.60 ? 65   VAL E CG2   1 
ATOM   6129 N  N     . ALA E 1 66  ? 29.938  -26.920 4.068   1.00 15.49 ? 66   ALA E N     1 
ATOM   6130 C  CA    . ALA E 1 66  ? 30.669  -27.035 5.327   1.00 16.74 ? 66   ALA E CA    1 
ATOM   6131 C  C     . ALA E 1 66  ? 30.929  -25.666 5.954   1.00 15.95 ? 66   ALA E C     1 
ATOM   6132 O  O     . ALA E 1 66  ? 30.676  -25.461 7.141   1.00 16.13 ? 66   ALA E O     1 
ATOM   6133 C  CB    . ALA E 1 66  ? 31.990  -27.782 5.107   1.00 15.52 ? 66   ALA E CB    1 
ATOM   6134 N  N     . LYS E 1 67  ? 31.410  -24.726 5.148   1.00 17.06 ? 67   LYS E N     1 
ATOM   6135 C  CA    . LYS E 1 67  ? 31.698  -23.379 5.633   1.00 18.79 ? 67   LYS E CA    1 
ATOM   6136 C  C     . LYS E 1 67  ? 30.433  -22.629 6.048   1.00 18.62 ? 67   LYS E C     1 
ATOM   6137 O  O     . LYS E 1 67  ? 30.439  -21.885 7.029   1.00 19.06 ? 67   LYS E O     1 
ATOM   6138 C  CB    . LYS E 1 67  ? 32.470  -22.588 4.579   1.00 20.26 ? 67   LYS E CB    1 
ATOM   6139 C  CG    . LYS E 1 67  ? 33.879  -23.123 4.350   1.00 27.05 ? 67   LYS E CG    1 
ATOM   6140 C  CD    . LYS E 1 67  ? 34.614  -22.345 3.271   1.00 33.23 ? 67   LYS E CD    1 
ATOM   6141 C  CE    . LYS E 1 67  ? 36.062  -22.812 3.151   1.00 37.86 ? 67   LYS E CE    1 
ATOM   6142 N  NZ    . LYS E 1 67  ? 36.780  -22.109 2.048   1.00 41.11 ? 67   LYS E NZ    1 
ATOM   6143 N  N     . ALA E 1 68  ? 29.348  -22.853 5.314   1.00 20.49 ? 68   ALA E N     1 
ATOM   6144 C  CA    . ALA E 1 68  ? 28.074  -22.205 5.609   1.00 19.73 ? 68   ALA E CA    1 
ATOM   6145 C  C     . ALA E 1 68  ? 27.571  -22.634 6.981   1.00 18.90 ? 68   ALA E C     1 
ATOM   6146 O  O     . ALA E 1 68  ? 27.173  -21.797 7.792   1.00 18.85 ? 68   ALA E O     1 
ATOM   6147 C  CB    . ALA E 1 68  ? 27.040  -22.551 4.535   1.00 19.47 ? 68   ALA E CB    1 
ATOM   6148 N  N     . TRP E 1 69  ? 27.624  -23.936 7.251   1.00 18.37 ? 69   TRP E N     1 
ATOM   6149 C  CA    . TRP E 1 69  ? 27.162  -24.452 8.530   1.00 17.60 ? 69   TRP E CA    1 
ATOM   6150 C  C     . TRP E 1 69  ? 28.022  -24.045 9.716   1.00 19.83 ? 69   TRP E C     1 
ATOM   6151 O  O     . TRP E 1 69  ? 27.523  -23.942 10.838  1.00 19.71 ? 69   TRP E O     1 
ATOM   6152 C  CB    . TRP E 1 69  ? 26.935  -25.960 8.458   1.00 18.24 ? 69   TRP E CB    1 
ATOM   6153 C  CG    . TRP E 1 69  ? 25.577  -26.267 7.914   1.00 20.45 ? 69   TRP E CG    1 
ATOM   6154 C  CD1   . TRP E 1 69  ? 25.216  -26.366 6.597   1.00 20.76 ? 69   TRP E CD1   1 
ATOM   6155 C  CD2   . TRP E 1 69  ? 24.379  -26.463 8.674   1.00 20.78 ? 69   TRP E CD2   1 
ATOM   6156 N  NE1   . TRP E 1 69  ? 23.866  -26.609 6.492   1.00 20.30 ? 69   TRP E NE1   1 
ATOM   6157 C  CE2   . TRP E 1 69  ? 23.327  -26.673 7.751   1.00 22.26 ? 69   TRP E CE2   1 
ATOM   6158 C  CE3   . TRP E 1 69  ? 24.092  -26.480 10.046  1.00 20.11 ? 69   TRP E CE3   1 
ATOM   6159 C  CZ2   . TRP E 1 69  ? 22.005  -26.898 8.157   1.00 21.29 ? 69   TRP E CZ2   1 
ATOM   6160 C  CZ3   . TRP E 1 69  ? 22.773  -26.704 10.452  1.00 22.72 ? 69   TRP E CZ3   1 
ATOM   6161 C  CH2   . TRP E 1 69  ? 21.749  -26.909 9.507   1.00 22.39 ? 69   TRP E CH2   1 
ATOM   6162 N  N     . ALA E 1 70  ? 29.300  -23.774 9.461   1.00 20.53 ? 70   ALA E N     1 
ATOM   6163 C  CA    . ALA E 1 70  ? 30.208  -23.325 10.513  1.00 22.47 ? 70   ALA E CA    1 
ATOM   6164 C  C     . ALA E 1 70  ? 29.778  -21.906 10.905  1.00 20.97 ? 70   ALA E C     1 
ATOM   6165 O  O     . ALA E 1 70  ? 29.783  -21.535 12.080  1.00 19.58 ? 70   ALA E O     1 
ATOM   6166 C  CB    . ALA E 1 70  ? 31.642  -23.321 10.004  1.00 24.35 ? 70   ALA E CB    1 
ATOM   6167 N  N     . PHE E 1 71  ? 29.389  -21.128 9.900   1.00 17.70 ? 71   PHE E N     1 
ATOM   6168 C  CA    . PHE E 1 71  ? 28.928  -19.762 10.110  1.00 17.34 ? 71   PHE E CA    1 
ATOM   6169 C  C     . PHE E 1 71  ? 27.539  -19.771 10.748  1.00 16.82 ? 71   PHE E C     1 
ATOM   6170 O  O     . PHE E 1 71  ? 27.272  -19.027 11.691  1.00 15.59 ? 71   PHE E O     1 
ATOM   6171 C  CB    . PHE E 1 71  ? 28.876  -19.014 8.771   1.00 18.59 ? 71   PHE E CB    1 
ATOM   6172 C  CG    . PHE E 1 71  ? 28.332  -17.618 8.877   1.00 17.20 ? 71   PHE E CG    1 
ATOM   6173 C  CD1   . PHE E 1 71  ? 29.169  -16.555 9.207   1.00 17.88 ? 71   PHE E CD1   1 
ATOM   6174 C  CD2   . PHE E 1 71  ? 26.979  -17.365 8.652   1.00 18.22 ? 71   PHE E CD2   1 
ATOM   6175 C  CE1   . PHE E 1 71  ? 28.669  -15.255 9.314   1.00 18.83 ? 71   PHE E CE1   1 
ATOM   6176 C  CE2   . PHE E 1 71  ? 26.466  -16.072 8.756   1.00 15.64 ? 71   PHE E CE2   1 
ATOM   6177 C  CZ    . PHE E 1 71  ? 27.314  -15.012 9.088   1.00 16.93 ? 71   PHE E CZ    1 
ATOM   6178 N  N     . LEU E 1 72  ? 26.660  -20.626 10.234  1.00 14.39 ? 72   LEU E N     1 
ATOM   6179 C  CA    . LEU E 1 72  ? 25.300  -20.712 10.744  1.00 15.44 ? 72   LEU E CA    1 
ATOM   6180 C  C     . LEU E 1 72  ? 25.202  -21.218 12.177  1.00 16.90 ? 72   LEU E C     1 
ATOM   6181 O  O     . LEU E 1 72  ? 24.175  -21.041 12.817  1.00 15.38 ? 72   LEU E O     1 
ATOM   6182 C  CB    . LEU E 1 72  ? 24.420  -21.553 9.812   1.00 15.78 ? 72   LEU E CB    1 
ATOM   6183 C  CG    . LEU E 1 72  ? 24.231  -20.975 8.402   1.00 18.33 ? 72   LEU E CG    1 
ATOM   6184 C  CD1   . LEU E 1 72  ? 23.352  -21.906 7.573   1.00 17.90 ? 72   LEU E CD1   1 
ATOM   6185 C  CD2   . LEU E 1 72  ? 23.601  -19.583 8.483   1.00 14.95 ? 72   LEU E CD2   1 
ATOM   6186 N  N     . THR E 1 73  ? 26.265  -21.844 12.678  1.00 18.58 ? 73   THR E N     1 
ATOM   6187 C  CA    . THR E 1 73  ? 26.274  -22.344 14.053  1.00 18.75 ? 73   THR E CA    1 
ATOM   6188 C  C     . THR E 1 73  ? 27.328  -21.641 14.916  1.00 19.15 ? 73   THR E C     1 
ATOM   6189 O  O     . THR E 1 73  ? 27.617  -22.081 16.031  1.00 18.95 ? 73   THR E O     1 
ATOM   6190 C  CB    . THR E 1 73  ? 26.521  -23.875 14.116  1.00 19.69 ? 73   THR E CB    1 
ATOM   6191 O  OG1   . THR E 1 73  ? 27.758  -24.192 13.467  1.00 18.49 ? 73   THR E OG1   1 
ATOM   6192 C  CG2   . THR E 1 73  ? 25.387  -24.637 13.451  1.00 20.10 ? 73   THR E CG2   1 
ATOM   6193 N  N     . ARG E 1 74  ? 27.861  -20.526 14.421  1.00 17.73 ? 74   ARG E N     1 
ATOM   6194 C  CA    . ARG E 1 74  ? 28.894  -19.775 15.136  1.00 19.77 ? 74   ARG E CA    1 
ATOM   6195 C  C     . ARG E 1 74  ? 28.435  -19.209 16.475  1.00 19.32 ? 74   ARG E C     1 
ATOM   6196 O  O     . ARG E 1 74  ? 29.256  -18.896 17.336  1.00 18.02 ? 74   ARG E O     1 
ATOM   6197 C  CB    . ARG E 1 74  ? 29.452  -18.652 14.255  1.00 20.81 ? 74   ARG E CB    1 
ATOM   6198 C  CG    . ARG E 1 74  ? 28.551  -17.416 14.123  1.00 22.29 ? 74   ARG E CG    1 
ATOM   6199 C  CD    . ARG E 1 74  ? 29.030  -16.499 12.998  1.00 25.68 ? 74   ARG E CD    1 
ATOM   6200 N  NE    . ARG E 1 74  ? 30.460  -16.208 13.093  1.00 30.92 ? 74   ARG E NE    1 
ATOM   6201 C  CZ    . ARG E 1 74  ? 30.989  -15.228 13.823  1.00 34.87 ? 74   ARG E CZ    1 
ATOM   6202 N  NH1   . ARG E 1 74  ? 30.212  -14.421 14.535  1.00 36.34 ? 74   ARG E NH1   1 
ATOM   6203 N  NH2   . ARG E 1 74  ? 32.305  -15.068 13.857  1.00 36.83 ? 74   ARG E NH2   1 
ATOM   6204 N  N     . GLY E 1 75  ? 27.121  -19.092 16.646  1.00 16.79 ? 75   GLY E N     1 
ATOM   6205 C  CA    . GLY E 1 75  ? 26.566  -18.560 17.878  1.00 17.48 ? 75   GLY E CA    1 
ATOM   6206 C  C     . GLY E 1 75  ? 26.928  -19.346 19.125  1.00 18.64 ? 75   GLY E C     1 
ATOM   6207 O  O     . GLY E 1 75  ? 27.093  -18.763 20.195  1.00 20.47 ? 75   GLY E O     1 
ATOM   6208 N  N     . TYR E 1 76  ? 27.042  -20.665 18.990  1.00 21.10 ? 76   TYR E N     1 
ATOM   6209 C  CA    . TYR E 1 76  ? 27.392  -21.536 20.112  1.00 24.62 ? 76   TYR E CA    1 
ATOM   6210 C  C     . TYR E 1 76  ? 28.785  -21.220 20.649  1.00 25.31 ? 76   TYR E C     1 
ATOM   6211 O  O     . TYR E 1 76  ? 29.061  -21.417 21.829  1.00 29.63 ? 76   TYR E O     1 
ATOM   6212 C  CB    . TYR E 1 76  ? 27.409  -23.003 19.677  1.00 20.57 ? 76   TYR E CB    1 
ATOM   6213 C  CG    . TYR E 1 76  ? 26.089  -23.589 19.243  1.00 20.21 ? 76   TYR E CG    1 
ATOM   6214 C  CD1   . TYR E 1 76  ? 25.034  -23.731 20.143  1.00 20.07 ? 76   TYR E CD1   1 
ATOM   6215 C  CD2   . TYR E 1 76  ? 25.918  -24.068 17.947  1.00 19.75 ? 76   TYR E CD2   1 
ATOM   6216 C  CE1   . TYR E 1 76  ? 23.841  -24.344 19.760  1.00 17.38 ? 76   TYR E CE1   1 
ATOM   6217 C  CE2   . TYR E 1 76  ? 24.731  -24.679 17.556  1.00 18.43 ? 76   TYR E CE2   1 
ATOM   6218 C  CZ    . TYR E 1 76  ? 23.700  -24.812 18.468  1.00 15.97 ? 76   TYR E CZ    1 
ATOM   6219 O  OH    . TYR E 1 76  ? 22.524  -25.399 18.082  1.00 18.44 ? 76   TYR E OH    1 
ATOM   6220 N  N     . ARG E 1 77  ? 29.655  -20.745 19.767  1.00 26.27 ? 77   ARG E N     1 
ATOM   6221 C  CA    . ARG E 1 77  ? 31.040  -20.451 20.115  1.00 29.18 ? 77   ARG E CA    1 
ATOM   6222 C  C     . ARG E 1 77  ? 31.361  -19.009 20.491  1.00 28.12 ? 77   ARG E C     1 
ATOM   6223 O  O     . ARG E 1 77  ? 32.528  -18.666 20.686  1.00 28.27 ? 77   ARG E O     1 
ATOM   6224 C  CB    . ARG E 1 77  ? 31.951  -20.932 18.982  1.00 32.01 ? 77   ARG E CB    1 
ATOM   6225 C  CG    . ARG E 1 77  ? 31.803  -22.426 18.700  1.00 34.53 ? 77   ARG E CG    1 
ATOM   6226 C  CD    . ARG E 1 77  ? 32.657  -22.890 17.528  1.00 38.86 ? 77   ARG E CD    1 
ATOM   6227 N  NE    . ARG E 1 77  ? 32.191  -22.383 16.237  1.00 40.23 ? 77   ARG E NE    1 
ATOM   6228 C  CZ    . ARG E 1 77  ? 31.121  -22.837 15.584  1.00 42.45 ? 77   ARG E CZ    1 
ATOM   6229 N  NH1   . ARG E 1 77  ? 30.378  -23.814 16.094  1.00 42.31 ? 77   ARG E NH1   1 
ATOM   6230 N  NH2   . ARG E 1 77  ? 30.822  -22.345 14.390  1.00 38.55 ? 77   ARG E NH2   1 
ATOM   6231 N  N     . GLN E 1 78  ? 30.337  -18.165 20.589  1.00 26.03 ? 78   GLN E N     1 
ATOM   6232 C  CA    . GLN E 1 78  ? 30.547  -16.767 20.964  1.00 24.31 ? 78   GLN E CA    1 
ATOM   6233 C  C     . GLN E 1 78  ? 30.334  -16.554 22.458  1.00 23.87 ? 78   GLN E C     1 
ATOM   6234 O  O     . GLN E 1 78  ? 29.635  -17.329 23.114  1.00 23.86 ? 78   GLN E O     1 
ATOM   6235 C  CB    . GLN E 1 78  ? 29.608  -15.842 20.191  1.00 21.74 ? 78   GLN E CB    1 
ATOM   6236 C  CG    . GLN E 1 78  ? 29.936  -15.704 18.721  1.00 23.14 ? 78   GLN E CG    1 
ATOM   6237 C  CD    . GLN E 1 78  ? 28.939  -14.819 18.005  1.00 23.15 ? 78   GLN E CD    1 
ATOM   6238 O  OE1   . GLN E 1 78  ? 27.810  -15.229 17.743  1.00 23.87 ? 78   GLN E OE1   1 
ATOM   6239 N  NE2   . GLN E 1 78  ? 29.343  -13.591 17.707  1.00 23.58 ? 78   GLN E NE2   1 
ATOM   6240 N  N     . ARG E 1 79  ? 30.942  -15.497 22.987  1.00 23.78 ? 79   ARG E N     1 
ATOM   6241 C  CA    . ARG E 1 79  ? 30.807  -15.165 24.401  1.00 25.87 ? 79   ARG E CA    1 
ATOM   6242 C  C     . ARG E 1 79  ? 30.109  -13.816 24.536  1.00 23.60 ? 79   ARG E C     1 
ATOM   6243 O  O     . ARG E 1 79  ? 30.507  -12.837 23.904  1.00 22.38 ? 79   ARG E O     1 
ATOM   6244 C  CB    . ARG E 1 79  ? 32.177  -15.125 25.086  1.00 30.01 ? 79   ARG E CB    1 
ATOM   6245 C  CG    . ARG E 1 79  ? 32.943  -16.441 25.019  1.00 38.85 ? 79   ARG E CG    1 
ATOM   6246 C  CD    . ARG E 1 79  ? 34.032  -16.508 26.078  1.00 47.06 ? 79   ARG E CD    1 
ATOM   6247 N  NE    . ARG E 1 79  ? 33.467  -16.587 27.425  1.00 52.60 ? 79   ARG E NE    1 
ATOM   6248 C  CZ    . ARG E 1 79  ? 34.183  -16.575 28.545  1.00 55.43 ? 79   ARG E CZ    1 
ATOM   6249 N  NH1   . ARG E 1 79  ? 35.507  -16.484 28.496  1.00 57.48 ? 79   ARG E NH1   1 
ATOM   6250 N  NH2   . ARG E 1 79  ? 33.573  -16.662 29.720  1.00 57.81 ? 79   ARG E NH2   1 
ATOM   6251 N  N     . LEU E 1 80  ? 29.080  -13.773 25.377  1.00 22.95 ? 80   LEU E N     1 
ATOM   6252 C  CA    . LEU E 1 80  ? 28.295  -12.563 25.596  1.00 24.18 ? 80   LEU E CA    1 
ATOM   6253 C  C     . LEU E 1 80  ? 29.124  -11.325 25.933  1.00 25.44 ? 80   LEU E C     1 
ATOM   6254 O  O     . LEU E 1 80  ? 28.853  -10.237 25.425  1.00 23.96 ? 80   LEU E O     1 
ATOM   6255 C  CB    . LEU E 1 80  ? 27.241  -12.808 26.678  1.00 23.80 ? 80   LEU E CB    1 
ATOM   6256 C  CG    . LEU E 1 80  ? 26.203  -11.711 26.924  1.00 26.77 ? 80   LEU E CG    1 
ATOM   6257 C  CD1   . LEU E 1 80  ? 25.489  -11.354 25.621  1.00 24.26 ? 80   LEU E CD1   1 
ATOM   6258 C  CD2   . LEU E 1 80  ? 25.201  -12.181 27.977  1.00 26.00 ? 80   LEU E CD2   1 
ATOM   6259 N  N     . GLU E 1 81  ? 30.129  -11.491 26.788  1.00 26.11 ? 81   GLU E N     1 
ATOM   6260 C  CA    . GLU E 1 81  ? 30.988  -10.378 27.179  1.00 28.93 ? 81   GLU E CA    1 
ATOM   6261 C  C     . GLU E 1 81  ? 31.779  -9.821  25.999  1.00 27.37 ? 81   GLU E C     1 
ATOM   6262 O  O     . GLU E 1 81  ? 31.988  -8.614  25.906  1.00 27.30 ? 81   GLU E O     1 
ATOM   6263 C  CB    . GLU E 1 81  ? 31.933  -10.777 28.323  1.00 34.26 ? 81   GLU E CB    1 
ATOM   6264 C  CG    . GLU E 1 81  ? 32.461  -12.209 28.274  1.00 45.12 ? 81   GLU E CG    1 
ATOM   6265 C  CD    . GLU E 1 81  ? 31.449  -13.229 28.782  1.00 50.85 ? 81   GLU E CD    1 
ATOM   6266 O  OE1   . GLU E 1 81  ? 31.074  -13.157 29.974  1.00 55.01 ? 81   GLU E OE1   1 
ATOM   6267 O  OE2   . GLU E 1 81  ? 31.029  -14.102 27.993  1.00 52.35 ? 81   GLU E OE2   1 
ATOM   6268 N  N     . GLU E 1 82  ? 32.198  -10.698 25.091  1.00 27.87 ? 82   GLU E N     1 
ATOM   6269 C  CA    . GLU E 1 82  ? 32.955  -10.276 23.913  1.00 29.60 ? 82   GLU E CA    1 
ATOM   6270 C  C     . GLU E 1 82  ? 32.033  -9.640  22.873  1.00 27.82 ? 82   GLU E C     1 
ATOM   6271 O  O     . GLU E 1 82  ? 32.403  -8.673  22.210  1.00 28.85 ? 82   GLU E O     1 
ATOM   6272 C  CB    . GLU E 1 82  ? 33.700  -11.466 23.306  1.00 35.20 ? 82   GLU E CB    1 
ATOM   6273 C  CG    . GLU E 1 82  ? 34.770  -12.052 24.225  1.00 44.93 ? 82   GLU E CG    1 
ATOM   6274 C  CD    . GLU E 1 82  ? 35.435  -13.299 23.661  1.00 50.94 ? 82   GLU E CD    1 
ATOM   6275 O  OE1   . GLU E 1 82  ? 35.937  -14.113 24.467  1.00 53.64 ? 82   GLU E OE1   1 
ATOM   6276 O  OE2   . GLU E 1 82  ? 35.463  -13.468 22.420  1.00 53.27 ? 82   GLU E OE2   1 
ATOM   6277 N  N     . VAL E 1 83  ? 30.827  -10.188 22.750  1.00 28.19 ? 83   VAL E N     1 
ATOM   6278 C  CA    . VAL E 1 83  ? 29.833  -9.687  21.805  1.00 27.03 ? 83   VAL E CA    1 
ATOM   6279 C  C     . VAL E 1 83  ? 29.430  -8.253  22.152  1.00 25.40 ? 83   VAL E C     1 
ATOM   6280 O  O     . VAL E 1 83  ? 29.312  -7.404  21.272  1.00 25.48 ? 83   VAL E O     1 
ATOM   6281 C  CB    . VAL E 1 83  ? 28.587  -10.609 21.779  1.00 29.11 ? 83   VAL E CB    1 
ATOM   6282 C  CG1   . VAL E 1 83  ? 27.429  -9.932  21.067  1.00 31.58 ? 83   VAL E CG1   1 
ATOM   6283 C  CG2   . VAL E 1 83  ? 28.930  -11.920 21.078  1.00 27.79 ? 83   VAL E CG2   1 
ATOM   6284 N  N     . VAL E 1 84  ? 29.241  -7.986  23.440  1.00 24.40 ? 84   VAL E N     1 
ATOM   6285 C  CA    . VAL E 1 84  ? 28.866  -6.652  23.899  1.00 25.04 ? 84   VAL E CA    1 
ATOM   6286 C  C     . VAL E 1 84  ? 30.083  -5.732  23.892  1.00 27.14 ? 84   VAL E C     1 
ATOM   6287 O  O     . VAL E 1 84  ? 29.959  -4.517  23.696  1.00 22.96 ? 84   VAL E O     1 
ATOM   6288 C  CB    . VAL E 1 84  ? 28.280  -6.708  25.336  1.00 27.76 ? 84   VAL E CB    1 
ATOM   6289 C  CG1   . VAL E 1 84  ? 28.094  -5.308  25.903  1.00 30.50 ? 84   VAL E CG1   1 
ATOM   6290 C  CG2   . VAL E 1 84  ? 26.957  -7.450  25.325  1.00 28.08 ? 84   VAL E CG2   1 
ATOM   6291 N  N     . GLY E 1 85  ? 31.261  -6.334  24.047  1.00 29.26 ? 85   GLY E N     1 
ATOM   6292 C  CA    . GLY E 1 85  ? 32.487  -5.565  24.102  1.00 34.31 ? 85   GLY E CA    1 
ATOM   6293 C  C     . GLY E 1 85  ? 32.412  -4.810  25.412  1.00 35.34 ? 85   GLY E C     1 
ATOM   6294 O  O     . GLY E 1 85  ? 32.244  -5.412  26.478  1.00 39.67 ? 85   GLY E O     1 
ATOM   6295 N  N     . GLY E 1 86  ? 32.483  -3.490  25.330  1.00 33.62 ? 86   GLY E N     1 
ATOM   6296 C  CA    . GLY E 1 86  ? 32.388  -2.677  26.527  1.00 33.46 ? 86   GLY E CA    1 
ATOM   6297 C  C     . GLY E 1 86  ? 31.431  -1.533  26.265  1.00 34.14 ? 86   GLY E C     1 
ATOM   6298 O  O     . GLY E 1 86  ? 31.413  -0.546  27.004  1.00 32.71 ? 86   GLY E O     1 
ATOM   6299 N  N     . ALA E 1 87  ? 30.615  -1.689  25.222  1.00 30.87 ? 87   ALA E N     1 
ATOM   6300 C  CA    . ALA E 1 87  ? 29.655  -0.671  24.815  1.00 30.11 ? 87   ALA E CA    1 
ATOM   6301 C  C     . ALA E 1 87  ? 28.430  -0.552  25.715  1.00 28.92 ? 87   ALA E C     1 
ATOM   6302 O  O     . ALA E 1 87  ? 27.301  -0.829  25.304  1.00 27.58 ? 87   ALA E O     1 
ATOM   6303 C  CB    . ALA E 1 87  ? 29.242  -0.889  23.369  1.00 26.23 ? 87   ALA E CB    1 
ATOM   6304 N  N     . VAL E 1 88  ? 28.678  -0.176  26.964  1.00 29.10 ? 88   VAL E N     1 
ATOM   6305 C  CA    . VAL E 1 88  ? 27.632  0.035   27.954  1.00 28.16 ? 88   VAL E CA    1 
ATOM   6306 C  C     . VAL E 1 88  ? 27.926  1.443   28.455  1.00 30.14 ? 88   VAL E C     1 
ATOM   6307 O  O     . VAL E 1 88  ? 28.994  1.703   29.014  1.00 30.05 ? 88   VAL E O     1 
ATOM   6308 C  CB    . VAL E 1 88  ? 27.714  -0.973  29.117  1.00 28.71 ? 88   VAL E CB    1 
ATOM   6309 C  CG1   . VAL E 1 88  ? 26.580  -0.726  30.098  1.00 29.34 ? 88   VAL E CG1   1 
ATOM   6310 C  CG2   . VAL E 1 88  ? 27.645  -2.403  28.587  1.00 30.42 ? 88   VAL E CG2   1 
ATOM   6311 N  N     . PHE E 1 89  ? 27.000  2.358   28.192  1.00 29.77 ? 89   PHE E N     1 
ATOM   6312 C  CA    . PHE E 1 89  ? 27.162  3.759   28.558  1.00 31.14 ? 89   PHE E CA    1 
ATOM   6313 C  C     . PHE E 1 89  ? 26.189  4.210   29.641  1.00 31.77 ? 89   PHE E C     1 
ATOM   6314 O  O     . PHE E 1 89  ? 25.219  3.515   29.948  1.00 30.75 ? 89   PHE E O     1 
ATOM   6315 C  CB    . PHE E 1 89  ? 26.966  4.625   27.308  1.00 30.59 ? 89   PHE E CB    1 
ATOM   6316 C  CG    . PHE E 1 89  ? 27.669  4.097   26.091  1.00 32.31 ? 89   PHE E CG    1 
ATOM   6317 C  CD1   . PHE E 1 89  ? 29.034  4.291   25.920  1.00 33.86 ? 89   PHE E CD1   1 
ATOM   6318 C  CD2   . PHE E 1 89  ? 26.966  3.385   25.122  1.00 32.95 ? 89   PHE E CD2   1 
ATOM   6319 C  CE1   . PHE E 1 89  ? 29.694  3.782   24.801  1.00 36.29 ? 89   PHE E CE1   1 
ATOM   6320 C  CE2   . PHE E 1 89  ? 27.612  2.873   24.004  1.00 34.07 ? 89   PHE E CE2   1 
ATOM   6321 C  CZ    . PHE E 1 89  ? 28.978  3.070   23.841  1.00 35.90 ? 89   PHE E CZ    1 
ATOM   6322 N  N     . PRO E 1 90  ? 26.462  5.371   30.264  1.00 32.01 ? 90   PRO E N     1 
ATOM   6323 C  CA    . PRO E 1 90  ? 25.591  5.907   31.314  1.00 31.86 ? 90   PRO E CA    1 
ATOM   6324 C  C     . PRO E 1 90  ? 24.255  6.294   30.690  1.00 31.41 ? 90   PRO E C     1 
ATOM   6325 O  O     . PRO E 1 90  ? 24.222  6.898   29.615  1.00 31.42 ? 90   PRO E O     1 
ATOM   6326 C  CB    . PRO E 1 90  ? 26.350  7.152   31.780  1.00 34.33 ? 90   PRO E CB    1 
ATOM   6327 C  CG    . PRO E 1 90  ? 27.784  6.791   31.524  1.00 32.88 ? 90   PRO E CG    1 
ATOM   6328 C  CD    . PRO E 1 90  ? 27.697  6.169   30.157  1.00 33.78 ? 90   PRO E CD    1 
ATOM   6329 N  N     . ALA E 1 91  ? 23.158  5.934   31.352  1.00 31.24 ? 91   ALA E N     1 
ATOM   6330 C  CA    . ALA E 1 91  ? 21.826  6.251   30.849  1.00 29.61 ? 91   ALA E CA    1 
ATOM   6331 C  C     . ALA E 1 91  ? 21.641  7.759   30.704  1.00 30.48 ? 91   ALA E C     1 
ATOM   6332 O  O     . ALA E 1 91  ? 22.095  8.530   31.550  1.00 31.45 ? 91   ALA E O     1 
ATOM   6333 C  CB    . ALA E 1 91  ? 20.763  5.672   31.771  1.00 27.65 ? 91   ALA E CB    1 
ATOM   6334 N  N     . GLU E 1 92  ? 20.995  8.172   29.617  1.00 28.28 ? 92   GLU E N     1 
ATOM   6335 C  CA    . GLU E 1 92  ? 20.745  9.589   29.348  1.00 29.04 ? 92   GLU E CA    1 
ATOM   6336 C  C     . GLU E 1 92  ? 19.388  10.038  29.873  1.00 30.66 ? 92   GLU E C     1 
ATOM   6337 O  O     . GLU E 1 92  ? 19.144  11.232  30.054  1.00 29.38 ? 92   GLU E O     1 
ATOM   6338 C  CB    . GLU E 1 92  ? 20.817  9.859   27.846  1.00 27.63 ? 92   GLU E CB    1 
ATOM   6339 C  CG    . GLU E 1 92  ? 22.187  9.620   27.229  1.00 28.96 ? 92   GLU E CG    1 
ATOM   6340 C  CD    . GLU E 1 92  ? 23.197  10.719  27.541  1.00 26.90 ? 92   GLU E CD    1 
ATOM   6341 O  OE1   . GLU E 1 92  ? 22.796  11.812  27.989  1.00 30.77 ? 92   GLU E OE1   1 
ATOM   6342 O  OE2   . GLU E 1 92  ? 24.400  10.491  27.310  1.00 29.92 ? 92   GLU E OE2   1 
ATOM   6343 N  N     . GLY E 1 93  ? 18.507  9.069   30.095  1.00 31.81 ? 93   GLY E N     1 
ATOM   6344 C  CA    . GLY E 1 93  ? 17.172  9.352   30.585  1.00 30.86 ? 93   GLY E CA    1 
ATOM   6345 C  C     . GLY E 1 93  ? 16.564  8.112   31.208  1.00 30.97 ? 93   GLY E C     1 
ATOM   6346 O  O     . GLY E 1 93  ? 17.228  7.080   31.337  1.00 30.34 ? 93   GLY E O     1 
ATOM   6347 N  N     . SER E 1 94  ? 15.287  8.199   31.566  1.00 30.57 ? 94   SER E N     1 
ATOM   6348 C  CA    . SER E 1 94  ? 14.595  7.083   32.201  1.00 32.40 ? 94   SER E CA    1 
ATOM   6349 C  C     . SER E 1 94  ? 13.577  6.394   31.294  1.00 29.46 ? 94   SER E C     1 
ATOM   6350 O  O     . SER E 1 94  ? 13.058  5.334   31.637  1.00 30.79 ? 94   SER E O     1 
ATOM   6351 C  CB    . SER E 1 94  ? 13.906  7.564   33.483  1.00 33.27 ? 94   SER E CB    1 
ATOM   6352 O  OG    . SER E 1 94  ? 13.048  8.663   33.215  1.00 35.16 ? 94   SER E OG    1 
ATOM   6353 N  N     . GLU E 1 95  ? 13.309  6.990   30.136  1.00 27.38 ? 95   GLU E N     1 
ATOM   6354 C  CA    . GLU E 1 95  ? 12.338  6.434   29.204  1.00 27.24 ? 95   GLU E CA    1 
ATOM   6355 C  C     . GLU E 1 95  ? 12.791  5.183   28.463  1.00 23.72 ? 95   GLU E C     1 
ATOM   6356 O  O     . GLU E 1 95  ? 13.980  4.907   28.315  1.00 21.96 ? 95   GLU E O     1 
ATOM   6357 C  CB    . GLU E 1 95  ? 11.880  7.493   28.197  1.00 31.91 ? 95   GLU E CB    1 
ATOM   6358 C  CG    . GLU E 1 95  ? 11.202  8.711   28.819  1.00 37.29 ? 95   GLU E CG    1 
ATOM   6359 C  CD    . GLU E 1 95  ? 9.947   8.365   29.606  1.00 40.41 ? 95   GLU E CD    1 
ATOM   6360 O  OE1   . GLU E 1 95  ? 9.144   7.534   29.127  1.00 42.74 ? 95   GLU E OE1   1 
ATOM   6361 O  OE2   . GLU E 1 95  ? 9.758   8.936   30.701  1.00 41.00 ? 95   GLU E OE2   1 
ATOM   6362 N  N     . MET E 1 96  ? 11.801  4.444   27.989  1.00 21.82 ? 96   MET E N     1 
ATOM   6363 C  CA    . MET E 1 96  ? 11.997  3.211   27.252  1.00 19.12 ? 96   MET E CA    1 
ATOM   6364 C  C     . MET E 1 96  ? 12.757  3.441   25.944  1.00 15.68 ? 96   MET E C     1 
ATOM   6365 O  O     . MET E 1 96  ? 12.570  4.458   25.273  1.00 17.87 ? 96   MET E O     1 
ATOM   6366 C  CB    . MET E 1 96  ? 10.616  2.614   26.943  1.00 18.95 ? 96   MET E CB    1 
ATOM   6367 C  CG    . MET E 1 96  ? 10.607  1.305   26.190  1.00 23.36 ? 96   MET E CG    1 
ATOM   6368 S  SD    . MET E 1 96  ? 8.916   0.823   25.748  1.00 20.83 ? 96   MET E SD    1 
ATOM   6369 C  CE    . MET E 1 96  ? 8.187   0.589   27.399  1.00 19.13 ? 96   MET E CE    1 
ATOM   6370 N  N     . VAL E 1 97  ? 13.665  2.523   25.636  1.00 13.90 ? 97   VAL E N     1 
ATOM   6371 C  CA    . VAL E 1 97  ? 14.413  2.560   24.383  1.00 16.65 ? 97   VAL E CA    1 
ATOM   6372 C  C     . VAL E 1 97  ? 13.887  1.357   23.598  1.00 15.62 ? 97   VAL E C     1 
ATOM   6373 O  O     . VAL E 1 97  ? 13.808  0.254   24.139  1.00 19.92 ? 97   VAL E O     1 
ATOM   6374 C  CB    . VAL E 1 97  ? 15.934  2.387   24.597  1.00 17.00 ? 97   VAL E CB    1 
ATOM   6375 C  CG1   . VAL E 1 97  ? 16.655  2.308   23.243  1.00 15.93 ? 97   VAL E CG1   1 
ATOM   6376 C  CG2   . VAL E 1 97  ? 16.485  3.550   25.407  1.00 15.92 ? 97   VAL E CG2   1 
ATOM   6377 N  N     . VAL E 1 98  ? 13.495  1.572   22.345  1.00 17.90 ? 98   VAL E N     1 
ATOM   6378 C  CA    . VAL E 1 98  ? 12.985  0.482   21.516  1.00 15.55 ? 98   VAL E CA    1 
ATOM   6379 C  C     . VAL E 1 98  ? 13.820  0.338   20.251  1.00 16.01 ? 98   VAL E C     1 
ATOM   6380 O  O     . VAL E 1 98  ? 14.002  1.301   19.510  1.00 18.95 ? 98   VAL E O     1 
ATOM   6381 C  CB    . VAL E 1 98  ? 11.497  0.701   21.109  1.00 17.37 ? 98   VAL E CB    1 
ATOM   6382 C  CG1   . VAL E 1 98  ? 10.981  -0.492  20.283  1.00 15.09 ? 98   VAL E CG1   1 
ATOM   6383 C  CG2   . VAL E 1 98  ? 10.621  0.895   22.352  1.00 16.83 ? 98   VAL E CG2   1 
ATOM   6384 N  N     . VAL E 1 99  ? 14.396  -0.844  20.058  1.00 15.70 ? 99   VAL E N     1 
ATOM   6385 C  CA    . VAL E 1 99  ? 15.179  -1.126  18.859  1.00 16.73 ? 99   VAL E CA    1 
ATOM   6386 C  C     . VAL E 1 99  ? 14.347  -2.151  18.099  1.00 16.57 ? 99   VAL E C     1 
ATOM   6387 O  O     . VAL E 1 99  ? 14.276  -3.316  18.486  1.00 18.66 ? 99   VAL E O     1 
ATOM   6388 C  CB    . VAL E 1 99  ? 16.563  -1.720  19.191  1.00 17.95 ? 99   VAL E CB    1 
ATOM   6389 C  CG1   . VAL E 1 99  ? 17.304  -2.083  17.903  1.00 17.27 ? 99   VAL E CG1   1 
ATOM   6390 C  CG2   . VAL E 1 99  ? 17.382  -0.717  19.997  1.00 18.77 ? 99   VAL E CG2   1 
ATOM   6391 N  N     . LYS E 1 100 ? 13.677  -1.710  17.044  1.00 18.03 ? 100  LYS E N     1 
ATOM   6392 C  CA    . LYS E 1 100 ? 12.849  -2.632  16.283  1.00 17.24 ? 100  LYS E CA    1 
ATOM   6393 C  C     . LYS E 1 100 ? 13.380  -3.010  14.911  1.00 12.77 ? 100  LYS E C     1 
ATOM   6394 O  O     . LYS E 1 100 ? 14.334  -2.417  14.413  1.00 10.15 ? 100  LYS E O     1 
ATOM   6395 C  CB    . LYS E 1 100 ? 11.420  -2.104  16.193  1.00 25.49 ? 100  LYS E CB    1 
ATOM   6396 C  CG    . LYS E 1 100 ? 11.287  -0.663  15.785  1.00 24.53 ? 100  LYS E CG    1 
ATOM   6397 C  CD    . LYS E 1 100 ? 9.866   -0.190  16.024  1.00 25.51 ? 100  LYS E CD    1 
ATOM   6398 C  CE    . LYS E 1 100 ? 9.659   1.212   15.514  1.00 29.60 ? 100  LYS E CE    1 
ATOM   6399 N  NZ    . LYS E 1 100 ? 8.328   1.801   15.878  1.00 29.21 ? 100  LYS E NZ    1 
ATOM   6400 N  N     . GLY E 1 101 ? 12.805  -4.066  14.346  1.00 13.69 ? 101  GLY E N     1 
ATOM   6401 C  CA    . GLY E 1 101 ? 13.200  -4.504  13.024  1.00 11.59 ? 101  GLY E CA    1 
ATOM   6402 C  C     . GLY E 1 101 ? 14.583  -5.094  12.852  1.00 11.64 ? 101  GLY E C     1 
ATOM   6403 O  O     . GLY E 1 101 ? 15.155  -4.972  11.779  1.00 13.54 ? 101  GLY E O     1 
ATOM   6404 N  N     . VAL E 1 102 ? 15.148  -5.702  13.893  1.00 10.89 ? 102  VAL E N     1 
ATOM   6405 C  CA    . VAL E 1 102 ? 16.465  -6.321  13.744  1.00 11.56 ? 102  VAL E CA    1 
ATOM   6406 C  C     . VAL E 1 102 ? 16.238  -7.652  13.032  1.00 11.83 ? 102  VAL E C     1 
ATOM   6407 O  O     . VAL E 1 102 ? 15.779  -8.613  13.647  1.00 14.14 ? 102  VAL E O     1 
ATOM   6408 C  CB    . VAL E 1 102 ? 17.150  -6.586  15.103  1.00 12.19 ? 102  VAL E CB    1 
ATOM   6409 C  CG1   . VAL E 1 102 ? 18.487  -7.320  14.885  1.00 12.28 ? 102  VAL E CG1   1 
ATOM   6410 C  CG2   . VAL E 1 102 ? 17.393  -5.275  15.828  1.00 12.49 ? 102  VAL E CG2   1 
ATOM   6411 N  N     . GLU E 1 103 ? 16.529  -7.705  11.733  1.00 10.63 ? 103  GLU E N     1 
ATOM   6412 C  CA    . GLU E 1 103 ? 16.322  -8.945  10.991  1.00 13.30 ? 103  GLU E CA    1 
ATOM   6413 C  C     . GLU E 1 103 ? 17.193  -10.062 11.544  1.00 11.23 ? 103  GLU E C     1 
ATOM   6414 O  O     . GLU E 1 103 ? 18.293  -9.815  12.049  1.00 14.25 ? 103  GLU E O     1 
ATOM   6415 C  CB    . GLU E 1 103 ? 16.571  -8.764  9.486   1.00 13.24 ? 103  GLU E CB    1 
ATOM   6416 C  CG    . GLU E 1 103 ? 18.021  -8.517  9.079   1.00 13.36 ? 103  GLU E CG    1 
ATOM   6417 C  CD    . GLU E 1 103 ? 18.346  -7.045  8.885   1.00 14.20 ? 103  GLU E CD    1 
ATOM   6418 O  OE1   . GLU E 1 103 ? 17.707  -6.189  9.532   1.00 14.45 ? 103  GLU E OE1   1 
ATOM   6419 O  OE2   . GLU E 1 103 ? 19.242  -6.743  8.072   1.00 13.56 ? 103  GLU E OE2   1 
ATOM   6420 N  N     . PHE E 1 104 ? 16.663  -11.279 11.516  1.00 10.77 ? 104  PHE E N     1 
ATOM   6421 C  CA    . PHE E 1 104 ? 17.393  -12.442 12.001  1.00 11.62 ? 104  PHE E CA    1 
ATOM   6422 C  C     . PHE E 1 104 ? 17.125  -13.655 11.127  1.00 14.11 ? 104  PHE E C     1 
ATOM   6423 O  O     . PHE E 1 104 ? 16.096  -13.740 10.449  1.00 9.89  ? 104  PHE E O     1 
ATOM   6424 C  CB    . PHE E 1 104 ? 17.001  -12.773 13.451  1.00 11.73 ? 104  PHE E CB    1 
ATOM   6425 C  CG    . PHE E 1 104 ? 15.751  -13.614 13.571  1.00 7.73  ? 104  PHE E CG    1 
ATOM   6426 C  CD1   . PHE E 1 104 ? 14.497  -13.015 13.591  1.00 8.61  ? 104  PHE E CD1   1 
ATOM   6427 C  CD2   . PHE E 1 104 ? 15.832  -15.007 13.622  1.00 11.58 ? 104  PHE E CD2   1 
ATOM   6428 C  CE1   . PHE E 1 104 ? 13.333  -13.790 13.655  1.00 9.30  ? 104  PHE E CE1   1 
ATOM   6429 C  CE2   . PHE E 1 104 ? 14.674  -15.795 13.686  1.00 11.82 ? 104  PHE E CE2   1 
ATOM   6430 C  CZ    . PHE E 1 104 ? 13.423  -15.181 13.701  1.00 11.53 ? 104  PHE E CZ    1 
ATOM   6431 N  N     . TYR E 1 105 ? 18.047  -14.611 11.190  1.00 12.83 ? 105  TYR E N     1 
ATOM   6432 C  CA    . TYR E 1 105 ? 17.942  -15.859 10.452  1.00 13.57 ? 105  TYR E CA    1 
ATOM   6433 C  C     . TYR E 1 105 ? 18.432  -16.948 11.395  1.00 15.55 ? 105  TYR E C     1 
ATOM   6434 O  O     . TYR E 1 105 ? 19.457  -16.786 12.059  1.00 15.52 ? 105  TYR E O     1 
ATOM   6435 C  CB    . TYR E 1 105 ? 18.828  -15.842 9.198   1.00 12.83 ? 105  TYR E CB    1 
ATOM   6436 C  CG    . TYR E 1 105 ? 18.407  -14.838 8.149   1.00 14.23 ? 105  TYR E CG    1 
ATOM   6437 C  CD1   . TYR E 1 105 ? 17.545  -15.204 7.113   1.00 10.68 ? 105  TYR E CD1   1 
ATOM   6438 C  CD2   . TYR E 1 105 ? 18.864  -13.522 8.196   1.00 13.88 ? 105  TYR E CD2   1 
ATOM   6439 C  CE1   . TYR E 1 105 ? 17.142  -14.275 6.140   1.00 16.03 ? 105  TYR E CE1   1 
ATOM   6440 C  CE2   . TYR E 1 105 ? 18.470  -12.586 7.237   1.00 14.36 ? 105  TYR E CE2   1 
ATOM   6441 C  CZ    . TYR E 1 105 ? 17.607  -12.970 6.212   1.00 17.25 ? 105  TYR E CZ    1 
ATOM   6442 O  OH    . TYR E 1 105 ? 17.196  -12.038 5.281   1.00 16.23 ? 105  TYR E OH    1 
ATOM   6443 N  N     . SER E 1 106 ? 17.692  -18.047 11.462  1.00 14.12 ? 106  SER E N     1 
ATOM   6444 C  CA    . SER E 1 106 ? 18.067  -19.159 12.322  1.00 13.90 ? 106  SER E CA    1 
ATOM   6445 C  C     . SER E 1 106 ? 17.706  -20.470 11.635  1.00 15.06 ? 106  SER E C     1 
ATOM   6446 O  O     . SER E 1 106 ? 17.292  -20.479 10.478  1.00 14.24 ? 106  SER E O     1 
ATOM   6447 C  CB    . SER E 1 106 ? 17.367  -19.044 13.685  1.00 14.45 ? 106  SER E CB    1 
ATOM   6448 O  OG    . SER E 1 106 ? 17.902  -19.976 14.613  1.00 14.50 ? 106  SER E OG    1 
ATOM   6449 N  N     . MET E 1 107 ? 17.924  -21.575 12.335  1.00 14.48 ? 107  MET E N     1 
ATOM   6450 C  CA    . MET E 1 107 ? 17.627  -22.904 11.814  1.00 17.29 ? 107  MET E CA    1 
ATOM   6451 C  C     . MET E 1 107 ? 16.796  -23.632 12.853  1.00 15.17 ? 107  MET E C     1 
ATOM   6452 O  O     . MET E 1 107 ? 17.165  -23.649 14.026  1.00 17.88 ? 107  MET E O     1 
ATOM   6453 C  CB    . MET E 1 107 ? 18.931  -23.678 11.573  1.00 18.62 ? 107  MET E CB    1 
ATOM   6454 C  CG    . MET E 1 107 ? 19.695  -23.257 10.326  1.00 23.73 ? 107  MET E CG    1 
ATOM   6455 S  SD    . MET E 1 107 ? 18.890  -23.839 8.817   1.00 24.89 ? 107  MET E SD    1 
ATOM   6456 C  CE    . MET E 1 107 ? 20.198  -23.668 7.640   1.00 24.02 ? 107  MET E CE    1 
ATOM   6457 N  N     . CYS E 1 108 ? 15.665  -24.207 12.450  1.00 16.04 ? 108  CYS E N     1 
ATOM   6458 C  CA    . CYS E 1 108 ? 14.843  -24.930 13.420  1.00 15.72 ? 108  CYS E CA    1 
ATOM   6459 C  C     . CYS E 1 108 ? 15.574  -26.215 13.792  1.00 16.66 ? 108  CYS E C     1 
ATOM   6460 O  O     . CYS E 1 108 ? 16.096  -26.915 12.923  1.00 13.31 ? 108  CYS E O     1 
ATOM   6461 C  CB    . CYS E 1 108 ? 13.447  -25.244 12.872  1.00 18.54 ? 108  CYS E CB    1 
ATOM   6462 S  SG    . CYS E 1 108 ? 13.402  -26.387 11.485  1.00 22.55 ? 108  CYS E SG    1 
ATOM   6463 N  N     . GLU E 1 109 ? 15.645  -26.507 15.086  1.00 16.12 ? 109  GLU E N     1 
ATOM   6464 C  CA    . GLU E 1 109 ? 16.342  -27.708 15.534  1.00 17.98 ? 109  GLU E CA    1 
ATOM   6465 C  C     . GLU E 1 109 ? 15.630  -28.989 15.102  1.00 17.27 ? 109  GLU E C     1 
ATOM   6466 O  O     . GLU E 1 109 ? 16.242  -30.053 15.032  1.00 15.70 ? 109  GLU E O     1 
ATOM   6467 C  CB    . GLU E 1 109 ? 16.528  -27.689 17.056  1.00 16.09 ? 109  GLU E CB    1 
ATOM   6468 C  CG    . GLU E 1 109 ? 15.263  -27.883 17.876  1.00 16.42 ? 109  GLU E CG    1 
ATOM   6469 C  CD    . GLU E 1 109 ? 15.508  -27.731 19.375  1.00 19.01 ? 109  GLU E CD    1 
ATOM   6470 O  OE1   . GLU E 1 109 ? 16.466  -27.028 19.757  1.00 20.43 ? 109  GLU E OE1   1 
ATOM   6471 O  OE2   . GLU E 1 109 ? 14.730  -28.296 20.169  1.00 22.02 ? 109  GLU E OE2   1 
ATOM   6472 N  N     . HIS E 1 110 ? 14.356  -28.860 14.745  1.00 15.77 ? 110  HIS E N     1 
ATOM   6473 C  CA    . HIS E 1 110 ? 13.539  -30.002 14.340  1.00 16.99 ? 110  HIS E CA    1 
ATOM   6474 C  C     . HIS E 1 110 ? 13.752  -30.512 12.915  1.00 18.39 ? 110  HIS E C     1 
ATOM   6475 O  O     . HIS E 1 110 ? 13.751  -31.724 12.684  1.00 19.89 ? 110  HIS E O     1 
ATOM   6476 C  CB    . HIS E 1 110 ? 12.056  -29.672 14.533  1.00 18.13 ? 110  HIS E CB    1 
ATOM   6477 C  CG    . HIS E 1 110 ? 11.728  -29.135 15.888  1.00 24.68 ? 110  HIS E CG    1 
ATOM   6478 N  ND1   . HIS E 1 110 ? 11.712  -27.785 16.169  1.00 32.99 ? 110  HIS E ND1   1 
ATOM   6479 C  CD2   . HIS E 1 110 ? 11.401  -29.762 17.041  1.00 28.12 ? 110  HIS E CD2   1 
ATOM   6480 C  CE1   . HIS E 1 110 ? 11.387  -27.606 17.436  1.00 31.62 ? 110  HIS E CE1   1 
ATOM   6481 N  NE2   . HIS E 1 110 ? 11.194  -28.789 17.988  1.00 29.39 ? 110  HIS E NE2   1 
ATOM   6482 N  N     . HIS E 1 111 ? 13.919  -29.600 11.960  1.00 17.80 ? 111  HIS E N     1 
ATOM   6483 C  CA    . HIS E 1 111 ? 14.096  -29.994 10.560  1.00 17.02 ? 111  HIS E CA    1 
ATOM   6484 C  C     . HIS E 1 111 ? 15.383  -29.493 9.924   1.00 16.49 ? 111  HIS E C     1 
ATOM   6485 O  O     . HIS E 1 111 ? 15.689  -29.859 8.791   1.00 19.29 ? 111  HIS E O     1 
ATOM   6486 C  CB    . HIS E 1 111 ? 12.927  -29.482 9.710   1.00 16.86 ? 111  HIS E CB    1 
ATOM   6487 C  CG    . HIS E 1 111 ? 11.587  -29.942 10.180  1.00 17.15 ? 111  HIS E CG    1 
ATOM   6488 N  ND1   . HIS E 1 111 ? 10.851  -29.249 11.116  1.00 18.23 ? 111  HIS E ND1   1 
ATOM   6489 C  CD2   . HIS E 1 111 ? 10.853  -31.031 9.853   1.00 18.48 ? 111  HIS E CD2   1 
ATOM   6490 C  CE1   . HIS E 1 111 ? 9.722   -29.893 11.348  1.00 18.96 ? 111  HIS E CE1   1 
ATOM   6491 N  NE2   . HIS E 1 111 ? 9.699   -30.977 10.594  1.00 18.72 ? 111  HIS E NE2   1 
ATOM   6492 N  N     . LEU E 1 112 ? 16.123  -28.655 10.644  1.00 16.03 ? 112  LEU E N     1 
ATOM   6493 C  CA    . LEU E 1 112 ? 17.359  -28.062 10.136  1.00 14.25 ? 112  LEU E CA    1 
ATOM   6494 C  C     . LEU E 1 112 ? 17.066  -27.202 8.902   1.00 14.58 ? 112  LEU E C     1 
ATOM   6495 O  O     . LEU E 1 112 ? 17.841  -27.171 7.949   1.00 13.79 ? 112  LEU E O     1 
ATOM   6496 C  CB    . LEU E 1 112 ? 18.420  -29.124 9.813   1.00 17.18 ? 112  LEU E CB    1 
ATOM   6497 C  CG    . LEU E 1 112 ? 18.801  -30.083 10.943  1.00 22.13 ? 112  LEU E CG    1 
ATOM   6498 C  CD1   . LEU E 1 112 ? 20.101  -30.789 10.585  1.00 23.05 ? 112  LEU E CD1   1 
ATOM   6499 C  CD2   . LEU E 1 112 ? 18.952  -29.327 12.244  1.00 19.28 ? 112  LEU E CD2   1 
ATOM   6500 N  N     . LEU E 1 113 ? 15.907  -26.547 8.920   1.00 14.31 ? 113  LEU E N     1 
ATOM   6501 C  CA    . LEU E 1 113 ? 15.497  -25.651 7.841   1.00 14.77 ? 113  LEU E CA    1 
ATOM   6502 C  C     . LEU E 1 113 ? 15.410  -24.239 8.426   1.00 14.41 ? 113  LEU E C     1 
ATOM   6503 O  O     . LEU E 1 113 ? 15.063  -24.056 9.597   1.00 13.67 ? 113  LEU E O     1 
ATOM   6504 C  CB    . LEU E 1 113 ? 14.159  -26.089 7.240   1.00 14.72 ? 113  LEU E CB    1 
ATOM   6505 C  CG    . LEU E 1 113 ? 14.211  -27.380 6.420   1.00 16.52 ? 113  LEU E CG    1 
ATOM   6506 C  CD1   . LEU E 1 113 ? 12.798  -27.795 6.037   1.00 16.53 ? 113  LEU E CD1   1 
ATOM   6507 C  CD2   . LEU E 1 113 ? 15.070  -27.187 5.184   1.00 17.27 ? 113  LEU E CD2   1 
ATOM   6508 N  N     . PRO E 1 114 ? 15.714  -23.219 7.611   1.00 14.77 ? 114  PRO E N     1 
ATOM   6509 C  CA    . PRO E 1 114 ? 15.682  -21.827 8.068   1.00 15.93 ? 114  PRO E CA    1 
ATOM   6510 C  C     . PRO E 1 114 ? 14.339  -21.255 8.506   1.00 16.30 ? 114  PRO E C     1 
ATOM   6511 O  O     . PRO E 1 114 ? 13.292  -21.649 8.006   1.00 15.32 ? 114  PRO E O     1 
ATOM   6512 C  CB    . PRO E 1 114 ? 16.194  -21.048 6.844   1.00 14.30 ? 114  PRO E CB    1 
ATOM   6513 C  CG    . PRO E 1 114 ? 16.960  -22.065 6.051   1.00 13.20 ? 114  PRO E CG    1 
ATOM   6514 C  CD    . PRO E 1 114 ? 16.100  -23.292 6.193   1.00 12.86 ? 114  PRO E CD    1 
ATOM   6515 N  N     . PHE E 1 115 ? 14.385  -20.409 9.533   1.00 12.39 ? 115  PHE E N     1 
ATOM   6516 C  CA    . PHE E 1 115 ? 13.206  -19.663 9.963   1.00 13.04 ? 115  PHE E CA    1 
ATOM   6517 C  C     . PHE E 1 115 ? 13.785  -18.275 10.186  1.00 12.38 ? 115  PHE E C     1 
ATOM   6518 O  O     . PHE E 1 115 ? 14.904  -18.132 10.687  1.00 14.64 ? 115  PHE E O     1 
ATOM   6519 C  CB    . PHE E 1 115 ? 12.428  -20.274 11.151  1.00 10.81 ? 115  PHE E CB    1 
ATOM   6520 C  CG    . PHE E 1 115 ? 13.083  -20.137 12.497  1.00 15.45 ? 115  PHE E CG    1 
ATOM   6521 C  CD1   . PHE E 1 115 ? 13.894  -21.156 12.995  1.00 14.09 ? 115  PHE E CD1   1 
ATOM   6522 C  CD2   . PHE E 1 115 ? 12.792  -19.051 13.319  1.00 10.76 ? 115  PHE E CD2   1 
ATOM   6523 C  CE1   . PHE E 1 115 ? 14.400  -21.099 14.301  1.00 13.00 ? 115  PHE E CE1   1 
ATOM   6524 C  CE2   . PHE E 1 115 ? 13.295  -18.986 14.631  1.00 14.10 ? 115  PHE E CE2   1 
ATOM   6525 C  CZ    . PHE E 1 115 ? 14.099  -20.018 15.116  1.00 12.89 ? 115  PHE E CZ    1 
ATOM   6526 N  N     . PHE E 1 116 ? 13.092  -17.256 9.695   1.00 12.55 ? 116  PHE E N     1 
ATOM   6527 C  CA    . PHE E 1 116 ? 13.631  -15.911 9.786   1.00 10.02 ? 116  PHE E CA    1 
ATOM   6528 C  C     . PHE E 1 116 ? 12.570  -14.841 9.922   1.00 11.55 ? 116  PHE E C     1 
ATOM   6529 O  O     . PHE E 1 116 ? 11.391  -15.093 9.712   1.00 10.74 ? 116  PHE E O     1 
ATOM   6530 C  CB    . PHE E 1 116 ? 14.480  -15.639 8.540   1.00 10.96 ? 116  PHE E CB    1 
ATOM   6531 C  CG    . PHE E 1 116 ? 13.737  -15.854 7.241   1.00 14.06 ? 116  PHE E CG    1 
ATOM   6532 C  CD1   . PHE E 1 116 ? 13.547  -17.140 6.734   1.00 16.21 ? 116  PHE E CD1   1 
ATOM   6533 C  CD2   . PHE E 1 116 ? 13.221  -14.772 6.533   1.00 18.00 ? 116  PHE E CD2   1 
ATOM   6534 C  CE1   . PHE E 1 116 ? 12.848  -17.347 5.534   1.00 17.90 ? 116  PHE E CE1   1 
ATOM   6535 C  CE2   . PHE E 1 116 ? 12.522  -14.969 5.333   1.00 18.24 ? 116  PHE E CE2   1 
ATOM   6536 C  CZ    . PHE E 1 116 ? 12.338  -16.257 4.839   1.00 16.43 ? 116  PHE E CZ    1 
ATOM   6537 N  N     . GLY E 1 117 ? 13.007  -13.635 10.265  1.00 10.75 ? 117  GLY E N     1 
ATOM   6538 C  CA    . GLY E 1 117 ? 12.072  -12.543 10.425  1.00 10.02 ? 117  GLY E CA    1 
ATOM   6539 C  C     . GLY E 1 117 ? 12.734  -11.369 11.100  1.00 9.45  ? 117  GLY E C     1 
ATOM   6540 O  O     . GLY E 1 117 ? 13.827  -10.958 10.713  1.00 10.96 ? 117  GLY E O     1 
ATOM   6541 N  N     . LYS E 1 118 ? 12.091  -10.856 12.143  1.00 10.40 ? 118  LYS E N     1 
ATOM   6542 C  CA    . LYS E 1 118 ? 12.620  -9.709  12.863  1.00 10.06 ? 118  LYS E CA    1 
ATOM   6543 C  C     . LYS E 1 118 ? 12.497  -9.852  14.365  1.00 9.94  ? 118  LYS E C     1 
ATOM   6544 O  O     . LYS E 1 118 ? 11.616  -10.557 14.869  1.00 11.38 ? 118  LYS E O     1 
ATOM   6545 C  CB    . LYS E 1 118 ? 11.891  -8.430  12.432  1.00 14.25 ? 118  LYS E CB    1 
ATOM   6546 C  CG    . LYS E 1 118 ? 12.125  -8.016  10.982  1.00 16.56 ? 118  LYS E CG    1 
ATOM   6547 C  CD    . LYS E 1 118 ? 11.243  -6.832  10.620  1.00 24.01 ? 118  LYS E CD    1 
ATOM   6548 C  CE    . LYS E 1 118 ? 11.473  -6.373  9.185   1.00 30.44 ? 118  LYS E CE    1 
ATOM   6549 N  NZ    . LYS E 1 118 ? 10.573  -5.235  8.830   1.00 37.45 ? 118  LYS E NZ    1 
ATOM   6550 N  N     . VAL E 1 119 ? 13.386  -9.158  15.070  1.00 11.12 ? 119  VAL E N     1 
ATOM   6551 C  CA    . VAL E 1 119 ? 13.377  -9.144  16.527  1.00 11.81 ? 119  VAL E CA    1 
ATOM   6552 C  C     . VAL E 1 119 ? 13.214  -7.686  16.933  1.00 14.57 ? 119  VAL E C     1 
ATOM   6553 O  O     . VAL E 1 119 ? 13.868  -6.797  16.377  1.00 11.51 ? 119  VAL E O     1 
ATOM   6554 C  CB    . VAL E 1 119 ? 14.691  -9.683  17.130  1.00 11.17 ? 119  VAL E CB    1 
ATOM   6555 C  CG1   . VAL E 1 119 ? 14.617  -9.664  18.676  1.00 9.87  ? 119  VAL E CG1   1 
ATOM   6556 C  CG2   . VAL E 1 119 ? 14.967  -11.090 16.623  1.00 14.86 ? 119  VAL E CG2   1 
ATOM   6557 N  N     . HIS E 1 120 ? 12.312  -7.448  17.876  1.00 12.13 ? 120  HIS E N     1 
ATOM   6558 C  CA    . HIS E 1 120 ? 12.052  -6.110  18.375  1.00 13.70 ? 120  HIS E CA    1 
ATOM   6559 C  C     . HIS E 1 120 ? 12.406  -6.141  19.860  1.00 16.27 ? 120  HIS E C     1 
ATOM   6560 O  O     . HIS E 1 120 ? 11.975  -7.035  20.591  1.00 13.11 ? 120  HIS E O     1 
ATOM   6561 C  CB    . HIS E 1 120 ? 10.578  -5.754  18.180  1.00 11.84 ? 120  HIS E CB    1 
ATOM   6562 C  CG    . HIS E 1 120 ? 10.068  -6.039  16.803  1.00 11.67 ? 120  HIS E CG    1 
ATOM   6563 N  ND1   . HIS E 1 120 ? 10.485  -5.337  15.693  1.00 13.36 ? 120  HIS E ND1   1 
ATOM   6564 C  CD2   . HIS E 1 120 ? 9.194   -6.971  16.354  1.00 16.95 ? 120  HIS E CD2   1 
ATOM   6565 C  CE1   . HIS E 1 120 ? 9.892   -5.826  14.617  1.00 14.59 ? 120  HIS E CE1   1 
ATOM   6566 N  NE2   . HIS E 1 120 ? 9.103   -6.818  14.992  1.00 15.51 ? 120  HIS E NE2   1 
ATOM   6567 N  N     . ILE E 1 121 ? 13.229  -5.190  20.284  1.00 15.47 ? 121  ILE E N     1 
ATOM   6568 C  CA    . ILE E 1 121 ? 13.672  -5.123  21.672  1.00 17.51 ? 121  ILE E CA    1 
ATOM   6569 C  C     . ILE E 1 121 ? 13.278  -3.815  22.348  1.00 14.86 ? 121  ILE E C     1 
ATOM   6570 O  O     . ILE E 1 121 ? 13.353  -2.744  21.752  1.00 17.64 ? 121  ILE E O     1 
ATOM   6571 C  CB    . ILE E 1 121 ? 15.206  -5.294  21.746  1.00 20.37 ? 121  ILE E CB    1 
ATOM   6572 C  CG1   . ILE E 1 121 ? 15.597  -6.662  21.180  1.00 18.55 ? 121  ILE E CG1   1 
ATOM   6573 C  CG2   . ILE E 1 121 ? 15.697  -5.133  23.183  1.00 20.97 ? 121  ILE E CG2   1 
ATOM   6574 C  CD1   . ILE E 1 121 ? 17.021  -6.755  20.693  1.00 17.19 ? 121  ILE E CD1   1 
ATOM   6575 N  N     . GLY E 1 122 ? 12.841  -3.916  23.597  1.00 14.75 ? 122  GLY E N     1 
ATOM   6576 C  CA    . GLY E 1 122 ? 12.474  -2.732  24.343  1.00 15.45 ? 122  GLY E CA    1 
ATOM   6577 C  C     . GLY E 1 122 ? 12.980  -2.863  25.766  1.00 15.94 ? 122  GLY E C     1 
ATOM   6578 O  O     . GLY E 1 122 ? 13.039  -3.971  26.303  1.00 14.58 ? 122  GLY E O     1 
ATOM   6579 N  N     . TYR E 1 123 ? 13.416  -1.754  26.355  1.00 15.88 ? 123  TYR E N     1 
ATOM   6580 C  CA    . TYR E 1 123 ? 13.889  -1.787  27.736  1.00 14.03 ? 123  TYR E CA    1 
ATOM   6581 C  C     . TYR E 1 123 ? 13.887  -0.418  28.401  1.00 17.85 ? 123  TYR E C     1 
ATOM   6582 O  O     . TYR E 1 123 ? 13.854  0.619   27.737  1.00 19.18 ? 123  TYR E O     1 
ATOM   6583 C  CB    . TYR E 1 123 ? 15.287  -2.424  27.830  1.00 14.82 ? 123  TYR E CB    1 
ATOM   6584 C  CG    . TYR E 1 123 ? 16.444  -1.510  27.475  1.00 14.73 ? 123  TYR E CG    1 
ATOM   6585 C  CD1   . TYR E 1 123 ? 17.219  -0.918  28.473  1.00 19.31 ? 123  TYR E CD1   1 
ATOM   6586 C  CD2   . TYR E 1 123 ? 16.785  -1.266  26.147  1.00 13.60 ? 123  TYR E CD2   1 
ATOM   6587 C  CE1   . TYR E 1 123 ? 18.309  -0.112  28.156  1.00 17.68 ? 123  TYR E CE1   1 
ATOM   6588 C  CE2   . TYR E 1 123 ? 17.872  -0.465  25.819  1.00 17.10 ? 123  TYR E CE2   1 
ATOM   6589 C  CZ    . TYR E 1 123 ? 18.633  0.106   26.827  1.00 21.22 ? 123  TYR E CZ    1 
ATOM   6590 O  OH    . TYR E 1 123 ? 19.735  0.860   26.503  1.00 23.52 ? 123  TYR E OH    1 
ATOM   6591 N  N     . ILE E 1 124 ? 13.856  -0.440  29.728  1.00 19.15 ? 124  ILE E N     1 
ATOM   6592 C  CA    . ILE E 1 124 ? 13.896  0.769   30.535  1.00 20.15 ? 124  ILE E CA    1 
ATOM   6593 C  C     . ILE E 1 124 ? 15.173  0.606   31.347  1.00 20.11 ? 124  ILE E C     1 
ATOM   6594 O  O     . ILE E 1 124 ? 15.307  -0.332  32.129  1.00 21.02 ? 124  ILE E O     1 
ATOM   6595 C  CB    . ILE E 1 124 ? 12.668  0.881   31.466  1.00 19.54 ? 124  ILE E CB    1 
ATOM   6596 C  CG1   . ILE E 1 124 ? 11.406  1.114   30.631  1.00 20.21 ? 124  ILE E CG1   1 
ATOM   6597 C  CG2   . ILE E 1 124 ? 12.861  2.032   32.462  1.00 20.86 ? 124  ILE E CG2   1 
ATOM   6598 C  CD1   . ILE E 1 124 ? 10.121  1.069   31.433  1.00 22.65 ? 124  ILE E CD1   1 
ATOM   6599 N  N     . PRO E 1 125 ? 16.150  1.490   31.121  1.00 23.10 ? 125  PRO E N     1 
ATOM   6600 C  CA    . PRO E 1 125 ? 17.447  1.473   31.803  1.00 24.61 ? 125  PRO E CA    1 
ATOM   6601 C  C     . PRO E 1 125 ? 17.383  1.682   33.310  1.00 24.44 ? 125  PRO E C     1 
ATOM   6602 O  O     . PRO E 1 125 ? 16.408  2.214   33.845  1.00 24.69 ? 125  PRO E O     1 
ATOM   6603 C  CB    . PRO E 1 125 ? 18.193  2.647   31.155  1.00 22.92 ? 125  PRO E CB    1 
ATOM   6604 C  CG    . PRO E 1 125 ? 17.473  2.877   29.855  1.00 29.40 ? 125  PRO E CG    1 
ATOM   6605 C  CD    . PRO E 1 125 ? 16.045  2.659   30.233  1.00 24.17 ? 125  PRO E CD    1 
ATOM   6606 N  N     . ASP E 1 126 ? 18.433  1.222   33.980  1.00 27.06 ? 126  ASP E N     1 
ATOM   6607 C  CA    . ASP E 1 126 ? 18.600  1.398   35.415  1.00 28.97 ? 126  ASP E CA    1 
ATOM   6608 C  C     . ASP E 1 126 ? 20.042  1.883   35.528  1.00 28.44 ? 126  ASP E C     1 
ATOM   6609 O  O     . ASP E 1 126 ? 20.926  1.159   35.990  1.00 27.78 ? 126  ASP E O     1 
ATOM   6610 C  CB    . ASP E 1 126 ? 18.406  0.088   36.190  1.00 29.68 ? 126  ASP E CB    1 
ATOM   6611 C  CG    . ASP E 1 126 ? 18.513  0.280   37.706  1.00 33.85 ? 126  ASP E CG    1 
ATOM   6612 O  OD1   . ASP E 1 126 ? 18.694  -0.723  38.430  1.00 35.04 ? 126  ASP E OD1   1 
ATOM   6613 O  OD2   . ASP E 1 126 ? 18.423  1.435   38.177  1.00 30.01 ? 126  ASP E OD2   1 
ATOM   6614 N  N     . GLY E 1 127 ? 20.283  3.072   34.982  1.00 28.97 ? 127  GLY E N     1 
ATOM   6615 C  CA    . GLY E 1 127 ? 21.611  3.658   35.019  1.00 29.88 ? 127  GLY E CA    1 
ATOM   6616 C  C     . GLY E 1 127 ? 22.548  3.285   33.879  1.00 29.41 ? 127  GLY E C     1 
ATOM   6617 O  O     . GLY E 1 127 ? 23.606  3.897   33.741  1.00 30.56 ? 127  GLY E O     1 
ATOM   6618 N  N     . LYS E 1 128 ? 22.171  2.314   33.047  1.00 25.87 ? 128  LYS E N     1 
ATOM   6619 C  CA    . LYS E 1 128 ? 23.035  1.900   31.940  1.00 27.71 ? 128  LYS E CA    1 
ATOM   6620 C  C     . LYS E 1 128 ? 22.293  1.565   30.645  1.00 26.40 ? 128  LYS E C     1 
ATOM   6621 O  O     . LYS E 1 128 ? 21.261  0.889   30.666  1.00 23.92 ? 128  LYS E O     1 
ATOM   6622 C  CB    . LYS E 1 128 ? 23.877  0.685   32.346  1.00 30.00 ? 128  LYS E CB    1 
ATOM   6623 C  CG    . LYS E 1 128 ? 24.869  0.936   33.478  1.00 37.65 ? 128  LYS E CG    1 
ATOM   6624 C  CD    . LYS E 1 128 ? 25.690  -0.309  33.797  1.00 43.24 ? 128  LYS E CD    1 
ATOM   6625 C  CE    . LYS E 1 128 ? 24.818  -1.446  34.317  1.00 47.14 ? 128  LYS E CE    1 
ATOM   6626 N  NZ    . LYS E 1 128 ? 25.620  -2.631  34.746  1.00 47.57 ? 128  LYS E NZ    1 
ATOM   6627 N  N     . ILE E 1 129 ? 22.826  2.055   29.527  1.00 23.87 ? 129  ILE E N     1 
ATOM   6628 C  CA    . ILE E 1 129 ? 22.259  1.782   28.209  1.00 21.69 ? 129  ILE E CA    1 
ATOM   6629 C  C     . ILE E 1 129 ? 23.286  1.031   27.369  1.00 23.15 ? 129  ILE E C     1 
ATOM   6630 O  O     . ILE E 1 129 ? 24.494  1.139   27.599  1.00 25.32 ? 129  ILE E O     1 
ATOM   6631 C  CB    . ILE E 1 129 ? 21.827  3.067   27.462  1.00 22.57 ? 129  ILE E CB    1 
ATOM   6632 C  CG1   . ILE E 1 129 ? 22.984  4.065   27.383  1.00 22.87 ? 129  ILE E CG1   1 
ATOM   6633 C  CG2   . ILE E 1 129 ? 20.583  3.661   28.112  1.00 23.36 ? 129  ILE E CG2   1 
ATOM   6634 C  CD1   . ILE E 1 129 ? 22.648  5.329   26.625  1.00 22.63 ? 129  ILE E CD1   1 
ATOM   6635 N  N     . LEU E 1 130 ? 22.802  0.266   26.398  1.00 22.28 ? 130  LEU E N     1 
ATOM   6636 C  CA    . LEU E 1 130 ? 23.672  -0.516  25.534  1.00 23.77 ? 130  LEU E CA    1 
ATOM   6637 C  C     . LEU E 1 130 ? 23.851  0.140   24.169  1.00 22.81 ? 130  LEU E C     1 
ATOM   6638 O  O     . LEU E 1 130 ? 22.960  0.847   23.689  1.00 23.43 ? 130  LEU E O     1 
ATOM   6639 C  CB    . LEU E 1 130 ? 23.085  -1.922  25.353  1.00 25.33 ? 130  LEU E CB    1 
ATOM   6640 C  CG    . LEU E 1 130 ? 23.867  -2.972  24.558  1.00 26.20 ? 130  LEU E CG    1 
ATOM   6641 C  CD1   . LEU E 1 130 ? 25.134  -3.346  25.312  1.00 25.92 ? 130  LEU E CD1   1 
ATOM   6642 C  CD2   . LEU E 1 130 ? 22.997  -4.207  24.335  1.00 21.95 ? 130  LEU E CD2   1 
ATOM   6643 N  N     . GLY E 1 131 ? 25.030  -0.053  23.578  1.00 21.23 ? 131  GLY E N     1 
ATOM   6644 C  CA    . GLY E 1 131 ? 25.293  0.476   22.252  1.00 21.22 ? 131  GLY E CA    1 
ATOM   6645 C  C     . GLY E 1 131 ? 24.289  -0.217  21.349  1.00 20.74 ? 131  GLY E C     1 
ATOM   6646 O  O     . GLY E 1 131 ? 24.162  -1.436  21.402  1.00 19.93 ? 131  GLY E O     1 
ATOM   6647 N  N     . LEU E 1 132 ? 23.569  0.556   20.542  1.00 22.05 ? 132  LEU E N     1 
ATOM   6648 C  CA    . LEU E 1 132 ? 22.527  0.013   19.670  1.00 22.32 ? 132  LEU E CA    1 
ATOM   6649 C  C     . LEU E 1 132 ? 22.874  -1.242  18.883  1.00 21.72 ? 132  LEU E C     1 
ATOM   6650 O  O     . LEU E 1 132 ? 22.107  -2.206  18.891  1.00 18.26 ? 132  LEU E O     1 
ATOM   6651 C  CB    . LEU E 1 132 ? 21.994  1.091   18.726  1.00 20.62 ? 132  LEU E CB    1 
ATOM   6652 C  CG    . LEU E 1 132 ? 21.353  2.314   19.387  1.00 25.04 ? 132  LEU E CG    1 
ATOM   6653 C  CD1   . LEU E 1 132 ? 20.771  3.208   18.317  1.00 22.46 ? 132  LEU E CD1   1 
ATOM   6654 C  CD2   . LEU E 1 132 ? 20.273  1.899   20.378  1.00 22.85 ? 132  LEU E CD2   1 
ATOM   6655 N  N     . SER E 1 133 ? 24.037  -1.242  18.237  1.00 20.59 ? 133  SER E N     1 
ATOM   6656 C  CA    . SER E 1 133 ? 24.472  -2.379  17.428  1.00 19.93 ? 133  SER E CA    1 
ATOM   6657 C  C     . SER E 1 133 ? 24.680  -3.663  18.219  1.00 18.76 ? 133  SER E C     1 
ATOM   6658 O  O     . SER E 1 133 ? 24.608  -4.755  17.657  1.00 17.45 ? 133  SER E O     1 
ATOM   6659 C  CB    . SER E 1 133 ? 25.768  -2.036  16.689  1.00 23.26 ? 133  SER E CB    1 
ATOM   6660 O  OG    . SER E 1 133 ? 26.845  -1.910  17.604  1.00 23.95 ? 133  SER E OG    1 
ATOM   6661 N  N     . LYS E 1 134 ? 24.951  -3.541  19.517  1.00 17.81 ? 134  LYS E N     1 
ATOM   6662 C  CA    . LYS E 1 134 ? 25.178  -4.728  20.330  1.00 16.69 ? 134  LYS E CA    1 
ATOM   6663 C  C     . LYS E 1 134 ? 23.916  -5.567  20.468  1.00 16.89 ? 134  LYS E C     1 
ATOM   6664 O  O     . LYS E 1 134 ? 23.989  -6.765  20.712  1.00 16.91 ? 134  LYS E O     1 
ATOM   6665 C  CB    . LYS E 1 134 ? 25.764  -4.364  21.700  1.00 19.57 ? 134  LYS E CB    1 
ATOM   6666 C  CG    . LYS E 1 134 ? 27.027  -3.503  21.622  1.00 18.19 ? 134  LYS E CG    1 
ATOM   6667 C  CD    . LYS E 1 134 ? 28.076  -4.088  20.667  1.00 19.23 ? 134  LYS E CD    1 
ATOM   6668 C  CE    . LYS E 1 134 ? 29.306  -3.191  20.587  1.00 20.10 ? 134  LYS E CE    1 
ATOM   6669 N  NZ    . LYS E 1 134 ? 30.341  -3.688  19.638  1.00 21.56 ? 134  LYS E NZ    1 
ATOM   6670 N  N     . PHE E 1 135 ? 22.757  -4.937  20.294  1.00 16.33 ? 135  PHE E N     1 
ATOM   6671 C  CA    . PHE E 1 135 ? 21.492  -5.663  20.364  1.00 16.17 ? 135  PHE E CA    1 
ATOM   6672 C  C     . PHE E 1 135 ? 21.430  -6.641  19.200  1.00 14.44 ? 135  PHE E C     1 
ATOM   6673 O  O     . PHE E 1 135 ? 21.014  -7.790  19.360  1.00 16.40 ? 135  PHE E O     1 
ATOM   6674 C  CB    . PHE E 1 135 ? 20.313  -4.695  20.309  1.00 16.10 ? 135  PHE E CB    1 
ATOM   6675 C  CG    . PHE E 1 135 ? 20.029  -4.026  21.615  1.00 17.43 ? 135  PHE E CG    1 
ATOM   6676 C  CD1   . PHE E 1 135 ? 19.574  -4.768  22.699  1.00 18.32 ? 135  PHE E CD1   1 
ATOM   6677 C  CD2   . PHE E 1 135 ? 20.226  -2.658  21.770  1.00 16.58 ? 135  PHE E CD2   1 
ATOM   6678 C  CE1   . PHE E 1 135 ? 19.320  -4.158  23.924  1.00 21.73 ? 135  PHE E CE1   1 
ATOM   6679 C  CE2   . PHE E 1 135 ? 19.975  -2.042  22.988  1.00 21.03 ? 135  PHE E CE2   1 
ATOM   6680 C  CZ    . PHE E 1 135 ? 19.521  -2.794  24.068  1.00 21.32 ? 135  PHE E CZ    1 
ATOM   6681 N  N     . ALA E 1 136 ? 21.881  -6.180  18.037  1.00 14.45 ? 136  ALA E N     1 
ATOM   6682 C  CA    . ALA E 1 136 ? 21.915  -7.004  16.836  1.00 15.44 ? 136  ALA E CA    1 
ATOM   6683 C  C     . ALA E 1 136 ? 22.950  -8.117  16.990  1.00 15.25 ? 136  ALA E C     1 
ATOM   6684 O  O     . ALA E 1 136 ? 22.735  -9.233  16.538  1.00 12.90 ? 136  ALA E O     1 
ATOM   6685 C  CB    . ALA E 1 136 ? 22.237  -6.146  15.619  1.00 17.05 ? 136  ALA E CB    1 
ATOM   6686 N  N     . ARG E 1 137 ? 24.074  -7.813  17.636  1.00 15.52 ? 137  ARG E N     1 
ATOM   6687 C  CA    . ARG E 1 137 ? 25.104  -8.826  17.835  1.00 16.80 ? 137  ARG E CA    1 
ATOM   6688 C  C     . ARG E 1 137 ? 24.609  -9.922  18.780  1.00 15.59 ? 137  ARG E C     1 
ATOM   6689 O  O     . ARG E 1 137 ? 24.956  -11.096 18.622  1.00 17.73 ? 137  ARG E O     1 
ATOM   6690 C  CB    . ARG E 1 137 ? 26.403  -8.195  18.344  1.00 17.61 ? 137  ARG E CB    1 
ATOM   6691 C  CG    . ARG E 1 137 ? 27.058  -7.275  17.326  1.00 18.21 ? 137  ARG E CG    1 
ATOM   6692 C  CD    . ARG E 1 137 ? 28.456  -6.841  17.738  1.00 23.26 ? 137  ARG E CD    1 
ATOM   6693 N  NE    . ARG E 1 137 ? 29.071  -5.982  16.725  1.00 24.29 ? 137  ARG E NE    1 
ATOM   6694 C  CZ    . ARG E 1 137 ? 29.647  -6.418  15.606  1.00 21.91 ? 137  ARG E CZ    1 
ATOM   6695 N  NH1   . ARG E 1 137 ? 29.705  -7.715  15.335  1.00 24.25 ? 137  ARG E NH1   1 
ATOM   6696 N  NH2   . ARG E 1 137 ? 30.147  -5.547  14.740  1.00 24.00 ? 137  ARG E NH2   1 
ATOM   6697 N  N     . ILE E 1 138 ? 23.792  -9.536  19.754  1.00 14.30 ? 138  ILE E N     1 
ATOM   6698 C  CA    . ILE E 1 138 ? 23.220  -10.491 20.697  1.00 14.78 ? 138  ILE E CA    1 
ATOM   6699 C  C     . ILE E 1 138 ? 22.195  -11.357 19.956  1.00 15.50 ? 138  ILE E C     1 
ATOM   6700 O  O     . ILE E 1 138 ? 22.173  -12.576 20.123  1.00 14.01 ? 138  ILE E O     1 
ATOM   6701 C  CB    . ILE E 1 138 ? 22.556  -9.774  21.895  1.00 15.52 ? 138  ILE E CB    1 
ATOM   6702 C  CG1   . ILE E 1 138 ? 23.641  -9.156  22.787  1.00 18.25 ? 138  ILE E CG1   1 
ATOM   6703 C  CG2   . ILE E 1 138 ? 21.697  -10.750 22.693  1.00 16.97 ? 138  ILE E CG2   1 
ATOM   6704 C  CD1   . ILE E 1 138 ? 23.111  -8.312  23.912  1.00 14.33 ? 138  ILE E CD1   1 
ATOM   6705 N  N     . VAL E 1 139 ? 21.376  -10.723 19.114  1.00 15.86 ? 139  VAL E N     1 
ATOM   6706 C  CA    . VAL E 1 139 ? 20.376  -11.445 18.327  1.00 15.04 ? 139  VAL E CA    1 
ATOM   6707 C  C     . VAL E 1 139 ? 21.090  -12.519 17.496  1.00 12.73 ? 139  VAL E C     1 
ATOM   6708 O  O     . VAL E 1 139 ? 20.732  -13.690 17.559  1.00 16.08 ? 139  VAL E O     1 
ATOM   6709 C  CB    . VAL E 1 139 ? 19.587  -10.495 17.381  1.00 15.08 ? 139  VAL E CB    1 
ATOM   6710 C  CG1   . VAL E 1 139 ? 18.748  -11.303 16.383  1.00 14.16 ? 139  VAL E CG1   1 
ATOM   6711 C  CG2   . VAL E 1 139 ? 18.678  -9.572  18.198  1.00 10.95 ? 139  VAL E CG2   1 
ATOM   6712 N  N     . ASP E 1 140 ? 22.149  -12.122 16.792  1.00 13.60 ? 140  ASP E N     1 
ATOM   6713 C  CA    . ASP E 1 140 ? 22.909  -13.049 15.959  1.00 15.48 ? 140  ASP E CA    1 
ATOM   6714 C  C     . ASP E 1 140 ? 23.564  -14.181 16.749  1.00 13.67 ? 140  ASP E C     1 
ATOM   6715 O  O     . ASP E 1 140 ? 23.657  -15.308 16.267  1.00 14.37 ? 140  ASP E O     1 
ATOM   6716 C  CB    . ASP E 1 140 ? 23.965  -12.299 15.139  1.00 15.49 ? 140  ASP E CB    1 
ATOM   6717 C  CG    . ASP E 1 140 ? 23.358  -11.454 14.026  1.00 18.49 ? 140  ASP E CG    1 
ATOM   6718 O  OD1   . ASP E 1 140 ? 22.173  -11.654 13.686  1.00 16.97 ? 140  ASP E OD1   1 
ATOM   6719 O  OD2   . ASP E 1 140 ? 24.075  -10.595 13.479  1.00 19.54 ? 140  ASP E OD2   1 
ATOM   6720 N  N     . MET E 1 141 ? 24.002  -13.886 17.967  1.00 15.40 ? 141  MET E N     1 
ATOM   6721 C  CA    . MET E 1 141 ? 24.645  -14.892 18.808  1.00 15.74 ? 141  MET E CA    1 
ATOM   6722 C  C     . MET E 1 141 ? 23.712  -16.061 19.117  1.00 17.06 ? 141  MET E C     1 
ATOM   6723 O  O     . MET E 1 141 ? 24.135  -17.219 19.151  1.00 18.17 ? 141  MET E O     1 
ATOM   6724 C  CB    . MET E 1 141 ? 25.119  -14.260 20.121  1.00 17.92 ? 141  MET E CB    1 
ATOM   6725 C  CG    . MET E 1 141 ? 25.757  -15.248 21.083  1.00 20.24 ? 141  MET E CG    1 
ATOM   6726 S  SD    . MET E 1 141 ? 26.337  -14.430 22.571  1.00 22.71 ? 141  MET E SD    1 
ATOM   6727 C  CE    . MET E 1 141 ? 26.431  -15.824 23.711  1.00 24.35 ? 141  MET E CE    1 
ATOM   6728 N  N     . PHE E 1 142 ? 22.441  -15.756 19.351  1.00 14.38 ? 142  PHE E N     1 
ATOM   6729 C  CA    . PHE E 1 142 ? 21.482  -16.794 19.669  1.00 11.54 ? 142  PHE E CA    1 
ATOM   6730 C  C     . PHE E 1 142 ? 20.739  -17.349 18.466  1.00 13.63 ? 142  PHE E C     1 
ATOM   6731 O  O     . PHE E 1 142 ? 20.282  -18.489 18.497  1.00 14.81 ? 142  PHE E O     1 
ATOM   6732 C  CB    . PHE E 1 142 ? 20.539  -16.314 20.769  1.00 13.82 ? 142  PHE E CB    1 
ATOM   6733 C  CG    . PHE E 1 142 ? 21.238  -16.103 22.087  1.00 17.97 ? 142  PHE E CG    1 
ATOM   6734 C  CD1   . PHE E 1 142 ? 21.550  -17.189 22.902  1.00 18.14 ? 142  PHE E CD1   1 
ATOM   6735 C  CD2   . PHE E 1 142 ? 21.652  -14.833 22.474  1.00 14.91 ? 142  PHE E CD2   1 
ATOM   6736 C  CE1   . PHE E 1 142 ? 22.270  -17.010 24.086  1.00 17.03 ? 142  PHE E CE1   1 
ATOM   6737 C  CE2   . PHE E 1 142 ? 22.372  -14.641 23.655  1.00 17.71 ? 142  PHE E CE2   1 
ATOM   6738 C  CZ    . PHE E 1 142 ? 22.683  -15.733 24.461  1.00 19.49 ? 142  PHE E CZ    1 
ATOM   6739 N  N     . ALA E 1 143 ? 20.687  -16.571 17.386  1.00 13.87 ? 143  ALA E N     1 
ATOM   6740 C  CA    . ALA E 1 143 ? 20.009  -17.001 16.161  1.00 13.52 ? 143  ALA E CA    1 
ATOM   6741 C  C     . ALA E 1 143 ? 20.871  -17.971 15.357  1.00 13.85 ? 143  ALA E C     1 
ATOM   6742 O  O     . ALA E 1 143 ? 20.361  -18.909 14.749  1.00 10.96 ? 143  ALA E O     1 
ATOM   6743 C  CB    . ALA E 1 143 ? 19.639  -15.793 15.307  1.00 13.29 ? 143  ALA E CB    1 
ATOM   6744 N  N     . ARG E 1 144 ? 22.182  -17.754 15.371  1.00 14.14 ? 144  ARG E N     1 
ATOM   6745 C  CA    . ARG E 1 144 ? 23.089  -18.623 14.635  1.00 12.35 ? 144  ARG E CA    1 
ATOM   6746 C  C     . ARG E 1 144 ? 23.386  -19.884 15.432  1.00 17.08 ? 144  ARG E C     1 
ATOM   6747 O  O     . ARG E 1 144 ? 24.524  -20.156 15.833  1.00 18.25 ? 144  ARG E O     1 
ATOM   6748 C  CB    . ARG E 1 144 ? 24.349  -17.854 14.241  1.00 14.10 ? 144  ARG E CB    1 
ATOM   6749 C  CG    . ARG E 1 144 ? 24.031  -16.794 13.195  1.00 17.86 ? 144  ARG E CG    1 
ATOM   6750 C  CD    . ARG E 1 144 ? 25.184  -15.875 12.881  1.00 22.80 ? 144  ARG E CD    1 
ATOM   6751 N  NE    . ARG E 1 144 ? 24.785  -14.903 11.861  1.00 23.97 ? 144  ARG E NE    1 
ATOM   6752 C  CZ    . ARG E 1 144 ? 25.415  -13.758 11.614  1.00 23.98 ? 144  ARG E CZ    1 
ATOM   6753 N  NH1   . ARG E 1 144 ? 26.492  -13.419 12.307  1.00 22.30 ? 144  ARG E NH1   1 
ATOM   6754 N  NH2   . ARG E 1 144 ? 24.951  -12.940 10.680  1.00 27.29 ? 144  ARG E NH2   1 
ATOM   6755 N  N     . ARG E 1 145 ? 22.316  -20.646 15.643  1.00 15.49 ? 145  ARG E N     1 
ATOM   6756 C  CA    . ARG E 1 145 ? 22.320  -21.900 16.382  1.00 15.09 ? 145  ARG E CA    1 
ATOM   6757 C  C     . ARG E 1 145 ? 21.110  -22.674 15.875  1.00 18.71 ? 145  ARG E C     1 
ATOM   6758 O  O     . ARG E 1 145 ? 20.388  -22.194 14.999  1.00 19.02 ? 145  ARG E O     1 
ATOM   6759 C  CB    . ARG E 1 145 ? 22.086  -21.637 17.879  1.00 13.87 ? 145  ARG E CB    1 
ATOM   6760 C  CG    . ARG E 1 145 ? 23.145  -20.801 18.572  1.00 15.44 ? 145  ARG E CG    1 
ATOM   6761 C  CD    . ARG E 1 145 ? 22.818  -20.609 20.051  1.00 15.69 ? 145  ARG E CD    1 
ATOM   6762 N  NE    . ARG E 1 145 ? 23.798  -19.746 20.698  1.00 16.95 ? 145  ARG E NE    1 
ATOM   6763 C  CZ    . ARG E 1 145 ? 24.021  -19.706 22.010  1.00 18.67 ? 145  ARG E CZ    1 
ATOM   6764 N  NH1   . ARG E 1 145 ? 23.326  -20.480 22.833  1.00 19.27 ? 145  ARG E NH1   1 
ATOM   6765 N  NH2   . ARG E 1 145 ? 24.968  -18.910 22.494  1.00 20.01 ? 145  ARG E NH2   1 
ATOM   6766 N  N     . LEU E 1 146 ? 20.929  -23.894 16.374  1.00 15.63 ? 146  LEU E N     1 
ATOM   6767 C  CA    . LEU E 1 146 ? 19.745  -24.667 16.036  1.00 15.45 ? 146  LEU E CA    1 
ATOM   6768 C  C     . LEU E 1 146 ? 18.782  -24.144 17.103  1.00 17.74 ? 146  LEU E C     1 
ATOM   6769 O  O     . LEU E 1 146 ? 19.114  -24.126 18.293  1.00 18.94 ? 146  LEU E O     1 
ATOM   6770 C  CB    . LEU E 1 146 ? 19.989  -26.167 16.195  1.00 16.96 ? 146  LEU E CB    1 
ATOM   6771 C  CG    . LEU E 1 146 ? 21.032  -26.811 15.276  1.00 14.92 ? 146  LEU E CG    1 
ATOM   6772 C  CD1   . LEU E 1 146 ? 20.892  -28.323 15.390  1.00 17.50 ? 146  LEU E CD1   1 
ATOM   6773 C  CD2   . LEU E 1 146 ? 20.832  -26.379 13.820  1.00 14.18 ? 146  LEU E CD2   1 
ATOM   6774 N  N     . GLN E 1 147 ? 17.608  -23.686 16.686  1.00 14.10 ? 147  GLN E N     1 
ATOM   6775 C  CA    . GLN E 1 147 ? 16.675  -23.094 17.629  1.00 12.15 ? 147  GLN E CA    1 
ATOM   6776 C  C     . GLN E 1 147 ? 15.213  -23.519 17.584  1.00 14.33 ? 147  GLN E C     1 
ATOM   6777 O  O     . GLN E 1 147 ? 14.781  -24.317 16.750  1.00 12.05 ? 147  GLN E O     1 
ATOM   6778 C  CB    . GLN E 1 147 ? 16.713  -21.568 17.463  1.00 14.36 ? 147  GLN E CB    1 
ATOM   6779 C  CG    . GLN E 1 147 ? 17.879  -20.855 18.136  1.00 16.19 ? 147  GLN E CG    1 
ATOM   6780 C  CD    . GLN E 1 147 ? 17.672  -20.698 19.632  1.00 12.81 ? 147  GLN E CD    1 
ATOM   6781 O  OE1   . GLN E 1 147 ? 16.716  -21.229 20.193  1.00 15.52 ? 147  GLN E OE1   1 
ATOM   6782 N  NE2   . GLN E 1 147 ? 18.551  -19.937 20.280  1.00 16.06 ? 147  GLN E NE2   1 
ATOM   6783 N  N     . VAL E 1 148 ? 14.479  -22.934 18.525  1.00 15.68 ? 148  VAL E N     1 
ATOM   6784 C  CA    . VAL E 1 148 ? 13.037  -23.061 18.708  1.00 18.05 ? 148  VAL E CA    1 
ATOM   6785 C  C     . VAL E 1 148 ? 12.724  -21.571 18.900  1.00 18.16 ? 148  VAL E C     1 
ATOM   6786 O  O     . VAL E 1 148 ? 13.326  -20.935 19.765  1.00 16.70 ? 148  VAL E O     1 
ATOM   6787 C  CB    . VAL E 1 148 ? 12.696  -23.818 20.013  1.00 21.82 ? 148  VAL E CB    1 
ATOM   6788 C  CG1   . VAL E 1 148 ? 11.208  -23.791 20.265  1.00 24.09 ? 148  VAL E CG1   1 
ATOM   6789 C  CG2   . VAL E 1 148 ? 13.180  -25.260 19.929  1.00 25.47 ? 148  VAL E CG2   1 
ATOM   6790 N  N     . GLN E 1 149 ? 11.818  -21.001 18.103  1.00 17.40 ? 149  GLN E N     1 
ATOM   6791 C  CA    . GLN E 1 149 ? 11.532  -19.567 18.223  1.00 13.99 ? 149  GLN E CA    1 
ATOM   6792 C  C     . GLN E 1 149 ? 11.175  -19.100 19.638  1.00 14.46 ? 149  GLN E C     1 
ATOM   6793 O  O     . GLN E 1 149 ? 11.514  -17.982 20.038  1.00 15.40 ? 149  GLN E O     1 
ATOM   6794 C  CB    . GLN E 1 149 ? 10.463  -19.110 17.224  1.00 14.45 ? 149  GLN E CB    1 
ATOM   6795 C  CG    . GLN E 1 149 ? 10.446  -17.595 17.071  1.00 13.41 ? 149  GLN E CG    1 
ATOM   6796 C  CD    . GLN E 1 149 ? 9.391   -17.087 16.109  1.00 16.66 ? 149  GLN E CD    1 
ATOM   6797 O  OE1   . GLN E 1 149 ? 9.243   -17.600 15.000  1.00 15.33 ? 149  GLN E OE1   1 
ATOM   6798 N  NE2   . GLN E 1 149 ? 8.666   -16.056 16.523  1.00 12.19 ? 149  GLN E NE2   1 
ATOM   6799 N  N     . GLU E 1 150 ? 10.512  -19.967 20.396  1.00 13.79 ? 150  GLU E N     1 
ATOM   6800 C  CA    . GLU E 1 150 ? 10.124  -19.656 21.767  1.00 15.77 ? 150  GLU E CA    1 
ATOM   6801 C  C     . GLU E 1 150 ? 11.347  -19.465 22.663  1.00 17.33 ? 150  GLU E C     1 
ATOM   6802 O  O     . GLU E 1 150 ? 11.340  -18.629 23.566  1.00 15.68 ? 150  GLU E O     1 
ATOM   6803 C  CB    . GLU E 1 150 ? 9.224   -20.760 22.329  1.00 15.42 ? 150  GLU E CB    1 
ATOM   6804 C  CG    . GLU E 1 150 ? 7.834   -20.831 21.691  1.00 18.62 ? 150  GLU E CG    1 
ATOM   6805 C  CD    . GLU E 1 150 ? 7.756   -21.692 20.427  1.00 20.64 ? 150  GLU E CD    1 
ATOM   6806 O  OE1   . GLU E 1 150 ? 8.771   -21.872 19.720  1.00 19.53 ? 150  GLU E OE1   1 
ATOM   6807 O  OE2   . GLU E 1 150 ? 6.648   -22.191 20.137  1.00 21.94 ? 150  GLU E OE2   1 
ATOM   6808 N  N     . ARG E 1 151 ? 12.387  -20.256 22.413  1.00 16.97 ? 151  ARG E N     1 
ATOM   6809 C  CA    . ARG E 1 151 ? 13.629  -20.178 23.179  1.00 15.22 ? 151  ARG E CA    1 
ATOM   6810 C  C     . ARG E 1 151 ? 14.437  -18.946 22.790  1.00 16.32 ? 151  ARG E C     1 
ATOM   6811 O  O     . ARG E 1 151 ? 14.996  -18.262 23.646  1.00 16.61 ? 151  ARG E O     1 
ATOM   6812 C  CB    . ARG E 1 151 ? 14.475  -21.428 22.927  1.00 18.56 ? 151  ARG E CB    1 
ATOM   6813 C  CG    . ARG E 1 151 ? 15.796  -21.474 23.696  1.00 21.82 ? 151  ARG E CG    1 
ATOM   6814 C  CD    . ARG E 1 151 ? 16.631  -22.683 23.275  1.00 18.96 ? 151  ARG E CD    1 
ATOM   6815 N  NE    . ARG E 1 151 ? 15.861  -23.915 23.391  1.00 22.64 ? 151  ARG E NE    1 
ATOM   6816 C  CZ    . ARG E 1 151 ? 15.912  -24.923 22.528  1.00 19.76 ? 151  ARG E CZ    1 
ATOM   6817 N  NH1   . ARG E 1 151 ? 16.709  -24.865 21.471  1.00 20.10 ? 151  ARG E NH1   1 
ATOM   6818 N  NH2   . ARG E 1 151 ? 15.126  -25.974 22.704  1.00 24.29 ? 151  ARG E NH2   1 
ATOM   6819 N  N     . LEU E 1 152 ? 14.487  -18.665 21.490  1.00 14.55 ? 152  LEU E N     1 
ATOM   6820 C  CA    . LEU E 1 152 ? 15.234  -17.529 20.965  1.00 13.71 ? 152  LEU E CA    1 
ATOM   6821 C  C     . LEU E 1 152 ? 14.859  -16.214 21.638  1.00 14.08 ? 152  LEU E C     1 
ATOM   6822 O  O     . LEU E 1 152 ? 15.738  -15.433 22.005  1.00 15.38 ? 152  LEU E O     1 
ATOM   6823 C  CB    . LEU E 1 152 ? 15.029  -17.419 19.450  1.00 12.84 ? 152  LEU E CB    1 
ATOM   6824 C  CG    . LEU E 1 152 ? 15.808  -16.340 18.705  1.00 13.16 ? 152  LEU E CG    1 
ATOM   6825 C  CD1   . LEU E 1 152 ? 17.310  -16.512 18.935  1.00 12.95 ? 152  LEU E CD1   1 
ATOM   6826 C  CD2   . LEU E 1 152 ? 15.475  -16.421 17.221  1.00 13.04 ? 152  LEU E CD2   1 
ATOM   6827 N  N     . ALA E 1 153 ? 13.559  -15.998 21.832  1.00 12.83 ? 153  ALA E N     1 
ATOM   6828 C  CA    . ALA E 1 153 ? 13.058  -14.776 22.460  1.00 12.47 ? 153  ALA E CA    1 
ATOM   6829 C  C     . ALA E 1 153 ? 13.554  -14.658 23.901  1.00 15.86 ? 153  ALA E C     1 
ATOM   6830 O  O     . ALA E 1 153 ? 14.045  -13.602 24.316  1.00 15.12 ? 153  ALA E O     1 
ATOM   6831 C  CB    . ALA E 1 153 ? 11.524  -14.759 22.428  1.00 16.26 ? 153  ALA E CB    1 
ATOM   6832 N  N     . VAL E 1 154 ? 13.443  -15.759 24.642  1.00 15.46 ? 154  VAL E N     1 
ATOM   6833 C  CA    . VAL E 1 154 ? 13.865  -15.816 26.037  1.00 16.13 ? 154  VAL E CA    1 
ATOM   6834 C  C     . VAL E 1 154 ? 15.374  -15.600 26.198  1.00 15.79 ? 154  VAL E C     1 
ATOM   6835 O  O     . VAL E 1 154 ? 15.804  -14.781 27.013  1.00 16.21 ? 154  VAL E O     1 
ATOM   6836 C  CB    . VAL E 1 154 ? 13.475  -17.166 26.689  1.00 18.37 ? 154  VAL E CB    1 
ATOM   6837 C  CG1   . VAL E 1 154 ? 13.931  -17.203 28.145  1.00 22.27 ? 154  VAL E CG1   1 
ATOM   6838 C  CG2   . VAL E 1 154 ? 11.969  -17.380 26.611  1.00 19.81 ? 154  VAL E CG2   1 
ATOM   6839 N  N     . GLN E 1 155 ? 16.174  -16.301 25.398  1.00 16.70 ? 155  GLN E N     1 
ATOM   6840 C  CA    . GLN E 1 155 ? 17.624  -16.167 25.496  1.00 17.73 ? 155  GLN E CA    1 
ATOM   6841 C  C     . GLN E 1 155 ? 18.121  -14.758 25.202  1.00 17.21 ? 155  GLN E C     1 
ATOM   6842 O  O     . GLN E 1 155 ? 19.041  -14.279 25.865  1.00 16.01 ? 155  GLN E O     1 
ATOM   6843 C  CB    . GLN E 1 155 ? 18.335  -17.195 24.618  1.00 19.65 ? 155  GLN E CB    1 
ATOM   6844 C  CG    . GLN E 1 155 ? 18.051  -18.631 25.028  1.00 19.96 ? 155  GLN E CG    1 
ATOM   6845 C  CD    . GLN E 1 155 ? 18.902  -19.634 24.279  1.00 22.63 ? 155  GLN E CD    1 
ATOM   6846 O  OE1   . GLN E 1 155 ? 18.935  -19.644 23.049  1.00 23.15 ? 155  GLN E OE1   1 
ATOM   6847 N  NE2   . GLN E 1 155 ? 19.606  -20.482 25.022  1.00 28.36 ? 155  GLN E NE2   1 
ATOM   6848 N  N     . ILE E 1 156 ? 17.514  -14.091 24.220  1.00 15.51 ? 156  ILE E N     1 
ATOM   6849 C  CA    . ILE E 1 156 ? 17.903  -12.722 23.882  1.00 14.95 ? 156  ILE E CA    1 
ATOM   6850 C  C     . ILE E 1 156 ? 17.572  -11.797 25.048  1.00 16.11 ? 156  ILE E C     1 
ATOM   6851 O  O     . ILE E 1 156 ? 18.404  -10.999 25.470  1.00 15.52 ? 156  ILE E O     1 
ATOM   6852 C  CB    . ILE E 1 156 ? 17.184  -12.204 22.603  1.00 17.36 ? 156  ILE E CB    1 
ATOM   6853 C  CG1   . ILE E 1 156 ? 17.665  -12.992 21.381  1.00 19.05 ? 156  ILE E CG1   1 
ATOM   6854 C  CG2   . ILE E 1 156 ? 17.460  -10.708 22.401  1.00 15.61 ? 156  ILE E CG2   1 
ATOM   6855 C  CD1   . ILE E 1 156 ? 16.926  -12.664 20.099  1.00 17.10 ? 156  ILE E CD1   1 
ATOM   6856 N  N     . ALA E 1 157 ? 16.358  -11.929 25.575  1.00 17.20 ? 157  ALA E N     1 
ATOM   6857 C  CA    . ALA E 1 157 ? 15.914  -11.112 26.698  1.00 17.37 ? 157  ALA E CA    1 
ATOM   6858 C  C     . ALA E 1 157 ? 16.813  -11.299 27.921  1.00 18.23 ? 157  ALA E C     1 
ATOM   6859 O  O     . ALA E 1 157 ? 17.235  -10.318 28.541  1.00 17.98 ? 157  ALA E O     1 
ATOM   6860 C  CB    . ALA E 1 157 ? 14.474  -11.439 27.050  1.00 15.77 ? 157  ALA E CB    1 
ATOM   6861 N  N     . GLU E 1 158 ? 17.141  -12.553 28.233  1.00 18.73 ? 158  GLU E N     1 
ATOM   6862 C  CA    . GLU E 1 158 ? 17.989  -12.860 29.386  1.00 22.29 ? 158  GLU E CA    1 
ATOM   6863 C  C     . GLU E 1 158 ? 19.410  -12.337 29.224  1.00 20.23 ? 158  GLU E C     1 
ATOM   6864 O  O     . GLU E 1 158 ? 20.049  -11.952 30.204  1.00 19.01 ? 158  GLU E O     1 
ATOM   6865 C  CB    . GLU E 1 158 ? 17.994  -14.365 29.676  1.00 21.34 ? 158  GLU E CB    1 
ATOM   6866 C  CG    . GLU E 1 158 ? 16.641  -14.897 30.163  1.00 27.70 ? 158  GLU E CG    1 
ATOM   6867 C  CD    . GLU E 1 158 ? 16.662  -16.380 30.519  1.00 32.08 ? 158  GLU E CD    1 
ATOM   6868 O  OE1   . GLU E 1 158 ? 17.572  -17.108 30.062  1.00 37.36 ? 158  GLU E OE1   1 
ATOM   6869 O  OE2   . GLU E 1 158 ? 15.753  -16.820 31.252  1.00 33.02 ? 158  GLU E OE2   1 
ATOM   6870 N  N     . ALA E 1 159 ? 19.894  -12.305 27.985  1.00 17.30 ? 159  ALA E N     1 
ATOM   6871 C  CA    . ALA E 1 159 ? 21.232  -11.803 27.704  1.00 18.19 ? 159  ALA E CA    1 
ATOM   6872 C  C     . ALA E 1 159 ? 21.276  -10.297 27.960  1.00 20.80 ? 159  ALA E C     1 
ATOM   6873 O  O     . ALA E 1 159 ? 22.210  -9.791  28.586  1.00 20.73 ? 159  ALA E O     1 
ATOM   6874 C  CB    . ALA E 1 159 ? 21.624  -12.111 26.261  1.00 15.90 ? 159  ALA E CB    1 
ATOM   6875 N  N     . ILE E 1 160 ? 20.251  -9.585  27.492  1.00 18.48 ? 160  ILE E N     1 
ATOM   6876 C  CA    . ILE E 1 160 ? 20.180  -8.138  27.679  1.00 18.30 ? 160  ILE E CA    1 
ATOM   6877 C  C     . ILE E 1 160 ? 20.031  -7.829  29.168  1.00 20.42 ? 160  ILE E C     1 
ATOM   6878 O  O     . ILE E 1 160 ? 20.591  -6.849  29.674  1.00 16.70 ? 160  ILE E O     1 
ATOM   6879 C  CB    . ILE E 1 160 ? 19.003  -7.528  26.892  1.00 17.37 ? 160  ILE E CB    1 
ATOM   6880 C  CG1   . ILE E 1 160 ? 19.262  -7.673  25.386  1.00 17.47 ? 160  ILE E CG1   1 
ATOM   6881 C  CG2   . ILE E 1 160 ? 18.819  -6.059  27.266  1.00 15.88 ? 160  ILE E CG2   1 
ATOM   6882 C  CD1   . ILE E 1 160 ? 18.040  -7.460  24.535  1.00 17.27 ? 160  ILE E CD1   1 
ATOM   6883 N  N     . GLN E 1 161 ? 19.295  -8.691  29.864  1.00 20.30 ? 161  GLN E N     1 
ATOM   6884 C  CA    . GLN E 1 161 ? 19.074  -8.546  31.300  1.00 23.91 ? 161  GLN E CA    1 
ATOM   6885 C  C     . GLN E 1 161 ? 20.398  -8.665  32.061  1.00 24.87 ? 161  GLN E C     1 
ATOM   6886 O  O     . GLN E 1 161 ? 20.684  -7.878  32.968  1.00 23.13 ? 161  GLN E O     1 
ATOM   6887 C  CB    . GLN E 1 161 ? 18.101  -9.626  31.784  1.00 26.55 ? 161  GLN E CB    1 
ATOM   6888 C  CG    . GLN E 1 161 ? 17.796  -9.584  33.281  1.00 32.62 ? 161  GLN E CG    1 
ATOM   6889 C  CD    . GLN E 1 161 ? 17.160  -8.277  33.711  1.00 34.65 ? 161  GLN E CD    1 
ATOM   6890 O  OE1   . GLN E 1 161 ? 17.464  -7.744  34.781  1.00 40.41 ? 161  GLN E OE1   1 
ATOM   6891 N  NE2   . GLN E 1 161 ? 16.273  -7.751  32.877  1.00 34.75 ? 161  GLN E NE2   1 
ATOM   6892 N  N     . GLU E 1 162 ? 21.201  -9.651  31.674  1.00 23.07 ? 162  GLU E N     1 
ATOM   6893 C  CA    . GLU E 1 162 ? 22.491  -9.902  32.308  1.00 27.21 ? 162  GLU E CA    1 
ATOM   6894 C  C     . GLU E 1 162 ? 23.496  -8.778  32.064  1.00 27.30 ? 162  GLU E C     1 
ATOM   6895 O  O     . GLU E 1 162 ? 24.264  -8.413  32.959  1.00 26.00 ? 162  GLU E O     1 
ATOM   6896 C  CB    . GLU E 1 162 ? 23.060  -11.229 31.805  1.00 29.21 ? 162  GLU E CB    1 
ATOM   6897 C  CG    . GLU E 1 162 ? 24.385  -11.631 32.440  1.00 38.80 ? 162  GLU E CG    1 
ATOM   6898 C  CD    . GLU E 1 162 ? 24.939  -12.926 31.874  1.00 41.40 ? 162  GLU E CD    1 
ATOM   6899 O  OE1   . GLU E 1 162 ? 26.179  -13.061 31.813  1.00 46.35 ? 162  GLU E OE1   1 
ATOM   6900 O  OE2   . GLU E 1 162 ? 24.141  -13.810 31.489  1.00 46.75 ? 162  GLU E OE2   1 
ATOM   6901 N  N     . VAL E 1 163 ? 23.459  -8.208  30.864  1.00 23.88 ? 163  VAL E N     1 
ATOM   6902 C  CA    . VAL E 1 163 ? 24.375  -7.139  30.478  1.00 25.80 ? 163  VAL E CA    1 
ATOM   6903 C  C     . VAL E 1 163 ? 24.066  -5.760  31.059  1.00 25.78 ? 163  VAL E C     1 
ATOM   6904 O  O     . VAL E 1 163 ? 24.978  -5.037  31.473  1.00 23.93 ? 163  VAL E O     1 
ATOM   6905 C  CB    . VAL E 1 163 ? 24.471  -7.035  28.928  1.00 28.09 ? 163  VAL E CB    1 
ATOM   6906 C  CG1   . VAL E 1 163 ? 25.233  -5.780  28.505  1.00 29.94 ? 163  VAL E CG1   1 
ATOM   6907 C  CG2   . VAL E 1 163 ? 25.154  -8.271  28.372  1.00 27.31 ? 163  VAL E CG2   1 
ATOM   6908 N  N     . LEU E 1 164 ? 22.789  -5.396  31.103  1.00 22.90 ? 164  LEU E N     1 
ATOM   6909 C  CA    . LEU E 1 164 ? 22.409  -4.079  31.596  1.00 25.04 ? 164  LEU E CA    1 
ATOM   6910 C  C     . LEU E 1 164 ? 21.718  -4.008  32.947  1.00 24.00 ? 164  LEU E C     1 
ATOM   6911 O  O     . LEU E 1 164 ? 21.683  -2.939  33.550  1.00 25.70 ? 164  LEU E O     1 
ATOM   6912 C  CB    . LEU E 1 164 ? 21.509  -3.379  30.579  1.00 25.35 ? 164  LEU E CB    1 
ATOM   6913 C  CG    . LEU E 1 164 ? 22.014  -3.168  29.157  1.00 25.51 ? 164  LEU E CG    1 
ATOM   6914 C  CD1   . LEU E 1 164 ? 20.883  -2.572  28.338  1.00 26.28 ? 164  LEU E CD1   1 
ATOM   6915 C  CD2   . LEU E 1 164 ? 23.234  -2.257  29.150  1.00 24.56 ? 164  LEU E CD2   1 
ATOM   6916 N  N     . GLU E 1 165 ? 21.162  -5.124  33.414  1.00 26.28 ? 165  GLU E N     1 
ATOM   6917 C  CA    . GLU E 1 165 ? 20.420  -5.142  34.679  1.00 26.53 ? 165  GLU E CA    1 
ATOM   6918 C  C     . GLU E 1 165 ? 19.450  -3.955  34.663  1.00 25.29 ? 165  GLU E C     1 
ATOM   6919 O  O     . GLU E 1 165 ? 19.437  -3.126  35.576  1.00 23.39 ? 165  GLU E O     1 
ATOM   6920 C  CB    . GLU E 1 165 ? 21.376  -5.050  35.877  1.00 30.66 ? 165  GLU E CB    1 
ATOM   6921 C  CG    . GLU E 1 165 ? 22.197  -6.314  36.117  1.00 37.06 ? 165  GLU E CG    1 
ATOM   6922 C  CD    . GLU E 1 165 ? 23.209  -6.168  37.250  1.00 41.47 ? 165  GLU E CD    1 
ATOM   6923 O  OE1   . GLU E 1 165 ? 24.284  -6.797  37.165  1.00 45.09 ? 165  GLU E OE1   1 
ATOM   6924 O  OE2   . GLU E 1 165 ? 22.935  -5.434  38.224  1.00 45.04 ? 165  GLU E OE2   1 
ATOM   6925 N  N     . PRO E 1 166 ? 18.647  -3.837  33.589  1.00 21.95 ? 166  PRO E N     1 
ATOM   6926 C  CA    . PRO E 1 166 ? 17.691  -2.736  33.469  1.00 20.53 ? 166  PRO E CA    1 
ATOM   6927 C  C     . PRO E 1 166 ? 16.464  -2.956  34.342  1.00 19.55 ? 166  PRO E C     1 
ATOM   6928 O  O     . PRO E 1 166 ? 16.320  -4.007  34.977  1.00 19.97 ? 166  PRO E O     1 
ATOM   6929 C  CB    . PRO E 1 166 ? 17.333  -2.781  31.989  1.00 22.71 ? 166  PRO E CB    1 
ATOM   6930 C  CG    . PRO E 1 166 ? 17.264  -4.230  31.739  1.00 20.77 ? 166  PRO E CG    1 
ATOM   6931 C  CD    . PRO E 1 166 ? 18.481  -4.785  32.469  1.00 23.31 ? 166  PRO E CD    1 
ATOM   6932 N  N     . GLN E 1 167 ? 15.585  -1.961  34.386  1.00 18.93 ? 167  GLN E N     1 
ATOM   6933 C  CA    . GLN E 1 167 ? 14.366  -2.085  35.178  1.00 18.58 ? 167  GLN E CA    1 
ATOM   6934 C  C     . GLN E 1 167 ? 13.497  -3.170  34.550  1.00 19.24 ? 167  GLN E C     1 
ATOM   6935 O  O     . GLN E 1 167 ? 12.786  -3.891  35.250  1.00 15.54 ? 167  GLN E O     1 
ATOM   6936 C  CB    . GLN E 1 167 ? 13.607  -0.761  35.224  1.00 23.06 ? 167  GLN E CB    1 
ATOM   6937 C  CG    . GLN E 1 167 ? 14.315  0.325   36.016  1.00 28.00 ? 167  GLN E CG    1 
ATOM   6938 C  CD    . GLN E 1 167 ? 13.441  1.540   36.239  1.00 32.33 ? 167  GLN E CD    1 
ATOM   6939 O  OE1   . GLN E 1 167 ? 13.827  2.666   35.918  1.00 37.30 ? 167  GLN E OE1   1 
ATOM   6940 N  NE2   . GLN E 1 167 ? 12.252  1.319   36.792  1.00 34.41 ? 167  GLN E NE2   1 
ATOM   6941 N  N     . GLY E 1 168 ? 13.600  -3.297  33.228  1.00 14.66 ? 168  GLY E N     1 
ATOM   6942 C  CA    . GLY E 1 168 ? 12.837  -4.302  32.510  1.00 13.71 ? 168  GLY E CA    1 
ATOM   6943 C  C     . GLY E 1 168 ? 13.300  -4.420  31.071  1.00 13.39 ? 168  GLY E C     1 
ATOM   6944 O  O     . GLY E 1 168 ? 13.953  -3.512  30.550  1.00 15.40 ? 168  GLY E O     1 
ATOM   6945 N  N     . VAL E 1 169 ? 12.992  -5.556  30.449  1.00 14.62 ? 169  VAL E N     1 
ATOM   6946 C  CA    . VAL E 1 169 ? 13.345  -5.831  29.054  1.00 14.25 ? 169  VAL E CA    1 
ATOM   6947 C  C     . VAL E 1 169 ? 12.200  -6.611  28.426  1.00 14.29 ? 169  VAL E C     1 
ATOM   6948 O  O     . VAL E 1 169 ? 11.583  -7.448  29.079  1.00 17.77 ? 169  VAL E O     1 
ATOM   6949 C  CB    . VAL E 1 169 ? 14.598  -6.752  28.913  1.00 18.44 ? 169  VAL E CB    1 
ATOM   6950 C  CG1   . VAL E 1 169 ? 14.966  -6.913  27.436  1.00 16.81 ? 169  VAL E CG1   1 
ATOM   6951 C  CG2   . VAL E 1 169 ? 15.770  -6.206  29.671  1.00 26.97 ? 169  VAL E CG2   1 
ATOM   6952 N  N     . GLY E 1 170 ? 11.942  -6.344  27.150  1.00 15.62 ? 170  GLY E N     1 
ATOM   6953 C  CA    . GLY E 1 170 ? 10.904  -7.048  26.428  1.00 12.29 ? 170  GLY E CA    1 
ATOM   6954 C  C     . GLY E 1 170 ? 11.459  -7.361  25.052  1.00 14.73 ? 170  GLY E C     1 
ATOM   6955 O  O     . GLY E 1 170 ? 12.073  -6.498  24.423  1.00 12.78 ? 170  GLY E O     1 
ATOM   6956 N  N     . VAL E 1 171 ? 11.295  -8.607  24.612  1.00 14.86 ? 171  VAL E N     1 
ATOM   6957 C  CA    . VAL E 1 171 ? 11.781  -9.034  23.302  1.00 13.14 ? 171  VAL E CA    1 
ATOM   6958 C  C     . VAL E 1 171 ? 10.659  -9.753  22.572  1.00 15.99 ? 171  VAL E C     1 
ATOM   6959 O  O     . VAL E 1 171 ? 10.035  -10.656 23.124  1.00 16.32 ? 171  VAL E O     1 
ATOM   6960 C  CB    . VAL E 1 171 ? 12.974  -10.022 23.424  1.00 14.34 ? 171  VAL E CB    1 
ATOM   6961 C  CG1   . VAL E 1 171 ? 13.410  -10.498 22.045  1.00 15.62 ? 171  VAL E CG1   1 
ATOM   6962 C  CG2   . VAL E 1 171 ? 14.150  -9.362  24.134  1.00 13.85 ? 171  VAL E CG2   1 
ATOM   6963 N  N     . VAL E 1 172 ? 10.408  -9.342  21.333  1.00 14.50 ? 172  VAL E N     1 
ATOM   6964 C  CA    . VAL E 1 172 ? 9.378   -9.956  20.505  1.00 13.68 ? 172  VAL E CA    1 
ATOM   6965 C  C     . VAL E 1 172 ? 10.063  -10.471 19.239  1.00 12.44 ? 172  VAL E C     1 
ATOM   6966 O  O     . VAL E 1 172 ? 10.854  -9.760  18.628  1.00 11.58 ? 172  VAL E O     1 
ATOM   6967 C  CB    . VAL E 1 172 ? 8.295   -8.923  20.106  1.00 13.43 ? 172  VAL E CB    1 
ATOM   6968 C  CG1   . VAL E 1 172 ? 7.322   -9.531  19.089  1.00 13.36 ? 172  VAL E CG1   1 
ATOM   6969 C  CG2   . VAL E 1 172 ? 7.534   -8.450  21.347  1.00 13.84 ? 172  VAL E CG2   1 
ATOM   6970 N  N     . VAL E 1 173 ? 9.830   -11.738 18.909  1.00 11.49 ? 173  VAL E N     1 
ATOM   6971 C  CA    . VAL E 1 173 ? 10.412  -12.332 17.708  1.00 10.52 ? 173  VAL E CA    1 
ATOM   6972 C  C     . VAL E 1 173 ? 9.251   -12.710 16.801  1.00 12.30 ? 173  VAL E C     1 
ATOM   6973 O  O     . VAL E 1 173 ? 8.281   -13.304 17.255  1.00 11.58 ? 173  VAL E O     1 
ATOM   6974 C  CB    . VAL E 1 173 ? 11.221  -13.614 18.033  1.00 10.93 ? 173  VAL E CB    1 
ATOM   6975 C  CG1   . VAL E 1 173 ? 11.797  -14.220 16.756  1.00 11.33 ? 173  VAL E CG1   1 
ATOM   6976 C  CG2   . VAL E 1 173 ? 12.331  -13.304 19.016  1.00 12.26 ? 173  VAL E CG2   1 
ATOM   6977 N  N     . GLU E 1 174 ? 9.318   -12.302 15.537  1.00 12.71 ? 174  GLU E N     1 
ATOM   6978 C  CA    . GLU E 1 174 ? 8.264   -12.637 14.590  1.00 9.90  ? 174  GLU E CA    1 
ATOM   6979 C  C     . GLU E 1 174 ? 8.955   -13.264 13.392  1.00 12.42 ? 174  GLU E C     1 
ATOM   6980 O  O     . GLU E 1 174 ? 9.838   -12.652 12.797  1.00 9.59  ? 174  GLU E O     1 
ATOM   6981 C  CB    . GLU E 1 174 ? 7.488   -11.388 14.168  1.00 13.88 ? 174  GLU E CB    1 
ATOM   6982 C  CG    . GLU E 1 174 ? 6.432   -11.662 13.114  1.00 18.47 ? 174  GLU E CG    1 
ATOM   6983 C  CD    . GLU E 1 174 ? 5.314   -10.639 13.123  1.00 22.15 ? 174  GLU E CD    1 
ATOM   6984 O  OE1   . GLU E 1 174 ? 5.592   -9.429  13.239  1.00 19.52 ? 174  GLU E OE1   1 
ATOM   6985 O  OE2   . GLU E 1 174 ? 4.146   -11.057 13.020  1.00 23.35 ? 174  GLU E OE2   1 
ATOM   6986 N  N     . GLY E 1 175 ? 8.576   -14.491 13.055  1.00 10.97 ? 175  GLY E N     1 
ATOM   6987 C  CA    . GLY E 1 175 ? 9.236   -15.132 11.940  1.00 13.19 ? 175  GLY E CA    1 
ATOM   6988 C  C     . GLY E 1 175 ? 8.405   -16.085 11.113  1.00 12.49 ? 175  GLY E C     1 
ATOM   6989 O  O     . GLY E 1 175 ? 7.303   -16.473 11.494  1.00 12.80 ? 175  GLY E O     1 
ATOM   6990 N  N     . VAL E 1 176 ? 8.934   -16.397 9.936   1.00 11.51 ? 176  VAL E N     1 
ATOM   6991 C  CA    . VAL E 1 176 ? 8.302   -17.333 9.022   1.00 15.12 ? 176  VAL E CA    1 
ATOM   6992 C  C     . VAL E 1 176 ? 9.182   -18.572 9.057   1.00 12.88 ? 176  VAL E C     1 
ATOM   6993 O  O     . VAL E 1 176 ? 10.410  -18.471 9.169   1.00 13.93 ? 176  VAL E O     1 
ATOM   6994 C  CB    . VAL E 1 176 ? 8.185   -16.768 7.591   1.00 16.83 ? 176  VAL E CB    1 
ATOM   6995 C  CG1   . VAL E 1 176 ? 7.289   -15.540 7.593   1.00 22.52 ? 176  VAL E CG1   1 
ATOM   6996 C  CG2   . VAL E 1 176 ? 9.540   -16.439 7.025   1.00 16.85 ? 176  VAL E CG2   1 
ATOM   6997 N  N     . HIS E 1 177 ? 8.555   -19.739 8.981   1.00 13.16 ? 177  HIS E N     1 
ATOM   6998 C  CA    . HIS E 1 177 ? 9.287   -20.995 9.069   1.00 13.69 ? 177  HIS E CA    1 
ATOM   6999 C  C     . HIS E 1 177 ? 9.210   -21.804 7.793   1.00 12.56 ? 177  HIS E C     1 
ATOM   7000 O  O     . HIS E 1 177 ? 8.139   -22.269 7.413   1.00 14.33 ? 177  HIS E O     1 
ATOM   7001 C  CB    . HIS E 1 177 ? 8.741   -21.803 10.246  1.00 18.03 ? 177  HIS E CB    1 
ATOM   7002 C  CG    . HIS E 1 177 ? 8.843   -21.085 11.557  1.00 18.24 ? 177  HIS E CG    1 
ATOM   7003 N  ND1   . HIS E 1 177 ? 9.620   -21.542 12.596  1.00 17.51 ? 177  HIS E ND1   1 
ATOM   7004 C  CD2   . HIS E 1 177 ? 8.309   -19.912 11.973  1.00 17.39 ? 177  HIS E CD2   1 
ATOM   7005 C  CE1   . HIS E 1 177 ? 9.567   -20.679 13.596  1.00 16.65 ? 177  HIS E CE1   1 
ATOM   7006 N  NE2   . HIS E 1 177 ? 8.778   -19.681 13.242  1.00 20.97 ? 177  HIS E NE2   1 
ATOM   7007 N  N     . LEU E 1 178 ? 10.351  -21.972 7.131   1.00 13.18 ? 178  LEU E N     1 
ATOM   7008 C  CA    . LEU E 1 178 ? 10.367  -22.730 5.888   1.00 13.33 ? 178  LEU E CA    1 
ATOM   7009 C  C     . LEU E 1 178 ? 9.906   -24.176 6.052   1.00 15.27 ? 178  LEU E C     1 
ATOM   7010 O  O     . LEU E 1 178 ? 9.367   -24.751 5.111   1.00 17.48 ? 178  LEU E O     1 
ATOM   7011 C  CB    . LEU E 1 178 ? 11.732  -22.648 5.199   1.00 13.61 ? 178  LEU E CB    1 
ATOM   7012 C  CG    . LEU E 1 178 ? 12.026  -21.273 4.593   1.00 14.60 ? 178  LEU E CG    1 
ATOM   7013 C  CD1   . LEU E 1 178 ? 13.337  -21.304 3.838   1.00 12.96 ? 178  LEU E CD1   1 
ATOM   7014 C  CD2   . LEU E 1 178 ? 10.884  -20.864 3.642   1.00 17.59 ? 178  LEU E CD2   1 
ATOM   7015 N  N     . CYS E 1 179 ? 10.044  -24.741 7.254   1.00 14.13 ? 179  CYS E N     1 
ATOM   7016 C  CA    . CYS E 1 179 ? 9.608   -26.123 7.473   1.00 15.03 ? 179  CYS E CA    1 
ATOM   7017 C  C     . CYS E 1 179 ? 8.080   -26.234 7.396   1.00 15.29 ? 179  CYS E C     1 
ATOM   7018 O  O     . CYS E 1 179 ? 7.534   -27.331 7.247   1.00 17.45 ? 179  CYS E O     1 
ATOM   7019 C  CB    . CYS E 1 179 ? 10.137  -26.673 8.806   1.00 18.02 ? 179  CYS E CB    1 
ATOM   7020 S  SG    . CYS E 1 179 ? 9.477   -25.868 10.253  1.00 18.90 ? 179  CYS E SG    1 
ATOM   7021 N  N     . MET E 1 180 ? 7.398   -25.094 7.496   1.00 16.49 ? 180  MET E N     1 
ATOM   7022 C  CA    . MET E 1 180 ? 5.940   -25.048 7.397   1.00 17.17 ? 180  MET E CA    1 
ATOM   7023 C  C     . MET E 1 180 ? 5.512   -24.628 5.990   1.00 15.50 ? 180  MET E C     1 
ATOM   7024 O  O     . MET E 1 180 ? 4.403   -24.927 5.561   1.00 16.18 ? 180  MET E O     1 
ATOM   7025 C  CB    . MET E 1 180 ? 5.353   -24.028 8.382   1.00 18.01 ? 180  MET E CB    1 
ATOM   7026 C  CG    . MET E 1 180 ? 5.303   -24.469 9.832   1.00 24.86 ? 180  MET E CG    1 
ATOM   7027 S  SD    . MET E 1 180 ? 4.414   -23.259 10.849  1.00 29.19 ? 180  MET E SD    1 
ATOM   7028 C  CE    . MET E 1 180 ? 2.810   -23.172 9.998   1.00 26.95 ? 180  MET E CE    1 
ATOM   7029 N  N     . MET E 1 181 ? 6.411   -23.954 5.280   1.00 15.71 ? 181  MET E N     1 
ATOM   7030 C  CA    . MET E 1 181 ? 6.131   -23.419 3.946   1.00 15.96 ? 181  MET E CA    1 
ATOM   7031 C  C     . MET E 1 181 ? 6.558   -24.234 2.733   1.00 16.53 ? 181  MET E C     1 
ATOM   7032 O  O     . MET E 1 181 ? 5.811   -24.321 1.752   1.00 15.05 ? 181  MET E O     1 
ATOM   7033 C  CB    . MET E 1 181 ? 6.743   -22.023 3.836   1.00 15.09 ? 181  MET E CB    1 
ATOM   7034 C  CG    . MET E 1 181 ? 6.242   -21.054 4.896   1.00 14.53 ? 181  MET E CG    1 
ATOM   7035 S  SD    . MET E 1 181 ? 7.324   -19.630 5.073   1.00 20.12 ? 181  MET E SD    1 
ATOM   7036 C  CE    . MET E 1 181 ? 6.749   -18.591 3.716   1.00 23.51 ? 181  MET E CE    1 
ATOM   7037 N  N     . MET E 1 182 ? 7.766   -24.792 2.775   1.00 16.56 ? 182  MET E N     1 
ATOM   7038 C  CA    . MET E 1 182 ? 8.280   -25.559 1.642   1.00 16.75 ? 182  MET E CA    1 
ATOM   7039 C  C     . MET E 1 182 ? 8.089   -27.068 1.733   1.00 15.73 ? 182  MET E C     1 
ATOM   7040 O  O     . MET E 1 182 ? 8.475   -27.804 0.824   1.00 15.16 ? 182  MET E O     1 
ATOM   7041 C  CB    . MET E 1 182 ? 9.750   -25.207 1.367   1.00 17.49 ? 182  MET E CB    1 
ATOM   7042 C  CG    . MET E 1 182 ? 10.777  -25.759 2.326   1.00 17.77 ? 182  MET E CG    1 
ATOM   7043 S  SD    . MET E 1 182 ? 12.412  -25.018 2.016   1.00 19.86 ? 182  MET E SD    1 
ATOM   7044 C  CE    . MET E 1 182 ? 12.842  -25.672 0.422   1.00 14.93 ? 182  MET E CE    1 
ATOM   7045 N  N     . ARG E 1 183 ? 7.447   -27.511 2.809   1.00 17.17 ? 183  ARG E N     1 
ATOM   7046 C  CA    . ARG E 1 183 ? 7.188   -28.929 3.043   1.00 17.65 ? 183  ARG E CA    1 
ATOM   7047 C  C     . ARG E 1 183 ? 6.110   -29.084 4.114   1.00 18.33 ? 183  ARG E C     1 
ATOM   7048 O  O     . ARG E 1 183 ? 5.601   -28.091 4.642   1.00 15.35 ? 183  ARG E O     1 
ATOM   7049 C  CB    . ARG E 1 183 ? 8.466   -29.631 3.518   1.00 17.26 ? 183  ARG E CB    1 
ATOM   7050 C  CG    . ARG E 1 183 ? 9.050   -29.031 4.796   1.00 19.22 ? 183  ARG E CG    1 
ATOM   7051 C  CD    . ARG E 1 183 ? 9.818   -30.066 5.602   1.00 18.10 ? 183  ARG E CD    1 
ATOM   7052 N  NE    . ARG E 1 183 ? 8.981   -31.208 5.963   1.00 21.40 ? 183  ARG E NE    1 
ATOM   7053 C  CZ    . ARG E 1 183 ? 8.094   -31.214 6.955   1.00 19.16 ? 183  ARG E CZ    1 
ATOM   7054 N  NH1   . ARG E 1 183 ? 7.912   -30.135 7.705   1.00 17.25 ? 183  ARG E NH1   1 
ATOM   7055 N  NH2   . ARG E 1 183 ? 7.386   -32.306 7.196   1.00 19.38 ? 183  ARG E NH2   1 
ATOM   7056 N  N     . GLY E 1 184 ? 5.773   -30.332 4.435   1.00 18.68 ? 184  GLY E N     1 
ATOM   7057 C  CA    . GLY E 1 184 ? 4.767   -30.599 5.455   1.00 18.22 ? 184  GLY E CA    1 
ATOM   7058 C  C     . GLY E 1 184 ? 3.410   -29.997 5.139   1.00 18.25 ? 184  GLY E C     1 
ATOM   7059 O  O     . GLY E 1 184 ? 2.821   -30.307 4.100   1.00 17.23 ? 184  GLY E O     1 
ATOM   7060 N  N     . VAL E 1 185 ? 2.916   -29.136 6.029   1.00 18.02 ? 185  VAL E N     1 
ATOM   7061 C  CA    . VAL E 1 185 ? 1.615   -28.491 5.836   1.00 18.52 ? 185  VAL E CA    1 
ATOM   7062 C  C     . VAL E 1 185 ? 1.599   -27.533 4.643   1.00 17.96 ? 185  VAL E C     1 
ATOM   7063 O  O     . VAL E 1 185 ? 0.541   -27.253 4.079   1.00 18.91 ? 185  VAL E O     1 
ATOM   7064 C  CB    . VAL E 1 185 ? 1.141   -27.733 7.104   1.00 18.59 ? 185  VAL E CB    1 
ATOM   7065 C  CG1   . VAL E 1 185 ? 0.895   -28.707 8.225   1.00 20.04 ? 185  VAL E CG1   1 
ATOM   7066 C  CG2   . VAL E 1 185 ? 2.164   -26.677 7.528   1.00 16.23 ? 185  VAL E CG2   1 
ATOM   7067 N  N     . GLU E 1 186 ? 2.771   -27.016 4.280   1.00 17.34 ? 186  GLU E N     1 
ATOM   7068 C  CA    . GLU E 1 186 ? 2.908   -26.101 3.148   1.00 15.45 ? 186  GLU E CA    1 
ATOM   7069 C  C     . GLU E 1 186 ? 1.996   -24.878 3.192   1.00 16.14 ? 186  GLU E C     1 
ATOM   7070 O  O     . GLU E 1 186 ? 1.425   -24.472 2.173   1.00 14.31 ? 186  GLU E O     1 
ATOM   7071 C  CB    . GLU E 1 186 ? 2.735   -26.852 1.818   1.00 16.84 ? 186  GLU E CB    1 
ATOM   7072 C  CG    . GLU E 1 186 ? 3.801   -27.918 1.573   1.00 16.61 ? 186  GLU E CG    1 
ATOM   7073 C  CD    . GLU E 1 186 ? 3.684   -28.550 0.203   1.00 18.36 ? 186  GLU E CD    1 
ATOM   7074 O  OE1   . GLU E 1 186 ? 3.949   -27.853 -0.793  1.00 17.32 ? 186  GLU E OE1   1 
ATOM   7075 O  OE2   . GLU E 1 186 ? 3.318   -29.742 0.121   1.00 19.83 ? 186  GLU E OE2   1 
ATOM   7076 N  N     . LYS E 1 187 ? 1.829   -24.313 4.382   1.00 12.65 ? 187  LYS E N     1 
ATOM   7077 C  CA    . LYS E 1 187 ? 1.020   -23.109 4.534   1.00 13.03 ? 187  LYS E CA    1 
ATOM   7078 C  C     . LYS E 1 187 ? 1.892   -21.939 4.091   1.00 14.72 ? 187  LYS E C     1 
ATOM   7079 O  O     . LYS E 1 187 ? 3.084   -21.881 4.419   1.00 14.49 ? 187  LYS E O     1 
ATOM   7080 C  CB    . LYS E 1 187 ? 0.576   -22.927 5.982   1.00 13.33 ? 187  LYS E CB    1 
ATOM   7081 C  CG    . LYS E 1 187 ? -0.438  -23.963 6.456   1.00 16.94 ? 187  LYS E CG    1 
ATOM   7082 C  CD    . LYS E 1 187 ? -1.793  -23.798 5.773   1.00 16.51 ? 187  LYS E CD    1 
ATOM   7083 C  CE    . LYS E 1 187 ? -2.793  -24.821 6.299   1.00 18.62 ? 187  LYS E CE    1 
ATOM   7084 N  NZ    . LYS E 1 187 ? -4.062  -24.847 5.502   1.00 17.00 ? 187  LYS E NZ    1 
ATOM   7085 N  N     . GLN E 1 188 ? 1.286   -20.994 3.382   1.00 12.67 ? 188  GLN E N     1 
ATOM   7086 C  CA    . GLN E 1 188 ? 2.005   -19.846 2.841   1.00 13.63 ? 188  GLN E CA    1 
ATOM   7087 C  C     . GLN E 1 188 ? 1.852   -18.495 3.539   1.00 13.04 ? 188  GLN E C     1 
ATOM   7088 O  O     . GLN E 1 188 ? 2.746   -17.662 3.459   1.00 13.59 ? 188  GLN E O     1 
ATOM   7089 C  CB    . GLN E 1 188 ? 1.622   -19.670 1.367   1.00 15.26 ? 188  GLN E CB    1 
ATOM   7090 C  CG    . GLN E 1 188 ? 1.791   -20.929 0.530   1.00 15.38 ? 188  GLN E CG    1 
ATOM   7091 C  CD    . GLN E 1 188 ? 3.231   -21.397 0.490   1.00 15.66 ? 188  GLN E CD    1 
ATOM   7092 O  OE1   . GLN E 1 188 ? 4.130   -20.621 0.184   1.00 17.88 ? 188  GLN E OE1   1 
ATOM   7093 N  NE2   . GLN E 1 188 ? 3.457   -22.668 0.808   1.00 16.21 ? 188  GLN E NE2   1 
ATOM   7094 N  N     . HIS E 1 189 ? 0.737   -18.274 4.224   1.00 12.60 ? 189  HIS E N     1 
ATOM   7095 C  CA    . HIS E 1 189 ? 0.491   -16.974 4.847   1.00 14.31 ? 189  HIS E CA    1 
ATOM   7096 C  C     . HIS E 1 189 ? 0.805   -16.845 6.330   1.00 13.60 ? 189  HIS E C     1 
ATOM   7097 O  O     . HIS E 1 189 ? 0.626   -15.771 6.907   1.00 14.89 ? 189  HIS E O     1 
ATOM   7098 C  CB    . HIS E 1 189 ? -0.974  -16.575 4.627   1.00 12.75 ? 189  HIS E CB    1 
ATOM   7099 C  CG    . HIS E 1 189 ? -1.345  -16.393 3.187   1.00 17.12 ? 189  HIS E CG    1 
ATOM   7100 N  ND1   . HIS E 1 189 ? -0.931  -15.308 2.446   1.00 19.21 ? 189  HIS E ND1   1 
ATOM   7101 C  CD2   . HIS E 1 189 ? -2.108  -17.147 2.360   1.00 18.64 ? 189  HIS E CD2   1 
ATOM   7102 C  CE1   . HIS E 1 189 ? -1.426  -15.399 1.223   1.00 23.23 ? 189  HIS E CE1   1 
ATOM   7103 N  NE2   . HIS E 1 189 ? -2.143  -16.505 1.144   1.00 18.41 ? 189  HIS E NE2   1 
ATOM   7104 N  N     . SER E 1 190 ? 1.320   -17.907 6.933   1.00 14.42 ? 190  SER E N     1 
ATOM   7105 C  CA    . SER E 1 190 ? 1.577   -17.891 8.367   1.00 12.95 ? 190  SER E CA    1 
ATOM   7106 C  C     . SER E 1 190 ? 2.900   -17.317 8.852   1.00 11.93 ? 190  SER E C     1 
ATOM   7107 O  O     . SER E 1 190 ? 3.924   -17.387 8.171   1.00 11.57 ? 190  SER E O     1 
ATOM   7108 C  CB    . SER E 1 190 ? 1.399   -19.299 8.940   1.00 12.48 ? 190  SER E CB    1 
ATOM   7109 O  OG    . SER E 1 190 ? 1.424   -19.276 10.356  1.00 20.95 ? 190  SER E OG    1 
ATOM   7110 N  N     . ARG E 1 191 ? 2.847   -16.723 10.039  1.00 11.32 ? 191  ARG E N     1 
ATOM   7111 C  CA    . ARG E 1 191 ? 4.035   -16.184 10.695  1.00 12.73 ? 191  ARG E CA    1 
ATOM   7112 C  C     . ARG E 1 191 ? 3.780   -16.304 12.189  1.00 12.66 ? 191  ARG E C     1 
ATOM   7113 O  O     . ARG E 1 191 ? 2.638   -16.204 12.653  1.00 14.56 ? 191  ARG E O     1 
ATOM   7114 C  CB    . ARG E 1 191 ? 4.356   -14.747 10.266  1.00 16.93 ? 191  ARG E CB    1 
ATOM   7115 C  CG    . ARG E 1 191 ? 3.360   -13.697 10.671  1.00 23.36 ? 191  ARG E CG    1 
ATOM   7116 C  CD    . ARG E 1 191 ? 3.739   -12.358 10.061  1.00 27.15 ? 191  ARG E CD    1 
ATOM   7117 N  NE    . ARG E 1 191 ? 2.865   -11.291 10.536  1.00 33.47 ? 191  ARG E NE    1 
ATOM   7118 C  CZ    . ARG E 1 191 ? 2.289   -10.385 9.752   1.00 36.19 ? 191  ARG E CZ    1 
ATOM   7119 N  NH1   . ARG E 1 191 ? 2.494   -10.408 8.441   1.00 44.18 ? 191  ARG E NH1   1 
ATOM   7120 N  NH2   . ARG E 1 191 ? 1.496   -9.465  10.279  1.00 37.64 ? 191  ARG E NH2   1 
ATOM   7121 N  N     . THR E 1 192 ? 4.845   -16.557 12.930  1.00 11.82 ? 192  THR E N     1 
ATOM   7122 C  CA    . THR E 1 192 ? 4.737   -16.769 14.365  1.00 11.93 ? 192  THR E CA    1 
ATOM   7123 C  C     . THR E 1 192 ? 5.380   -15.691 15.207  1.00 10.22 ? 192  THR E C     1 
ATOM   7124 O  O     . THR E 1 192 ? 6.416   -15.146 14.849  1.00 9.47  ? 192  THR E O     1 
ATOM   7125 C  CB    . THR E 1 192 ? 5.332   -18.138 14.723  1.00 15.31 ? 192  THR E CB    1 
ATOM   7126 O  OG1   . THR E 1 192 ? 4.558   -19.157 14.077  1.00 17.56 ? 192  THR E OG1   1 
ATOM   7127 C  CG2   . THR E 1 192 ? 5.338   -18.370 16.246  1.00 10.38 ? 192  THR E CG2   1 
ATOM   7128 N  N     . VAL E 1 193 ? 4.731   -15.375 16.321  1.00 10.92 ? 193  VAL E N     1 
ATOM   7129 C  CA    . VAL E 1 193 ? 5.232   -14.372 17.242  1.00 11.58 ? 193  VAL E CA    1 
ATOM   7130 C  C     . VAL E 1 193 ? 5.464   -15.026 18.589  1.00 10.93 ? 193  VAL E C     1 
ATOM   7131 O  O     . VAL E 1 193 ? 4.616   -15.773 19.080  1.00 13.36 ? 193  VAL E O     1 
ATOM   7132 C  CB    . VAL E 1 193 ? 4.220   -13.216 17.443  1.00 13.29 ? 193  VAL E CB    1 
ATOM   7133 C  CG1   . VAL E 1 193 ? 4.694   -12.280 18.559  1.00 15.03 ? 193  VAL E CG1   1 
ATOM   7134 C  CG2   . VAL E 1 193 ? 4.032   -12.446 16.144  1.00 13.59 ? 193  VAL E CG2   1 
ATOM   7135 N  N     . THR E 1 194 ? 6.652   -14.797 19.139  1.00 12.74 ? 194  THR E N     1 
ATOM   7136 C  CA    . THR E 1 194 ? 7.012   -15.297 20.462  1.00 11.11 ? 194  THR E CA    1 
ATOM   7137 C  C     . THR E 1 194 ? 7.619   -14.098 21.182  1.00 12.76 ? 194  THR E C     1 
ATOM   7138 O  O     . THR E 1 194 ? 8.031   -13.126 20.556  1.00 11.72 ? 194  THR E O     1 
ATOM   7139 C  CB    . THR E 1 194 ? 8.050   -16.442 20.416  1.00 10.29 ? 194  THR E CB    1 
ATOM   7140 O  OG1   . THR E 1 194 ? 9.244   -15.996 19.761  1.00 12.06 ? 194  THR E OG1   1 
ATOM   7141 C  CG2   . THR E 1 194 ? 7.479   -17.660 19.685  1.00 12.44 ? 194  THR E CG2   1 
ATOM   7142 N  N     . SER E 1 195 ? 7.660   -14.152 22.503  1.00 13.10 ? 195  SER E N     1 
ATOM   7143 C  CA    . SER E 1 195 ? 8.220   -13.035 23.232  1.00 15.62 ? 195  SER E CA    1 
ATOM   7144 C  C     . SER E 1 195 ? 8.693   -13.451 24.601  1.00 13.62 ? 195  SER E C     1 
ATOM   7145 O  O     . SER E 1 195 ? 8.536   -14.604 25.002  1.00 12.33 ? 195  SER E O     1 
ATOM   7146 C  CB    . SER E 1 195 ? 7.181   -11.916 23.360  1.00 18.77 ? 195  SER E CB    1 
ATOM   7147 O  OG    . SER E 1 195 ? 6.043   -12.364 24.072  1.00 19.91 ? 195  SER E OG    1 
ATOM   7148 N  N     . ALA E 1 196 ? 9.326   -12.503 25.281  1.00 11.86 ? 196  ALA E N     1 
ATOM   7149 C  CA    . ALA E 1 196 ? 9.826   -12.700 26.631  1.00 14.61 ? 196  ALA E CA    1 
ATOM   7150 C  C     . ALA E 1 196 ? 9.773   -11.328 27.284  1.00 13.93 ? 196  ALA E C     1 
ATOM   7151 O  O     . ALA E 1 196 ? 10.194  -10.334 26.691  1.00 15.19 ? 196  ALA E O     1 
ATOM   7152 C  CB    . ALA E 1 196 ? 11.245  -13.234 26.604  1.00 15.16 ? 196  ALA E CB    1 
ATOM   7153 N  N     . MET E 1 197 ? 9.197   -11.274 28.480  1.00 13.97 ? 197  MET E N     1 
ATOM   7154 C  CA    . MET E 1 197 ? 9.061   -10.025 29.217  1.00 15.41 ? 197  MET E CA    1 
ATOM   7155 C  C     . MET E 1 197 ? 9.692   -10.189 30.592  1.00 15.49 ? 197  MET E C     1 
ATOM   7156 O  O     . MET E 1 197 ? 9.311   -11.075 31.357  1.00 16.78 ? 197  MET E O     1 
ATOM   7157 C  CB    . MET E 1 197 ? 7.582   -9.670  29.371  1.00 14.67 ? 197  MET E CB    1 
ATOM   7158 C  CG    . MET E 1 197 ? 6.828   -9.494  28.056  1.00 16.94 ? 197  MET E CG    1 
ATOM   7159 S  SD    . MET E 1 197 ? 7.354   -8.028  27.177  1.00 15.50 ? 197  MET E SD    1 
ATOM   7160 C  CE    . MET E 1 197 ? 6.997   -8.501  25.484  1.00 17.24 ? 197  MET E CE    1 
ATOM   7161 N  N     . LEU E 1 198 ? 10.640  -9.315  30.907  1.00 17.18 ? 198  LEU E N     1 
ATOM   7162 C  CA    . LEU E 1 198 ? 11.338  -9.375  32.187  1.00 18.45 ? 198  LEU E CA    1 
ATOM   7163 C  C     . LEU E 1 198 ? 11.226  -8.064  32.952  1.00 17.28 ? 198  LEU E C     1 
ATOM   7164 O  O     . LEU E 1 198 ? 11.046  -7.001  32.360  1.00 16.58 ? 198  LEU E O     1 
ATOM   7165 C  CB    . LEU E 1 198 ? 12.815  -9.707  31.958  1.00 20.24 ? 198  LEU E CB    1 
ATOM   7166 C  CG    . LEU E 1 198 ? 13.132  -10.963 31.141  1.00 21.30 ? 198  LEU E CG    1 
ATOM   7167 C  CD1   . LEU E 1 198 ? 14.640  -11.102 30.985  1.00 19.69 ? 198  LEU E CD1   1 
ATOM   7168 C  CD2   . LEU E 1 198 ? 12.537  -12.197 31.802  1.00 22.77 ? 198  LEU E CD2   1 
ATOM   7169 N  N     . GLY E 1 199 ? 11.325  -8.152  34.277  1.00 17.44 ? 199  GLY E N     1 
ATOM   7170 C  CA    . GLY E 1 199 ? 11.244  -6.965  35.106  1.00 18.81 ? 199  GLY E CA    1 
ATOM   7171 C  C     . GLY E 1 199 ? 9.939   -6.212  34.953  1.00 15.08 ? 199  GLY E C     1 
ATOM   7172 O  O     . GLY E 1 199 ? 8.870   -6.816  34.898  1.00 15.86 ? 199  GLY E O     1 
ATOM   7173 N  N     . VAL E 1 200 ? 10.022  -4.889  34.851  1.00 14.38 ? 200  VAL E N     1 
ATOM   7174 C  CA    . VAL E 1 200 ? 8.822   -4.075  34.720  1.00 16.94 ? 200  VAL E CA    1 
ATOM   7175 C  C     . VAL E 1 200 ? 7.989   -4.367  33.469  1.00 15.16 ? 200  VAL E C     1 
ATOM   7176 O  O     . VAL E 1 200 ? 6.825   -3.997  33.419  1.00 15.37 ? 200  VAL E O     1 
ATOM   7177 C  CB    . VAL E 1 200 ? 9.126   -2.558  34.803  1.00 14.94 ? 200  VAL E CB    1 
ATOM   7178 C  CG1   . VAL E 1 200 ? 9.723   -2.212  36.169  1.00 16.75 ? 200  VAL E CG1   1 
ATOM   7179 C  CG2   . VAL E 1 200 ? 10.059  -2.134  33.680  1.00 14.88 ? 200  VAL E CG2   1 
ATOM   7180 N  N     . PHE E 1 201 ? 8.586   -4.999  32.459  1.00 17.07 ? 201  PHE E N     1 
ATOM   7181 C  CA    . PHE E 1 201 ? 7.846   -5.340  31.238  1.00 16.30 ? 201  PHE E CA    1 
ATOM   7182 C  C     . PHE E 1 201 ? 6.876   -6.487  31.512  1.00 18.12 ? 201  PHE E C     1 
ATOM   7183 O  O     . PHE E 1 201 ? 5.875   -6.646  30.817  1.00 18.09 ? 201  PHE E O     1 
ATOM   7184 C  CB    . PHE E 1 201 ? 8.799   -5.714  30.095  1.00 17.01 ? 201  PHE E CB    1 
ATOM   7185 C  CG    . PHE E 1 201 ? 9.359   -4.526  29.362  1.00 16.11 ? 201  PHE E CG    1 
ATOM   7186 C  CD1   . PHE E 1 201 ? 9.105   -4.347  28.006  1.00 16.12 ? 201  PHE E CD1   1 
ATOM   7187 C  CD2   . PHE E 1 201 ? 10.131  -3.581  30.029  1.00 17.03 ? 201  PHE E CD2   1 
ATOM   7188 C  CE1   . PHE E 1 201 ? 9.612   -3.240  27.323  1.00 18.39 ? 201  PHE E CE1   1 
ATOM   7189 C  CE2   . PHE E 1 201 ? 10.641  -2.472  29.359  1.00 15.89 ? 201  PHE E CE2   1 
ATOM   7190 C  CZ    . PHE E 1 201 ? 10.382  -2.300  28.003  1.00 19.59 ? 201  PHE E CZ    1 
ATOM   7191 N  N     . ARG E 1 202 ? 7.185   -7.292  32.526  1.00 18.00 ? 202  ARG E N     1 
ATOM   7192 C  CA    . ARG E 1 202 ? 6.321   -8.405  32.909  1.00 19.61 ? 202  ARG E CA    1 
ATOM   7193 C  C     . ARG E 1 202 ? 5.323   -7.935  33.962  1.00 19.75 ? 202  ARG E C     1 
ATOM   7194 O  O     . ARG E 1 202 ? 4.132   -8.250  33.897  1.00 19.90 ? 202  ARG E O     1 
ATOM   7195 C  CB    . ARG E 1 202 ? 7.154   -9.561  33.486  1.00 22.26 ? 202  ARG E CB    1 
ATOM   7196 C  CG    . ARG E 1 202 ? 6.317   -10.700 34.073  1.00 29.76 ? 202  ARG E CG    1 
ATOM   7197 C  CD    . ARG E 1 202 ? 7.153   -11.661 34.915  1.00 37.30 ? 202  ARG E CD    1 
ATOM   7198 N  NE    . ARG E 1 202 ? 8.043   -12.499 34.114  1.00 44.55 ? 202  ARG E NE    1 
ATOM   7199 C  CZ    . ARG E 1 202 ? 7.716   -13.693 33.625  1.00 46.54 ? 202  ARG E CZ    1 
ATOM   7200 N  NH1   . ARG E 1 202 ? 6.512   -14.206 33.849  1.00 47.55 ? 202  ARG E NH1   1 
ATOM   7201 N  NH2   . ARG E 1 202 ? 8.601   -14.383 32.916  1.00 49.00 ? 202  ARG E NH2   1 
ATOM   7202 N  N     . GLU E 1 203 ? 5.819   -7.135  34.905  1.00 17.50 ? 203  GLU E N     1 
ATOM   7203 C  CA    . GLU E 1 203 ? 5.024   -6.634  36.025  1.00 17.78 ? 203  GLU E CA    1 
ATOM   7204 C  C     . GLU E 1 203 ? 4.074   -5.475  35.742  1.00 18.15 ? 203  GLU E C     1 
ATOM   7205 O  O     . GLU E 1 203 ? 3.007   -5.393  36.351  1.00 18.45 ? 203  GLU E O     1 
ATOM   7206 C  CB    . GLU E 1 203 ? 5.962   -6.227  37.166  1.00 15.10 ? 203  GLU E CB    1 
ATOM   7207 C  CG    . GLU E 1 203 ? 6.941   -7.315  37.593  1.00 19.44 ? 203  GLU E CG    1 
ATOM   7208 C  CD    . GLU E 1 203 ? 8.064   -6.787  38.479  1.00 24.18 ? 203  GLU E CD    1 
ATOM   7209 O  OE1   . GLU E 1 203 ? 8.887   -7.600  38.942  1.00 25.94 ? 203  GLU E OE1   1 
ATOM   7210 O  OE2   . GLU E 1 203 ? 8.140   -5.559  38.695  1.00 24.46 ? 203  GLU E OE2   1 
ATOM   7211 N  N     . ASN E 1 204 ? 4.476   -4.567  34.855  1.00 17.85 ? 204  ASN E N     1 
ATOM   7212 C  CA    . ASN E 1 204 ? 3.671   -3.385  34.537  1.00 16.54 ? 204  ASN E CA    1 
ATOM   7213 C  C     . ASN E 1 204 ? 2.945   -3.549  33.202  1.00 20.01 ? 204  ASN E C     1 
ATOM   7214 O  O     . ASN E 1 204 ? 3.555   -3.453  32.134  1.00 16.65 ? 204  ASN E O     1 
ATOM   7215 C  CB    . ASN E 1 204 ? 4.579   -2.140  34.518  1.00 15.13 ? 204  ASN E CB    1 
ATOM   7216 C  CG    . ASN E 1 204 ? 3.803   -0.830  34.585  1.00 18.99 ? 204  ASN E CG    1 
ATOM   7217 O  OD1   . ASN E 1 204 ? 4.190   0.096   35.308  1.00 21.32 ? 204  ASN E OD1   1 
ATOM   7218 N  ND2   . ASN E 1 204 ? 2.719   -0.739  33.831  1.00 16.92 ? 204  ASN E ND2   1 
ATOM   7219 N  N     . GLN E 1 205 ? 1.634   -3.774  33.277  1.00 20.82 ? 205  GLN E N     1 
ATOM   7220 C  CA    . GLN E 1 205 ? 0.793   -3.963  32.091  1.00 22.31 ? 205  GLN E CA    1 
ATOM   7221 C  C     . GLN E 1 205 ? 0.868   -2.773  31.120  1.00 20.14 ? 205  GLN E C     1 
ATOM   7222 O  O     . GLN E 1 205 ? 0.941   -2.958  29.899  1.00 19.32 ? 205  GLN E O     1 
ATOM   7223 C  CB    . GLN E 1 205 ? -0.658  -4.204  32.527  1.00 25.31 ? 205  GLN E CB    1 
ATOM   7224 C  CG    . GLN E 1 205 ? -1.475  -5.095  31.597  1.00 33.27 ? 205  GLN E CG    1 
ATOM   7225 C  CD    . GLN E 1 205 ? -1.853  -4.419  30.294  1.00 37.66 ? 205  GLN E CD    1 
ATOM   7226 O  OE1   . GLN E 1 205 ? -1.743  -5.013  29.220  1.00 40.40 ? 205  GLN E OE1   1 
ATOM   7227 N  NE2   . GLN E 1 205 ? -2.311  -3.174  30.382  1.00 38.60 ? 205  GLN E NE2   1 
ATOM   7228 N  N     . LYS E 1 206 ? 0.878   -1.560  31.669  1.00 19.12 ? 206  LYS E N     1 
ATOM   7229 C  CA    . LYS E 1 206 ? 0.945   -0.350  30.858  1.00 20.33 ? 206  LYS E CA    1 
ATOM   7230 C  C     . LYS E 1 206 ? 2.281   -0.225  30.129  1.00 19.19 ? 206  LYS E C     1 
ATOM   7231 O  O     . LYS E 1 206 ? 2.323   0.215   28.980  1.00 17.46 ? 206  LYS E O     1 
ATOM   7232 C  CB    . LYS E 1 206 ? 0.679   0.886   31.718  1.00 25.70 ? 206  LYS E CB    1 
ATOM   7233 C  CG    . LYS E 1 206 ? -0.661  0.844   32.446  1.00 33.73 ? 206  LYS E CG    1 
ATOM   7234 C  CD    . LYS E 1 206 ? -1.832  0.748   31.472  1.00 37.79 ? 206  LYS E CD    1 
ATOM   7235 C  CE    . LYS E 1 206 ? -3.158  0.560   32.205  1.00 42.38 ? 206  LYS E CE    1 
ATOM   7236 N  NZ    . LYS E 1 206 ? -3.460  1.678   33.147  1.00 44.80 ? 206  LYS E NZ    1 
ATOM   7237 N  N     . THR E 1 207 ? 3.363   -0.628  30.791  1.00 18.42 ? 207  THR E N     1 
ATOM   7238 C  CA    . THR E 1 207 ? 4.693   -0.579  30.193  1.00 18.58 ? 207  THR E CA    1 
ATOM   7239 C  C     . THR E 1 207 ? 4.757   -1.555  29.020  1.00 18.58 ? 207  THR E C     1 
ATOM   7240 O  O     . THR E 1 207 ? 5.264   -1.218  27.943  1.00 17.06 ? 207  THR E O     1 
ATOM   7241 C  CB    . THR E 1 207 ? 5.790   -0.936  31.222  1.00 20.29 ? 207  THR E CB    1 
ATOM   7242 O  OG1   . THR E 1 207 ? 5.809   0.057   32.257  1.00 15.38 ? 207  THR E OG1   1 
ATOM   7243 C  CG2   . THR E 1 207 ? 7.162   -0.991  30.559  1.00 16.81 ? 207  THR E CG2   1 
ATOM   7244 N  N     . ARG E 1 208 ? 4.221   -2.756  29.230  1.00 18.10 ? 208  ARG E N     1 
ATOM   7245 C  CA    . ARG E 1 208 ? 4.214   -3.775  28.186  1.00 18.19 ? 208  ARG E CA    1 
ATOM   7246 C  C     . ARG E 1 208 ? 3.379   -3.313  26.999  1.00 15.48 ? 208  ARG E C     1 
ATOM   7247 O  O     . ARG E 1 208 ? 3.812   -3.412  25.856  1.00 14.93 ? 208  ARG E O     1 
ATOM   7248 C  CB    . ARG E 1 208 ? 3.685   -5.106  28.721  1.00 19.48 ? 208  ARG E CB    1 
ATOM   7249 C  CG    . ARG E 1 208 ? 3.714   -6.233  27.681  1.00 22.84 ? 208  ARG E CG    1 
ATOM   7250 C  CD    . ARG E 1 208 ? 3.529   -7.608  28.307  1.00 20.22 ? 208  ARG E CD    1 
ATOM   7251 N  NE    . ARG E 1 208 ? 2.257   -7.732  29.015  1.00 21.90 ? 208  ARG E NE    1 
ATOM   7252 C  CZ    . ARG E 1 208 ? 2.111   -7.594  30.331  1.00 25.51 ? 208  ARG E CZ    1 
ATOM   7253 N  NH1   . ARG E 1 208 ? 3.163   -7.323  31.095  1.00 22.97 ? 208  ARG E NH1   1 
ATOM   7254 N  NH2   . ARG E 1 208 ? 0.911   -7.730  30.885  1.00 23.08 ? 208  ARG E NH2   1 
ATOM   7255 N  N     . GLU E 1 209 ? 2.195   -2.785  27.285  1.00 18.17 ? 209  GLU E N     1 
ATOM   7256 C  CA    . GLU E 1 209 ? 1.289   -2.290  26.252  1.00 18.05 ? 209  GLU E CA    1 
ATOM   7257 C  C     . GLU E 1 209 ? 1.945   -1.160  25.451  1.00 18.75 ? 209  GLU E C     1 
ATOM   7258 O  O     . GLU E 1 209 ? 1.819   -1.093  24.220  1.00 16.61 ? 209  GLU E O     1 
ATOM   7259 C  CB    . GLU E 1 209 ? -0.006  -1.808  26.905  1.00 22.94 ? 209  GLU E CB    1 
ATOM   7260 C  CG    . GLU E 1 209 ? -1.135  -1.479  25.940  1.00 33.17 ? 209  GLU E CG    1 
ATOM   7261 C  CD    . GLU E 1 209 ? -2.474  -1.278  26.647  1.00 36.97 ? 209  GLU E CD    1 
ATOM   7262 O  OE1   . GLU E 1 209 ? -3.456  -0.910  25.965  1.00 40.64 ? 209  GLU E OE1   1 
ATOM   7263 O  OE2   . GLU E 1 209 ? -2.548  -1.496  27.878  1.00 35.14 ? 209  GLU E OE2   1 
ATOM   7264 N  N     . GLU E 1 210 ? 2.659   -0.281  26.148  1.00 14.67 ? 210  GLU E N     1 
ATOM   7265 C  CA    . GLU E 1 210 ? 3.342   0.830   25.488  1.00 16.55 ? 210  GLU E CA    1 
ATOM   7266 C  C     . GLU E 1 210 ? 4.424   0.308   24.538  1.00 15.66 ? 210  GLU E C     1 
ATOM   7267 O  O     . GLU E 1 210 ? 4.573   0.809   23.423  1.00 15.28 ? 210  GLU E O     1 
ATOM   7268 C  CB    . GLU E 1 210 ? 3.944   1.776   26.529  1.00 17.30 ? 210  GLU E CB    1 
ATOM   7269 C  CG    . GLU E 1 210 ? 4.740   2.938   25.936  1.00 20.10 ? 210  GLU E CG    1 
ATOM   7270 C  CD    . GLU E 1 210 ? 5.137   3.961   26.984  1.00 22.59 ? 210  GLU E CD    1 
ATOM   7271 O  OE1   . GLU E 1 210 ? 6.348   4.219   27.148  1.00 22.63 ? 210  GLU E OE1   1 
ATOM   7272 O  OE2   . GLU E 1 210 ? 4.233   4.506   27.644  1.00 21.04 ? 210  GLU E OE2   1 
ATOM   7273 N  N     . PHE E 1 211 ? 5.162   -0.713  24.974  1.00 15.12 ? 211  PHE E N     1 
ATOM   7274 C  CA    . PHE E 1 211 ? 6.208   -1.317  24.149  1.00 15.62 ? 211  PHE E CA    1 
ATOM   7275 C  C     . PHE E 1 211 ? 5.593   -1.961  22.908  1.00 15.57 ? 211  PHE E C     1 
ATOM   7276 O  O     . PHE E 1 211 ? 6.054   -1.730  21.792  1.00 15.49 ? 211  PHE E O     1 
ATOM   7277 C  CB    . PHE E 1 211 ? 6.982   -2.368  24.958  1.00 14.82 ? 211  PHE E CB    1 
ATOM   7278 C  CG    . PHE E 1 211 ? 7.868   -3.268  24.127  1.00 15.73 ? 211  PHE E CG    1 
ATOM   7279 C  CD1   . PHE E 1 211 ? 8.772   -2.741  23.202  1.00 15.14 ? 211  PHE E CD1   1 
ATOM   7280 C  CD2   . PHE E 1 211 ? 7.811   -4.652  24.291  1.00 14.60 ? 211  PHE E CD2   1 
ATOM   7281 C  CE1   . PHE E 1 211 ? 9.607   -3.578  22.454  1.00 17.93 ? 211  PHE E CE1   1 
ATOM   7282 C  CE2   . PHE E 1 211 ? 8.639   -5.497  23.550  1.00 18.35 ? 211  PHE E CE2   1 
ATOM   7283 C  CZ    . PHE E 1 211 ? 9.541   -4.960  22.628  1.00 17.18 ? 211  PHE E CZ    1 
ATOM   7284 N  N     . LEU E 1 212 ? 4.554   -2.767  23.107  1.00 16.16 ? 212  LEU E N     1 
ATOM   7285 C  CA    . LEU E 1 212 ? 3.894   -3.440  21.988  1.00 17.57 ? 212  LEU E CA    1 
ATOM   7286 C  C     . LEU E 1 212 ? 3.235   -2.459  21.016  1.00 19.71 ? 212  LEU E C     1 
ATOM   7287 O  O     . LEU E 1 212 ? 3.223   -2.697  19.803  1.00 19.68 ? 212  LEU E O     1 
ATOM   7288 C  CB    . LEU E 1 212 ? 2.885   -4.469  22.502  1.00 16.78 ? 212  LEU E CB    1 
ATOM   7289 C  CG    . LEU E 1 212 ? 3.522   -5.628  23.280  1.00 16.65 ? 212  LEU E CG    1 
ATOM   7290 C  CD1   . LEU E 1 212 ? 2.450   -6.581  23.790  1.00 16.83 ? 212  LEU E CD1   1 
ATOM   7291 C  CD2   . LEU E 1 212 ? 4.522   -6.366  22.392  1.00 16.59 ? 212  LEU E CD2   1 
ATOM   7292 N  N     . SER E 1 213 ? 2.717   -1.349  21.544  1.00 17.24 ? 213  SER E N     1 
ATOM   7293 C  CA    . SER E 1 213 ? 2.087   -0.325  20.710  1.00 19.68 ? 213  SER E CA    1 
ATOM   7294 C  C     . SER E 1 213 ? 3.114   0.334   19.785  1.00 19.96 ? 213  SER E C     1 
ATOM   7295 O  O     . SER E 1 213 ? 2.798   0.685   18.645  1.00 20.86 ? 213  SER E O     1 
ATOM   7296 C  CB    . SER E 1 213 ? 1.390   0.728   21.577  1.00 17.99 ? 213  SER E CB    1 
ATOM   7297 O  OG    . SER E 1 213 ? 0.185   0.211   22.116  1.00 23.10 ? 213  SER E OG    1 
ATOM   7298 N  N     . HIS E 1 214 ? 4.341   0.494   20.278  1.00 19.45 ? 214  HIS E N     1 
ATOM   7299 C  CA    . HIS E 1 214 ? 5.421   1.082   19.485  1.00 19.80 ? 214  HIS E CA    1 
ATOM   7300 C  C     . HIS E 1 214 ? 5.752   0.211   18.274  1.00 21.14 ? 214  HIS E C     1 
ATOM   7301 O  O     . HIS E 1 214 ? 6.273   0.706   17.279  1.00 20.03 ? 214  HIS E O     1 
ATOM   7302 C  CB    . HIS E 1 214 ? 6.691   1.248   20.328  1.00 18.56 ? 214  HIS E CB    1 
ATOM   7303 C  CG    . HIS E 1 214 ? 6.767   2.548   21.064  1.00 21.81 ? 214  HIS E CG    1 
ATOM   7304 N  ND1   . HIS E 1 214 ? 6.560   3.763   20.447  1.00 19.82 ? 214  HIS E ND1   1 
ATOM   7305 C  CD2   . HIS E 1 214 ? 7.023   2.825   22.365  1.00 19.47 ? 214  HIS E CD2   1 
ATOM   7306 C  CE1   . HIS E 1 214 ? 6.682   4.732   21.337  1.00 21.22 ? 214  HIS E CE1   1 
ATOM   7307 N  NE2   . HIS E 1 214 ? 6.963   4.190   22.508  1.00 21.60 ? 214  HIS E NE2   1 
ATOM   7308 N  N     . LEU E 1 215 ? 5.462   -1.084  18.373  1.00 22.65 ? 215  LEU E N     1 
ATOM   7309 C  CA    . LEU E 1 215 ? 5.749   -2.027  17.289  1.00 24.45 ? 215  LEU E CA    1 
ATOM   7310 C  C     . LEU E 1 215 ? 4.647   -2.066  16.238  1.00 28.81 ? 215  LEU E C     1 
ATOM   7311 O  O     . LEU E 1 215 ? 4.834   -2.611  15.147  1.00 30.59 ? 215  LEU E O     1 
ATOM   7312 C  CB    . LEU E 1 215 ? 5.965   -3.435  17.853  1.00 21.49 ? 215  LEU E CB    1 
ATOM   7313 C  CG    . LEU E 1 215 ? 7.029   -3.585  18.942  1.00 18.97 ? 215  LEU E CG    1 
ATOM   7314 C  CD1   . LEU E 1 215 ? 7.155   -5.045  19.344  1.00 17.99 ? 215  LEU E CD1   1 
ATOM   7315 C  CD2   . LEU E 1 215 ? 8.359   -3.055  18.442  1.00 17.45 ? 215  LEU E CD2   1 
ATOM   7316 N  N     . ARG E 1 216 ? 3.500   -1.490  16.575  1.00 30.08 ? 216  ARG E N     1 
ATOM   7317 C  CA    . ARG E 1 216 ? 2.358   -1.459  15.676  1.00 33.33 ? 216  ARG E CA    1 
ATOM   7318 C  C     . ARG E 1 216 ? 2.433   -0.237  14.756  1.00 34.98 ? 216  ARG E C     1 
ATOM   7319 O  O     . ARG E 1 216 ? 3.256   -0.283  13.816  1.00 38.09 ? 216  ARG E O     1 
ATOM   7320 C  CB    . ARG E 1 216 ? 1.064   -1.485  16.499  1.00 31.49 ? 216  ARG E CB    1 
ATOM   7321 C  CG    . ARG E 1 216 ? 0.037   -2.493  16.009  1.00 34.78 ? 216  ARG E CG    1 
ATOM   7322 C  CD    . ARG E 1 216 ? -0.811  -3.049  17.151  1.00 27.62 ? 216  ARG E CD    1 
ATOM   7323 N  NE    . ARG E 1 216 ? -1.421  -2.000  17.965  1.00 27.58 ? 216  ARG E NE    1 
ATOM   7324 C  CZ    . ARG E 1 216 ? -1.242  -1.875  19.277  1.00 26.20 ? 216  ARG E CZ    1 
ATOM   7325 N  NH1   . ARG E 1 216 ? -0.472  -2.736  19.935  1.00 23.85 ? 216  ARG E NH1   1 
ATOM   7326 N  NH2   . ARG E 1 216 ? -1.826  -0.881  19.934  1.00 25.86 ? 216  ARG E NH2   1 
HETATM 7327 ZN ZN    . ZN  F 2 .   ? -23.487 -20.753 2.828   1.00 22.17 ? 1001 ZN  A ZN    1 
HETATM 7328 P  PG    . 8DG G 3 .   ? -29.492 -16.582 1.305   1.00 21.80 ? 821  8DG A PG    1 
HETATM 7329 O  O1G   . 8DG G 3 .   ? -30.013 -16.457 -0.094  1.00 22.62 ? 821  8DG A O1G   1 
HETATM 7330 O  O2G   . 8DG G 3 .   ? -29.700 -15.336 2.117   1.00 22.09 ? 821  8DG A O2G   1 
HETATM 7331 O  O3G   . 8DG G 3 .   ? -28.002 -16.930 1.270   1.00 23.78 ? 821  8DG A O3G   1 
HETATM 7332 O  O3B   . 8DG G 3 .   ? -30.305 -17.752 2.043   1.00 28.10 ? 821  8DG A O3B   1 
HETATM 7333 P  PB    . 8DG G 3 .   ? -30.864 -19.147 1.449   1.00 30.44 ? 821  8DG A PB    1 
HETATM 7334 O  O1B   . 8DG G 3 .   ? -29.839 -19.786 0.602   1.00 27.65 ? 821  8DG A O1B   1 
HETATM 7335 O  O2B   . 8DG G 3 .   ? -32.136 -18.921 0.737   1.00 33.69 ? 821  8DG A O2B   1 
HETATM 7336 O  O3A   . 8DG G 3 .   ? -31.095 -20.048 2.732   1.00 32.44 ? 821  8DG A O3A   1 
HETATM 7337 P  PA    . 8DG G 3 .   ? -31.481 -19.774 4.277   1.00 33.02 ? 821  8DG A PA    1 
HETATM 7338 O  O1A   . 8DG G 3 .   ? -31.744 -21.095 4.921   1.00 30.14 ? 821  8DG A O1A   1 
HETATM 7339 O  O2A   . 8DG G 3 .   ? -32.618 -18.813 4.301   1.00 30.84 ? 821  8DG A O2A   1 
HETATM 7340 O  "O5'" . 8DG G 3 .   ? -30.136 -19.112 4.809   1.00 32.63 ? 821  8DG A "O5'" 1 
HETATM 7341 C  "C5'" . 8DG G 3 .   ? -28.922 -19.853 5.004   1.00 32.67 ? 821  8DG A "C5'" 1 
HETATM 7342 C  "C4'" . 8DG G 3 .   ? -27.991 -19.009 5.835   1.00 29.95 ? 821  8DG A "C4'" 1 
HETATM 7343 O  "O4'" . 8DG G 3 .   ? -26.764 -19.705 6.207   1.00 30.81 ? 821  8DG A "O4'" 1 
HETATM 7344 C  "C3'" . 8DG G 3 .   ? -27.513 -17.711 5.143   1.00 28.64 ? 821  8DG A "C3'" 1 
HETATM 7345 O  "O3'" . 8DG G 3 .   ? -28.030 -16.574 5.825   1.00 25.04 ? 821  8DG A "O3'" 1 
HETATM 7346 C  "C2'" . 8DG G 3 .   ? -26.014 -17.798 5.202   1.00 26.25 ? 821  8DG A "C2'" 1 
HETATM 7347 C  "C1'" . 8DG G 3 .   ? -25.849 -18.654 6.406   1.00 28.87 ? 821  8DG A "C1'" 1 
HETATM 7348 N  N9    . 8DG G 3 .   ? -24.497 -19.176 6.624   1.00 27.28 ? 821  8DG A N9    1 
HETATM 7349 C  C8    . 8DG G 3 .   ? -23.683 -19.861 5.742   1.00 25.90 ? 821  8DG A C8    1 
HETATM 7350 N  N7    . 8DG G 3 .   ? -22.515 -20.165 6.259   1.00 23.68 ? 821  8DG A N7    1 
HETATM 7351 C  C5    . 8DG G 3 .   ? -22.572 -19.650 7.556   1.00 24.70 ? 821  8DG A C5    1 
HETATM 7352 C  C6    . 8DG G 3 .   ? -21.612 -19.651 8.610   1.00 25.88 ? 821  8DG A C6    1 
HETATM 7353 O  O6    . 8DG G 3 .   ? -20.470 -20.113 8.632   1.00 21.38 ? 821  8DG A O6    1 
HETATM 7354 N  N1    . 8DG G 3 .   ? -22.103 -19.017 9.766   1.00 24.46 ? 821  8DG A N1    1 
HETATM 7355 C  C2    . 8DG G 3 .   ? -23.363 -18.455 9.867   1.00 27.90 ? 821  8DG A C2    1 
HETATM 7356 N  N2    . 8DG G 3 .   ? -23.664 -17.896 11.049  1.00 25.85 ? 821  8DG A N2    1 
HETATM 7357 N  N3    . 8DG G 3 .   ? -24.245 -18.443 8.895   1.00 27.47 ? 821  8DG A N3    1 
HETATM 7358 C  C4    . 8DG G 3 .   ? -23.791 -19.053 7.774   1.00 25.83 ? 821  8DG A C4    1 
HETATM 7359 O  O8    . 8DG G 3 .   ? -24.076 -20.124 4.599   1.00 23.53 ? 821  8DG A O8    1 
HETATM 7360 P  PG    . 8DG H 3 .   ? 5.418   -31.667 10.183  1.00 26.62 ? 825  8DG A PG    1 
HETATM 7361 O  O1G   . 8DG H 3 .   ? 4.045   -31.329 10.704  1.00 27.23 ? 825  8DG A O1G   1 
HETATM 7362 O  O2G   . 8DG H 3 .   ? 6.285   -30.460 9.961   1.00 27.53 ? 825  8DG A O2G   1 
HETATM 7363 O  O3G   . 8DG H 3 .   ? 5.279   -32.450 8.884   1.00 26.00 ? 825  8DG A O3G   1 
HETATM 7364 O  O3B   . 8DG H 3 .   ? 6.142   -32.563 11.295  1.00 29.29 ? 825  8DG A O3B   1 
HETATM 7365 P  PB    . 8DG H 3 .   ? 7.310   -33.665 11.097  1.00 29.91 ? 825  8DG A PB    1 
HETATM 7366 O  O1B   . 8DG H 3 .   ? 8.388   -33.130 10.249  1.00 29.52 ? 825  8DG A O1B   1 
HETATM 7367 O  O2B   . 8DG H 3 .   ? 6.736   -34.920 10.566  1.00 32.25 ? 825  8DG A O2B   1 
HETATM 7368 O  O3A   . 8DG H 3 .   ? 7.871   -33.877 12.563  1.00 33.58 ? 825  8DG A O3A   1 
HETATM 7369 P  PA    . 8DG H 3 .   ? 7.231   -33.834 14.040  1.00 33.04 ? 825  8DG A PA    1 
HETATM 7370 O  O1A   . 8DG H 3 .   ? 8.263   -34.345 14.995  1.00 33.29 ? 825  8DG A O1A   1 
HETATM 7371 O  O2A   . 8DG H 3 .   ? 5.943   -34.590 14.008  1.00 32.06 ? 825  8DG A O2A   1 
HETATM 7372 O  "O5'" . 8DG H 3 .   ? 6.994   -32.278 14.224  1.00 31.75 ? 825  8DG A "O5'" 1 
HETATM 7373 C  "C5'" . 8DG H 3 .   ? 8.058   -31.353 14.478  1.00 32.45 ? 825  8DG A "C5'" 1 
HETATM 7374 C  "C4'" . 8DG H 3 .   ? 7.435   -30.040 14.866  1.00 32.16 ? 825  8DG A "C4'" 1 
HETATM 7375 O  "O4'" . 8DG H 3 .   ? 8.417   -29.018 15.196  1.00 31.33 ? 825  8DG A "O4'" 1 
HETATM 7376 C  "C3'" . 8DG H 3 .   ? 6.552   -29.403 13.766  1.00 31.96 ? 825  8DG A "C3'" 1 
HETATM 7377 O  "O3'" . 8DG H 3 .   ? 5.176   -29.442 14.144  1.00 29.50 ? 825  8DG A "O3'" 1 
HETATM 7378 C  "C2'" . 8DG H 3 .   ? 7.088   -28.006 13.635  1.00 31.05 ? 825  8DG A "C2'" 1 
HETATM 7379 C  "C1'" . 8DG H 3 .   ? 7.720   -27.819 14.971  1.00 32.71 ? 825  8DG A "C1'" 1 
HETATM 7380 N  N9    . 8DG H 3 .   ? 8.622   -26.671 15.073  1.00 31.91 ? 825  8DG A N9    1 
HETATM 7381 C  C8    . 8DG H 3 .   ? 9.680   -26.332 14.250  1.00 30.27 ? 825  8DG A C8    1 
HETATM 7382 N  N7    . 8DG H 3 .   ? 10.271  -25.220 14.612  1.00 26.41 ? 825  8DG A N7    1 
HETATM 7383 C  C5    . 8DG H 3 .   ? 9.563   -24.811 15.738  1.00 28.14 ? 825  8DG A C5    1 
HETATM 7384 C  C6    . 8DG H 3 .   ? 9.719   -23.671 16.575  1.00 27.37 ? 825  8DG A C6    1 
HETATM 7385 O  O6    . 8DG H 3 .   ? 10.533  -22.746 16.500  1.00 22.68 ? 825  8DG A O6    1 
HETATM 7386 N  N1    . 8DG H 3 .   ? 8.776   -23.659 17.617  1.00 29.95 ? 825  8DG A N1    1 
HETATM 7387 C  C2    . 8DG H 3 .   ? 7.808   -24.637 17.802  1.00 29.13 ? 825  8DG A C2    1 
HETATM 7388 N  N2    . 8DG H 3 .   ? 6.995   -24.469 18.849  1.00 28.16 ? 825  8DG A N2    1 
HETATM 7389 N  N3    . 8DG H 3 .   ? 7.658   -25.681 17.025  1.00 29.23 ? 825  8DG A N3    1 
HETATM 7390 C  C4    . 8DG H 3 .   ? 8.560   -25.710 16.020  1.00 28.75 ? 825  8DG A C4    1 
HETATM 7391 O  O8    . 8DG H 3 .   ? 9.978   -27.043 13.287  1.00 29.12 ? 825  8DG A O8    1 
HETATM 7392 ZN ZN    . ZN  I 2 .   ? -28.431 15.047  1.710   1.00 25.42 ? 1002 ZN  B ZN    1 
HETATM 7393 ZN ZN    . ZN  J 2 .   ? 3.179   31.067  9.560   1.00 34.33 ? 1003 ZN  C ZN    1 
HETATM 7394 P  PG    . 8DG K 3 .   ? -26.458 22.250  2.224   1.00 30.98 ? 822  8DG C PG    1 
HETATM 7395 O  O1G   . 8DG K 3 .   ? -26.220 20.805  1.881   1.00 32.59 ? 822  8DG C O1G   1 
HETATM 7396 O  O2G   . 8DG K 3 .   ? -26.346 23.168  1.043   1.00 32.00 ? 822  8DG C O2G   1 
HETATM 7397 O  O3G   . 8DG K 3 .   ? -25.472 22.693  3.296   1.00 31.24 ? 822  8DG C O3G   1 
HETATM 7398 O  O3B   . 8DG K 3 .   ? -27.949 22.353  2.796   1.00 36.33 ? 822  8DG C O3B   1 
HETATM 7399 P  PB    . 8DG K 3 .   ? -29.313 22.657  1.993   1.00 40.13 ? 822  8DG C PB    1 
HETATM 7400 O  O1B   . 8DG K 3 .   ? -29.417 21.765  0.825   1.00 38.30 ? 822  8DG C O1B   1 
HETATM 7401 O  O2B   . 8DG K 3 .   ? -29.381 24.087  1.627   1.00 42.47 ? 822  8DG C O2B   1 
HETATM 7402 O  O3A   . 8DG K 3 .   ? -30.468 22.282  3.023   1.00 38.26 ? 822  8DG C O3A   1 
HETATM 7403 P  PA    . 8DG K 3 .   ? -30.637 22.367  4.630   1.00 37.21 ? 822  8DG C PA    1 
HETATM 7404 O  O1A   . 8DG K 3 .   ? -32.056 22.036  4.973   1.00 31.79 ? 822  8DG C O1A   1 
HETATM 7405 O  O2A   . 8DG K 3 .   ? -30.167 23.715  5.060   1.00 36.31 ? 822  8DG C O2A   1 
HETATM 7406 O  "O5'" . 8DG K 3 .   ? -29.643 21.223  5.097   1.00 35.90 ? 822  8DG C "O5'" 1 
HETATM 7407 C  "C5'" . 8DG K 3 .   ? -29.938 19.828  4.966   1.00 34.66 ? 822  8DG C "C5'" 1 
HETATM 7408 C  "C4'" . 8DG K 3 .   ? -28.923 19.068  5.778   1.00 35.08 ? 822  8DG C "C4'" 1 
HETATM 7409 O  "O4'" . 8DG K 3 .   ? -29.156 17.634  5.771   1.00 35.59 ? 822  8DG C "O4'" 1 
HETATM 7410 C  "C3'" . 8DG K 3 .   ? -27.461 19.234  5.299   1.00 35.11 ? 822  8DG C "C3'" 1 
HETATM 7411 O  "O3'" . 8DG K 3 .   ? -26.718 20.016  6.230   1.00 30.32 ? 822  8DG C "O3'" 1 
HETATM 7412 C  "C2'" . 8DG K 3 .   ? -26.952 17.822  5.171   1.00 35.12 ? 822  8DG C "C2'" 1 
HETATM 7413 C  "C1'" . 8DG K 3 .   ? -27.893 17.090  6.071   1.00 33.68 ? 822  8DG C "C1'" 1 
HETATM 7414 N  N9    . 8DG K 3 .   ? -27.926 15.626  5.909   1.00 33.96 ? 822  8DG C N9    1 
HETATM 7415 C  C8    . 8DG K 3 .   ? -28.133 14.884  4.755   1.00 33.60 ? 822  8DG C C8    1 
HETATM 7416 N  N7    . 8DG K 3 .   ? -28.080 13.586  4.962   1.00 30.26 ? 822  8DG C N7    1 
HETATM 7417 C  C5    . 8DG K 3 .   ? -27.826 13.472  6.332   1.00 31.20 ? 822  8DG C C5    1 
HETATM 7418 C  C6    . 8DG K 3 .   ? -27.652 12.321  7.165   1.00 32.19 ? 822  8DG C C6    1 
HETATM 7419 O  O6    . 8DG K 3 .   ? -27.678 11.121  6.871   1.00 26.49 ? 822  8DG C O6    1 
HETATM 7420 N  N1    . 8DG K 3 .   ? -27.419 12.678  8.505   1.00 30.51 ? 822  8DG C N1    1 
HETATM 7421 C  C2    . 8DG K 3 .   ? -27.362 13.986  8.964   1.00 33.77 ? 822  8DG C C2    1 
HETATM 7422 N  N2    . 8DG K 3 .   ? -27.135 14.135  10.275  1.00 31.63 ? 822  8DG C N2    1 
HETATM 7423 N  N3    . 8DG K 3 .   ? -27.512 15.047  8.199   1.00 31.05 ? 822  8DG C N3    1 
HETATM 7424 C  C4    . 8DG K 3 .   ? -27.741 14.725  6.904   1.00 31.10 ? 822  8DG C C4    1 
HETATM 7425 O  O8    . 8DG K 3 .   ? -28.336 15.447  3.679   1.00 29.92 ? 822  8DG C O8    1 
HETATM 7426 ZN ZN    . ZN  L 2 .   ? 27.612  4.882   15.699  1.00 24.67 ? 1004 ZN  D ZN    1 
HETATM 7427 P  PG    . 8DG M 3 .   ? 10.413  31.347  11.259  1.00 34.97 ? 823  8DG D PG    1 
HETATM 7428 O  O1G   . 8DG M 3 .   ? 11.026  30.401  12.254  1.00 34.51 ? 823  8DG D O1G   1 
HETATM 7429 O  O2G   . 8DG M 3 .   ? 9.229   30.781  10.524  1.00 35.08 ? 823  8DG D O2G   1 
HETATM 7430 O  O3G   . 8DG M 3 .   ? 11.480  31.780  10.254  1.00 34.98 ? 823  8DG D O3G   1 
HETATM 7431 O  O3B   . 8DG M 3 .   ? 9.881   32.610  12.080  1.00 42.08 ? 823  8DG D O3B   1 
HETATM 7432 P  PB    . 8DG M 3 .   ? 9.836   34.150  11.615  1.00 45.87 ? 823  8DG D PB    1 
HETATM 7433 O  O1B   . 8DG M 3 .   ? 9.211   34.258  10.284  1.00 44.50 ? 823  8DG D O1B   1 
HETATM 7434 O  O2B   . 8DG M 3 .   ? 11.192  34.733  11.655  1.00 45.59 ? 823  8DG D O2B   1 
HETATM 7435 O  O3A   . 8DG M 3 .   ? 8.883   34.843  12.686  1.00 45.97 ? 823  8DG D O3A   1 
HETATM 7436 P  PA    . 8DG M 3 .   ? 8.693   34.744  14.292  1.00 44.82 ? 823  8DG D PA    1 
HETATM 7437 O  O1A   . 8DG M 3 .   ? 7.872   35.912  14.728  1.00 44.73 ? 823  8DG D O1A   1 
HETATM 7438 O  O2A   . 8DG M 3 .   ? 10.046  34.647  14.904  1.00 43.29 ? 823  8DG D O2A   1 
HETATM 7439 O  "O5'" . 8DG M 3 .   ? 7.887   33.378  14.426  1.00 42.94 ? 823  8DG D "O5'" 1 
HETATM 7440 C  "C5'" . 8DG M 3 .   ? 6.489   33.244  14.129  1.00 41.07 ? 823  8DG D "C5'" 1 
HETATM 7441 C  "C4'" . 8DG M 3 .   ? 6.073   31.839  14.495  1.00 38.91 ? 823  8DG D "C4'" 1 
HETATM 7442 O  "O4'" . 8DG M 3 .   ? 4.663   31.581  14.259  1.00 40.72 ? 823  8DG D "O4'" 1 
HETATM 7443 C  "C3'" . 8DG M 3 .   ? 6.814   30.731  13.715  1.00 39.01 ? 823  8DG D "C3'" 1 
HETATM 7444 O  "O3'" . 8DG M 3 .   ? 7.766   30.083  14.554  1.00 39.54 ? 823  8DG D "O3'" 1 
HETATM 7445 C  "C2'" . 8DG M 3 .   ? 5.721   29.809  13.234  1.00 38.91 ? 823  8DG D "C2'" 1 
HETATM 7446 C  "C1'" . 8DG M 3 .   ? 4.585   30.172  14.136  1.00 39.57 ? 823  8DG D "C1'" 1 
HETATM 7447 N  N9    . 8DG M 3 .   ? 3.243   29.803  13.659  1.00 37.33 ? 823  8DG D N9    1 
HETATM 7448 C  C8    . 8DG M 3 .   ? 2.688   30.013  12.406  1.00 37.50 ? 823  8DG D C8    1 
HETATM 7449 N  N7    . 8DG M 3 .   ? 1.465   29.548  12.302  1.00 34.16 ? 823  8DG D N7    1 
HETATM 7450 C  C5    . 8DG M 3 .   ? 1.199   29.004  13.557  1.00 35.81 ? 823  8DG D C5    1 
HETATM 7451 C  C6    . 8DG M 3 .   ? 0.039   28.345  14.066  1.00 36.51 ? 823  8DG D C6    1 
HETATM 7452 O  O6    . 8DG M 3 .   ? -1.034  28.090  13.506  1.00 37.22 ? 823  8DG D O6    1 
HETATM 7453 N  N1    . 8DG M 3 .   ? 0.207   27.954  15.404  1.00 36.98 ? 823  8DG D N1    1 
HETATM 7454 C  C2    . 8DG M 3 .   ? 1.359   28.177  16.143  1.00 35.72 ? 823  8DG D C2    1 
HETATM 7455 N  N2    . 8DG M 3 .   ? 1.337   27.736  17.405  1.00 35.12 ? 823  8DG D N2    1 
HETATM 7456 N  N3    . 8DG M 3 .   ? 2.432   28.779  15.678  1.00 37.35 ? 823  8DG D N3    1 
HETATM 7457 C  C4    . 8DG M 3 .   ? 2.290   29.167  14.386  1.00 35.00 ? 823  8DG D C4    1 
HETATM 7458 O  O8    . 8DG M 3 .   ? 3.335   30.581  11.519  1.00 37.09 ? 823  8DG D O8    1 
HETATM 7459 P  PG    . 8DG N 3 .   ? 30.061  -2.093  16.376  1.00 25.10 ? 824  8DG D PG    1 
HETATM 7460 O  O1G   . 8DG N 3 .   ? 30.944  -2.742  15.354  1.00 24.06 ? 824  8DG D O1G   1 
HETATM 7461 O  O2G   . 8DG N 3 .   ? 29.126  -3.064  17.047  1.00 23.87 ? 824  8DG D O2G   1 
HETATM 7462 O  O3G   . 8DG N 3 .   ? 29.246  -0.979  15.728  1.00 26.47 ? 824  8DG D O3G   1 
HETATM 7463 O  O3B   . 8DG N 3 .   ? 31.002  -1.479  17.521  1.00 28.91 ? 824  8DG D O3B   1 
HETATM 7464 P  PB    . 8DG N 3 .   ? 32.460  -0.789  17.386  1.00 33.43 ? 824  8DG D PB    1 
HETATM 7465 O  O1B   . 8DG N 3 .   ? 32.483  0.142   16.240  1.00 33.51 ? 824  8DG D O1B   1 
HETATM 7466 O  O2B   . 8DG N 3 .   ? 33.514  -1.827  17.303  1.00 34.19 ? 824  8DG D O2B   1 
HETATM 7467 O  O3A   . 8DG N 3 .   ? 32.593  0.041   18.732  1.00 33.11 ? 824  8DG D O3A   1 
HETATM 7468 P  PA    . 8DG N 3 .   ? 32.092  -0.178  20.252  1.00 30.09 ? 824  8DG D PA    1 
HETATM 7469 O  O1A   . 8DG N 3 .   ? 32.791  0.829   21.114  1.00 27.86 ? 824  8DG D O1A   1 
HETATM 7470 O  O2A   . 8DG N 3 .   ? 32.323  -1.607  20.600  1.00 28.31 ? 824  8DG D O2A   1 
HETATM 7471 O  "O5'" . 8DG N 3 .   ? 30.550  0.152   20.127  1.00 28.64 ? 824  8DG D "O5'" 1 
HETATM 7472 C  "C5'" . 8DG N 3 .   ? 30.044  1.479   19.955  1.00 31.56 ? 824  8DG D "C5'" 1 
HETATM 7473 C  "C4'" . 8DG N 3 .   ? 28.555  1.430   20.166  1.00 29.58 ? 824  8DG D "C4'" 1 
HETATM 7474 O  "O4'" . 8DG N 3 .   ? 27.924  2.729   20.031  1.00 31.60 ? 824  8DG D "O4'" 1 
HETATM 7475 C  "C3'" . 8DG N 3 .   ? 27.797  0.517   19.173  1.00 31.82 ? 824  8DG D "C3'" 1 
HETATM 7476 O  "O3'" . 8DG N 3 .   ? 27.335  -0.660  19.830  1.00 27.91 ? 824  8DG D "O3'" 1 
HETATM 7477 C  "C2'" . 8DG N 3 .   ? 26.680  1.380   18.653  1.00 30.17 ? 824  8DG D "C2'" 1 
HETATM 7478 C  "C1'" . 8DG N 3 .   ? 26.589  2.417   19.721  1.00 30.32 ? 824  8DG D "C1'" 1 
HETATM 7479 N  N9    . 8DG N 3 .   ? 25.857  3.637   19.358  1.00 29.04 ? 824  8DG D N9    1 
HETATM 7480 C  C8    . 8DG N 3 .   ? 26.076  4.498   18.298  1.00 28.44 ? 824  8DG D C8    1 
HETATM 7481 N  N7    . 8DG N 3 .   ? 25.217  5.489   18.257  1.00 25.80 ? 824  8DG D N7    1 
HETATM 7482 C  C5    . 8DG N 3 .   ? 24.392  5.263   19.359  1.00 28.93 ? 824  8DG D C5    1 
HETATM 7483 C  C6    . 8DG N 3 .   ? 23.266  5.987   19.854  1.00 29.19 ? 824  8DG D C6    1 
HETATM 7484 O  O6    . 8DG N 3 .   ? 22.731  7.010   19.419  1.00 26.69 ? 824  8DG D O6    1 
HETATM 7485 N  N1    . 8DG N 3 .   ? 22.734  5.392   21.010  1.00 31.23 ? 824  8DG D N1    1 
HETATM 7486 C  C2    . 8DG N 3 .   ? 23.236  4.243   21.599  1.00 30.72 ? 824  8DG D C2    1 
HETATM 7487 N  N2    . 8DG N 3 .   ? 22.601  3.825   22.700  1.00 31.35 ? 824  8DG D N2    1 
HETATM 7488 N  N3    . 8DG N 3 .   ? 24.267  3.570   21.143  1.00 31.14 ? 824  8DG D N3    1 
HETATM 7489 C  C4    . 8DG N 3 .   ? 24.796  4.130   20.028  1.00 28.22 ? 824  8DG D C4    1 
HETATM 7490 O  O8    . 8DG N 3 .   ? 26.997  4.294   17.508  1.00 28.21 ? 824  8DG D O8    1 
HETATM 7491 ZN ZN    . ZN  O 2 .   ? 11.040  -27.100 11.578  1.00 22.54 ? 1005 ZN  E ZN    1 
HETATM 7492 O  O     . HOH P 4 .   ? 6.384   -16.628 23.347  1.00 14.63 ? 1002 HOH A O     1 
HETATM 7493 O  O     . HOH P 4 .   ? -14.488 -28.777 3.245   1.00 11.22 ? 1003 HOH A O     1 
HETATM 7494 O  O     . HOH P 4 .   ? -19.887 -20.001 1.381   1.00 16.26 ? 1004 HOH A O     1 
HETATM 7495 O  O     . HOH P 4 .   ? -22.848 -16.422 -9.848  1.00 15.77 ? 1005 HOH A O     1 
HETATM 7496 O  O     . HOH P 4 .   ? -7.702  -25.433 5.035   1.00 17.70 ? 1006 HOH A O     1 
HETATM 7497 O  O     . HOH P 4 .   ? -17.059 -30.688 12.932  1.00 18.97 ? 1007 HOH A O     1 
HETATM 7498 O  O     . HOH P 4 .   ? -22.204 -12.433 -7.668  1.00 15.49 ? 1008 HOH A O     1 
HETATM 7499 O  O     . HOH P 4 .   ? -1.741  -23.582 1.568   1.00 16.85 ? 1009 HOH A O     1 
HETATM 7500 O  O     . HOH P 4 .   ? -11.896 -27.561 2.771   1.00 15.27 ? 1010 HOH A O     1 
HETATM 7501 O  O     . HOH P 4 .   ? -4.677  -32.110 8.914   1.00 20.33 ? 1011 HOH A O     1 
HETATM 7502 O  O     . HOH P 4 .   ? -26.294 -14.711 0.128   1.00 16.80 ? 1012 HOH A O     1 
HETATM 7503 O  O     . HOH P 4 .   ? 4.172   -23.334 19.914  1.00 17.65 ? 1013 HOH A O     1 
HETATM 7504 O  O     . HOH P 4 .   ? -7.268  -12.257 9.017   1.00 17.00 ? 1014 HOH A O     1 
HETATM 7505 O  O     . HOH P 4 .   ? -17.941 -12.781 2.594   1.00 20.40 ? 1015 HOH A O     1 
HETATM 7506 O  O     . HOH P 4 .   ? -7.163  -26.593 2.639   1.00 20.96 ? 1016 HOH A O     1 
HETATM 7507 O  O     . HOH P 4 .   ? -25.903 -24.201 11.179  1.00 25.79 ? 1017 HOH A O     1 
HETATM 7508 O  O     . HOH P 4 .   ? -19.107 -29.663 11.208  1.00 21.45 ? 1018 HOH A O     1 
HETATM 7509 O  O     . HOH P 4 .   ? 0.736   -26.129 27.768  1.00 27.14 ? 1019 HOH A O     1 
HETATM 7510 O  O     . HOH P 4 .   ? -15.700 -39.475 -14.670 1.00 24.04 ? 1020 HOH A O     1 
HETATM 7511 O  O     . HOH P 4 .   ? -29.085 -18.979 -5.263  1.00 25.51 ? 1021 HOH A O     1 
HETATM 7512 O  O     . HOH P 4 .   ? -17.359 -18.668 20.525  1.00 21.29 ? 1022 HOH A O     1 
HETATM 7513 O  O     . HOH P 4 .   ? -2.023  -12.628 9.126   1.00 26.79 ? 1023 HOH A O     1 
HETATM 7514 O  O     . HOH P 4 .   ? -8.761  -7.978  8.959   1.00 26.19 ? 1024 HOH A O     1 
HETATM 7515 O  O     . HOH P 4 .   ? -15.105 -9.688  0.576   1.00 21.90 ? 1025 HOH A O     1 
HETATM 7516 O  O     . HOH P 4 .   ? -8.435  -6.340  17.025  1.00 25.73 ? 1026 HOH A O     1 
HETATM 7517 O  O     . HOH P 4 .   ? -14.205 -34.528 16.076  1.00 39.89 ? 1027 HOH A O     1 
HETATM 7518 O  O     . HOH P 4 .   ? -28.974 -16.093 -5.809  1.00 20.60 ? 1028 HOH A O     1 
HETATM 7519 O  O     . HOH P 4 .   ? -16.616 -30.476 -24.252 1.00 29.41 ? 1029 HOH A O     1 
HETATM 7520 O  O     . HOH P 4 .   ? 7.587   -21.133 25.576  1.00 25.49 ? 1030 HOH A O     1 
HETATM 7521 O  O     . HOH P 4 .   ? -28.801 -13.141 -6.367  1.00 28.10 ? 1031 HOH A O     1 
HETATM 7522 O  O     . HOH P 4 .   ? -21.201 -25.907 -22.049 1.00 20.87 ? 1032 HOH A O     1 
HETATM 7523 O  O     . HOH P 4 .   ? -12.920 -34.996 -19.422 1.00 28.87 ? 1033 HOH A O     1 
HETATM 7524 O  O     . HOH P 4 .   ? 0.912   -6.477  16.208  1.00 29.85 ? 1034 HOH A O     1 
HETATM 7525 O  O     . HOH P 4 .   ? 2.840   -8.591  16.701  1.00 27.98 ? 1035 HOH A O     1 
HETATM 7526 O  O     . HOH P 4 .   ? 2.581   -10.916 23.786  1.00 26.49 ? 1036 HOH A O     1 
HETATM 7527 O  O     . HOH P 4 .   ? -6.510  -17.014 2.118   1.00 42.69 ? 1037 HOH A O     1 
HETATM 7528 O  O     . HOH P 4 .   ? -20.767 -19.629 4.248   1.00 35.17 ? 1038 HOH A O     1 
HETATM 7529 O  O     . HOH P 4 .   ? 7.072   -27.692 10.597  1.00 27.76 ? 1039 HOH A O     1 
HETATM 7530 O  O     . HOH P 4 .   ? -33.644 -30.866 -14.661 1.00 29.31 ? 1040 HOH A O     1 
HETATM 7531 O  O     . HOH P 4 .   ? -25.370 -4.340  -2.643  1.00 25.98 ? 1041 HOH A O     1 
HETATM 7532 O  O     . HOH P 4 .   ? 9.995   -34.202 8.206   1.00 27.14 ? 1042 HOH A O     1 
HETATM 7533 O  O     . HOH P 4 .   ? -0.169  -6.876  21.681  1.00 18.44 ? 1043 HOH A O     1 
HETATM 7534 O  O     . HOH P 4 .   ? 8.504   -13.719 29.939  1.00 26.25 ? 1044 HOH A O     1 
HETATM 7535 O  O     . HOH P 4 .   ? -27.328 -11.237 -10.163 1.00 25.90 ? 1045 HOH A O     1 
HETATM 7536 O  O     . HOH P 4 .   ? -2.348  -33.884 9.280   1.00 27.39 ? 1046 HOH A O     1 
HETATM 7537 O  O     . HOH P 4 .   ? -19.056 -10.320 0.727   1.00 25.85 ? 1047 HOH A O     1 
HETATM 7538 O  O     . HOH P 4 .   ? -0.066  -8.238  12.660  1.00 41.81 ? 1048 HOH A O     1 
HETATM 7539 O  O     . HOH P 4 .   ? -3.452  -4.382  23.948  1.00 24.75 ? 1049 HOH A O     1 
HETATM 7540 O  O     . HOH P 4 .   ? -0.425  -5.894  26.100  1.00 22.35 ? 1050 HOH A O     1 
HETATM 7541 O  O     . HOH P 4 .   ? -24.051 -7.318  -6.059  1.00 21.15 ? 1051 HOH A O     1 
HETATM 7542 O  O     . HOH P 4 .   ? -6.550  -32.674 6.342   1.00 30.38 ? 1052 HOH A O     1 
HETATM 7543 O  O     . HOH P 4 .   ? -10.000 -36.831 17.290  1.00 30.61 ? 1053 HOH A O     1 
HETATM 7544 O  O     . HOH P 4 .   ? -6.836  -5.434  21.237  1.00 24.13 ? 1054 HOH A O     1 
HETATM 7545 O  O     . HOH P 4 .   ? -3.230  -6.237  27.248  1.00 36.15 ? 1055 HOH A O     1 
HETATM 7546 O  O     . HOH P 4 .   ? -6.809  -2.568  22.328  1.00 39.11 ? 1056 HOH A O     1 
HETATM 7547 O  O     . HOH P 4 .   ? -13.197 -40.823 -8.207  1.00 34.37 ? 1057 HOH A O     1 
HETATM 7548 O  O     . HOH P 4 .   ? 1.355   -34.961 12.313  1.00 34.35 ? 1058 HOH A O     1 
HETATM 7549 O  O     . HOH P 4 .   ? -7.178  -37.718 1.103   1.00 38.02 ? 1059 HOH A O     1 
HETATM 7550 O  O     . HOH P 4 .   ? -25.207 -16.945 2.193   1.00 33.29 ? 1060 HOH A O     1 
HETATM 7551 O  O     . HOH P 4 .   ? 3.571   -10.493 30.085  1.00 28.12 ? 1061 HOH A O     1 
HETATM 7552 O  O     . HOH P 4 .   ? -5.647  -39.038 11.409  1.00 26.05 ? 1062 HOH A O     1 
HETATM 7553 O  O     . HOH P 4 .   ? -14.232 -4.324  3.052   1.00 29.60 ? 1063 HOH A O     1 
HETATM 7554 O  O     . HOH P 4 .   ? -19.371 -37.378 -17.248 1.00 29.40 ? 1064 HOH A O     1 
HETATM 7555 O  O     . HOH P 4 .   ? -7.241  -39.031 18.759  1.00 36.94 ? 1065 HOH A O     1 
HETATM 7556 O  O     . HOH P 4 .   ? -12.449 -30.018 19.135  1.00 30.61 ? 1066 HOH A O     1 
HETATM 7557 O  O     . HOH P 4 .   ? -10.813 -29.248 24.978  1.00 32.44 ? 1067 HOH A O     1 
HETATM 7558 O  O     . HOH P 4 .   ? -3.005  -30.499 6.946   1.00 27.29 ? 1068 HOH A O     1 
HETATM 7559 O  O     . HOH P 4 .   ? -12.906 -5.429  -0.792  1.00 35.37 ? 1069 HOH A O     1 
HETATM 7560 O  O     . HOH P 4 .   ? -18.523 -27.027 22.348  1.00 37.24 ? 1070 HOH A O     1 
HETATM 7561 O  O     . HOH P 4 .   ? -12.103 -37.445 15.111  1.00 34.73 ? 1071 HOH A O     1 
HETATM 7562 O  O     . HOH P 4 .   ? 11.069  -27.153 23.601  1.00 40.45 ? 1072 HOH A O     1 
HETATM 7563 O  O     . HOH P 4 .   ? -3.258  -27.367 3.773   1.00 30.73 ? 1073 HOH A O     1 
HETATM 7564 O  O     . HOH P 4 .   ? -14.614 -46.072 -3.391  1.00 43.54 ? 1074 HOH A O     1 
HETATM 7565 O  O     . HOH P 4 .   ? -25.436 -41.588 -12.824 1.00 34.28 ? 1075 HOH A O     1 
HETATM 7566 O  O     . HOH P 4 .   ? 1.303   -35.943 9.159   1.00 43.90 ? 1076 HOH A O     1 
HETATM 7567 O  O     . HOH P 4 .   ? -1.564  -8.444  29.025  1.00 28.58 ? 1077 HOH A O     1 
HETATM 7568 O  O     . HOH P 4 .   ? -28.958 -32.357 -19.682 1.00 36.07 ? 1078 HOH A O     1 
HETATM 7569 O  O     . HOH P 4 .   ? -32.350 -16.768 -1.459  1.00 31.31 ? 1079 HOH A O     1 
HETATM 7570 O  O     . HOH P 4 .   ? -10.121 -3.809  6.052   1.00 44.93 ? 1080 HOH A O     1 
HETATM 7571 O  O     . HOH P 4 .   ? -0.069  -37.018 19.491  1.00 29.53 ? 1081 HOH A O     1 
HETATM 7572 O  O     . HOH P 4 .   ? -0.160  -28.796 30.515  1.00 45.27 ? 1082 HOH A O     1 
HETATM 7573 O  O     . HOH P 4 .   ? -17.429 -33.060 -26.943 1.00 36.59 ? 1083 HOH A O     1 
HETATM 7574 O  O     . HOH P 4 .   ? -18.521 -19.316 18.076  1.00 37.92 ? 1084 HOH A O     1 
HETATM 7575 O  O     . HOH P 4 .   ? -0.728  -34.598 23.820  1.00 37.64 ? 1085 HOH A O     1 
HETATM 7576 O  O     . HOH P 4 .   ? -20.464 -33.734 -27.285 1.00 41.64 ? 1086 HOH A O     1 
HETATM 7577 O  O     . HOH P 4 .   ? -15.841 -36.446 13.085  1.00 44.98 ? 1087 HOH A O     1 
HETATM 7578 O  O     . HOH P 4 .   ? 14.143  -21.136 27.538  1.00 36.55 ? 1088 HOH A O     1 
HETATM 7579 O  O     . HOH P 4 .   ? -14.451 -6.430  5.129   1.00 29.55 ? 1089 HOH A O     1 
HETATM 7580 O  O     . HOH P 4 .   ? -5.786  -10.049 11.618  1.00 34.94 ? 1090 HOH A O     1 
HETATM 7581 O  O     . HOH P 4 .   ? 4.952   -22.724 30.994  1.00 39.74 ? 1091 HOH A O     1 
HETATM 7582 O  O     . HOH P 4 .   ? -19.288 -31.759 15.357  1.00 44.45 ? 1092 HOH A O     1 
HETATM 7583 O  O     . HOH P 4 .   ? -12.836 -13.110 21.273  1.00 28.61 ? 1093 HOH A O     1 
HETATM 7584 O  O     . HOH Q 4 .   ? -27.557 -1.448  0.075   1.00 17.65 ? 1003 HOH B O     1 
HETATM 7585 O  O     . HOH Q 4 .   ? -23.830 -15.133 12.800  1.00 16.44 ? 1004 HOH B O     1 
HETATM 7586 O  O     . HOH Q 4 .   ? -32.641 4.269   -1.260  1.00 15.09 ? 1005 HOH B O     1 
HETATM 7587 O  O     . HOH Q 4 .   ? -36.890 3.543   7.931   1.00 19.58 ? 1006 HOH B O     1 
HETATM 7588 O  O     . HOH Q 4 .   ? -23.175 -5.570  -3.732  1.00 16.74 ? 1007 HOH B O     1 
HETATM 7589 O  O     . HOH Q 4 .   ? -28.967 -1.578  27.934  1.00 19.23 ? 1008 HOH B O     1 
HETATM 7590 O  O     . HOH Q 4 .   ? -10.473 -6.687  18.966  1.00 14.38 ? 1009 HOH B O     1 
HETATM 7591 O  O     . HOH Q 4 .   ? -23.488 20.139  1.049   1.00 23.56 ? 1010 HOH B O     1 
HETATM 7592 O  O     . HOH Q 4 .   ? -28.820 -14.722 20.368  1.00 20.70 ? 1011 HOH B O     1 
HETATM 7593 O  O     . HOH Q 4 .   ? -17.564 -16.105 17.098  1.00 16.73 ? 1012 HOH B O     1 
HETATM 7594 O  O     . HOH Q 4 .   ? -29.468 -1.522  25.255  1.00 17.38 ? 1013 HOH B O     1 
HETATM 7595 O  O     . HOH Q 4 .   ? -33.174 -7.274  1.747   1.00 18.94 ? 1014 HOH B O     1 
HETATM 7596 O  O     . HOH Q 4 .   ? -26.267 12.219  -0.117  1.00 18.42 ? 1015 HOH B O     1 
HETATM 7597 O  O     . HOH Q 4 .   ? -11.407 0.164   20.225  1.00 18.38 ? 1016 HOH B O     1 
HETATM 7598 O  O     . HOH Q 4 .   ? -10.229 -8.619  13.391  1.00 25.15 ? 1017 HOH B O     1 
HETATM 7599 O  O     . HOH Q 4 .   ? -35.587 -1.893  13.084  1.00 23.35 ? 1018 HOH B O     1 
HETATM 7600 O  O     . HOH Q 4 .   ? -27.965 -1.689  -2.653  1.00 24.08 ? 1019 HOH B O     1 
HETATM 7601 O  O     . HOH Q 4 .   ? -22.286 18.687  -9.569  1.00 23.86 ? 1020 HOH B O     1 
HETATM 7602 O  O     . HOH Q 4 .   ? -34.088 14.078  9.315   1.00 28.21 ? 1021 HOH B O     1 
HETATM 7603 O  O     . HOH Q 4 .   ? -40.824 -5.749  9.647   1.00 26.75 ? 1022 HOH B O     1 
HETATM 7604 O  O     . HOH Q 4 .   ? -39.951 -0.309  9.586   1.00 37.28 ? 1023 HOH B O     1 
HETATM 7605 O  O     . HOH Q 4 .   ? -9.850  -3.341  22.200  1.00 20.71 ? 1024 HOH B O     1 
HETATM 7606 O  O     . HOH Q 4 .   ? -21.611 -18.906 18.357  1.00 22.11 ? 1025 HOH B O     1 
HETATM 7607 O  O     . HOH Q 4 .   ? -18.612 18.976  -6.622  1.00 22.29 ? 1026 HOH B O     1 
HETATM 7608 O  O     . HOH Q 4 .   ? -15.616 1.222   6.846   1.00 22.35 ? 1027 HOH B O     1 
HETATM 7609 O  O     . HOH Q 4 .   ? -40.142 5.963   -20.711 1.00 26.56 ? 1028 HOH B O     1 
HETATM 7610 O  O     . HOH Q 4 .   ? -10.451 -7.132  23.663  1.00 20.31 ? 1029 HOH B O     1 
HETATM 7611 O  O     . HOH Q 4 .   ? -14.983 11.347  0.780   1.00 23.09 ? 1030 HOH B O     1 
HETATM 7612 O  O     . HOH Q 4 .   ? -35.131 -4.384  18.958  1.00 23.95 ? 1031 HOH B O     1 
HETATM 7613 O  O     . HOH Q 4 .   ? -12.444 4.067   8.049   1.00 26.09 ? 1032 HOH B O     1 
HETATM 7614 O  O     . HOH Q 4 .   ? -25.296 -23.552 14.416  1.00 30.08 ? 1033 HOH B O     1 
HETATM 7615 O  O     . HOH Q 4 .   ? -24.900 23.718  -4.623  1.00 25.71 ? 1034 HOH B O     1 
HETATM 7616 O  O     . HOH Q 4 .   ? -30.900 -7.870  -0.100  1.00 28.97 ? 1035 HOH B O     1 
HETATM 7617 O  O     . HOH Q 4 .   ? -16.716 14.666  1.268   1.00 23.29 ? 1036 HOH B O     1 
HETATM 7618 O  O     . HOH Q 4 .   ? -22.032 24.244  -4.570  1.00 30.08 ? 1037 HOH B O     1 
HETATM 7619 O  O     . HOH Q 4 .   ? -34.248 -14.538 3.360   1.00 28.57 ? 1038 HOH B O     1 
HETATM 7620 O  O     . HOH Q 4 .   ? -36.527 6.157   6.842   1.00 25.67 ? 1039 HOH B O     1 
HETATM 7621 O  O     . HOH Q 4 .   ? -20.193 6.228   16.398  1.00 29.62 ? 1040 HOH B O     1 
HETATM 7622 O  O     . HOH Q 4 .   ? -33.886 -5.107  -0.428  1.00 24.57 ? 1041 HOH B O     1 
HETATM 7623 O  O     . HOH Q 4 .   ? -34.459 0.864   -14.218 1.00 23.04 ? 1042 HOH B O     1 
HETATM 7624 O  O     . HOH Q 4 .   ? -20.975 -7.626  30.151  1.00 30.41 ? 1043 HOH B O     1 
HETATM 7625 O  O     . HOH Q 4 .   ? -27.112 6.001   18.032  1.00 24.35 ? 1044 HOH B O     1 
HETATM 7626 O  O     . HOH Q 4 .   ? -12.245 2.450   16.132  1.00 22.81 ? 1045 HOH B O     1 
HETATM 7627 O  O     . HOH Q 4 .   ? -27.645 -6.430  -2.316  1.00 26.50 ? 1046 HOH B O     1 
HETATM 7628 O  O     . HOH Q 4 .   ? -19.179 12.499  2.394   1.00 25.65 ? 1047 HOH B O     1 
HETATM 7629 O  O     . HOH Q 4 .   ? -33.950 -9.973  1.175   1.00 26.99 ? 1048 HOH B O     1 
HETATM 7630 O  O     . HOH Q 4 .   ? -28.886 -6.946  23.432  1.00 30.81 ? 1049 HOH B O     1 
HETATM 7631 O  O     . HOH Q 4 .   ? -19.221 24.602  -7.989  1.00 29.94 ? 1050 HOH B O     1 
HETATM 7632 O  O     . HOH Q 4 .   ? -28.514 17.052  -23.873 1.00 27.54 ? 1051 HOH B O     1 
HETATM 7633 O  O     . HOH Q 4 .   ? -32.488 -12.451 -3.723  1.00 39.74 ? 1052 HOH B O     1 
HETATM 7634 O  O     . HOH Q 4 .   ? -37.888 -15.452 10.030  1.00 26.57 ? 1053 HOH B O     1 
HETATM 7635 O  O     . HOH Q 4 .   ? -13.326 -3.069  8.738   1.00 37.19 ? 1054 HOH B O     1 
HETATM 7636 O  O     . HOH Q 4 .   ? -40.276 -8.932  2.701   1.00 36.80 ? 1055 HOH B O     1 
HETATM 7637 O  O     . HOH Q 4 .   ? -10.091 11.728  4.284   1.00 34.90 ? 1056 HOH B O     1 
HETATM 7638 O  O     . HOH Q 4 .   ? -27.769 22.806  -4.657  1.00 41.53 ? 1057 HOH B O     1 
HETATM 7639 O  O     . HOH Q 4 .   ? -33.169 12.587  -30.734 1.00 36.27 ? 1058 HOH B O     1 
HETATM 7640 O  O     . HOH Q 4 .   ? -19.433 -25.419 18.985  1.00 36.12 ? 1059 HOH B O     1 
HETATM 7641 O  O     . HOH Q 4 .   ? -15.276 1.776   10.476  1.00 37.81 ? 1060 HOH B O     1 
HETATM 7642 O  O     . HOH Q 4 .   ? -23.599 -21.088 23.377  1.00 35.39 ? 1061 HOH B O     1 
HETATM 7643 O  O     . HOH Q 4 .   ? -37.885 -4.940  -6.417  1.00 32.48 ? 1062 HOH B O     1 
HETATM 7644 O  O     . HOH Q 4 .   ? -30.313 11.968  -27.722 1.00 35.02 ? 1063 HOH B O     1 
HETATM 7645 O  O     . HOH Q 4 .   ? -12.919 23.112  0.642   1.00 33.99 ? 1064 HOH B O     1 
HETATM 7646 O  O     . HOH Q 4 .   ? -32.561 14.232  -6.066  1.00 35.46 ? 1065 HOH B O     1 
HETATM 7647 O  O     . HOH Q 4 .   ? -31.324 18.859  -25.173 1.00 37.56 ? 1066 HOH B O     1 
HETATM 7648 O  O     . HOH Q 4 .   ? -30.286 10.603  -7.169  1.00 44.37 ? 1067 HOH B O     1 
HETATM 7649 O  O     . HOH Q 4 .   ? -10.430 11.034  -0.227  1.00 47.60 ? 1068 HOH B O     1 
HETATM 7650 O  O     . HOH Q 4 .   ? -8.766  -6.060  13.821  1.00 43.65 ? 1069 HOH B O     1 
HETATM 7651 O  O     . HOH Q 4 .   ? -15.359 3.596   4.347   1.00 45.85 ? 1070 HOH B O     1 
HETATM 7652 O  O     . HOH Q 4 .   ? -35.189 -13.656 0.410   1.00 41.44 ? 1071 HOH B O     1 
HETATM 7653 O  O     . HOH Q 4 .   ? -16.915 3.174   0.950   1.00 46.75 ? 1072 HOH B O     1 
HETATM 7654 O  O     . HOH Q 4 .   ? -4.087  -3.256  11.165  1.00 35.56 ? 1073 HOH B O     1 
HETATM 7655 O  O     . HOH Q 4 .   ? -41.027 -2.084  -4.876  1.00 35.27 ? 1074 HOH B O     1 
HETATM 7656 O  O     . HOH Q 4 .   ? -13.731 -7.820  25.881  1.00 30.47 ? 1075 HOH B O     1 
HETATM 7657 O  O     . HOH Q 4 .   ? -18.629 -13.332 25.335  1.00 36.46 ? 1076 HOH B O     1 
HETATM 7658 O  O     . HOH Q 4 .   ? -20.066 -8.393  27.242  1.00 27.83 ? 1077 HOH B O     1 
HETATM 7659 O  O     . HOH Q 4 .   ? -24.914 -10.798 29.282  1.00 38.97 ? 1078 HOH B O     1 
HETATM 7660 O  O     . HOH Q 4 .   ? -18.068 -1.663  31.530  1.00 48.42 ? 1079 HOH B O     1 
HETATM 7661 O  O     . HOH Q 4 .   ? -33.301 8.948   -10.359 1.00 38.22 ? 1080 HOH B O     1 
HETATM 7662 O  O     . HOH Q 4 .   ? -11.459 -4.585  24.884  1.00 33.94 ? 1081 HOH B O     1 
HETATM 7663 O  O     . HOH Q 4 .   ? -35.144 4.058   18.938  1.00 44.30 ? 1082 HOH B O     1 
HETATM 7664 O  O     . HOH Q 4 .   ? -38.860 4.844   10.421  1.00 47.71 ? 1083 HOH B O     1 
HETATM 7665 O  O     . HOH Q 4 .   ? -38.137 -15.948 3.578   1.00 34.58 ? 1084 HOH B O     1 
HETATM 7666 O  O     . HOH Q 4 .   ? -40.204 -5.083  -1.407  1.00 42.70 ? 1085 HOH B O     1 
HETATM 7667 O  O     . HOH Q 4 .   ? -26.555 -23.690 21.270  1.00 39.43 ? 1086 HOH B O     1 
HETATM 7668 O  O     . HOH Q 4 .   ? -37.722 -9.536  1.027   1.00 42.96 ? 1087 HOH B O     1 
HETATM 7669 O  O     . HOH Q 4 .   ? -45.975 13.756  -17.767 1.00 34.23 ? 1088 HOH B O     1 
HETATM 7670 O  O     . HOH Q 4 .   ? -19.128 -23.868 22.682  1.00 40.82 ? 1089 HOH B O     1 
HETATM 7671 O  O     . HOH Q 4 .   ? -36.558 -14.645 14.939  1.00 42.02 ? 1090 HOH B O     1 
HETATM 7672 O  O     . HOH R 4 .   ? -24.233 7.645   15.557  1.00 16.09 ? 1004 HOH C O     1 
HETATM 7673 O  O     . HOH R 4 .   ? -11.528 25.471  4.211   1.00 25.04 ? 1005 HOH C O     1 
HETATM 7674 O  O     . HOH R 4 .   ? -7.980  32.321  5.054   1.00 21.92 ? 1006 HOH C O     1 
HETATM 7675 O  O     . HOH R 4 .   ? -24.929 14.615  12.652  1.00 19.35 ? 1007 HOH C O     1 
HETATM 7676 O  O     . HOH R 4 .   ? -14.280 4.009   12.334  1.00 31.48 ? 1008 HOH C O     1 
HETATM 7677 O  O     . HOH R 4 .   ? 11.470  25.109  0.770   1.00 22.67 ? 1009 HOH C O     1 
HETATM 7678 O  O     . HOH R 4 .   ? 4.429   17.629  5.614   1.00 26.80 ? 1010 HOH C O     1 
HETATM 7679 O  O     . HOH R 4 .   ? -13.353 21.037  -1.244  1.00 24.62 ? 1011 HOH C O     1 
HETATM 7680 O  O     . HOH R 4 .   ? -18.546 5.123   18.499  1.00 25.21 ? 1012 HOH C O     1 
HETATM 7681 O  O     . HOH R 4 .   ? -4.479  21.725  20.485  1.00 25.37 ? 1013 HOH C O     1 
HETATM 7682 O  O     . HOH R 4 .   ? -19.251 28.528  5.440   1.00 25.66 ? 1014 HOH C O     1 
HETATM 7683 O  O     . HOH R 4 .   ? -5.931  13.764  9.377   1.00 23.03 ? 1015 HOH C O     1 
HETATM 7684 O  O     . HOH R 4 .   ? 10.547  29.075  -1.506  1.00 28.77 ? 1016 HOH C O     1 
HETATM 7685 O  O     . HOH R 4 .   ? -17.156 35.081  14.938  1.00 37.37 ? 1017 HOH C O     1 
HETATM 7686 O  O     . HOH R 4 .   ? 3.986   20.846  11.150  1.00 25.35 ? 1018 HOH C O     1 
HETATM 7687 O  O     . HOH R 4 .   ? 1.232   28.487  9.770   1.00 42.83 ? 1019 HOH C O     1 
HETATM 7688 O  O     . HOH R 4 .   ? -14.681 2.393   22.609  1.00 24.69 ? 1020 HOH C O     1 
HETATM 7689 O  O     . HOH R 4 .   ? -13.427 3.715   18.387  1.00 24.07 ? 1021 HOH C O     1 
HETATM 7690 O  O     . HOH R 4 .   ? 1.641   28.621  6.809   1.00 25.45 ? 1022 HOH C O     1 
HETATM 7691 O  O     . HOH R 4 .   ? -28.523 10.210  16.576  1.00 27.85 ? 1023 HOH C O     1 
HETATM 7692 O  O     . HOH R 4 .   ? -2.441  11.563  10.663  1.00 25.61 ? 1024 HOH C O     1 
HETATM 7693 O  O     . HOH R 4 .   ? -11.331 33.961  14.407  1.00 32.40 ? 1025 HOH C O     1 
HETATM 7694 O  O     . HOH R 4 .   ? -11.515 26.519  1.639   1.00 26.28 ? 1026 HOH C O     1 
HETATM 7695 O  O     . HOH R 4 .   ? -7.480  6.368   21.114  1.00 32.23 ? 1027 HOH C O     1 
HETATM 7696 O  O     . HOH R 4 .   ? -8.808  29.922  3.581   1.00 26.52 ? 1028 HOH C O     1 
HETATM 7697 O  O     . HOH R 4 .   ? -6.071  18.287  2.131   1.00 40.68 ? 1029 HOH C O     1 
HETATM 7698 O  O     . HOH R 4 .   ? 16.047  19.042  7.745   1.00 27.88 ? 1030 HOH C O     1 
HETATM 7699 O  O     . HOH R 4 .   ? 16.612  27.579  0.826   1.00 28.23 ? 1031 HOH C O     1 
HETATM 7700 O  O     . HOH R 4 .   ? -27.446 17.702  20.750  1.00 35.34 ? 1032 HOH C O     1 
HETATM 7701 O  O     . HOH R 4 .   ? 5.974   13.443  3.987   1.00 35.91 ? 1033 HOH C O     1 
HETATM 7702 O  O     . HOH R 4 .   ? 6.821   20.113  7.204   1.00 27.88 ? 1034 HOH C O     1 
HETATM 7703 O  O     . HOH R 4 .   ? -16.258 21.532  28.616  1.00 35.09 ? 1035 HOH C O     1 
HETATM 7704 O  O     . HOH R 4 .   ? 13.405  31.825  4.895   1.00 31.17 ? 1036 HOH C O     1 
HETATM 7705 O  O     . HOH R 4 .   ? 5.031   11.493  11.001  1.00 36.97 ? 1037 HOH C O     1 
HETATM 7706 O  O     . HOH R 4 .   ? -5.101  8.651   17.896  1.00 27.43 ? 1038 HOH C O     1 
HETATM 7707 O  O     . HOH R 4 .   ? -33.321 13.197  12.511  1.00 42.40 ? 1039 HOH C O     1 
HETATM 7708 O  O     . HOH R 4 .   ? -11.457 3.114   13.057  1.00 43.76 ? 1040 HOH C O     1 
HETATM 7709 O  O     . HOH R 4 .   ? -21.664 34.445  14.289  1.00 47.63 ? 1041 HOH C O     1 
HETATM 7710 O  O     . HOH R 4 .   ? 6.018   12.403  8.298   1.00 35.64 ? 1042 HOH C O     1 
HETATM 7711 O  O     . HOH R 4 .   ? 14.044  41.896  -9.066  1.00 43.67 ? 1043 HOH C O     1 
HETATM 7712 O  O     . HOH R 4 .   ? -16.763 29.664  18.099  1.00 33.20 ? 1044 HOH C O     1 
HETATM 7713 O  O     . HOH R 4 .   ? 3.929   21.548  8.231   1.00 27.18 ? 1045 HOH C O     1 
HETATM 7714 O  O     . HOH R 4 .   ? -9.609  35.914  -7.948  1.00 39.74 ? 1046 HOH C O     1 
HETATM 7715 O  O     . HOH R 4 .   ? -26.559 26.803  5.390   1.00 42.26 ? 1047 HOH C O     1 
HETATM 7716 O  O     . HOH R 4 .   ? -22.826 27.553  -0.888  1.00 50.29 ? 1048 HOH C O     1 
HETATM 7717 O  O     . HOH R 4 .   ? -8.560  34.608  13.937  1.00 36.36 ? 1049 HOH C O     1 
HETATM 7718 O  O     . HOH R 4 .   ? -9.834  11.308  7.167   1.00 39.32 ? 1050 HOH C O     1 
HETATM 7719 O  O     . HOH R 4 .   ? 14.920  21.867  3.743   1.00 28.46 ? 1051 HOH C O     1 
HETATM 7720 O  O     . HOH R 4 .   ? -22.051 3.126   23.674  1.00 38.60 ? 1052 HOH C O     1 
HETATM 7721 O  O     . HOH R 4 .   ? -6.387  3.804   22.695  1.00 44.25 ? 1053 HOH C O     1 
HETATM 7722 O  O     . HOH R 4 .   ? 4.027   14.078  9.954   1.00 37.69 ? 1054 HOH C O     1 
HETATM 7723 O  O     . HOH R 4 .   ? -19.782 27.660  22.743  1.00 38.39 ? 1055 HOH C O     1 
HETATM 7724 O  O     . HOH R 4 .   ? 6.846   17.454  1.678   1.00 35.85 ? 1056 HOH C O     1 
HETATM 7725 O  O     . HOH R 4 .   ? -2.380  36.243  -2.634  1.00 45.94 ? 1057 HOH C O     1 
HETATM 7726 O  O     . HOH R 4 .   ? -0.868  44.987  -12.742 1.00 43.35 ? 1058 HOH C O     1 
HETATM 7727 O  O     . HOH R 4 .   ? -17.153 30.417  3.630   1.00 39.69 ? 1059 HOH C O     1 
HETATM 7728 O  O     . HOH R 4 .   ? 13.438  12.460  3.425   1.00 41.28 ? 1060 HOH C O     1 
HETATM 7729 O  O     . HOH R 4 .   ? -4.883  7.951   11.523  1.00 46.13 ? 1061 HOH C O     1 
HETATM 7730 O  O     . HOH R 4 .   ? -10.783 3.411   21.976  1.00 32.39 ? 1062 HOH C O     1 
HETATM 7731 O  O     . HOH R 4 .   ? 8.963   37.491  -14.519 1.00 32.65 ? 1063 HOH C O     1 
HETATM 7732 O  O     . HOH R 4 .   ? -16.782 36.061  -1.196  1.00 46.02 ? 1064 HOH C O     1 
HETATM 7733 O  O     . HOH R 4 .   ? -9.468  10.011  9.808   1.00 34.39 ? 1065 HOH C O     1 
HETATM 7734 O  O     . HOH R 4 .   ? -10.081 13.302  30.752  1.00 37.33 ? 1066 HOH C O     1 
HETATM 7735 O  O     . HOH R 4 .   ? -10.451 50.196  3.914   1.00 47.06 ? 1067 HOH C O     1 
HETATM 7736 O  O     . HOH R 4 .   ? -22.059 28.446  4.337   1.00 35.43 ? 1068 HOH C O     1 
HETATM 7737 O  O     . HOH R 4 .   ? -18.596 26.750  2.730   1.00 41.55 ? 1069 HOH C O     1 
HETATM 7738 O  O     . HOH R 4 .   ? -1.120  51.217  -7.360  1.00 50.44 ? 1070 HOH C O     1 
HETATM 7739 O  O     . HOH R 4 .   ? -29.656 12.150  22.374  1.00 50.97 ? 1071 HOH C O     1 
HETATM 7740 O  O     . HOH S 4 .   ? 27.272  -1.902  13.543  1.00 20.82 ? 1005 HOH D O     1 
HETATM 7741 O  O     . HOH S 4 .   ? 29.905  0.079   3.408   1.00 16.48 ? 1006 HOH D O     1 
HETATM 7742 O  O     . HOH S 4 .   ? 26.211  -2.661  4.602   1.00 15.74 ? 1007 HOH D O     1 
HETATM 7743 O  O     . HOH S 4 .   ? 9.726   28.218  9.114   1.00 22.32 ? 1008 HOH D O     1 
HETATM 7744 O  O     . HOH S 4 .   ? 2.532   25.306  19.416  1.00 22.35 ? 1009 HOH D O     1 
HETATM 7745 O  O     . HOH S 4 .   ? 14.379  19.525  5.612   1.00 19.81 ? 1010 HOH D O     1 
HETATM 7746 O  O     . HOH S 4 .   ? 14.466  6.743   25.282  1.00 20.04 ? 1011 HOH D O     1 
HETATM 7747 O  O     . HOH S 4 .   ? 25.658  16.573  13.311  1.00 20.66 ? 1012 HOH D O     1 
HETATM 7748 O  O     . HOH S 4 .   ? 9.773   -3.507  12.082  1.00 31.57 ? 1013 HOH D O     1 
HETATM 7749 O  O     . HOH S 4 .   ? 24.494  18.215  23.263  1.00 24.71 ? 1014 HOH D O     1 
HETATM 7750 O  O     . HOH S 4 .   ? -3.946  12.215  14.946  1.00 29.24 ? 1015 HOH D O     1 
HETATM 7751 O  O     . HOH S 4 .   ? 18.298  18.030  11.607  1.00 21.41 ? 1016 HOH D O     1 
HETATM 7752 O  O     . HOH S 4 .   ? 38.503  25.214  15.857  1.00 34.72 ? 1017 HOH D O     1 
HETATM 7753 O  O     . HOH S 4 .   ? 19.234  1.491   12.025  1.00 24.51 ? 1018 HOH D O     1 
HETATM 7754 O  O     . HOH S 4 .   ? 18.158  25.889  14.577  1.00 23.67 ? 1019 HOH D O     1 
HETATM 7755 O  O     . HOH S 4 .   ? 30.345  -6.853  4.441   1.00 26.46 ? 1020 HOH D O     1 
HETATM 7756 O  O     . HOH S 4 .   ? 23.405  17.011  11.590  1.00 22.59 ? 1021 HOH D O     1 
HETATM 7757 O  O     . HOH S 4 .   ? 39.169  12.328  -10.192 1.00 24.16 ? 1022 HOH D O     1 
HETATM 7758 O  O     . HOH S 4 .   ? 33.885  -0.828  10.365  1.00 29.73 ? 1023 HOH D O     1 
HETATM 7759 O  O     . HOH S 4 .   ? 26.198  16.057  22.460  1.00 26.21 ? 1024 HOH D O     1 
HETATM 7760 O  O     . HOH S 4 .   ? 23.352  23.146  25.306  1.00 36.85 ? 1025 HOH D O     1 
HETATM 7761 O  O     . HOH S 4 .   ? 32.561  -3.324  9.735   1.00 24.68 ? 1026 HOH D O     1 
HETATM 7762 O  O     . HOH S 4 .   ? 3.186   26.645  28.268  1.00 39.60 ? 1027 HOH D O     1 
HETATM 7763 O  O     . HOH S 4 .   ? -3.716  26.240  22.755  1.00 30.06 ? 1028 HOH D O     1 
HETATM 7764 O  O     . HOH S 4 .   ? 18.259  0.822   14.885  1.00 23.04 ? 1029 HOH D O     1 
HETATM 7765 O  O     . HOH S 4 .   ? 25.153  6.263   12.882  1.00 22.09 ? 1030 HOH D O     1 
HETATM 7766 O  O     . HOH S 4 .   ? 42.396  17.601  -2.058  1.00 22.52 ? 1031 HOH D O     1 
HETATM 7767 O  O     . HOH S 4 .   ? -5.360  15.014  21.762  1.00 28.86 ? 1032 HOH D O     1 
HETATM 7768 O  O     . HOH S 4 .   ? 16.292  0.451   8.570   1.00 25.42 ? 1033 HOH D O     1 
HETATM 7769 O  O     . HOH S 4 .   ? 21.178  27.781  24.893  1.00 38.09 ? 1034 HOH D O     1 
HETATM 7770 O  O     . HOH S 4 .   ? 42.748  13.680  -12.001 1.00 33.00 ? 1035 HOH D O     1 
HETATM 7771 O  O     . HOH S 4 .   ? 19.546  18.897  9.281   1.00 27.47 ? 1036 HOH D O     1 
HETATM 7772 O  O     . HOH S 4 .   ? 8.517   8.160   12.940  1.00 24.27 ? 1037 HOH D O     1 
HETATM 7773 O  O     . HOH S 4 .   ? 7.279   4.004   12.890  1.00 29.93 ? 1038 HOH D O     1 
HETATM 7774 O  O     . HOH S 4 .   ? 30.816  -5.509  8.717   1.00 24.69 ? 1039 HOH D O     1 
HETATM 7775 O  O     . HOH S 4 .   ? 2.684   3.906   19.775  1.00 27.71 ? 1040 HOH D O     1 
HETATM 7776 O  O     . HOH S 4 .   ? 44.275  24.327  5.316   1.00 29.42 ? 1041 HOH D O     1 
HETATM 7777 O  O     . HOH S 4 .   ? 13.756  11.106  7.355   1.00 39.42 ? 1042 HOH D O     1 
HETATM 7778 O  O     . HOH S 4 .   ? 30.525  21.871  1.972   1.00 27.74 ? 1043 HOH D O     1 
HETATM 7779 O  O     . HOH S 4 .   ? 47.629  4.390   5.394   1.00 32.68 ? 1044 HOH D O     1 
HETATM 7780 O  O     . HOH S 4 .   ? 39.316  6.683   -6.941  1.00 23.59 ? 1045 HOH D O     1 
HETATM 7781 O  O     . HOH S 4 .   ? 28.316  7.467   24.661  1.00 35.99 ? 1046 HOH D O     1 
HETATM 7782 O  O     . HOH S 4 .   ? -4.979  9.868   20.571  1.00 26.67 ? 1047 HOH D O     1 
HETATM 7783 O  O     . HOH S 4 .   ? 40.420  21.953  -0.722  1.00 30.04 ? 1048 HOH D O     1 
HETATM 7784 O  O     . HOH S 4 .   ? 19.083  -1.090  10.260  1.00 28.96 ? 1049 HOH D O     1 
HETATM 7785 O  O     . HOH S 4 .   ? 6.746   29.260  10.386  1.00 32.08 ? 1050 HOH D O     1 
HETATM 7786 O  O     . HOH S 4 .   ? 18.454  21.034  26.670  1.00 33.87 ? 1051 HOH D O     1 
HETATM 7787 O  O     . HOH S 4 .   ? 26.897  0.819   15.459  1.00 32.81 ? 1052 HOH D O     1 
HETATM 7788 O  O     . HOH S 4 .   ? 0.188   2.816   12.381  1.00 35.75 ? 1053 HOH D O     1 
HETATM 7789 O  O     . HOH S 4 .   ? 20.830  24.698  13.085  1.00 32.17 ? 1054 HOH D O     1 
HETATM 7790 O  O     . HOH S 4 .   ? 7.964   7.497   26.495  1.00 26.72 ? 1055 HOH D O     1 
HETATM 7791 O  O     . HOH S 4 .   ? 14.259  32.154  15.159  1.00 44.74 ? 1056 HOH D O     1 
HETATM 7792 O  O     . HOH S 4 .   ? -0.675  4.579   22.542  1.00 24.31 ? 1057 HOH D O     1 
HETATM 7793 O  O     . HOH S 4 .   ? 39.040  8.153   -10.012 1.00 44.79 ? 1058 HOH D O     1 
HETATM 7794 O  O     . HOH S 4 .   ? -7.071  9.367   24.585  1.00 31.62 ? 1059 HOH D O     1 
HETATM 7795 O  O     . HOH S 4 .   ? 38.440  29.353  9.671   1.00 40.58 ? 1060 HOH D O     1 
HETATM 7796 O  O     . HOH S 4 .   ? 43.458  6.727   -6.331  1.00 45.65 ? 1061 HOH D O     1 
HETATM 7797 O  O     . HOH S 4 .   ? 9.047   15.571  34.837  1.00 41.26 ? 1062 HOH D O     1 
HETATM 7798 O  O     . HOH S 4 .   ? 18.858  15.463  32.217  1.00 47.20 ? 1063 HOH D O     1 
HETATM 7799 O  O     . HOH S 4 .   ? 6.888   -1.297  10.775  1.00 43.04 ? 1064 HOH D O     1 
HETATM 7800 O  O     . HOH S 4 .   ? -4.889  14.116  28.719  1.00 44.23 ? 1065 HOH D O     1 
HETATM 7801 O  O     . HOH S 4 .   ? -2.996  2.770   22.990  1.00 40.61 ? 1066 HOH D O     1 
HETATM 7802 O  O     . HOH S 4 .   ? 17.625  -0.881  4.460   1.00 39.49 ? 1067 HOH D O     1 
HETATM 7803 O  O     . HOH S 4 .   ? 16.536  22.330  8.698   1.00 32.30 ? 1068 HOH D O     1 
HETATM 7804 O  O     . HOH S 4 .   ? 35.024  -2.021  12.894  1.00 39.46 ? 1069 HOH D O     1 
HETATM 7805 O  O     . HOH S 4 .   ? -5.264  7.910   26.632  1.00 35.06 ? 1070 HOH D O     1 
HETATM 7806 O  O     . HOH S 4 .   ? 46.167  7.061   -4.736  1.00 47.74 ? 1071 HOH D O     1 
HETATM 7807 O  O     . HOH S 4 .   ? 47.330  18.267  5.037   1.00 37.80 ? 1072 HOH D O     1 
HETATM 7808 O  O     . HOH S 4 .   ? 44.392  2.765   -2.645  1.00 41.27 ? 1073 HOH D O     1 
HETATM 7809 O  O     . HOH S 4 .   ? 44.252  28.942  11.360  1.00 46.06 ? 1074 HOH D O     1 
HETATM 7810 O  O     . HOH S 4 .   ? 16.585  8.811   26.873  1.00 38.14 ? 1075 HOH D O     1 
HETATM 7811 O  O     . HOH S 4 .   ? -3.720  9.189   15.071  1.00 39.80 ? 1076 HOH D O     1 
HETATM 7812 O  O     . HOH S 4 .   ? 47.413  7.511   -0.752  1.00 34.58 ? 1077 HOH D O     1 
HETATM 7813 O  O     . HOH S 4 .   ? 12.041  -1.227  11.776  1.00 39.31 ? 1078 HOH D O     1 
HETATM 7814 O  O     . HOH S 4 .   ? 2.907   7.094   33.938  1.00 38.37 ? 1079 HOH D O     1 
HETATM 7815 O  O     . HOH S 4 .   ? 3.372   19.478  35.498  1.00 40.41 ? 1080 HOH D O     1 
HETATM 7816 O  O     . HOH S 4 .   ? -4.814  6.712   23.480  1.00 35.14 ? 1081 HOH D O     1 
HETATM 7817 O  O     . HOH T 4 .   ? 21.340  -21.052 12.337  1.00 14.50 ? 1006 HOH E O     1 
HETATM 7818 O  O     . HOH T 4 .   ? 5.457   -25.734 -0.667  1.00 15.41 ? 1007 HOH E O     1 
HETATM 7819 O  O     . HOH T 4 .   ? 21.413  -18.499 11.124  1.00 13.76 ? 1008 HOH E O     1 
HETATM 7820 O  O     . HOH T 4 .   ? 21.442  -8.244  7.529   1.00 16.21 ? 1009 HOH E O     1 
HETATM 7821 O  O     . HOH T 4 .   ? 19.620  -23.825 20.956  1.00 21.16 ? 1010 HOH E O     1 
HETATM 7822 O  O     . HOH T 4 .   ? 33.919  -29.536 -2.279  1.00 18.05 ? 1011 HOH E O     1 
HETATM 7823 O  O     . HOH T 4 .   ? 20.510  -13.256 12.278  1.00 17.78 ? 1012 HOH E O     1 
HETATM 7824 O  O     . HOH T 4 .   ? 11.379  -10.820 35.659  1.00 25.67 ? 1013 HOH E O     1 
HETATM 7825 O  O     . HOH T 4 .   ? 20.350  1.709   23.898  1.00 19.99 ? 1014 HOH E O     1 
HETATM 7826 O  O     . HOH T 4 .   ? 9.388   -27.951 -1.673  1.00 18.83 ? 1015 HOH E O     1 
HETATM 7827 O  O     . HOH T 4 .   ? 7.721   -7.792  12.850  1.00 16.85 ? 1016 HOH E O     1 
HETATM 7828 O  O     . HOH T 4 .   ? 27.047  -11.667 16.939  1.00 18.85 ? 1017 HOH E O     1 
HETATM 7829 O  O     . HOH T 4 .   ? 11.983  -23.927 9.491   1.00 22.89 ? 1018 HOH E O     1 
HETATM 7830 O  O     . HOH T 4 .   ? 20.913  -21.863 22.471  1.00 21.67 ? 1019 HOH E O     1 
HETATM 7831 O  O     . HOH T 4 .   ? 6.307   -32.799 3.160   1.00 21.72 ? 1020 HOH E O     1 
HETATM 7832 O  O     . HOH T 4 .   ? 8.278   -16.547 27.002  1.00 23.90 ? 1021 HOH E O     1 
HETATM 7833 O  O     . HOH T 4 .   ? 5.094   -28.420 7.995   1.00 18.67 ? 1022 HOH E O     1 
HETATM 7834 O  O     . HOH T 4 .   ? 10.727  -23.855 12.258  1.00 38.57 ? 1023 HOH E O     1 
HETATM 7835 O  O     . HOH T 4 .   ? 5.628   -19.636 8.824   1.00 23.54 ? 1024 HOH E O     1 
HETATM 7836 O  O     . HOH T 4 .   ? 8.854   -33.491 4.202   1.00 27.56 ? 1025 HOH E O     1 
HETATM 7837 O  O     . HOH T 4 .   ? 26.414  -29.443 -13.410 1.00 23.54 ? 1026 HOH E O     1 
HETATM 7838 O  O     . HOH T 4 .   ? 6.864   4.406   17.695  1.00 27.40 ? 1027 HOH E O     1 
HETATM 7839 O  O     . HOH T 4 .   ? 7.747   5.097   25.004  1.00 23.59 ? 1028 HOH E O     1 
HETATM 7840 O  O     . HOH T 4 .   ? 29.785  -21.249 2.009   1.00 21.92 ? 1029 HOH E O     1 
HETATM 7841 O  O     . HOH T 4 .   ? 20.441  -0.497  32.744  1.00 28.60 ? 1030 HOH E O     1 
HETATM 7842 O  O     . HOH T 4 .   ? 20.678  -32.200 -11.606 1.00 21.81 ? 1031 HOH E O     1 
HETATM 7843 O  O     . HOH T 4 .   ? 4.027   -19.601 11.247  1.00 21.76 ? 1032 HOH E O     1 
HETATM 7844 O  O     . HOH T 4 .   ? 31.256  -6.220  19.807  1.00 33.52 ? 1033 HOH E O     1 
HETATM 7845 O  O     . HOH T 4 .   ? 28.317  -16.172 26.942  1.00 35.23 ? 1034 HOH E O     1 
HETATM 7846 O  O     . HOH T 4 .   ? 3.150   -30.670 -2.497  1.00 27.13 ? 1035 HOH E O     1 
HETATM 7847 O  O     . HOH T 4 .   ? -4.198  -24.511 2.761   1.00 31.85 ? 1036 HOH E O     1 
HETATM 7848 O  O     . HOH T 4 .   ? 36.472  -28.273 -2.505  1.00 27.40 ? 1037 HOH E O     1 
HETATM 7849 O  O     . HOH T 4 .   ? 3.909   -31.674 1.909   1.00 30.24 ? 1038 HOH E O     1 
HETATM 7850 O  O     . HOH T 4 .   ? 4.207   -16.405 5.501   1.00 26.15 ? 1039 HOH E O     1 
HETATM 7851 O  O     . HOH T 4 .   ? 3.605   -7.900  11.959  1.00 33.83 ? 1040 HOH E O     1 
HETATM 7852 O  O     . HOH T 4 .   ? 14.223  -10.693 5.614   1.00 36.31 ? 1041 HOH E O     1 
HETATM 7853 O  O     . HOH T 4 .   ? 3.558   3.250   22.586  1.00 19.48 ? 1042 HOH E O     1 
HETATM 7854 O  O     . HOH T 4 .   ? 29.537  -10.046 17.269  1.00 26.55 ? 1043 HOH E O     1 
HETATM 7855 O  O     . HOH T 4 .   ? -4.184  -16.860 -0.993  1.00 28.10 ? 1044 HOH E O     1 
HETATM 7856 O  O     . HOH T 4 .   ? 10.346  -4.327  39.476  1.00 22.01 ? 1045 HOH E O     1 
HETATM 7857 O  O     . HOH T 4 .   ? 1.614   4.590   26.710  1.00 24.84 ? 1046 HOH E O     1 
HETATM 7858 O  O     . HOH T 4 .   ? 29.475  -31.923 -15.314 1.00 30.43 ? 1047 HOH E O     1 
HETATM 7859 O  O     . HOH T 4 .   ? 12.059  -28.829 20.580  1.00 32.14 ? 1048 HOH E O     1 
HETATM 7860 O  O     . HOH T 4 .   ? 22.170  -13.771 10.058  1.00 26.27 ? 1049 HOH E O     1 
HETATM 7861 O  O     . HOH T 4 .   ? 24.245  -9.254  35.574  1.00 28.52 ? 1050 HOH E O     1 
HETATM 7862 O  O     . HOH T 4 .   ? 1.605   -13.465 2.627   1.00 31.80 ? 1051 HOH E O     1 
HETATM 7863 O  O     . HOH T 4 .   ? 0.439   -4.305  35.794  1.00 33.08 ? 1052 HOH E O     1 
HETATM 7864 O  O     . HOH T 4 .   ? 31.764  -32.417 -4.933  1.00 29.32 ? 1053 HOH E O     1 
HETATM 7865 O  O     . HOH T 4 .   ? 20.706  -16.007 27.429  1.00 26.22 ? 1054 HOH E O     1 
HETATM 7866 O  O     . HOH T 4 .   ? 18.569  6.734   28.296  1.00 28.35 ? 1055 HOH E O     1 
HETATM 7867 O  O     . HOH T 4 .   ? 0.650   -5.594  19.267  1.00 27.14 ? 1056 HOH E O     1 
HETATM 7868 O  O     . HOH T 4 .   ? 32.499  -20.214 7.924   1.00 32.70 ? 1057 HOH E O     1 
HETATM 7869 O  O     . HOH T 4 .   ? 4.609   -10.621 25.782  1.00 20.77 ? 1058 HOH E O     1 
HETATM 7870 O  O     . HOH T 4 .   ? 17.641  -29.781 6.564   1.00 27.18 ? 1059 HOH E O     1 
HETATM 7871 O  O     . HOH T 4 .   ? -0.366  1.626   24.537  1.00 22.76 ? 1060 HOH E O     1 
HETATM 7872 O  O     . HOH T 4 .   ? 14.634  -6.594  34.496  1.00 30.77 ? 1061 HOH E O     1 
HETATM 7873 O  O     . HOH T 4 .   ? -0.587  -8.517  8.670   1.00 39.75 ? 1062 HOH E O     1 
HETATM 7874 O  O     . HOH T 4 .   ? 3.476   -3.108  11.743  1.00 37.40 ? 1063 HOH E O     1 
HETATM 7875 O  O     . HOH T 4 .   ? 12.319  -0.619  38.809  1.00 40.53 ? 1064 HOH E O     1 
HETATM 7876 O  O     . HOH T 4 .   ? 32.297  -18.654 11.154  1.00 40.15 ? 1065 HOH E O     1 
HETATM 7877 O  O     . HOH T 4 .   ? 7.385   0.393   34.382  1.00 28.11 ? 1066 HOH E O     1 
HETATM 7878 O  O     . HOH T 4 .   ? 22.195  -1.354  36.123  1.00 42.70 ? 1067 HOH E O     1 
HETATM 7879 O  O     . HOH T 4 .   ? 22.422  -30.716 -13.910 1.00 39.73 ? 1068 HOH E O     1 
HETATM 7880 O  O     . HOH T 4 .   ? 23.940  -40.707 -6.560  1.00 42.91 ? 1069 HOH E O     1 
HETATM 7881 O  O     . HOH T 4 .   ? 26.700  -10.255 14.271  1.00 35.66 ? 1070 HOH E O     1 
HETATM 7882 O  O     . HOH T 4 .   ? 4.195   3.041   16.998  1.00 33.82 ? 1071 HOH E O     1 
HETATM 7883 O  O     . HOH T 4 .   ? 24.239  -9.801  10.847  1.00 25.47 ? 1072 HOH E O     1 
HETATM 7884 O  O     . HOH T 4 .   ? 31.960  -38.833 1.589   1.00 30.33 ? 1073 HOH E O     1 
HETATM 7885 O  O     . HOH T 4 .   ? 19.468  -43.326 -1.434  1.00 33.47 ? 1074 HOH E O     1 
HETATM 7886 O  O     . HOH T 4 .   ? -3.810  -12.879 1.994   1.00 39.75 ? 1075 HOH E O     1 
HETATM 7887 O  O     . HOH T 4 .   ? 8.837   -18.455 24.866  1.00 36.85 ? 1076 HOH E O     1 
HETATM 7888 O  O     . HOH T 4 .   ? 5.565   -7.315  15.839  1.00 39.11 ? 1077 HOH E O     1 
HETATM 7889 O  O     . HOH T 4 .   ? 3.391   -20.013 6.319   1.00 30.11 ? 1078 HOH E O     1 
HETATM 7890 O  O     . HOH T 4 .   ? 19.439  -12.885 32.703  1.00 35.90 ? 1079 HOH E O     1 
HETATM 7891 O  O     . HOH T 4 .   ? 27.146  -14.262 15.193  1.00 37.75 ? 1080 HOH E O     1 
HETATM 7892 O  O     . HOH T 4 .   ? 38.384  -27.473 9.924   1.00 39.77 ? 1081 HOH E O     1 
HETATM 7893 O  O     . HOH T 4 .   ? 9.851   7.335   33.287  1.00 35.36 ? 1082 HOH E O     1 
HETATM 7894 O  O     . HOH T 4 .   ? 14.802  -19.666 31.190  1.00 43.84 ? 1083 HOH E O     1 
HETATM 7895 O  O     . HOH T 4 .   ? 25.453  7.927   27.107  1.00 40.87 ? 1084 HOH E O     1 
HETATM 7896 O  O     . HOH T 4 .   ? -0.333  -2.717  22.880  1.00 23.92 ? 1085 HOH E O     1 
HETATM 7897 O  O     . HOH T 4 .   ? 18.650  -25.749 5.275   1.00 46.64 ? 1086 HOH E O     1 
HETATM 7898 O  O     . HOH T 4 .   ? 36.926  -33.761 3.559   1.00 33.17 ? 1087 HOH E O     1 
HETATM 7899 O  O     . HOH T 4 .   ? 23.069  -38.696 -10.280 1.00 38.10 ? 1088 HOH E O     1 
HETATM 7900 O  O     . HOH T 4 .   ? 32.628  -14.044 21.146  1.00 37.67 ? 1089 HOH E O     1 
HETATM 7901 O  O     . HOH T 4 .   ? 6.768   7.658   30.853  1.00 33.49 ? 1090 HOH E O     1 
HETATM 7902 O  O     . HOH T 4 .   ? 18.251  -38.592 -9.408  1.00 46.12 ? 1091 HOH E O     1 
HETATM 7903 O  O     . HOH T 4 .   ? 3.465   -5.622  19.134  1.00 31.18 ? 1092 HOH E O     1 
HETATM 7904 O  O     . HOH T 4 .   ? 32.040  -17.934 16.770  1.00 33.16 ? 1093 HOH E O     1 
HETATM 7905 O  O     . HOH T 4 .   ? 1.148   -7.949  33.686  1.00 38.27 ? 1094 HOH E O     1 
HETATM 7906 O  O     . HOH T 4 .   ? 28.144  -5.507  31.161  1.00 35.95 ? 1095 HOH E O     1 
HETATM 7907 O  O     . HOH T 4 .   ? 17.680  12.671  32.154  1.00 43.31 ? 1096 HOH E O     1 
HETATM 7908 O  O     . HOH T 4 .   ? 24.124  10.852  31.374  1.00 50.10 ? 1097 HOH E O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   PRO 5   5   ?   ?   ?   A . n 
A 1 6   GLN 6   6   ?   ?   ?   A . n 
A 1 7   SER 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   ?   ?   ?   A . n 
A 1 9   GLY 9   9   ?   ?   ?   A . n 
A 1 10  GLN 10  10  ?   ?   ?   A . n 
A 1 11  GLU 11  11  ?   ?   ?   A . n 
A 1 12  ARG 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  SER 14  14  ?   ?   ?   A . n 
A 1 15  MET 15  15  ?   ?   ?   A . n 
A 1 16  GLU 16  16  ?   ?   ?   A . n 
A 1 17  ARG 17  17  ?   ?   ?   A . n 
A 1 18  LYS 18  18  ?   ?   ?   A . n 
A 1 19  MET 19  19  ?   ?   ?   A . n 
A 1 20  VAL 20  20  ?   ?   ?   A . n 
A 1 21  GLU 21  21  ?   ?   ?   A . n 
A 1 22  LEU 22  22  ?   ?   ?   A . n 
A 1 23  GLU 23  23  ?   ?   ?   A . n 
A 1 24  ASP 24  24  ?   ?   ?   A . n 
A 1 25  THR 25  25  ?   ?   ?   A . n 
A 1 26  GLY 26  26  ?   ?   ?   A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  THR 28  28  ?   ?   ?   A . n 
A 1 29  PHE 29  29  ?   ?   ?   A . n 
A 1 30  ALA 30  30  ?   ?   ?   A . n 
A 1 31  THR 31  31  ?   ?   ?   A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  TRP 45  45  45  TRP TRP A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  GLN 47  47  47  GLN GLN A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  TRP 69  69  69  TRP TRP A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  MET 96  96  96  MET MET A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 MET 107 107 107 MET MET A . n 
A 1 108 CYS 108 108 108 CYS CYS A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 HIS 110 110 110 HIS HIS A . n 
A 1 111 HIS 111 111 111 HIS HIS A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 PHE 115 115 115 PHE PHE A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 HIS 120 120 120 HIS HIS A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 TYR 123 123 123 TYR TYR A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 PRO 125 125 125 PRO PRO A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 MET 141 141 141 MET MET A . n 
A 1 142 PHE 142 142 142 PHE PHE A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 GLN 155 155 155 GLN GLN A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 GLU 158 158 158 GLU GLU A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 GLU 162 162 162 GLU GLU A . n 
A 1 163 VAL 163 163 163 VAL VAL A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 PRO 166 166 166 PRO PRO A . n 
A 1 167 GLN 167 167 167 GLN GLN A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 VAL 169 169 169 VAL VAL A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 CYS 179 179 179 CYS CYS A . n 
A 1 180 MET 180 180 180 MET MET A . n 
A 1 181 MET 181 181 181 MET MET A . n 
A 1 182 MET 182 182 182 MET MET A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 LYS 187 187 187 LYS LYS A . n 
A 1 188 GLN 188 188 188 GLN GLN A . n 
A 1 189 HIS 189 189 189 HIS HIS A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 THR 192 192 192 THR THR A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 MET 197 197 197 MET MET A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 ASN 204 204 204 ASN ASN A . n 
A 1 205 GLN 205 205 205 GLN GLN A . n 
A 1 206 LYS 206 206 206 LYS LYS A . n 
A 1 207 THR 207 207 207 THR THR A . n 
A 1 208 ARG 208 208 208 ARG ARG A . n 
A 1 209 GLU 209 209 209 GLU GLU A . n 
A 1 210 GLU 210 210 210 GLU GLU A . n 
A 1 211 PHE 211 211 211 PHE PHE A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 HIS 214 214 214 HIS HIS A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 ?   ?   ?   A . n 
A 1 218 GLY 218 218 ?   ?   ?   A . n 
A 1 219 THR 219 219 ?   ?   ?   A . n 
A 1 220 ALA 220 220 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   PRO 3   3   ?   ?   ?   B . n 
B 1 4   GLY 4   4   ?   ?   ?   B . n 
B 1 5   PRO 5   5   ?   ?   ?   B . n 
B 1 6   GLN 6   6   ?   ?   ?   B . n 
B 1 7   SER 7   7   ?   ?   ?   B . n 
B 1 8   GLY 8   8   ?   ?   ?   B . n 
B 1 9   GLY 9   9   ?   ?   ?   B . n 
B 1 10  GLN 10  10  ?   ?   ?   B . n 
B 1 11  GLU 11  11  ?   ?   ?   B . n 
B 1 12  ARG 12  12  ?   ?   ?   B . n 
B 1 13  GLY 13  13  ?   ?   ?   B . n 
B 1 14  SER 14  14  ?   ?   ?   B . n 
B 1 15  MET 15  15  ?   ?   ?   B . n 
B 1 16  GLU 16  16  ?   ?   ?   B . n 
B 1 17  ARG 17  17  ?   ?   ?   B . n 
B 1 18  LYS 18  18  ?   ?   ?   B . n 
B 1 19  MET 19  19  ?   ?   ?   B . n 
B 1 20  VAL 20  20  ?   ?   ?   B . n 
B 1 21  GLU 21  21  ?   ?   ?   B . n 
B 1 22  LEU 22  22  ?   ?   ?   B . n 
B 1 23  GLU 23  23  ?   ?   ?   B . n 
B 1 24  ASP 24  24  ?   ?   ?   B . n 
B 1 25  THR 25  25  ?   ?   ?   B . n 
B 1 26  GLY 26  26  ?   ?   ?   B . n 
B 1 27  LEU 27  27  ?   ?   ?   B . n 
B 1 28  THR 28  28  ?   ?   ?   B . n 
B 1 29  PHE 29  29  ?   ?   ?   B . n 
B 1 30  ALA 30  30  ?   ?   ?   B . n 
B 1 31  THR 31  31  ?   ?   ?   B . n 
B 1 32  GLU 32  32  32  GLU GLU B . n 
B 1 33  VAL 33  33  33  VAL VAL B . n 
B 1 34  ASP 34  34  34  ASP ASP B . n 
B 1 35  LEU 35  35  35  LEU LEU B . n 
B 1 36  GLU 36  36  36  GLU GLU B . n 
B 1 37  ARG 37  37  37  ARG ARG B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  GLN 39  39  39  GLN GLN B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  LEU 41  41  41  LEU LEU B . n 
B 1 42  ALA 42  42  42  ALA ALA B . n 
B 1 43  ALA 43  43  43  ALA ALA B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  TRP 45  45  45  TRP TRP B . n 
B 1 46  LEU 46  46  46  LEU LEU B . n 
B 1 47  GLN 47  47  47  GLN GLN B . n 
B 1 48  VAL 48  48  48  VAL VAL B . n 
B 1 49  ILE 49  49  49  ILE ILE B . n 
B 1 50  GLY 50  50  50  GLY GLY B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  ASP 52  52  52  ASP ASP B . n 
B 1 53  PRO 53  53  53  PRO PRO B . n 
B 1 54  GLY 54  54  54  GLY GLY B . n 
B 1 55  ARG 55  55  55  ARG ARG B . n 
B 1 56  GLU 56  56  56  GLU GLU B . n 
B 1 57  GLY 57  57  57  GLY GLY B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  LEU 59  59  59  LEU LEU B . n 
B 1 60  LYS 60  60  60  LYS LYS B . n 
B 1 61  THR 61  61  61  THR THR B . n 
B 1 62  PRO 62  62  62  PRO PRO B . n 
B 1 63  GLU 63  63  63  GLU GLU B . n 
B 1 64  ARG 64  64  64  ARG ARG B . n 
B 1 65  VAL 65  65  65  VAL VAL B . n 
B 1 66  ALA 66  66  66  ALA ALA B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  ALA 68  68  68  ALA ALA B . n 
B 1 69  TRP 69  69  69  TRP TRP B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  PHE 71  71  71  PHE PHE B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  THR 73  73  73  THR THR B . n 
B 1 74  ARG 74  74  74  ARG ARG B . n 
B 1 75  GLY 75  75  75  GLY GLY B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  ARG 77  77  77  ARG ARG B . n 
B 1 78  GLN 78  78  78  GLN GLN B . n 
B 1 79  ARG 79  79  79  ARG ARG B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  VAL 83  83  83  VAL VAL B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  GLY 85  85  85  GLY GLY B . n 
B 1 86  GLY 86  86  86  GLY GLY B . n 
B 1 87  ALA 87  87  87  ALA ALA B . n 
B 1 88  VAL 88  88  88  VAL VAL B . n 
B 1 89  PHE 89  89  89  PHE PHE B . n 
B 1 90  PRO 90  90  90  PRO PRO B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  GLY 93  93  93  GLY GLY B . n 
B 1 94  SER 94  94  94  SER SER B . n 
B 1 95  GLU 95  95  95  GLU GLU B . n 
B 1 96  MET 96  96  96  MET MET B . n 
B 1 97  VAL 97  97  97  VAL VAL B . n 
B 1 98  VAL 98  98  98  VAL VAL B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 LYS 100 100 100 LYS LYS B . n 
B 1 101 GLY 101 101 101 GLY GLY B . n 
B 1 102 VAL 102 102 102 VAL VAL B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 PHE 104 104 104 PHE PHE B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 SER 106 106 106 SER SER B . n 
B 1 107 MET 107 107 107 MET MET B . n 
B 1 108 CYS 108 108 108 CYS CYS B . n 
B 1 109 GLU 109 109 109 GLU GLU B . n 
B 1 110 HIS 110 110 110 HIS HIS B . n 
B 1 111 HIS 111 111 111 HIS HIS B . n 
B 1 112 LEU 112 112 112 LEU LEU B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 PRO 114 114 114 PRO PRO B . n 
B 1 115 PHE 115 115 115 PHE PHE B . n 
B 1 116 PHE 116 116 116 PHE PHE B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 LYS 118 118 118 LYS LYS B . n 
B 1 119 VAL 119 119 119 VAL VAL B . n 
B 1 120 HIS 120 120 120 HIS HIS B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 TYR 123 123 123 TYR TYR B . n 
B 1 124 ILE 124 124 124 ILE ILE B . n 
B 1 125 PRO 125 125 125 PRO PRO B . n 
B 1 126 ASP 126 126 126 ASP ASP B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 LYS 128 128 128 LYS LYS B . n 
B 1 129 ILE 129 129 129 ILE ILE B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 GLY 131 131 131 GLY GLY B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 SER 133 133 133 SER SER B . n 
B 1 134 LYS 134 134 134 LYS LYS B . n 
B 1 135 PHE 135 135 135 PHE PHE B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 ARG 137 137 137 ARG ARG B . n 
B 1 138 ILE 138 138 138 ILE ILE B . n 
B 1 139 VAL 139 139 139 VAL VAL B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 MET 141 141 141 MET MET B . n 
B 1 142 PHE 142 142 142 PHE PHE B . n 
B 1 143 ALA 143 143 143 ALA ALA B . n 
B 1 144 ARG 144 144 144 ARG ARG B . n 
B 1 145 ARG 145 145 145 ARG ARG B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 GLN 147 147 147 GLN GLN B . n 
B 1 148 VAL 148 148 148 VAL VAL B . n 
B 1 149 GLN 149 149 149 GLN GLN B . n 
B 1 150 GLU 150 150 150 GLU GLU B . n 
B 1 151 ARG 151 151 151 ARG ARG B . n 
B 1 152 LEU 152 152 152 LEU LEU B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 VAL 154 154 154 VAL VAL B . n 
B 1 155 GLN 155 155 155 GLN GLN B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 GLU 158 158 158 GLU GLU B . n 
B 1 159 ALA 159 159 159 ALA ALA B . n 
B 1 160 ILE 160 160 160 ILE ILE B . n 
B 1 161 GLN 161 161 161 GLN GLN B . n 
B 1 162 GLU 162 162 162 GLU GLU B . n 
B 1 163 VAL 163 163 163 VAL VAL B . n 
B 1 164 LEU 164 164 164 LEU LEU B . n 
B 1 165 GLU 165 165 165 GLU GLU B . n 
B 1 166 PRO 166 166 166 PRO PRO B . n 
B 1 167 GLN 167 167 167 GLN GLN B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 VAL 169 169 169 VAL VAL B . n 
B 1 170 GLY 170 170 170 GLY GLY B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 VAL 173 173 173 VAL VAL B . n 
B 1 174 GLU 174 174 174 GLU GLU B . n 
B 1 175 GLY 175 175 175 GLY GLY B . n 
B 1 176 VAL 176 176 176 VAL VAL B . n 
B 1 177 HIS 177 177 177 HIS HIS B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 CYS 179 179 179 CYS CYS B . n 
B 1 180 MET 180 180 180 MET MET B . n 
B 1 181 MET 181 181 181 MET MET B . n 
B 1 182 MET 182 182 182 MET MET B . n 
B 1 183 ARG 183 183 183 ARG ARG B . n 
B 1 184 GLY 184 184 184 GLY GLY B . n 
B 1 185 VAL 185 185 185 VAL VAL B . n 
B 1 186 GLU 186 186 186 GLU GLU B . n 
B 1 187 LYS 187 187 187 LYS LYS B . n 
B 1 188 GLN 188 188 188 GLN GLN B . n 
B 1 189 HIS 189 189 189 HIS HIS B . n 
B 1 190 SER 190 190 190 SER SER B . n 
B 1 191 ARG 191 191 191 ARG ARG B . n 
B 1 192 THR 192 192 192 THR THR B . n 
B 1 193 VAL 193 193 193 VAL VAL B . n 
B 1 194 THR 194 194 194 THR THR B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 ALA 196 196 196 ALA ALA B . n 
B 1 197 MET 197 197 197 MET MET B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 GLY 199 199 199 GLY GLY B . n 
B 1 200 VAL 200 200 200 VAL VAL B . n 
B 1 201 PHE 201 201 201 PHE PHE B . n 
B 1 202 ARG 202 202 202 ARG ARG B . n 
B 1 203 GLU 203 203 203 GLU GLU B . n 
B 1 204 ASN 204 204 204 ASN ASN B . n 
B 1 205 GLN 205 205 205 GLN GLN B . n 
B 1 206 LYS 206 206 206 LYS LYS B . n 
B 1 207 THR 207 207 207 THR THR B . n 
B 1 208 ARG 208 208 208 ARG ARG B . n 
B 1 209 GLU 209 209 209 GLU GLU B . n 
B 1 210 GLU 210 210 210 GLU GLU B . n 
B 1 211 PHE 211 211 211 PHE PHE B . n 
B 1 212 LEU 212 212 212 LEU LEU B . n 
B 1 213 SER 213 213 213 SER SER B . n 
B 1 214 HIS 214 214 214 HIS HIS B . n 
B 1 215 LEU 215 215 215 LEU LEU B . n 
B 1 216 ARG 216 216 216 ARG ARG B . n 
B 1 217 ASP 217 217 ?   ?   ?   B . n 
B 1 218 GLY 218 218 ?   ?   ?   B . n 
B 1 219 THR 219 219 ?   ?   ?   B . n 
B 1 220 ALA 220 220 ?   ?   ?   B . n 
C 1 1   MET 1   1   ?   ?   ?   C . n 
C 1 2   SER 2   2   ?   ?   ?   C . n 
C 1 3   PRO 3   3   ?   ?   ?   C . n 
C 1 4   GLY 4   4   ?   ?   ?   C . n 
C 1 5   PRO 5   5   ?   ?   ?   C . n 
C 1 6   GLN 6   6   ?   ?   ?   C . n 
C 1 7   SER 7   7   ?   ?   ?   C . n 
C 1 8   GLY 8   8   ?   ?   ?   C . n 
C 1 9   GLY 9   9   ?   ?   ?   C . n 
C 1 10  GLN 10  10  ?   ?   ?   C . n 
C 1 11  GLU 11  11  ?   ?   ?   C . n 
C 1 12  ARG 12  12  ?   ?   ?   C . n 
C 1 13  GLY 13  13  ?   ?   ?   C . n 
C 1 14  SER 14  14  ?   ?   ?   C . n 
C 1 15  MET 15  15  ?   ?   ?   C . n 
C 1 16  GLU 16  16  ?   ?   ?   C . n 
C 1 17  ARG 17  17  ?   ?   ?   C . n 
C 1 18  LYS 18  18  ?   ?   ?   C . n 
C 1 19  MET 19  19  ?   ?   ?   C . n 
C 1 20  VAL 20  20  ?   ?   ?   C . n 
C 1 21  GLU 21  21  ?   ?   ?   C . n 
C 1 22  LEU 22  22  ?   ?   ?   C . n 
C 1 23  GLU 23  23  ?   ?   ?   C . n 
C 1 24  ASP 24  24  ?   ?   ?   C . n 
C 1 25  THR 25  25  ?   ?   ?   C . n 
C 1 26  GLY 26  26  ?   ?   ?   C . n 
C 1 27  LEU 27  27  ?   ?   ?   C . n 
C 1 28  THR 28  28  ?   ?   ?   C . n 
C 1 29  PHE 29  29  ?   ?   ?   C . n 
C 1 30  ALA 30  30  ?   ?   ?   C . n 
C 1 31  THR 31  31  ?   ?   ?   C . n 
C 1 32  GLU 32  32  32  GLU GLU C . n 
C 1 33  VAL 33  33  33  VAL VAL C . n 
C 1 34  ASP 34  34  34  ASP ASP C . n 
C 1 35  LEU 35  35  35  LEU LEU C . n 
C 1 36  GLU 36  36  36  GLU GLU C . n 
C 1 37  ARG 37  37  37  ARG ARG C . n 
C 1 38  LEU 38  38  38  LEU LEU C . n 
C 1 39  GLN 39  39  39  GLN GLN C . n 
C 1 40  ALA 40  40  40  ALA ALA C . n 
C 1 41  LEU 41  41  41  LEU LEU C . n 
C 1 42  ALA 42  42  42  ALA ALA C . n 
C 1 43  ALA 43  43  43  ALA ALA C . n 
C 1 44  GLU 44  44  44  GLU GLU C . n 
C 1 45  TRP 45  45  45  TRP TRP C . n 
C 1 46  LEU 46  46  46  LEU LEU C . n 
C 1 47  GLN 47  47  47  GLN GLN C . n 
C 1 48  VAL 48  48  48  VAL VAL C . n 
C 1 49  ILE 49  49  49  ILE ILE C . n 
C 1 50  GLY 50  50  50  GLY GLY C . n 
C 1 51  GLU 51  51  51  GLU GLU C . n 
C 1 52  ASP 52  52  52  ASP ASP C . n 
C 1 53  PRO 53  53  53  PRO PRO C . n 
C 1 54  GLY 54  54  54  GLY GLY C . n 
C 1 55  ARG 55  55  55  ARG ARG C . n 
C 1 56  GLU 56  56  56  GLU GLU C . n 
C 1 57  GLY 57  57  57  GLY GLY C . n 
C 1 58  LEU 58  58  58  LEU LEU C . n 
C 1 59  LEU 59  59  59  LEU LEU C . n 
C 1 60  LYS 60  60  60  LYS LYS C . n 
C 1 61  THR 61  61  61  THR THR C . n 
C 1 62  PRO 62  62  62  PRO PRO C . n 
C 1 63  GLU 63  63  63  GLU GLU C . n 
C 1 64  ARG 64  64  64  ARG ARG C . n 
C 1 65  VAL 65  65  65  VAL VAL C . n 
C 1 66  ALA 66  66  66  ALA ALA C . n 
C 1 67  LYS 67  67  67  LYS LYS C . n 
C 1 68  ALA 68  68  68  ALA ALA C . n 
C 1 69  TRP 69  69  69  TRP TRP C . n 
C 1 70  ALA 70  70  70  ALA ALA C . n 
C 1 71  PHE 71  71  71  PHE PHE C . n 
C 1 72  LEU 72  72  72  LEU LEU C . n 
C 1 73  THR 73  73  73  THR THR C . n 
C 1 74  ARG 74  74  74  ARG ARG C . n 
C 1 75  GLY 75  75  75  GLY GLY C . n 
C 1 76  TYR 76  76  76  TYR TYR C . n 
C 1 77  ARG 77  77  77  ARG ARG C . n 
C 1 78  GLN 78  78  78  GLN GLN C . n 
C 1 79  ARG 79  79  79  ARG ARG C . n 
C 1 80  LEU 80  80  80  LEU LEU C . n 
C 1 81  GLU 81  81  81  GLU GLU C . n 
C 1 82  GLU 82  82  82  GLU GLU C . n 
C 1 83  VAL 83  83  83  VAL VAL C . n 
C 1 84  VAL 84  84  84  VAL VAL C . n 
C 1 85  GLY 85  85  85  GLY GLY C . n 
C 1 86  GLY 86  86  86  GLY GLY C . n 
C 1 87  ALA 87  87  87  ALA ALA C . n 
C 1 88  VAL 88  88  88  VAL VAL C . n 
C 1 89  PHE 89  89  89  PHE PHE C . n 
C 1 90  PRO 90  90  90  PRO PRO C . n 
C 1 91  ALA 91  91  91  ALA ALA C . n 
C 1 92  GLU 92  92  92  GLU GLU C . n 
C 1 93  GLY 93  93  93  GLY GLY C . n 
C 1 94  SER 94  94  94  SER SER C . n 
C 1 95  GLU 95  95  95  GLU GLU C . n 
C 1 96  MET 96  96  96  MET MET C . n 
C 1 97  VAL 97  97  97  VAL VAL C . n 
C 1 98  VAL 98  98  98  VAL VAL C . n 
C 1 99  VAL 99  99  99  VAL VAL C . n 
C 1 100 LYS 100 100 100 LYS LYS C . n 
C 1 101 GLY 101 101 101 GLY GLY C . n 
C 1 102 VAL 102 102 102 VAL VAL C . n 
C 1 103 GLU 103 103 103 GLU GLU C . n 
C 1 104 PHE 104 104 104 PHE PHE C . n 
C 1 105 TYR 105 105 105 TYR TYR C . n 
C 1 106 SER 106 106 106 SER SER C . n 
C 1 107 MET 107 107 107 MET MET C . n 
C 1 108 CYS 108 108 108 CYS CYS C . n 
C 1 109 GLU 109 109 109 GLU GLU C . n 
C 1 110 HIS 110 110 110 HIS HIS C . n 
C 1 111 HIS 111 111 111 HIS HIS C . n 
C 1 112 LEU 112 112 112 LEU LEU C . n 
C 1 113 LEU 113 113 113 LEU LEU C . n 
C 1 114 PRO 114 114 114 PRO PRO C . n 
C 1 115 PHE 115 115 115 PHE PHE C . n 
C 1 116 PHE 116 116 116 PHE PHE C . n 
C 1 117 GLY 117 117 117 GLY GLY C . n 
C 1 118 LYS 118 118 118 LYS LYS C . n 
C 1 119 VAL 119 119 119 VAL VAL C . n 
C 1 120 HIS 120 120 120 HIS HIS C . n 
C 1 121 ILE 121 121 121 ILE ILE C . n 
C 1 122 GLY 122 122 122 GLY GLY C . n 
C 1 123 TYR 123 123 123 TYR TYR C . n 
C 1 124 ILE 124 124 124 ILE ILE C . n 
C 1 125 PRO 125 125 125 PRO PRO C . n 
C 1 126 ASP 126 126 126 ASP ASP C . n 
C 1 127 GLY 127 127 127 GLY GLY C . n 
C 1 128 LYS 128 128 128 LYS LYS C . n 
C 1 129 ILE 129 129 129 ILE ILE C . n 
C 1 130 LEU 130 130 130 LEU LEU C . n 
C 1 131 GLY 131 131 131 GLY GLY C . n 
C 1 132 LEU 132 132 132 LEU LEU C . n 
C 1 133 SER 133 133 133 SER SER C . n 
C 1 134 LYS 134 134 134 LYS LYS C . n 
C 1 135 PHE 135 135 135 PHE PHE C . n 
C 1 136 ALA 136 136 136 ALA ALA C . n 
C 1 137 ARG 137 137 137 ARG ARG C . n 
C 1 138 ILE 138 138 138 ILE ILE C . n 
C 1 139 VAL 139 139 139 VAL VAL C . n 
C 1 140 ASP 140 140 140 ASP ASP C . n 
C 1 141 MET 141 141 141 MET MET C . n 
C 1 142 PHE 142 142 142 PHE PHE C . n 
C 1 143 ALA 143 143 143 ALA ALA C . n 
C 1 144 ARG 144 144 144 ARG ARG C . n 
C 1 145 ARG 145 145 145 ARG ARG C . n 
C 1 146 LEU 146 146 146 LEU LEU C . n 
C 1 147 GLN 147 147 147 GLN GLN C . n 
C 1 148 VAL 148 148 148 VAL VAL C . n 
C 1 149 GLN 149 149 149 GLN GLN C . n 
C 1 150 GLU 150 150 150 GLU GLU C . n 
C 1 151 ARG 151 151 151 ARG ARG C . n 
C 1 152 LEU 152 152 152 LEU LEU C . n 
C 1 153 ALA 153 153 153 ALA ALA C . n 
C 1 154 VAL 154 154 154 VAL VAL C . n 
C 1 155 GLN 155 155 155 GLN GLN C . n 
C 1 156 ILE 156 156 156 ILE ILE C . n 
C 1 157 ALA 157 157 157 ALA ALA C . n 
C 1 158 GLU 158 158 158 GLU GLU C . n 
C 1 159 ALA 159 159 159 ALA ALA C . n 
C 1 160 ILE 160 160 160 ILE ILE C . n 
C 1 161 GLN 161 161 161 GLN GLN C . n 
C 1 162 GLU 162 162 162 GLU GLU C . n 
C 1 163 VAL 163 163 163 VAL VAL C . n 
C 1 164 LEU 164 164 164 LEU LEU C . n 
C 1 165 GLU 165 165 165 GLU GLU C . n 
C 1 166 PRO 166 166 166 PRO PRO C . n 
C 1 167 GLN 167 167 167 GLN GLN C . n 
C 1 168 GLY 168 168 168 GLY GLY C . n 
C 1 169 VAL 169 169 169 VAL VAL C . n 
C 1 170 GLY 170 170 170 GLY GLY C . n 
C 1 171 VAL 171 171 171 VAL VAL C . n 
C 1 172 VAL 172 172 172 VAL VAL C . n 
C 1 173 VAL 173 173 173 VAL VAL C . n 
C 1 174 GLU 174 174 174 GLU GLU C . n 
C 1 175 GLY 175 175 175 GLY GLY C . n 
C 1 176 VAL 176 176 176 VAL VAL C . n 
C 1 177 HIS 177 177 177 HIS HIS C . n 
C 1 178 LEU 178 178 178 LEU LEU C . n 
C 1 179 CYS 179 179 179 CYS CYS C . n 
C 1 180 MET 180 180 180 MET MET C . n 
C 1 181 MET 181 181 181 MET MET C . n 
C 1 182 MET 182 182 182 MET MET C . n 
C 1 183 ARG 183 183 183 ARG ARG C . n 
C 1 184 GLY 184 184 184 GLY GLY C . n 
C 1 185 VAL 185 185 185 VAL VAL C . n 
C 1 186 GLU 186 186 186 GLU GLU C . n 
C 1 187 LYS 187 187 187 LYS LYS C . n 
C 1 188 GLN 188 188 188 GLN GLN C . n 
C 1 189 HIS 189 189 189 HIS HIS C . n 
C 1 190 SER 190 190 190 SER SER C . n 
C 1 191 ARG 191 191 191 ARG ARG C . n 
C 1 192 THR 192 192 192 THR THR C . n 
C 1 193 VAL 193 193 193 VAL VAL C . n 
C 1 194 THR 194 194 194 THR THR C . n 
C 1 195 SER 195 195 195 SER SER C . n 
C 1 196 ALA 196 196 196 ALA ALA C . n 
C 1 197 MET 197 197 197 MET MET C . n 
C 1 198 LEU 198 198 198 LEU LEU C . n 
C 1 199 GLY 199 199 199 GLY GLY C . n 
C 1 200 VAL 200 200 200 VAL VAL C . n 
C 1 201 PHE 201 201 201 PHE PHE C . n 
C 1 202 ARG 202 202 202 ARG ARG C . n 
C 1 203 GLU 203 203 203 GLU GLU C . n 
C 1 204 ASN 204 204 204 ASN ASN C . n 
C 1 205 GLN 205 205 205 GLN GLN C . n 
C 1 206 LYS 206 206 206 LYS LYS C . n 
C 1 207 THR 207 207 207 THR THR C . n 
C 1 208 ARG 208 208 208 ARG ARG C . n 
C 1 209 GLU 209 209 209 GLU GLU C . n 
C 1 210 GLU 210 210 210 GLU GLU C . n 
C 1 211 PHE 211 211 211 PHE PHE C . n 
C 1 212 LEU 212 212 212 LEU LEU C . n 
C 1 213 SER 213 213 213 SER SER C . n 
C 1 214 HIS 214 214 214 HIS HIS C . n 
C 1 215 LEU 215 215 215 LEU LEU C . n 
C 1 216 ARG 216 216 216 ARG ARG C . n 
C 1 217 ASP 217 217 ?   ?   ?   C . n 
C 1 218 GLY 218 218 ?   ?   ?   C . n 
C 1 219 THR 219 219 ?   ?   ?   C . n 
C 1 220 ALA 220 220 ?   ?   ?   C . n 
D 1 1   MET 1   1   ?   ?   ?   D . n 
D 1 2   SER 2   2   ?   ?   ?   D . n 
D 1 3   PRO 3   3   ?   ?   ?   D . n 
D 1 4   GLY 4   4   ?   ?   ?   D . n 
D 1 5   PRO 5   5   ?   ?   ?   D . n 
D 1 6   GLN 6   6   ?   ?   ?   D . n 
D 1 7   SER 7   7   ?   ?   ?   D . n 
D 1 8   GLY 8   8   ?   ?   ?   D . n 
D 1 9   GLY 9   9   ?   ?   ?   D . n 
D 1 10  GLN 10  10  ?   ?   ?   D . n 
D 1 11  GLU 11  11  ?   ?   ?   D . n 
D 1 12  ARG 12  12  ?   ?   ?   D . n 
D 1 13  GLY 13  13  ?   ?   ?   D . n 
D 1 14  SER 14  14  ?   ?   ?   D . n 
D 1 15  MET 15  15  ?   ?   ?   D . n 
D 1 16  GLU 16  16  ?   ?   ?   D . n 
D 1 17  ARG 17  17  ?   ?   ?   D . n 
D 1 18  LYS 18  18  ?   ?   ?   D . n 
D 1 19  MET 19  19  ?   ?   ?   D . n 
D 1 20  VAL 20  20  ?   ?   ?   D . n 
D 1 21  GLU 21  21  ?   ?   ?   D . n 
D 1 22  LEU 22  22  ?   ?   ?   D . n 
D 1 23  GLU 23  23  ?   ?   ?   D . n 
D 1 24  ASP 24  24  ?   ?   ?   D . n 
D 1 25  THR 25  25  ?   ?   ?   D . n 
D 1 26  GLY 26  26  ?   ?   ?   D . n 
D 1 27  LEU 27  27  ?   ?   ?   D . n 
D 1 28  THR 28  28  ?   ?   ?   D . n 
D 1 29  PHE 29  29  ?   ?   ?   D . n 
D 1 30  ALA 30  30  ?   ?   ?   D . n 
D 1 31  THR 31  31  ?   ?   ?   D . n 
D 1 32  GLU 32  32  32  GLU GLU D . n 
D 1 33  VAL 33  33  33  VAL VAL D . n 
D 1 34  ASP 34  34  34  ASP ASP D . n 
D 1 35  LEU 35  35  35  LEU LEU D . n 
D 1 36  GLU 36  36  36  GLU GLU D . n 
D 1 37  ARG 37  37  37  ARG ARG D . n 
D 1 38  LEU 38  38  38  LEU LEU D . n 
D 1 39  GLN 39  39  39  GLN GLN D . n 
D 1 40  ALA 40  40  40  ALA ALA D . n 
D 1 41  LEU 41  41  41  LEU LEU D . n 
D 1 42  ALA 42  42  42  ALA ALA D . n 
D 1 43  ALA 43  43  43  ALA ALA D . n 
D 1 44  GLU 44  44  44  GLU GLU D . n 
D 1 45  TRP 45  45  45  TRP TRP D . n 
D 1 46  LEU 46  46  46  LEU LEU D . n 
D 1 47  GLN 47  47  47  GLN GLN D . n 
D 1 48  VAL 48  48  48  VAL VAL D . n 
D 1 49  ILE 49  49  49  ILE ILE D . n 
D 1 50  GLY 50  50  50  GLY GLY D . n 
D 1 51  GLU 51  51  51  GLU GLU D . n 
D 1 52  ASP 52  52  52  ASP ASP D . n 
D 1 53  PRO 53  53  53  PRO PRO D . n 
D 1 54  GLY 54  54  54  GLY GLY D . n 
D 1 55  ARG 55  55  55  ARG ARG D . n 
D 1 56  GLU 56  56  56  GLU GLU D . n 
D 1 57  GLY 57  57  57  GLY GLY D . n 
D 1 58  LEU 58  58  58  LEU LEU D . n 
D 1 59  LEU 59  59  59  LEU LEU D . n 
D 1 60  LYS 60  60  60  LYS LYS D . n 
D 1 61  THR 61  61  61  THR THR D . n 
D 1 62  PRO 62  62  62  PRO PRO D . n 
D 1 63  GLU 63  63  63  GLU GLU D . n 
D 1 64  ARG 64  64  64  ARG ARG D . n 
D 1 65  VAL 65  65  65  VAL VAL D . n 
D 1 66  ALA 66  66  66  ALA ALA D . n 
D 1 67  LYS 67  67  67  LYS LYS D . n 
D 1 68  ALA 68  68  68  ALA ALA D . n 
D 1 69  TRP 69  69  69  TRP TRP D . n 
D 1 70  ALA 70  70  70  ALA ALA D . n 
D 1 71  PHE 71  71  71  PHE PHE D . n 
D 1 72  LEU 72  72  72  LEU LEU D . n 
D 1 73  THR 73  73  73  THR THR D . n 
D 1 74  ARG 74  74  74  ARG ARG D . n 
D 1 75  GLY 75  75  75  GLY GLY D . n 
D 1 76  TYR 76  76  76  TYR TYR D . n 
D 1 77  ARG 77  77  77  ARG ARG D . n 
D 1 78  GLN 78  78  78  GLN GLN D . n 
D 1 79  ARG 79  79  79  ARG ARG D . n 
D 1 80  LEU 80  80  80  LEU LEU D . n 
D 1 81  GLU 81  81  81  GLU GLU D . n 
D 1 82  GLU 82  82  82  GLU GLU D . n 
D 1 83  VAL 83  83  83  VAL VAL D . n 
D 1 84  VAL 84  84  84  VAL VAL D . n 
D 1 85  GLY 85  85  85  GLY GLY D . n 
D 1 86  GLY 86  86  86  GLY GLY D . n 
D 1 87  ALA 87  87  87  ALA ALA D . n 
D 1 88  VAL 88  88  88  VAL VAL D . n 
D 1 89  PHE 89  89  89  PHE PHE D . n 
D 1 90  PRO 90  90  90  PRO PRO D . n 
D 1 91  ALA 91  91  91  ALA ALA D . n 
D 1 92  GLU 92  92  92  GLU GLU D . n 
D 1 93  GLY 93  93  93  GLY GLY D . n 
D 1 94  SER 94  94  94  SER SER D . n 
D 1 95  GLU 95  95  95  GLU GLU D . n 
D 1 96  MET 96  96  96  MET MET D . n 
D 1 97  VAL 97  97  97  VAL VAL D . n 
D 1 98  VAL 98  98  98  VAL VAL D . n 
D 1 99  VAL 99  99  99  VAL VAL D . n 
D 1 100 LYS 100 100 100 LYS LYS D . n 
D 1 101 GLY 101 101 101 GLY GLY D . n 
D 1 102 VAL 102 102 102 VAL VAL D . n 
D 1 103 GLU 103 103 103 GLU GLU D . n 
D 1 104 PHE 104 104 104 PHE PHE D . n 
D 1 105 TYR 105 105 105 TYR TYR D . n 
D 1 106 SER 106 106 106 SER SER D . n 
D 1 107 MET 107 107 107 MET MET D . n 
D 1 108 CYS 108 108 108 CYS CYS D . n 
D 1 109 GLU 109 109 109 GLU GLU D . n 
D 1 110 HIS 110 110 110 HIS HIS D . n 
D 1 111 HIS 111 111 111 HIS HIS D . n 
D 1 112 LEU 112 112 112 LEU LEU D . n 
D 1 113 LEU 113 113 113 LEU LEU D . n 
D 1 114 PRO 114 114 114 PRO PRO D . n 
D 1 115 PHE 115 115 115 PHE PHE D . n 
D 1 116 PHE 116 116 116 PHE PHE D . n 
D 1 117 GLY 117 117 117 GLY GLY D . n 
D 1 118 LYS 118 118 118 LYS LYS D . n 
D 1 119 VAL 119 119 119 VAL VAL D . n 
D 1 120 HIS 120 120 120 HIS HIS D . n 
D 1 121 ILE 121 121 121 ILE ILE D . n 
D 1 122 GLY 122 122 122 GLY GLY D . n 
D 1 123 TYR 123 123 123 TYR TYR D . n 
D 1 124 ILE 124 124 124 ILE ILE D . n 
D 1 125 PRO 125 125 125 PRO PRO D . n 
D 1 126 ASP 126 126 126 ASP ASP D . n 
D 1 127 GLY 127 127 127 GLY GLY D . n 
D 1 128 LYS 128 128 128 LYS LYS D . n 
D 1 129 ILE 129 129 129 ILE ILE D . n 
D 1 130 LEU 130 130 130 LEU LEU D . n 
D 1 131 GLY 131 131 131 GLY GLY D . n 
D 1 132 LEU 132 132 132 LEU LEU D . n 
D 1 133 SER 133 133 133 SER SER D . n 
D 1 134 LYS 134 134 134 LYS LYS D . n 
D 1 135 PHE 135 135 135 PHE PHE D . n 
D 1 136 ALA 136 136 136 ALA ALA D . n 
D 1 137 ARG 137 137 137 ARG ARG D . n 
D 1 138 ILE 138 138 138 ILE ILE D . n 
D 1 139 VAL 139 139 139 VAL VAL D . n 
D 1 140 ASP 140 140 140 ASP ASP D . n 
D 1 141 MET 141 141 141 MET MET D . n 
D 1 142 PHE 142 142 142 PHE PHE D . n 
D 1 143 ALA 143 143 143 ALA ALA D . n 
D 1 144 ARG 144 144 144 ARG ARG D . n 
D 1 145 ARG 145 145 145 ARG ARG D . n 
D 1 146 LEU 146 146 146 LEU LEU D . n 
D 1 147 GLN 147 147 147 GLN GLN D . n 
D 1 148 VAL 148 148 148 VAL VAL D . n 
D 1 149 GLN 149 149 149 GLN GLN D . n 
D 1 150 GLU 150 150 150 GLU GLU D . n 
D 1 151 ARG 151 151 151 ARG ARG D . n 
D 1 152 LEU 152 152 152 LEU LEU D . n 
D 1 153 ALA 153 153 153 ALA ALA D . n 
D 1 154 VAL 154 154 154 VAL VAL D . n 
D 1 155 GLN 155 155 155 GLN GLN D . n 
D 1 156 ILE 156 156 156 ILE ILE D . n 
D 1 157 ALA 157 157 157 ALA ALA D . n 
D 1 158 GLU 158 158 158 GLU GLU D . n 
D 1 159 ALA 159 159 159 ALA ALA D . n 
D 1 160 ILE 160 160 160 ILE ILE D . n 
D 1 161 GLN 161 161 161 GLN GLN D . n 
D 1 162 GLU 162 162 162 GLU GLU D . n 
D 1 163 VAL 163 163 163 VAL VAL D . n 
D 1 164 LEU 164 164 164 LEU LEU D . n 
D 1 165 GLU 165 165 165 GLU GLU D . n 
D 1 166 PRO 166 166 166 PRO PRO D . n 
D 1 167 GLN 167 167 167 GLN GLN D . n 
D 1 168 GLY 168 168 168 GLY GLY D . n 
D 1 169 VAL 169 169 169 VAL VAL D . n 
D 1 170 GLY 170 170 170 GLY GLY D . n 
D 1 171 VAL 171 171 171 VAL VAL D . n 
D 1 172 VAL 172 172 172 VAL VAL D . n 
D 1 173 VAL 173 173 173 VAL VAL D . n 
D 1 174 GLU 174 174 174 GLU GLU D . n 
D 1 175 GLY 175 175 175 GLY GLY D . n 
D 1 176 VAL 176 176 176 VAL VAL D . n 
D 1 177 HIS 177 177 177 HIS HIS D . n 
D 1 178 LEU 178 178 178 LEU LEU D . n 
D 1 179 CYS 179 179 179 CYS CYS D . n 
D 1 180 MET 180 180 180 MET MET D . n 
D 1 181 MET 181 181 181 MET MET D . n 
D 1 182 MET 182 182 182 MET MET D . n 
D 1 183 ARG 183 183 183 ARG ARG D . n 
D 1 184 GLY 184 184 184 GLY GLY D . n 
D 1 185 VAL 185 185 185 VAL VAL D . n 
D 1 186 GLU 186 186 186 GLU GLU D . n 
D 1 187 LYS 187 187 187 LYS LYS D . n 
D 1 188 GLN 188 188 188 GLN GLN D . n 
D 1 189 HIS 189 189 189 HIS HIS D . n 
D 1 190 SER 190 190 190 SER SER D . n 
D 1 191 ARG 191 191 191 ARG ARG D . n 
D 1 192 THR 192 192 192 THR THR D . n 
D 1 193 VAL 193 193 193 VAL VAL D . n 
D 1 194 THR 194 194 194 THR THR D . n 
D 1 195 SER 195 195 195 SER SER D . n 
D 1 196 ALA 196 196 196 ALA ALA D . n 
D 1 197 MET 197 197 197 MET MET D . n 
D 1 198 LEU 198 198 198 LEU LEU D . n 
D 1 199 GLY 199 199 199 GLY GLY D . n 
D 1 200 VAL 200 200 200 VAL VAL D . n 
D 1 201 PHE 201 201 201 PHE PHE D . n 
D 1 202 ARG 202 202 202 ARG ARG D . n 
D 1 203 GLU 203 203 203 GLU GLU D . n 
D 1 204 ASN 204 204 204 ASN ASN D . n 
D 1 205 GLN 205 205 205 GLN GLN D . n 
D 1 206 LYS 206 206 206 LYS LYS D . n 
D 1 207 THR 207 207 207 THR THR D . n 
D 1 208 ARG 208 208 208 ARG ARG D . n 
D 1 209 GLU 209 209 209 GLU GLU D . n 
D 1 210 GLU 210 210 210 GLU GLU D . n 
D 1 211 PHE 211 211 211 PHE PHE D . n 
D 1 212 LEU 212 212 212 LEU LEU D . n 
D 1 213 SER 213 213 213 SER SER D . n 
D 1 214 HIS 214 214 214 HIS HIS D . n 
D 1 215 LEU 215 215 215 LEU LEU D . n 
D 1 216 ARG 216 216 216 ARG ARG D . n 
D 1 217 ASP 217 217 ?   ?   ?   D . n 
D 1 218 GLY 218 218 ?   ?   ?   D . n 
D 1 219 THR 219 219 ?   ?   ?   D . n 
D 1 220 ALA 220 220 ?   ?   ?   D . n 
E 1 1   MET 1   1   ?   ?   ?   E . n 
E 1 2   SER 2   2   ?   ?   ?   E . n 
E 1 3   PRO 3   3   ?   ?   ?   E . n 
E 1 4   GLY 4   4   ?   ?   ?   E . n 
E 1 5   PRO 5   5   ?   ?   ?   E . n 
E 1 6   GLN 6   6   ?   ?   ?   E . n 
E 1 7   SER 7   7   ?   ?   ?   E . n 
E 1 8   GLY 8   8   ?   ?   ?   E . n 
E 1 9   GLY 9   9   ?   ?   ?   E . n 
E 1 10  GLN 10  10  ?   ?   ?   E . n 
E 1 11  GLU 11  11  ?   ?   ?   E . n 
E 1 12  ARG 12  12  ?   ?   ?   E . n 
E 1 13  GLY 13  13  ?   ?   ?   E . n 
E 1 14  SER 14  14  ?   ?   ?   E . n 
E 1 15  MET 15  15  ?   ?   ?   E . n 
E 1 16  GLU 16  16  ?   ?   ?   E . n 
E 1 17  ARG 17  17  ?   ?   ?   E . n 
E 1 18  LYS 18  18  ?   ?   ?   E . n 
E 1 19  MET 19  19  ?   ?   ?   E . n 
E 1 20  VAL 20  20  ?   ?   ?   E . n 
E 1 21  GLU 21  21  ?   ?   ?   E . n 
E 1 22  LEU 22  22  ?   ?   ?   E . n 
E 1 23  GLU 23  23  ?   ?   ?   E . n 
E 1 24  ASP 24  24  ?   ?   ?   E . n 
E 1 25  THR 25  25  ?   ?   ?   E . n 
E 1 26  GLY 26  26  ?   ?   ?   E . n 
E 1 27  LEU 27  27  ?   ?   ?   E . n 
E 1 28  THR 28  28  ?   ?   ?   E . n 
E 1 29  PHE 29  29  ?   ?   ?   E . n 
E 1 30  ALA 30  30  ?   ?   ?   E . n 
E 1 31  THR 31  31  ?   ?   ?   E . n 
E 1 32  GLU 32  32  ?   ?   ?   E . n 
E 1 33  VAL 33  33  33  VAL VAL E . n 
E 1 34  ASP 34  34  34  ASP ASP E . n 
E 1 35  LEU 35  35  35  LEU LEU E . n 
E 1 36  GLU 36  36  36  GLU GLU E . n 
E 1 37  ARG 37  37  37  ARG ARG E . n 
E 1 38  LEU 38  38  38  LEU LEU E . n 
E 1 39  GLN 39  39  39  GLN GLN E . n 
E 1 40  ALA 40  40  40  ALA ALA E . n 
E 1 41  LEU 41  41  41  LEU LEU E . n 
E 1 42  ALA 42  42  42  ALA ALA E . n 
E 1 43  ALA 43  43  43  ALA ALA E . n 
E 1 44  GLU 44  44  44  GLU GLU E . n 
E 1 45  TRP 45  45  45  TRP TRP E . n 
E 1 46  LEU 46  46  46  LEU LEU E . n 
E 1 47  GLN 47  47  47  GLN GLN E . n 
E 1 48  VAL 48  48  48  VAL VAL E . n 
E 1 49  ILE 49  49  49  ILE ILE E . n 
E 1 50  GLY 50  50  50  GLY GLY E . n 
E 1 51  GLU 51  51  51  GLU GLU E . n 
E 1 52  ASP 52  52  52  ASP ASP E . n 
E 1 53  PRO 53  53  53  PRO PRO E . n 
E 1 54  GLY 54  54  54  GLY GLY E . n 
E 1 55  ARG 55  55  55  ARG ARG E . n 
E 1 56  GLU 56  56  56  GLU GLU E . n 
E 1 57  GLY 57  57  57  GLY GLY E . n 
E 1 58  LEU 58  58  58  LEU LEU E . n 
E 1 59  LEU 59  59  59  LEU LEU E . n 
E 1 60  LYS 60  60  60  LYS LYS E . n 
E 1 61  THR 61  61  61  THR THR E . n 
E 1 62  PRO 62  62  62  PRO PRO E . n 
E 1 63  GLU 63  63  63  GLU GLU E . n 
E 1 64  ARG 64  64  64  ARG ARG E . n 
E 1 65  VAL 65  65  65  VAL VAL E . n 
E 1 66  ALA 66  66  66  ALA ALA E . n 
E 1 67  LYS 67  67  67  LYS LYS E . n 
E 1 68  ALA 68  68  68  ALA ALA E . n 
E 1 69  TRP 69  69  69  TRP TRP E . n 
E 1 70  ALA 70  70  70  ALA ALA E . n 
E 1 71  PHE 71  71  71  PHE PHE E . n 
E 1 72  LEU 72  72  72  LEU LEU E . n 
E 1 73  THR 73  73  73  THR THR E . n 
E 1 74  ARG 74  74  74  ARG ARG E . n 
E 1 75  GLY 75  75  75  GLY GLY E . n 
E 1 76  TYR 76  76  76  TYR TYR E . n 
E 1 77  ARG 77  77  77  ARG ARG E . n 
E 1 78  GLN 78  78  78  GLN GLN E . n 
E 1 79  ARG 79  79  79  ARG ARG E . n 
E 1 80  LEU 80  80  80  LEU LEU E . n 
E 1 81  GLU 81  81  81  GLU GLU E . n 
E 1 82  GLU 82  82  82  GLU GLU E . n 
E 1 83  VAL 83  83  83  VAL VAL E . n 
E 1 84  VAL 84  84  84  VAL VAL E . n 
E 1 85  GLY 85  85  85  GLY GLY E . n 
E 1 86  GLY 86  86  86  GLY GLY E . n 
E 1 87  ALA 87  87  87  ALA ALA E . n 
E 1 88  VAL 88  88  88  VAL VAL E . n 
E 1 89  PHE 89  89  89  PHE PHE E . n 
E 1 90  PRO 90  90  90  PRO PRO E . n 
E 1 91  ALA 91  91  91  ALA ALA E . n 
E 1 92  GLU 92  92  92  GLU GLU E . n 
E 1 93  GLY 93  93  93  GLY GLY E . n 
E 1 94  SER 94  94  94  SER SER E . n 
E 1 95  GLU 95  95  95  GLU GLU E . n 
E 1 96  MET 96  96  96  MET MET E . n 
E 1 97  VAL 97  97  97  VAL VAL E . n 
E 1 98  VAL 98  98  98  VAL VAL E . n 
E 1 99  VAL 99  99  99  VAL VAL E . n 
E 1 100 LYS 100 100 100 LYS LYS E . n 
E 1 101 GLY 101 101 101 GLY GLY E . n 
E 1 102 VAL 102 102 102 VAL VAL E . n 
E 1 103 GLU 103 103 103 GLU GLU E . n 
E 1 104 PHE 104 104 104 PHE PHE E . n 
E 1 105 TYR 105 105 105 TYR TYR E . n 
E 1 106 SER 106 106 106 SER SER E . n 
E 1 107 MET 107 107 107 MET MET E . n 
E 1 108 CYS 108 108 108 CYS CYS E . n 
E 1 109 GLU 109 109 109 GLU GLU E . n 
E 1 110 HIS 110 110 110 HIS HIS E . n 
E 1 111 HIS 111 111 111 HIS HIS E . n 
E 1 112 LEU 112 112 112 LEU LEU E . n 
E 1 113 LEU 113 113 113 LEU LEU E . n 
E 1 114 PRO 114 114 114 PRO PRO E . n 
E 1 115 PHE 115 115 115 PHE PHE E . n 
E 1 116 PHE 116 116 116 PHE PHE E . n 
E 1 117 GLY 117 117 117 GLY GLY E . n 
E 1 118 LYS 118 118 118 LYS LYS E . n 
E 1 119 VAL 119 119 119 VAL VAL E . n 
E 1 120 HIS 120 120 120 HIS HIS E . n 
E 1 121 ILE 121 121 121 ILE ILE E . n 
E 1 122 GLY 122 122 122 GLY GLY E . n 
E 1 123 TYR 123 123 123 TYR TYR E . n 
E 1 124 ILE 124 124 124 ILE ILE E . n 
E 1 125 PRO 125 125 125 PRO PRO E . n 
E 1 126 ASP 126 126 126 ASP ASP E . n 
E 1 127 GLY 127 127 127 GLY GLY E . n 
E 1 128 LYS 128 128 128 LYS LYS E . n 
E 1 129 ILE 129 129 129 ILE ILE E . n 
E 1 130 LEU 130 130 130 LEU LEU E . n 
E 1 131 GLY 131 131 131 GLY GLY E . n 
E 1 132 LEU 132 132 132 LEU LEU E . n 
E 1 133 SER 133 133 133 SER SER E . n 
E 1 134 LYS 134 134 134 LYS LYS E . n 
E 1 135 PHE 135 135 135 PHE PHE E . n 
E 1 136 ALA 136 136 136 ALA ALA E . n 
E 1 137 ARG 137 137 137 ARG ARG E . n 
E 1 138 ILE 138 138 138 ILE ILE E . n 
E 1 139 VAL 139 139 139 VAL VAL E . n 
E 1 140 ASP 140 140 140 ASP ASP E . n 
E 1 141 MET 141 141 141 MET MET E . n 
E 1 142 PHE 142 142 142 PHE PHE E . n 
E 1 143 ALA 143 143 143 ALA ALA E . n 
E 1 144 ARG 144 144 144 ARG ARG E . n 
E 1 145 ARG 145 145 145 ARG ARG E . n 
E 1 146 LEU 146 146 146 LEU LEU E . n 
E 1 147 GLN 147 147 147 GLN GLN E . n 
E 1 148 VAL 148 148 148 VAL VAL E . n 
E 1 149 GLN 149 149 149 GLN GLN E . n 
E 1 150 GLU 150 150 150 GLU GLU E . n 
E 1 151 ARG 151 151 151 ARG ARG E . n 
E 1 152 LEU 152 152 152 LEU LEU E . n 
E 1 153 ALA 153 153 153 ALA ALA E . n 
E 1 154 VAL 154 154 154 VAL VAL E . n 
E 1 155 GLN 155 155 155 GLN GLN E . n 
E 1 156 ILE 156 156 156 ILE ILE E . n 
E 1 157 ALA 157 157 157 ALA ALA E . n 
E 1 158 GLU 158 158 158 GLU GLU E . n 
E 1 159 ALA 159 159 159 ALA ALA E . n 
E 1 160 ILE 160 160 160 ILE ILE E . n 
E 1 161 GLN 161 161 161 GLN GLN E . n 
E 1 162 GLU 162 162 162 GLU GLU E . n 
E 1 163 VAL 163 163 163 VAL VAL E . n 
E 1 164 LEU 164 164 164 LEU LEU E . n 
E 1 165 GLU 165 165 165 GLU GLU E . n 
E 1 166 PRO 166 166 166 PRO PRO E . n 
E 1 167 GLN 167 167 167 GLN GLN E . n 
E 1 168 GLY 168 168 168 GLY GLY E . n 
E 1 169 VAL 169 169 169 VAL VAL E . n 
E 1 170 GLY 170 170 170 GLY GLY E . n 
E 1 171 VAL 171 171 171 VAL VAL E . n 
E 1 172 VAL 172 172 172 VAL VAL E . n 
E 1 173 VAL 173 173 173 VAL VAL E . n 
E 1 174 GLU 174 174 174 GLU GLU E . n 
E 1 175 GLY 175 175 175 GLY GLY E . n 
E 1 176 VAL 176 176 176 VAL VAL E . n 
E 1 177 HIS 177 177 177 HIS HIS E . n 
E 1 178 LEU 178 178 178 LEU LEU E . n 
E 1 179 CYS 179 179 179 CYS CYS E . n 
E 1 180 MET 180 180 180 MET MET E . n 
E 1 181 MET 181 181 181 MET MET E . n 
E 1 182 MET 182 182 182 MET MET E . n 
E 1 183 ARG 183 183 183 ARG ARG E . n 
E 1 184 GLY 184 184 184 GLY GLY E . n 
E 1 185 VAL 185 185 185 VAL VAL E . n 
E 1 186 GLU 186 186 186 GLU GLU E . n 
E 1 187 LYS 187 187 187 LYS LYS E . n 
E 1 188 GLN 188 188 188 GLN GLN E . n 
E 1 189 HIS 189 189 189 HIS HIS E . n 
E 1 190 SER 190 190 190 SER SER E . n 
E 1 191 ARG 191 191 191 ARG ARG E . n 
E 1 192 THR 192 192 192 THR THR E . n 
E 1 193 VAL 193 193 193 VAL VAL E . n 
E 1 194 THR 194 194 194 THR THR E . n 
E 1 195 SER 195 195 195 SER SER E . n 
E 1 196 ALA 196 196 196 ALA ALA E . n 
E 1 197 MET 197 197 197 MET MET E . n 
E 1 198 LEU 198 198 198 LEU LEU E . n 
E 1 199 GLY 199 199 199 GLY GLY E . n 
E 1 200 VAL 200 200 200 VAL VAL E . n 
E 1 201 PHE 201 201 201 PHE PHE E . n 
E 1 202 ARG 202 202 202 ARG ARG E . n 
E 1 203 GLU 203 203 203 GLU GLU E . n 
E 1 204 ASN 204 204 204 ASN ASN E . n 
E 1 205 GLN 205 205 205 GLN GLN E . n 
E 1 206 LYS 206 206 206 LYS LYS E . n 
E 1 207 THR 207 207 207 THR THR E . n 
E 1 208 ARG 208 208 208 ARG ARG E . n 
E 1 209 GLU 209 209 209 GLU GLU E . n 
E 1 210 GLU 210 210 210 GLU GLU E . n 
E 1 211 PHE 211 211 211 PHE PHE E . n 
E 1 212 LEU 212 212 212 LEU LEU E . n 
E 1 213 SER 213 213 213 SER SER E . n 
E 1 214 HIS 214 214 214 HIS HIS E . n 
E 1 215 LEU 215 215 215 LEU LEU E . n 
E 1 216 ARG 216 216 216 ARG ARG E . n 
E 1 217 ASP 217 217 ?   ?   ?   E . n 
E 1 218 GLY 218 218 ?   ?   ?   E . n 
E 1 219 THR 219 219 ?   ?   ?   E . n 
E 1 220 ALA 220 220 ?   ?   ?   E . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'NPPSFA, National Project on Protein Structural and Functional Analyses' 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   decameric 
_pdbx_struct_assembly.oligomeric_count     10 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 58850 ? 
1 MORE         -633  ? 
1 'SSA (A^2)'  56730 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O8  ? G 8DG .   ? A 8DG 821 ? 1_555 ZN ? F ZN . ? A ZN 1001 ? 1_555 SG  ? A CYS 108 ? A CYS 108 ? 1_555 121.8 ? 
2  O8  ? G 8DG .   ? A 8DG 821 ? 1_555 ZN ? F ZN . ? A ZN 1001 ? 1_555 SG  ? A CYS 179 ? A CYS 179 ? 1_555 95.6  ? 
3  SG  ? A CYS 108 ? A CYS 108 ? 1_555 ZN ? F ZN . ? A ZN 1001 ? 1_555 SG  ? A CYS 179 ? A CYS 179 ? 1_555 119.3 ? 
4  O8  ? G 8DG .   ? A 8DG 821 ? 1_555 ZN ? F ZN . ? A ZN 1001 ? 1_555 ND1 ? A HIS 111 ? A HIS 111 ? 1_555 96.1  ? 
5  SG  ? A CYS 108 ? A CYS 108 ? 1_555 ZN ? F ZN . ? A ZN 1001 ? 1_555 ND1 ? A HIS 111 ? A HIS 111 ? 1_555 113.2 ? 
6  SG  ? A CYS 179 ? A CYS 179 ? 1_555 ZN ? F ZN . ? A ZN 1001 ? 1_555 ND1 ? A HIS 111 ? A HIS 111 ? 1_555 107.3 ? 
7  SG  ? B CYS 179 ? B CYS 179 ? 1_555 ZN ? I ZN . ? B ZN 1002 ? 1_555 O8  ? K 8DG .   ? C 8DG 822 ? 1_555 97.3  ? 
8  SG  ? B CYS 179 ? B CYS 179 ? 1_555 ZN ? I ZN . ? B ZN 1002 ? 1_555 ND1 ? B HIS 111 ? B HIS 111 ? 1_555 110.0 ? 
9  O8  ? K 8DG .   ? C 8DG 822 ? 1_555 ZN ? I ZN . ? B ZN 1002 ? 1_555 ND1 ? B HIS 111 ? B HIS 111 ? 1_555 95.0  ? 
10 SG  ? B CYS 179 ? B CYS 179 ? 1_555 ZN ? I ZN . ? B ZN 1002 ? 1_555 SG  ? B CYS 108 ? B CYS 108 ? 1_555 117.4 ? 
11 O8  ? K 8DG .   ? C 8DG 822 ? 1_555 ZN ? I ZN . ? B ZN 1002 ? 1_555 SG  ? B CYS 108 ? B CYS 108 ? 1_555 125.1 ? 
12 ND1 ? B HIS 111 ? B HIS 111 ? 1_555 ZN ? I ZN . ? B ZN 1002 ? 1_555 SG  ? B CYS 108 ? B CYS 108 ? 1_555 109.4 ? 
13 SG  ? C CYS 179 ? C CYS 179 ? 1_555 ZN ? J ZN . ? C ZN 1003 ? 1_555 O8  ? M 8DG .   ? D 8DG 823 ? 1_555 92.1  ? 
14 SG  ? C CYS 179 ? C CYS 179 ? 1_555 ZN ? J ZN . ? C ZN 1003 ? 1_555 SG  ? C CYS 108 ? C CYS 108 ? 1_555 119.9 ? 
15 O8  ? M 8DG .   ? D 8DG 823 ? 1_555 ZN ? J ZN . ? C ZN 1003 ? 1_555 SG  ? C CYS 108 ? C CYS 108 ? 1_555 126.5 ? 
16 SG  ? C CYS 179 ? C CYS 179 ? 1_555 ZN ? J ZN . ? C ZN 1003 ? 1_555 ND1 ? C HIS 111 ? C HIS 111 ? 1_555 108.8 ? 
17 O8  ? M 8DG .   ? D 8DG 823 ? 1_555 ZN ? J ZN . ? C ZN 1003 ? 1_555 ND1 ? C HIS 111 ? C HIS 111 ? 1_555 95.7  ? 
18 SG  ? C CYS 108 ? C CYS 108 ? 1_555 ZN ? J ZN . ? C ZN 1003 ? 1_555 ND1 ? C HIS 111 ? C HIS 111 ? 1_555 110.3 ? 
19 O8  ? N 8DG .   ? D 8DG 824 ? 1_555 ZN ? L ZN . ? D ZN 1004 ? 1_555 ND1 ? D HIS 111 ? D HIS 111 ? 1_555 96.2  ? 
20 O8  ? N 8DG .   ? D 8DG 824 ? 1_555 ZN ? L ZN . ? D ZN 1004 ? 1_555 SG  ? D CYS 108 ? D CYS 108 ? 1_555 120.7 ? 
21 ND1 ? D HIS 111 ? D HIS 111 ? 1_555 ZN ? L ZN . ? D ZN 1004 ? 1_555 SG  ? D CYS 108 ? D CYS 108 ? 1_555 111.3 ? 
22 O8  ? N 8DG .   ? D 8DG 824 ? 1_555 ZN ? L ZN . ? D ZN 1004 ? 1_555 SG  ? D CYS 179 ? D CYS 179 ? 1_555 97.3  ? 
23 ND1 ? D HIS 111 ? D HIS 111 ? 1_555 ZN ? L ZN . ? D ZN 1004 ? 1_555 SG  ? D CYS 179 ? D CYS 179 ? 1_555 108.0 ? 
24 SG  ? D CYS 108 ? D CYS 108 ? 1_555 ZN ? L ZN . ? D ZN 1004 ? 1_555 SG  ? D CYS 179 ? D CYS 179 ? 1_555 120.1 ? 
25 O8  ? H 8DG .   ? A 8DG 825 ? 1_555 ZN ? O ZN . ? E ZN 1005 ? 1_555 SG  ? E CYS 108 ? E CYS 108 ? 1_555 121.9 ? 
26 O8  ? H 8DG .   ? A 8DG 825 ? 1_555 ZN ? O ZN . ? E ZN 1005 ? 1_555 SG  ? E CYS 179 ? E CYS 179 ? 1_555 96.4  ? 
27 SG  ? E CYS 108 ? E CYS 108 ? 1_555 ZN ? O ZN . ? E ZN 1005 ? 1_555 SG  ? E CYS 179 ? E CYS 179 ? 1_555 117.1 ? 
28 O8  ? H 8DG .   ? A 8DG 825 ? 1_555 ZN ? O ZN . ? E ZN 1005 ? 1_555 ND1 ? E HIS 111 ? E HIS 111 ? 1_555 99.2  ? 
29 SG  ? E CYS 108 ? E CYS 108 ? 1_555 ZN ? O ZN . ? E ZN 1005 ? 1_555 ND1 ? E HIS 111 ? E HIS 111 ? 1_555 110.8 ? 
30 SG  ? E CYS 179 ? E CYS 179 ? 1_555 ZN ? O ZN . ? E ZN 1005 ? 1_555 ND1 ? E HIS 111 ? E HIS 111 ? 1_555 109.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-19 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
CNS       refinement        . ? 3 
HKL-2000  'data reduction'  . ? 4 
CNS       phasing           . ? 5 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A SER 2   ? A SER 2   
3   1 Y 1 A PRO 3   ? A PRO 3   
4   1 Y 1 A GLY 4   ? A GLY 4   
5   1 Y 1 A PRO 5   ? A PRO 5   
6   1 Y 1 A GLN 6   ? A GLN 6   
7   1 Y 1 A SER 7   ? A SER 7   
8   1 Y 1 A GLY 8   ? A GLY 8   
9   1 Y 1 A GLY 9   ? A GLY 9   
10  1 Y 1 A GLN 10  ? A GLN 10  
11  1 Y 1 A GLU 11  ? A GLU 11  
12  1 Y 1 A ARG 12  ? A ARG 12  
13  1 Y 1 A GLY 13  ? A GLY 13  
14  1 Y 1 A SER 14  ? A SER 14  
15  1 Y 1 A MET 15  ? A MET 15  
16  1 Y 1 A GLU 16  ? A GLU 16  
17  1 Y 1 A ARG 17  ? A ARG 17  
18  1 Y 1 A LYS 18  ? A LYS 18  
19  1 Y 1 A MET 19  ? A MET 19  
20  1 Y 1 A VAL 20  ? A VAL 20  
21  1 Y 1 A GLU 21  ? A GLU 21  
22  1 Y 1 A LEU 22  ? A LEU 22  
23  1 Y 1 A GLU 23  ? A GLU 23  
24  1 Y 1 A ASP 24  ? A ASP 24  
25  1 Y 1 A THR 25  ? A THR 25  
26  1 Y 1 A GLY 26  ? A GLY 26  
27  1 Y 1 A LEU 27  ? A LEU 27  
28  1 Y 1 A THR 28  ? A THR 28  
29  1 Y 1 A PHE 29  ? A PHE 29  
30  1 Y 1 A ALA 30  ? A ALA 30  
31  1 Y 1 A THR 31  ? A THR 31  
32  1 Y 1 A ASP 217 ? A ASP 217 
33  1 Y 1 A GLY 218 ? A GLY 218 
34  1 Y 1 A THR 219 ? A THR 219 
35  1 Y 1 A ALA 220 ? A ALA 220 
36  1 Y 1 B MET 1   ? B MET 1   
37  1 Y 1 B SER 2   ? B SER 2   
38  1 Y 1 B PRO 3   ? B PRO 3   
39  1 Y 1 B GLY 4   ? B GLY 4   
40  1 Y 1 B PRO 5   ? B PRO 5   
41  1 Y 1 B GLN 6   ? B GLN 6   
42  1 Y 1 B SER 7   ? B SER 7   
43  1 Y 1 B GLY 8   ? B GLY 8   
44  1 Y 1 B GLY 9   ? B GLY 9   
45  1 Y 1 B GLN 10  ? B GLN 10  
46  1 Y 1 B GLU 11  ? B GLU 11  
47  1 Y 1 B ARG 12  ? B ARG 12  
48  1 Y 1 B GLY 13  ? B GLY 13  
49  1 Y 1 B SER 14  ? B SER 14  
50  1 Y 1 B MET 15  ? B MET 15  
51  1 Y 1 B GLU 16  ? B GLU 16  
52  1 Y 1 B ARG 17  ? B ARG 17  
53  1 Y 1 B LYS 18  ? B LYS 18  
54  1 Y 1 B MET 19  ? B MET 19  
55  1 Y 1 B VAL 20  ? B VAL 20  
56  1 Y 1 B GLU 21  ? B GLU 21  
57  1 Y 1 B LEU 22  ? B LEU 22  
58  1 Y 1 B GLU 23  ? B GLU 23  
59  1 Y 1 B ASP 24  ? B ASP 24  
60  1 Y 1 B THR 25  ? B THR 25  
61  1 Y 1 B GLY 26  ? B GLY 26  
62  1 Y 1 B LEU 27  ? B LEU 27  
63  1 Y 1 B THR 28  ? B THR 28  
64  1 Y 1 B PHE 29  ? B PHE 29  
65  1 Y 1 B ALA 30  ? B ALA 30  
66  1 Y 1 B THR 31  ? B THR 31  
67  1 Y 1 B ASP 217 ? B ASP 217 
68  1 Y 1 B GLY 218 ? B GLY 218 
69  1 Y 1 B THR 219 ? B THR 219 
70  1 Y 1 B ALA 220 ? B ALA 220 
71  1 Y 1 C MET 1   ? C MET 1   
72  1 Y 1 C SER 2   ? C SER 2   
73  1 Y 1 C PRO 3   ? C PRO 3   
74  1 Y 1 C GLY 4   ? C GLY 4   
75  1 Y 1 C PRO 5   ? C PRO 5   
76  1 Y 1 C GLN 6   ? C GLN 6   
77  1 Y 1 C SER 7   ? C SER 7   
78  1 Y 1 C GLY 8   ? C GLY 8   
79  1 Y 1 C GLY 9   ? C GLY 9   
80  1 Y 1 C GLN 10  ? C GLN 10  
81  1 Y 1 C GLU 11  ? C GLU 11  
82  1 Y 1 C ARG 12  ? C ARG 12  
83  1 Y 1 C GLY 13  ? C GLY 13  
84  1 Y 1 C SER 14  ? C SER 14  
85  1 Y 1 C MET 15  ? C MET 15  
86  1 Y 1 C GLU 16  ? C GLU 16  
87  1 Y 1 C ARG 17  ? C ARG 17  
88  1 Y 1 C LYS 18  ? C LYS 18  
89  1 Y 1 C MET 19  ? C MET 19  
90  1 Y 1 C VAL 20  ? C VAL 20  
91  1 Y 1 C GLU 21  ? C GLU 21  
92  1 Y 1 C LEU 22  ? C LEU 22  
93  1 Y 1 C GLU 23  ? C GLU 23  
94  1 Y 1 C ASP 24  ? C ASP 24  
95  1 Y 1 C THR 25  ? C THR 25  
96  1 Y 1 C GLY 26  ? C GLY 26  
97  1 Y 1 C LEU 27  ? C LEU 27  
98  1 Y 1 C THR 28  ? C THR 28  
99  1 Y 1 C PHE 29  ? C PHE 29  
100 1 Y 1 C ALA 30  ? C ALA 30  
101 1 Y 1 C THR 31  ? C THR 31  
102 1 Y 1 C ASP 217 ? C ASP 217 
103 1 Y 1 C GLY 218 ? C GLY 218 
104 1 Y 1 C THR 219 ? C THR 219 
105 1 Y 1 C ALA 220 ? C ALA 220 
106 1 Y 1 D MET 1   ? D MET 1   
107 1 Y 1 D SER 2   ? D SER 2   
108 1 Y 1 D PRO 3   ? D PRO 3   
109 1 Y 1 D GLY 4   ? D GLY 4   
110 1 Y 1 D PRO 5   ? D PRO 5   
111 1 Y 1 D GLN 6   ? D GLN 6   
112 1 Y 1 D SER 7   ? D SER 7   
113 1 Y 1 D GLY 8   ? D GLY 8   
114 1 Y 1 D GLY 9   ? D GLY 9   
115 1 Y 1 D GLN 10  ? D GLN 10  
116 1 Y 1 D GLU 11  ? D GLU 11  
117 1 Y 1 D ARG 12  ? D ARG 12  
118 1 Y 1 D GLY 13  ? D GLY 13  
119 1 Y 1 D SER 14  ? D SER 14  
120 1 Y 1 D MET 15  ? D MET 15  
121 1 Y 1 D GLU 16  ? D GLU 16  
122 1 Y 1 D ARG 17  ? D ARG 17  
123 1 Y 1 D LYS 18  ? D LYS 18  
124 1 Y 1 D MET 19  ? D MET 19  
125 1 Y 1 D VAL 20  ? D VAL 20  
126 1 Y 1 D GLU 21  ? D GLU 21  
127 1 Y 1 D LEU 22  ? D LEU 22  
128 1 Y 1 D GLU 23  ? D GLU 23  
129 1 Y 1 D ASP 24  ? D ASP 24  
130 1 Y 1 D THR 25  ? D THR 25  
131 1 Y 1 D GLY 26  ? D GLY 26  
132 1 Y 1 D LEU 27  ? D LEU 27  
133 1 Y 1 D THR 28  ? D THR 28  
134 1 Y 1 D PHE 29  ? D PHE 29  
135 1 Y 1 D ALA 30  ? D ALA 30  
136 1 Y 1 D THR 31  ? D THR 31  
137 1 Y 1 D ASP 217 ? D ASP 217 
138 1 Y 1 D GLY 218 ? D GLY 218 
139 1 Y 1 D THR 219 ? D THR 219 
140 1 Y 1 D ALA 220 ? D ALA 220 
141 1 Y 1 E MET 1   ? E MET 1   
142 1 Y 1 E SER 2   ? E SER 2   
143 1 Y 1 E PRO 3   ? E PRO 3   
144 1 Y 1 E GLY 4   ? E GLY 4   
145 1 Y 1 E PRO 5   ? E PRO 5   
146 1 Y 1 E GLN 6   ? E GLN 6   
147 1 Y 1 E SER 7   ? E SER 7   
148 1 Y 1 E GLY 8   ? E GLY 8   
149 1 Y 1 E GLY 9   ? E GLY 9   
150 1 Y 1 E GLN 10  ? E GLN 10  
151 1 Y 1 E GLU 11  ? E GLU 11  
152 1 Y 1 E ARG 12  ? E ARG 12  
153 1 Y 1 E GLY 13  ? E GLY 13  
154 1 Y 1 E SER 14  ? E SER 14  
155 1 Y 1 E MET 15  ? E MET 15  
156 1 Y 1 E GLU 16  ? E GLU 16  
157 1 Y 1 E ARG 17  ? E ARG 17  
158 1 Y 1 E LYS 18  ? E LYS 18  
159 1 Y 1 E MET 19  ? E MET 19  
160 1 Y 1 E VAL 20  ? E VAL 20  
161 1 Y 1 E GLU 21  ? E GLU 21  
162 1 Y 1 E LEU 22  ? E LEU 22  
163 1 Y 1 E GLU 23  ? E GLU 23  
164 1 Y 1 E ASP 24  ? E ASP 24  
165 1 Y 1 E THR 25  ? E THR 25  
166 1 Y 1 E GLY 26  ? E GLY 26  
167 1 Y 1 E LEU 27  ? E LEU 27  
168 1 Y 1 E THR 28  ? E THR 28  
169 1 Y 1 E PHE 29  ? E PHE 29  
170 1 Y 1 E ALA 30  ? E ALA 30  
171 1 Y 1 E THR 31  ? E THR 31  
172 1 Y 1 E GLU 32  ? E GLU 32  
173 1 Y 1 E ASP 217 ? E ASP 217 
174 1 Y 1 E GLY 218 ? E GLY 218 
175 1 Y 1 E THR 219 ? E THR 219 
176 1 Y 1 E ALA 220 ? E ALA 220 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                                ZN  
3 "8-OXO-2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" 8DG 
4 water                                     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 2 ZN  1  1001 1   ZN  ZN2 A . 
G 3 8DG 1  821  821 8DG 8DG A . 
H 3 8DG 1  825  825 8DG 8DG A . 
I 2 ZN  1  1002 2   ZN  ZN2 B . 
J 2 ZN  1  1003 3   ZN  ZN2 C . 
K 3 8DG 1  822  822 8DG 8DG C . 
L 2 ZN  1  1004 4   ZN  ZN2 D . 
M 3 8DG 1  823  823 8DG 8DG D . 
N 3 8DG 1  824  824 8DG 8DG D . 
O 2 ZN  1  1005 5   ZN  ZN2 E . 
P 4 HOH 1  1002 4   HOH HOH A . 
P 4 HOH 2  1003 6   HOH HOH A . 
P 4 HOH 3  1004 9   HOH HOH A . 
P 4 HOH 4  1005 10  HOH HOH A . 
P 4 HOH 5  1006 11  HOH HOH A . 
P 4 HOH 6  1007 13  HOH HOH A . 
P 4 HOH 7  1008 19  HOH HOH A . 
P 4 HOH 8  1009 20  HOH HOH A . 
P 4 HOH 9  1010 31  HOH HOH A . 
P 4 HOH 10 1011 36  HOH HOH A . 
P 4 HOH 11 1012 39  HOH HOH A . 
P 4 HOH 12 1013 41  HOH HOH A . 
P 4 HOH 13 1014 42  HOH HOH A . 
P 4 HOH 14 1015 52  HOH HOH A . 
P 4 HOH 15 1016 54  HOH HOH A . 
P 4 HOH 16 1017 60  HOH HOH A . 
P 4 HOH 17 1018 61  HOH HOH A . 
P 4 HOH 18 1019 64  HOH HOH A . 
P 4 HOH 19 1020 66  HOH HOH A . 
P 4 HOH 20 1021 73  HOH HOH A . 
P 4 HOH 21 1022 74  HOH HOH A . 
P 4 HOH 22 1023 81  HOH HOH A . 
P 4 HOH 23 1024 84  HOH HOH A . 
P 4 HOH 24 1025 93  HOH HOH A . 
P 4 HOH 25 1026 95  HOH HOH A . 
P 4 HOH 26 1027 99  HOH HOH A . 
P 4 HOH 27 1028 103 HOH HOH A . 
P 4 HOH 28 1029 104 HOH HOH A . 
P 4 HOH 29 1030 106 HOH HOH A . 
P 4 HOH 30 1031 107 HOH HOH A . 
P 4 HOH 31 1032 108 HOH HOH A . 
P 4 HOH 32 1033 113 HOH HOH A . 
P 4 HOH 33 1034 117 HOH HOH A . 
P 4 HOH 34 1035 128 HOH HOH A . 
P 4 HOH 35 1036 138 HOH HOH A . 
P 4 HOH 36 1037 139 HOH HOH A . 
P 4 HOH 37 1038 143 HOH HOH A . 
P 4 HOH 38 1039 157 HOH HOH A . 
P 4 HOH 39 1040 158 HOH HOH A . 
P 4 HOH 40 1041 160 HOH HOH A . 
P 4 HOH 41 1042 161 HOH HOH A . 
P 4 HOH 42 1043 163 HOH HOH A . 
P 4 HOH 43 1044 172 HOH HOH A . 
P 4 HOH 44 1045 181 HOH HOH A . 
P 4 HOH 45 1046 189 HOH HOH A . 
P 4 HOH 46 1047 191 HOH HOH A . 
P 4 HOH 47 1048 195 HOH HOH A . 
P 4 HOH 48 1049 200 HOH HOH A . 
P 4 HOH 49 1050 201 HOH HOH A . 
P 4 HOH 50 1051 209 HOH HOH A . 
P 4 HOH 51 1052 213 HOH HOH A . 
P 4 HOH 52 1053 222 HOH HOH A . 
P 4 HOH 53 1054 227 HOH HOH A . 
P 4 HOH 54 1055 241 HOH HOH A . 
P 4 HOH 55 1056 243 HOH HOH A . 
P 4 HOH 56 1057 253 HOH HOH A . 
P 4 HOH 57 1058 257 HOH HOH A . 
P 4 HOH 58 1059 267 HOH HOH A . 
P 4 HOH 59 1060 268 HOH HOH A . 
P 4 HOH 60 1061 269 HOH HOH A . 
P 4 HOH 61 1062 272 HOH HOH A . 
P 4 HOH 62 1063 278 HOH HOH A . 
P 4 HOH 63 1064 279 HOH HOH A . 
P 4 HOH 64 1065 284 HOH HOH A . 
P 4 HOH 65 1066 285 HOH HOH A . 
P 4 HOH 66 1067 286 HOH HOH A . 
P 4 HOH 67 1068 289 HOH HOH A . 
P 4 HOH 68 1069 292 HOH HOH A . 
P 4 HOH 69 1070 297 HOH HOH A . 
P 4 HOH 70 1071 299 HOH HOH A . 
P 4 HOH 71 1072 305 HOH HOH A . 
P 4 HOH 72 1073 308 HOH HOH A . 
P 4 HOH 73 1074 311 HOH HOH A . 
P 4 HOH 74 1075 320 HOH HOH A . 
P 4 HOH 75 1076 330 HOH HOH A . 
P 4 HOH 76 1077 331 HOH HOH A . 
P 4 HOH 77 1078 339 HOH HOH A . 
P 4 HOH 78 1079 347 HOH HOH A . 
P 4 HOH 79 1080 349 HOH HOH A . 
P 4 HOH 80 1081 355 HOH HOH A . 
P 4 HOH 81 1082 360 HOH HOH A . 
P 4 HOH 82 1083 363 HOH HOH A . 
P 4 HOH 83 1084 364 HOH HOH A . 
P 4 HOH 84 1085 368 HOH HOH A . 
P 4 HOH 85 1086 376 HOH HOH A . 
P 4 HOH 86 1087 388 HOH HOH A . 
P 4 HOH 87 1088 396 HOH HOH A . 
P 4 HOH 88 1089 398 HOH HOH A . 
P 4 HOH 89 1090 409 HOH HOH A . 
P 4 HOH 90 1091 411 HOH HOH A . 
P 4 HOH 91 1092 416 HOH HOH A . 
P 4 HOH 92 1093 417 HOH HOH A . 
Q 4 HOH 1  1003 2   HOH HOH B . 
Q 4 HOH 2  1004 3   HOH HOH B . 
Q 4 HOH 3  1005 5   HOH HOH B . 
Q 4 HOH 4  1006 8   HOH HOH B . 
Q 4 HOH 5  1007 18  HOH HOH B . 
Q 4 HOH 6  1008 21  HOH HOH B . 
Q 4 HOH 7  1009 29  HOH HOH B . 
Q 4 HOH 8  1010 30  HOH HOH B . 
Q 4 HOH 9  1011 32  HOH HOH B . 
Q 4 HOH 10 1012 38  HOH HOH B . 
Q 4 HOH 11 1013 40  HOH HOH B . 
Q 4 HOH 12 1014 45  HOH HOH B . 
Q 4 HOH 13 1015 46  HOH HOH B . 
Q 4 HOH 14 1016 57  HOH HOH B . 
Q 4 HOH 15 1017 62  HOH HOH B . 
Q 4 HOH 16 1018 65  HOH HOH B . 
Q 4 HOH 17 1019 77  HOH HOH B . 
Q 4 HOH 18 1020 78  HOH HOH B . 
Q 4 HOH 19 1021 85  HOH HOH B . 
Q 4 HOH 20 1022 88  HOH HOH B . 
Q 4 HOH 21 1023 91  HOH HOH B . 
Q 4 HOH 22 1024 92  HOH HOH B . 
Q 4 HOH 23 1025 96  HOH HOH B . 
Q 4 HOH 24 1026 105 HOH HOH B . 
Q 4 HOH 25 1027 111 HOH HOH B . 
Q 4 HOH 26 1028 112 HOH HOH B . 
Q 4 HOH 27 1029 115 HOH HOH B . 
Q 4 HOH 28 1030 116 HOH HOH B . 
Q 4 HOH 29 1031 118 HOH HOH B . 
Q 4 HOH 30 1032 119 HOH HOH B . 
Q 4 HOH 31 1033 122 HOH HOH B . 
Q 4 HOH 32 1034 136 HOH HOH B . 
Q 4 HOH 33 1035 150 HOH HOH B . 
Q 4 HOH 34 1036 151 HOH HOH B . 
Q 4 HOH 35 1037 153 HOH HOH B . 
Q 4 HOH 36 1038 154 HOH HOH B . 
Q 4 HOH 37 1039 162 HOH HOH B . 
Q 4 HOH 38 1040 171 HOH HOH B . 
Q 4 HOH 39 1041 177 HOH HOH B . 
Q 4 HOH 40 1042 183 HOH HOH B . 
Q 4 HOH 41 1043 184 HOH HOH B . 
Q 4 HOH 42 1044 190 HOH HOH B . 
Q 4 HOH 43 1045 192 HOH HOH B . 
Q 4 HOH 44 1046 193 HOH HOH B . 
Q 4 HOH 45 1047 196 HOH HOH B . 
Q 4 HOH 46 1048 198 HOH HOH B . 
Q 4 HOH 47 1049 206 HOH HOH B . 
Q 4 HOH 48 1050 220 HOH HOH B . 
Q 4 HOH 49 1051 228 HOH HOH B . 
Q 4 HOH 50 1052 230 HOH HOH B . 
Q 4 HOH 51 1053 231 HOH HOH B . 
Q 4 HOH 52 1054 236 HOH HOH B . 
Q 4 HOH 53 1055 248 HOH HOH B . 
Q 4 HOH 54 1056 260 HOH HOH B . 
Q 4 HOH 55 1057 265 HOH HOH B . 
Q 4 HOH 56 1058 270 HOH HOH B . 
Q 4 HOH 57 1059 273 HOH HOH B . 
Q 4 HOH 58 1060 275 HOH HOH B . 
Q 4 HOH 59 1061 280 HOH HOH B . 
Q 4 HOH 60 1062 281 HOH HOH B . 
Q 4 HOH 61 1063 282 HOH HOH B . 
Q 4 HOH 62 1064 290 HOH HOH B . 
Q 4 HOH 63 1065 293 HOH HOH B . 
Q 4 HOH 64 1066 296 HOH HOH B . 
Q 4 HOH 65 1067 301 HOH HOH B . 
Q 4 HOH 66 1068 304 HOH HOH B . 
Q 4 HOH 67 1069 309 HOH HOH B . 
Q 4 HOH 68 1070 319 HOH HOH B . 
Q 4 HOH 69 1071 322 HOH HOH B . 
Q 4 HOH 70 1072 335 HOH HOH B . 
Q 4 HOH 71 1073 336 HOH HOH B . 
Q 4 HOH 72 1074 342 HOH HOH B . 
Q 4 HOH 73 1075 344 HOH HOH B . 
Q 4 HOH 74 1076 346 HOH HOH B . 
Q 4 HOH 75 1077 354 HOH HOH B . 
Q 4 HOH 76 1078 356 HOH HOH B . 
Q 4 HOH 77 1079 373 HOH HOH B . 
Q 4 HOH 78 1080 377 HOH HOH B . 
Q 4 HOH 79 1081 382 HOH HOH B . 
Q 4 HOH 80 1082 385 HOH HOH B . 
Q 4 HOH 81 1083 389 HOH HOH B . 
Q 4 HOH 82 1084 392 HOH HOH B . 
Q 4 HOH 83 1085 401 HOH HOH B . 
Q 4 HOH 84 1086 404 HOH HOH B . 
Q 4 HOH 85 1087 406 HOH HOH B . 
Q 4 HOH 86 1088 408 HOH HOH B . 
Q 4 HOH 87 1089 413 HOH HOH B . 
Q 4 HOH 88 1090 414 HOH HOH B . 
R 4 HOH 1  1004 7   HOH HOH C . 
R 4 HOH 2  1005 22  HOH HOH C . 
R 4 HOH 3  1006 24  HOH HOH C . 
R 4 HOH 4  1007 37  HOH HOH C . 
R 4 HOH 5  1008 48  HOH HOH C . 
R 4 HOH 6  1009 59  HOH HOH C . 
R 4 HOH 7  1010 68  HOH HOH C . 
R 4 HOH 8  1011 76  HOH HOH C . 
R 4 HOH 9  1012 80  HOH HOH C . 
R 4 HOH 10 1013 94  HOH HOH C . 
R 4 HOH 11 1014 100 HOH HOH C . 
R 4 HOH 12 1015 121 HOH HOH C . 
R 4 HOH 13 1016 125 HOH HOH C . 
R 4 HOH 14 1017 126 HOH HOH C . 
R 4 HOH 15 1018 130 HOH HOH C . 
R 4 HOH 16 1019 140 HOH HOH C . 
R 4 HOH 17 1020 145 HOH HOH C . 
R 4 HOH 18 1021 146 HOH HOH C . 
R 4 HOH 19 1022 148 HOH HOH C . 
R 4 HOH 20 1023 149 HOH HOH C . 
R 4 HOH 21 1024 155 HOH HOH C . 
R 4 HOH 22 1025 156 HOH HOH C . 
R 4 HOH 23 1026 166 HOH HOH C . 
R 4 HOH 24 1027 175 HOH HOH C . 
R 4 HOH 25 1028 176 HOH HOH C . 
R 4 HOH 26 1029 180 HOH HOH C . 
R 4 HOH 27 1030 185 HOH HOH C . 
R 4 HOH 28 1031 187 HOH HOH C . 
R 4 HOH 29 1032 203 HOH HOH C . 
R 4 HOH 30 1033 216 HOH HOH C . 
R 4 HOH 31 1034 217 HOH HOH C . 
R 4 HOH 32 1035 224 HOH HOH C . 
R 4 HOH 33 1036 233 HOH HOH C . 
R 4 HOH 34 1037 235 HOH HOH C . 
R 4 HOH 35 1038 237 HOH HOH C . 
R 4 HOH 36 1039 239 HOH HOH C . 
R 4 HOH 37 1040 242 HOH HOH C . 
R 4 HOH 38 1041 249 HOH HOH C . 
R 4 HOH 39 1042 251 HOH HOH C . 
R 4 HOH 40 1043 256 HOH HOH C . 
R 4 HOH 41 1044 258 HOH HOH C . 
R 4 HOH 42 1045 259 HOH HOH C . 
R 4 HOH 43 1046 262 HOH HOH C . 
R 4 HOH 44 1047 264 HOH HOH C . 
R 4 HOH 45 1048 288 HOH HOH C . 
R 4 HOH 46 1049 295 HOH HOH C . 
R 4 HOH 47 1050 314 HOH HOH C . 
R 4 HOH 48 1051 321 HOH HOH C . 
R 4 HOH 49 1052 323 HOH HOH C . 
R 4 HOH 50 1053 324 HOH HOH C . 
R 4 HOH 51 1054 338 HOH HOH C . 
R 4 HOH 52 1055 345 HOH HOH C . 
R 4 HOH 53 1056 348 HOH HOH C . 
R 4 HOH 54 1057 357 HOH HOH C . 
R 4 HOH 55 1058 366 HOH HOH C . 
R 4 HOH 56 1059 367 HOH HOH C . 
R 4 HOH 57 1060 369 HOH HOH C . 
R 4 HOH 58 1061 371 HOH HOH C . 
R 4 HOH 59 1062 378 HOH HOH C . 
R 4 HOH 60 1063 379 HOH HOH C . 
R 4 HOH 61 1064 383 HOH HOH C . 
R 4 HOH 62 1065 384 HOH HOH C . 
R 4 HOH 63 1066 387 HOH HOH C . 
R 4 HOH 64 1067 394 HOH HOH C . 
R 4 HOH 65 1068 395 HOH HOH C . 
R 4 HOH 66 1069 400 HOH HOH C . 
R 4 HOH 67 1070 407 HOH HOH C . 
R 4 HOH 68 1071 415 HOH HOH C . 
S 4 HOH 1  1005 16  HOH HOH D . 
S 4 HOH 2  1006 17  HOH HOH D . 
S 4 HOH 3  1007 26  HOH HOH D . 
S 4 HOH 4  1008 27  HOH HOH D . 
S 4 HOH 5  1009 47  HOH HOH D . 
S 4 HOH 6  1010 53  HOH HOH D . 
S 4 HOH 7  1011 56  HOH HOH D . 
S 4 HOH 8  1012 67  HOH HOH D . 
S 4 HOH 9  1013 69  HOH HOH D . 
S 4 HOH 10 1014 70  HOH HOH D . 
S 4 HOH 11 1015 79  HOH HOH D . 
S 4 HOH 12 1016 82  HOH HOH D . 
S 4 HOH 13 1017 87  HOH HOH D . 
S 4 HOH 14 1018 90  HOH HOH D . 
S 4 HOH 15 1019 97  HOH HOH D . 
S 4 HOH 16 1020 98  HOH HOH D . 
S 4 HOH 17 1021 109 HOH HOH D . 
S 4 HOH 18 1022 110 HOH HOH D . 
S 4 HOH 19 1023 123 HOH HOH D . 
S 4 HOH 20 1024 124 HOH HOH D . 
S 4 HOH 21 1025 127 HOH HOH D . 
S 4 HOH 22 1026 131 HOH HOH D . 
S 4 HOH 23 1027 132 HOH HOH D . 
S 4 HOH 24 1028 134 HOH HOH D . 
S 4 HOH 25 1029 142 HOH HOH D . 
S 4 HOH 26 1030 144 HOH HOH D . 
S 4 HOH 27 1031 147 HOH HOH D . 
S 4 HOH 28 1032 159 HOH HOH D . 
S 4 HOH 29 1033 167 HOH HOH D . 
S 4 HOH 30 1034 169 HOH HOH D . 
S 4 HOH 31 1035 174 HOH HOH D . 
S 4 HOH 32 1036 186 HOH HOH D . 
S 4 HOH 33 1037 197 HOH HOH D . 
S 4 HOH 34 1038 205 HOH HOH D . 
S 4 HOH 35 1039 207 HOH HOH D . 
S 4 HOH 36 1040 208 HOH HOH D . 
S 4 HOH 37 1041 210 HOH HOH D . 
S 4 HOH 38 1042 211 HOH HOH D . 
S 4 HOH 39 1043 212 HOH HOH D . 
S 4 HOH 40 1044 219 HOH HOH D . 
S 4 HOH 41 1045 221 HOH HOH D . 
S 4 HOH 42 1046 225 HOH HOH D . 
S 4 HOH 43 1047 229 HOH HOH D . 
S 4 HOH 44 1048 238 HOH HOH D . 
S 4 HOH 45 1049 245 HOH HOH D . 
S 4 HOH 46 1050 246 HOH HOH D . 
S 4 HOH 47 1051 247 HOH HOH D . 
S 4 HOH 48 1052 250 HOH HOH D . 
S 4 HOH 49 1053 271 HOH HOH D . 
S 4 HOH 50 1054 274 HOH HOH D . 
S 4 HOH 51 1055 277 HOH HOH D . 
S 4 HOH 52 1056 291 HOH HOH D . 
S 4 HOH 53 1057 294 HOH HOH D . 
S 4 HOH 54 1058 300 HOH HOH D . 
S 4 HOH 55 1059 302 HOH HOH D . 
S 4 HOH 56 1060 303 HOH HOH D . 
S 4 HOH 57 1061 307 HOH HOH D . 
S 4 HOH 58 1062 315 HOH HOH D . 
S 4 HOH 59 1063 317 HOH HOH D . 
S 4 HOH 60 1064 318 HOH HOH D . 
S 4 HOH 61 1065 326 HOH HOH D . 
S 4 HOH 62 1066 327 HOH HOH D . 
S 4 HOH 63 1067 334 HOH HOH D . 
S 4 HOH 64 1068 343 HOH HOH D . 
S 4 HOH 65 1069 359 HOH HOH D . 
S 4 HOH 66 1070 361 HOH HOH D . 
S 4 HOH 67 1071 362 HOH HOH D . 
S 4 HOH 68 1072 370 HOH HOH D . 
S 4 HOH 69 1073 372 HOH HOH D . 
S 4 HOH 70 1074 374 HOH HOH D . 
S 4 HOH 71 1075 375 HOH HOH D . 
S 4 HOH 72 1076 390 HOH HOH D . 
S 4 HOH 73 1077 391 HOH HOH D . 
S 4 HOH 74 1078 399 HOH HOH D . 
S 4 HOH 75 1079 402 HOH HOH D . 
S 4 HOH 76 1080 403 HOH HOH D . 
S 4 HOH 77 1081 410 HOH HOH D . 
T 4 HOH 1  1006 1   HOH HOH E . 
T 4 HOH 2  1007 12  HOH HOH E . 
T 4 HOH 3  1008 14  HOH HOH E . 
T 4 HOH 4  1009 15  HOH HOH E . 
T 4 HOH 5  1010 23  HOH HOH E . 
T 4 HOH 6  1011 25  HOH HOH E . 
T 4 HOH 7  1012 28  HOH HOH E . 
T 4 HOH 8  1013 33  HOH HOH E . 
T 4 HOH 9  1014 34  HOH HOH E . 
T 4 HOH 10 1015 35  HOH HOH E . 
T 4 HOH 11 1016 43  HOH HOH E . 
T 4 HOH 12 1017 49  HOH HOH E . 
T 4 HOH 13 1018 50  HOH HOH E . 
T 4 HOH 14 1019 51  HOH HOH E . 
T 4 HOH 15 1020 55  HOH HOH E . 
T 4 HOH 16 1021 58  HOH HOH E . 
T 4 HOH 17 1022 63  HOH HOH E . 
T 4 HOH 18 1023 71  HOH HOH E . 
T 4 HOH 19 1024 72  HOH HOH E . 
T 4 HOH 20 1025 75  HOH HOH E . 
T 4 HOH 21 1026 83  HOH HOH E . 
T 4 HOH 22 1027 86  HOH HOH E . 
T 4 HOH 23 1028 89  HOH HOH E . 
T 4 HOH 24 1029 101 HOH HOH E . 
T 4 HOH 25 1030 102 HOH HOH E . 
T 4 HOH 26 1031 114 HOH HOH E . 
T 4 HOH 27 1032 120 HOH HOH E . 
T 4 HOH 28 1033 129 HOH HOH E . 
T 4 HOH 29 1034 133 HOH HOH E . 
T 4 HOH 30 1035 135 HOH HOH E . 
T 4 HOH 31 1036 137 HOH HOH E . 
T 4 HOH 32 1037 141 HOH HOH E . 
T 4 HOH 33 1038 152 HOH HOH E . 
T 4 HOH 34 1039 164 HOH HOH E . 
T 4 HOH 35 1040 165 HOH HOH E . 
T 4 HOH 36 1041 168 HOH HOH E . 
T 4 HOH 37 1042 170 HOH HOH E . 
T 4 HOH 38 1043 173 HOH HOH E . 
T 4 HOH 39 1044 178 HOH HOH E . 
T 4 HOH 40 1045 179 HOH HOH E . 
T 4 HOH 41 1046 182 HOH HOH E . 
T 4 HOH 42 1047 188 HOH HOH E . 
T 4 HOH 43 1048 194 HOH HOH E . 
T 4 HOH 44 1049 199 HOH HOH E . 
T 4 HOH 45 1050 202 HOH HOH E . 
T 4 HOH 46 1051 204 HOH HOH E . 
T 4 HOH 47 1052 214 HOH HOH E . 
T 4 HOH 48 1053 215 HOH HOH E . 
T 4 HOH 49 1054 218 HOH HOH E . 
T 4 HOH 50 1055 223 HOH HOH E . 
T 4 HOH 51 1056 226 HOH HOH E . 
T 4 HOH 52 1057 232 HOH HOH E . 
T 4 HOH 53 1058 234 HOH HOH E . 
T 4 HOH 54 1059 240 HOH HOH E . 
T 4 HOH 55 1060 244 HOH HOH E . 
T 4 HOH 56 1061 252 HOH HOH E . 
T 4 HOH 57 1062 254 HOH HOH E . 
T 4 HOH 58 1063 255 HOH HOH E . 
T 4 HOH 59 1064 261 HOH HOH E . 
T 4 HOH 60 1065 263 HOH HOH E . 
T 4 HOH 61 1066 266 HOH HOH E . 
T 4 HOH 62 1067 276 HOH HOH E . 
T 4 HOH 63 1068 283 HOH HOH E . 
T 4 HOH 64 1069 287 HOH HOH E . 
T 4 HOH 65 1070 298 HOH HOH E . 
T 4 HOH 66 1071 306 HOH HOH E . 
T 4 HOH 67 1072 310 HOH HOH E . 
T 4 HOH 68 1073 312 HOH HOH E . 
T 4 HOH 69 1074 313 HOH HOH E . 
T 4 HOH 70 1075 316 HOH HOH E . 
T 4 HOH 71 1076 325 HOH HOH E . 
T 4 HOH 72 1077 328 HOH HOH E . 
T 4 HOH 73 1078 329 HOH HOH E . 
T 4 HOH 74 1079 332 HOH HOH E . 
T 4 HOH 75 1080 333 HOH HOH E . 
T 4 HOH 76 1081 337 HOH HOH E . 
T 4 HOH 77 1082 340 HOH HOH E . 
T 4 HOH 78 1083 341 HOH HOH E . 
T 4 HOH 79 1084 350 HOH HOH E . 
T 4 HOH 80 1085 351 HOH HOH E . 
T 4 HOH 81 1086 352 HOH HOH E . 
T 4 HOH 82 1087 353 HOH HOH E . 
T 4 HOH 83 1088 358 HOH HOH E . 
T 4 HOH 84 1089 365 HOH HOH E . 
T 4 HOH 85 1090 380 HOH HOH E . 
T 4 HOH 86 1091 381 HOH HOH E . 
T 4 HOH 87 1092 386 HOH HOH E . 
T 4 HOH 88 1093 393 HOH HOH E . 
T 4 HOH 89 1094 397 HOH HOH E . 
T 4 HOH 90 1095 405 HOH HOH E . 
T 4 HOH 91 1096 412 HOH HOH E . 
T 4 HOH 92 1097 418 HOH HOH E . 
#