data_1WVA
# 
_entry.id   1WVA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1WVA         
RCSB  RCSB024042   
WWPDB D_1000024042 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1WVB 
_pdbx_database_related.details        'The same protein, E256Q mutant' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WVA 
_pdbx_database_status.recvd_initial_deposition_date   2004-12-14 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Di Costanzo, L.'    1 
'Sabio, G.'          2 
'Mora, A.'           3 
'Rodriguez, P.C.'    4 
'Ochoa, A.C.'        5 
'Centeno, F.'        6 
'Christianson, D.W.' 7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of human arginase I at 1.29 A resolution and exploration of inhibition in the immune response' 
Proc.Natl.Acad.Sci.Usa 102 13058 13063 2005 PNASA6 US 0027-8424 0040 ? 16141327 10.1073/pnas.0504027102 
1       'Human arginase II: crystal structure and physiological role in male and female sexual arousal'                   
Biochemistry           42  8445  8451  2003 BICHAW US 0006-2960 0033 ? 12859189 10.1021/bi034340j       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Di Costanzo, L.'    1  
primary 'Sabio, G.'          2  
primary 'Mora, A.'           3  
primary 'Rodriguez, P.C.'    4  
primary 'Ochoa, A.C.'        5  
primary 'Centeno, F.'        6  
primary 'Christianson, D.W.' 7  
1       'Cama, E.'           8  
1       'Colleluori, D.M.'   9  
1       'Emig, F.A.'         10 
1       'Shin, H.'           11 
1       'Kim, S.W.'          12 
1       'Kim, N.N.'          13 
1       'Traish, A.M.'       14 
1       'Ash, D.E.'          15 
1       'Christianson, D.W.' 16 
# 
_cell.entry_id           1WVA 
_cell.length_a           90.602 
_cell.length_b           90.602 
_cell.length_c           69.311 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1WVA 
_symmetry.space_group_name_H-M             'P 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                143 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Arginase 1'                   34779.879 2   3.5.3.1 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'           54.938    4   ?       ? ? ? 
3 non-polymer syn 'S-2-(BORONOETHYL)-L-CYSTEINE' 210.036   2   ?       ? ? ? 
4 water       nat water                          18.015    201 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'arginase I, Liver-type arginase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL
AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP
GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP
PK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL
AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP
GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP
PK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ALA n 
1 4   LYS n 
1 5   SER n 
1 6   ARG n 
1 7   THR n 
1 8   ILE n 
1 9   GLY n 
1 10  ILE n 
1 11  ILE n 
1 12  GLY n 
1 13  ALA n 
1 14  PRO n 
1 15  PHE n 
1 16  SER n 
1 17  LYS n 
1 18  GLY n 
1 19  GLN n 
1 20  PRO n 
1 21  ARG n 
1 22  GLY n 
1 23  GLY n 
1 24  VAL n 
1 25  GLU n 
1 26  GLU n 
1 27  GLY n 
1 28  PRO n 
1 29  THR n 
1 30  VAL n 
1 31  LEU n 
1 32  ARG n 
1 33  LYS n 
1 34  ALA n 
1 35  GLY n 
1 36  LEU n 
1 37  LEU n 
1 38  GLU n 
1 39  LYS n 
1 40  LEU n 
1 41  LYS n 
1 42  GLU n 
1 43  GLN n 
1 44  GLU n 
1 45  CYS n 
1 46  ASP n 
1 47  VAL n 
1 48  LYS n 
1 49  ASP n 
1 50  TYR n 
1 51  GLY n 
1 52  ASP n 
1 53  LEU n 
1 54  PRO n 
1 55  PHE n 
1 56  ALA n 
1 57  ASP n 
1 58  ILE n 
1 59  PRO n 
1 60  ASN n 
1 61  ASP n 
1 62  SER n 
1 63  PRO n 
1 64  PHE n 
1 65  GLN n 
1 66  ILE n 
1 67  VAL n 
1 68  LYS n 
1 69  ASN n 
1 70  PRO n 
1 71  ARG n 
1 72  SER n 
1 73  VAL n 
1 74  GLY n 
1 75  LYS n 
1 76  ALA n 
1 77  SER n 
1 78  GLU n 
1 79  GLN n 
1 80  LEU n 
1 81  ALA n 
1 82  GLY n 
1 83  LYS n 
1 84  VAL n 
1 85  ALA n 
1 86  GLU n 
1 87  VAL n 
1 88  LYS n 
1 89  LYS n 
1 90  ASN n 
1 91  GLY n 
1 92  ARG n 
1 93  ILE n 
1 94  SER n 
1 95  LEU n 
1 96  VAL n 
1 97  LEU n 
1 98  GLY n 
1 99  GLY n 
1 100 ASP n 
1 101 HIS n 
1 102 SER n 
1 103 LEU n 
1 104 ALA n 
1 105 ILE n 
1 106 GLY n 
1 107 SER n 
1 108 ILE n 
1 109 SER n 
1 110 GLY n 
1 111 HIS n 
1 112 ALA n 
1 113 ARG n 
1 114 VAL n 
1 115 HIS n 
1 116 PRO n 
1 117 ASP n 
1 118 LEU n 
1 119 GLY n 
1 120 VAL n 
1 121 ILE n 
1 122 TRP n 
1 123 VAL n 
1 124 ASP n 
1 125 ALA n 
1 126 HIS n 
1 127 THR n 
1 128 ASP n 
1 129 ILE n 
1 130 ASN n 
1 131 THR n 
1 132 PRO n 
1 133 LEU n 
1 134 THR n 
1 135 THR n 
1 136 THR n 
1 137 SER n 
1 138 GLY n 
1 139 ASN n 
1 140 LEU n 
1 141 HIS n 
1 142 GLY n 
1 143 GLN n 
1 144 PRO n 
1 145 VAL n 
1 146 SER n 
1 147 PHE n 
1 148 LEU n 
1 149 LEU n 
1 150 LYS n 
1 151 GLU n 
1 152 LEU n 
1 153 LYS n 
1 154 GLY n 
1 155 LYS n 
1 156 ILE n 
1 157 PRO n 
1 158 ASP n 
1 159 VAL n 
1 160 PRO n 
1 161 GLY n 
1 162 PHE n 
1 163 SER n 
1 164 TRP n 
1 165 VAL n 
1 166 THR n 
1 167 PRO n 
1 168 CYS n 
1 169 ILE n 
1 170 SER n 
1 171 ALA n 
1 172 LYS n 
1 173 ASP n 
1 174 ILE n 
1 175 VAL n 
1 176 TYR n 
1 177 ILE n 
1 178 GLY n 
1 179 LEU n 
1 180 ARG n 
1 181 ASP n 
1 182 VAL n 
1 183 ASP n 
1 184 PRO n 
1 185 GLY n 
1 186 GLU n 
1 187 HIS n 
1 188 TYR n 
1 189 ILE n 
1 190 LEU n 
1 191 LYS n 
1 192 THR n 
1 193 LEU n 
1 194 GLY n 
1 195 ILE n 
1 196 LYS n 
1 197 TYR n 
1 198 PHE n 
1 199 SER n 
1 200 MET n 
1 201 THR n 
1 202 GLU n 
1 203 VAL n 
1 204 ASP n 
1 205 ARG n 
1 206 LEU n 
1 207 GLY n 
1 208 ILE n 
1 209 GLY n 
1 210 LYS n 
1 211 VAL n 
1 212 MET n 
1 213 GLU n 
1 214 GLU n 
1 215 THR n 
1 216 LEU n 
1 217 SER n 
1 218 TYR n 
1 219 LEU n 
1 220 LEU n 
1 221 GLY n 
1 222 ARG n 
1 223 LYS n 
1 224 LYS n 
1 225 ARG n 
1 226 PRO n 
1 227 ILE n 
1 228 HIS n 
1 229 LEU n 
1 230 SER n 
1 231 PHE n 
1 232 ASP n 
1 233 VAL n 
1 234 ASP n 
1 235 GLY n 
1 236 LEU n 
1 237 ASP n 
1 238 PRO n 
1 239 SER n 
1 240 PHE n 
1 241 THR n 
1 242 PRO n 
1 243 ALA n 
1 244 THR n 
1 245 GLY n 
1 246 THR n 
1 247 PRO n 
1 248 VAL n 
1 249 VAL n 
1 250 GLY n 
1 251 GLY n 
1 252 LEU n 
1 253 THR n 
1 254 TYR n 
1 255 ARG n 
1 256 GLU n 
1 257 GLY n 
1 258 LEU n 
1 259 TYR n 
1 260 ILE n 
1 261 THR n 
1 262 GLU n 
1 263 GLU n 
1 264 ILE n 
1 265 TYR n 
1 266 LYS n 
1 267 THR n 
1 268 GLY n 
1 269 LEU n 
1 270 LEU n 
1 271 SER n 
1 272 GLY n 
1 273 LEU n 
1 274 ASP n 
1 275 ILE n 
1 276 MET n 
1 277 GLU n 
1 278 VAL n 
1 279 ASN n 
1 280 PRO n 
1 281 SER n 
1 282 LEU n 
1 283 GLY n 
1 284 LYS n 
1 285 THR n 
1 286 PRO n 
1 287 GLU n 
1 288 GLU n 
1 289 VAL n 
1 290 THR n 
1 291 ARG n 
1 292 THR n 
1 293 VAL n 
1 294 ASN n 
1 295 THR n 
1 296 ALA n 
1 297 VAL n 
1 298 ALA n 
1 299 ILE n 
1 300 THR n 
1 301 LEU n 
1 302 ALA n 
1 303 CYS n 
1 304 PHE n 
1 305 GLY n 
1 306 LEU n 
1 307 ALA n 
1 308 ARG n 
1 309 GLU n 
1 310 GLY n 
1 311 ASN n 
1 312 HIS n 
1 313 LYS n 
1 314 PRO n 
1 315 ILE n 
1 316 ASP n 
1 317 TYR n 
1 318 LEU n 
1 319 ASN n 
1 320 PRO n 
1 321 PRO n 
1 322 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11-d 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARGI1_HUMAN 
_struct_ref.pdbx_db_accession          P05089 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL
AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP
GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP
PK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1WVA A 1 ? 322 ? P05089 1 ? 322 ? 1 322 
2 1 1WVA B 1 ? 322 ? P05089 1 ? 322 ? 1 322 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                        ? 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE                       ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE                     ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                ? 'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE                       ? 'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE                      ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE                        ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE                      ? 'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER                          ? 'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE                     ? 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE                        ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE                         ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE                     ? 'C5 H11 N O2 S'      149.211 
MN  non-polymer         . 'MANGANESE (II) ION'           ? 'Mn 2'               54.938  
PHE 'L-peptide linking' y PHENYLALANINE                  ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE                        ? 'C5 H9 N O2'         115.130 
S2C 'L-peptide linking' n 'S-2-(BORONOETHYL)-L-CYSTEINE' ? 'C5 H13 B N O5 S -1' 210.036 
SER 'L-peptide linking' y SERINE                         ? 'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE                      ? 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                     ? 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE                       ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE                         ? 'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          1WVA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.36 
_exptl_crystal.density_percent_sol   47.87 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    '20% PEGMME 5000, bis-tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-06-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.10000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.10000 
# 
_reflns.entry_id                     1WVA 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.d_resolution_high            1.94 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   46041 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.075 
_reflns.pdbx_Rsym_value              0.075 
_reflns.pdbx_netI_over_sigmaI        8.7 
_reflns.B_iso_Wilson_estimate        24.0 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.94 
_reflns_shell.d_res_low              2.02 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.34 
_reflns_shell.pdbx_Rsym_value        0.34 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        3.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2121 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1WVA 
_refine.ls_d_res_high                            1.94 
_refine.ls_d_res_low                             50.0 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_ls_sigma_I                          1.0 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     45844 
_refine.ls_number_reflns_R_free                  4119 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1504 
_refine.ls_R_factor_R_work                       0.1504 
_refine.ls_R_factor_R_free                       0.209 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1D3V 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  
'This is a twinned structure. The twinning operator is (h,k,l) -> (-h,-k,l) and the twinning fraction is 0.5.' 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4688 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             201 
_refine_hist.number_atoms_total               4919 
_refine_hist.d_res_high                       1.94 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.9  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.9   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1WVA 
_struct.title                     'Crystal structure of human arginase I from twinned crystal' 
_struct.pdbx_descriptor           'Arginase 1(E.C.3.5.3.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WVA 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Hydrolase, twinned crystal, BEC inhibitor' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 21  ? GLU A 25  ? ARG A 21  GLU A 25  5 ? 5  
HELX_P HELX_P2  2  GLU A 26  ? ALA A 34  ? GLU A 26  ALA A 34  1 ? 9  
HELX_P HELX_P3  3  GLY A 35  ? GLN A 43  ? GLY A 35  GLN A 43  1 ? 9  
HELX_P HELX_P4  4  ASN A 69  ? LYS A 88  ? ASN A 69  LYS A 88  1 ? 20 
HELX_P HELX_P5  5  ASP A 100 ? SER A 102 ? ASP A 100 SER A 102 5 ? 3  
HELX_P HELX_P6  6  LEU A 103 ? ARG A 113 ? LEU A 103 ARG A 113 1 ? 11 
HELX_P HELX_P7  7  ASN A 139 ? GLY A 142 ? ASN A 139 GLY A 142 5 ? 4  
HELX_P HELX_P8  8  GLN A 143 ? LEU A 149 ? GLN A 143 LEU A 149 1 ? 7  
HELX_P HELX_P9  9  LYS A 150 ? LYS A 153 ? LYS A 150 LYS A 153 5 ? 4  
HELX_P HELX_P10 10 SER A 170 ? LYS A 172 ? SER A 170 LYS A 172 5 ? 3  
HELX_P HELX_P11 11 ASP A 183 ? GLY A 194 ? ASP A 183 GLY A 194 1 ? 12 
HELX_P HELX_P12 12 SER A 199 ? GLY A 221 ? SER A 199 GLY A 221 1 ? 23 
HELX_P HELX_P13 13 ASP A 234 ? LEU A 236 ? ASP A 234 LEU A 236 5 ? 3  
HELX_P HELX_P14 14 THR A 253 ? THR A 267 ? THR A 253 THR A 267 1 ? 15 
HELX_P HELX_P15 15 ASN A 279 ? GLY A 283 ? ASN A 279 GLY A 283 5 ? 5  
HELX_P HELX_P16 16 THR A 285 ? PHE A 304 ? THR A 285 PHE A 304 1 ? 20 
HELX_P HELX_P17 17 GLY B 22  ? GLU B 25  ? GLY B 22  GLU B 25  5 ? 4  
HELX_P HELX_P18 18 GLU B 26  ? ALA B 34  ? GLU B 26  ALA B 34  1 ? 9  
HELX_P HELX_P19 19 GLY B 35  ? GLU B 42  ? GLY B 35  GLU B 42  1 ? 8  
HELX_P HELX_P20 20 ASN B 69  ? ASN B 90  ? ASN B 69  ASN B 90  1 ? 22 
HELX_P HELX_P21 21 ASP B 100 ? SER B 102 ? ASP B 100 SER B 102 5 ? 3  
HELX_P HELX_P22 22 LEU B 103 ? HIS B 115 ? LEU B 103 HIS B 115 1 ? 13 
HELX_P HELX_P23 23 ASN B 139 ? GLY B 142 ? ASN B 139 GLY B 142 5 ? 4  
HELX_P HELX_P24 24 GLN B 143 ? LEU B 149 ? GLN B 143 LEU B 149 1 ? 7  
HELX_P HELX_P25 25 LYS B 150 ? LYS B 153 ? LYS B 150 LYS B 153 5 ? 4  
HELX_P HELX_P26 26 SER B 170 ? LYS B 172 ? SER B 170 LYS B 172 5 ? 3  
HELX_P HELX_P27 27 ASP B 183 ? LEU B 193 ? ASP B 183 LEU B 193 1 ? 11 
HELX_P HELX_P28 28 SER B 199 ? GLY B 207 ? SER B 199 GLY B 207 1 ? 9  
HELX_P HELX_P29 29 GLY B 207 ? LEU B 220 ? GLY B 207 LEU B 220 1 ? 14 
HELX_P HELX_P30 30 ASP B 234 ? LEU B 236 ? ASP B 234 LEU B 236 5 ? 3  
HELX_P HELX_P31 31 THR B 253 ? LYS B 266 ? THR B 253 LYS B 266 1 ? 14 
HELX_P HELX_P32 32 ASN B 279 ? GLY B 283 ? ASN B 279 GLY B 283 5 ? 5  
HELX_P HELX_P33 33 THR B 285 ? PHE B 304 ? THR B 285 PHE B 304 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C MN . MN ? ? ? 1_555 A HIS 101 ND1 ? ? A MN 2314 A HIS 101  1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc2  metalc ? ? C MN . MN ? ? ? 1_555 A ASP 124 OD2 ? ? A MN 2314 A ASP 124  1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc3  metalc ? ? C MN . MN ? ? ? 1_555 A ASP 128 OD2 ? ? A MN 2314 A ASP 128  1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc4  metalc ? ? C MN . MN ? ? ? 1_555 A ASP 232 OD2 ? ? A MN 2314 A ASP 232  1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc5  metalc ? ? D MN . MN ? ? ? 1_555 A HIS 126 ND1 ? ? A MN 2315 A HIS 126  1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc6  metalc ? ? D MN . MN ? ? ? 1_555 A ASP 124 OD1 ? ? A MN 2315 A ASP 124  1_555 ? ? ? ? ? ? ? 2.239 ? 
metalc7  metalc ? ? D MN . MN ? ? ? 1_555 A ASP 232 OD2 ? ? A MN 2315 A ASP 232  1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc8  metalc ? ? D MN . MN ? ? ? 1_555 A ASP 234 OD1 ? ? A MN 2315 A ASP 234  1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc9  metalc ? ? F MN . MN ? ? ? 1_555 B HIS 101 ND1 ? ? B MN 1314 B HIS 101  1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc10 metalc ? ? F MN . MN ? ? ? 1_555 B ASP 124 OD2 ? ? B MN 1314 B ASP 124  1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc11 metalc ? ? F MN . MN ? ? ? 1_555 B ASP 128 OD2 ? ? B MN 1314 B ASP 128  1_555 ? ? ? ? ? ? ? 2.207 ? 
metalc12 metalc ? ? F MN . MN ? ? ? 1_555 B ASP 232 OD2 ? ? B MN 1314 B ASP 232  1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc13 metalc ? ? G MN . MN ? ? ? 1_555 B HIS 126 ND1 ? ? B MN 1315 B HIS 126  1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc14 metalc ? ? G MN . MN ? ? ? 1_555 B ASP 124 OD1 ? ? B MN 1315 B ASP 124  1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc15 metalc ? ? G MN . MN ? ? ? 1_555 B ASP 232 OD2 ? ? B MN 1315 B ASP 232  1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc16 metalc ? ? G MN . MN ? ? ? 1_555 B ASP 234 OD2 ? ? B MN 1315 B ASP 234  1_555 ? ? ? ? ? ? ? 2.508 ? 
metalc17 metalc ? ? C MN . MN ? ? ? 1_555 E S2C .   O1  ? ? A MN 2314 A S2C 1317 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc18 metalc ? ? C MN . MN ? ? ? 1_555 E S2C .   O2  ? ? A MN 2314 A S2C 1317 1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc19 metalc ? ? D MN . MN ? ? ? 1_555 A ASP 234 OD2 ? ? A MN 2315 A ASP 234  1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc20 metalc ? ? D MN . MN ? ? ? 1_555 E S2C .   O1  ? ? A MN 2315 A S2C 1317 1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc21 metalc ? ? F MN . MN ? ? ? 1_555 H S2C .   O1  ? ? B MN 1314 B S2C 1316 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc22 metalc ? ? F MN . MN ? ? ? 1_555 H S2C .   O2  ? ? B MN 1314 B S2C 1316 1_555 ? ? ? ? ? ? ? 2.584 ? 
metalc23 metalc ? ? G MN . MN ? ? ? 1_555 B ASP 234 OD1 ? ? B MN 1315 B ASP 234  1_555 ? ? ? ? ? ? ? 2.198 ? 
metalc24 metalc ? ? G MN . MN ? ? ? 1_555 H S2C .   O1  ? ? B MN 1315 B S2C 1316 1_555 ? ? ? ? ? ? ? 2.356 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
A 6 7 ? parallel 
A 7 8 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
B 6 7 ? parallel 
B 7 8 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 47  ? ASP A 52  ? VAL A 47  ASP A 52  
A 2 ILE A 8   ? GLY A 12  ? ILE A 8   GLY A 12  
A 3 ILE A 93  ? LEU A 97  ? ILE A 93  LEU A 97  
A 4 LEU A 270 ? MET A 276 ? LEU A 270 MET A 276 
A 5 ILE A 227 ? ASP A 232 ? ILE A 227 ASP A 232 
A 6 GLY A 119 ? VAL A 123 ? GLY A 119 VAL A 123 
A 7 ILE A 174 ? ILE A 177 ? ILE A 174 ILE A 177 
A 8 LYS A 196 ? PHE A 198 ? LYS A 196 PHE A 198 
B 1 VAL B 47  ? ASP B 52  ? VAL B 47  ASP B 52  
B 2 THR B 7   ? GLY B 12  ? THR B 7   GLY B 12  
B 3 ARG B 92  ? LEU B 97  ? ARG B 92  LEU B 97  
B 4 LEU B 270 ? MET B 276 ? LEU B 270 MET B 276 
B 5 ILE B 227 ? ASP B 232 ? ILE B 227 ASP B 232 
B 6 GLY B 119 ? VAL B 123 ? GLY B 119 VAL B 123 
B 7 ILE B 174 ? ILE B 177 ? ILE B 174 ILE B 177 
B 8 LYS B 196 ? PHE B 198 ? LYS B 196 PHE B 198 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 51  ? O GLY A 51  N GLY A 12  ? N GLY A 12  
A 2 3 N GLY A 9   ? N GLY A 9   O LEU A 95  ? O LEU A 95  
A 3 4 N SER A 94  ? N SER A 94  O LEU A 273 ? O LEU A 273 
A 4 5 O MET A 276 ? O MET A 276 N PHE A 231 ? N PHE A 231 
A 5 6 O ASP A 232 ? O ASP A 232 N VAL A 123 ? N VAL A 123 
A 6 7 N TRP A 122 ? N TRP A 122 O VAL A 175 ? O VAL A 175 
A 7 8 N TYR A 176 ? N TYR A 176 O PHE A 198 ? O PHE A 198 
B 1 2 O LYS B 48  ? O LYS B 48  N ILE B 8   ? N ILE B 8   
B 2 3 N ILE B 11  ? N ILE B 11  O LEU B 95  ? O LEU B 95  
B 3 4 N SER B 94  ? N SER B 94  O LEU B 273 ? O LEU B 273 
B 4 5 O GLY B 272 ? O GLY B 272 N LEU B 229 ? N LEU B 229 
B 5 6 O ASP B 232 ? O ASP B 232 N VAL B 123 ? N VAL B 123 
B 6 7 N TRP B 122 ? N TRP B 122 O VAL B 175 ? O VAL B 175 
B 7 8 N TYR B 176 ? N TYR B 176 O PHE B 198 ? O PHE B 198 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN B 1314'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN B 1315'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 2314'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 2315'  
AC5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE S2C B 1316' 
AC6 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE S2C A 1317' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  HIS B 101 ? HIS B 101  . ? 1_555 ? 
2  AC1 6  ASP B 124 ? ASP B 124  . ? 1_555 ? 
3  AC1 6  ASP B 128 ? ASP B 128  . ? 1_555 ? 
4  AC1 6  ASP B 232 ? ASP B 232  . ? 1_555 ? 
5  AC1 6  MN  G .   ? MN  B 1315 . ? 1_555 ? 
6  AC1 6  S2C H .   ? S2C B 1316 . ? 1_555 ? 
7  AC2 6  ASP B 124 ? ASP B 124  . ? 1_555 ? 
8  AC2 6  HIS B 126 ? HIS B 126  . ? 1_555 ? 
9  AC2 6  ASP B 232 ? ASP B 232  . ? 1_555 ? 
10 AC2 6  ASP B 234 ? ASP B 234  . ? 1_555 ? 
11 AC2 6  MN  F .   ? MN  B 1314 . ? 1_555 ? 
12 AC2 6  S2C H .   ? S2C B 1316 . ? 1_555 ? 
13 AC3 6  HIS A 101 ? HIS A 101  . ? 1_555 ? 
14 AC3 6  ASP A 124 ? ASP A 124  . ? 1_555 ? 
15 AC3 6  ASP A 128 ? ASP A 128  . ? 1_555 ? 
16 AC3 6  ASP A 232 ? ASP A 232  . ? 1_555 ? 
17 AC3 6  S2C E .   ? S2C A 1317 . ? 1_555 ? 
18 AC3 6  MN  D .   ? MN  A 2315 . ? 1_555 ? 
19 AC4 6  ASP A 124 ? ASP A 124  . ? 1_555 ? 
20 AC4 6  HIS A 126 ? HIS A 126  . ? 1_555 ? 
21 AC4 6  ASP A 232 ? ASP A 232  . ? 1_555 ? 
22 AC4 6  ASP A 234 ? ASP A 234  . ? 1_555 ? 
23 AC4 6  S2C E .   ? S2C A 1317 . ? 1_555 ? 
24 AC4 6  MN  C .   ? MN  A 2314 . ? 1_555 ? 
25 AC5 20 HIS B 101 ? HIS B 101  . ? 1_555 ? 
26 AC5 20 ASP B 124 ? ASP B 124  . ? 1_555 ? 
27 AC5 20 HIS B 126 ? HIS B 126  . ? 1_555 ? 
28 AC5 20 ASP B 128 ? ASP B 128  . ? 1_555 ? 
29 AC5 20 ASN B 130 ? ASN B 130  . ? 1_555 ? 
30 AC5 20 SER B 137 ? SER B 137  . ? 1_555 ? 
31 AC5 20 HIS B 141 ? HIS B 141  . ? 1_555 ? 
32 AC5 20 ASP B 183 ? ASP B 183  . ? 1_555 ? 
33 AC5 20 GLU B 186 ? GLU B 186  . ? 1_555 ? 
34 AC5 20 ASP B 232 ? ASP B 232  . ? 1_555 ? 
35 AC5 20 ASP B 234 ? ASP B 234  . ? 1_555 ? 
36 AC5 20 GLU B 277 ? GLU B 277  . ? 1_555 ? 
37 AC5 20 MN  F .   ? MN  B 1314 . ? 1_555 ? 
38 AC5 20 MN  G .   ? MN  B 1315 . ? 1_555 ? 
39 AC5 20 HOH J .   ? HOH B 1327 . ? 1_555 ? 
40 AC5 20 HOH J .   ? HOH B 1331 . ? 1_555 ? 
41 AC5 20 HOH J .   ? HOH B 1349 . ? 1_555 ? 
42 AC5 20 HOH J .   ? HOH B 1352 . ? 1_555 ? 
43 AC5 20 HOH J .   ? HOH B 1367 . ? 1_555 ? 
44 AC5 20 HOH J .   ? HOH B 1402 . ? 1_555 ? 
45 AC6 19 HIS A 101 ? HIS A 101  . ? 1_555 ? 
46 AC6 19 ASP A 124 ? ASP A 124  . ? 1_555 ? 
47 AC6 19 HIS A 126 ? HIS A 126  . ? 1_555 ? 
48 AC6 19 ASP A 128 ? ASP A 128  . ? 1_555 ? 
49 AC6 19 ASN A 130 ? ASN A 130  . ? 1_555 ? 
50 AC6 19 SER A 137 ? SER A 137  . ? 1_555 ? 
51 AC6 19 HIS A 141 ? HIS A 141  . ? 1_555 ? 
52 AC6 19 ASP A 183 ? ASP A 183  . ? 1_555 ? 
53 AC6 19 GLU A 186 ? GLU A 186  . ? 1_555 ? 
54 AC6 19 ASP A 232 ? ASP A 232  . ? 1_555 ? 
55 AC6 19 ASP A 234 ? ASP A 234  . ? 1_555 ? 
56 AC6 19 GLU A 277 ? GLU A 277  . ? 1_555 ? 
57 AC6 19 MN  C .   ? MN  A 2314 . ? 1_555 ? 
58 AC6 19 MN  D .   ? MN  A 2315 . ? 1_555 ? 
59 AC6 19 HOH I .   ? HOH A 2325 . ? 1_555 ? 
60 AC6 19 HOH I .   ? HOH A 2333 . ? 1_555 ? 
61 AC6 19 HOH I .   ? HOH A 2354 . ? 1_555 ? 
62 AC6 19 HOH I .   ? HOH A 2385 . ? 1_555 ? 
63 AC6 19 HOH I .   ? HOH A 2419 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1WVA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WVA 
_atom_sites.fract_transf_matrix[1][1]   0.011037 
_atom_sites.fract_transf_matrix[1][2]   0.006372 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012745 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014428 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
B  
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 5   ? -7.229  33.260 9.497   1.00 45.65 ? 5    SER A N   1 
ATOM   2    C  CA  . SER A 1 5   ? -6.618  32.029 8.920   1.00 44.52 ? 5    SER A CA  1 
ATOM   3    C  C   . SER A 1 5   ? -5.098  32.166 8.814   1.00 44.21 ? 5    SER A C   1 
ATOM   4    O  O   . SER A 1 5   ? -4.429  32.631 9.745   1.00 42.71 ? 5    SER A O   1 
ATOM   5    C  CB  . SER A 1 5   ? -7.215  31.757 7.535   1.00 45.46 ? 5    SER A CB  1 
ATOM   6    O  OG  . SER A 1 5   ? -7.057  32.878 6.678   1.00 46.34 ? 5    SER A OG  1 
ATOM   7    N  N   . ARG A 1 6   ? -4.562  31.741 7.675   1.00 43.97 ? 6    ARG A N   1 
ATOM   8    C  CA  . ARG A 1 6   ? -3.133  31.820 7.403   1.00 43.98 ? 6    ARG A CA  1 
ATOM   9    C  C   . ARG A 1 6   ? -2.923  32.134 5.926   1.00 42.85 ? 6    ARG A C   1 
ATOM   10   O  O   . ARG A 1 6   ? -3.199  31.309 5.048   1.00 43.34 ? 6    ARG A O   1 
ATOM   11   C  CB  . ARG A 1 6   ? -2.429  30.512 7.789   1.00 45.40 ? 6    ARG A CB  1 
ATOM   12   C  CG  . ARG A 1 6   ? -2.129  30.402 9.278   1.00 47.33 ? 6    ARG A CG  1 
ATOM   13   C  CD  . ARG A 1 6   ? -1.354  31.631 9.753   1.00 49.70 ? 6    ARG A CD  1 
ATOM   14   N  NE  . ARG A 1 6   ? -0.959  31.578 11.162  1.00 51.51 ? 6    ARG A NE  1 
ATOM   15   C  CZ  . ARG A 1 6   ? -0.013  30.781 11.655  1.00 53.15 ? 6    ARG A CZ  1 
ATOM   16   N  NH1 . ARG A 1 6   ? 0.653   29.951 10.856  1.00 53.61 ? 6    ARG A NH1 1 
ATOM   17   N  NH2 . ARG A 1 6   ? 0.276   30.818 12.951  1.00 52.64 ? 6    ARG A NH2 1 
ATOM   18   N  N   . THR A 1 7   ? -2.446  33.349 5.668   1.00 39.99 ? 7    THR A N   1 
ATOM   19   C  CA  . THR A 1 7   ? -2.202  33.831 4.316   1.00 37.14 ? 7    THR A CA  1 
ATOM   20   C  C   . THR A 1 7   ? -1.129  33.041 3.576   1.00 34.46 ? 7    THR A C   1 
ATOM   21   O  O   . THR A 1 7   ? -0.169  32.555 4.177   1.00 34.16 ? 7    THR A O   1 
ATOM   22   C  CB  . THR A 1 7   ? -1.767  35.301 4.339   1.00 36.84 ? 7    THR A CB  1 
ATOM   23   O  OG1 . THR A 1 7   ? -2.564  36.015 5.285   1.00 38.29 ? 7    THR A OG1 1 
ATOM   24   C  CG2 . THR A 1 7   ? -1.939  35.932 2.965   1.00 38.44 ? 7    THR A CG2 1 
ATOM   25   N  N   . ILE A 1 8   ? -1.297  32.937 2.262   1.00 32.27 ? 8    ILE A N   1 
ATOM   26   C  CA  . ILE A 1 8   ? -0.353  32.227 1.410   1.00 29.47 ? 8    ILE A CA  1 
ATOM   27   C  C   . ILE A 1 8   ? 0.501   33.262 0.695   1.00 27.81 ? 8    ILE A C   1 
ATOM   28   O  O   . ILE A 1 8   ? -0.003  34.290 0.248   1.00 27.57 ? 8    ILE A O   1 
ATOM   29   C  CB  . ILE A 1 8   ? -1.067  31.397 0.319   1.00 29.02 ? 8    ILE A CB  1 
ATOM   30   C  CG1 . ILE A 1 8   ? -2.416  30.879 0.844   1.00 28.14 ? 8    ILE A CG1 1 
ATOM   31   C  CG2 . ILE A 1 8   ? -0.136  30.283 -0.167  1.00 27.58 ? 8    ILE A CG2 1 
ATOM   32   C  CD1 . ILE A 1 8   ? -2.518  29.379 1.048   1.00 26.86 ? 8    ILE A CD1 1 
ATOM   33   N  N   . GLY A 1 9   ? 1.793   32.985 0.595   1.00 26.90 ? 9    GLY A N   1 
ATOM   34   C  CA  . GLY A 1 9   ? 2.698   33.889 -0.086  1.00 25.83 ? 9    GLY A CA  1 
ATOM   35   C  C   . GLY A 1 9   ? 3.393   33.087 -1.161  1.00 24.90 ? 9    GLY A C   1 
ATOM   36   O  O   . GLY A 1 9   ? 4.416   32.457 -0.899  1.00 24.43 ? 9    GLY A O   1 
ATOM   37   N  N   . ILE A 1 10  ? 2.832   33.104 -2.368  1.00 25.48 ? 10   ILE A N   1 
ATOM   38   C  CA  . ILE A 1 10  ? 3.383   32.346 -3.490  1.00 25.21 ? 10   ILE A CA  1 
ATOM   39   C  C   . ILE A 1 10  ? 4.636   32.978 -4.086  1.00 24.87 ? 10   ILE A C   1 
ATOM   40   O  O   . ILE A 1 10  ? 4.726   34.202 -4.223  1.00 24.57 ? 10   ILE A O   1 
ATOM   41   C  CB  . ILE A 1 10  ? 2.343   32.163 -4.640  1.00 25.31 ? 10   ILE A CB  1 
ATOM   42   C  CG1 . ILE A 1 10  ? 0.990   31.730 -4.077  1.00 25.47 ? 10   ILE A CG1 1 
ATOM   43   C  CG2 . ILE A 1 10  ? 2.833   31.108 -5.622  1.00 24.15 ? 10   ILE A CG2 1 
ATOM   44   C  CD1 . ILE A 1 10  ? 0.272   32.827 -3.303  1.00 26.95 ? 10   ILE A CD1 1 
ATOM   45   N  N   . ILE A 1 11  ? 5.596   32.123 -4.439  1.00 23.75 ? 11   ILE A N   1 
ATOM   46   C  CA  . ILE A 1 11  ? 6.853   32.555 -5.039  1.00 23.26 ? 11   ILE A CA  1 
ATOM   47   C  C   . ILE A 1 11  ? 7.284   31.582 -6.131  1.00 23.61 ? 11   ILE A C   1 
ATOM   48   O  O   . ILE A 1 11  ? 7.461   30.389 -5.886  1.00 24.76 ? 11   ILE A O   1 
ATOM   49   C  CB  . ILE A 1 11  ? 7.990   32.629 -3.993  1.00 22.85 ? 11   ILE A CB  1 
ATOM   50   C  CG1 . ILE A 1 11  ? 7.683   33.706 -2.947  1.00 21.54 ? 11   ILE A CG1 1 
ATOM   51   C  CG2 . ILE A 1 11  ? 9.310   32.908 -4.689  1.00 23.79 ? 11   ILE A CG2 1 
ATOM   52   C  CD1 . ILE A 1 11  ? 8.582   33.650 -1.753  1.00 19.21 ? 11   ILE A CD1 1 
ATOM   53   N  N   . GLY A 1 12  ? 7.440   32.095 -7.342  1.00 23.90 ? 12   GLY A N   1 
ATOM   54   C  CA  . GLY A 1 12  ? 7.876   31.253 -8.436  1.00 22.39 ? 12   GLY A CA  1 
ATOM   55   C  C   . GLY A 1 12  ? 9.384   31.216 -8.365  1.00 20.65 ? 12   GLY A C   1 
ATOM   56   O  O   . GLY A 1 12  ? 10.009  32.198 -7.967  1.00 21.26 ? 12   GLY A O   1 
ATOM   57   N  N   . ALA A 1 13  ? 9.973   30.089 -8.734  1.00 19.20 ? 13   ALA A N   1 
ATOM   58   C  CA  . ALA A 1 13  ? 11.426  29.952 -8.690  1.00 19.79 ? 13   ALA A CA  1 
ATOM   59   C  C   . ALA A 1 13  ? 11.875  29.007 -9.792  1.00 19.71 ? 13   ALA A C   1 
ATOM   60   O  O   . ALA A 1 13  ? 12.397  27.927 -9.521  1.00 20.81 ? 13   ALA A O   1 
ATOM   61   C  CB  . ALA A 1 13  ? 11.861  29.417 -7.319  1.00 16.13 ? 13   ALA A CB  1 
ATOM   62   N  N   . PRO A 1 14  ? 11.677  29.407 -11.058 1.00 20.60 ? 14   PRO A N   1 
ATOM   63   C  CA  . PRO A 1 14  ? 12.054  28.601 -12.223 1.00 20.27 ? 14   PRO A CA  1 
ATOM   64   C  C   . PRO A 1 14  ? 13.572  28.473 -12.419 1.00 21.50 ? 14   PRO A C   1 
ATOM   65   O  O   . PRO A 1 14  ? 14.133  29.004 -13.383 1.00 22.66 ? 14   PRO A O   1 
ATOM   66   C  CB  . PRO A 1 14  ? 11.375  29.339 -13.366 1.00 20.84 ? 14   PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 14  ? 11.477  30.768 -12.934 1.00 18.74 ? 14   PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 14  ? 11.113  30.704 -11.475 1.00 20.06 ? 14   PRO A CD  1 
ATOM   69   N  N   . PHE A 1 15  ? 14.226  27.760 -11.506 1.00 20.54 ? 15   PHE A N   1 
ATOM   70   C  CA  . PHE A 1 15  ? 15.671  27.564 -11.557 1.00 19.51 ? 15   PHE A CA  1 
ATOM   71   C  C   . PHE A 1 15  ? 16.014  26.087 -11.714 1.00 19.49 ? 15   PHE A C   1 
ATOM   72   O  O   . PHE A 1 15  ? 15.437  25.233 -11.037 1.00 20.00 ? 15   PHE A O   1 
ATOM   73   C  CB  . PHE A 1 15  ? 16.307  28.107 -10.279 1.00 20.48 ? 15   PHE A CB  1 
ATOM   74   C  CG  . PHE A 1 15  ? 17.793  27.960 -10.237 1.00 20.30 ? 15   PHE A CG  1 
ATOM   75   C  CD1 . PHE A 1 15  ? 18.606  28.753 -11.039 1.00 21.90 ? 15   PHE A CD1 1 
ATOM   76   C  CD2 . PHE A 1 15  ? 18.386  27.020 -9.403  1.00 18.27 ? 15   PHE A CD2 1 
ATOM   77   C  CE1 . PHE A 1 15  ? 19.992  28.606 -11.008 1.00 20.34 ? 15   PHE A CE1 1 
ATOM   78   C  CE2 . PHE A 1 15  ? 19.756  26.869 -9.368  1.00 17.09 ? 15   PHE A CE2 1 
ATOM   79   C  CZ  . PHE A 1 15  ? 20.564  27.662 -10.170 1.00 19.53 ? 15   PHE A CZ  1 
ATOM   80   N  N   . SER A 1 16  ? 16.966  25.791 -12.595 1.00 18.76 ? 16   SER A N   1 
ATOM   81   C  CA  . SER A 1 16  ? 17.365  24.409 -12.860 1.00 18.56 ? 16   SER A CA  1 
ATOM   82   C  C   . SER A 1 16  ? 18.868  24.161 -12.848 1.00 18.82 ? 16   SER A C   1 
ATOM   83   O  O   . SER A 1 16  ? 19.305  23.055 -13.146 1.00 21.12 ? 16   SER A O   1 
ATOM   84   C  CB  . SER A 1 16  ? 16.862  23.969 -14.233 1.00 17.92 ? 16   SER A CB  1 
ATOM   85   O  OG  . SER A 1 16  ? 17.873  24.179 -15.211 1.00 14.58 ? 16   SER A OG  1 
ATOM   86   N  N   . LYS A 1 17  ? 19.666  25.168 -12.525 1.00 19.14 ? 17   LYS A N   1 
ATOM   87   C  CA  . LYS A 1 17  ? 21.110  24.974 -12.546 1.00 17.99 ? 17   LYS A CA  1 
ATOM   88   C  C   . LYS A 1 17  ? 21.709  24.296 -11.319 1.00 18.20 ? 17   LYS A C   1 
ATOM   89   O  O   . LYS A 1 17  ? 22.930  24.234 -11.166 1.00 20.30 ? 17   LYS A O   1 
ATOM   90   C  CB  . LYS A 1 17  ? 21.800  26.306 -12.823 1.00 18.63 ? 17   LYS A CB  1 
ATOM   91   C  CG  . LYS A 1 17  ? 21.401  26.885 -14.168 1.00 17.87 ? 17   LYS A CG  1 
ATOM   92   C  CD  . LYS A 1 17  ? 22.423  27.870 -14.672 1.00 20.11 ? 17   LYS A CD  1 
ATOM   93   C  CE  . LYS A 1 17  ? 22.069  28.352 -16.070 1.00 19.47 ? 17   LYS A CE  1 
ATOM   94   N  NZ  . LYS A 1 17  ? 23.206  29.124 -16.646 1.00 22.01 ? 17   LYS A NZ  1 
ATOM   95   N  N   . GLY A 1 18  ? 20.847  23.788 -10.449 1.00 17.02 ? 18   GLY A N   1 
ATOM   96   C  CA  . GLY A 1 18  ? 21.314  23.080 -9.276  1.00 16.47 ? 18   GLY A CA  1 
ATOM   97   C  C   . GLY A 1 18  ? 21.476  21.624 -9.678  1.00 15.84 ? 18   GLY A C   1 
ATOM   98   O  O   . GLY A 1 18  ? 21.949  20.787 -8.906  1.00 16.04 ? 18   GLY A O   1 
ATOM   99   N  N   . GLN A 1 19  ? 21.075  21.319 -10.907 1.00 15.18 ? 19   GLN A N   1 
ATOM   100  C  CA  . GLN A 1 19  ? 21.185  19.967 -11.429 1.00 16.96 ? 19   GLN A CA  1 
ATOM   101  C  C   . GLN A 1 19  ? 21.319  19.979 -12.964 1.00 17.77 ? 19   GLN A C   1 
ATOM   102  O  O   . GLN A 1 19  ? 21.292  21.046 -13.580 1.00 18.12 ? 19   GLN A O   1 
ATOM   103  C  CB  . GLN A 1 19  ? 19.987  19.131 -10.941 1.00 18.32 ? 19   GLN A CB  1 
ATOM   104  C  CG  . GLN A 1 19  ? 18.624  19.769 -11.135 1.00 14.41 ? 19   GLN A CG  1 
ATOM   105  C  CD  . GLN A 1 19  ? 18.071  19.520 -12.508 1.00 14.69 ? 19   GLN A CD  1 
ATOM   106  O  OE1 . GLN A 1 19  ? 17.788  18.375 -12.881 1.00 14.68 ? 19   GLN A OE1 1 
ATOM   107  N  NE2 . GLN A 1 19  ? 17.913  20.588 -13.279 1.00 14.80 ? 19   GLN A NE2 1 
ATOM   108  N  N   . PRO A 1 20  ? 21.479  18.798 -13.597 1.00 17.66 ? 20   PRO A N   1 
ATOM   109  C  CA  . PRO A 1 20  ? 21.635  18.648 -15.055 1.00 18.33 ? 20   PRO A CA  1 
ATOM   110  C  C   . PRO A 1 20  ? 20.469  18.805 -16.055 1.00 17.50 ? 20   PRO A C   1 
ATOM   111  O  O   . PRO A 1 20  ? 20.677  19.295 -17.166 1.00 18.42 ? 20   PRO A O   1 
ATOM   112  C  CB  . PRO A 1 20  ? 22.299  17.277 -15.181 1.00 18.75 ? 20   PRO A CB  1 
ATOM   113  C  CG  . PRO A 1 20  ? 21.696  16.528 -14.035 1.00 21.06 ? 20   PRO A CG  1 
ATOM   114  C  CD  . PRO A 1 20  ? 21.772  17.527 -12.912 1.00 17.45 ? 20   PRO A CD  1 
ATOM   115  N  N   . ARG A 1 21  ? 19.261  18.393 -15.694 1.00 17.30 ? 21   ARG A N   1 
ATOM   116  C  CA  . ARG A 1 21  ? 18.131  18.500 -16.625 1.00 17.31 ? 21   ARG A CA  1 
ATOM   117  C  C   . ARG A 1 21  ? 17.366  19.824 -16.509 1.00 17.74 ? 21   ARG A C   1 
ATOM   118  O  O   . ARG A 1 21  ? 16.708  20.079 -15.509 1.00 18.31 ? 21   ARG A O   1 
ATOM   119  C  CB  . ARG A 1 21  ? 17.196  17.316 -16.403 1.00 14.80 ? 21   ARG A CB  1 
ATOM   120  C  CG  . ARG A 1 21  ? 17.911  15.982 -16.529 1.00 15.46 ? 21   ARG A CG  1 
ATOM   121  C  CD  . ARG A 1 21  ? 17.220  14.911 -15.724 1.00 14.47 ? 21   ARG A CD  1 
ATOM   122  N  NE  . ARG A 1 21  ? 17.385  15.115 -14.284 1.00 16.57 ? 21   ARG A NE  1 
ATOM   123  C  CZ  . ARG A 1 21  ? 18.515  14.892 -13.616 1.00 16.69 ? 21   ARG A CZ  1 
ATOM   124  N  NH1 . ARG A 1 21  ? 19.589  14.459 -14.252 1.00 15.85 ? 21   ARG A NH1 1 
ATOM   125  N  NH2 . ARG A 1 21  ? 18.570  15.087 -12.306 1.00 20.45 ? 21   ARG A NH2 1 
ATOM   126  N  N   . GLY A 1 22  ? 17.448  20.650 -17.550 1.00 17.70 ? 22   GLY A N   1 
ATOM   127  C  CA  . GLY A 1 22  ? 16.796  21.950 -17.542 1.00 20.00 ? 22   GLY A CA  1 
ATOM   128  C  C   . GLY A 1 22  ? 15.279  22.061 -17.433 1.00 21.52 ? 22   GLY A C   1 
ATOM   129  O  O   . GLY A 1 22  ? 14.764  23.160 -17.206 1.00 21.37 ? 22   GLY A O   1 
ATOM   130  N  N   . GLY A 1 23  ? 14.564  20.949 -17.577 1.00 21.69 ? 23   GLY A N   1 
ATOM   131  C  CA  . GLY A 1 23  ? 13.109  20.977 -17.507 1.00 21.93 ? 23   GLY A CA  1 
ATOM   132  C  C   . GLY A 1 23  ? 12.426  21.392 -16.206 1.00 23.79 ? 23   GLY A C   1 
ATOM   133  O  O   . GLY A 1 23  ? 11.299  21.898 -16.230 1.00 22.30 ? 23   GLY A O   1 
ATOM   134  N  N   . VAL A 1 24  ? 13.081  21.186 -15.067 1.00 24.17 ? 24   VAL A N   1 
ATOM   135  C  CA  . VAL A 1 24  ? 12.477  21.549 -13.789 1.00 25.81 ? 24   VAL A CA  1 
ATOM   136  C  C   . VAL A 1 24  ? 12.091  23.023 -13.730 1.00 27.92 ? 24   VAL A C   1 
ATOM   137  O  O   . VAL A 1 24  ? 11.368  23.450 -12.833 1.00 28.39 ? 24   VAL A O   1 
ATOM   138  C  CB  . VAL A 1 24  ? 13.413  21.209 -12.611 1.00 26.04 ? 24   VAL A CB  1 
ATOM   139  C  CG1 . VAL A 1 24  ? 13.652  19.710 -12.572 1.00 28.28 ? 24   VAL A CG1 1 
ATOM   140  C  CG2 . VAL A 1 24  ? 14.732  21.942 -12.752 1.00 24.23 ? 24   VAL A CG2 1 
ATOM   141  N  N   . GLU A 1 25  ? 12.577  23.803 -14.689 1.00 30.17 ? 25   GLU A N   1 
ATOM   142  C  CA  . GLU A 1 25  ? 12.255  25.222 -14.751 1.00 31.52 ? 25   GLU A CA  1 
ATOM   143  C  C   . GLU A 1 25  ? 10.754  25.345 -15.023 1.00 31.52 ? 25   GLU A C   1 
ATOM   144  O  O   . GLU A 1 25  ? 10.105  26.301 -14.594 1.00 31.38 ? 25   GLU A O   1 
ATOM   145  C  CB  . GLU A 1 25  ? 13.025  25.882 -15.896 1.00 35.02 ? 25   GLU A CB  1 
ATOM   146  C  CG  . GLU A 1 25  ? 14.527  25.695 -15.857 1.00 38.46 ? 25   GLU A CG  1 
ATOM   147  C  CD  . GLU A 1 25  ? 15.192  26.163 -17.138 1.00 41.30 ? 25   GLU A CD  1 
ATOM   148  O  OE1 . GLU A 1 25  ? 14.802  25.667 -18.218 1.00 42.35 ? 25   GLU A OE1 1 
ATOM   149  O  OE2 . GLU A 1 25  ? 16.101  27.020 -17.066 1.00 43.66 ? 25   GLU A OE2 1 
ATOM   150  N  N   . GLU A 1 26  ? 10.224  24.360 -15.746 1.00 31.44 ? 26   GLU A N   1 
ATOM   151  C  CA  . GLU A 1 26  ? 8.812   24.291 -16.124 1.00 32.22 ? 26   GLU A CA  1 
ATOM   152  C  C   . GLU A 1 26  ? 7.895   24.260 -14.904 1.00 30.72 ? 26   GLU A C   1 
ATOM   153  O  O   . GLU A 1 26  ? 6.722   24.631 -14.990 1.00 30.15 ? 26   GLU A O   1 
ATOM   154  C  CB  . GLU A 1 26  ? 8.551   23.021 -16.942 1.00 35.20 ? 26   GLU A CB  1 
ATOM   155  C  CG  . GLU A 1 26  ? 9.496   22.777 -18.118 1.00 39.86 ? 26   GLU A CG  1 
ATOM   156  C  CD  . GLU A 1 26  ? 9.553   21.301 -18.529 1.00 42.03 ? 26   GLU A CD  1 
ATOM   157  O  OE1 . GLU A 1 26  ? 9.987   20.470 -17.704 1.00 41.84 ? 26   GLU A OE1 1 
ATOM   158  O  OE2 . GLU A 1 26  ? 9.163   20.967 -19.673 1.00 44.21 ? 26   GLU A OE2 1 
ATOM   159  N  N   . GLY A 1 27  ? 8.444   23.805 -13.781 1.00 29.43 ? 27   GLY A N   1 
ATOM   160  C  CA  . GLY A 1 27  ? 7.695   23.676 -12.538 1.00 29.23 ? 27   GLY A CA  1 
ATOM   161  C  C   . GLY A 1 27  ? 6.641   24.713 -12.194 1.00 28.54 ? 27   GLY A C   1 
ATOM   162  O  O   . GLY A 1 27  ? 5.450   24.404 -12.173 1.00 28.75 ? 27   GLY A O   1 
ATOM   163  N  N   . PRO A 1 28  ? 7.047   25.955 -11.907 1.00 27.56 ? 28   PRO A N   1 
ATOM   164  C  CA  . PRO A 1 28  ? 6.098   27.016 -11.559 1.00 26.97 ? 28   PRO A CA  1 
ATOM   165  C  C   . PRO A 1 28  ? 4.960   27.166 -12.565 1.00 25.18 ? 28   PRO A C   1 
ATOM   166  O  O   . PRO A 1 28  ? 3.792   27.282 -12.196 1.00 24.23 ? 28   PRO A O   1 
ATOM   167  C  CB  . PRO A 1 28  ? 6.983   28.262 -11.498 1.00 26.94 ? 28   PRO A CB  1 
ATOM   168  C  CG  . PRO A 1 28  ? 8.310   27.715 -11.057 1.00 28.03 ? 28   PRO A CG  1 
ATOM   169  C  CD  . PRO A 1 28  ? 8.433   26.462 -11.900 1.00 28.00 ? 28   PRO A CD  1 
ATOM   170  N  N   . THR A 1 29  ? 5.326   27.157 -13.839 1.00 25.64 ? 29   THR A N   1 
ATOM   171  C  CA  . THR A 1 29  ? 4.390   27.306 -14.947 1.00 26.89 ? 29   THR A CA  1 
ATOM   172  C  C   . THR A 1 29  ? 3.292   26.242 -14.987 1.00 26.86 ? 29   THR A C   1 
ATOM   173  O  O   . THR A 1 29  ? 2.096   26.561 -15.032 1.00 26.95 ? 29   THR A O   1 
ATOM   174  C  CB  . THR A 1 29  ? 5.164   27.279 -16.297 1.00 28.34 ? 29   THR A CB  1 
ATOM   175  O  OG1 . THR A 1 29  ? 6.047   28.410 -16.360 1.00 29.42 ? 29   THR A OG1 1 
ATOM   176  C  CG2 . THR A 1 29  ? 4.203   27.304 -17.484 1.00 27.37 ? 29   THR A CG2 1 
ATOM   177  N  N   . VAL A 1 30  ? 3.706   24.981 -14.987 1.00 25.37 ? 30   VAL A N   1 
ATOM   178  C  CA  . VAL A 1 30  ? 2.767   23.874 -15.037 1.00 25.46 ? 30   VAL A CA  1 
ATOM   179  C  C   . VAL A 1 30  ? 1.919   23.830 -13.770 1.00 23.96 ? 30   VAL A C   1 
ATOM   180  O  O   . VAL A 1 30  ? 0.721   23.547 -13.823 1.00 22.66 ? 30   VAL A O   1 
ATOM   181  C  CB  . VAL A 1 30  ? 3.509   22.536 -15.209 1.00 24.90 ? 30   VAL A CB  1 
ATOM   182  C  CG1 . VAL A 1 30  ? 2.513   21.409 -15.355 1.00 27.87 ? 30   VAL A CG1 1 
ATOM   183  C  CG2 . VAL A 1 30  ? 4.408   22.602 -16.430 1.00 25.15 ? 30   VAL A CG2 1 
ATOM   184  N  N   . LEU A 1 31  ? 2.549   24.120 -12.636 1.00 23.35 ? 31   LEU A N   1 
ATOM   185  C  CA  . LEU A 1 31  ? 1.859   24.123 -11.350 1.00 21.79 ? 31   LEU A CA  1 
ATOM   186  C  C   . LEU A 1 31  ? 0.773   25.180 -11.333 1.00 22.34 ? 31   LEU A C   1 
ATOM   187  O  O   . LEU A 1 31  ? -0.298  24.974 -10.764 1.00 21.60 ? 31   LEU A O   1 
ATOM   188  C  CB  . LEU A 1 31  ? 2.850   24.379 -10.216 1.00 19.45 ? 31   LEU A CB  1 
ATOM   189  C  CG  . LEU A 1 31  ? 3.652   23.147 -9.795  1.00 16.34 ? 31   LEU A CG  1 
ATOM   190  C  CD1 . LEU A 1 31  ? 4.648   23.515 -8.708  1.00 15.60 ? 31   LEU A CD1 1 
ATOM   191  C  CD2 . LEU A 1 31  ? 2.690   22.080 -9.306  1.00 14.74 ? 31   LEU A CD2 1 
ATOM   192  N  N   . ARG A 1 32  ? 1.061   26.312 -11.965 1.00 23.47 ? 32   ARG A N   1 
ATOM   193  C  CA  . ARG A 1 32  ? 0.113   27.415 -12.040 1.00 25.20 ? 32   ARG A CA  1 
ATOM   194  C  C   . ARG A 1 32  ? -1.022  27.059 -12.994 1.00 25.78 ? 32   ARG A C   1 
ATOM   195  O  O   . ARG A 1 32  ? -2.201  27.153 -12.648 1.00 25.29 ? 32   ARG A O   1 
ATOM   196  C  CB  . ARG A 1 32  ? 0.818   28.683 -12.533 1.00 24.99 ? 32   ARG A CB  1 
ATOM   197  C  CG  . ARG A 1 32  ? 1.601   29.433 -11.466 1.00 26.26 ? 32   ARG A CG  1 
ATOM   198  C  CD  . ARG A 1 32  ? 2.027   30.802 -11.979 1.00 27.16 ? 32   ARG A CD  1 
ATOM   199  N  NE  . ARG A 1 32  ? 2.515   31.672 -10.913 1.00 30.98 ? 32   ARG A NE  1 
ATOM   200  C  CZ  . ARG A 1 32  ? 3.655   31.482 -10.257 1.00 31.95 ? 32   ARG A CZ  1 
ATOM   201  N  NH1 . ARG A 1 32  ? 4.434   30.450 -10.557 1.00 34.20 ? 32   ARG A NH1 1 
ATOM   202  N  NH2 . ARG A 1 32  ? 4.015   32.321 -9.298  1.00 32.89 ? 32   ARG A NH2 1 
ATOM   203  N  N   . LYS A 1 33  ? -0.643  26.644 -14.197 1.00 27.58 ? 33   LYS A N   1 
ATOM   204  C  CA  . LYS A 1 33  ? -1.586  26.259 -15.239 1.00 28.34 ? 33   LYS A CA  1 
ATOM   205  C  C   . LYS A 1 33  ? -2.559  25.168 -14.774 1.00 29.82 ? 33   LYS A C   1 
ATOM   206  O  O   . LYS A 1 33  ? -3.638  25.006 -15.351 1.00 29.02 ? 33   LYS A O   1 
ATOM   207  C  CB  . LYS A 1 33  ? -0.806  25.782 -16.462 1.00 28.45 ? 33   LYS A CB  1 
ATOM   208  C  CG  . LYS A 1 33  ? -1.651  25.398 -17.652 1.00 30.74 ? 33   LYS A CG  1 
ATOM   209  C  CD  . LYS A 1 33  ? -0.771  24.760 -18.720 1.00 34.34 ? 33   LYS A CD  1 
ATOM   210  C  CE  . LYS A 1 33  ? -1.537  24.439 -19.996 1.00 33.97 ? 33   LYS A CE  1 
ATOM   211  N  NZ  . LYS A 1 33  ? -0.633  23.856 -21.033 1.00 34.93 ? 33   LYS A NZ  1 
ATOM   212  N  N   . ALA A 1 34  ? -2.178  24.420 -13.736 1.00 30.34 ? 34   ALA A N   1 
ATOM   213  C  CA  . ALA A 1 34  ? -3.032  23.355 -13.199 1.00 30.17 ? 34   ALA A CA  1 
ATOM   214  C  C   . ALA A 1 34  ? -4.126  23.926 -12.288 1.00 29.94 ? 34   ALA A C   1 
ATOM   215  O  O   . ALA A 1 34  ? -4.870  23.180 -11.650 1.00 28.10 ? 34   ALA A O   1 
ATOM   216  C  CB  . ALA A 1 34  ? -2.186  22.336 -12.431 1.00 29.34 ? 34   ALA A CB  1 
ATOM   217  N  N   . GLY A 1 35  ? -4.201  25.253 -12.228 1.00 30.55 ? 35   GLY A N   1 
ATOM   218  C  CA  . GLY A 1 35  ? -5.202  25.922 -11.414 1.00 31.10 ? 35   GLY A CA  1 
ATOM   219  C  C   . GLY A 1 35  ? -4.908  25.973 -9.925  1.00 32.03 ? 35   GLY A C   1 
ATOM   220  O  O   . GLY A 1 35  ? -5.832  26.070 -9.114  1.00 32.53 ? 35   GLY A O   1 
ATOM   221  N  N   . LEU A 1 36  ? -3.632  25.921 -9.551  1.00 31.09 ? 36   LEU A N   1 
ATOM   222  C  CA  . LEU A 1 36  ? -3.274  25.950 -8.138  1.00 30.35 ? 36   LEU A CA  1 
ATOM   223  C  C   . LEU A 1 36  ? -3.822  27.146 -7.361  1.00 30.13 ? 36   LEU A C   1 
ATOM   224  O  O   . LEU A 1 36  ? -4.302  26.978 -6.241  1.00 29.80 ? 36   LEU A O   1 
ATOM   225  C  CB  . LEU A 1 36  ? -1.753  25.904 -7.960  1.00 30.04 ? 36   LEU A CB  1 
ATOM   226  C  CG  . LEU A 1 36  ? -1.284  25.942 -6.498  1.00 29.09 ? 36   LEU A CG  1 
ATOM   227  C  CD1 . LEU A 1 36  ? -1.663  24.635 -5.802  1.00 29.02 ? 36   LEU A CD1 1 
ATOM   228  C  CD2 . LEU A 1 36  ? 0.223   26.173 -6.438  1.00 29.02 ? 36   LEU A CD2 1 
ATOM   229  N  N   . LEU A 1 37  ? -3.757  28.347 -7.932  1.00 30.29 ? 37   LEU A N   1 
ATOM   230  C  CA  . LEU A 1 37  ? -4.241  29.526 -7.212  1.00 30.36 ? 37   LEU A CA  1 
ATOM   231  C  C   . LEU A 1 37  ? -5.739  29.554 -6.917  1.00 29.32 ? 37   LEU A C   1 
ATOM   232  O  O   . LEU A 1 37  ? -6.139  29.780 -5.777  1.00 28.07 ? 37   LEU A O   1 
ATOM   233  C  CB  . LEU A 1 37  ? -3.840  30.819 -7.933  1.00 33.48 ? 37   LEU A CB  1 
ATOM   234  C  CG  . LEU A 1 37  ? -2.362  31.243 -7.877  1.00 36.43 ? 37   LEU A CG  1 
ATOM   235  C  CD1 . LEU A 1 37  ? -2.271  32.736 -8.158  1.00 36.86 ? 37   LEU A CD1 1 
ATOM   236  C  CD2 . LEU A 1 37  ? -1.756  30.953 -6.508  1.00 36.65 ? 37   LEU A CD2 1 
ATOM   237  N  N   . GLU A 1 38  ? -6.569  29.331 -7.929  1.00 28.73 ? 38   GLU A N   1 
ATOM   238  C  CA  . GLU A 1 38  ? -8.010  29.345 -7.715  1.00 29.03 ? 38   GLU A CA  1 
ATOM   239  C  C   . GLU A 1 38  ? -8.477  28.229 -6.795  1.00 27.90 ? 38   GLU A C   1 
ATOM   240  O  O   . GLU A 1 38  ? -9.506  28.354 -6.138  1.00 28.77 ? 38   GLU A O   1 
ATOM   241  C  CB  . GLU A 1 38  ? -8.762  29.262 -9.044  1.00 31.36 ? 38   GLU A CB  1 
ATOM   242  C  CG  . GLU A 1 38  ? -8.789  30.576 -9.807  1.00 35.91 ? 38   GLU A CG  1 
ATOM   243  C  CD  . GLU A 1 38  ? -7.422  30.977 -10.328 1.00 38.94 ? 38   GLU A CD  1 
ATOM   244  O  OE1 . GLU A 1 38  ? -6.933  30.323 -11.277 1.00 39.37 ? 38   GLU A OE1 1 
ATOM   245  O  OE2 . GLU A 1 38  ? -6.836  31.941 -9.783  1.00 41.37 ? 38   GLU A OE2 1 
ATOM   246  N  N   . LYS A 1 39  ? -7.730  27.134 -6.750  1.00 26.73 ? 39   LYS A N   1 
ATOM   247  C  CA  . LYS A 1 39  ? -8.096  26.022 -5.882  1.00 26.91 ? 39   LYS A CA  1 
ATOM   248  C  C   . LYS A 1 39  ? -7.786  26.365 -4.426  1.00 26.30 ? 39   LYS A C   1 
ATOM   249  O  O   . LYS A 1 39  ? -8.521  25.981 -3.520  1.00 25.98 ? 39   LYS A O   1 
ATOM   250  C  CB  . LYS A 1 39  ? -7.346  24.762 -6.304  1.00 25.95 ? 39   LYS A CB  1 
ATOM   251  C  CG  . LYS A 1 39  ? -7.692  24.317 -7.703  1.00 26.02 ? 39   LYS A CG  1 
ATOM   252  C  CD  . LYS A 1 39  ? -7.018  23.009 -8.029  1.00 27.76 ? 39   LYS A CD  1 
ATOM   253  C  CE  . LYS A 1 39  ? -7.481  22.485 -9.371  1.00 28.64 ? 39   LYS A CE  1 
ATOM   254  N  NZ  . LYS A 1 39  ? -6.973  21.109 -9.608  1.00 28.81 ? 39   LYS A NZ  1 
ATOM   255  N  N   . LEU A 1 40  ? -6.687  27.085 -4.208  1.00 26.35 ? 40   LEU A N   1 
ATOM   256  C  CA  . LEU A 1 40  ? -6.307  27.508 -2.863  1.00 26.25 ? 40   LEU A CA  1 
ATOM   257  C  C   . LEU A 1 40  ? -7.297  28.582 -2.438  1.00 27.16 ? 40   LEU A C   1 
ATOM   258  O  O   . LEU A 1 40  ? -7.618  28.710 -1.253  1.00 25.88 ? 40   LEU A O   1 
ATOM   259  C  CB  . LEU A 1 40  ? -4.885  28.075 -2.858  1.00 25.22 ? 40   LEU A CB  1 
ATOM   260  C  CG  . LEU A 1 40  ? -3.746  27.064 -3.017  1.00 24.16 ? 40   LEU A CG  1 
ATOM   261  C  CD1 . LEU A 1 40  ? -2.455  27.794 -3.322  1.00 24.57 ? 40   LEU A CD1 1 
ATOM   262  C  CD2 . LEU A 1 40  ? -3.625  26.231 -1.751  1.00 21.91 ? 40   LEU A CD2 1 
ATOM   263  N  N   . LYS A 1 41  ? -7.769  29.350 -3.423  1.00 28.11 ? 41   LYS A N   1 
ATOM   264  C  CA  . LYS A 1 41  ? -8.750  30.405 -3.195  1.00 28.79 ? 41   LYS A CA  1 
ATOM   265  C  C   . LYS A 1 41  ? -10.105 29.765 -2.889  1.00 30.07 ? 41   LYS A C   1 
ATOM   266  O  O   . LYS A 1 41  ? -10.879 30.303 -2.099  1.00 30.12 ? 41   LYS A O   1 
ATOM   267  C  CB  . LYS A 1 41  ? -8.864  31.322 -4.422  1.00 28.76 ? 41   LYS A CB  1 
ATOM   268  C  CG  . LYS A 1 41  ? -7.626  32.179 -4.690  1.00 29.73 ? 41   LYS A CG  1 
ATOM   269  C  CD  . LYS A 1 41  ? -7.898  33.303 -5.700  1.00 30.25 ? 41   LYS A CD  1 
ATOM   270  C  CE  . LYS A 1 41  ? -6.707  34.269 -5.786  1.00 32.28 ? 41   LYS A CE  1 
ATOM   271  N  NZ  . LYS A 1 41  ? -6.982  35.521 -6.566  1.00 32.48 ? 41   LYS A NZ  1 
ATOM   272  N  N   . GLU A 1 42  ? -10.388 28.620 -3.512  1.00 32.17 ? 42   GLU A N   1 
ATOM   273  C  CA  . GLU A 1 42  ? -11.639 27.904 -3.264  1.00 34.54 ? 42   GLU A CA  1 
ATOM   274  C  C   . GLU A 1 42  ? -11.643 27.453 -1.817  1.00 35.89 ? 42   GLU A C   1 
ATOM   275  O  O   . GLU A 1 42  ? -12.696 27.263 -1.215  1.00 36.30 ? 42   GLU A O   1 
ATOM   276  C  CB  . GLU A 1 42  ? -11.762 26.670 -4.152  1.00 36.29 ? 42   GLU A CB  1 
ATOM   277  C  CG  . GLU A 1 42  ? -12.221 26.938 -5.560  1.00 37.09 ? 42   GLU A CG  1 
ATOM   278  C  CD  . GLU A 1 42  ? -12.572 25.658 -6.288  1.00 38.78 ? 42   GLU A CD  1 
ATOM   279  O  OE1 . GLU A 1 42  ? -13.449 24.920 -5.786  1.00 38.91 ? 42   GLU A OE1 1 
ATOM   280  O  OE2 . GLU A 1 42  ? -11.973 25.391 -7.354  1.00 38.86 ? 42   GLU A OE2 1 
ATOM   281  N  N   . GLN A 1 43  ? -10.449 27.262 -1.269  1.00 38.50 ? 43   GLN A N   1 
ATOM   282  C  CA  . GLN A 1 43  ? -10.307 26.855 0.121   1.00 40.66 ? 43   GLN A CA  1 
ATOM   283  C  C   . GLN A 1 43  ? -10.517 28.091 0.990   1.00 43.31 ? 43   GLN A C   1 
ATOM   284  O  O   . GLN A 1 43  ? -11.372 28.914 0.672   1.00 43.94 ? 43   GLN A O   1 
ATOM   285  C  CB  . GLN A 1 43  ? -8.931  26.209 0.338   1.00 39.76 ? 43   GLN A CB  1 
ATOM   286  C  CG  . GLN A 1 43  ? -8.971  24.697 0.099   1.00 37.08 ? 43   GLN A CG  1 
ATOM   287  C  CD  . GLN A 1 43  ? -7.658  24.101 -0.374  1.00 35.37 ? 43   GLN A CD  1 
ATOM   288  O  OE1 . GLN A 1 43  ? -6.604  24.314 0.225   1.00 35.07 ? 43   GLN A OE1 1 
ATOM   289  N  NE2 . GLN A 1 43  ? -7.724  23.329 -1.452  1.00 33.41 ? 43   GLN A NE2 1 
ATOM   290  N  N   . GLU A 1 44  ? -9.757  28.261 2.064   1.00 47.07 ? 44   GLU A N   1 
ATOM   291  C  CA  . GLU A 1 44  ? -9.995  29.432 2.904   1.00 50.56 ? 44   GLU A CA  1 
ATOM   292  C  C   . GLU A 1 44  ? -8.815  30.346 3.207   1.00 51.87 ? 44   GLU A C   1 
ATOM   293  O  O   . GLU A 1 44  ? -8.804  30.986 4.261   1.00 53.17 ? 44   GLU A O   1 
ATOM   294  C  CB  . GLU A 1 44  ? -10.611 29.003 4.238   1.00 52.30 ? 44   GLU A CB  1 
ATOM   295  C  CG  . GLU A 1 44  ? -9.639  28.269 5.158   1.00 55.61 ? 44   GLU A CG  1 
ATOM   296  C  CD  . GLU A 1 44  ? -9.756  28.707 6.613   1.00 57.54 ? 44   GLU A CD  1 
ATOM   297  O  OE1 . GLU A 1 44  ? -8.997  28.175 7.453   1.00 59.06 ? 44   GLU A OE1 1 
ATOM   298  O  OE2 . GLU A 1 44  ? -10.599 29.582 6.918   1.00 58.33 ? 44   GLU A OE2 1 
ATOM   299  N  N   . CYS A 1 45  ? -7.830  30.436 2.319   1.00 52.81 ? 45   CYS A N   1 
ATOM   300  C  CA  . CYS A 1 45  ? -6.693  31.311 2.611   1.00 54.07 ? 45   CYS A CA  1 
ATOM   301  C  C   . CYS A 1 45  ? -6.415  32.372 1.547   1.00 53.31 ? 45   CYS A C   1 
ATOM   302  O  O   . CYS A 1 45  ? -6.641  32.147 0.356   1.00 53.84 ? 45   CYS A O   1 
ATOM   303  C  CB  . CYS A 1 45  ? -5.423  30.478 2.869   1.00 55.41 ? 45   CYS A CB  1 
ATOM   304  S  SG  . CYS A 1 45  ? -5.434  29.466 4.404   1.00 56.82 ? 45   CYS A SG  1 
ATOM   305  N  N   . ASP A 1 46  ? -5.939  33.534 1.997   1.00 52.19 ? 46   ASP A N   1 
ATOM   306  C  CA  . ASP A 1 46  ? -5.612  34.644 1.107   1.00 51.60 ? 46   ASP A CA  1 
ATOM   307  C  C   . ASP A 1 46  ? -4.385  34.305 0.277   1.00 50.06 ? 46   ASP A C   1 
ATOM   308  O  O   . ASP A 1 46  ? -3.320  34.008 0.816   1.00 49.21 ? 46   ASP A O   1 
ATOM   309  C  CB  . ASP A 1 46  ? -5.332  35.923 1.902   1.00 53.22 ? 46   ASP A CB  1 
ATOM   310  C  CG  . ASP A 1 46  ? -6.591  36.565 2.443   1.00 56.09 ? 46   ASP A CG  1 
ATOM   311  O  OD1 . ASP A 1 46  ? -7.507  36.850 1.641   1.00 58.34 ? 46   ASP A OD1 1 
ATOM   312  O  OD2 . ASP A 1 46  ? -6.663  36.794 3.668   1.00 57.52 ? 46   ASP A OD2 1 
ATOM   313  N  N   . VAL A 1 47  ? -4.539  34.363 -1.038  1.00 48.89 ? 47   VAL A N   1 
ATOM   314  C  CA  . VAL A 1 47  ? -3.447  34.057 -1.948  1.00 47.81 ? 47   VAL A CA  1 
ATOM   315  C  C   . VAL A 1 47  ? -2.813  35.337 -2.494  1.00 47.10 ? 47   VAL A C   1 
ATOM   316  O  O   . VAL A 1 47  ? -3.465  36.106 -3.204  1.00 47.88 ? 47   VAL A O   1 
ATOM   317  C  CB  . VAL A 1 47  ? -3.956  33.194 -3.128  1.00 47.71 ? 47   VAL A CB  1 
ATOM   318  C  CG1 . VAL A 1 47  ? -2.809  32.803 -4.030  1.00 46.31 ? 47   VAL A CG1 1 
ATOM   319  C  CG2 . VAL A 1 47  ? -4.653  31.956 -2.597  1.00 47.15 ? 47   VAL A CG2 1 
ATOM   320  N  N   . LYS A 1 48  ? -1.545  35.562 -2.149  1.00 45.79 ? 48   LYS A N   1 
ATOM   321  C  CA  . LYS A 1 48  ? -0.803  36.739 -2.613  1.00 43.78 ? 48   LYS A CA  1 
ATOM   322  C  C   . LYS A 1 48  ? 0.337   36.244 -3.507  1.00 41.07 ? 48   LYS A C   1 
ATOM   323  O  O   . LYS A 1 48  ? 1.378   35.808 -3.016  1.00 40.58 ? 48   LYS A O   1 
ATOM   324  C  CB  . LYS A 1 48  ? -0.216  37.509 -1.426  1.00 45.65 ? 48   LYS A CB  1 
ATOM   325  C  CG  . LYS A 1 48  ? -1.070  37.496 -0.154  1.00 49.25 ? 48   LYS A CG  1 
ATOM   326  C  CD  . LYS A 1 48  ? -2.441  38.144 -0.344  1.00 50.66 ? 48   LYS A CD  1 
ATOM   327  C  CE  . LYS A 1 48  ? -3.214  38.175 0.973   1.00 50.14 ? 48   LYS A CE  1 
ATOM   328  N  NZ  . LYS A 1 48  ? -4.620  38.624 0.800   1.00 50.13 ? 48   LYS A NZ  1 
ATOM   329  N  N   . ASP A 1 49  ? 0.138   36.317 -4.818  1.00 37.74 ? 49   ASP A N   1 
ATOM   330  C  CA  . ASP A 1 49  ? 1.138   35.843 -5.766  1.00 35.46 ? 49   ASP A CA  1 
ATOM   331  C  C   . ASP A 1 49  ? 2.302   36.810 -5.992  1.00 33.76 ? 49   ASP A C   1 
ATOM   332  O  O   . ASP A 1 49  ? 2.171   37.796 -6.721  1.00 33.06 ? 49   ASP A O   1 
ATOM   333  C  CB  . ASP A 1 49  ? 0.469   35.534 -7.109  1.00 35.88 ? 49   ASP A CB  1 
ATOM   334  C  CG  . ASP A 1 49  ? 1.352   34.705 -8.027  1.00 36.62 ? 49   ASP A CG  1 
ATOM   335  O  OD1 . ASP A 1 49  ? 2.539   35.053 -8.197  1.00 35.76 ? 49   ASP A OD1 1 
ATOM   336  O  OD2 . ASP A 1 49  ? 0.854   33.704 -8.588  1.00 39.46 ? 49   ASP A OD2 1 
ATOM   337  N  N   . TYR A 1 50  ? 3.445   36.520 -5.375  1.00 30.80 ? 50   TYR A N   1 
ATOM   338  C  CA  . TYR A 1 50  ? 4.628   37.361 -5.543  1.00 28.70 ? 50   TYR A CA  1 
ATOM   339  C  C   . TYR A 1 50  ? 5.327   37.126 -6.888  1.00 27.67 ? 50   TYR A C   1 
ATOM   340  O  O   . TYR A 1 50  ? 6.452   37.581 -7.099  1.00 27.78 ? 50   TYR A O   1 
ATOM   341  C  CB  . TYR A 1 50  ? 5.622   37.126 -4.404  1.00 26.10 ? 50   TYR A CB  1 
ATOM   342  C  CG  . TYR A 1 50  ? 5.158   37.685 -3.090  1.00 24.72 ? 50   TYR A CG  1 
ATOM   343  C  CD1 . TYR A 1 50  ? 4.149   37.056 -2.361  1.00 23.44 ? 50   TYR A CD1 1 
ATOM   344  C  CD2 . TYR A 1 50  ? 5.707   38.861 -2.582  1.00 23.86 ? 50   TYR A CD2 1 
ATOM   345  C  CE1 . TYR A 1 50  ? 3.697   37.583 -1.156  1.00 23.76 ? 50   TYR A CE1 1 
ATOM   346  C  CE2 . TYR A 1 50  ? 5.262   39.400 -1.378  1.00 24.30 ? 50   TYR A CE2 1 
ATOM   347  C  CZ  . TYR A 1 50  ? 4.260   38.754 -0.670  1.00 23.99 ? 50   TYR A CZ  1 
ATOM   348  O  OH  . TYR A 1 50  ? 3.848   39.257 0.545   1.00 27.81 ? 50   TYR A OH  1 
ATOM   349  N  N   . GLY A 1 51  ? 4.655   36.405 -7.785  1.00 26.91 ? 51   GLY A N   1 
ATOM   350  C  CA  . GLY A 1 51  ? 5.206   36.135 -9.100  1.00 25.02 ? 51   GLY A CA  1 
ATOM   351  C  C   . GLY A 1 51  ? 6.363   35.162 -9.141  1.00 25.23 ? 51   GLY A C   1 
ATOM   352  O  O   . GLY A 1 51  ? 6.714   34.546 -8.136  1.00 24.01 ? 51   GLY A O   1 
ATOM   353  N  N   . ASP A 1 52  ? 6.958   35.028 -10.321 1.00 26.04 ? 52   ASP A N   1 
ATOM   354  C  CA  . ASP A 1 52  ? 8.081   34.127 -10.518 1.00 29.02 ? 52   ASP A CA  1 
ATOM   355  C  C   . ASP A 1 52  ? 9.409   34.863 -10.555 1.00 30.69 ? 52   ASP A C   1 
ATOM   356  O  O   . ASP A 1 52  ? 9.602   35.786 -11.342 1.00 31.42 ? 52   ASP A O   1 
ATOM   357  C  CB  . ASP A 1 52  ? 7.896   33.330 -11.806 1.00 29.90 ? 52   ASP A CB  1 
ATOM   358  C  CG  . ASP A 1 52  ? 6.670   32.449 -11.761 1.00 32.05 ? 52   ASP A CG  1 
ATOM   359  O  OD1 . ASP A 1 52  ? 5.564   32.929 -12.096 1.00 33.74 ? 52   ASP A OD1 1 
ATOM   360  O  OD2 . ASP A 1 52  ? 6.811   31.276 -11.365 1.00 33.61 ? 52   ASP A OD2 1 
ATOM   361  N  N   . LEU A 1 53  ? 10.325  34.440 -9.692  1.00 32.75 ? 53   LEU A N   1 
ATOM   362  C  CA  . LEU A 1 53  ? 11.638  35.054 -9.603  1.00 34.57 ? 53   LEU A CA  1 
ATOM   363  C  C   . LEU A 1 53  ? 12.449  34.981 -10.887 1.00 36.00 ? 53   LEU A C   1 
ATOM   364  O  O   . LEU A 1 53  ? 12.577  33.917 -11.499 1.00 36.16 ? 53   LEU A O   1 
ATOM   365  C  CB  . LEU A 1 53  ? 12.438  34.410 -8.472  1.00 34.43 ? 53   LEU A CB  1 
ATOM   366  C  CG  . LEU A 1 53  ? 12.058  34.888 -7.079  1.00 34.23 ? 53   LEU A CG  1 
ATOM   367  C  CD1 . LEU A 1 53  ? 12.918  34.206 -6.037  1.00 34.95 ? 53   LEU A CD1 1 
ATOM   368  C  CD2 . LEU A 1 53  ? 12.245  36.391 -7.029  1.00 35.68 ? 53   LEU A CD2 1 
ATOM   369  N  N   . PRO A 1 54  ? 12.986  36.130 -11.326 1.00 37.28 ? 54   PRO A N   1 
ATOM   370  C  CA  . PRO A 1 54  ? 13.797  36.190 -12.542 1.00 37.61 ? 54   PRO A CA  1 
ATOM   371  C  C   . PRO A 1 54  ? 15.265  36.019 -12.154 1.00 38.39 ? 54   PRO A C   1 
ATOM   372  O  O   . PRO A 1 54  ? 15.882  36.927 -11.600 1.00 37.81 ? 54   PRO A O   1 
ATOM   373  C  CB  . PRO A 1 54  ? 13.486  37.577 -13.084 1.00 38.66 ? 54   PRO A CB  1 
ATOM   374  C  CG  . PRO A 1 54  ? 13.367  38.388 -11.833 1.00 37.80 ? 54   PRO A CG  1 
ATOM   375  C  CD  . PRO A 1 54  ? 12.568  37.482 -10.908 1.00 37.66 ? 54   PRO A CD  1 
ATOM   376  N  N   . PHE A 1 55  ? 15.810  34.840 -12.432 1.00 39.75 ? 55   PHE A N   1 
ATOM   377  C  CA  . PHE A 1 55  ? 17.198  34.535 -12.104 1.00 41.56 ? 55   PHE A CA  1 
ATOM   378  C  C   . PHE A 1 55  ? 18.165  34.843 -13.256 1.00 42.71 ? 55   PHE A C   1 
ATOM   379  O  O   . PHE A 1 55  ? 18.424  33.984 -14.105 1.00 43.15 ? 55   PHE A O   1 
ATOM   380  C  CB  . PHE A 1 55  ? 17.329  33.056 -11.720 1.00 41.14 ? 55   PHE A CB  1 
ATOM   381  C  CG  . PHE A 1 55  ? 16.453  32.639 -10.568 1.00 41.17 ? 55   PHE A CG  1 
ATOM   382  C  CD1 . PHE A 1 55  ? 16.518  33.303 -9.347  1.00 41.31 ? 55   PHE A CD1 1 
ATOM   383  C  CD2 . PHE A 1 55  ? 15.590  31.557 -10.692 1.00 41.65 ? 55   PHE A CD2 1 
ATOM   384  C  CE1 . PHE A 1 55  ? 15.738  32.891 -8.264  1.00 40.57 ? 55   PHE A CE1 1 
ATOM   385  C  CE2 . PHE A 1 55  ? 14.806  31.138 -9.615  1.00 41.28 ? 55   PHE A CE2 1 
ATOM   386  C  CZ  . PHE A 1 55  ? 14.882  31.806 -8.400  1.00 40.69 ? 55   PHE A CZ  1 
ATOM   387  N  N   . ALA A 1 56  ? 18.703  36.059 -13.283 1.00 43.68 ? 56   ALA A N   1 
ATOM   388  C  CA  . ALA A 1 56  ? 19.641  36.441 -14.339 1.00 44.75 ? 56   ALA A CA  1 
ATOM   389  C  C   . ALA A 1 56  ? 20.830  35.496 -14.297 1.00 44.48 ? 56   ALA A C   1 
ATOM   390  O  O   . ALA A 1 56  ? 21.427  35.297 -13.243 1.00 45.27 ? 56   ALA A O   1 
ATOM   391  C  CB  . ALA A 1 56  ? 20.109  37.881 -14.143 1.00 45.59 ? 56   ALA A CB  1 
ATOM   392  N  N   . ASP A 1 57  ? 21.169  34.916 -15.442 1.00 44.88 ? 57   ASP A N   1 
ATOM   393  C  CA  . ASP A 1 57  ? 22.281  33.976 -15.520 1.00 46.08 ? 57   ASP A CA  1 
ATOM   394  C  C   . ASP A 1 57  ? 23.638  34.631 -15.284 1.00 45.74 ? 57   ASP A C   1 
ATOM   395  O  O   . ASP A 1 57  ? 23.837  35.803 -15.603 1.00 45.69 ? 57   ASP A O   1 
ATOM   396  C  CB  . ASP A 1 57  ? 22.299  33.290 -16.888 1.00 47.87 ? 57   ASP A CB  1 
ATOM   397  C  CG  . ASP A 1 57  ? 23.315  32.158 -16.959 1.00 50.15 ? 57   ASP A CG  1 
ATOM   398  O  OD1 . ASP A 1 57  ? 23.659  31.733 -18.087 1.00 50.29 ? 57   ASP A OD1 1 
ATOM   399  O  OD2 . ASP A 1 57  ? 23.763  31.684 -15.887 1.00 50.77 ? 57   ASP A OD2 1 
ATOM   400  N  N   . ILE A 1 58  ? 24.566  33.861 -14.720 1.00 45.60 ? 58   ILE A N   1 
ATOM   401  C  CA  . ILE A 1 58  ? 25.920  34.336 -14.461 1.00 45.39 ? 58   ILE A CA  1 
ATOM   402  C  C   . ILE A 1 58  ? 26.799  33.892 -15.620 1.00 45.50 ? 58   ILE A C   1 
ATOM   403  O  O   . ILE A 1 58  ? 27.192  32.726 -15.701 1.00 46.30 ? 58   ILE A O   1 
ATOM   404  C  CB  . ILE A 1 58  ? 26.493  33.759 -13.142 1.00 45.20 ? 58   ILE A CB  1 
ATOM   405  C  CG1 . ILE A 1 58  ? 25.735  34.349 -11.950 1.00 44.84 ? 58   ILE A CG1 1 
ATOM   406  C  CG2 . ILE A 1 58  ? 27.986  34.058 -13.035 1.00 44.38 ? 58   ILE A CG2 1 
ATOM   407  C  CD1 . ILE A 1 58  ? 25.684  35.873 -11.946 1.00 45.30 ? 58   ILE A CD1 1 
ATOM   408  N  N   . PRO A 1 59  ? 27.128  34.829 -16.529 1.00 45.31 ? 59   PRO A N   1 
ATOM   409  C  CA  . PRO A 1 59  ? 27.961  34.555 -17.704 1.00 44.52 ? 59   PRO A CA  1 
ATOM   410  C  C   . PRO A 1 59  ? 29.164  33.635 -17.470 1.00 43.84 ? 59   PRO A C   1 
ATOM   411  O  O   . PRO A 1 59  ? 29.254  32.570 -18.080 1.00 42.85 ? 59   PRO A O   1 
ATOM   412  C  CB  . PRO A 1 59  ? 28.363  35.958 -18.181 1.00 44.36 ? 59   PRO A CB  1 
ATOM   413  C  CG  . PRO A 1 59  ? 28.256  36.802 -16.936 1.00 44.58 ? 59   PRO A CG  1 
ATOM   414  C  CD  . PRO A 1 59  ? 26.982  36.282 -16.330 1.00 44.67 ? 59   PRO A CD  1 
ATOM   415  N  N   . ASN A 1 60  ? 30.077  34.035 -16.587 1.00 42.97 ? 60   ASN A N   1 
ATOM   416  C  CA  . ASN A 1 60  ? 31.270  33.230 -16.319 1.00 42.21 ? 60   ASN A CA  1 
ATOM   417  C  C   . ASN A 1 60  ? 31.176  32.466 -14.998 1.00 40.47 ? 60   ASN A C   1 
ATOM   418  O  O   . ASN A 1 60  ? 31.884  32.781 -14.042 1.00 41.01 ? 60   ASN A O   1 
ATOM   419  C  CB  . ASN A 1 60  ? 32.515  34.131 -16.302 1.00 43.28 ? 60   ASN A CB  1 
ATOM   420  C  CG  . ASN A 1 60  ? 33.588  33.683 -17.293 1.00 44.06 ? 60   ASN A CG  1 
ATOM   421  O  OD1 . ASN A 1 60  ? 34.044  32.537 -17.261 1.00 43.68 ? 60   ASN A OD1 1 
ATOM   422  N  ND2 . ASN A 1 60  ? 34.002  34.596 -18.172 1.00 43.73 ? 60   ASN A ND2 1 
ATOM   423  N  N   . ASP A 1 61  ? 30.310  31.461 -14.943 1.00 38.85 ? 61   ASP A N   1 
ATOM   424  C  CA  . ASP A 1 61  ? 30.160  30.682 -13.719 1.00 37.38 ? 61   ASP A CA  1 
ATOM   425  C  C   . ASP A 1 61  ? 30.901  29.359 -13.789 1.00 36.14 ? 61   ASP A C   1 
ATOM   426  O  O   . ASP A 1 61  ? 30.312  28.301 -14.013 1.00 35.44 ? 61   ASP A O   1 
ATOM   427  C  CB  . ASP A 1 61  ? 28.683  30.432 -13.410 1.00 36.48 ? 61   ASP A CB  1 
ATOM   428  C  CG  . ASP A 1 61  ? 28.482  29.637 -12.129 1.00 35.10 ? 61   ASP A CG  1 
ATOM   429  O  OD1 . ASP A 1 61  ? 29.259  29.819 -11.167 1.00 34.78 ? 61   ASP A OD1 1 
ATOM   430  O  OD2 . ASP A 1 61  ? 27.534  28.838 -12.077 1.00 33.23 ? 61   ASP A OD2 1 
ATOM   431  N  N   . SER A 1 62  ? 32.208  29.435 -13.587 1.00 35.28 ? 62   SER A N   1 
ATOM   432  C  CA  . SER A 1 62  ? 33.050  28.257 -13.618 1.00 34.74 ? 62   SER A CA  1 
ATOM   433  C  C   . SER A 1 62  ? 32.795  27.407 -12.382 1.00 33.78 ? 62   SER A C   1 
ATOM   434  O  O   . SER A 1 62  ? 32.422  27.920 -11.327 1.00 33.36 ? 62   SER A O   1 
ATOM   435  C  CB  . SER A 1 62  ? 34.515  28.674 -13.678 1.00 35.73 ? 62   SER A CB  1 
ATOM   436  O  OG  . SER A 1 62  ? 34.728  29.529 -14.786 1.00 38.66 ? 62   SER A OG  1 
ATOM   437  N  N   . PRO A 1 63  ? 32.994  26.089 -12.503 1.00 33.25 ? 63   PRO A N   1 
ATOM   438  C  CA  . PRO A 1 63  ? 32.795  25.128 -11.416 1.00 33.00 ? 63   PRO A CA  1 
ATOM   439  C  C   . PRO A 1 63  ? 33.721  25.331 -10.221 1.00 32.93 ? 63   PRO A C   1 
ATOM   440  O  O   . PRO A 1 63  ? 34.772  25.979 -10.325 1.00 33.79 ? 63   PRO A O   1 
ATOM   441  C  CB  . PRO A 1 63  ? 33.073  23.783 -12.088 1.00 31.35 ? 63   PRO A CB  1 
ATOM   442  C  CG  . PRO A 1 63  ? 32.765  24.035 -13.519 1.00 33.29 ? 63   PRO A CG  1 
ATOM   443  C  CD  . PRO A 1 63  ? 33.353  25.393 -13.748 1.00 31.29 ? 63   PRO A CD  1 
ATOM   444  N  N   . PHE A 1 64  ? 33.304  24.775 -9.086  1.00 31.32 ? 64   PHE A N   1 
ATOM   445  C  CA  . PHE A 1 64  ? 34.094  24.793 -7.863  1.00 29.65 ? 64   PHE A CA  1 
ATOM   446  C  C   . PHE A 1 64  ? 34.430  23.321 -7.743  1.00 30.00 ? 64   PHE A C   1 
ATOM   447  O  O   . PHE A 1 64  ? 33.557  22.503 -7.448  1.00 29.31 ? 64   PHE A O   1 
ATOM   448  C  CB  . PHE A 1 64  ? 33.267  25.220 -6.648  1.00 28.64 ? 64   PHE A CB  1 
ATOM   449  C  CG  . PHE A 1 64  ? 34.006  25.095 -5.339  1.00 27.26 ? 64   PHE A CG  1 
ATOM   450  C  CD1 . PHE A 1 64  ? 34.971  26.027 -4.972  1.00 28.28 ? 64   PHE A CD1 1 
ATOM   451  C  CD2 . PHE A 1 64  ? 33.743  24.038 -4.476  1.00 27.83 ? 64   PHE A CD2 1 
ATOM   452  C  CE1 . PHE A 1 64  ? 35.663  25.906 -3.763  1.00 28.69 ? 64   PHE A CE1 1 
ATOM   453  C  CE2 . PHE A 1 64  ? 34.430  23.910 -3.265  1.00 28.13 ? 64   PHE A CE2 1 
ATOM   454  C  CZ  . PHE A 1 64  ? 35.390  24.847 -2.911  1.00 28.10 ? 64   PHE A CZ  1 
ATOM   455  N  N   . GLN A 1 65  ? 35.685  22.978 -7.999  1.00 31.19 ? 65   GLN A N   1 
ATOM   456  C  CA  . GLN A 1 65  ? 36.100  21.588 -7.941  1.00 32.87 ? 65   GLN A CA  1 
ATOM   457  C  C   . GLN A 1 65  ? 35.233  20.802 -8.921  1.00 32.85 ? 65   GLN A C   1 
ATOM   458  O  O   . GLN A 1 65  ? 35.375  20.941 -10.138 1.00 31.99 ? 65   GLN A O   1 
ATOM   459  C  CB  . GLN A 1 65  ? 35.927  21.036 -6.518  1.00 35.28 ? 65   GLN A CB  1 
ATOM   460  C  CG  . GLN A 1 65  ? 36.779  21.749 -5.471  1.00 37.66 ? 65   GLN A CG  1 
ATOM   461  C  CD  . GLN A 1 65  ? 36.722  21.085 -4.108  1.00 39.72 ? 65   GLN A CD  1 
ATOM   462  O  OE1 . GLN A 1 65  ? 37.356  21.544 -3.155  1.00 40.53 ? 65   GLN A OE1 1 
ATOM   463  N  NE2 . GLN A 1 65  ? 35.963  19.996 -4.007  1.00 40.31 ? 65   GLN A NE2 1 
ATOM   464  N  N   . ILE A 1 66  ? 34.322  20.000 -8.374  1.00 32.33 ? 66   ILE A N   1 
ATOM   465  C  CA  . ILE A 1 66  ? 33.410  19.166 -9.155  1.00 31.16 ? 66   ILE A CA  1 
ATOM   466  C  C   . ILE A 1 66  ? 31.996  19.760 -9.134  1.00 29.48 ? 66   ILE A C   1 
ATOM   467  O  O   . ILE A 1 66  ? 31.118  19.344 -9.886  1.00 28.31 ? 66   ILE A O   1 
ATOM   468  C  CB  . ILE A 1 66  ? 33.410  17.719 -8.577  1.00 30.02 ? 66   ILE A CB  1 
ATOM   469  C  CG1 . ILE A 1 66  ? 32.217  16.923 -9.091  1.00 30.18 ? 66   ILE A CG1 1 
ATOM   470  C  CG2 . ILE A 1 66  ? 33.418  17.771 -7.053  1.00 32.33 ? 66   ILE A CG2 1 
ATOM   471  C  CD1 . ILE A 1 66  ? 32.072  15.567 -8.424  1.00 28.38 ? 66   ILE A CD1 1 
ATOM   472  N  N   . VAL A 1 67  ? 31.801  20.753 -8.274  1.00 30.00 ? 67   VAL A N   1 
ATOM   473  C  CA  . VAL A 1 67  ? 30.514  21.424 -8.117  1.00 28.71 ? 67   VAL A CA  1 
ATOM   474  C  C   . VAL A 1 67  ? 30.240  22.367 -9.289  1.00 28.25 ? 67   VAL A C   1 
ATOM   475  O  O   . VAL A 1 67  ? 30.989  23.311 -9.530  1.00 27.62 ? 67   VAL A O   1 
ATOM   476  C  CB  . VAL A 1 67  ? 30.483  22.237 -6.799  1.00 28.57 ? 67   VAL A CB  1 
ATOM   477  C  CG1 . VAL A 1 67  ? 29.068  22.700 -6.496  1.00 28.24 ? 67   VAL A CG1 1 
ATOM   478  C  CG2 . VAL A 1 67  ? 31.029  21.394 -5.660  1.00 28.29 ? 67   VAL A CG2 1 
ATOM   479  N  N   . LYS A 1 68  ? 29.151  22.117 -10.006 1.00 28.03 ? 68   LYS A N   1 
ATOM   480  C  CA  . LYS A 1 68  ? 28.801  22.933 -11.159 1.00 27.87 ? 68   LYS A CA  1 
ATOM   481  C  C   . LYS A 1 68  ? 27.834  24.070 -10.871 1.00 27.69 ? 68   LYS A C   1 
ATOM   482  O  O   . LYS A 1 68  ? 27.000  23.996 -9.963  1.00 27.39 ? 68   LYS A O   1 
ATOM   483  C  CB  . LYS A 1 68  ? 28.228  22.046 -12.263 1.00 27.78 ? 68   LYS A CB  1 
ATOM   484  C  CG  . LYS A 1 68  ? 29.262  21.171 -12.939 1.00 28.06 ? 68   LYS A CG  1 
ATOM   485  C  CD  . LYS A 1 68  ? 28.622  19.966 -13.598 1.00 30.56 ? 68   LYS A CD  1 
ATOM   486  C  CE  . LYS A 1 68  ? 28.045  19.013 -12.553 1.00 32.02 ? 68   LYS A CE  1 
ATOM   487  N  NZ  . LYS A 1 68  ? 27.703  17.675 -13.118 1.00 32.73 ? 68   LYS A NZ  1 
ATOM   488  N  N   . ASN A 1 69  ? 27.966  25.128 -11.661 1.00 27.03 ? 69   ASN A N   1 
ATOM   489  C  CA  . ASN A 1 69  ? 27.115  26.297 -11.542 1.00 26.24 ? 69   ASN A CA  1 
ATOM   490  C  C   . ASN A 1 69  ? 26.984  26.807 -10.109 1.00 25.54 ? 69   ASN A C   1 
ATOM   491  O  O   . ASN A 1 69  ? 25.902  27.217 -9.687  1.00 25.09 ? 69   ASN A O   1 
ATOM   492  C  CB  . ASN A 1 69  ? 25.728  25.976 -12.109 1.00 27.70 ? 69   ASN A CB  1 
ATOM   493  C  CG  . ASN A 1 69  ? 25.788  25.454 -13.533 1.00 27.74 ? 69   ASN A CG  1 
ATOM   494  O  OD1 . ASN A 1 69  ? 26.293  26.129 -14.433 1.00 30.08 ? 69   ASN A OD1 1 
ATOM   495  N  ND2 . ASN A 1 69  ? 25.274  24.248 -13.745 1.00 28.68 ? 69   ASN A ND2 1 
ATOM   496  N  N   . PRO A 1 70  ? 28.086  26.803 -9.343  1.00 24.91 ? 70   PRO A N   1 
ATOM   497  C  CA  . PRO A 1 70  ? 27.995  27.284 -7.961  1.00 24.72 ? 70   PRO A CA  1 
ATOM   498  C  C   . PRO A 1 70  ? 27.443  28.708 -7.797  1.00 24.45 ? 70   PRO A C   1 
ATOM   499  O  O   . PRO A 1 70  ? 26.625  28.965 -6.910  1.00 22.14 ? 70   PRO A O   1 
ATOM   500  C  CB  . PRO A 1 70  ? 29.435  27.140 -7.450  1.00 24.46 ? 70   PRO A CB  1 
ATOM   501  C  CG  . PRO A 1 70  ? 30.258  27.267 -8.683  1.00 23.91 ? 70   PRO A CG  1 
ATOM   502  C  CD  . PRO A 1 70  ? 29.475  26.441 -9.675  1.00 24.77 ? 70   PRO A CD  1 
ATOM   503  N  N   . ARG A 1 71  ? 27.877  29.622 -8.662  1.00 24.48 ? 71   ARG A N   1 
ATOM   504  C  CA  . ARG A 1 71  ? 27.444  31.015 -8.597  1.00 23.36 ? 71   ARG A CA  1 
ATOM   505  C  C   . ARG A 1 71  ? 25.979  31.238 -8.974  1.00 22.87 ? 71   ARG A C   1 
ATOM   506  O  O   . ARG A 1 71  ? 25.328  32.155 -8.465  1.00 20.21 ? 71   ARG A O   1 
ATOM   507  C  CB  . ARG A 1 71  ? 28.344  31.878 -9.487  1.00 23.86 ? 71   ARG A CB  1 
ATOM   508  C  CG  . ARG A 1 71  ? 29.791  31.847 -9.065  1.00 22.44 ? 71   ARG A CG  1 
ATOM   509  C  CD  . ARG A 1 71  ? 30.663  32.727 -9.929  1.00 23.17 ? 71   ARG A CD  1 
ATOM   510  N  NE  . ARG A 1 71  ? 32.070  32.558 -9.576  1.00 22.88 ? 71   ARG A NE  1 
ATOM   511  C  CZ  . ARG A 1 71  ? 32.752  31.430 -9.749  1.00 21.97 ? 71   ARG A CZ  1 
ATOM   512  N  NH1 . ARG A 1 71  ? 32.153  30.369 -10.277 1.00 22.06 ? 71   ARG A NH1 1 
ATOM   513  N  NH2 . ARG A 1 71  ? 34.026  31.356 -9.380  1.00 21.99 ? 71   ARG A NH2 1 
ATOM   514  N  N   . SER A 1 72  ? 25.466  30.401 -9.869  1.00 23.05 ? 72   SER A N   1 
ATOM   515  C  CA  . SER A 1 72  ? 24.080  30.514 -10.312 1.00 23.36 ? 72   SER A CA  1 
ATOM   516  C  C   . SER A 1 72  ? 23.181  29.949 -9.229  1.00 21.79 ? 72   SER A C   1 
ATOM   517  O  O   . SER A 1 72  ? 22.166  30.537 -8.872  1.00 24.85 ? 72   SER A O   1 
ATOM   518  C  CB  . SER A 1 72  ? 23.868  29.723 -11.605 1.00 22.92 ? 72   SER A CB  1 
ATOM   519  O  OG  . SER A 1 72  ? 24.859  30.048 -12.559 1.00 28.00 ? 72   SER A OG  1 
ATOM   520  N  N   . VAL A 1 73  ? 23.564  28.790 -8.718  1.00 20.71 ? 73   VAL A N   1 
ATOM   521  C  CA  . VAL A 1 73  ? 22.807  28.125 -7.672  1.00 18.58 ? 73   VAL A CA  1 
ATOM   522  C  C   . VAL A 1 73  ? 22.806  28.965 -6.407  1.00 19.56 ? 73   VAL A C   1 
ATOM   523  O  O   . VAL A 1 73  ? 21.816  29.001 -5.688  1.00 21.74 ? 73   VAL A O   1 
ATOM   524  C  CB  . VAL A 1 73  ? 23.412  26.746 -7.367  1.00 15.60 ? 73   VAL A CB  1 
ATOM   525  C  CG1 . VAL A 1 73  ? 22.769  26.146 -6.123  1.00 14.86 ? 73   VAL A CG1 1 
ATOM   526  C  CG2 . VAL A 1 73  ? 23.218  25.839 -8.562  1.00 11.09 ? 73   VAL A CG2 1 
ATOM   527  N  N   . GLY A 1 74  ? 23.917  29.652 -6.157  1.00 20.55 ? 74   GLY A N   1 
ATOM   528  C  CA  . GLY A 1 74  ? 24.045  30.478 -4.970  1.00 21.67 ? 74   GLY A CA  1 
ATOM   529  C  C   . GLY A 1 74  ? 23.271  31.779 -5.012  1.00 22.54 ? 74   GLY A C   1 
ATOM   530  O  O   . GLY A 1 74  ? 22.642  32.162 -4.027  1.00 22.82 ? 74   GLY A O   1 
ATOM   531  N  N   . LYS A 1 75  ? 23.311  32.470 -6.144  1.00 23.03 ? 75   LYS A N   1 
ATOM   532  C  CA  . LYS A 1 75  ? 22.591  33.733 -6.262  1.00 22.22 ? 75   LYS A CA  1 
ATOM   533  C  C   . LYS A 1 75  ? 21.089  33.466 -6.342  1.00 20.18 ? 75   LYS A C   1 
ATOM   534  O  O   . LYS A 1 75  ? 20.275  34.313 -5.981  1.00 18.47 ? 75   LYS A O   1 
ATOM   535  C  CB  . LYS A 1 75  ? 23.059  34.488 -7.511  1.00 24.13 ? 75   LYS A CB  1 
ATOM   536  C  CG  . LYS A 1 75  ? 22.887  35.999 -7.435  1.00 26.36 ? 75   LYS A CG  1 
ATOM   537  C  CD  . LYS A 1 75  ? 23.790  36.597 -6.372  1.00 28.50 ? 75   LYS A CD  1 
ATOM   538  C  CE  . LYS A 1 75  ? 23.653  38.105 -6.334  1.00 29.98 ? 75   LYS A CE  1 
ATOM   539  N  NZ  . LYS A 1 75  ? 22.224  38.509 -6.259  1.00 31.12 ? 75   LYS A NZ  1 
ATOM   540  N  N   . ALA A 1 76  ? 20.738  32.278 -6.823  1.00 20.54 ? 76   ALA A N   1 
ATOM   541  C  CA  . ALA A 1 76  ? 19.342  31.862 -6.963  1.00 19.30 ? 76   ALA A CA  1 
ATOM   542  C  C   . ALA A 1 76  ? 18.709  31.711 -5.592  1.00 18.83 ? 76   ALA A C   1 
ATOM   543  O  O   . ALA A 1 76  ? 17.545  32.061 -5.391  1.00 18.41 ? 76   ALA A O   1 
ATOM   544  C  CB  . ALA A 1 76  ? 19.259  30.534 -7.727  1.00 18.87 ? 76   ALA A CB  1 
ATOM   545  N  N   . SER A 1 77  ? 19.476  31.168 -4.654  1.00 18.22 ? 77   SER A N   1 
ATOM   546  C  CA  . SER A 1 77  ? 18.984  30.997 -3.302  1.00 18.96 ? 77   SER A CA  1 
ATOM   547  C  C   . SER A 1 77  ? 19.022  32.350 -2.605  1.00 20.64 ? 77   SER A C   1 
ATOM   548  O  O   . SER A 1 77  ? 18.111  32.682 -1.842  1.00 22.20 ? 77   SER A O   1 
ATOM   549  C  CB  . SER A 1 77  ? 19.836  29.986 -2.542  1.00 18.32 ? 77   SER A CB  1 
ATOM   550  O  OG  . SER A 1 77  ? 19.571  28.674 -2.991  1.00 17.81 ? 77   SER A OG  1 
ATOM   551  N  N   . GLU A 1 78  ? 20.065  33.139 -2.881  1.00 21.50 ? 78   GLU A N   1 
ATOM   552  C  CA  . GLU A 1 78  ? 20.190  34.455 -2.269  1.00 20.35 ? 78   GLU A CA  1 
ATOM   553  C  C   . GLU A 1 78  ? 18.971  35.312 -2.584  1.00 20.03 ? 78   GLU A C   1 
ATOM   554  O  O   . GLU A 1 78  ? 18.397  35.923 -1.683  1.00 20.20 ? 78   GLU A O   1 
ATOM   555  C  CB  . GLU A 1 78  ? 21.463  35.173 -2.729  1.00 20.78 ? 78   GLU A CB  1 
ATOM   556  C  CG  . GLU A 1 78  ? 21.639  36.527 -2.030  1.00 25.48 ? 78   GLU A CG  1 
ATOM   557  C  CD  . GLU A 1 78  ? 22.976  37.201 -2.293  1.00 26.44 ? 78   GLU A CD  1 
ATOM   558  O  OE1 . GLU A 1 78  ? 23.352  37.387 -3.470  1.00 29.52 ? 78   GLU A OE1 1 
ATOM   559  O  OE2 . GLU A 1 78  ? 23.649  37.564 -1.309  1.00 30.12 ? 78   GLU A OE2 1 
ATOM   560  N  N   . GLN A 1 79  ? 18.579  35.364 -3.854  1.00 20.54 ? 79   GLN A N   1 
ATOM   561  C  CA  . GLN A 1 79  ? 17.405  36.143 -4.249  1.00 21.60 ? 79   GLN A CA  1 
ATOM   562  C  C   . GLN A 1 79  ? 16.194  35.566 -3.523  1.00 21.94 ? 79   GLN A C   1 
ATOM   563  O  O   . GLN A 1 79  ? 15.432  36.290 -2.888  1.00 22.53 ? 79   GLN A O   1 
ATOM   564  C  CB  . GLN A 1 79  ? 17.135  36.050 -5.760  1.00 23.09 ? 79   GLN A CB  1 
ATOM   565  C  CG  . GLN A 1 79  ? 18.218  36.595 -6.696  1.00 26.46 ? 79   GLN A CG  1 
ATOM   566  C  CD  . GLN A 1 79  ? 17.929  36.272 -8.164  1.00 27.25 ? 79   GLN A CD  1 
ATOM   567  O  OE1 . GLN A 1 79  ? 16.951  36.752 -8.747  1.00 27.56 ? 79   GLN A OE1 1 
ATOM   568  N  NE2 . GLN A 1 79  ? 18.776  35.443 -8.759  1.00 28.79 ? 79   GLN A NE2 1 
ATOM   569  N  N   . LEU A 1 80  ? 16.036  34.248 -3.619  1.00 21.18 ? 80   LEU A N   1 
ATOM   570  C  CA  . LEU A 1 80  ? 14.910  33.556 -3.007  1.00 20.85 ? 80   LEU A CA  1 
ATOM   571  C  C   . LEU A 1 80  ? 14.818  33.796 -1.507  1.00 21.31 ? 80   LEU A C   1 
ATOM   572  O  O   . LEU A 1 80  ? 13.726  33.964 -0.982  1.00 23.15 ? 80   LEU A O   1 
ATOM   573  C  CB  . LEU A 1 80  ? 14.991  32.047 -3.299  1.00 19.58 ? 80   LEU A CB  1 
ATOM   574  C  CG  . LEU A 1 80  ? 13.828  31.181 -2.803  1.00 17.32 ? 80   LEU A CG  1 
ATOM   575  C  CD1 . LEU A 1 80  ? 12.537  31.693 -3.404  1.00 15.92 ? 80   LEU A CD1 1 
ATOM   576  C  CD2 . LEU A 1 80  ? 14.056  29.727 -3.173  1.00 12.78 ? 80   LEU A CD2 1 
ATOM   577  N  N   . ALA A 1 81  ? 15.957  33.808 -0.819  1.00 22.06 ? 81   ALA A N   1 
ATOM   578  C  CA  . ALA A 1 81  ? 15.984  34.038 0.624   1.00 21.77 ? 81   ALA A CA  1 
ATOM   579  C  C   . ALA A 1 81  ? 15.394  35.406 0.949   1.00 22.94 ? 81   ALA A C   1 
ATOM   580  O  O   . ALA A 1 81  ? 14.550  35.537 1.831   1.00 23.44 ? 81   ALA A O   1 
ATOM   581  C  CB  . ALA A 1 81  ? 17.417  33.955 1.137   1.00 20.93 ? 81   ALA A CB  1 
ATOM   582  N  N   . GLY A 1 82  ? 15.855  36.426 0.236   1.00 24.51 ? 82   GLY A N   1 
ATOM   583  C  CA  . GLY A 1 82  ? 15.345  37.763 0.454   1.00 23.63 ? 82   GLY A CA  1 
ATOM   584  C  C   . GLY A 1 82  ? 13.873  37.808 0.097   1.00 24.88 ? 82   GLY A C   1 
ATOM   585  O  O   . GLY A 1 82  ? 13.103  38.535 0.722   1.00 25.57 ? 82   GLY A O   1 
ATOM   586  N  N   . LYS A 1 83  ? 13.473  37.039 -0.912  1.00 24.14 ? 83   LYS A N   1 
ATOM   587  C  CA  . LYS A 1 83  ? 12.072  36.999 -1.324  1.00 24.89 ? 83   LYS A CA  1 
ATOM   588  C  C   . LYS A 1 83  ? 11.186  36.342 -0.256  1.00 24.19 ? 83   LYS A C   1 
ATOM   589  O  O   . LYS A 1 83  ? 10.096  36.833 0.048   1.00 23.45 ? 83   LYS A O   1 
ATOM   590  C  CB  . LYS A 1 83  ? 11.932  36.245 -2.652  1.00 27.01 ? 83   LYS A CB  1 
ATOM   591  C  CG  . LYS A 1 83  ? 12.151  37.100 -3.899  1.00 32.00 ? 83   LYS A CG  1 
ATOM   592  C  CD  . LYS A 1 83  ? 13.522  37.786 -3.933  1.00 35.28 ? 83   LYS A CD  1 
ATOM   593  C  CE  . LYS A 1 83  ? 13.741  38.571 -5.231  1.00 36.54 ? 83   LYS A CE  1 
ATOM   594  N  NZ  . LYS A 1 83  ? 15.119  39.139 -5.332  1.00 38.57 ? 83   LYS A NZ  1 
ATOM   595  N  N   . VAL A 1 84  ? 11.665  35.230 0.302   1.00 22.53 ? 84   VAL A N   1 
ATOM   596  C  CA  . VAL A 1 84  ? 10.951  34.485 1.337   1.00 19.50 ? 84   VAL A CA  1 
ATOM   597  C  C   . VAL A 1 84  ? 10.839  35.295 2.639   1.00 19.94 ? 84   VAL A C   1 
ATOM   598  O  O   . VAL A 1 84  ? 9.845   35.202 3.357   1.00 18.40 ? 84   VAL A O   1 
ATOM   599  C  CB  . VAL A 1 84  ? 11.651  33.116 1.596   1.00 17.37 ? 84   VAL A CB  1 
ATOM   600  C  CG1 . VAL A 1 84  ? 11.148  32.484 2.895   1.00 18.29 ? 84   VAL A CG1 1 
ATOM   601  C  CG2 . VAL A 1 84  ? 11.384  32.173 0.415   1.00 14.79 ? 84   VAL A CG2 1 
ATOM   602  N  N   . ALA A 1 85  ? 11.850  36.105 2.935   1.00 21.09 ? 85   ALA A N   1 
ATOM   603  C  CA  . ALA A 1 85  ? 11.820  36.915 4.146   1.00 21.49 ? 85   ALA A CA  1 
ATOM   604  C  C   . ALA A 1 85  ? 10.745  38.001 4.055   1.00 22.16 ? 85   ALA A C   1 
ATOM   605  O  O   . ALA A 1 85  ? 10.202  38.424 5.077   1.00 21.34 ? 85   ALA A O   1 
ATOM   606  C  CB  . ALA A 1 85  ? 13.188  37.547 4.394   1.00 20.86 ? 85   ALA A CB  1 
ATOM   607  N  N   . GLU A 1 86  ? 10.428  38.436 2.836   1.00 24.06 ? 86   GLU A N   1 
ATOM   608  C  CA  . GLU A 1 86  ? 9.421   39.479 2.635   1.00 27.03 ? 86   GLU A CA  1 
ATOM   609  C  C   . GLU A 1 86  ? 8.003   38.944 2.807   1.00 28.11 ? 86   GLU A C   1 
ATOM   610  O  O   . GLU A 1 86  ? 7.178   39.575 3.477   1.00 27.22 ? 86   GLU A O   1 
ATOM   611  C  CB  . GLU A 1 86  ? 9.581   40.119 1.250   1.00 29.42 ? 86   GLU A CB  1 
ATOM   612  C  CG  . GLU A 1 86  ? 8.688   41.344 0.998   1.00 36.27 ? 86   GLU A CG  1 
ATOM   613  C  CD  . GLU A 1 86  ? 8.788   42.421 2.093   1.00 39.23 ? 86   GLU A CD  1 
ATOM   614  O  OE1 . GLU A 1 86  ? 9.902   42.640 2.626   1.00 40.12 ? 86   GLU A OE1 1 
ATOM   615  O  OE2 . GLU A 1 86  ? 7.753   43.062 2.410   1.00 39.83 ? 86   GLU A OE2 1 
ATOM   616  N  N   . VAL A 1 87  ? 7.714   37.787 2.209   1.00 28.28 ? 87   VAL A N   1 
ATOM   617  C  CA  . VAL A 1 87  ? 6.387   37.197 2.342   1.00 27.52 ? 87   VAL A CA  1 
ATOM   618  C  C   . VAL A 1 87  ? 6.165   36.860 3.814   1.00 28.03 ? 87   VAL A C   1 
ATOM   619  O  O   . VAL A 1 87  ? 5.074   37.065 4.349   1.00 29.18 ? 87   VAL A O   1 
ATOM   620  C  CB  . VAL A 1 87  ? 6.232   35.905 1.503   1.00 27.41 ? 87   VAL A CB  1 
ATOM   621  C  CG1 . VAL A 1 87  ? 6.725   36.139 0.095   1.00 25.29 ? 87   VAL A CG1 1 
ATOM   622  C  CG2 . VAL A 1 87  ? 6.979   34.762 2.152   1.00 28.31 ? 87   VAL A CG2 1 
ATOM   623  N  N   . LYS A 1 88  ? 7.205   36.348 4.468   1.00 27.96 ? 88   LYS A N   1 
ATOM   624  C  CA  . LYS A 1 88  ? 7.118   36.000 5.881   1.00 29.43 ? 88   LYS A CA  1 
ATOM   625  C  C   . LYS A 1 88  ? 6.991   37.270 6.712   1.00 30.35 ? 88   LYS A C   1 
ATOM   626  O  O   . LYS A 1 88  ? 6.572   37.225 7.863   1.00 32.85 ? 88   LYS A O   1 
ATOM   627  C  CB  . LYS A 1 88  ? 8.358   35.215 6.331   1.00 29.33 ? 88   LYS A CB  1 
ATOM   628  C  CG  . LYS A 1 88  ? 8.510   33.830 5.697   1.00 27.02 ? 88   LYS A CG  1 
ATOM   629  C  CD  . LYS A 1 88  ? 7.266   32.990 5.897   1.00 25.40 ? 88   LYS A CD  1 
ATOM   630  C  CE  . LYS A 1 88  ? 6.917   32.864 7.372   1.00 24.05 ? 88   LYS A CE  1 
ATOM   631  N  NZ  . LYS A 1 88  ? 5.589   32.225 7.547   1.00 23.30 ? 88   LYS A NZ  1 
ATOM   632  N  N   . LYS A 1 89  ? 7.356   38.402 6.119   1.00 31.46 ? 89   LYS A N   1 
ATOM   633  C  CA  . LYS A 1 89  ? 7.279   39.698 6.791   1.00 31.85 ? 89   LYS A CA  1 
ATOM   634  C  C   . LYS A 1 89  ? 5.863   40.257 6.659   1.00 31.61 ? 89   LYS A C   1 
ATOM   635  O  O   . LYS A 1 89  ? 5.351   40.936 7.554   1.00 30.95 ? 89   LYS A O   1 
ATOM   636  C  CB  . LYS A 1 89  ? 8.283   40.662 6.161   1.00 33.05 ? 89   LYS A CB  1 
ATOM   637  C  CG  . LYS A 1 89  ? 8.473   41.960 6.919   1.00 33.55 ? 89   LYS A CG  1 
ATOM   638  C  CD  . LYS A 1 89  ? 9.612   42.786 6.327   1.00 33.59 ? 89   LYS A CD  1 
ATOM   639  C  CE  . LYS A 1 89  ? 10.955  42.057 6.414   1.00 32.59 ? 89   LYS A CE  1 
ATOM   640  N  NZ  . LYS A 1 89  ? 11.049  40.892 5.495   1.00 31.41 ? 89   LYS A NZ  1 
ATOM   641  N  N   . ASN A 1 90  ? 5.236   39.965 5.527   1.00 32.33 ? 90   ASN A N   1 
ATOM   642  C  CA  . ASN A 1 90  ? 3.880   40.413 5.277   1.00 32.47 ? 90   ASN A CA  1 
ATOM   643  C  C   . ASN A 1 90  ? 2.949   39.421 5.952   1.00 32.43 ? 90   ASN A C   1 
ATOM   644  O  O   . ASN A 1 90  ? 1.786   39.295 5.587   1.00 31.64 ? 90   ASN A O   1 
ATOM   645  C  CB  . ASN A 1 90  ? 3.597   40.468 3.773   1.00 33.50 ? 90   ASN A CB  1 
ATOM   646  C  CG  . ASN A 1 90  ? 4.499   41.453 3.040   1.00 34.46 ? 90   ASN A CG  1 
ATOM   647  O  OD1 . ASN A 1 90  ? 4.830   42.525 3.558   1.00 35.65 ? 90   ASN A OD1 1 
ATOM   648  N  ND2 . ASN A 1 90  ? 4.888   41.099 1.824   1.00 33.75 ? 90   ASN A ND2 1 
ATOM   649  N  N   . GLY A 1 91  ? 3.489   38.714 6.940   1.00 32.65 ? 91   GLY A N   1 
ATOM   650  C  CA  . GLY A 1 91  ? 2.719   37.733 7.688   1.00 33.15 ? 91   GLY A CA  1 
ATOM   651  C  C   . GLY A 1 91  ? 2.057   36.673 6.831   1.00 33.38 ? 91   GLY A C   1 
ATOM   652  O  O   . GLY A 1 91  ? 0.829   36.614 6.755   1.00 34.68 ? 91   GLY A O   1 
ATOM   653  N  N   . ARG A 1 92  ? 2.857   35.820 6.198   1.00 32.92 ? 92   ARG A N   1 
ATOM   654  C  CA  . ARG A 1 92  ? 2.306   34.779 5.339   1.00 32.86 ? 92   ARG A CA  1 
ATOM   655  C  C   . ARG A 1 92  ? 3.141   33.510 5.303   1.00 31.62 ? 92   ARG A C   1 
ATOM   656  O  O   . ARG A 1 92  ? 4.277   33.484 5.765   1.00 31.94 ? 92   ARG A O   1 
ATOM   657  C  CB  . ARG A 1 92  ? 2.161   35.311 3.911   1.00 33.77 ? 92   ARG A CB  1 
ATOM   658  C  CG  . ARG A 1 92  ? 1.299   36.534 3.816   1.00 37.06 ? 92   ARG A CG  1 
ATOM   659  C  CD  . ARG A 1 92  ? 1.313   37.147 2.445   1.00 41.77 ? 92   ARG A CD  1 
ATOM   660  N  NE  . ARG A 1 92  ? 0.636   38.437 2.495   1.00 48.54 ? 92   ARG A NE  1 
ATOM   661  C  CZ  . ARG A 1 92  ? 0.678   39.353 1.535   1.00 51.45 ? 92   ARG A CZ  1 
ATOM   662  N  NH1 . ARG A 1 92  ? 1.368   39.122 0.427   1.00 54.00 ? 92   ARG A NH1 1 
ATOM   663  N  NH2 . ARG A 1 92  ? 0.044   40.510 1.692   1.00 53.06 ? 92   ARG A NH2 1 
ATOM   664  N  N   . ILE A 1 93  ? 2.551   32.453 4.752   1.00 30.25 ? 93   ILE A N   1 
ATOM   665  C  CA  . ILE A 1 93  ? 3.234   31.175 4.598   1.00 26.56 ? 93   ILE A CA  1 
ATOM   666  C  C   . ILE A 1 93  ? 3.956   31.321 3.264   1.00 25.11 ? 93   ILE A C   1 
ATOM   667  O  O   . ILE A 1 93  ? 3.324   31.647 2.262   1.00 24.53 ? 93   ILE A O   1 
ATOM   668  C  CB  . ILE A 1 93  ? 2.224   29.988 4.469   1.00 25.02 ? 93   ILE A CB  1 
ATOM   669  C  CG1 . ILE A 1 93  ? 1.292   29.943 5.678   1.00 23.53 ? 93   ILE A CG1 1 
ATOM   670  C  CG2 . ILE A 1 93  ? 2.964   28.678 4.322   1.00 23.39 ? 93   ILE A CG2 1 
ATOM   671  C  CD1 . ILE A 1 93  ? 1.994   29.996 7.008   1.00 23.94 ? 93   ILE A CD1 1 
ATOM   672  N  N   . SER A 1 94  ? 5.266   31.113 3.236   1.00 23.31 ? 94   SER A N   1 
ATOM   673  C  CA  . SER A 1 94  ? 5.970   31.222 1.967   1.00 24.20 ? 94   SER A CA  1 
ATOM   674  C  C   . SER A 1 94  ? 5.738   29.920 1.203   1.00 24.15 ? 94   SER A C   1 
ATOM   675  O  O   . SER A 1 94  ? 5.915   28.832 1.749   1.00 23.89 ? 94   SER A O   1 
ATOM   676  C  CB  . SER A 1 94  ? 7.473   31.476 2.185   1.00 24.91 ? 94   SER A CB  1 
ATOM   677  O  OG  . SER A 1 94  ? 8.076   30.487 3.003   1.00 24.14 ? 94   SER A OG  1 
ATOM   678  N  N   . LEU A 1 95  ? 5.314   30.031 -0.054  1.00 24.51 ? 95   LEU A N   1 
ATOM   679  C  CA  . LEU A 1 95  ? 5.048   28.849 -0.873  1.00 22.92 ? 95   LEU A CA  1 
ATOM   680  C  C   . LEU A 1 95  ? 5.913   28.918 -2.125  1.00 21.83 ? 95   LEU A C   1 
ATOM   681  O  O   . LEU A 1 95  ? 5.570   29.613 -3.081  1.00 22.22 ? 95   LEU A O   1 
ATOM   682  C  CB  . LEU A 1 95  ? 3.564   28.805 -1.270  1.00 24.20 ? 95   LEU A CB  1 
ATOM   683  C  CG  . LEU A 1 95  ? 2.923   27.492 -1.750  1.00 25.03 ? 95   LEU A CG  1 
ATOM   684  C  CD1 . LEU A 1 95  ? 1.505   27.786 -2.221  1.00 23.66 ? 95   LEU A CD1 1 
ATOM   685  C  CD2 . LEU A 1 95  ? 3.725   26.861 -2.869  1.00 24.31 ? 95   LEU A CD2 1 
ATOM   686  N  N   . VAL A 1 96  ? 7.033   28.200 -2.115  1.00 18.59 ? 96   VAL A N   1 
ATOM   687  C  CA  . VAL A 1 96  ? 7.931   28.197 -3.259  1.00 17.26 ? 96   VAL A CA  1 
ATOM   688  C  C   . VAL A 1 96  ? 7.695   27.011 -4.193  1.00 16.74 ? 96   VAL A C   1 
ATOM   689  O  O   . VAL A 1 96  ? 7.803   25.849 -3.791  1.00 13.90 ? 96   VAL A O   1 
ATOM   690  C  CB  . VAL A 1 96  ? 9.421   28.185 -2.818  1.00 16.56 ? 96   VAL A CB  1 
ATOM   691  C  CG1 . VAL A 1 96  ? 10.337  28.262 -4.046  1.00 15.36 ? 96   VAL A CG1 1 
ATOM   692  C  CG2 . VAL A 1 96  ? 9.696   29.345 -1.873  1.00 17.11 ? 96   VAL A CG2 1 
ATOM   693  N  N   . LEU A 1 97  ? 7.349   27.326 -5.439  1.00 17.49 ? 97   LEU A N   1 
ATOM   694  C  CA  . LEU A 1 97  ? 7.130   26.325 -6.474  1.00 18.86 ? 97   LEU A CA  1 
ATOM   695  C  C   . LEU A 1 97  ? 8.450   26.386 -7.223  1.00 21.61 ? 97   LEU A C   1 
ATOM   696  O  O   . LEU A 1 97  ? 8.610   27.138 -8.192  1.00 22.26 ? 97   LEU A O   1 
ATOM   697  C  CB  . LEU A 1 97  ? 5.989   26.747 -7.398  1.00 19.69 ? 97   LEU A CB  1 
ATOM   698  C  CG  . LEU A 1 97  ? 4.683   27.166 -6.723  1.00 20.11 ? 97   LEU A CG  1 
ATOM   699  C  CD1 . LEU A 1 97  ? 3.748   27.730 -7.779  1.00 18.75 ? 97   LEU A CD1 1 
ATOM   700  C  CD2 . LEU A 1 97  ? 4.053   25.971 -5.990  1.00 18.77 ? 97   LEU A CD2 1 
ATOM   701  N  N   . GLY A 1 98  ? 9.413   25.602 -6.771  1.00 22.51 ? 98   GLY A N   1 
ATOM   702  C  CA  . GLY A 1 98  ? 10.709  25.672 -7.406  1.00 24.47 ? 98   GLY A CA  1 
ATOM   703  C  C   . GLY A 1 98  ? 11.029  24.724 -8.529  1.00 24.42 ? 98   GLY A C   1 
ATOM   704  O  O   . GLY A 1 98  ? 10.163  24.082 -9.132  1.00 24.34 ? 98   GLY A O   1 
ATOM   705  N  N   . GLY A 1 99  ? 12.319  24.699 -8.829  1.00 24.80 ? 99   GLY A N   1 
ATOM   706  C  CA  . GLY A 1 99  ? 12.841  23.825 -9.845  1.00 24.45 ? 99   GLY A CA  1 
ATOM   707  C  C   . GLY A 1 99  ? 13.541  22.753 -9.040  1.00 24.15 ? 99   GLY A C   1 
ATOM   708  O  O   . GLY A 1 99  ? 12.884  21.875 -8.474  1.00 24.56 ? 99   GLY A O   1 
ATOM   709  N  N   . ASP A 1 100 ? 14.865  22.853 -8.940  1.00 22.93 ? 100  ASP A N   1 
ATOM   710  C  CA  . ASP A 1 100 ? 15.653  21.867 -8.210  1.00 20.32 ? 100  ASP A CA  1 
ATOM   711  C  C   . ASP A 1 100 ? 15.835  22.228 -6.730  1.00 19.42 ? 100  ASP A C   1 
ATOM   712  O  O   . ASP A 1 100 ? 15.943  23.398 -6.366  1.00 17.72 ? 100  ASP A O   1 
ATOM   713  C  CB  . ASP A 1 100 ? 17.008  21.668 -8.915  1.00 21.72 ? 100  ASP A CB  1 
ATOM   714  C  CG  . ASP A 1 100 ? 17.890  22.899 -8.863  1.00 20.23 ? 100  ASP A CG  1 
ATOM   715  O  OD1 . ASP A 1 100 ? 18.575  23.083 -7.841  1.00 21.97 ? 100  ASP A OD1 1 
ATOM   716  O  OD2 . ASP A 1 100 ? 17.897  23.680 -9.836  1.00 19.38 ? 100  ASP A OD2 1 
ATOM   717  N  N   . HIS A 1 101 ? 15.870  21.203 -5.885  1.00 18.66 ? 101  HIS A N   1 
ATOM   718  C  CA  . HIS A 1 101 ? 15.991  21.381 -4.444  1.00 17.98 ? 101  HIS A CA  1 
ATOM   719  C  C   . HIS A 1 101 ? 17.166  22.213 -3.938  1.00 16.86 ? 101  HIS A C   1 
ATOM   720  O  O   . HIS A 1 101 ? 17.261  22.451 -2.740  1.00 14.66 ? 101  HIS A O   1 
ATOM   721  C  CB  . HIS A 1 101 ? 15.987  20.011 -3.745  1.00 16.87 ? 101  HIS A CB  1 
ATOM   722  C  CG  . HIS A 1 101 ? 15.054  19.934 -2.571  1.00 15.08 ? 101  HIS A CG  1 
ATOM   723  N  ND1 . HIS A 1 101 ? 14.661  18.739 -2.008  1.00 13.96 ? 101  HIS A ND1 1 
ATOM   724  C  CD2 . HIS A 1 101 ? 14.437  20.906 -1.853  1.00 14.82 ? 101  HIS A CD2 1 
ATOM   725  C  CE1 . HIS A 1 101 ? 13.841  18.975 -0.997  1.00 14.04 ? 101  HIS A CE1 1 
ATOM   726  N  NE2 . HIS A 1 101 ? 13.688  20.282 -0.881  1.00 12.93 ? 101  HIS A NE2 1 
ATOM   727  N  N   . SER A 1 102 ? 18.058  22.660 -4.820  1.00 17.39 ? 102  SER A N   1 
ATOM   728  C  CA  . SER A 1 102 ? 19.182  23.480 -4.355  1.00 17.41 ? 102  SER A CA  1 
ATOM   729  C  C   . SER A 1 102 ? 18.605  24.796 -3.830  1.00 16.79 ? 102  SER A C   1 
ATOM   730  O  O   . SER A 1 102 ? 19.208  25.468 -3.001  1.00 14.84 ? 102  SER A O   1 
ATOM   731  C  CB  . SER A 1 102 ? 20.166  23.768 -5.489  1.00 17.32 ? 102  SER A CB  1 
ATOM   732  O  OG  . SER A 1 102 ? 19.612  24.678 -6.421  1.00 16.68 ? 102  SER A OG  1 
ATOM   733  N  N   . LEU A 1 103 ? 17.420  25.150 -4.320  1.00 16.42 ? 103  LEU A N   1 
ATOM   734  C  CA  . LEU A 1 103 ? 16.746  26.373 -3.896  1.00 16.63 ? 103  LEU A CA  1 
ATOM   735  C  C   . LEU A 1 103 ? 16.384  26.356 -2.410  1.00 16.16 ? 103  LEU A C   1 
ATOM   736  O  O   . LEU A 1 103 ? 16.145  27.410 -1.824  1.00 15.34 ? 103  LEU A O   1 
ATOM   737  C  CB  . LEU A 1 103 ? 15.468  26.592 -4.716  1.00 16.80 ? 103  LEU A CB  1 
ATOM   738  C  CG  . LEU A 1 103 ? 15.613  27.003 -6.181  1.00 18.24 ? 103  LEU A CG  1 
ATOM   739  C  CD1 . LEU A 1 103 ? 14.242  26.958 -6.873  1.00 18.69 ? 103  LEU A CD1 1 
ATOM   740  C  CD2 . LEU A 1 103 ? 16.205  28.398 -6.252  1.00 16.41 ? 103  LEU A CD2 1 
ATOM   741  N  N   . ALA A 1 104 ? 16.325  25.171 -1.804  1.00 16.07 ? 104  ALA A N   1 
ATOM   742  C  CA  . ALA A 1 104 ? 15.982  25.069 -0.383  1.00 15.95 ? 104  ALA A CA  1 
ATOM   743  C  C   . ALA A 1 104 ? 16.946  25.899 0.453   1.00 15.93 ? 104  ALA A C   1 
ATOM   744  O  O   . ALA A 1 104 ? 16.593  26.388 1.527   1.00 14.79 ? 104  ALA A O   1 
ATOM   745  C  CB  . ALA A 1 104 ? 16.015  23.611 0.079   1.00 15.76 ? 104  ALA A CB  1 
ATOM   746  N  N   . ILE A 1 105 ? 18.174  26.048 -0.035  1.00 16.41 ? 105  ILE A N   1 
ATOM   747  C  CA  . ILE A 1 105 ? 19.160  26.845 0.678   1.00 15.24 ? 105  ILE A CA  1 
ATOM   748  C  C   . ILE A 1 105 ? 18.569  28.238 0.903   1.00 15.71 ? 105  ILE A C   1 
ATOM   749  O  O   . ILE A 1 105 ? 18.536  28.734 2.030   1.00 16.09 ? 105  ILE A O   1 
ATOM   750  C  CB  . ILE A 1 105 ? 20.484  26.964 -0.120  1.00 15.28 ? 105  ILE A CB  1 
ATOM   751  C  CG1 . ILE A 1 105 ? 21.038  25.572 -0.416  1.00 15.98 ? 105  ILE A CG1 1 
ATOM   752  C  CG2 . ILE A 1 105 ? 21.514  27.753 0.687   1.00 15.20 ? 105  ILE A CG2 1 
ATOM   753  C  CD1 . ILE A 1 105 ? 22.401  25.570 -1.094  1.00 17.30 ? 105  ILE A CD1 1 
ATOM   754  N  N   . GLY A 1 106 ? 18.081  28.856 -0.169  1.00 15.22 ? 106  GLY A N   1 
ATOM   755  C  CA  . GLY A 1 106 ? 17.504  30.183 -0.050  1.00 14.79 ? 106  GLY A CA  1 
ATOM   756  C  C   . GLY A 1 106 ? 16.167  30.212 0.665   1.00 14.06 ? 106  GLY A C   1 
ATOM   757  O  O   . GLY A 1 106 ? 15.902  31.088 1.491   1.00 14.12 ? 106  GLY A O   1 
ATOM   758  N  N   . SER A 1 107 ? 15.316  29.246 0.349   1.00 15.29 ? 107  SER A N   1 
ATOM   759  C  CA  . SER A 1 107 ? 13.995  29.173 0.957   1.00 15.87 ? 107  SER A CA  1 
ATOM   760  C  C   . SER A 1 107 ? 14.067  29.120 2.490   1.00 17.11 ? 107  SER A C   1 
ATOM   761  O  O   . SER A 1 107 ? 13.392  29.890 3.181   1.00 15.61 ? 107  SER A O   1 
ATOM   762  C  CB  . SER A 1 107 ? 13.251  27.945 0.432   1.00 14.88 ? 107  SER A CB  1 
ATOM   763  O  OG  . SER A 1 107 ? 11.909  27.935 0.884   1.00 17.46 ? 107  SER A OG  1 
ATOM   764  N  N   . ILE A 1 108 ? 14.893  28.213 3.008   1.00 17.02 ? 108  ILE A N   1 
ATOM   765  C  CA  . ILE A 1 108 ? 15.049  28.038 4.443   1.00 16.50 ? 108  ILE A CA  1 
ATOM   766  C  C   . ILE A 1 108 ? 15.836  29.161 5.099   1.00 17.28 ? 108  ILE A C   1 
ATOM   767  O  O   . ILE A 1 108 ? 15.611  29.473 6.264   1.00 18.07 ? 108  ILE A O   1 
ATOM   768  C  CB  . ILE A 1 108 ? 15.726  26.679 4.766   1.00 17.18 ? 108  ILE A CB  1 
ATOM   769  C  CG1 . ILE A 1 108 ? 14.809  25.529 4.329   1.00 16.10 ? 108  ILE A CG1 1 
ATOM   770  C  CG2 . ILE A 1 108 ? 16.010  26.570 6.264   1.00 15.99 ? 108  ILE A CG2 1 
ATOM   771  C  CD1 . ILE A 1 108 ? 15.373  24.148 4.599   1.00 14.70 ? 108  ILE A CD1 1 
ATOM   772  N  N   . SER A 1 109 ? 16.759  29.763 4.359   1.00 17.55 ? 109  SER A N   1 
ATOM   773  C  CA  . SER A 1 109 ? 17.557  30.865 4.896   1.00 19.98 ? 109  SER A CA  1 
ATOM   774  C  C   . SER A 1 109 ? 16.694  32.119 5.072   1.00 20.16 ? 109  SER A C   1 
ATOM   775  O  O   . SER A 1 109 ? 16.642  32.716 6.154   1.00 20.52 ? 109  SER A O   1 
ATOM   776  C  CB  . SER A 1 109 ? 18.732  31.182 3.959   1.00 21.48 ? 109  SER A CB  1 
ATOM   777  O  OG  . SER A 1 109 ? 19.692  30.138 3.953   1.00 19.89 ? 109  SER A OG  1 
ATOM   778  N  N   . GLY A 1 110 ? 16.022  32.516 3.999   1.00 19.09 ? 110  GLY A N   1 
ATOM   779  C  CA  . GLY A 1 110 ? 15.167  33.683 4.064   1.00 19.24 ? 110  GLY A CA  1 
ATOM   780  C  C   . GLY A 1 110 ? 14.050  33.478 5.068   1.00 19.84 ? 110  GLY A C   1 
ATOM   781  O  O   . GLY A 1 110 ? 13.539  34.439 5.652   1.00 19.93 ? 110  GLY A O   1 
ATOM   782  N  N   . HIS A 1 111 ? 13.666  32.218 5.263   1.00 20.53 ? 111  HIS A N   1 
ATOM   783  C  CA  . HIS A 1 111 ? 12.612  31.876 6.208   1.00 18.96 ? 111  HIS A CA  1 
ATOM   784  C  C   . HIS A 1 111 ? 13.137  32.070 7.623   1.00 18.37 ? 111  HIS A C   1 
ATOM   785  O  O   . HIS A 1 111 ? 12.519  32.758 8.431   1.00 18.42 ? 111  HIS A O   1 
ATOM   786  C  CB  . HIS A 1 111 ? 12.173  30.424 6.017   1.00 20.14 ? 111  HIS A CB  1 
ATOM   787  C  CG  . HIS A 1 111 ? 10.944  30.059 6.790   1.00 22.84 ? 111  HIS A CG  1 
ATOM   788  N  ND1 . HIS A 1 111 ? 10.395  28.795 6.761   1.00 22.26 ? 111  HIS A ND1 1 
ATOM   789  C  CD2 . HIS A 1 111 ? 10.152  30.794 7.608   1.00 23.14 ? 111  HIS A CD2 1 
ATOM   790  C  CE1 . HIS A 1 111 ? 9.318   28.768 7.527   1.00 23.22 ? 111  HIS A CE1 1 
ATOM   791  N  NE2 . HIS A 1 111 ? 9.149   29.968 8.052   1.00 22.45 ? 111  HIS A NE2 1 
ATOM   792  N  N   . ALA A 1 112 ? 14.291  31.471 7.905   1.00 18.03 ? 112  ALA A N   1 
ATOM   793  C  CA  . ALA A 1 112 ? 14.919  31.566 9.220   1.00 19.31 ? 112  ALA A CA  1 
ATOM   794  C  C   . ALA A 1 112 ? 15.337  32.992 9.632   1.00 20.59 ? 112  ALA A C   1 
ATOM   795  O  O   . ALA A 1 112 ? 15.537  33.253 10.824  1.00 19.14 ? 112  ALA A O   1 
ATOM   796  C  CB  . ALA A 1 112 ? 16.119  30.627 9.291   1.00 17.04 ? 112  ALA A CB  1 
ATOM   797  N  N   . ARG A 1 113 ? 15.483  33.904 8.667   1.00 20.58 ? 113  ARG A N   1 
ATOM   798  C  CA  . ARG A 1 113 ? 15.844  35.289 8.994   1.00 23.01 ? 113  ARG A CA  1 
ATOM   799  C  C   . ARG A 1 113 ? 14.657  35.955 9.689   1.00 23.64 ? 113  ARG A C   1 
ATOM   800  O  O   . ARG A 1 113 ? 14.812  36.957 10.393  1.00 25.17 ? 113  ARG A O   1 
ATOM   801  C  CB  . ARG A 1 113 ? 16.173  36.105 7.742   1.00 21.41 ? 113  ARG A CB  1 
ATOM   802  C  CG  . ARG A 1 113 ? 17.413  35.692 6.998   1.00 23.55 ? 113  ARG A CG  1 
ATOM   803  C  CD  . ARG A 1 113 ? 17.602  36.629 5.826   1.00 24.47 ? 113  ARG A CD  1 
ATOM   804  N  NE  . ARG A 1 113 ? 18.596  36.158 4.868   1.00 25.63 ? 113  ARG A NE  1 
ATOM   805  C  CZ  . ARG A 1 113 ? 18.791  36.719 3.680   1.00 25.93 ? 113  ARG A CZ  1 
ATOM   806  N  NH1 . ARG A 1 113 ? 18.060  37.764 3.319   1.00 27.23 ? 113  ARG A NH1 1 
ATOM   807  N  NH2 . ARG A 1 113 ? 19.705  36.238 2.850   1.00 28.60 ? 113  ARG A NH2 1 
ATOM   808  N  N   . VAL A 1 114 ? 13.471  35.397 9.468   1.00 24.06 ? 114  VAL A N   1 
ATOM   809  C  CA  . VAL A 1 114 ? 12.247  35.917 10.060  1.00 24.34 ? 114  VAL A CA  1 
ATOM   810  C  C   . VAL A 1 114 ? 11.860  35.080 11.282  1.00 24.22 ? 114  VAL A C   1 
ATOM   811  O  O   . VAL A 1 114 ? 11.418  35.617 12.292  1.00 25.70 ? 114  VAL A O   1 
ATOM   812  C  CB  . VAL A 1 114 ? 11.093  35.906 9.026   1.00 23.87 ? 114  VAL A CB  1 
ATOM   813  C  CG1 . VAL A 1 114 ? 9.835   36.497 9.635   1.00 26.33 ? 114  VAL A CG1 1 
ATOM   814  C  CG2 . VAL A 1 114 ? 11.497  36.693 7.793   1.00 22.67 ? 114  VAL A CG2 1 
ATOM   815  N  N   . HIS A 1 115 ? 12.032  33.764 11.188  1.00 24.44 ? 115  HIS A N   1 
ATOM   816  C  CA  . HIS A 1 115 ? 11.716  32.864 12.296  1.00 24.12 ? 115  HIS A CA  1 
ATOM   817  C  C   . HIS A 1 115 ? 12.859  31.875 12.421  1.00 24.24 ? 115  HIS A C   1 
ATOM   818  O  O   . HIS A 1 115 ? 12.768  30.754 11.927  1.00 24.51 ? 115  HIS A O   1 
ATOM   819  C  CB  . HIS A 1 115 ? 10.421  32.081 12.037  1.00 25.27 ? 115  HIS A CB  1 
ATOM   820  C  CG  . HIS A 1 115 ? 9.206   32.939 11.852  1.00 24.47 ? 115  HIS A CG  1 
ATOM   821  N  ND1 . HIS A 1 115 ? 8.842   33.462 10.629  1.00 25.36 ? 115  HIS A ND1 1 
ATOM   822  C  CD2 . HIS A 1 115 ? 8.262   33.346 12.731  1.00 23.80 ? 115  HIS A CD2 1 
ATOM   823  C  CE1 . HIS A 1 115 ? 7.725   34.153 10.762  1.00 23.57 ? 115  HIS A CE1 1 
ATOM   824  N  NE2 . HIS A 1 115 ? 7.351   34.097 12.027  1.00 26.05 ? 115  HIS A NE2 1 
ATOM   825  N  N   . PRO A 1 116 ? 13.948  32.270 13.094  1.00 24.65 ? 116  PRO A N   1 
ATOM   826  C  CA  . PRO A 1 116 ? 15.120  31.411 13.277  1.00 24.73 ? 116  PRO A CA  1 
ATOM   827  C  C   . PRO A 1 116 ? 14.874  30.177 14.126  1.00 25.64 ? 116  PRO A C   1 
ATOM   828  O  O   . PRO A 1 116 ? 15.743  29.306 14.232  1.00 26.48 ? 116  PRO A O   1 
ATOM   829  C  CB  . PRO A 1 116 ? 16.132  32.354 13.914  1.00 25.77 ? 116  PRO A CB  1 
ATOM   830  C  CG  . PRO A 1 116 ? 15.274  33.223 14.754  1.00 25.04 ? 116  PRO A CG  1 
ATOM   831  C  CD  . PRO A 1 116 ? 14.129  33.545 13.811  1.00 25.10 ? 116  PRO A CD  1 
ATOM   832  N  N   . ASP A 1 117 ? 13.691  30.107 14.725  1.00 26.58 ? 117  ASP A N   1 
ATOM   833  C  CA  . ASP A 1 117 ? 13.330  28.983 15.581  1.00 26.92 ? 117  ASP A CA  1 
ATOM   834  C  C   . ASP A 1 117 ? 12.636  27.852 14.826  1.00 26.78 ? 117  ASP A C   1 
ATOM   835  O  O   . ASP A 1 117 ? 12.326  26.812 15.409  1.00 27.80 ? 117  ASP A O   1 
ATOM   836  C  CB  . ASP A 1 117 ? 12.437  29.466 16.729  1.00 27.41 ? 117  ASP A CB  1 
ATOM   837  C  CG  . ASP A 1 117 ? 11.113  30.024 16.248  1.00 29.20 ? 117  ASP A CG  1 
ATOM   838  O  OD1 . ASP A 1 117 ? 11.107  30.851 15.311  1.00 30.51 ? 117  ASP A OD1 1 
ATOM   839  O  OD2 . ASP A 1 117 ? 10.071  29.640 16.818  1.00 32.09 ? 117  ASP A OD2 1 
ATOM   840  N  N   . LEU A 1 118 ? 12.414  28.045 13.529  1.00 24.38 ? 118  LEU A N   1 
ATOM   841  C  CA  . LEU A 1 118 ? 11.746  27.037 12.716  1.00 22.71 ? 118  LEU A CA  1 
ATOM   842  C  C   . LEU A 1 118 ? 12.357  25.639 12.797  1.00 22.12 ? 118  LEU A C   1 
ATOM   843  O  O   . LEU A 1 118 ? 13.554  25.475 13.035  1.00 22.62 ? 118  LEU A O   1 
ATOM   844  C  CB  . LEU A 1 118 ? 11.697  27.484 11.245  1.00 23.53 ? 118  LEU A CB  1 
ATOM   845  C  CG  . LEU A 1 118 ? 12.969  27.563 10.392  1.00 25.90 ? 118  LEU A CG  1 
ATOM   846  C  CD1 . LEU A 1 118 ? 13.466  26.169 10.045  1.00 27.47 ? 118  LEU A CD1 1 
ATOM   847  C  CD2 . LEU A 1 118 ? 12.667  28.321 9.114   1.00 26.56 ? 118  LEU A CD2 1 
ATOM   848  N  N   . GLY A 1 119 ? 11.503  24.638 12.606  1.00 20.20 ? 119  GLY A N   1 
ATOM   849  C  CA  . GLY A 1 119 ? 11.931  23.248 12.604  1.00 18.28 ? 119  GLY A CA  1 
ATOM   850  C  C   . GLY A 1 119 ? 11.645  22.758 11.196  1.00 15.37 ? 119  GLY A C   1 
ATOM   851  O  O   . GLY A 1 119 ? 10.681  23.218 10.592  1.00 14.47 ? 119  GLY A O   1 
ATOM   852  N  N   . VAL A 1 120 ? 12.451  21.840 10.664  1.00 14.73 ? 120  VAL A N   1 
ATOM   853  C  CA  . VAL A 1 120 ? 12.243  21.368 9.288   1.00 14.17 ? 120  VAL A CA  1 
ATOM   854  C  C   . VAL A 1 120 ? 11.849  19.897 9.092   1.00 13.26 ? 120  VAL A C   1 
ATOM   855  O  O   . VAL A 1 120 ? 12.400  19.008 9.736   1.00 12.53 ? 120  VAL A O   1 
ATOM   856  C  CB  . VAL A 1 120 ? 13.511  21.613 8.420   1.00 13.73 ? 120  VAL A CB  1 
ATOM   857  C  CG1 . VAL A 1 120 ? 13.207  21.299 6.960   1.00 13.92 ? 120  VAL A CG1 1 
ATOM   858  C  CG2 . VAL A 1 120 ? 13.999  23.051 8.578   1.00 14.31 ? 120  VAL A CG2 1 
ATOM   859  N  N   . ILE A 1 121 ? 10.893  19.664 8.192   1.00 11.35 ? 121  ILE A N   1 
ATOM   860  C  CA  . ILE A 1 121 ? 10.451  18.321 7.836   1.00 11.24 ? 121  ILE A CA  1 
ATOM   861  C  C   . ILE A 1 121 ? 10.827  18.223 6.375   1.00 9.70  ? 121  ILE A C   1 
ATOM   862  O  O   . ILE A 1 121 ? 10.318  18.973 5.549   1.00 8.46  ? 121  ILE A O   1 
ATOM   863  C  CB  . ILE A 1 121 ? 8.916   18.123 7.945   1.00 11.69 ? 121  ILE A CB  1 
ATOM   864  C  CG1 . ILE A 1 121 ? 8.472   18.220 9.403   1.00 12.57 ? 121  ILE A CG1 1 
ATOM   865  C  CG2 . ILE A 1 121 ? 8.531   16.750 7.386   1.00 12.49 ? 121  ILE A CG2 1 
ATOM   866  C  CD1 . ILE A 1 121 ? 8.745   19.558 10.026  1.00 16.52 ? 121  ILE A CD1 1 
ATOM   867  N  N   . TRP A 1 122 ? 11.716  17.293 6.065   1.00 11.32 ? 122  TRP A N   1 
ATOM   868  C  CA  . TRP A 1 122 ? 12.216  17.115 4.711   1.00 11.18 ? 122  TRP A CA  1 
ATOM   869  C  C   . TRP A 1 122 ? 11.722  15.804 4.101   1.00 11.16 ? 122  TRP A C   1 
ATOM   870  O  O   . TRP A 1 122 ? 12.249  14.731 4.395   1.00 11.86 ? 122  TRP A O   1 
ATOM   871  C  CB  . TRP A 1 122 ? 13.752  17.157 4.767   1.00 13.52 ? 122  TRP A CB  1 
ATOM   872  C  CG  . TRP A 1 122 ? 14.482  17.315 3.453   1.00 14.57 ? 122  TRP A CG  1 
ATOM   873  C  CD1 . TRP A 1 122 ? 14.780  16.332 2.560   1.00 15.00 ? 122  TRP A CD1 1 
ATOM   874  C  CD2 . TRP A 1 122 ? 15.066  18.522 2.931   1.00 15.03 ? 122  TRP A CD2 1 
ATOM   875  N  NE1 . TRP A 1 122 ? 15.520  16.842 1.520   1.00 16.65 ? 122  TRP A NE1 1 
ATOM   876  C  CE2 . TRP A 1 122 ? 15.708  18.186 1.721   1.00 16.25 ? 122  TRP A CE2 1 
ATOM   877  C  CE3 . TRP A 1 122 ? 15.105  19.857 3.368   1.00 17.07 ? 122  TRP A CE3 1 
ATOM   878  C  CZ2 . TRP A 1 122 ? 16.389  19.136 0.937   1.00 16.36 ? 122  TRP A CZ2 1 
ATOM   879  C  CZ3 . TRP A 1 122 ? 15.786  20.806 2.580   1.00 15.60 ? 122  TRP A CZ3 1 
ATOM   880  C  CH2 . TRP A 1 122 ? 16.413  20.432 1.381   1.00 14.53 ? 122  TRP A CH2 1 
ATOM   881  N  N   . VAL A 1 123 ? 10.701  15.898 3.253   1.00 11.25 ? 123  VAL A N   1 
ATOM   882  C  CA  . VAL A 1 123 ? 10.132  14.725 2.596   1.00 10.85 ? 123  VAL A CA  1 
ATOM   883  C  C   . VAL A 1 123 ? 10.912  14.509 1.302   1.00 12.89 ? 123  VAL A C   1 
ATOM   884  O  O   . VAL A 1 123 ? 10.839  15.306 0.352   1.00 12.02 ? 123  VAL A O   1 
ATOM   885  C  CB  . VAL A 1 123 ? 8.628   14.930 2.328   1.00 8.76  ? 123  VAL A CB  1 
ATOM   886  C  CG1 . VAL A 1 123 ? 8.039   13.708 1.631   1.00 8.97  ? 123  VAL A CG1 1 
ATOM   887  C  CG2 . VAL A 1 123 ? 7.920   15.167 3.656   1.00 4.90  ? 123  VAL A CG2 1 
ATOM   888  N  N   . ASP A 1 124 ? 11.658  13.410 1.263   1.00 13.19 ? 124  ASP A N   1 
ATOM   889  C  CA  . ASP A 1 124 ? 12.511  13.176 0.116   1.00 12.96 ? 124  ASP A CA  1 
ATOM   890  C  C   . ASP A 1 124 ? 12.960  11.726 0.059   1.00 14.48 ? 124  ASP A C   1 
ATOM   891  O  O   . ASP A 1 124 ? 12.949  11.022 1.070   1.00 14.79 ? 124  ASP A O   1 
ATOM   892  C  CB  . ASP A 1 124 ? 13.731  14.082 0.281   1.00 13.96 ? 124  ASP A CB  1 
ATOM   893  C  CG  . ASP A 1 124 ? 14.342  14.493 -1.015  1.00 11.97 ? 124  ASP A CG  1 
ATOM   894  O  OD1 . ASP A 1 124 ? 14.638  13.611 -1.836  1.00 13.62 ? 124  ASP A OD1 1 
ATOM   895  O  OD2 . ASP A 1 124 ? 14.544  15.706 -1.205  1.00 14.39 ? 124  ASP A OD2 1 
ATOM   896  N  N   . ALA A 1 125 ? 13.357  11.279 -1.127  1.00 13.85 ? 125  ALA A N   1 
ATOM   897  C  CA  . ALA A 1 125 ? 13.860  9.926  -1.277  1.00 12.16 ? 125  ALA A CA  1 
ATOM   898  C  C   . ALA A 1 125 ? 15.332  10.032 -0.897  1.00 11.22 ? 125  ALA A C   1 
ATOM   899  O  O   . ALA A 1 125 ? 15.982  9.045  -0.542  1.00 11.26 ? 125  ALA A O   1 
ATOM   900  C  CB  . ALA A 1 125 ? 13.711  9.463  -2.730  1.00 11.89 ? 125  ALA A CB  1 
ATOM   901  N  N   . HIS A 1 126 ? 15.828  11.266 -0.936  1.00 11.51 ? 126  HIS A N   1 
ATOM   902  C  CA  . HIS A 1 126 ? 17.221  11.579 -0.652  1.00 10.40 ? 126  HIS A CA  1 
ATOM   903  C  C   . HIS A 1 126 ? 17.422  12.538 0.525   1.00 11.16 ? 126  HIS A C   1 
ATOM   904  O  O   . HIS A 1 126 ? 16.531  13.309 0.868   1.00 12.20 ? 126  HIS A O   1 
ATOM   905  C  CB  . HIS A 1 126 ? 17.838  12.172 -1.919  1.00 10.28 ? 126  HIS A CB  1 
ATOM   906  C  CG  . HIS A 1 126 ? 17.462  11.429 -3.164  1.00 8.78  ? 126  HIS A CG  1 
ATOM   907  N  ND1 . HIS A 1 126 ? 16.564  11.923 -4.083  1.00 5.66  ? 126  HIS A ND1 1 
ATOM   908  C  CD2 . HIS A 1 126 ? 17.814  10.198 -3.607  1.00 9.60  ? 126  HIS A CD2 1 
ATOM   909  C  CE1 . HIS A 1 126 ? 16.379  11.029 -5.039  1.00 9.33  ? 126  HIS A CE1 1 
ATOM   910  N  NE2 . HIS A 1 126 ? 17.124  9.973  -4.772  1.00 7.05  ? 126  HIS A NE2 1 
ATOM   911  N  N   . THR A 1 127 ? 18.603  12.486 1.135   1.00 10.33 ? 127  THR A N   1 
ATOM   912  C  CA  . THR A 1 127 ? 18.929  13.359 2.260   1.00 12.26 ? 127  THR A CA  1 
ATOM   913  C  C   . THR A 1 127 ? 19.399  14.738 1.804   1.00 12.02 ? 127  THR A C   1 
ATOM   914  O  O   . THR A 1 127 ? 19.243  15.716 2.536   1.00 10.58 ? 127  THR A O   1 
ATOM   915  C  CB  . THR A 1 127 ? 20.028  12.751 3.167   1.00 11.02 ? 127  THR A CB  1 
ATOM   916  O  OG1 . THR A 1 127 ? 21.031  12.115 2.362   1.00 13.72 ? 127  THR A OG1 1 
ATOM   917  C  CG2 . THR A 1 127 ? 19.428  11.738 4.117   1.00 11.97 ? 127  THR A CG2 1 
ATOM   918  N  N   . ASP A 1 128 ? 19.965  14.804 0.597   1.00 11.25 ? 128  ASP A N   1 
ATOM   919  C  CA  . ASP A 1 128 ? 20.468  16.053 0.039   1.00 11.51 ? 128  ASP A CA  1 
ATOM   920  C  C   . ASP A 1 128 ? 21.386  16.751 1.040   1.00 11.73 ? 128  ASP A C   1 
ATOM   921  O  O   . ASP A 1 128 ? 21.393  17.983 1.158   1.00 9.77  ? 128  ASP A O   1 
ATOM   922  C  CB  . ASP A 1 128 ? 19.310  16.986 -0.322  1.00 12.42 ? 128  ASP A CB  1 
ATOM   923  C  CG  . ASP A 1 128 ? 18.350  16.374 -1.334  1.00 9.57  ? 128  ASP A CG  1 
ATOM   924  O  OD1 . ASP A 1 128 ? 18.735  15.455 -2.094  1.00 2.07  ? 128  ASP A OD1 1 
ATOM   925  O  OD2 . ASP A 1 128 ? 17.197  16.838 -1.370  1.00 12.37 ? 128  ASP A OD2 1 
ATOM   926  N  N   . ILE A 1 129 ? 22.176  15.948 1.742   1.00 12.76 ? 129  ILE A N   1 
ATOM   927  C  CA  . ILE A 1 129 ? 23.081  16.459 2.762   1.00 13.78 ? 129  ILE A CA  1 
ATOM   928  C  C   . ILE A 1 129 ? 24.563  16.276 2.373   1.00 15.86 ? 129  ILE A C   1 
ATOM   929  O  O   . ILE A 1 129 ? 25.453  16.180 3.227   1.00 14.12 ? 129  ILE A O   1 
ATOM   930  C  CB  . ILE A 1 129 ? 22.747  15.773 4.117   1.00 12.53 ? 129  ILE A CB  1 
ATOM   931  C  CG1 . ILE A 1 129 ? 23.000  16.736 5.286   1.00 14.30 ? 129  ILE A CG1 1 
ATOM   932  C  CG2 . ILE A 1 129 ? 23.473  14.451 4.236   1.00 11.09 ? 129  ILE A CG2 1 
ATOM   933  C  CD1 . ILE A 1 129 ? 24.414  17.172 5.481   1.00 17.23 ? 129  ILE A CD1 1 
ATOM   934  N  N   . ASN A 1 130 ? 24.824  16.227 1.069   1.00 16.76 ? 130  ASN A N   1 
ATOM   935  C  CA  . ASN A 1 130 ? 26.197  16.094 0.589   1.00 16.56 ? 130  ASN A CA  1 
ATOM   936  C  C   . ASN A 1 130 ? 26.856  17.463 0.649   1.00 16.77 ? 130  ASN A C   1 
ATOM   937  O  O   . ASN A 1 130 ? 26.177  18.484 0.564   1.00 16.97 ? 130  ASN A O   1 
ATOM   938  C  CB  . ASN A 1 130 ? 26.237  15.582 -0.862  1.00 16.22 ? 130  ASN A CB  1 
ATOM   939  C  CG  . ASN A 1 130 ? 26.514  14.094 -0.950  1.00 13.56 ? 130  ASN A CG  1 
ATOM   940  O  OD1 . ASN A 1 130 ? 27.407  13.586 -0.289  1.00 13.82 ? 130  ASN A OD1 1 
ATOM   941  N  ND2 . ASN A 1 130 ? 25.753  13.394 -1.778  1.00 14.47 ? 130  ASN A ND2 1 
ATOM   942  N  N   . THR A 1 131 ? 28.178  17.482 0.817   1.00 18.54 ? 131  THR A N   1 
ATOM   943  C  CA  . THR A 1 131 ? 28.911  18.740 0.859   1.00 17.87 ? 131  THR A CA  1 
ATOM   944  C  C   . THR A 1 131 ? 29.653  18.861 -0.458  1.00 19.67 ? 131  THR A C   1 
ATOM   945  O  O   . THR A 1 131 ? 29.581  17.970 -1.314  1.00 18.16 ? 131  THR A O   1 
ATOM   946  C  CB  . THR A 1 131 ? 29.950  18.800 2.010   1.00 16.94 ? 131  THR A CB  1 
ATOM   947  O  OG1 . THR A 1 131 ? 31.025  17.899 1.733   1.00 15.65 ? 131  THR A OG1 1 
ATOM   948  C  CG2 . THR A 1 131 ? 29.303  18.445 3.350   1.00 16.95 ? 131  THR A CG2 1 
ATOM   949  N  N   . PRO A 1 132 ? 30.364  19.979 -0.651  1.00 20.50 ? 132  PRO A N   1 
ATOM   950  C  CA  . PRO A 1 132 ? 31.108  20.162 -1.897  1.00 20.87 ? 132  PRO A CA  1 
ATOM   951  C  C   . PRO A 1 132 ? 32.215  19.125 -2.041  1.00 20.19 ? 132  PRO A C   1 
ATOM   952  O  O   . PRO A 1 132 ? 32.571  18.736 -3.152  1.00 20.35 ? 132  PRO A O   1 
ATOM   953  C  CB  . PRO A 1 132 ? 31.656  21.578 -1.755  1.00 21.41 ? 132  PRO A CB  1 
ATOM   954  C  CG  . PRO A 1 132 ? 30.584  22.265 -0.959  1.00 20.81 ? 132  PRO A CG  1 
ATOM   955  C  CD  . PRO A 1 132 ? 30.290  21.241 0.106   1.00 20.03 ? 132  PRO A CD  1 
ATOM   956  N  N   . LEU A 1 133 ? 32.732  18.671 -0.901  1.00 19.51 ? 133  LEU A N   1 
ATOM   957  C  CA  . LEU A 1 133 ? 33.822  17.707 -0.859  1.00 18.31 ? 133  LEU A CA  1 
ATOM   958  C  C   . LEU A 1 133 ? 33.412  16.238 -0.830  1.00 18.40 ? 133  LEU A C   1 
ATOM   959  O  O   . LEU A 1 133 ? 34.236  15.362 -1.068  1.00 18.51 ? 133  LEU A O   1 
ATOM   960  C  CB  . LEU A 1 133 ? 34.706  18.011 0.349   1.00 18.32 ? 133  LEU A CB  1 
ATOM   961  C  CG  . LEU A 1 133 ? 35.112  19.483 0.499   1.00 17.13 ? 133  LEU A CG  1 
ATOM   962  C  CD1 . LEU A 1 133 ? 36.053  19.623 1.684   1.00 15.92 ? 133  LEU A CD1 1 
ATOM   963  C  CD2 . LEU A 1 133 ? 35.793  19.977 -0.780  1.00 16.74 ? 133  LEU A CD2 1 
ATOM   964  N  N   . THR A 1 134 ? 32.147  15.958 -0.534  1.00 21.19 ? 134  THR A N   1 
ATOM   965  C  CA  . THR A 1 134 ? 31.688  14.572 -0.488  1.00 20.34 ? 134  THR A CA  1 
ATOM   966  C  C   . THR A 1 134 ? 30.902  14.256 -1.740  1.00 20.35 ? 134  THR A C   1 
ATOM   967  O  O   . THR A 1 134 ? 30.765  13.098 -2.125  1.00 20.48 ? 134  THR A O   1 
ATOM   968  C  CB  . THR A 1 134 ? 30.784  14.312 0.714   1.00 21.36 ? 134  THR A CB  1 
ATOM   969  O  OG1 . THR A 1 134 ? 29.510  14.924 0.490   1.00 23.60 ? 134  THR A OG1 1 
ATOM   970  C  CG2 . THR A 1 134 ? 31.405  14.895 1.979   1.00 22.08 ? 134  THR A CG2 1 
ATOM   971  N  N   . THR A 1 135 ? 30.381  15.295 -2.377  1.00 21.05 ? 135  THR A N   1 
ATOM   972  C  CA  . THR A 1 135 ? 29.610  15.108 -3.596  1.00 21.67 ? 135  THR A CA  1 
ATOM   973  C  C   . THR A 1 135 ? 30.437  14.392 -4.675  1.00 21.97 ? 135  THR A C   1 
ATOM   974  O  O   . THR A 1 135 ? 31.648  14.598 -4.793  1.00 21.00 ? 135  THR A O   1 
ATOM   975  C  CB  . THR A 1 135 ? 29.117  16.459 -4.154  1.00 20.98 ? 135  THR A CB  1 
ATOM   976  O  OG1 . THR A 1 135 ? 28.122  16.219 -5.155  1.00 21.98 ? 135  THR A OG1 1 
ATOM   977  C  CG2 . THR A 1 135 ? 30.272  17.244 -4.778  1.00 19.08 ? 135  THR A CG2 1 
ATOM   978  N  N   . THR A 1 136 ? 29.771  13.540 -5.449  1.00 22.29 ? 136  THR A N   1 
ATOM   979  C  CA  . THR A 1 136 ? 30.419  12.806 -6.528  1.00 23.82 ? 136  THR A CA  1 
ATOM   980  C  C   . THR A 1 136 ? 29.827  13.255 -7.861  1.00 24.01 ? 136  THR A C   1 
ATOM   981  O  O   . THR A 1 136 ? 30.486  13.224 -8.899  1.00 25.55 ? 136  THR A O   1 
ATOM   982  C  CB  . THR A 1 136 ? 30.221  11.286 -6.374  1.00 25.08 ? 136  THR A CB  1 
ATOM   983  O  OG1 . THR A 1 136 ? 28.832  10.999 -6.147  1.00 28.40 ? 136  THR A OG1 1 
ATOM   984  C  CG2 . THR A 1 136 ? 31.051  10.756 -5.220  1.00 24.81 ? 136  THR A CG2 1 
ATOM   985  N  N   . SER A 1 137 ? 28.574  13.680 -7.824  1.00 25.36 ? 137  SER A N   1 
ATOM   986  C  CA  . SER A 1 137 ? 27.908  14.147 -9.029  1.00 25.43 ? 137  SER A CA  1 
ATOM   987  C  C   . SER A 1 137 ? 28.231  15.630 -9.223  1.00 24.37 ? 137  SER A C   1 
ATOM   988  O  O   . SER A 1 137 ? 28.358  16.109 -10.356 1.00 24.39 ? 137  SER A O   1 
ATOM   989  C  CB  . SER A 1 137 ? 26.392  13.941 -8.901  1.00 24.64 ? 137  SER A CB  1 
ATOM   990  O  OG  . SER A 1 137 ? 25.879  14.588 -7.748  1.00 25.46 ? 137  SER A OG  1 
ATOM   991  N  N   . GLY A 1 138 ? 28.375  16.343 -8.105  1.00 22.54 ? 138  GLY A N   1 
ATOM   992  C  CA  . GLY A 1 138 ? 28.666  17.763 -8.160  1.00 20.05 ? 138  GLY A CA  1 
ATOM   993  C  C   . GLY A 1 138 ? 27.428  18.603 -8.436  1.00 19.10 ? 138  GLY A C   1 
ATOM   994  O  O   . GLY A 1 138 ? 27.542  19.769 -8.803  1.00 18.90 ? 138  GLY A O   1 
ATOM   995  N  N   . ASN A 1 139 ? 26.248  18.004 -8.282  1.00 18.86 ? 139  ASN A N   1 
ATOM   996  C  CA  . ASN A 1 139 ? 24.980  18.706 -8.496  1.00 19.36 ? 139  ASN A CA  1 
ATOM   997  C  C   . ASN A 1 139 ? 24.541  19.288 -7.159  1.00 20.29 ? 139  ASN A C   1 
ATOM   998  O  O   . ASN A 1 139 ? 24.384  18.550 -6.182  1.00 19.93 ? 139  ASN A O   1 
ATOM   999  C  CB  . ASN A 1 139 ? 23.901  17.747 -9.013  1.00 18.88 ? 139  ASN A CB  1 
ATOM   1000 C  CG  . ASN A 1 139 ? 24.266  17.128 -10.343 1.00 19.52 ? 139  ASN A CG  1 
ATOM   1001 O  OD1 . ASN A 1 139 ? 24.699  17.825 -11.259 1.00 21.84 ? 139  ASN A OD1 1 
ATOM   1002 N  ND2 . ASN A 1 139 ? 24.091  15.818 -10.460 1.00 19.11 ? 139  ASN A ND2 1 
ATOM   1003 N  N   . LEU A 1 140 ? 24.336  20.602 -7.118  1.00 18.76 ? 140  LEU A N   1 
ATOM   1004 C  CA  . LEU A 1 140 ? 23.961  21.265 -5.875  1.00 18.12 ? 140  LEU A CA  1 
ATOM   1005 C  C   . LEU A 1 140 ? 22.568  20.976 -5.326  1.00 17.76 ? 140  LEU A C   1 
ATOM   1006 O  O   . LEU A 1 140 ? 22.263  21.371 -4.196  1.00 16.88 ? 140  LEU A O   1 
ATOM   1007 C  CB  . LEU A 1 140 ? 24.158  22.775 -6.017  1.00 17.88 ? 140  LEU A CB  1 
ATOM   1008 C  CG  . LEU A 1 140 ? 25.593  23.247 -5.764  1.00 18.27 ? 140  LEU A CG  1 
ATOM   1009 C  CD1 . LEU A 1 140 ? 25.871  24.541 -6.508  1.00 18.25 ? 140  LEU A CD1 1 
ATOM   1010 C  CD2 . LEU A 1 140 ? 25.815  23.397 -4.259  1.00 15.94 ? 140  LEU A CD2 1 
ATOM   1011 N  N   . HIS A 1 141 ? 21.728  20.293 -6.105  1.00 15.86 ? 141  HIS A N   1 
ATOM   1012 C  CA  . HIS A 1 141 ? 20.380  19.984 -5.642  1.00 14.53 ? 141  HIS A CA  1 
ATOM   1013 C  C   . HIS A 1 141 ? 20.416  18.834 -4.643  1.00 15.93 ? 141  HIS A C   1 
ATOM   1014 O  O   . HIS A 1 141 ? 19.399  18.495 -4.036  1.00 16.20 ? 141  HIS A O   1 
ATOM   1015 C  CB  . HIS A 1 141 ? 19.435  19.674 -6.823  1.00 13.66 ? 141  HIS A CB  1 
ATOM   1016 C  CG  . HIS A 1 141 ? 19.664  18.342 -7.479  1.00 14.94 ? 141  HIS A CG  1 
ATOM   1017 N  ND1 . HIS A 1 141 ? 18.758  17.788 -8.357  1.00 13.82 ? 141  HIS A ND1 1 
ATOM   1018 C  CD2 . HIS A 1 141 ? 20.676  17.448 -7.373  1.00 13.49 ? 141  HIS A CD2 1 
ATOM   1019 C  CE1 . HIS A 1 141 ? 19.200  16.609 -8.758  1.00 12.78 ? 141  HIS A CE1 1 
ATOM   1020 N  NE2 . HIS A 1 141 ? 20.361  16.379 -8.175  1.00 10.47 ? 141  HIS A NE2 1 
ATOM   1021 N  N   . GLY A 1 142 ? 21.606  18.257 -4.467  1.00 15.37 ? 142  GLY A N   1 
ATOM   1022 C  CA  . GLY A 1 142 ? 21.790  17.164 -3.524  1.00 15.10 ? 142  GLY A CA  1 
ATOM   1023 C  C   . GLY A 1 142 ? 22.739  17.540 -2.395  1.00 14.48 ? 142  GLY A C   1 
ATOM   1024 O  O   . GLY A 1 142 ? 23.350  16.661 -1.772  1.00 14.94 ? 142  GLY A O   1 
ATOM   1025 N  N   . GLN A 1 143 ? 22.849  18.845 -2.130  1.00 13.85 ? 143  GLN A N   1 
ATOM   1026 C  CA  . GLN A 1 143 ? 23.719  19.394 -1.082  1.00 15.31 ? 143  GLN A CA  1 
ATOM   1027 C  C   . GLN A 1 143 ? 23.106  20.531 -0.245  1.00 15.69 ? 143  GLN A C   1 
ATOM   1028 O  O   . GLN A 1 143 ? 23.772  21.050 0.657   1.00 15.63 ? 143  GLN A O   1 
ATOM   1029 C  CB  . GLN A 1 143 ? 24.996  19.979 -1.693  1.00 14.70 ? 143  GLN A CB  1 
ATOM   1030 C  CG  . GLN A 1 143 ? 25.783  19.105 -2.618  1.00 14.29 ? 143  GLN A CG  1 
ATOM   1031 C  CD  . GLN A 1 143 ? 26.951  19.865 -3.213  1.00 16.11 ? 143  GLN A CD  1 
ATOM   1032 O  OE1 . GLN A 1 143 ? 27.766  20.426 -2.485  1.00 16.20 ? 143  GLN A OE1 1 
ATOM   1033 N  NE2 . GLN A 1 143 ? 27.033  19.896 -4.541  1.00 14.35 ? 143  GLN A NE2 1 
ATOM   1034 N  N   . PRO A 1 144 ? 21.841  20.925 -0.511  1.00 15.67 ? 144  PRO A N   1 
ATOM   1035 C  CA  . PRO A 1 144 ? 21.248  22.024 0.265   1.00 14.09 ? 144  PRO A CA  1 
ATOM   1036 C  C   . PRO A 1 144 ? 21.338  21.956 1.795   1.00 14.23 ? 144  PRO A C   1 
ATOM   1037 O  O   . PRO A 1 144 ? 21.681  22.946 2.440   1.00 11.84 ? 144  PRO A O   1 
ATOM   1038 C  CB  . PRO A 1 144 ? 19.805  22.064 -0.245  1.00 12.95 ? 144  PRO A CB  1 
ATOM   1039 C  CG  . PRO A 1 144 ? 19.528  20.630 -0.536  1.00 13.84 ? 144  PRO A CG  1 
ATOM   1040 C  CD  . PRO A 1 144 ? 20.787  20.200 -1.252  1.00 15.12 ? 144  PRO A CD  1 
ATOM   1041 N  N   . VAL A 1 145 ? 21.040  20.797 2.371   1.00 14.52 ? 145  VAL A N   1 
ATOM   1042 C  CA  . VAL A 1 145 ? 21.086  20.646 3.822   1.00 13.75 ? 145  VAL A CA  1 
ATOM   1043 C  C   . VAL A 1 145 ? 22.467  20.880 4.435   1.00 13.21 ? 145  VAL A C   1 
ATOM   1044 O  O   . VAL A 1 145 ? 22.560  21.416 5.537   1.00 12.63 ? 145  VAL A O   1 
ATOM   1045 C  CB  . VAL A 1 145 ? 20.556  19.254 4.250   1.00 14.03 ? 145  VAL A CB  1 
ATOM   1046 C  CG1 . VAL A 1 145 ? 20.734  19.057 5.747   1.00 14.54 ? 145  VAL A CG1 1 
ATOM   1047 C  CG2 . VAL A 1 145 ? 19.081  19.138 3.893   1.00 12.68 ? 145  VAL A CG2 1 
ATOM   1048 N  N   . SER A 1 146 ? 23.534  20.493 3.738   1.00 13.73 ? 146  SER A N   1 
ATOM   1049 C  CA  . SER A 1 146 ? 24.887  20.696 4.273   1.00 15.81 ? 146  SER A CA  1 
ATOM   1050 C  C   . SER A 1 146 ? 25.209  22.186 4.493   1.00 17.83 ? 146  SER A C   1 
ATOM   1051 O  O   . SER A 1 146 ? 25.850  22.548 5.483   1.00 16.35 ? 146  SER A O   1 
ATOM   1052 C  CB  . SER A 1 146 ? 25.952  20.065 3.356   1.00 14.14 ? 146  SER A CB  1 
ATOM   1053 O  OG  . SER A 1 146 ? 26.305  20.913 2.273   1.00 13.58 ? 146  SER A OG  1 
ATOM   1054 N  N   . PHE A 1 147 ? 24.757  23.044 3.577   1.00 19.33 ? 147  PHE A N   1 
ATOM   1055 C  CA  . PHE A 1 147 ? 25.003  24.481 3.686   1.00 19.03 ? 147  PHE A CA  1 
ATOM   1056 C  C   . PHE A 1 147 ? 24.159  25.096 4.800   1.00 18.90 ? 147  PHE A C   1 
ATOM   1057 O  O   . PHE A 1 147 ? 24.495  26.159 5.331   1.00 19.75 ? 147  PHE A O   1 
ATOM   1058 C  CB  . PHE A 1 147 ? 24.674  25.193 2.358   1.00 21.77 ? 147  PHE A CB  1 
ATOM   1059 C  CG  . PHE A 1 147 ? 25.646  24.898 1.233   1.00 23.25 ? 147  PHE A CG  1 
ATOM   1060 C  CD1 . PHE A 1 147 ? 25.724  23.626 0.665   1.00 24.32 ? 147  PHE A CD1 1 
ATOM   1061 C  CD2 . PHE A 1 147 ? 26.474  25.906 0.731   1.00 24.20 ? 147  PHE A CD2 1 
ATOM   1062 C  CE1 . PHE A 1 147 ? 26.612  23.363 -0.386  1.00 23.60 ? 147  PHE A CE1 1 
ATOM   1063 C  CE2 . PHE A 1 147 ? 27.363  25.656 -0.318  1.00 21.45 ? 147  PHE A CE2 1 
ATOM   1064 C  CZ  . PHE A 1 147 ? 27.432  24.386 -0.878  1.00 24.02 ? 147  PHE A CZ  1 
ATOM   1065 N  N   . LEU A 1 148 ? 23.065  24.421 5.150   1.00 19.09 ? 148  LEU A N   1 
ATOM   1066 C  CA  . LEU A 1 148 ? 22.145  24.899 6.189   1.00 19.88 ? 148  LEU A CA  1 
ATOM   1067 C  C   . LEU A 1 148 ? 22.488  24.453 7.622   1.00 19.97 ? 148  LEU A C   1 
ATOM   1068 O  O   . LEU A 1 148 ? 22.439  25.258 8.548   1.00 18.32 ? 148  LEU A O   1 
ATOM   1069 C  CB  . LEU A 1 148 ? 20.706  24.476 5.845   1.00 18.21 ? 148  LEU A CB  1 
ATOM   1070 C  CG  . LEU A 1 148 ? 20.040  25.162 4.640   1.00 18.68 ? 148  LEU A CG  1 
ATOM   1071 C  CD1 . LEU A 1 148 ? 18.794  24.410 4.224   1.00 17.85 ? 148  LEU A CD1 1 
ATOM   1072 C  CD2 . LEU A 1 148 ? 19.707  26.597 4.984   1.00 17.02 ? 148  LEU A CD2 1 
ATOM   1073 N  N   . LEU A 1 149 ? 22.833  23.179 7.806   1.00 21.51 ? 149  LEU A N   1 
ATOM   1074 C  CA  . LEU A 1 149 ? 23.159  22.671 9.143   1.00 22.80 ? 149  LEU A CA  1 
ATOM   1075 C  C   . LEU A 1 149 ? 24.316  23.374 9.848   1.00 22.26 ? 149  LEU A C   1 
ATOM   1076 O  O   . LEU A 1 149 ? 25.407  23.531 9.297   1.00 22.53 ? 149  LEU A O   1 
ATOM   1077 C  CB  . LEU A 1 149 ? 23.461  21.168 9.114   1.00 21.09 ? 149  LEU A CB  1 
ATOM   1078 C  CG  . LEU A 1 149 ? 22.305  20.174 9.069   1.00 23.44 ? 149  LEU A CG  1 
ATOM   1079 C  CD1 . LEU A 1 149 ? 22.840  18.831 9.543   1.00 23.43 ? 149  LEU A CD1 1 
ATOM   1080 C  CD2 . LEU A 1 149 ? 21.140  20.625 9.966   1.00 21.64 ? 149  LEU A CD2 1 
ATOM   1081 N  N   . LYS A 1 150 ? 24.071  23.768 11.092  1.00 22.41 ? 150  LYS A N   1 
ATOM   1082 C  CA  . LYS A 1 150 ? 25.079  24.447 11.888  1.00 21.32 ? 150  LYS A CA  1 
ATOM   1083 C  C   . LYS A 1 150 ? 26.274  23.555 12.229  1.00 20.62 ? 150  LYS A C   1 
ATOM   1084 O  O   . LYS A 1 150 ? 27.410  24.031 12.247  1.00 18.65 ? 150  LYS A O   1 
ATOM   1085 C  CB  . LYS A 1 150 ? 24.444  24.991 13.166  1.00 21.93 ? 150  LYS A CB  1 
ATOM   1086 C  CG  . LYS A 1 150 ? 23.490  26.144 12.922  1.00 21.94 ? 150  LYS A CG  1 
ATOM   1087 C  CD  . LYS A 1 150 ? 23.053  26.776 14.227  1.00 23.51 ? 150  LYS A CD  1 
ATOM   1088 C  CE  . LYS A 1 150 ? 22.284  28.065 13.984  1.00 23.89 ? 150  LYS A CE  1 
ATOM   1089 N  NZ  . LYS A 1 150 ? 21.900  28.724 15.263  1.00 22.57 ? 150  LYS A NZ  1 
ATOM   1090 N  N   . GLU A 1 151 ? 26.009  22.269 12.480  1.00 20.16 ? 151  GLU A N   1 
ATOM   1091 C  CA  . GLU A 1 151 ? 27.044  21.290 12.833  1.00 20.48 ? 151  GLU A CA  1 
ATOM   1092 C  C   . GLU A 1 151 ? 28.006  20.946 11.709  1.00 21.48 ? 151  GLU A C   1 
ATOM   1093 O  O   . GLU A 1 151 ? 29.028  20.304 11.941  1.00 21.34 ? 151  GLU A O   1 
ATOM   1094 C  CB  . GLU A 1 151 ? 26.418  19.978 13.322  1.00 20.05 ? 151  GLU A CB  1 
ATOM   1095 C  CG  . GLU A 1 151 ? 25.772  20.023 14.696  1.00 21.20 ? 151  GLU A CG  1 
ATOM   1096 C  CD  . GLU A 1 151 ? 24.532  20.883 14.728  1.00 19.82 ? 151  GLU A CD  1 
ATOM   1097 O  OE1 . GLU A 1 151 ? 23.919  21.053 13.656  1.00 19.45 ? 151  GLU A OE1 1 
ATOM   1098 O  OE2 . GLU A 1 151 ? 24.159  21.372 15.819  1.00 22.08 ? 151  GLU A OE2 1 
ATOM   1099 N  N   . LEU A 1 152 ? 27.679  21.355 10.490  1.00 24.57 ? 152  LEU A N   1 
ATOM   1100 C  CA  . LEU A 1 152 ? 28.536  21.056 9.348   1.00 27.01 ? 152  LEU A CA  1 
ATOM   1101 C  C   . LEU A 1 152 ? 29.398  22.226 8.916   1.00 29.21 ? 152  LEU A C   1 
ATOM   1102 O  O   . LEU A 1 152 ? 30.240  22.088 8.022   1.00 29.73 ? 152  LEU A O   1 
ATOM   1103 C  CB  . LEU A 1 152 ? 27.692  20.572 8.175   1.00 27.40 ? 152  LEU A CB  1 
ATOM   1104 C  CG  . LEU A 1 152 ? 27.595  19.061 8.000   1.00 26.59 ? 152  LEU A CG  1 
ATOM   1105 C  CD1 . LEU A 1 152 ? 27.973  18.332 9.280   1.00 27.73 ? 152  LEU A CD1 1 
ATOM   1106 C  CD2 . LEU A 1 152 ? 26.188  18.730 7.574   1.00 28.59 ? 152  LEU A CD2 1 
ATOM   1107 N  N   . LYS A 1 153 ? 29.180  23.384 9.534   1.00 30.98 ? 153  LYS A N   1 
ATOM   1108 C  CA  . LYS A 1 153 ? 29.995  24.542 9.209   1.00 33.36 ? 153  LYS A CA  1 
ATOM   1109 C  C   . LYS A 1 153 ? 31.348  24.055 9.695   1.00 34.20 ? 153  LYS A C   1 
ATOM   1110 O  O   . LYS A 1 153 ? 31.436  23.395 10.736  1.00 35.74 ? 153  LYS A O   1 
ATOM   1111 C  CB  . LYS A 1 153 ? 29.547  25.783 9.994   1.00 34.07 ? 153  LYS A CB  1 
ATOM   1112 C  CG  . LYS A 1 153 ? 29.992  27.106 9.355   1.00 34.81 ? 153  LYS A CG  1 
ATOM   1113 C  CD  . LYS A 1 153 ? 29.520  28.321 10.154  1.00 35.28 ? 153  LYS A CD  1 
ATOM   1114 C  CE  . LYS A 1 153 ? 29.827  29.629 9.423   1.00 34.03 ? 153  LYS A CE  1 
ATOM   1115 N  NZ  . LYS A 1 153 ? 29.524  30.834 10.252  1.00 33.57 ? 153  LYS A NZ  1 
ATOM   1116 N  N   . GLY A 1 154 ? 32.393  24.356 8.937   1.00 34.02 ? 154  GLY A N   1 
ATOM   1117 C  CA  . GLY A 1 154 ? 33.715  23.888 9.304   1.00 32.63 ? 154  GLY A CA  1 
ATOM   1118 C  C   . GLY A 1 154 ? 34.053  22.739 8.375   1.00 31.92 ? 154  GLY A C   1 
ATOM   1119 O  O   . GLY A 1 154 ? 35.216  22.401 8.196   1.00 31.19 ? 154  GLY A O   1 
ATOM   1120 N  N   . LYS A 1 155 ? 33.017  22.139 7.788   1.00 32.65 ? 155  LYS A N   1 
ATOM   1121 C  CA  . LYS A 1 155 ? 33.180  21.032 6.847   1.00 32.92 ? 155  LYS A CA  1 
ATOM   1122 C  C   . LYS A 1 155 ? 32.819  21.536 5.447   1.00 32.24 ? 155  LYS A C   1 
ATOM   1123 O  O   . LYS A 1 155 ? 33.173  20.925 4.441   1.00 32.99 ? 155  LYS A O   1 
ATOM   1124 C  CB  . LYS A 1 155 ? 32.266  19.856 7.221   1.00 33.11 ? 155  LYS A CB  1 
ATOM   1125 C  CG  . LYS A 1 155 ? 31.943  19.750 8.708   1.00 35.93 ? 155  LYS A CG  1 
ATOM   1126 C  CD  . LYS A 1 155 ? 33.189  19.742 9.584   1.00 36.60 ? 155  LYS A CD  1 
ATOM   1127 C  CE  . LYS A 1 155 ? 32.833  20.032 11.045  1.00 36.00 ? 155  LYS A CE  1 
ATOM   1128 N  NZ  . LYS A 1 155 ? 34.028  20.259 11.909  1.00 34.19 ? 155  LYS A NZ  1 
ATOM   1129 N  N   . ILE A 1 156 ? 32.104  22.654 5.391   1.00 31.59 ? 156  ILE A N   1 
ATOM   1130 C  CA  . ILE A 1 156 ? 31.707  23.243 4.117   1.00 31.02 ? 156  ILE A CA  1 
ATOM   1131 C  C   . ILE A 1 156 ? 32.762  24.238 3.634   1.00 32.00 ? 156  ILE A C   1 
ATOM   1132 O  O   . ILE A 1 156 ? 32.993  25.270 4.271   1.00 31.81 ? 156  ILE A O   1 
ATOM   1133 C  CB  . ILE A 1 156 ? 30.367  24.012 4.229   1.00 29.54 ? 156  ILE A CB  1 
ATOM   1134 C  CG1 . ILE A 1 156 ? 29.303  23.130 4.880   1.00 28.73 ? 156  ILE A CG1 1 
ATOM   1135 C  CG2 . ILE A 1 156 ? 29.906  24.445 2.842   1.00 27.94 ? 156  ILE A CG2 1 
ATOM   1136 C  CD1 . ILE A 1 156 ? 28.896  21.944 4.041   1.00 27.98 ? 156  ILE A CD1 1 
ATOM   1137 N  N   . PRO A 1 157 ? 33.420  23.943 2.502   1.00 32.06 ? 157  PRO A N   1 
ATOM   1138 C  CA  . PRO A 1 157 ? 34.437  24.869 1.992   1.00 31.46 ? 157  PRO A CA  1 
ATOM   1139 C  C   . PRO A 1 157 ? 33.755  26.140 1.473   1.00 31.44 ? 157  PRO A C   1 
ATOM   1140 O  O   . PRO A 1 157 ? 32.566  26.112 1.143   1.00 31.27 ? 157  PRO A O   1 
ATOM   1141 C  CB  . PRO A 1 157 ? 35.097  24.059 0.881   1.00 30.92 ? 157  PRO A CB  1 
ATOM   1142 C  CG  . PRO A 1 157 ? 33.950  23.252 0.342   1.00 31.35 ? 157  PRO A CG  1 
ATOM   1143 C  CD  . PRO A 1 157 ? 33.270  22.778 1.610   1.00 31.10 ? 157  PRO A CD  1 
ATOM   1144 N  N   . ASP A 1 158 ? 34.484  27.252 1.412   1.00 30.92 ? 158  ASP A N   1 
ATOM   1145 C  CA  . ASP A 1 158 ? 33.886  28.490 0.907   1.00 32.73 ? 158  ASP A CA  1 
ATOM   1146 C  C   . ASP A 1 158 ? 33.722  28.400 -0.620  1.00 31.88 ? 158  ASP A C   1 
ATOM   1147 O  O   . ASP A 1 158 ? 34.677  28.595 -1.375  1.00 30.06 ? 158  ASP A O   1 
ATOM   1148 C  CB  . ASP A 1 158 ? 34.742  29.711 1.284   1.00 33.49 ? 158  ASP A CB  1 
ATOM   1149 C  CG  . ASP A 1 158 ? 34.758  29.983 2.788   1.00 35.02 ? 158  ASP A CG  1 
ATOM   1150 O  OD1 . ASP A 1 158 ? 33.672  30.027 3.402   1.00 36.35 ? 158  ASP A OD1 1 
ATOM   1151 O  OD2 . ASP A 1 158 ? 35.857  30.159 3.357   1.00 36.22 ? 158  ASP A OD2 1 
ATOM   1152 N  N   . VAL A 1 159 ? 32.500  28.094 -1.057  1.00 31.45 ? 159  VAL A N   1 
ATOM   1153 C  CA  . VAL A 1 159 ? 32.183  27.948 -2.476  1.00 30.23 ? 159  VAL A CA  1 
ATOM   1154 C  C   . VAL A 1 159 ? 31.717  29.264 -3.076  1.00 30.34 ? 159  VAL A C   1 
ATOM   1155 O  O   . VAL A 1 159 ? 30.937  29.997 -2.467  1.00 30.55 ? 159  VAL A O   1 
ATOM   1156 C  CB  . VAL A 1 159 ? 31.061  26.912 -2.699  1.00 30.70 ? 159  VAL A CB  1 
ATOM   1157 C  CG1 . VAL A 1 159 ? 30.862  26.674 -4.188  1.00 29.22 ? 159  VAL A CG1 1 
ATOM   1158 C  CG2 . VAL A 1 159 ? 31.392  25.613 -1.970  1.00 30.65 ? 159  VAL A CG2 1 
ATOM   1159 N  N   . PRO A 1 160 ? 32.192  29.585 -4.287  1.00 29.46 ? 160  PRO A N   1 
ATOM   1160 C  CA  . PRO A 1 160 ? 31.775  30.838 -4.910  1.00 28.48 ? 160  PRO A CA  1 
ATOM   1161 C  C   . PRO A 1 160 ? 30.254  30.886 -5.027  1.00 27.76 ? 160  PRO A C   1 
ATOM   1162 O  O   . PRO A 1 160 ? 29.627  29.965 -5.561  1.00 26.93 ? 160  PRO A O   1 
ATOM   1163 C  CB  . PRO A 1 160 ? 32.470  30.791 -6.267  1.00 30.00 ? 160  PRO A CB  1 
ATOM   1164 C  CG  . PRO A 1 160 ? 33.731  30.014 -5.967  1.00 29.78 ? 160  PRO A CG  1 
ATOM   1165 C  CD  . PRO A 1 160 ? 33.203  28.895 -5.108  1.00 29.58 ? 160  PRO A CD  1 
ATOM   1166 N  N   . GLY A 1 161 ? 29.667  31.959 -4.507  1.00 26.95 ? 161  GLY A N   1 
ATOM   1167 C  CA  . GLY A 1 161 ? 28.226  32.117 -4.558  1.00 23.17 ? 161  GLY A CA  1 
ATOM   1168 C  C   . GLY A 1 161 ? 27.528  32.026 -3.212  1.00 20.62 ? 161  GLY A C   1 
ATOM   1169 O  O   . GLY A 1 161 ? 26.410  32.515 -3.066  1.00 20.99 ? 161  GLY A O   1 
ATOM   1170 N  N   . PHE A 1 162 ? 28.183  31.426 -2.224  1.00 19.98 ? 162  PHE A N   1 
ATOM   1171 C  CA  . PHE A 1 162 ? 27.587  31.260 -0.902  1.00 19.57 ? 162  PHE A CA  1 
ATOM   1172 C  C   . PHE A 1 162 ? 28.314  31.939 0.254   1.00 20.37 ? 162  PHE A C   1 
ATOM   1173 O  O   . PHE A 1 162 ? 28.511  31.334 1.309   1.00 21.37 ? 162  PHE A O   1 
ATOM   1174 C  CB  . PHE A 1 162 ? 27.453  29.768 -0.587  1.00 18.81 ? 162  PHE A CB  1 
ATOM   1175 C  CG  . PHE A 1 162 ? 26.722  28.999 -1.640  1.00 19.10 ? 162  PHE A CG  1 
ATOM   1176 C  CD1 . PHE A 1 162 ? 27.367  28.611 -2.808  1.00 18.89 ? 162  PHE A CD1 1 
ATOM   1177 C  CD2 . PHE A 1 162 ? 25.378  28.685 -1.479  1.00 17.86 ? 162  PHE A CD2 1 
ATOM   1178 C  CE1 . PHE A 1 162 ? 26.684  27.921 -3.804  1.00 19.08 ? 162  PHE A CE1 1 
ATOM   1179 C  CE2 . PHE A 1 162 ? 24.684  27.994 -2.470  1.00 18.34 ? 162  PHE A CE2 1 
ATOM   1180 C  CZ  . PHE A 1 162 ? 25.342  27.611 -3.637  1.00 17.91 ? 162  PHE A CZ  1 
ATOM   1181 N  N   . SER A 1 163 ? 28.716  33.189 0.073   1.00 20.47 ? 163  SER A N   1 
ATOM   1182 C  CA  . SER A 1 163 ? 29.401  33.891 1.147   1.00 20.04 ? 163  SER A CA  1 
ATOM   1183 C  C   . SER A 1 163 ? 28.356  34.435 2.105   1.00 20.06 ? 163  SER A C   1 
ATOM   1184 O  O   . SER A 1 163 ? 28.637  34.661 3.280   1.00 21.41 ? 163  SER A O   1 
ATOM   1185 C  CB  . SER A 1 163 ? 30.241  35.050 0.597   1.00 20.07 ? 163  SER A CB  1 
ATOM   1186 O  OG  . SER A 1 163 ? 29.422  36.127 0.171   1.00 21.39 ? 163  SER A OG  1 
ATOM   1187 N  N   . TRP A 1 164 ? 27.143  34.634 1.592   1.00 19.68 ? 164  TRP A N   1 
ATOM   1188 C  CA  . TRP A 1 164 ? 26.041  35.175 2.384   1.00 19.62 ? 164  TRP A CA  1 
ATOM   1189 C  C   . TRP A 1 164 ? 25.445  34.173 3.367   1.00 19.60 ? 164  TRP A C   1 
ATOM   1190 O  O   . TRP A 1 164 ? 24.832  34.559 4.367   1.00 19.23 ? 164  TRP A O   1 
ATOM   1191 C  CB  . TRP A 1 164 ? 24.931  35.682 1.455   1.00 18.43 ? 164  TRP A CB  1 
ATOM   1192 C  CG  . TRP A 1 164 ? 24.375  34.619 0.552   1.00 18.79 ? 164  TRP A CG  1 
ATOM   1193 C  CD1 . TRP A 1 164 ? 24.953  34.116 -0.580  1.00 18.36 ? 164  TRP A CD1 1 
ATOM   1194 C  CD2 . TRP A 1 164 ? 23.162  33.876 0.746   1.00 18.50 ? 164  TRP A CD2 1 
ATOM   1195 N  NE1 . TRP A 1 164 ? 24.179  33.105 -1.099  1.00 19.87 ? 164  TRP A NE1 1 
ATOM   1196 C  CE2 . TRP A 1 164 ? 23.074  32.937 -0.304  1.00 18.33 ? 164  TRP A CE2 1 
ATOM   1197 C  CE3 . TRP A 1 164 ? 22.143  33.911 1.709   1.00 18.47 ? 164  TRP A CE3 1 
ATOM   1198 C  CZ2 . TRP A 1 164 ? 22.007  32.040 -0.420  1.00 20.49 ? 164  TRP A CZ2 1 
ATOM   1199 C  CZ3 . TRP A 1 164 ? 21.079  33.017 1.594   1.00 18.78 ? 164  TRP A CZ3 1 
ATOM   1200 C  CH2 . TRP A 1 164 ? 21.021  32.096 0.539   1.00 19.45 ? 164  TRP A CH2 1 
ATOM   1201 N  N   . VAL A 1 165 ? 25.646  32.890 3.082   1.00 20.15 ? 165  VAL A N   1 
ATOM   1202 C  CA  . VAL A 1 165 ? 25.096  31.816 3.891   1.00 19.70 ? 165  VAL A CA  1 
ATOM   1203 C  C   . VAL A 1 165 ? 25.639  31.688 5.307   1.00 21.58 ? 165  VAL A C   1 
ATOM   1204 O  O   . VAL A 1 165 ? 26.848  31.668 5.541   1.00 21.55 ? 165  VAL A O   1 
ATOM   1205 C  CB  . VAL A 1 165 ? 25.250  30.445 3.162   1.00 20.75 ? 165  VAL A CB  1 
ATOM   1206 C  CG1 . VAL A 1 165 ? 24.616  29.328 3.980   1.00 19.55 ? 165  VAL A CG1 1 
ATOM   1207 C  CG2 . VAL A 1 165 ? 24.589  30.508 1.790   1.00 18.30 ? 165  VAL A CG2 1 
ATOM   1208 N  N   . THR A 1 166 ? 24.708  31.605 6.251   1.00 22.02 ? 166  THR A N   1 
ATOM   1209 C  CA  . THR A 1 166 ? 25.031  31.429 7.656   1.00 23.75 ? 166  THR A CA  1 
ATOM   1210 C  C   . THR A 1 166 ? 24.221  30.219 8.101   1.00 23.79 ? 166  THR A C   1 
ATOM   1211 O  O   . THR A 1 166 ? 22.990  30.253 8.059   1.00 24.80 ? 166  THR A O   1 
ATOM   1212 C  CB  . THR A 1 166 ? 24.584  32.627 8.510   1.00 22.30 ? 166  THR A CB  1 
ATOM   1213 O  OG1 . THR A 1 166 ? 25.160  33.831 7.994   1.00 24.05 ? 166  THR A OG1 1 
ATOM   1214 C  CG2 . THR A 1 166 ? 25.031  32.436 9.948   1.00 21.94 ? 166  THR A CG2 1 
ATOM   1215 N  N   . PRO A 1 167 ? 24.894  29.135 8.527   1.00 25.07 ? 167  PRO A N   1 
ATOM   1216 C  CA  . PRO A 1 167 ? 24.179  27.932 8.973   1.00 25.81 ? 167  PRO A CA  1 
ATOM   1217 C  C   . PRO A 1 167 ? 23.018  28.330 9.887   1.00 25.83 ? 167  PRO A C   1 
ATOM   1218 O  O   . PRO A 1 167 ? 23.242  28.795 11.005  1.00 26.14 ? 167  PRO A O   1 
ATOM   1219 C  CB  . PRO A 1 167 ? 25.260  27.150 9.713   1.00 25.47 ? 167  PRO A CB  1 
ATOM   1220 C  CG  . PRO A 1 167 ? 26.496  27.511 8.964   1.00 26.49 ? 167  PRO A CG  1 
ATOM   1221 C  CD  . PRO A 1 167 ? 26.343  28.999 8.761   1.00 24.67 ? 167  PRO A CD  1 
ATOM   1222 N  N   . CYS A 1 168 ? 21.787  28.143 9.416   1.00 25.49 ? 168  CYS A N   1 
ATOM   1223 C  CA  . CYS A 1 168 ? 20.617  28.531 10.199  1.00 26.61 ? 168  CYS A CA  1 
ATOM   1224 C  C   . CYS A 1 168 ? 19.890  27.445 10.993  1.00 25.73 ? 168  CYS A C   1 
ATOM   1225 O  O   . CYS A 1 168 ? 19.226  27.757 11.975  1.00 27.33 ? 168  CYS A O   1 
ATOM   1226 C  CB  . CYS A 1 168 ? 19.609  29.260 9.301   1.00 27.04 ? 168  CYS A CB  1 
ATOM   1227 S  SG  . CYS A 1 168 ? 19.014  28.294 7.900   1.00 30.79 ? 168  CYS A SG  1 
ATOM   1228 N  N   . ILE A 1 169 ? 19.997  26.183 10.590  1.00 24.59 ? 169  ILE A N   1 
ATOM   1229 C  CA  . ILE A 1 169 ? 19.313  25.124 11.329  1.00 24.22 ? 169  ILE A CA  1 
ATOM   1230 C  C   . ILE A 1 169 ? 20.245  24.064 11.917  1.00 23.29 ? 169  ILE A C   1 
ATOM   1231 O  O   . ILE A 1 169 ? 21.195  23.626 11.271  1.00 23.73 ? 169  ILE A O   1 
ATOM   1232 C  CB  . ILE A 1 169 ? 18.236  24.451 10.449  1.00 23.90 ? 169  ILE A CB  1 
ATOM   1233 C  CG1 . ILE A 1 169 ? 18.787  24.226 9.045   1.00 24.28 ? 169  ILE A CG1 1 
ATOM   1234 C  CG2 . ILE A 1 169 ? 16.977  25.318 10.419  1.00 26.27 ? 169  ILE A CG2 1 
ATOM   1235 C  CD1 . ILE A 1 169 ? 17.737  23.920 8.004   1.00 22.17 ? 169  ILE A CD1 1 
ATOM   1236 N  N   . SER A 1 170 ? 19.981  23.664 13.159  1.00 22.23 ? 170  SER A N   1 
ATOM   1237 C  CA  . SER A 1 170 ? 20.811  22.660 13.810  1.00 21.91 ? 170  SER A CA  1 
ATOM   1238 C  C   . SER A 1 170 ? 20.276  21.250 13.604  1.00 22.06 ? 170  SER A C   1 
ATOM   1239 O  O   . SER A 1 170 ? 19.092  21.048 13.326  1.00 21.39 ? 170  SER A O   1 
ATOM   1240 C  CB  . SER A 1 170 ? 20.943  22.945 15.310  1.00 21.87 ? 170  SER A CB  1 
ATOM   1241 O  OG  . SER A 1 170 ? 19.713  22.768 15.976  1.00 25.65 ? 170  SER A OG  1 
ATOM   1242 N  N   . ALA A 1 171 ? 21.179  20.285 13.745  1.00 21.69 ? 171  ALA A N   1 
ATOM   1243 C  CA  . ALA A 1 171 ? 20.888  18.867 13.580  1.00 21.64 ? 171  ALA A CA  1 
ATOM   1244 C  C   . ALA A 1 171 ? 19.609  18.419 14.302  1.00 22.03 ? 171  ALA A C   1 
ATOM   1245 O  O   . ALA A 1 171 ? 18.785  17.675 13.751  1.00 22.06 ? 171  ALA A O   1 
ATOM   1246 C  CB  . ALA A 1 171 ? 22.093  18.049 14.074  1.00 20.33 ? 171  ALA A CB  1 
ATOM   1247 N  N   . LYS A 1 172 ? 19.450  18.889 15.532  1.00 21.06 ? 172  LYS A N   1 
ATOM   1248 C  CA  . LYS A 1 172 ? 18.309  18.534 16.357  1.00 20.41 ? 172  LYS A CA  1 
ATOM   1249 C  C   . LYS A 1 172 ? 16.981  19.116 15.874  1.00 18.04 ? 172  LYS A C   1 
ATOM   1250 O  O   . LYS A 1 172 ? 15.929  18.735 16.376  1.00 18.30 ? 172  LYS A O   1 
ATOM   1251 C  CB  . LYS A 1 172 ? 18.566  18.987 17.802  1.00 21.61 ? 172  LYS A CB  1 
ATOM   1252 C  CG  . LYS A 1 172 ? 18.352  20.484 18.020  1.00 26.27 ? 172  LYS A CG  1 
ATOM   1253 C  CD  . LYS A 1 172 ? 18.697  20.931 19.437  1.00 29.92 ? 172  LYS A CD  1 
ATOM   1254 C  CE  . LYS A 1 172 ? 18.076  22.288 19.767  1.00 29.59 ? 172  LYS A CE  1 
ATOM   1255 N  NZ  . LYS A 1 172 ? 18.521  23.385 18.856  1.00 30.75 ? 172  LYS A NZ  1 
ATOM   1256 N  N   . ASP A 1 173 ? 17.019  20.021 14.899  1.00 17.87 ? 173  ASP A N   1 
ATOM   1257 C  CA  . ASP A 1 173 ? 15.792  20.658 14.420  1.00 18.24 ? 173  ASP A CA  1 
ATOM   1258 C  C   . ASP A 1 173 ? 15.237  20.256 13.055  1.00 16.89 ? 173  ASP A C   1 
ATOM   1259 O  O   . ASP A 1 173 ? 14.402  20.969 12.493  1.00 14.49 ? 173  ASP A O   1 
ATOM   1260 C  CB  . ASP A 1 173 ? 15.970  22.171 14.434  1.00 19.24 ? 173  ASP A CB  1 
ATOM   1261 C  CG  . ASP A 1 173 ? 16.198  22.701 15.810  1.00 19.23 ? 173  ASP A CG  1 
ATOM   1262 O  OD1 . ASP A 1 173 ? 15.326  22.492 16.672  1.00 20.69 ? 173  ASP A OD1 1 
ATOM   1263 O  OD2 . ASP A 1 173 ? 17.250  23.323 16.029  1.00 20.21 ? 173  ASP A OD2 1 
ATOM   1264 N  N   . ILE A 1 174 ? 15.671  19.121 12.526  1.00 14.98 ? 174  ILE A N   1 
ATOM   1265 C  CA  . ILE A 1 174 ? 15.180  18.700 11.224  1.00 15.44 ? 174  ILE A CA  1 
ATOM   1266 C  C   . ILE A 1 174 ? 14.820  17.214 11.236  1.00 14.57 ? 174  ILE A C   1 
ATOM   1267 O  O   . ILE A 1 174 ? 15.447  16.416 11.944  1.00 13.52 ? 174  ILE A O   1 
ATOM   1268 C  CB  . ILE A 1 174 ? 16.246  19.049 10.118  1.00 16.19 ? 174  ILE A CB  1 
ATOM   1269 C  CG1 . ILE A 1 174 ? 15.641  18.926 8.712   1.00 19.73 ? 174  ILE A CG1 1 
ATOM   1270 C  CG2 . ILE A 1 174 ? 17.491  18.201 10.303  1.00 17.75 ? 174  ILE A CG2 1 
ATOM   1271 C  CD1 . ILE A 1 174 ? 15.870  17.603 8.012   1.00 19.61 ? 174  ILE A CD1 1 
ATOM   1272 N  N   . VAL A 1 175 ? 13.776  16.864 10.481  1.00 13.99 ? 175  VAL A N   1 
ATOM   1273 C  CA  . VAL A 1 175 ? 13.312  15.478 10.368  1.00 13.45 ? 175  VAL A CA  1 
ATOM   1274 C  C   . VAL A 1 175 ? 13.109  15.052 8.913   1.00 13.88 ? 175  VAL A C   1 
ATOM   1275 O  O   . VAL A 1 175 ? 12.430  15.734 8.144   1.00 12.57 ? 175  VAL A O   1 
ATOM   1276 C  CB  . VAL A 1 175 ? 11.972  15.256 11.093  1.00 9.98  ? 175  VAL A CB  1 
ATOM   1277 C  CG1 . VAL A 1 175 ? 11.566  13.782 10.982  1.00 7.79  ? 175  VAL A CG1 1 
ATOM   1278 C  CG2 . VAL A 1 175 ? 12.085  15.678 12.541  1.00 9.66  ? 175  VAL A CG2 1 
ATOM   1279 N  N   . TYR A 1 176 ? 13.695  13.912 8.550   1.00 16.19 ? 176  TYR A N   1 
ATOM   1280 C  CA  . TYR A 1 176 ? 13.571  13.365 7.195   1.00 14.27 ? 176  TYR A CA  1 
ATOM   1281 C  C   . TYR A 1 176 ? 12.468  12.318 7.137   1.00 13.00 ? 176  TYR A C   1 
ATOM   1282 O  O   . TYR A 1 176 ? 12.339  11.512 8.054   1.00 12.45 ? 176  TYR A O   1 
ATOM   1283 C  CB  . TYR A 1 176 ? 14.867  12.684 6.770   1.00 13.19 ? 176  TYR A CB  1 
ATOM   1284 C  CG  . TYR A 1 176 ? 16.010  13.594 6.400   1.00 16.36 ? 176  TYR A CG  1 
ATOM   1285 C  CD1 . TYR A 1 176 ? 16.003  14.302 5.199   1.00 16.74 ? 176  TYR A CD1 1 
ATOM   1286 C  CD2 . TYR A 1 176 ? 17.144  13.678 7.213   1.00 16.41 ? 176  TYR A CD2 1 
ATOM   1287 C  CE1 . TYR A 1 176 ? 17.103  15.063 4.806   1.00 17.63 ? 176  TYR A CE1 1 
ATOM   1288 C  CE2 . TYR A 1 176 ? 18.243  14.429 6.835   1.00 18.69 ? 176  TYR A CE2 1 
ATOM   1289 C  CZ  . TYR A 1 176 ? 18.222  15.118 5.628   1.00 18.55 ? 176  TYR A CZ  1 
ATOM   1290 O  OH  . TYR A 1 176 ? 19.333  15.827 5.234   1.00 18.29 ? 176  TYR A OH  1 
ATOM   1291 N  N   . ILE A 1 177 ? 11.681  12.323 6.062   1.00 12.71 ? 177  ILE A N   1 
ATOM   1292 C  CA  . ILE A 1 177 ? 10.617  11.333 5.889   1.00 13.47 ? 177  ILE A CA  1 
ATOM   1293 C  C   . ILE A 1 177 ? 10.623  10.811 4.453   1.00 14.05 ? 177  ILE A C   1 
ATOM   1294 O  O   . ILE A 1 177 ? 10.446  11.591 3.523   1.00 13.94 ? 177  ILE A O   1 
ATOM   1295 C  CB  . ILE A 1 177 ? 9.212   11.922 6.173   1.00 13.83 ? 177  ILE A CB  1 
ATOM   1296 C  CG1 . ILE A 1 177 ? 9.102   12.358 7.634   1.00 13.98 ? 177  ILE A CG1 1 
ATOM   1297 C  CG2 . ILE A 1 177 ? 8.143   10.863 5.891   1.00 14.93 ? 177  ILE A CG2 1 
ATOM   1298 C  CD1 . ILE A 1 177 ? 7.794   13.043 7.971   1.00 12.72 ? 177  ILE A CD1 1 
ATOM   1299 N  N   . GLY A 1 178 ? 10.849  9.507  4.277   1.00 13.65 ? 178  GLY A N   1 
ATOM   1300 C  CA  . GLY A 1 178 ? 10.850  8.919  2.940   1.00 13.45 ? 178  GLY A CA  1 
ATOM   1301 C  C   . GLY A 1 178 ? 12.165  8.460  2.307   1.00 14.66 ? 178  GLY A C   1 
ATOM   1302 O  O   . GLY A 1 178 ? 12.163  7.985  1.163   1.00 14.87 ? 178  GLY A O   1 
ATOM   1303 N  N   . LEU A 1 179 ? 13.281  8.583  3.028   1.00 13.85 ? 179  LEU A N   1 
ATOM   1304 C  CA  . LEU A 1 179 ? 14.599  8.188  2.517   1.00 12.48 ? 179  LEU A CA  1 
ATOM   1305 C  C   . LEU A 1 179 ? 14.697  6.751  1.999   1.00 13.54 ? 179  LEU A C   1 
ATOM   1306 O  O   . LEU A 1 179 ? 14.136  5.825  2.587   1.00 15.07 ? 179  LEU A O   1 
ATOM   1307 C  CB  . LEU A 1 179 ? 15.662  8.386  3.602   1.00 9.80  ? 179  LEU A CB  1 
ATOM   1308 C  CG  . LEU A 1 179 ? 15.725  9.765  4.241   1.00 9.83  ? 179  LEU A CG  1 
ATOM   1309 C  CD1 . LEU A 1 179 ? 16.875  9.817  5.230   1.00 9.02  ? 179  LEU A CD1 1 
ATOM   1310 C  CD2 . LEU A 1 179 ? 15.890  10.820 3.149   1.00 11.20 ? 179  LEU A CD2 1 
ATOM   1311 N  N   . ARG A 1 180 ? 15.431  6.566  0.903   1.00 14.73 ? 180  ARG A N   1 
ATOM   1312 C  CA  . ARG A 1 180 ? 15.607  5.232  0.324   1.00 16.58 ? 180  ARG A CA  1 
ATOM   1313 C  C   . ARG A 1 180 ? 16.831  5.151  -0.602  1.00 17.21 ? 180  ARG A C   1 
ATOM   1314 O  O   . ARG A 1 180 ? 17.115  4.092  -1.164  1.00 16.15 ? 180  ARG A O   1 
ATOM   1315 C  CB  . ARG A 1 180 ? 14.327  4.803  -0.422  1.00 18.59 ? 180  ARG A CB  1 
ATOM   1316 C  CG  . ARG A 1 180 ? 14.196  5.347  -1.839  1.00 19.82 ? 180  ARG A CG  1 
ATOM   1317 C  CD  . ARG A 1 180 ? 12.774  5.241  -2.347  1.00 20.53 ? 180  ARG A CD  1 
ATOM   1318 N  NE  . ARG A 1 180 ? 11.910  6.176  -1.646  1.00 20.75 ? 180  ARG A NE  1 
ATOM   1319 C  CZ  . ARG A 1 180 ? 11.040  6.990  -2.232  1.00 17.89 ? 180  ARG A CZ  1 
ATOM   1320 N  NH1 . ARG A 1 180 ? 10.888  7.004  -3.549  1.00 14.63 ? 180  ARG A NH1 1 
ATOM   1321 N  NH2 . ARG A 1 180 ? 10.323  7.805  -1.486  1.00 20.05 ? 180  ARG A NH2 1 
ATOM   1322 N  N   . ASP A 1 181 ? 17.551  6.268  -0.746  1.00 18.25 ? 181  ASP A N   1 
ATOM   1323 C  CA  . ASP A 1 181 ? 18.765  6.329  -1.575  1.00 19.61 ? 181  ASP A CA  1 
ATOM   1324 C  C   . ASP A 1 181 ? 19.748  7.390  -1.054  1.00 20.28 ? 181  ASP A C   1 
ATOM   1325 O  O   . ASP A 1 181 ? 19.945  8.445  -1.666  1.00 19.74 ? 181  ASP A O   1 
ATOM   1326 C  CB  . ASP A 1 181 ? 18.419  6.637  -3.031  1.00 21.57 ? 181  ASP A CB  1 
ATOM   1327 C  CG  . ASP A 1 181 ? 19.655  6.744  -3.906  1.00 23.18 ? 181  ASP A CG  1 
ATOM   1328 O  OD1 . ASP A 1 181 ? 20.436  5.776  -3.956  1.00 25.20 ? 181  ASP A OD1 1 
ATOM   1329 O  OD2 . ASP A 1 181 ? 19.848  7.799  -4.541  1.00 27.93 ? 181  ASP A OD2 1 
ATOM   1330 N  N   . VAL A 1 182 ? 20.367  7.085  0.081   1.00 19.02 ? 182  VAL A N   1 
ATOM   1331 C  CA  . VAL A 1 182 ? 21.307  7.979  0.736   1.00 18.30 ? 182  VAL A CA  1 
ATOM   1332 C  C   . VAL A 1 182 ? 22.718  7.563  0.376   1.00 17.27 ? 182  VAL A C   1 
ATOM   1333 O  O   . VAL A 1 182 ? 23.023  6.376  0.386   1.00 15.70 ? 182  VAL A O   1 
ATOM   1334 C  CB  . VAL A 1 182 ? 21.150  7.882  2.260   1.00 18.07 ? 182  VAL A CB  1 
ATOM   1335 C  CG1 . VAL A 1 182 ? 22.013  8.919  2.946   1.00 20.06 ? 182  VAL A CG1 1 
ATOM   1336 C  CG2 . VAL A 1 182 ? 19.686  8.033  2.632   1.00 20.05 ? 182  VAL A CG2 1 
ATOM   1337 N  N   . ASP A 1 183 ? 23.577  8.532  0.068   1.00 17.89 ? 183  ASP A N   1 
ATOM   1338 C  CA  . ASP A 1 183 ? 24.961  8.220  -0.280  1.00 17.04 ? 183  ASP A CA  1 
ATOM   1339 C  C   . ASP A 1 183 ? 25.691  7.731  0.973   1.00 16.85 ? 183  ASP A C   1 
ATOM   1340 O  O   . ASP A 1 183 ? 25.294  8.063  2.089   1.00 16.78 ? 183  ASP A O   1 
ATOM   1341 C  CB  . ASP A 1 183 ? 25.666  9.458  -0.861  1.00 18.30 ? 183  ASP A CB  1 
ATOM   1342 C  CG  . ASP A 1 183 ? 25.078  9.902  -2.207  1.00 20.56 ? 183  ASP A CG  1 
ATOM   1343 O  OD1 . ASP A 1 183 ? 24.473  9.071  -2.911  1.00 24.97 ? 183  ASP A OD1 1 
ATOM   1344 O  OD2 . ASP A 1 183 ? 25.232  11.082 -2.580  1.00 21.84 ? 183  ASP A OD2 1 
ATOM   1345 N  N   . PRO A 1 184 ? 26.760  6.920  0.805   1.00 17.11 ? 184  PRO A N   1 
ATOM   1346 C  CA  . PRO A 1 184 ? 27.536  6.394  1.940   1.00 16.37 ? 184  PRO A CA  1 
ATOM   1347 C  C   . PRO A 1 184 ? 28.052  7.499  2.868   1.00 15.86 ? 184  PRO A C   1 
ATOM   1348 O  O   . PRO A 1 184 ? 28.163  7.312  4.084   1.00 15.17 ? 184  PRO A O   1 
ATOM   1349 C  CB  . PRO A 1 184 ? 28.672  5.633  1.255   1.00 17.19 ? 184  PRO A CB  1 
ATOM   1350 C  CG  . PRO A 1 184 ? 28.025  5.139  0.004   1.00 15.72 ? 184  PRO A CG  1 
ATOM   1351 C  CD  . PRO A 1 184 ? 27.267  6.362  -0.464  1.00 15.22 ? 184  PRO A CD  1 
ATOM   1352 N  N   . GLY A 1 185 ? 28.376  8.644  2.278   1.00 14.18 ? 185  GLY A N   1 
ATOM   1353 C  CA  . GLY A 1 185 ? 28.848  9.764  3.058   1.00 15.34 ? 185  GLY A CA  1 
ATOM   1354 C  C   . GLY A 1 185 ? 27.680  10.431 3.759   1.00 15.37 ? 185  GLY A C   1 
ATOM   1355 O  O   . GLY A 1 185 ? 27.786  10.819 4.925   1.00 15.22 ? 185  GLY A O   1 
ATOM   1356 N  N   . GLU A 1 186 ? 26.560  10.567 3.051   1.00 15.12 ? 186  GLU A N   1 
ATOM   1357 C  CA  . GLU A 1 186 ? 25.372  11.181 3.632   1.00 14.06 ? 186  GLU A CA  1 
ATOM   1358 C  C   . GLU A 1 186 ? 24.918  10.372 4.844   1.00 14.81 ? 186  GLU A C   1 
ATOM   1359 O  O   . GLU A 1 186 ? 24.516  10.931 5.866   1.00 14.69 ? 186  GLU A O   1 
ATOM   1360 C  CB  . GLU A 1 186 ? 24.234  11.230 2.620   1.00 13.99 ? 186  GLU A CB  1 
ATOM   1361 C  CG  . GLU A 1 186 ? 24.371  12.283 1.542   1.00 15.99 ? 186  GLU A CG  1 
ATOM   1362 C  CD  . GLU A 1 186 ? 23.153  12.328 0.639   1.00 15.40 ? 186  GLU A CD  1 
ATOM   1363 O  OE1 . GLU A 1 186 ? 22.957  11.382 -0.153  1.00 12.45 ? 186  GLU A OE1 1 
ATOM   1364 O  OE2 . GLU A 1 186 ? 22.381  13.302 0.739   1.00 16.13 ? 186  GLU A OE2 1 
ATOM   1365 N  N   . HIS A 1 187 ? 24.974  9.049  4.723   1.00 13.41 ? 187  HIS A N   1 
ATOM   1366 C  CA  . HIS A 1 187 ? 24.564  8.172  5.813   1.00 12.94 ? 187  HIS A CA  1 
ATOM   1367 C  C   . HIS A 1 187 ? 25.477  8.371  7.021   1.00 14.57 ? 187  HIS A C   1 
ATOM   1368 O  O   . HIS A 1 187 ? 25.038  8.285  8.175   1.00 13.96 ? 187  HIS A O   1 
ATOM   1369 C  CB  . HIS A 1 187 ? 24.612  6.708  5.372   1.00 10.91 ? 187  HIS A CB  1 
ATOM   1370 C  CG  . HIS A 1 187 ? 24.107  5.760  6.409   1.00 9.27  ? 187  HIS A CG  1 
ATOM   1371 N  ND1 . HIS A 1 187 ? 24.886  4.760  6.947   1.00 8.79  ? 187  HIS A ND1 1 
ATOM   1372 C  CD2 . HIS A 1 187 ? 22.915  5.695  7.049   1.00 10.12 ? 187  HIS A CD2 1 
ATOM   1373 C  CE1 . HIS A 1 187 ? 24.197  4.122  7.878   1.00 7.70  ? 187  HIS A CE1 1 
ATOM   1374 N  NE2 . HIS A 1 187 ? 22.997  4.671  7.958   1.00 8.35  ? 187  HIS A NE2 1 
ATOM   1375 N  N   . TYR A 1 188 ? 26.751  8.632  6.744   1.00 14.40 ? 188  TYR A N   1 
ATOM   1376 C  CA  . TYR A 1 188 ? 27.728  8.855  7.793   1.00 15.77 ? 188  TYR A CA  1 
ATOM   1377 C  C   . TYR A 1 188 ? 27.374  10.110 8.569   1.00 15.68 ? 188  TYR A C   1 
ATOM   1378 O  O   . TYR A 1 188 ? 27.527  10.157 9.782   1.00 18.74 ? 188  TYR A O   1 
ATOM   1379 C  CB  . TYR A 1 188 ? 29.117  9.016  7.193   1.00 17.74 ? 188  TYR A CB  1 
ATOM   1380 C  CG  . TYR A 1 188 ? 30.154  9.409  8.214   1.00 19.27 ? 188  TYR A CG  1 
ATOM   1381 C  CD1 . TYR A 1 188 ? 30.662  8.475  9.122   1.00 18.59 ? 188  TYR A CD1 1 
ATOM   1382 C  CD2 . TYR A 1 188 ? 30.614  10.724 8.289   1.00 18.98 ? 188  TYR A CD2 1 
ATOM   1383 C  CE1 . TYR A 1 188 ? 31.607  8.846  10.079  1.00 18.05 ? 188  TYR A CE1 1 
ATOM   1384 C  CE2 . TYR A 1 188 ? 31.552  11.102 9.239   1.00 20.29 ? 188  TYR A CE2 1 
ATOM   1385 C  CZ  . TYR A 1 188 ? 32.046  10.161 10.131  1.00 19.35 ? 188  TYR A CZ  1 
ATOM   1386 O  OH  . TYR A 1 188 ? 32.984  10.548 11.064  1.00 22.37 ? 188  TYR A OH  1 
ATOM   1387 N  N   . ILE A 1 189 ? 26.907  11.127 7.859   1.00 15.52 ? 189  ILE A N   1 
ATOM   1388 C  CA  . ILE A 1 189 ? 26.523  12.394 8.473   1.00 16.34 ? 189  ILE A CA  1 
ATOM   1389 C  C   . ILE A 1 189 ? 25.245  12.203 9.290   1.00 18.27 ? 189  ILE A C   1 
ATOM   1390 O  O   . ILE A 1 189 ? 25.136  12.699 10.418  1.00 18.70 ? 189  ILE A O   1 
ATOM   1391 C  CB  . ILE A 1 189 ? 26.280  13.479 7.387   1.00 17.63 ? 189  ILE A CB  1 
ATOM   1392 C  CG1 . ILE A 1 189 ? 27.530  13.635 6.520   1.00 17.47 ? 189  ILE A CG1 1 
ATOM   1393 C  CG2 . ILE A 1 189 ? 25.911  14.813 8.024   1.00 17.54 ? 189  ILE A CG2 1 
ATOM   1394 C  CD1 . ILE A 1 189 ? 28.763  14.043 7.287   1.00 18.19 ? 189  ILE A CD1 1 
ATOM   1395 N  N   . LEU A 1 190 ? 24.275  11.483 8.730   1.00 18.48 ? 190  LEU A N   1 
ATOM   1396 C  CA  . LEU A 1 190 ? 23.022  11.246 9.450   1.00 20.46 ? 190  LEU A CA  1 
ATOM   1397 C  C   . LEU A 1 190 ? 23.316  10.650 10.820  1.00 19.05 ? 190  LEU A C   1 
ATOM   1398 O  O   . LEU A 1 190 ? 22.946  11.212 11.848  1.00 19.49 ? 190  LEU A O   1 
ATOM   1399 C  CB  . LEU A 1 190 ? 22.119  10.279 8.680   1.00 20.54 ? 190  LEU A CB  1 
ATOM   1400 C  CG  . LEU A 1 190 ? 21.355  10.783 7.456   1.00 23.92 ? 190  LEU A CG  1 
ATOM   1401 C  CD1 . LEU A 1 190 ? 20.651  9.597  6.782   1.00 22.63 ? 190  LEU A CD1 1 
ATOM   1402 C  CD2 . LEU A 1 190 ? 20.348  11.844 7.874   1.00 21.46 ? 190  LEU A CD2 1 
ATOM   1403 N  N   . LYS A 1 191 ? 23.994  9.506  10.806  1.00 18.93 ? 191  LYS A N   1 
ATOM   1404 C  CA  . LYS A 1 191 ? 24.359  8.768  12.010  1.00 17.56 ? 191  LYS A CA  1 
ATOM   1405 C  C   . LYS A 1 191 ? 25.317  9.488  12.948  1.00 15.75 ? 191  LYS A C   1 
ATOM   1406 O  O   . LYS A 1 191 ? 25.166  9.408  14.159  1.00 17.34 ? 191  LYS A O   1 
ATOM   1407 C  CB  . LYS A 1 191 ? 24.954  7.421  11.612  1.00 18.36 ? 191  LYS A CB  1 
ATOM   1408 C  CG  . LYS A 1 191 ? 24.065  6.609  10.670  1.00 19.54 ? 191  LYS A CG  1 
ATOM   1409 C  CD  . LYS A 1 191 ? 22.692  6.299  11.274  1.00 18.62 ? 191  LYS A CD  1 
ATOM   1410 C  CE  . LYS A 1 191 ? 22.808  5.472  12.547  1.00 19.31 ? 191  LYS A CE  1 
ATOM   1411 N  NZ  . LYS A 1 191 ? 21.484  5.057  13.083  1.00 20.23 ? 191  LYS A NZ  1 
ATOM   1412 N  N   . THR A 1 192 ? 26.304  10.184 12.398  1.00 15.03 ? 192  THR A N   1 
ATOM   1413 C  CA  . THR A 1 192 ? 27.262  10.917 13.224  1.00 14.88 ? 192  THR A CA  1 
ATOM   1414 C  C   . THR A 1 192 ? 26.623  12.104 13.939  1.00 14.18 ? 192  THR A C   1 
ATOM   1415 O  O   . THR A 1 192 ? 26.787  12.276 15.149  1.00 12.93 ? 192  THR A O   1 
ATOM   1416 C  CB  . THR A 1 192 ? 28.423  11.433 12.380  1.00 14.60 ? 192  THR A CB  1 
ATOM   1417 O  OG1 . THR A 1 192 ? 29.198  10.319 11.941  1.00 17.78 ? 192  THR A OG1 1 
ATOM   1418 C  CG2 . THR A 1 192 ? 29.305  12.372 13.185  1.00 16.87 ? 192  THR A CG2 1 
ATOM   1419 N  N   . LEU A 1 193 ? 25.896  12.921 13.181  1.00 14.56 ? 193  LEU A N   1 
ATOM   1420 C  CA  . LEU A 1 193 ? 25.227  14.101 13.726  1.00 15.25 ? 193  LEU A CA  1 
ATOM   1421 C  C   . LEU A 1 193 ? 23.965  13.770 14.517  1.00 13.61 ? 193  LEU A C   1 
ATOM   1422 O  O   . LEU A 1 193 ? 23.493  14.575 15.312  1.00 13.71 ? 193  LEU A O   1 
ATOM   1423 C  CB  . LEU A 1 193 ? 24.889  15.074 12.596  1.00 15.81 ? 193  LEU A CB  1 
ATOM   1424 C  CG  . LEU A 1 193 ? 25.912  16.180 12.324  1.00 16.46 ? 193  LEU A CG  1 
ATOM   1425 C  CD1 . LEU A 1 193 ? 27.320  15.606 12.299  1.00 16.02 ? 193  LEU A CD1 1 
ATOM   1426 C  CD2 . LEU A 1 193 ? 25.566  16.867 11.009  1.00 14.96 ? 193  LEU A CD2 1 
ATOM   1427 N  N   . GLY A 1 194 ? 23.424  12.581 14.291  1.00 12.87 ? 194  GLY A N   1 
ATOM   1428 C  CA  . GLY A 1 194 ? 22.234  12.173 15.002  1.00 13.29 ? 194  GLY A CA  1 
ATOM   1429 C  C   . GLY A 1 194 ? 21.001  12.889 14.506  1.00 14.89 ? 194  GLY A C   1 
ATOM   1430 O  O   . GLY A 1 194 ? 20.204  13.375 15.304  1.00 15.66 ? 194  GLY A O   1 
ATOM   1431 N  N   . ILE A 1 195 ? 20.840  12.962 13.189  1.00 15.51 ? 195  ILE A N   1 
ATOM   1432 C  CA  . ILE A 1 195 ? 19.682  13.628 12.605  1.00 15.19 ? 195  ILE A CA  1 
ATOM   1433 C  C   . ILE A 1 195 ? 18.513  12.663 12.625  1.00 15.19 ? 195  ILE A C   1 
ATOM   1434 O  O   . ILE A 1 195 ? 18.671  11.489 12.301  1.00 17.95 ? 195  ILE A O   1 
ATOM   1435 C  CB  . ILE A 1 195 ? 19.926  14.031 11.140  1.00 14.63 ? 195  ILE A CB  1 
ATOM   1436 C  CG1 . ILE A 1 195 ? 21.267  14.747 11.009  1.00 12.62 ? 195  ILE A CG1 1 
ATOM   1437 C  CG2 . ILE A 1 195 ? 18.773  14.915 10.643  1.00 11.65 ? 195  ILE A CG2 1 
ATOM   1438 C  CD1 . ILE A 1 195 ? 21.370  15.978 11.845  1.00 16.65 ? 195  ILE A CD1 1 
ATOM   1439 N  N   . LYS A 1 196 ? 17.343  13.153 13.014  1.00 14.93 ? 196  LYS A N   1 
ATOM   1440 C  CA  . LYS A 1 196 ? 16.150  12.315 13.056  1.00 12.56 ? 196  LYS A CA  1 
ATOM   1441 C  C   . LYS A 1 196 ? 15.684  12.048 11.623  1.00 12.69 ? 196  LYS A C   1 
ATOM   1442 O  O   . LYS A 1 196 ? 15.552  12.977 10.816  1.00 10.97 ? 196  LYS A O   1 
ATOM   1443 C  CB  . LYS A 1 196 ? 15.040  13.025 13.828  1.00 10.91 ? 196  LYS A CB  1 
ATOM   1444 C  CG  . LYS A 1 196 ? 13.805  12.192 14.049  1.00 9.30  ? 196  LYS A CG  1 
ATOM   1445 C  CD  . LYS A 1 196 ? 14.116  11.044 14.970  1.00 11.05 ? 196  LYS A CD  1 
ATOM   1446 C  CE  . LYS A 1 196 ? 12.855  10.506 15.595  1.00 13.93 ? 196  LYS A CE  1 
ATOM   1447 N  NZ  . LYS A 1 196 ? 13.125  9.173  16.180  1.00 14.58 ? 196  LYS A NZ  1 
ATOM   1448 N  N   . TYR A 1 197 ? 15.440  10.778 11.310  1.00 11.72 ? 197  TYR A N   1 
ATOM   1449 C  CA  . TYR A 1 197 ? 14.986  10.409 9.980   1.00 13.18 ? 197  TYR A CA  1 
ATOM   1450 C  C   . TYR A 1 197 ? 14.071  9.193  10.023  1.00 13.01 ? 197  TYR A C   1 
ATOM   1451 O  O   . TYR A 1 197 ? 14.230  8.307  10.858  1.00 14.88 ? 197  TYR A O   1 
ATOM   1452 C  CB  . TYR A 1 197 ? 16.186  10.113 9.065   1.00 10.39 ? 197  TYR A CB  1 
ATOM   1453 C  CG  . TYR A 1 197 ? 16.975  8.888  9.488   1.00 14.31 ? 197  TYR A CG  1 
ATOM   1454 C  CD1 . TYR A 1 197 ? 16.537  7.596  9.161   1.00 11.95 ? 197  TYR A CD1 1 
ATOM   1455 C  CD2 . TYR A 1 197 ? 18.113  9.014  10.288  1.00 12.49 ? 197  TYR A CD2 1 
ATOM   1456 C  CE1 . TYR A 1 197 ? 17.204  6.471  9.631   1.00 13.30 ? 197  TYR A CE1 1 
ATOM   1457 C  CE2 . TYR A 1 197 ? 18.785  7.897  10.764  1.00 13.31 ? 197  TYR A CE2 1 
ATOM   1458 C  CZ  . TYR A 1 197 ? 18.324  6.632  10.442  1.00 14.54 ? 197  TYR A CZ  1 
ATOM   1459 O  OH  . TYR A 1 197 ? 18.943  5.538  10.999  1.00 16.77 ? 197  TYR A OH  1 
ATOM   1460 N  N   . PHE A 1 198 ? 13.100  9.174  9.122   1.00 12.78 ? 198  PHE A N   1 
ATOM   1461 C  CA  . PHE A 1 198 ? 12.180  8.053  8.999   1.00 12.56 ? 198  PHE A CA  1 
ATOM   1462 C  C   . PHE A 1 198 ? 12.291  7.598  7.538   1.00 12.83 ? 198  PHE A C   1 
ATOM   1463 O  O   . PHE A 1 198 ? 11.589  8.116  6.666   1.00 10.62 ? 198  PHE A O   1 
ATOM   1464 C  CB  . PHE A 1 198 ? 10.740  8.476  9.313   1.00 11.97 ? 198  PHE A CB  1 
ATOM   1465 C  CG  . PHE A 1 198 ? 10.495  8.782  10.763  1.00 12.97 ? 198  PHE A CG  1 
ATOM   1466 C  CD1 . PHE A 1 198 ? 10.660  10.080 11.261  1.00 12.34 ? 198  PHE A CD1 1 
ATOM   1467 C  CD2 . PHE A 1 198 ? 10.093  7.774  11.638  1.00 11.58 ? 198  PHE A CD2 1 
ATOM   1468 C  CE1 . PHE A 1 198 ? 10.424  10.368 12.608  1.00 11.14 ? 198  PHE A CE1 1 
ATOM   1469 C  CE2 . PHE A 1 198 ? 9.853   8.052  12.990  1.00 11.14 ? 198  PHE A CE2 1 
ATOM   1470 C  CZ  . PHE A 1 198 ? 10.019  9.354  13.474  1.00 10.88 ? 198  PHE A CZ  1 
ATOM   1471 N  N   . SER A 1 199 ? 13.198  6.651  7.283   1.00 11.82 ? 199  SER A N   1 
ATOM   1472 C  CA  . SER A 1 199 ? 13.420  6.126  5.939   1.00 11.95 ? 199  SER A CA  1 
ATOM   1473 C  C   . SER A 1 199 ? 12.231  5.244  5.589   1.00 12.35 ? 199  SER A C   1 
ATOM   1474 O  O   . SER A 1 199 ? 11.345  5.051  6.426   1.00 11.95 ? 199  SER A O   1 
ATOM   1475 C  CB  . SER A 1 199 ? 14.722  5.307  5.895   1.00 12.25 ? 199  SER A CB  1 
ATOM   1476 O  OG  . SER A 1 199 ? 14.553  4.008  6.445   1.00 11.69 ? 199  SER A OG  1 
ATOM   1477 N  N   . MET A 1 200 ? 12.193  4.701  4.374   1.00 12.08 ? 200  MET A N   1 
ATOM   1478 C  CA  . MET A 1 200 ? 11.054  3.849  4.033   1.00 12.16 ? 200  MET A CA  1 
ATOM   1479 C  C   . MET A 1 200 ? 10.938  2.679  5.006   1.00 11.42 ? 200  MET A C   1 
ATOM   1480 O  O   . MET A 1 200 ? 9.833   2.219  5.305   1.00 10.60 ? 200  MET A O   1 
ATOM   1481 C  CB  . MET A 1 200 ? 11.141  3.326  2.589   1.00 11.63 ? 200  MET A CB  1 
ATOM   1482 C  CG  . MET A 1 200 ? 10.854  4.369  1.510   1.00 7.66  ? 200  MET A CG  1 
ATOM   1483 S  SD  . MET A 1 200 ? 9.569   5.592  1.918   1.00 11.49 ? 200  MET A SD  1 
ATOM   1484 C  CE  . MET A 1 200 ? 8.129   4.618  2.019   1.00 8.39  ? 200  MET A CE  1 
ATOM   1485 N  N   . THR A 1 201 ? 12.079  2.211  5.507   1.00 10.43 ? 201  THR A N   1 
ATOM   1486 C  CA  . THR A 1 201 ? 12.119  1.097  6.462   1.00 10.19 ? 201  THR A CA  1 
ATOM   1487 C  C   . THR A 1 201 ? 11.268  1.413  7.699   1.00 9.17  ? 201  THR A C   1 
ATOM   1488 O  O   . THR A 1 201 ? 10.502  0.570  8.178   1.00 4.44  ? 201  THR A O   1 
ATOM   1489 C  CB  . THR A 1 201 ? 13.592  0.796  6.887   1.00 10.11 ? 201  THR A CB  1 
ATOM   1490 O  OG1 . THR A 1 201 ? 14.361  0.459  5.726   1.00 8.72  ? 201  THR A OG1 1 
ATOM   1491 C  CG2 . THR A 1 201 ? 13.650  -0.361 7.874   1.00 11.90 ? 201  THR A CG2 1 
ATOM   1492 N  N   . GLU A 1 202 ? 11.388  2.645  8.185   1.00 9.72  ? 202  GLU A N   1 
ATOM   1493 C  CA  . GLU A 1 202 ? 10.641  3.098  9.356   1.00 11.58 ? 202  GLU A CA  1 
ATOM   1494 C  C   . GLU A 1 202 ? 9.168   3.295  9.033   1.00 11.42 ? 202  GLU A C   1 
ATOM   1495 O  O   . GLU A 1 202 ? 8.291   2.956  9.842   1.00 11.04 ? 202  GLU A O   1 
ATOM   1496 C  CB  . GLU A 1 202 ? 11.219  4.417  9.892   1.00 12.18 ? 202  GLU A CB  1 
ATOM   1497 C  CG  . GLU A 1 202 ? 12.462  4.274  10.780  1.00 12.90 ? 202  GLU A CG  1 
ATOM   1498 C  CD  . GLU A 1 202 ? 13.666  3.704  10.050  1.00 13.99 ? 202  GLU A CD  1 
ATOM   1499 O  OE1 . GLU A 1 202 ? 14.137  4.340  9.083   1.00 13.71 ? 202  GLU A OE1 1 
ATOM   1500 O  OE2 . GLU A 1 202 ? 14.150  2.621  10.449  1.00 11.88 ? 202  GLU A OE2 1 
ATOM   1501 N  N   . VAL A 1 203 ? 8.897   3.856  7.857   1.00 10.62 ? 203  VAL A N   1 
ATOM   1502 C  CA  . VAL A 1 203 ? 7.527   4.088  7.432   1.00 11.35 ? 203  VAL A CA  1 
ATOM   1503 C  C   . VAL A 1 203 ? 6.839   2.728  7.351   1.00 13.75 ? 203  VAL A C   1 
ATOM   1504 O  O   . VAL A 1 203 ? 5.654   2.592  7.665   1.00 14.96 ? 203  VAL A O   1 
ATOM   1505 C  CB  . VAL A 1 203 ? 7.473   4.772  6.052   1.00 9.09  ? 203  VAL A CB  1 
ATOM   1506 C  CG1 . VAL A 1 203 ? 6.027   5.011  5.653   1.00 8.34  ? 203  VAL A CG1 1 
ATOM   1507 C  CG2 . VAL A 1 203 ? 8.238   6.088  6.094   1.00 8.30  ? 203  VAL A CG2 1 
ATOM   1508 N  N   . ASP A 1 204 ? 7.601   1.719  6.941   1.00 13.69 ? 204  ASP A N   1 
ATOM   1509 C  CA  . ASP A 1 204 ? 7.083   0.360  6.833   1.00 15.30 ? 204  ASP A CA  1 
ATOM   1510 C  C   . ASP A 1 204 ? 6.831   -0.223 8.219   1.00 16.22 ? 204  ASP A C   1 
ATOM   1511 O  O   . ASP A 1 204 ? 5.818   -0.884 8.449   1.00 16.16 ? 204  ASP A O   1 
ATOM   1512 C  CB  . ASP A 1 204 ? 8.075   -0.561 6.104   1.00 14.06 ? 204  ASP A CB  1 
ATOM   1513 C  CG  . ASP A 1 204 ? 8.239   -0.214 4.643   1.00 12.88 ? 204  ASP A CG  1 
ATOM   1514 O  OD1 . ASP A 1 204 ? 7.381   0.502  4.096   1.00 11.04 ? 204  ASP A OD1 1 
ATOM   1515 O  OD2 . ASP A 1 204 ? 9.227   -0.672 4.035   1.00 13.80 ? 204  ASP A OD2 1 
ATOM   1516 N  N   . ARG A 1 205 ? 7.753   0.010  9.148   1.00 16.23 ? 205  ARG A N   1 
ATOM   1517 C  CA  . ARG A 1 205 ? 7.567   -0.548 10.473  1.00 16.24 ? 205  ARG A CA  1 
ATOM   1518 C  C   . ARG A 1 205 ? 6.551   0.191  11.339  1.00 15.30 ? 205  ARG A C   1 
ATOM   1519 O  O   . ARG A 1 205 ? 5.734   -0.452 11.998  1.00 16.27 ? 205  ARG A O   1 
ATOM   1520 C  CB  . ARG A 1 205 ? 8.908   -0.685 11.208  1.00 17.52 ? 205  ARG A CB  1 
ATOM   1521 C  CG  . ARG A 1 205 ? 9.369   0.492  12.043  1.00 20.85 ? 205  ARG A CG  1 
ATOM   1522 C  CD  . ARG A 1 205 ? 10.305  -0.010 13.162  1.00 20.83 ? 205  ARG A CD  1 
ATOM   1523 N  NE  . ARG A 1 205 ? 11.375  -0.849 12.621  1.00 17.84 ? 205  ARG A NE  1 
ATOM   1524 C  CZ  . ARG A 1 205 ? 12.431  -0.380 11.968  1.00 17.98 ? 205  ARG A CZ  1 
ATOM   1525 N  NH1 . ARG A 1 205 ? 12.564  0.928  11.788  1.00 18.08 ? 205  ARG A NH1 1 
ATOM   1526 N  NH2 . ARG A 1 205 ? 13.338  -1.214 11.474  1.00 10.59 ? 205  ARG A NH2 1 
ATOM   1527 N  N   . LEU A 1 206 ? 6.569   1.522  11.322  1.00 12.79 ? 206  LEU A N   1 
ATOM   1528 C  CA  . LEU A 1 206 ? 5.636   2.291  12.151  1.00 12.61 ? 206  LEU A CA  1 
ATOM   1529 C  C   . LEU A 1 206 ? 4.282   2.601  11.520  1.00 12.61 ? 206  LEU A C   1 
ATOM   1530 O  O   . LEU A 1 206 ? 3.279   2.767  12.225  1.00 10.18 ? 206  LEU A O   1 
ATOM   1531 C  CB  . LEU A 1 206 ? 6.260   3.629  12.567  1.00 11.50 ? 206  LEU A CB  1 
ATOM   1532 C  CG  . LEU A 1 206 ? 7.545   3.710  13.387  1.00 10.96 ? 206  LEU A CG  1 
ATOM   1533 C  CD1 . LEU A 1 206 ? 7.781   5.178  13.753  1.00 14.44 ? 206  LEU A CD1 1 
ATOM   1534 C  CD2 . LEU A 1 206 ? 7.448   2.853  14.639  1.00 10.21 ? 206  LEU A CD2 1 
ATOM   1535 N  N   . GLY A 1 207 ? 4.265   2.678  10.192  1.00 12.52 ? 207  GLY A N   1 
ATOM   1536 C  CA  . GLY A 1 207 ? 3.059   3.040  9.483   1.00 12.95 ? 207  GLY A CA  1 
ATOM   1537 C  C   . GLY A 1 207 ? 3.136   4.553  9.468   1.00 13.49 ? 207  GLY A C   1 
ATOM   1538 O  O   . GLY A 1 207 ? 3.681   5.134  10.404  1.00 14.78 ? 207  GLY A O   1 
ATOM   1539 N  N   . ILE A 1 208 ? 2.607   5.197  8.434   1.00 13.37 ? 208  ILE A N   1 
ATOM   1540 C  CA  . ILE A 1 208 ? 2.670   6.653  8.341   1.00 13.92 ? 208  ILE A CA  1 
ATOM   1541 C  C   . ILE A 1 208 ? 2.008   7.378  9.515   1.00 14.80 ? 208  ILE A C   1 
ATOM   1542 O  O   . ILE A 1 208 ? 2.364   8.514  9.819   1.00 15.74 ? 208  ILE A O   1 
ATOM   1543 C  CB  . ILE A 1 208 ? 2.051   7.170  7.002   1.00 14.13 ? 208  ILE A CB  1 
ATOM   1544 C  CG1 . ILE A 1 208 ? 2.519   8.603  6.744   1.00 12.38 ? 208  ILE A CG1 1 
ATOM   1545 C  CG2 . ILE A 1 208 ? 0.516   7.118  7.051   1.00 13.97 ? 208  ILE A CG2 1 
ATOM   1546 C  CD1 . ILE A 1 208 ? 4.024   8.727  6.574   1.00 12.63 ? 208  ILE A CD1 1 
ATOM   1547 N  N   . GLY A 1 209 ? 1.061   6.720  10.178  1.00 15.15 ? 209  GLY A N   1 
ATOM   1548 C  CA  . GLY A 1 209 ? 0.381   7.335  11.310  1.00 14.64 ? 209  GLY A CA  1 
ATOM   1549 C  C   . GLY A 1 209 ? 1.293   7.595  12.497  1.00 15.77 ? 209  GLY A C   1 
ATOM   1550 O  O   . GLY A 1 209 ? 1.290   8.685  13.071  1.00 16.09 ? 209  GLY A O   1 
ATOM   1551 N  N   . LYS A 1 210 ? 2.074   6.588  12.873  1.00 16.53 ? 210  LYS A N   1 
ATOM   1552 C  CA  . LYS A 1 210 ? 3.004   6.714  13.994  1.00 15.97 ? 210  LYS A CA  1 
ATOM   1553 C  C   . LYS A 1 210 ? 4.188   7.593  13.579  1.00 15.53 ? 210  LYS A C   1 
ATOM   1554 O  O   . LYS A 1 210 ? 4.757   8.304  14.410  1.00 15.42 ? 210  LYS A O   1 
ATOM   1555 C  CB  . LYS A 1 210 ? 3.492   5.326  14.419  1.00 19.19 ? 210  LYS A CB  1 
ATOM   1556 C  CG  . LYS A 1 210 ? 4.112   5.264  15.802  1.00 22.23 ? 210  LYS A CG  1 
ATOM   1557 C  CD  . LYS A 1 210 ? 3.158   5.783  16.866  1.00 24.99 ? 210  LYS A CD  1 
ATOM   1558 C  CE  . LYS A 1 210 ? 3.673   5.476  18.264  1.00 26.80 ? 210  LYS A CE  1 
ATOM   1559 N  NZ  . LYS A 1 210 ? 5.070   5.945  18.502  1.00 26.41 ? 210  LYS A NZ  1 
ATOM   1560 N  N   . VAL A 1 211 ? 4.540   7.555  12.291  1.00 13.05 ? 211  VAL A N   1 
ATOM   1561 C  CA  . VAL A 1 211 ? 5.644   8.362  11.771  1.00 12.89 ? 211  VAL A CA  1 
ATOM   1562 C  C   . VAL A 1 211 ? 5.368   9.856  11.948  1.00 13.88 ? 211  VAL A C   1 
ATOM   1563 O  O   . VAL A 1 211 ? 6.226   10.599 12.436  1.00 12.66 ? 211  VAL A O   1 
ATOM   1564 C  CB  . VAL A 1 211 ? 5.913   8.081  10.262  1.00 12.66 ? 211  VAL A CB  1 
ATOM   1565 C  CG1 . VAL A 1 211 ? 6.852   9.153  9.686   1.00 12.73 ? 211  VAL A CG1 1 
ATOM   1566 C  CG2 . VAL A 1 211 ? 6.552   6.707  10.087  1.00 9.42  ? 211  VAL A CG2 1 
ATOM   1567 N  N   . MET A 1 212 ? 4.171   10.290 11.556  1.00 15.13 ? 212  MET A N   1 
ATOM   1568 C  CA  . MET A 1 212 ? 3.787   11.694 11.677  1.00 15.61 ? 212  MET A CA  1 
ATOM   1569 C  C   . MET A 1 212 ? 3.637   12.140 13.124  1.00 15.58 ? 212  MET A C   1 
ATOM   1570 O  O   . MET A 1 212 ? 3.923   13.289 13.464  1.00 13.97 ? 212  MET A O   1 
ATOM   1571 C  CB  . MET A 1 212 ? 2.482   11.968 10.915  1.00 16.78 ? 212  MET A CB  1 
ATOM   1572 C  CG  . MET A 1 212 ? 2.663   12.098 9.404   1.00 14.63 ? 212  MET A CG  1 
ATOM   1573 S  SD  . MET A 1 212 ? 4.056   13.200 9.004   1.00 15.93 ? 212  MET A SD  1 
ATOM   1574 C  CE  . MET A 1 212 ? 3.361   14.778 9.467   1.00 12.73 ? 212  MET A CE  1 
ATOM   1575 N  N   . GLU A 1 213 ? 3.178   11.231 13.974  1.00 17.46 ? 213  GLU A N   1 
ATOM   1576 C  CA  . GLU A 1 213 ? 3.007   11.554 15.382  1.00 19.54 ? 213  GLU A CA  1 
ATOM   1577 C  C   . GLU A 1 213 ? 4.372   11.741 16.022  1.00 18.00 ? 213  GLU A C   1 
ATOM   1578 O  O   . GLU A 1 213 ? 4.565   12.636 16.845  1.00 18.50 ? 213  GLU A O   1 
ATOM   1579 C  CB  . GLU A 1 213 ? 2.261   10.431 16.111  1.00 22.47 ? 213  GLU A CB  1 
ATOM   1580 C  CG  . GLU A 1 213 ? 2.194   10.641 17.616  1.00 27.14 ? 213  GLU A CG  1 
ATOM   1581 C  CD  . GLU A 1 213 ? 1.609   9.454  18.341  1.00 31.38 ? 213  GLU A CD  1 
ATOM   1582 O  OE1 . GLU A 1 213 ? 2.235   8.367  18.310  1.00 33.28 ? 213  GLU A OE1 1 
ATOM   1583 O  OE2 . GLU A 1 213 ? 0.521   9.611  18.939  1.00 35.07 ? 213  GLU A OE2 1 
ATOM   1584 N  N   . GLU A 1 214 ? 5.314   10.887 15.633  1.00 16.37 ? 214  GLU A N   1 
ATOM   1585 C  CA  . GLU A 1 214 ? 6.664   10.942 16.166  1.00 15.00 ? 214  GLU A CA  1 
ATOM   1586 C  C   . GLU A 1 214 ? 7.507   12.100 15.649  1.00 13.83 ? 214  GLU A C   1 
ATOM   1587 O  O   . GLU A 1 214 ? 8.283   12.680 16.407  1.00 13.81 ? 214  GLU A O   1 
ATOM   1588 C  CB  . GLU A 1 214 ? 7.379   9.617  15.908  1.00 17.70 ? 214  GLU A CB  1 
ATOM   1589 C  CG  . GLU A 1 214 ? 6.963   8.520  16.871  1.00 20.99 ? 214  GLU A CG  1 
ATOM   1590 C  CD  . GLU A 1 214 ? 7.742   7.230  16.672  1.00 23.19 ? 214  GLU A CD  1 
ATOM   1591 O  OE1 . GLU A 1 214 ? 8.974   7.296  16.462  1.00 21.86 ? 214  GLU A OE1 1 
ATOM   1592 O  OE2 . GLU A 1 214 ? 7.120   6.146  16.743  1.00 25.93 ? 214  GLU A OE2 1 
ATOM   1593 N  N   . THR A 1 215 ? 7.377   12.447 14.373  1.00 14.24 ? 215  THR A N   1 
ATOM   1594 C  CA  . THR A 1 215 ? 8.169   13.554 13.853  1.00 14.41 ? 215  THR A CA  1 
ATOM   1595 C  C   . THR A 1 215 ? 7.654   14.884 14.407  1.00 14.23 ? 215  THR A C   1 
ATOM   1596 O  O   . THR A 1 215 ? 8.433   15.809 14.627  1.00 15.03 ? 215  THR A O   1 
ATOM   1597 C  CB  . THR A 1 215 ? 8.162   13.625 12.298  1.00 15.82 ? 215  THR A CB  1 
ATOM   1598 O  OG1 . THR A 1 215 ? 7.022   14.362 11.849  1.00 19.62 ? 215  THR A OG1 1 
ATOM   1599 C  CG2 . THR A 1 215 ? 8.135   12.251 11.696  1.00 11.69 ? 215  THR A CG2 1 
ATOM   1600 N  N   . LEU A 1 216 ? 6.345   14.978 14.632  1.00 14.49 ? 216  LEU A N   1 
ATOM   1601 C  CA  . LEU A 1 216 ? 5.757   16.200 15.170  1.00 14.60 ? 216  LEU A CA  1 
ATOM   1602 C  C   . LEU A 1 216 ? 6.035   16.340 16.660  1.00 14.44 ? 216  LEU A C   1 
ATOM   1603 O  O   . LEU A 1 216 ? 6.268   17.443 17.150  1.00 14.31 ? 216  LEU A O   1 
ATOM   1604 C  CB  . LEU A 1 216 ? 4.243   16.249 14.914  1.00 14.28 ? 216  LEU A CB  1 
ATOM   1605 C  CG  . LEU A 1 216 ? 3.791   16.595 13.491  1.00 13.31 ? 216  LEU A CG  1 
ATOM   1606 C  CD1 . LEU A 1 216 ? 2.278   16.673 13.458  1.00 13.86 ? 216  LEU A CD1 1 
ATOM   1607 C  CD2 . LEU A 1 216 ? 4.395   17.928 13.047  1.00 14.32 ? 216  LEU A CD2 1 
ATOM   1608 N  N   . SER A 1 217 ? 6.013   15.228 17.383  1.00 14.69 ? 217  SER A N   1 
ATOM   1609 C  CA  . SER A 1 217 ? 6.299   15.285 18.805  1.00 16.61 ? 217  SER A CA  1 
ATOM   1610 C  C   . SER A 1 217 ? 7.778   15.605 18.975  1.00 16.16 ? 217  SER A C   1 
ATOM   1611 O  O   . SER A 1 217 ? 8.160   16.313 19.906  1.00 16.67 ? 217  SER A O   1 
ATOM   1612 C  CB  . SER A 1 217 ? 5.987   13.951 19.482  1.00 18.45 ? 217  SER A CB  1 
ATOM   1613 O  OG  . SER A 1 217 ? 7.029   13.019 19.248  1.00 25.00 ? 217  SER A OG  1 
ATOM   1614 N  N   . TYR A 1 218 ? 8.608   15.093 18.066  1.00 16.88 ? 218  TYR A N   1 
ATOM   1615 C  CA  . TYR A 1 218 ? 10.062  15.319 18.112  1.00 18.19 ? 218  TYR A CA  1 
ATOM   1616 C  C   . TYR A 1 218 ? 10.437  16.782 17.867  1.00 18.54 ? 218  TYR A C   1 
ATOM   1617 O  O   . TYR A 1 218 ? 11.387  17.300 18.464  1.00 18.43 ? 218  TYR A O   1 
ATOM   1618 C  CB  . TYR A 1 218 ? 10.768  14.440 17.072  1.00 17.69 ? 218  TYR A CB  1 
ATOM   1619 C  CG  . TYR A 1 218 ? 12.265  14.678 16.946  1.00 18.09 ? 218  TYR A CG  1 
ATOM   1620 C  CD1 . TYR A 1 218 ? 13.176  14.002 17.765  1.00 16.71 ? 218  TYR A CD1 1 
ATOM   1621 C  CD2 . TYR A 1 218 ? 12.773  15.574 15.991  1.00 15.70 ? 218  TYR A CD2 1 
ATOM   1622 C  CE1 . TYR A 1 218 ? 14.567  14.207 17.633  1.00 15.86 ? 218  TYR A CE1 1 
ATOM   1623 C  CE2 . TYR A 1 218 ? 14.156  15.789 15.854  1.00 14.59 ? 218  TYR A CE2 1 
ATOM   1624 C  CZ  . TYR A 1 218 ? 15.048  15.099 16.675  1.00 15.13 ? 218  TYR A CZ  1 
ATOM   1625 O  OH  . TYR A 1 218 ? 16.413  15.275 16.516  1.00 15.69 ? 218  TYR A OH  1 
ATOM   1626 N  N   . LEU A 1 219 ? 9.686   17.439 16.989  1.00 18.69 ? 219  LEU A N   1 
ATOM   1627 C  CA  . LEU A 1 219 ? 9.931   18.834 16.644  1.00 20.93 ? 219  LEU A CA  1 
ATOM   1628 C  C   . LEU A 1 219 ? 9.100   19.815 17.470  1.00 23.47 ? 219  LEU A C   1 
ATOM   1629 O  O   . LEU A 1 219 ? 9.578   20.896 17.827  1.00 24.52 ? 219  LEU A O   1 
ATOM   1630 C  CB  . LEU A 1 219 ? 9.647   19.058 15.152  1.00 19.81 ? 219  LEU A CB  1 
ATOM   1631 C  CG  . LEU A 1 219 ? 10.624  18.431 14.146  1.00 20.60 ? 219  LEU A CG  1 
ATOM   1632 C  CD1 . LEU A 1 219 ? 9.972   18.321 12.780  1.00 17.28 ? 219  LEU A CD1 1 
ATOM   1633 C  CD2 . LEU A 1 219 ? 11.895  19.265 14.075  1.00 18.61 ? 219  LEU A CD2 1 
ATOM   1634 N  N   . LEU A 1 220 ? 7.862   19.438 17.779  1.00 25.38 ? 220  LEU A N   1 
ATOM   1635 C  CA  . LEU A 1 220 ? 6.971   20.315 18.531  1.00 27.83 ? 220  LEU A CA  1 
ATOM   1636 C  C   . LEU A 1 220 ? 6.798   19.932 19.997  1.00 29.02 ? 220  LEU A C   1 
ATOM   1637 O  O   . LEU A 1 220 ? 5.884   20.409 20.669  1.00 28.09 ? 220  LEU A O   1 
ATOM   1638 C  CB  . LEU A 1 220 ? 5.607   20.370 17.836  1.00 27.62 ? 220  LEU A CB  1 
ATOM   1639 C  CG  . LEU A 1 220 ? 5.671   20.810 16.367  1.00 28.80 ? 220  LEU A CG  1 
ATOM   1640 C  CD1 . LEU A 1 220 ? 4.271   20.846 15.786  1.00 27.60 ? 220  LEU A CD1 1 
ATOM   1641 C  CD2 . LEU A 1 220 ? 6.338   22.187 16.256  1.00 28.19 ? 220  LEU A CD2 1 
ATOM   1642 N  N   . GLY A 1 221 ? 7.692   19.082 20.492  1.00 31.42 ? 221  GLY A N   1 
ATOM   1643 C  CA  . GLY A 1 221 ? 7.620   18.654 21.877  1.00 33.67 ? 221  GLY A CA  1 
ATOM   1644 C  C   . GLY A 1 221 ? 7.888   19.773 22.869  1.00 35.45 ? 221  GLY A C   1 
ATOM   1645 O  O   . GLY A 1 221 ? 6.948   20.304 23.469  1.00 36.05 ? 221  GLY A O   1 
ATOM   1646 N  N   . ARG A 1 222 ? 9.161   20.132 23.043  1.00 35.41 ? 222  ARG A N   1 
ATOM   1647 C  CA  . ARG A 1 222 ? 9.538   21.193 23.977  1.00 36.14 ? 222  ARG A CA  1 
ATOM   1648 C  C   . ARG A 1 222 ? 8.780   22.494 23.738  1.00 36.75 ? 222  ARG A C   1 
ATOM   1649 O  O   . ARG A 1 222 ? 8.131   23.021 24.642  1.00 38.05 ? 222  ARG A O   1 
ATOM   1650 C  CB  . ARG A 1 222 ? 11.037  21.496 23.896  1.00 36.51 ? 222  ARG A CB  1 
ATOM   1651 C  CG  . ARG A 1 222 ? 11.963  20.513 24.597  1.00 36.62 ? 222  ARG A CG  1 
ATOM   1652 C  CD  . ARG A 1 222 ? 13.361  21.126 24.700  1.00 37.65 ? 222  ARG A CD  1 
ATOM   1653 N  NE  . ARG A 1 222 ? 14.370  20.214 25.235  1.00 38.13 ? 222  ARG A NE  1 
ATOM   1654 C  CZ  . ARG A 1 222 ? 15.646  20.546 25.425  1.00 37.49 ? 222  ARG A CZ  1 
ATOM   1655 N  NH1 . ARG A 1 222 ? 16.062  21.767 25.126  1.00 38.00 ? 222  ARG A NH1 1 
ATOM   1656 N  NH2 . ARG A 1 222 ? 16.509  19.659 25.904  1.00 37.11 ? 222  ARG A NH2 1 
ATOM   1657 N  N   . LYS A 1 223 ? 8.864   23.016 22.520  1.00 36.10 ? 223  LYS A N   1 
ATOM   1658 C  CA  . LYS A 1 223 ? 8.200   24.268 22.200  1.00 35.03 ? 223  LYS A CA  1 
ATOM   1659 C  C   . LYS A 1 223 ? 7.537   24.234 20.828  1.00 34.26 ? 223  LYS A C   1 
ATOM   1660 O  O   . LYS A 1 223 ? 8.009   23.554 19.914  1.00 34.65 ? 223  LYS A O   1 
ATOM   1661 C  CB  . LYS A 1 223 ? 9.219   25.415 22.222  1.00 36.03 ? 223  LYS A CB  1 
ATOM   1662 C  CG  . LYS A 1 223 ? 10.280  25.319 23.317  1.00 37.81 ? 223  LYS A CG  1 
ATOM   1663 C  CD  . LYS A 1 223 ? 9.697   25.486 24.722  1.00 39.25 ? 223  LYS A CD  1 
ATOM   1664 C  CE  . LYS A 1 223 ? 10.761  25.285 25.806  1.00 38.49 ? 223  LYS A CE  1 
ATOM   1665 N  NZ  . LYS A 1 223 ? 11.323  23.896 25.836  1.00 37.76 ? 223  LYS A NZ  1 
ATOM   1666 N  N   . LYS A 1 224 ? 6.435   24.966 20.696  1.00 32.43 ? 224  LYS A N   1 
ATOM   1667 C  CA  . LYS A 1 224 ? 5.737   25.072 19.422  1.00 31.36 ? 224  LYS A CA  1 
ATOM   1668 C  C   . LYS A 1 224 ? 6.638   26.018 18.638  1.00 29.96 ? 224  LYS A C   1 
ATOM   1669 O  O   . LYS A 1 224 ? 7.375   26.791 19.239  1.00 31.06 ? 224  LYS A O   1 
ATOM   1670 C  CB  . LYS A 1 224 ? 4.349   25.683 19.625  1.00 31.03 ? 224  LYS A CB  1 
ATOM   1671 C  CG  . LYS A 1 224 ? 3.364   24.719 20.247  1.00 32.88 ? 224  LYS A CG  1 
ATOM   1672 C  CD  . LYS A 1 224 ? 3.911   24.144 21.545  1.00 34.26 ? 224  LYS A CD  1 
ATOM   1673 C  CE  . LYS A 1 224 ? 3.175   22.874 21.952  1.00 36.21 ? 224  LYS A CE  1 
ATOM   1674 N  NZ  . LYS A 1 224 ? 3.762   22.263 23.182  1.00 35.77 ? 224  LYS A NZ  1 
ATOM   1675 N  N   . ARG A 1 225 ? 6.596   25.977 17.314  1.00 28.22 ? 225  ARG A N   1 
ATOM   1676 C  CA  . ARG A 1 225 ? 7.484   26.839 16.543  1.00 26.94 ? 225  ARG A CA  1 
ATOM   1677 C  C   . ARG A 1 225 ? 7.208   26.706 15.055  1.00 25.88 ? 225  ARG A C   1 
ATOM   1678 O  O   . ARG A 1 225 ? 6.655   25.703 14.610  1.00 27.55 ? 225  ARG A O   1 
ATOM   1679 C  CB  . ARG A 1 225 ? 8.925   26.426 16.804  1.00 25.55 ? 225  ARG A CB  1 
ATOM   1680 C  CG  . ARG A 1 225 ? 9.245   25.092 16.154  1.00 26.69 ? 225  ARG A CG  1 
ATOM   1681 C  CD  . ARG A 1 225 ? 10.517  24.499 16.678  1.00 26.54 ? 225  ARG A CD  1 
ATOM   1682 N  NE  . ARG A 1 225 ? 11.050  23.512 15.753  1.00 25.60 ? 225  ARG A NE  1 
ATOM   1683 C  CZ  . ARG A 1 225 ? 12.062  22.703 16.032  1.00 25.57 ? 225  ARG A CZ  1 
ATOM   1684 N  NH1 . ARG A 1 225 ? 12.646  22.758 17.216  1.00 26.03 ? 225  ARG A NH1 1 
ATOM   1685 N  NH2 . ARG A 1 225 ? 12.501  21.852 15.117  1.00 29.63 ? 225  ARG A NH2 1 
ATOM   1686 N  N   . PRO A 1 226 ? 7.598   27.717 14.264  1.00 25.34 ? 226  PRO A N   1 
ATOM   1687 C  CA  . PRO A 1 226 ? 7.384   27.688 12.816  1.00 23.13 ? 226  PRO A CA  1 
ATOM   1688 C  C   . PRO A 1 226 ? 7.902   26.409 12.175  1.00 21.97 ? 226  PRO A C   1 
ATOM   1689 O  O   . PRO A 1 226 ? 8.981   25.923 12.516  1.00 20.96 ? 226  PRO A O   1 
ATOM   1690 C  CB  . PRO A 1 226 ? 8.129   28.929 12.344  1.00 24.96 ? 226  PRO A CB  1 
ATOM   1691 C  CG  . PRO A 1 226 ? 7.859   29.895 13.463  1.00 22.33 ? 226  PRO A CG  1 
ATOM   1692 C  CD  . PRO A 1 226 ? 8.106   29.036 14.688  1.00 24.77 ? 226  PRO A CD  1 
ATOM   1693 N  N   . ILE A 1 227 ? 7.119   25.875 11.243  1.00 20.40 ? 227  ILE A N   1 
ATOM   1694 C  CA  . ILE A 1 227 ? 7.460   24.648 10.542  1.00 18.60 ? 227  ILE A CA  1 
ATOM   1695 C  C   . ILE A 1 227 ? 7.713   24.879 9.055   1.00 18.82 ? 227  ILE A C   1 
ATOM   1696 O  O   . ILE A 1 227 ? 6.898   25.486 8.352   1.00 20.71 ? 227  ILE A O   1 
ATOM   1697 C  CB  . ILE A 1 227 ? 6.330   23.597 10.691  1.00 17.72 ? 227  ILE A CB  1 
ATOM   1698 C  CG1 . ILE A 1 227 ? 6.285   23.064 12.133  1.00 17.65 ? 227  ILE A CG1 1 
ATOM   1699 C  CG2 . ILE A 1 227 ? 6.523   22.469 9.681   1.00 19.09 ? 227  ILE A CG2 1 
ATOM   1700 C  CD1 . ILE A 1 227 ? 7.569   22.387 12.607  1.00 13.88 ? 227  ILE A CD1 1 
ATOM   1701 N  N   . HIS A 1 228 ? 8.852   24.396 8.573   1.00 18.25 ? 228  HIS A N   1 
ATOM   1702 C  CA  . HIS A 1 228 ? 9.172   24.530 7.166   1.00 15.99 ? 228  HIS A CA  1 
ATOM   1703 C  C   . HIS A 1 228 ? 9.143   23.149 6.529   1.00 16.30 ? 228  HIS A C   1 
ATOM   1704 O  O   . HIS A 1 228 ? 9.976   22.295 6.832   1.00 17.24 ? 228  HIS A O   1 
ATOM   1705 C  CB  . HIS A 1 228 ? 10.562  25.141 6.971   1.00 16.15 ? 228  HIS A CB  1 
ATOM   1706 C  CG  . HIS A 1 228 ? 10.866  25.494 5.547   1.00 16.21 ? 228  HIS A CG  1 
ATOM   1707 N  ND1 . HIS A 1 228 ? 10.616  26.743 5.017   1.00 17.29 ? 228  HIS A ND1 1 
ATOM   1708 C  CD2 . HIS A 1 228 ? 11.336  24.741 4.524   1.00 16.77 ? 228  HIS A CD2 1 
ATOM   1709 C  CE1 . HIS A 1 228 ? 10.916  26.744 3.731   1.00 16.84 ? 228  HIS A CE1 1 
ATOM   1710 N  NE2 . HIS A 1 228 ? 11.355  25.540 3.405   1.00 17.16 ? 228  HIS A NE2 1 
ATOM   1711 N  N   . LEU A 1 229 ? 8.164   22.910 5.668   1.00 16.66 ? 229  LEU A N   1 
ATOM   1712 C  CA  . LEU A 1 229 ? 8.101   21.629 4.976   1.00 14.57 ? 229  LEU A CA  1 
ATOM   1713 C  C   . LEU A 1 229 ? 8.764   21.798 3.611   1.00 14.15 ? 229  LEU A C   1 
ATOM   1714 O  O   . LEU A 1 229 ? 8.311   22.596 2.787   1.00 15.03 ? 229  LEU A O   1 
ATOM   1715 C  CB  . LEU A 1 229 ? 6.645   21.162 4.781   1.00 12.63 ? 229  LEU A CB  1 
ATOM   1716 C  CG  . LEU A 1 229 ? 6.431   19.931 3.878   1.00 10.65 ? 229  LEU A CG  1 
ATOM   1717 C  CD1 . LEU A 1 229 ? 7.151   18.713 4.451   1.00 7.95  ? 229  LEU A CD1 1 
ATOM   1718 C  CD2 . LEU A 1 229 ? 4.945   19.639 3.747   1.00 12.46 ? 229  LEU A CD2 1 
ATOM   1719 N  N   . SER A 1 230 ? 9.862   21.090 3.391   1.00 12.49 ? 230  SER A N   1 
ATOM   1720 C  CA  . SER A 1 230 ? 10.523  21.135 2.095   1.00 13.60 ? 230  SER A CA  1 
ATOM   1721 C  C   . SER A 1 230 ? 10.095  19.799 1.502   1.00 15.20 ? 230  SER A C   1 
ATOM   1722 O  O   . SER A 1 230 ? 10.487  18.741 1.999   1.00 15.57 ? 230  SER A O   1 
ATOM   1723 C  CB  . SER A 1 230 ? 12.043  21.183 2.252   1.00 13.16 ? 230  SER A CB  1 
ATOM   1724 O  OG  . SER A 1 230 ? 12.671  21.646 1.070   1.00 13.38 ? 230  SER A OG  1 
ATOM   1725 N  N   . PHE A 1 231 ? 9.267   19.843 0.461   1.00 14.74 ? 231  PHE A N   1 
ATOM   1726 C  CA  . PHE A 1 231 ? 8.778   18.616 -0.144  1.00 14.91 ? 231  PHE A CA  1 
ATOM   1727 C  C   . PHE A 1 231 ? 9.338   18.319 -1.542  1.00 14.82 ? 231  PHE A C   1 
ATOM   1728 O  O   . PHE A 1 231 ? 9.057   19.027 -2.507  1.00 13.84 ? 231  PHE A O   1 
ATOM   1729 C  CB  . PHE A 1 231 ? 7.246   18.654 -0.189  1.00 14.83 ? 231  PHE A CB  1 
ATOM   1730 C  CG  . PHE A 1 231 ? 6.606   17.324 -0.481  1.00 16.46 ? 231  PHE A CG  1 
ATOM   1731 C  CD1 . PHE A 1 231 ? 6.784   16.698 -1.712  1.00 17.45 ? 231  PHE A CD1 1 
ATOM   1732 C  CD2 . PHE A 1 231 ? 5.794   16.710 0.471   1.00 17.95 ? 231  PHE A CD2 1 
ATOM   1733 C  CE1 . PHE A 1 231 ? 6.158   15.479 -1.993  1.00 19.08 ? 231  PHE A CE1 1 
ATOM   1734 C  CE2 . PHE A 1 231 ? 5.162   15.494 0.204   1.00 16.21 ? 231  PHE A CE2 1 
ATOM   1735 C  CZ  . PHE A 1 231 ? 5.343   14.876 -1.030  1.00 18.11 ? 231  PHE A CZ  1 
ATOM   1736 N  N   . ASP A 1 232 ? 10.146  17.266 -1.634  1.00 15.84 ? 232  ASP A N   1 
ATOM   1737 C  CA  . ASP A 1 232 ? 10.690  16.845 -2.913  1.00 16.48 ? 232  ASP A CA  1 
ATOM   1738 C  C   . ASP A 1 232 ? 9.684   15.844 -3.473  1.00 17.60 ? 232  ASP A C   1 
ATOM   1739 O  O   . ASP A 1 232 ? 9.403   14.810 -2.855  1.00 18.61 ? 232  ASP A O   1 
ATOM   1740 C  CB  . ASP A 1 232 ? 12.034  16.150 -2.748  1.00 16.80 ? 232  ASP A CB  1 
ATOM   1741 C  CG  . ASP A 1 232 ? 12.672  15.800 -4.084  1.00 17.84 ? 232  ASP A CG  1 
ATOM   1742 O  OD1 . ASP A 1 232 ? 11.955  15.342 -4.997  1.00 13.49 ? 232  ASP A OD1 1 
ATOM   1743 O  OD2 . ASP A 1 232 ? 13.901  15.974 -4.215  1.00 21.22 ? 232  ASP A OD2 1 
ATOM   1744 N  N   . VAL A 1 233 ? 9.136   16.161 -4.639  1.00 16.23 ? 233  VAL A N   1 
ATOM   1745 C  CA  . VAL A 1 233 ? 8.165   15.297 -5.275  1.00 14.85 ? 233  VAL A CA  1 
ATOM   1746 C  C   . VAL A 1 233 ? 8.677   13.858 -5.400  1.00 12.76 ? 233  VAL A C   1 
ATOM   1747 O  O   . VAL A 1 233 ? 7.892   12.924 -5.375  1.00 12.05 ? 233  VAL A O   1 
ATOM   1748 C  CB  . VAL A 1 233 ? 7.776   15.889 -6.641  1.00 15.83 ? 233  VAL A CB  1 
ATOM   1749 C  CG1 . VAL A 1 233 ? 7.058   14.876 -7.483  1.00 18.61 ? 233  VAL A CG1 1 
ATOM   1750 C  CG2 . VAL A 1 233 ? 6.880   17.094 -6.410  1.00 15.29 ? 233  VAL A CG2 1 
ATOM   1751 N  N   . ASP A 1 234 ? 9.988   13.663 -5.493  1.00 12.27 ? 234  ASP A N   1 
ATOM   1752 C  CA  . ASP A 1 234 ? 10.483  12.294 -5.606  1.00 12.13 ? 234  ASP A CA  1 
ATOM   1753 C  C   . ASP A 1 234 ? 10.419  11.496 -4.309  1.00 10.58 ? 234  ASP A C   1 
ATOM   1754 O  O   . ASP A 1 234 ? 10.838  10.336 -4.271  1.00 10.90 ? 234  ASP A O   1 
ATOM   1755 C  CB  . ASP A 1 234 ? 11.906  12.239 -6.201  1.00 13.63 ? 234  ASP A CB  1 
ATOM   1756 C  CG  . ASP A 1 234 ? 12.978  12.784 -5.274  1.00 15.40 ? 234  ASP A CG  1 
ATOM   1757 O  OD1 . ASP A 1 234 ? 12.864  12.635 -4.033  1.00 10.46 ? 234  ASP A OD1 1 
ATOM   1758 O  OD2 . ASP A 1 234 ? 13.964  13.338 -5.819  1.00 11.50 ? 234  ASP A OD2 1 
ATOM   1759 N  N   . GLY A 1 235 ? 9.897   12.121 -3.254  1.00 9.01  ? 235  GLY A N   1 
ATOM   1760 C  CA  . GLY A 1 235 ? 9.748   11.430 -1.990  1.00 9.17  ? 235  GLY A CA  1 
ATOM   1761 C  C   . GLY A 1 235 ? 8.650   10.392 -2.158  1.00 10.20 ? 235  GLY A C   1 
ATOM   1762 O  O   . GLY A 1 235 ? 8.604   9.390  -1.447  1.00 9.98  ? 235  GLY A O   1 
ATOM   1763 N  N   . LEU A 1 236 ? 7.743   10.644 -3.101  1.00 12.77 ? 236  LEU A N   1 
ATOM   1764 C  CA  . LEU A 1 236 ? 6.657   9.709  -3.384  1.00 12.29 ? 236  LEU A CA  1 
ATOM   1765 C  C   . LEU A 1 236 ? 7.096   8.755  -4.492  1.00 10.33 ? 236  LEU A C   1 
ATOM   1766 O  O   . LEU A 1 236 ? 7.957   9.089  -5.305  1.00 10.04 ? 236  LEU A O   1 
ATOM   1767 C  CB  . LEU A 1 236 ? 5.386   10.445 -3.834  1.00 13.94 ? 236  LEU A CB  1 
ATOM   1768 C  CG  . LEU A 1 236 ? 4.762   11.584 -3.019  1.00 16.12 ? 236  LEU A CG  1 
ATOM   1769 C  CD1 . LEU A 1 236 ? 3.303   11.677 -3.435  1.00 16.65 ? 236  LEU A CD1 1 
ATOM   1770 C  CD2 . LEU A 1 236 ? 4.853   11.346 -1.515  1.00 15.95 ? 236  LEU A CD2 1 
ATOM   1771 N  N   . ASP A 1 237 ? 6.493   7.572  -4.518  1.00 11.53 ? 237  ASP A N   1 
ATOM   1772 C  CA  . ASP A 1 237 ? 6.804   6.551  -5.512  1.00 11.02 ? 237  ASP A CA  1 
ATOM   1773 C  C   . ASP A 1 237 ? 6.582   7.066  -6.946  1.00 11.85 ? 237  ASP A C   1 
ATOM   1774 O  O   . ASP A 1 237 ? 5.661   7.857  -7.201  1.00 10.38 ? 237  ASP A O   1 
ATOM   1775 C  CB  . ASP A 1 237 ? 5.940   5.316  -5.236  1.00 12.18 ? 237  ASP A CB  1 
ATOM   1776 C  CG  . ASP A 1 237 ? 6.359   4.101  -6.048  1.00 10.47 ? 237  ASP A CG  1 
ATOM   1777 O  OD1 . ASP A 1 237 ? 5.845   3.930  -7.175  1.00 12.77 ? 237  ASP A OD1 1 
ATOM   1778 O  OD2 . ASP A 1 237 ? 7.202   3.321  -5.559  1.00 8.39  ? 237  ASP A OD2 1 
ATOM   1779 N  N   . PRO A 1 238 ? 7.441   6.632  -7.896  1.00 13.30 ? 238  PRO A N   1 
ATOM   1780 C  CA  . PRO A 1 238 ? 7.391   7.012  -9.315  1.00 12.95 ? 238  PRO A CA  1 
ATOM   1781 C  C   . PRO A 1 238 ? 6.064   6.726  -10.007 1.00 14.03 ? 238  PRO A C   1 
ATOM   1782 O  O   . PRO A 1 238 ? 5.808   7.234  -11.091 1.00 16.44 ? 238  PRO A O   1 
ATOM   1783 C  CB  . PRO A 1 238 ? 8.533   6.207  -9.930  1.00 13.50 ? 238  PRO A CB  1 
ATOM   1784 C  CG  . PRO A 1 238 ? 9.516   6.120  -8.815  1.00 12.53 ? 238  PRO A CG  1 
ATOM   1785 C  CD  . PRO A 1 238 ? 8.625   5.788  -7.637  1.00 12.48 ? 238  PRO A CD  1 
ATOM   1786 N  N   . SER A 1 239 ? 5.228   5.901  -9.390  1.00 15.74 ? 239  SER A N   1 
ATOM   1787 C  CA  . SER A 1 239 ? 3.933   5.578  -9.971  1.00 16.21 ? 239  SER A CA  1 
ATOM   1788 C  C   . SER A 1 239 ? 2.956   6.726  -9.713  1.00 16.77 ? 239  SER A C   1 
ATOM   1789 O  O   . SER A 1 239 ? 1.850   6.758  -10.265 1.00 16.36 ? 239  SER A O   1 
ATOM   1790 C  CB  . SER A 1 239 ? 3.392   4.283  -9.365  1.00 15.42 ? 239  SER A CB  1 
ATOM   1791 O  OG  . SER A 1 239 ? 3.253   4.394  -7.957  1.00 18.43 ? 239  SER A OG  1 
ATOM   1792 N  N   . PHE A 1 240 ? 3.374   7.672  -8.874  1.00 17.27 ? 240  PHE A N   1 
ATOM   1793 C  CA  . PHE A 1 240 ? 2.534   8.814  -8.531  1.00 16.56 ? 240  PHE A CA  1 
ATOM   1794 C  C   . PHE A 1 240 ? 3.150   10.137 -8.977  1.00 16.06 ? 240  PHE A C   1 
ATOM   1795 O  O   . PHE A 1 240 ? 2.439   11.090 -9.284  1.00 15.85 ? 240  PHE A O   1 
ATOM   1796 C  CB  . PHE A 1 240 ? 2.274   8.829  -7.020  1.00 16.57 ? 240  PHE A CB  1 
ATOM   1797 C  CG  . PHE A 1 240 ? 1.544   7.613  -6.524  1.00 16.99 ? 240  PHE A CG  1 
ATOM   1798 C  CD1 . PHE A 1 240 ? 0.214   7.400  -6.864  1.00 17.27 ? 240  PHE A CD1 1 
ATOM   1799 C  CD2 . PHE A 1 240 ? 2.193   6.668  -5.737  1.00 17.94 ? 240  PHE A CD2 1 
ATOM   1800 C  CE1 . PHE A 1 240 ? -0.459  6.262  -6.425  1.00 18.26 ? 240  PHE A CE1 1 
ATOM   1801 C  CE2 . PHE A 1 240 ? 1.526   5.522  -5.291  1.00 18.46 ? 240  PHE A CE2 1 
ATOM   1802 C  CZ  . PHE A 1 240 ? 0.199   5.322  -5.637  1.00 17.15 ? 240  PHE A CZ  1 
ATOM   1803 N  N   . THR A 1 241 ? 4.475   10.189 -9.009  1.00 16.10 ? 241  THR A N   1 
ATOM   1804 C  CA  . THR A 1 241 ? 5.184   11.399 -9.425  1.00 15.08 ? 241  THR A CA  1 
ATOM   1805 C  C   . THR A 1 241 ? 6.371   11.012 -10.312 1.00 13.59 ? 241  THR A C   1 
ATOM   1806 O  O   . THR A 1 241 ? 7.528   11.267 -9.982  1.00 11.76 ? 241  THR A O   1 
ATOM   1807 C  CB  . THR A 1 241 ? 5.676   12.184 -8.206  1.00 14.81 ? 241  THR A CB  1 
ATOM   1808 O  OG1 . THR A 1 241 ? 6.549   11.361 -7.428  1.00 16.81 ? 241  THR A OG1 1 
ATOM   1809 C  CG2 . THR A 1 241 ? 4.494   12.602 -7.332  1.00 15.63 ? 241  THR A CG2 1 
ATOM   1810 N  N   . PRO A 1 242 ? 6.083   10.382 -11.460 1.00 14.64 ? 242  PRO A N   1 
ATOM   1811 C  CA  . PRO A 1 242 ? 7.096   9.934  -12.425 1.00 15.10 ? 242  PRO A CA  1 
ATOM   1812 C  C   . PRO A 1 242 ? 7.885   11.044 -13.130 1.00 14.17 ? 242  PRO A C   1 
ATOM   1813 O  O   . PRO A 1 242 ? 9.026   10.837 -13.536 1.00 14.10 ? 242  PRO A O   1 
ATOM   1814 C  CB  . PRO A 1 242 ? 6.282   9.078  -13.395 1.00 15.23 ? 242  PRO A CB  1 
ATOM   1815 C  CG  . PRO A 1 242 ? 4.939   9.775  -13.395 1.00 16.23 ? 242  PRO A CG  1 
ATOM   1816 C  CD  . PRO A 1 242 ? 4.721   10.050 -11.930 1.00 15.07 ? 242  PRO A CD  1 
ATOM   1817 N  N   . ALA A 1 243 ? 7.284   12.220 -13.271 1.00 14.17 ? 243  ALA A N   1 
ATOM   1818 C  CA  . ALA A 1 243 ? 7.961   13.330 -13.927 1.00 14.89 ? 243  ALA A CA  1 
ATOM   1819 C  C   . ALA A 1 243 ? 8.881   14.105 -12.980 1.00 14.21 ? 243  ALA A C   1 
ATOM   1820 O  O   . ALA A 1 243 ? 8.649   15.277 -12.697 1.00 12.17 ? 243  ALA A O   1 
ATOM   1821 C  CB  . ALA A 1 243 ? 6.936   14.275 -14.558 1.00 17.07 ? 243  ALA A CB  1 
ATOM   1822 N  N   . THR A 1 244 ? 9.917   13.422 -12.494 1.00 15.36 ? 244  THR A N   1 
ATOM   1823 C  CA  . THR A 1 244 ? 10.928  13.999 -11.607 1.00 16.38 ? 244  THR A CA  1 
ATOM   1824 C  C   . THR A 1 244 ? 12.305  13.514 -12.072 1.00 15.40 ? 244  THR A C   1 
ATOM   1825 O  O   . THR A 1 244 ? 12.421  12.454 -12.687 1.00 15.96 ? 244  THR A O   1 
ATOM   1826 C  CB  . THR A 1 244 ? 10.722  13.591 -10.105 1.00 18.05 ? 244  THR A CB  1 
ATOM   1827 O  OG1 . THR A 1 244 ? 10.520  12.173 -10.000 1.00 18.46 ? 244  THR A OG1 1 
ATOM   1828 C  CG2 . THR A 1 244 ? 9.539   14.327 -9.506  1.00 21.06 ? 244  THR A CG2 1 
ATOM   1829 N  N   . GLY A 1 245 ? 13.342  14.286 -11.755 1.00 15.81 ? 245  GLY A N   1 
ATOM   1830 C  CA  . GLY A 1 245 ? 14.698  13.959 -12.169 1.00 14.31 ? 245  GLY A CA  1 
ATOM   1831 C  C   . GLY A 1 245 ? 15.445  12.769 -11.583 1.00 14.13 ? 245  GLY A C   1 
ATOM   1832 O  O   . GLY A 1 245 ? 16.360  12.252 -12.221 1.00 10.20 ? 245  GLY A O   1 
ATOM   1833 N  N   . THR A 1 246 ? 15.072  12.329 -10.387 1.00 15.22 ? 246  THR A N   1 
ATOM   1834 C  CA  . THR A 1 246 ? 15.752  11.207 -9.740  1.00 16.79 ? 246  THR A CA  1 
ATOM   1835 C  C   . THR A 1 246 ? 14.740  10.319 -9.002  1.00 17.84 ? 246  THR A C   1 
ATOM   1836 O  O   . THR A 1 246 ? 14.665  10.328 -7.767  1.00 18.48 ? 246  THR A O   1 
ATOM   1837 C  CB  . THR A 1 246 ? 16.805  11.716 -8.718  1.00 16.61 ? 246  THR A CB  1 
ATOM   1838 O  OG1 . THR A 1 246 ? 17.534  12.817 -9.276  1.00 15.48 ? 246  THR A OG1 1 
ATOM   1839 C  CG2 . THR A 1 246 ? 17.781  10.601 -8.369  1.00 17.55 ? 246  THR A CG2 1 
ATOM   1840 N  N   . PRO A 1 247 ? 13.937  9.545  -9.754  1.00 18.65 ? 247  PRO A N   1 
ATOM   1841 C  CA  . PRO A 1 247 ? 12.934  8.662  -9.142  1.00 18.30 ? 247  PRO A CA  1 
ATOM   1842 C  C   . PRO A 1 247 ? 13.495  7.359  -8.566  1.00 17.33 ? 247  PRO A C   1 
ATOM   1843 O  O   . PRO A 1 247 ? 14.445  6.789  -9.094  1.00 18.53 ? 247  PRO A O   1 
ATOM   1844 C  CB  . PRO A 1 247 ? 11.937  8.435  -10.284 1.00 18.18 ? 247  PRO A CB  1 
ATOM   1845 C  CG  . PRO A 1 247 ? 12.801  8.462  -11.488 1.00 18.37 ? 247  PRO A CG  1 
ATOM   1846 C  CD  . PRO A 1 247 ? 13.772  9.599  -11.221 1.00 18.57 ? 247  PRO A CD  1 
ATOM   1847 N  N   . VAL A 1 248 ? 12.916  6.902  -7.463  1.00 16.42 ? 248  VAL A N   1 
ATOM   1848 C  CA  . VAL A 1 248 ? 13.357  5.662  -6.829  1.00 17.08 ? 248  VAL A CA  1 
ATOM   1849 C  C   . VAL A 1 248 ? 12.139  4.838  -6.406  1.00 15.90 ? 248  VAL A C   1 
ATOM   1850 O  O   . VAL A 1 248 ? 11.184  5.371  -5.836  1.00 15.88 ? 248  VAL A O   1 
ATOM   1851 C  CB  . VAL A 1 248 ? 14.257  5.945  -5.586  1.00 17.92 ? 248  VAL A CB  1 
ATOM   1852 C  CG1 . VAL A 1 248 ? 14.834  4.629  -5.042  1.00 18.02 ? 248  VAL A CG1 1 
ATOM   1853 C  CG2 . VAL A 1 248 ? 15.394  6.913  -5.965  1.00 18.31 ? 248  VAL A CG2 1 
ATOM   1854 N  N   . VAL A 1 249 ? 12.172  3.540  -6.698  1.00 15.63 ? 249  VAL A N   1 
ATOM   1855 C  CA  . VAL A 1 249 ? 11.067  2.648  -6.356  1.00 14.88 ? 249  VAL A CA  1 
ATOM   1856 C  C   . VAL A 1 249 ? 10.930  2.500  -4.853  1.00 14.01 ? 249  VAL A C   1 
ATOM   1857 O  O   . VAL A 1 249 ? 11.867  2.786  -4.108  1.00 13.06 ? 249  VAL A O   1 
ATOM   1858 C  CB  . VAL A 1 249 ? 11.265  1.230  -6.963  1.00 15.60 ? 249  VAL A CB  1 
ATOM   1859 C  CG1 . VAL A 1 249 ? 11.376  1.319  -8.482  1.00 18.22 ? 249  VAL A CG1 1 
ATOM   1860 C  CG2 . VAL A 1 249 ? 12.505  0.583  -6.376  1.00 16.46 ? 249  VAL A CG2 1 
ATOM   1861 N  N   . GLY A 1 250 ? 9.760   2.035  -4.424  1.00 13.71 ? 250  GLY A N   1 
ATOM   1862 C  CA  . GLY A 1 250 ? 9.486   1.832  -3.009  1.00 13.83 ? 250  GLY A CA  1 
ATOM   1863 C  C   . GLY A 1 250 ? 9.167   3.092  -2.216  1.00 15.11 ? 250  GLY A C   1 
ATOM   1864 O  O   . GLY A 1 250 ? 9.360   3.124  -0.999  1.00 14.89 ? 250  GLY A O   1 
ATOM   1865 N  N   . GLY A 1 251 ? 8.657   4.119  -2.888  1.00 15.54 ? 251  GLY A N   1 
ATOM   1866 C  CA  . GLY A 1 251 ? 8.359   5.372  -2.214  1.00 14.55 ? 251  GLY A CA  1 
ATOM   1867 C  C   . GLY A 1 251 ? 7.009   5.517  -1.532  1.00 14.96 ? 251  GLY A C   1 
ATOM   1868 O  O   . GLY A 1 251 ? 6.186   4.598  -1.518  1.00 14.39 ? 251  GLY A O   1 
ATOM   1869 N  N   . LEU A 1 252 ? 6.798   6.694  -0.947  1.00 13.86 ? 252  LEU A N   1 
ATOM   1870 C  CA  . LEU A 1 252 ? 5.553   7.022  -0.261  1.00 14.63 ? 252  LEU A CA  1 
ATOM   1871 C  C   . LEU A 1 252 ? 4.367   6.923  -1.230  1.00 16.21 ? 252  LEU A C   1 
ATOM   1872 O  O   . LEU A 1 252 ? 4.442   7.366  -2.379  1.00 14.48 ? 252  LEU A O   1 
ATOM   1873 C  CB  . LEU A 1 252 ? 5.640   8.440  0.313   1.00 11.24 ? 252  LEU A CB  1 
ATOM   1874 C  CG  . LEU A 1 252 ? 6.762   8.737  1.318   1.00 10.35 ? 252  LEU A CG  1 
ATOM   1875 C  CD1 . LEU A 1 252 ? 6.941   10.219 1.433   1.00 8.92  ? 252  LEU A CD1 1 
ATOM   1876 C  CD2 . LEU A 1 252 ? 6.448   8.140  2.667   1.00 9.50  ? 252  LEU A CD2 1 
ATOM   1877 N  N   . THR A 1 253 ? 3.274   6.340  -0.750  1.00 17.77 ? 253  THR A N   1 
ATOM   1878 C  CA  . THR A 1 253 ? 2.067   6.160  -1.545  1.00 19.17 ? 253  THR A CA  1 
ATOM   1879 C  C   . THR A 1 253 ? 1.355   7.499  -1.724  1.00 19.58 ? 253  THR A C   1 
ATOM   1880 O  O   . THR A 1 253 ? 1.664   8.468  -1.026  1.00 20.44 ? 253  THR A O   1 
ATOM   1881 C  CB  . THR A 1 253 ? 1.103   5.142  -0.852  1.00 20.18 ? 253  THR A CB  1 
ATOM   1882 O  OG1 . THR A 1 253 ? 1.691   3.833  -0.874  1.00 21.57 ? 253  THR A OG1 1 
ATOM   1883 C  CG2 . THR A 1 253 ? -0.229  5.078  -1.562  1.00 22.91 ? 253  THR A CG2 1 
ATOM   1884 N  N   . TYR A 1 254 ? 0.417   7.554  -2.667  1.00 17.20 ? 254  TYR A N   1 
ATOM   1885 C  CA  . TYR A 1 254 ? -0.351  8.768  -2.909  1.00 16.83 ? 254  TYR A CA  1 
ATOM   1886 C  C   . TYR A 1 254 ? -0.939  9.178  -1.574  1.00 16.04 ? 254  TYR A C   1 
ATOM   1887 O  O   . TYR A 1 254 ? -0.764  10.307 -1.124  1.00 16.24 ? 254  TYR A O   1 
ATOM   1888 C  CB  . TYR A 1 254 ? -1.497  8.499  -3.883  1.00 16.97 ? 254  TYR A CB  1 
ATOM   1889 C  CG  . TYR A 1 254 ? -2.282  9.735  -4.272  1.00 18.08 ? 254  TYR A CG  1 
ATOM   1890 C  CD1 . TYR A 1 254 ? -1.797  10.615 -5.242  1.00 18.37 ? 254  TYR A CD1 1 
ATOM   1891 C  CD2 . TYR A 1 254 ? -3.510  10.028 -3.671  1.00 17.59 ? 254  TYR A CD2 1 
ATOM   1892 C  CE1 . TYR A 1 254 ? -2.515  11.755 -5.607  1.00 18.40 ? 254  TYR A CE1 1 
ATOM   1893 C  CE2 . TYR A 1 254 ? -4.237  11.171 -4.032  1.00 19.43 ? 254  TYR A CE2 1 
ATOM   1894 C  CZ  . TYR A 1 254 ? -3.730  12.025 -5.002  1.00 18.42 ? 254  TYR A CZ  1 
ATOM   1895 O  OH  . TYR A 1 254 ? -4.438  13.137 -5.382  1.00 19.69 ? 254  TYR A OH  1 
ATOM   1896 N  N   . ARG A 1 255 ? -1.630  8.228  -0.949  1.00 15.64 ? 255  ARG A N   1 
ATOM   1897 C  CA  . ARG A 1 255 ? -2.277  8.424  0.346   1.00 14.98 ? 255  ARG A CA  1 
ATOM   1898 C  C   . ARG A 1 255 ? -1.347  8.875  1.469   1.00 14.12 ? 255  ARG A C   1 
ATOM   1899 O  O   . ARG A 1 255 ? -1.727  9.731  2.259   1.00 12.07 ? 255  ARG A O   1 
ATOM   1900 C  CB  . ARG A 1 255 ? -2.994  7.135  0.766   1.00 15.60 ? 255  ARG A CB  1 
ATOM   1901 C  CG  . ARG A 1 255 ? -4.232  6.806  -0.069  1.00 14.60 ? 255  ARG A CG  1 
ATOM   1902 C  CD  . ARG A 1 255 ? -4.644  5.346  0.102   1.00 14.68 ? 255  ARG A CD  1 
ATOM   1903 N  NE  . ARG A 1 255 ? -4.602  4.908  1.496   1.00 13.77 ? 255  ARG A NE  1 
ATOM   1904 C  CZ  . ARG A 1 255 ? -4.895  3.678  1.901   1.00 13.09 ? 255  ARG A CZ  1 
ATOM   1905 N  NH1 . ARG A 1 255 ? -5.258  2.756  1.020   1.00 14.76 ? 255  ARG A NH1 1 
ATOM   1906 N  NH2 . ARG A 1 255 ? -4.813  3.362  3.184   1.00 15.43 ? 255  ARG A NH2 1 
ATOM   1907 N  N   . GLU A 1 256 ? -0.143  8.304  1.552   1.00 13.17 ? 256  GLU A N   1 
ATOM   1908 C  CA  . GLU A 1 256 ? 0.798   8.684  2.605   1.00 13.89 ? 256  GLU A CA  1 
ATOM   1909 C  C   . GLU A 1 256 ? 1.284   10.129 2.449   1.00 13.99 ? 256  GLU A C   1 
ATOM   1910 O  O   . GLU A 1 256 ? 1.577   10.798 3.441   1.00 13.08 ? 256  GLU A O   1 
ATOM   1911 C  CB  . GLU A 1 256 ? 2.000   7.736  2.629   1.00 13.37 ? 256  GLU A CB  1 
ATOM   1912 C  CG  . GLU A 1 256 ? 1.687   6.338  3.126   1.00 13.38 ? 256  GLU A CG  1 
ATOM   1913 C  CD  . GLU A 1 256 ? 2.859   5.393  2.939   1.00 16.16 ? 256  GLU A CD  1 
ATOM   1914 O  OE1 . GLU A 1 256 ? 3.578   5.555  1.932   1.00 17.09 ? 256  GLU A OE1 1 
ATOM   1915 O  OE2 . GLU A 1 256 ? 3.059   4.487  3.780   1.00 18.13 ? 256  GLU A OE2 1 
ATOM   1916 N  N   . GLY A 1 257 ? 1.374   10.596 1.205   1.00 13.93 ? 257  GLY A N   1 
ATOM   1917 C  CA  . GLY A 1 257 ? 1.790   11.966 0.953   1.00 13.00 ? 257  GLY A CA  1 
ATOM   1918 C  C   . GLY A 1 257 ? 0.732   12.909 1.500   1.00 14.00 ? 257  GLY A C   1 
ATOM   1919 O  O   . GLY A 1 257 ? 1.052   13.924 2.119   1.00 15.07 ? 257  GLY A O   1 
ATOM   1920 N  N   . LEU A 1 258 ? -0.538  12.570 1.280   1.00 13.47 ? 258  LEU A N   1 
ATOM   1921 C  CA  . LEU A 1 258 ? -1.646  13.394 1.764   1.00 14.41 ? 258  LEU A CA  1 
ATOM   1922 C  C   . LEU A 1 258 ? -1.759  13.379 3.281   1.00 14.55 ? 258  LEU A C   1 
ATOM   1923 O  O   . LEU A 1 258 ? -2.080  14.399 3.883   1.00 16.32 ? 258  LEU A O   1 
ATOM   1924 C  CB  . LEU A 1 258 ? -2.980  12.945 1.156   1.00 11.99 ? 258  LEU A CB  1 
ATOM   1925 C  CG  . LEU A 1 258 ? -3.212  13.209 -0.337  1.00 14.98 ? 258  LEU A CG  1 
ATOM   1926 C  CD1 . LEU A 1 258 ? -4.671  12.912 -0.675  1.00 15.33 ? 258  LEU A CD1 1 
ATOM   1927 C  CD2 . LEU A 1 258 ? -2.897  14.654 -0.673  1.00 15.18 ? 258  LEU A CD2 1 
ATOM   1928 N  N   . TYR A 1 259 ? -1.503  12.236 3.910   1.00 13.46 ? 259  TYR A N   1 
ATOM   1929 C  CA  . TYR A 1 259 ? -1.588  12.178 5.368   1.00 14.77 ? 259  TYR A CA  1 
ATOM   1930 C  C   . TYR A 1 259 ? -0.566  13.145 5.977   1.00 14.21 ? 259  TYR A C   1 
ATOM   1931 O  O   . TYR A 1 259 ? -0.904  13.999 6.795   1.00 14.24 ? 259  TYR A O   1 
ATOM   1932 C  CB  . TYR A 1 259 ? -1.314  10.760 5.879   1.00 14.12 ? 259  TYR A CB  1 
ATOM   1933 C  CG  . TYR A 1 259 ? -1.512  10.640 7.373   1.00 14.47 ? 259  TYR A CG  1 
ATOM   1934 C  CD1 . TYR A 1 259 ? -2.792  10.632 7.924   1.00 14.72 ? 259  TYR A CD1 1 
ATOM   1935 C  CD2 . TYR A 1 259 ? -0.423  10.580 8.240   1.00 14.48 ? 259  TYR A CD2 1 
ATOM   1936 C  CE1 . TYR A 1 259 ? -2.982  10.571 9.303   1.00 15.77 ? 259  TYR A CE1 1 
ATOM   1937 C  CE2 . TYR A 1 259 ? -0.603  10.516 9.626   1.00 12.42 ? 259  TYR A CE2 1 
ATOM   1938 C  CZ  . TYR A 1 259 ? -1.880  10.514 10.148  1.00 14.18 ? 259  TYR A CZ  1 
ATOM   1939 O  OH  . TYR A 1 259 ? -2.069  10.466 11.513  1.00 14.74 ? 259  TYR A OH  1 
ATOM   1940 N  N   . ILE A 1 260 ? 0.687   12.988 5.565   1.00 15.22 ? 260  ILE A N   1 
ATOM   1941 C  CA  . ILE A 1 260 ? 1.782   13.830 6.023   1.00 14.20 ? 260  ILE A CA  1 
ATOM   1942 C  C   . ILE A 1 260 ? 1.360   15.281 5.994   1.00 12.60 ? 260  ILE A C   1 
ATOM   1943 O  O   . ILE A 1 260 ? 1.426   15.972 7.001   1.00 12.32 ? 260  ILE A O   1 
ATOM   1944 C  CB  . ILE A 1 260 ? 3.030   13.687 5.100   1.00 15.52 ? 260  ILE A CB  1 
ATOM   1945 C  CG1 . ILE A 1 260 ? 3.735   12.364 5.369   1.00 15.01 ? 260  ILE A CG1 1 
ATOM   1946 C  CG2 . ILE A 1 260 ? 3.991   14.864 5.305   1.00 16.50 ? 260  ILE A CG2 1 
ATOM   1947 C  CD1 . ILE A 1 260 ? 4.891   12.112 4.414   1.00 19.00 ? 260  ILE A CD1 1 
ATOM   1948 N  N   . THR A 1 261 ? 0.933   15.731 4.819   1.00 14.22 ? 261  THR A N   1 
ATOM   1949 C  CA  . THR A 1 261 ? 0.523   17.114 4.621   1.00 14.49 ? 261  THR A CA  1 
ATOM   1950 C  C   . THR A 1 261 ? -0.766  17.518 5.360   1.00 14.27 ? 261  THR A C   1 
ATOM   1951 O  O   . THR A 1 261 ? -0.904  18.664 5.783   1.00 13.88 ? 261  THR A O   1 
ATOM   1952 C  CB  . THR A 1 261 ? 0.404   17.421 3.108   1.00 13.78 ? 261  THR A CB  1 
ATOM   1953 O  OG1 . THR A 1 261 ? -0.237  16.326 2.448   1.00 11.30 ? 261  THR A OG1 1 
ATOM   1954 C  CG2 . THR A 1 261 ? 1.797   17.640 2.495   1.00 12.27 ? 261  THR A CG2 1 
ATOM   1955 N  N   . GLU A 1 262 ? -1.706  16.592 5.517   1.00 13.33 ? 262  GLU A N   1 
ATOM   1956 C  CA  . GLU A 1 262 ? -2.933  16.909 6.238   1.00 14.14 ? 262  GLU A CA  1 
ATOM   1957 C  C   . GLU A 1 262 ? -2.604  17.049 7.734   1.00 15.07 ? 262  GLU A C   1 
ATOM   1958 O  O   . GLU A 1 262 ? -3.207  17.853 8.443   1.00 16.69 ? 262  GLU A O   1 
ATOM   1959 C  CB  . GLU A 1 262 ? -3.988  15.813 6.024   1.00 13.76 ? 262  GLU A CB  1 
ATOM   1960 C  CG  . GLU A 1 262 ? -4.490  15.669 4.573   1.00 14.25 ? 262  GLU A CG  1 
ATOM   1961 C  CD  . GLU A 1 262 ? -5.557  14.588 4.405   1.00 12.79 ? 262  GLU A CD  1 
ATOM   1962 O  OE1 . GLU A 1 262 ? -5.460  13.543 5.078   1.00 13.89 ? 262  GLU A OE1 1 
ATOM   1963 O  OE2 . GLU A 1 262 ? -6.482  14.773 3.585   1.00 12.30 ? 262  GLU A OE2 1 
ATOM   1964 N  N   . GLU A 1 263 ? -1.641  16.267 8.214   1.00 16.07 ? 263  GLU A N   1 
ATOM   1965 C  CA  . GLU A 1 263 ? -1.246  16.339 9.619   1.00 15.80 ? 263  GLU A CA  1 
ATOM   1966 C  C   . GLU A 1 263 ? -0.426  17.594 9.895   1.00 16.48 ? 263  GLU A C   1 
ATOM   1967 O  O   . GLU A 1 263 ? -0.527  18.174 10.974  1.00 17.53 ? 263  GLU A O   1 
ATOM   1968 C  CB  . GLU A 1 263 ? -0.447  15.095 10.032  1.00 13.91 ? 263  GLU A CB  1 
ATOM   1969 C  CG  . GLU A 1 263 ? -1.294  13.833 10.177  1.00 14.00 ? 263  GLU A CG  1 
ATOM   1970 C  CD  . GLU A 1 263 ? -2.419  13.986 11.186  1.00 13.44 ? 263  GLU A CD  1 
ATOM   1971 O  OE1 . GLU A 1 263 ? -2.131  14.258 12.370  1.00 15.53 ? 263  GLU A OE1 1 
ATOM   1972 O  OE2 . GLU A 1 263 ? -3.594  13.835 10.800  1.00 12.98 ? 263  GLU A OE2 1 
ATOM   1973 N  N   . ILE A 1 264 ? 0.387   18.010 8.926   1.00 16.11 ? 264  ILE A N   1 
ATOM   1974 C  CA  . ILE A 1 264 ? 1.197   19.214 9.093   1.00 18.39 ? 264  ILE A CA  1 
ATOM   1975 C  C   . ILE A 1 264 ? 0.282   20.443 9.121   1.00 19.27 ? 264  ILE A C   1 
ATOM   1976 O  O   . ILE A 1 264 ? 0.509   21.399 9.875   1.00 19.72 ? 264  ILE A O   1 
ATOM   1977 C  CB  . ILE A 1 264 ? 2.218   19.379 7.942   1.00 17.98 ? 264  ILE A CB  1 
ATOM   1978 C  CG1 . ILE A 1 264 ? 3.263   18.259 8.000   1.00 21.28 ? 264  ILE A CG1 1 
ATOM   1979 C  CG2 . ILE A 1 264 ? 2.880   20.751 8.019   1.00 17.89 ? 264  ILE A CG2 1 
ATOM   1980 C  CD1 . ILE A 1 264 ? 4.020   18.175 9.317   1.00 22.67 ? 264  ILE A CD1 1 
ATOM   1981 N  N   . TYR A 1 265 ? -0.750  20.421 8.288   1.00 19.09 ? 265  TYR A N   1 
ATOM   1982 C  CA  . TYR A 1 265 ? -1.677  21.535 8.248   1.00 19.33 ? 265  TYR A CA  1 
ATOM   1983 C  C   . TYR A 1 265 ? -2.335  21.692 9.621   1.00 20.14 ? 265  TYR A C   1 
ATOM   1984 O  O   . TYR A 1 265 ? -2.379  22.782 10.186  1.00 21.46 ? 265  TYR A O   1 
ATOM   1985 C  CB  . TYR A 1 265 ? -2.753  21.297 7.186   1.00 18.34 ? 265  TYR A CB  1 
ATOM   1986 C  CG  . TYR A 1 265 ? -3.989  22.132 7.418   1.00 20.10 ? 265  TYR A CG  1 
ATOM   1987 C  CD1 . TYR A 1 265 ? -3.958  23.517 7.269   1.00 21.11 ? 265  TYR A CD1 1 
ATOM   1988 C  CD2 . TYR A 1 265 ? -5.174  21.546 7.854   1.00 20.51 ? 265  TYR A CD2 1 
ATOM   1989 C  CE1 . TYR A 1 265 ? -5.080  24.299 7.551   1.00 22.78 ? 265  TYR A CE1 1 
ATOM   1990 C  CE2 . TYR A 1 265 ? -6.297  22.315 8.140   1.00 20.95 ? 265  TYR A CE2 1 
ATOM   1991 C  CZ  . TYR A 1 265 ? -6.246  23.686 7.985   1.00 21.86 ? 265  TYR A CZ  1 
ATOM   1992 O  OH  . TYR A 1 265 ? -7.370  24.440 8.245   1.00 24.76 ? 265  TYR A OH  1 
ATOM   1993 N  N   . LYS A 1 266 ? -2.831  20.586 10.157  1.00 19.52 ? 266  LYS A N   1 
ATOM   1994 C  CA  . LYS A 1 266 ? -3.513  20.595 11.444  1.00 20.35 ? 266  LYS A CA  1 
ATOM   1995 C  C   . LYS A 1 266 ? -2.723  21.150 12.639  1.00 20.05 ? 266  LYS A C   1 
ATOM   1996 O  O   . LYS A 1 266 ? -3.323  21.593 13.617  1.00 18.10 ? 266  LYS A O   1 
ATOM   1997 C  CB  . LYS A 1 266 ? -4.038  19.180 11.744  1.00 21.53 ? 266  LYS A CB  1 
ATOM   1998 C  CG  . LYS A 1 266 ? -5.135  18.727 10.772  1.00 21.68 ? 266  LYS A CG  1 
ATOM   1999 C  CD  . LYS A 1 266 ? -5.182  17.216 10.613  1.00 23.44 ? 266  LYS A CD  1 
ATOM   2000 C  CE  . LYS A 1 266 ? -5.517  16.533 11.922  1.00 26.26 ? 266  LYS A CE  1 
ATOM   2001 N  NZ  . LYS A 1 266 ? -5.543  15.055 11.771  1.00 28.11 ? 266  LYS A NZ  1 
ATOM   2002 N  N   . THR A 1 267 ? -1.391  21.132 12.577  1.00 21.11 ? 267  THR A N   1 
ATOM   2003 C  CA  . THR A 1 267 ? -0.596  21.674 13.688  1.00 21.77 ? 267  THR A CA  1 
ATOM   2004 C  C   . THR A 1 267 ? -0.835  23.175 13.739  1.00 22.06 ? 267  THR A C   1 
ATOM   2005 O  O   . THR A 1 267 ? -0.680  23.812 14.780  1.00 22.17 ? 267  THR A O   1 
ATOM   2006 C  CB  . THR A 1 267 ? 0.929   21.464 13.496  1.00 21.61 ? 267  THR A CB  1 
ATOM   2007 O  OG1 . THR A 1 267 ? 1.376   22.221 12.362  1.00 20.54 ? 267  THR A OG1 1 
ATOM   2008 C  CG2 . THR A 1 267 ? 1.253   19.987 13.291  1.00 19.01 ? 267  THR A CG2 1 
ATOM   2009 N  N   . GLY A 1 268 ? -1.210  23.725 12.590  1.00 23.44 ? 268  GLY A N   1 
ATOM   2010 C  CA  . GLY A 1 268 ? -1.457  25.147 12.479  1.00 23.74 ? 268  GLY A CA  1 
ATOM   2011 C  C   . GLY A 1 268 ? -0.155  25.914 12.569  1.00 23.66 ? 268  GLY A C   1 
ATOM   2012 O  O   . GLY A 1 268 ? -0.160  27.129 12.771  1.00 23.18 ? 268  GLY A O   1 
ATOM   2013 N  N   . LEU A 1 269 ? 0.965   25.210 12.419  1.00 23.56 ? 269  LEU A N   1 
ATOM   2014 C  CA  . LEU A 1 269 ? 2.266   25.864 12.506  1.00 23.14 ? 269  LEU A CA  1 
ATOM   2015 C  C   . LEU A 1 269 ? 3.036   25.912 11.195  1.00 23.55 ? 269  LEU A C   1 
ATOM   2016 O  O   . LEU A 1 269 ? 4.223   26.243 11.194  1.00 23.43 ? 269  LEU A O   1 
ATOM   2017 C  CB  . LEU A 1 269 ? 3.135   25.202 13.586  1.00 22.04 ? 269  LEU A CB  1 
ATOM   2018 C  CG  . LEU A 1 269 ? 2.649   25.293 15.038  1.00 21.12 ? 269  LEU A CG  1 
ATOM   2019 C  CD1 . LEU A 1 269 ? 3.658   24.627 15.944  1.00 20.23 ? 269  LEU A CD1 1 
ATOM   2020 C  CD2 . LEU A 1 269 ? 2.455   26.742 15.440  1.00 18.74 ? 269  LEU A CD2 1 
ATOM   2021 N  N   . LEU A 1 270 ? 2.378   25.579 10.084  1.00 23.68 ? 270  LEU A N   1 
ATOM   2022 C  CA  . LEU A 1 270 ? 3.050   25.637 8.788   1.00 23.52 ? 270  LEU A CA  1 
ATOM   2023 C  C   . LEU A 1 270 ? 3.416   27.103 8.571   1.00 23.60 ? 270  LEU A C   1 
ATOM   2024 O  O   . LEU A 1 270 ? 2.589   27.984 8.801   1.00 23.65 ? 270  LEU A O   1 
ATOM   2025 C  CB  . LEU A 1 270 ? 2.125   25.161 7.659   1.00 21.69 ? 270  LEU A CB  1 
ATOM   2026 C  CG  . LEU A 1 270 ? 2.721   25.202 6.238   1.00 20.22 ? 270  LEU A CG  1 
ATOM   2027 C  CD1 . LEU A 1 270 ? 3.917   24.263 6.144   1.00 17.71 ? 270  LEU A CD1 1 
ATOM   2028 C  CD2 . LEU A 1 270 ? 1.665   24.828 5.218   1.00 17.84 ? 270  LEU A CD2 1 
ATOM   2029 N  N   . SER A 1 271 ? 4.649   27.362 8.139   1.00 23.60 ? 271  SER A N   1 
ATOM   2030 C  CA  . SER A 1 271 ? 5.108   28.733 7.914   1.00 23.75 ? 271  SER A CA  1 
ATOM   2031 C  C   . SER A 1 271 ? 5.777   28.900 6.554   1.00 22.70 ? 271  SER A C   1 
ATOM   2032 O  O   . SER A 1 271 ? 5.838   30.003 6.008   1.00 20.70 ? 271  SER A O   1 
ATOM   2033 C  CB  . SER A 1 271 ? 6.098   29.137 9.008   1.00 26.56 ? 271  SER A CB  1 
ATOM   2034 O  OG  . SER A 1 271 ? 5.535   28.961 10.298  1.00 31.34 ? 271  SER A OG  1 
ATOM   2035 N  N   . GLY A 1 272 ? 6.292   27.795 6.028   1.00 21.60 ? 272  GLY A N   1 
ATOM   2036 C  CA  . GLY A 1 272 ? 6.962   27.814 4.746   1.00 19.91 ? 272  GLY A CA  1 
ATOM   2037 C  C   . GLY A 1 272 ? 6.813   26.453 4.099   1.00 20.14 ? 272  GLY A C   1 
ATOM   2038 O  O   . GLY A 1 272 ? 6.854   25.432 4.786   1.00 17.30 ? 272  GLY A O   1 
ATOM   2039 N  N   . LEU A 1 273 ? 6.642   26.441 2.780   1.00 20.03 ? 273  LEU A N   1 
ATOM   2040 C  CA  . LEU A 1 273 ? 6.479   25.201 2.027   1.00 20.22 ? 273  LEU A CA  1 
ATOM   2041 C  C   . LEU A 1 273 ? 7.255   25.281 0.710   1.00 20.52 ? 273  LEU A C   1 
ATOM   2042 O  O   . LEU A 1 273 ? 7.285   26.327 0.064   1.00 21.93 ? 273  LEU A O   1 
ATOM   2043 C  CB  . LEU A 1 273 ? 4.996   24.975 1.707   1.00 18.91 ? 273  LEU A CB  1 
ATOM   2044 C  CG  . LEU A 1 273 ? 4.430   23.568 1.495   1.00 18.98 ? 273  LEU A CG  1 
ATOM   2045 C  CD1 . LEU A 1 273 ? 3.214   23.698 0.598   1.00 20.51 ? 273  LEU A CD1 1 
ATOM   2046 C  CD2 . LEU A 1 273 ? 5.446   22.626 0.875   1.00 20.68 ? 273  LEU A CD2 1 
ATOM   2047 N  N   . ASP A 1 274 ? 7.892   24.178 0.328   1.00 19.81 ? 274  ASP A N   1 
ATOM   2048 C  CA  . ASP A 1 274 ? 8.625   24.108 -0.932  1.00 18.74 ? 274  ASP A CA  1 
ATOM   2049 C  C   . ASP A 1 274 ? 8.044   22.908 -1.654  1.00 18.22 ? 274  ASP A C   1 
ATOM   2050 O  O   . ASP A 1 274 ? 7.906   21.838 -1.054  1.00 19.28 ? 274  ASP A O   1 
ATOM   2051 C  CB  . ASP A 1 274 ? 10.136  23.850 -0.734  1.00 15.67 ? 274  ASP A CB  1 
ATOM   2052 C  CG  . ASP A 1 274 ? 10.828  24.925 0.082   1.00 15.02 ? 274  ASP A CG  1 
ATOM   2053 O  OD1 . ASP A 1 274 ? 10.477  26.109 -0.060  1.00 16.93 ? 274  ASP A OD1 1 
ATOM   2054 O  OD2 . ASP A 1 274 ? 11.747  24.585 0.859   1.00 14.06 ? 274  ASP A OD2 1 
ATOM   2055 N  N   . ILE A 1 275 ? 7.683   23.093 -2.922  1.00 18.07 ? 275  ILE A N   1 
ATOM   2056 C  CA  . ILE A 1 275 ? 7.163   22.012 -3.759  1.00 18.36 ? 275  ILE A CA  1 
ATOM   2057 C  C   . ILE A 1 275 ? 8.202   21.895 -4.862  1.00 18.45 ? 275  ILE A C   1 
ATOM   2058 O  O   . ILE A 1 275 ? 8.130   22.579 -5.887  1.00 16.91 ? 275  ILE A O   1 
ATOM   2059 C  CB  . ILE A 1 275 ? 5.793   22.352 -4.368  1.00 20.32 ? 275  ILE A CB  1 
ATOM   2060 C  CG1 . ILE A 1 275 ? 4.776   22.599 -3.250  1.00 21.33 ? 275  ILE A CG1 1 
ATOM   2061 C  CG2 . ILE A 1 275 ? 5.324   21.202 -5.267  1.00 20.07 ? 275  ILE A CG2 1 
ATOM   2062 C  CD1 . ILE A 1 275 ? 4.572   21.406 -2.330  1.00 21.10 ? 275  ILE A CD1 1 
ATOM   2063 N  N   . MET A 1 276 ? 9.157   20.998 -4.643  1.00 19.05 ? 276  MET A N   1 
ATOM   2064 C  CA  . MET A 1 276 ? 10.285  20.826 -5.542  1.00 18.46 ? 276  MET A CA  1 
ATOM   2065 C  C   . MET A 1 276 ? 10.387  19.606 -6.446  1.00 17.77 ? 276  MET A C   1 
ATOM   2066 O  O   . MET A 1 276 ? 9.629   18.645 -6.336  1.00 17.94 ? 276  MET A O   1 
ATOM   2067 C  CB  . MET A 1 276 ? 11.563  20.907 -4.709  1.00 20.68 ? 276  MET A CB  1 
ATOM   2068 C  CG  . MET A 1 276 ? 11.527  21.997 -3.652  1.00 21.41 ? 276  MET A CG  1 
ATOM   2069 S  SD  . MET A 1 276 ? 11.183  23.588 -4.399  1.00 28.25 ? 276  MET A SD  1 
ATOM   2070 C  CE  . MET A 1 276 ? 12.834  24.101 -4.844  1.00 25.39 ? 276  MET A CE  1 
ATOM   2071 N  N   . GLU A 1 277 ? 11.368  19.697 -7.340  1.00 17.59 ? 277  GLU A N   1 
ATOM   2072 C  CA  . GLU A 1 277 ? 11.742  18.667 -8.303  1.00 18.09 ? 277  GLU A CA  1 
ATOM   2073 C  C   . GLU A 1 277 ? 10.716  18.126 -9.290  1.00 18.57 ? 277  GLU A C   1 
ATOM   2074 O  O   . GLU A 1 277 ? 10.856  16.998 -9.763  1.00 19.96 ? 277  GLU A O   1 
ATOM   2075 C  CB  . GLU A 1 277 ? 12.409  17.494 -7.572  1.00 16.87 ? 277  GLU A CB  1 
ATOM   2076 C  CG  . GLU A 1 277 ? 13.683  17.849 -6.799  1.00 16.37 ? 277  GLU A CG  1 
ATOM   2077 C  CD  . GLU A 1 277 ? 14.857  18.265 -7.691  1.00 19.67 ? 277  GLU A CD  1 
ATOM   2078 O  OE1 . GLU A 1 277 ? 14.923  17.831 -8.862  1.00 21.48 ? 277  GLU A OE1 1 
ATOM   2079 O  OE2 . GLU A 1 277 ? 15.739  19.014 -7.211  1.00 17.96 ? 277  GLU A OE2 1 
ATOM   2080 N  N   . VAL A 1 278 ? 9.692   18.910 -9.610  1.00 19.36 ? 278  VAL A N   1 
ATOM   2081 C  CA  . VAL A 1 278 ? 8.714   18.469 -10.604 1.00 20.83 ? 278  VAL A CA  1 
ATOM   2082 C  C   . VAL A 1 278 ? 9.309   18.900 -11.958 1.00 21.22 ? 278  VAL A C   1 
ATOM   2083 O  O   . VAL A 1 278 ? 9.696   20.065 -12.142 1.00 21.67 ? 278  VAL A O   1 
ATOM   2084 C  CB  . VAL A 1 278 ? 7.325   19.140 -10.408 1.00 20.52 ? 278  VAL A CB  1 
ATOM   2085 C  CG1 . VAL A 1 278 ? 6.372   18.681 -11.494 1.00 21.42 ? 278  VAL A CG1 1 
ATOM   2086 C  CG2 . VAL A 1 278 ? 6.756   18.790 -9.043  1.00 20.77 ? 278  VAL A CG2 1 
ATOM   2087 N  N   . ASN A 1 279 ? 9.397   17.962 -12.894 1.00 20.42 ? 279  ASN A N   1 
ATOM   2088 C  CA  . ASN A 1 279 ? 9.979   18.242 -14.204 1.00 20.05 ? 279  ASN A CA  1 
ATOM   2089 C  C   . ASN A 1 279 ? 9.118   17.563 -15.262 1.00 20.40 ? 279  ASN A C   1 
ATOM   2090 O  O   . ASN A 1 279 ? 9.299   16.385 -15.573 1.00 20.46 ? 279  ASN A O   1 
ATOM   2091 C  CB  . ASN A 1 279 ? 11.417  17.708 -14.231 1.00 18.95 ? 279  ASN A CB  1 
ATOM   2092 C  CG  . ASN A 1 279 ? 12.205  18.176 -15.445 1.00 19.76 ? 279  ASN A CG  1 
ATOM   2093 O  OD1 . ASN A 1 279 ? 13.430  18.056 -15.472 1.00 19.44 ? 279  ASN A OD1 1 
ATOM   2094 N  ND2 . ASN A 1 279 ? 11.513  18.699 -16.453 1.00 16.54 ? 279  ASN A ND2 1 
ATOM   2095 N  N   . PRO A 1 280 ? 8.157   18.306 -15.827 1.00 21.57 ? 280  PRO A N   1 
ATOM   2096 C  CA  . PRO A 1 280 ? 7.266   17.749 -16.850 1.00 22.54 ? 280  PRO A CA  1 
ATOM   2097 C  C   . PRO A 1 280 ? 7.938   17.189 -18.106 1.00 23.49 ? 280  PRO A C   1 
ATOM   2098 O  O   . PRO A 1 280 ? 7.432   16.246 -18.707 1.00 23.10 ? 280  PRO A O   1 
ATOM   2099 C  CB  . PRO A 1 280 ? 6.311   18.907 -17.145 1.00 21.35 ? 280  PRO A CB  1 
ATOM   2100 C  CG  . PRO A 1 280 ? 7.126   20.118 -16.820 1.00 22.00 ? 280  PRO A CG  1 
ATOM   2101 C  CD  . PRO A 1 280 ? 7.851   19.725 -15.569 1.00 19.81 ? 280  PRO A CD  1 
ATOM   2102 N  N   . SER A 1 281 ? 9.074   17.753 -18.505 1.00 24.95 ? 281  SER A N   1 
ATOM   2103 C  CA  . SER A 1 281 ? 9.753   17.257 -19.697 1.00 27.00 ? 281  SER A CA  1 
ATOM   2104 C  C   . SER A 1 281 ? 10.286  15.848 -19.476 1.00 28.30 ? 281  SER A C   1 
ATOM   2105 O  O   . SER A 1 281 ? 10.818  15.230 -20.403 1.00 28.95 ? 281  SER A O   1 
ATOM   2106 C  CB  . SER A 1 281 ? 10.916  18.166 -20.070 1.00 26.29 ? 281  SER A CB  1 
ATOM   2107 O  OG  . SER A 1 281 ? 11.982  17.997 -19.158 1.00 28.58 ? 281  SER A OG  1 
ATOM   2108 N  N   . LEU A 1 282 ? 10.142  15.342 -18.249 1.00 28.99 ? 282  LEU A N   1 
ATOM   2109 C  CA  . LEU A 1 282 ? 10.623  14.007 -17.902 1.00 28.37 ? 282  LEU A CA  1 
ATOM   2110 C  C   . LEU A 1 282 ? 9.527   12.954 -17.793 1.00 30.21 ? 282  LEU A C   1 
ATOM   2111 O  O   . LEU A 1 282 ? 9.805   11.793 -17.473 1.00 31.32 ? 282  LEU A O   1 
ATOM   2112 C  CB  . LEU A 1 282 ? 11.410  14.050 -16.594 1.00 27.71 ? 282  LEU A CB  1 
ATOM   2113 C  CG  . LEU A 1 282 ? 12.591  15.024 -16.540 1.00 25.06 ? 282  LEU A CG  1 
ATOM   2114 C  CD1 . LEU A 1 282 ? 13.389  14.769 -15.270 1.00 24.88 ? 282  LEU A CD1 1 
ATOM   2115 C  CD2 . LEU A 1 282 ? 13.475  14.839 -17.763 1.00 26.07 ? 282  LEU A CD2 1 
ATOM   2116 N  N   . GLY A 1 283 ? 8.284   13.354 -18.044 1.00 31.81 ? 283  GLY A N   1 
ATOM   2117 C  CA  . GLY A 1 283 ? 7.192   12.399 -17.999 1.00 33.05 ? 283  GLY A CA  1 
ATOM   2118 C  C   . GLY A 1 283 ? 7.235   11.602 -19.292 1.00 34.32 ? 283  GLY A C   1 
ATOM   2119 O  O   . GLY A 1 283 ? 7.471   12.169 -20.360 1.00 35.14 ? 283  GLY A O   1 
ATOM   2120 N  N   . LYS A 1 284 ? 7.033   10.292 -19.211 1.00 34.73 ? 284  LYS A N   1 
ATOM   2121 C  CA  . LYS A 1 284 ? 7.055   9.448  -20.403 1.00 35.47 ? 284  LYS A CA  1 
ATOM   2122 C  C   . LYS A 1 284 ? 5.966   9.899  -21.370 1.00 34.47 ? 284  LYS A C   1 
ATOM   2123 O  O   . LYS A 1 284 ? 6.221   10.134 -22.552 1.00 35.70 ? 284  LYS A O   1 
ATOM   2124 C  CB  . LYS A 1 284 ? 6.817   7.985  -20.022 1.00 38.08 ? 284  LYS A CB  1 
ATOM   2125 C  CG  . LYS A 1 284 ? 6.859   7.003  -21.195 1.00 41.62 ? 284  LYS A CG  1 
ATOM   2126 C  CD  . LYS A 1 284 ? 6.327   5.617  -20.801 1.00 41.95 ? 284  LYS A CD  1 
ATOM   2127 C  CE  . LYS A 1 284 ? 7.082   5.034  -19.608 1.00 43.49 ? 284  LYS A CE  1 
ATOM   2128 N  NZ  . LYS A 1 284 ? 6.568   3.702  -19.180 1.00 43.86 ? 284  LYS A NZ  1 
ATOM   2129 N  N   . THR A 1 285 ? 4.747   10.015 -20.856 1.00 32.34 ? 285  THR A N   1 
ATOM   2130 C  CA  . THR A 1 285 ? 3.610   10.432 -21.663 1.00 29.42 ? 285  THR A CA  1 
ATOM   2131 C  C   . THR A 1 285 ? 2.987   11.692 -21.065 1.00 28.81 ? 285  THR A C   1 
ATOM   2132 O  O   . THR A 1 285 ? 3.346   12.101 -19.959 1.00 29.20 ? 285  THR A O   1 
ATOM   2133 C  CB  . THR A 1 285 ? 2.540   9.321  -21.713 1.00 29.08 ? 285  THR A CB  1 
ATOM   2134 O  OG1 . THR A 1 285 ? 2.049   9.064  -20.392 1.00 29.29 ? 285  THR A OG1 1 
ATOM   2135 C  CG2 . THR A 1 285 ? 3.127   8.042  -22.272 1.00 28.50 ? 285  THR A CG2 1 
ATOM   2136 N  N   . PRO A 1 286 ? 2.060   12.335 -21.800 1.00 27.40 ? 286  PRO A N   1 
ATOM   2137 C  CA  . PRO A 1 286 ? 1.366   13.553 -21.359 1.00 26.31 ? 286  PRO A CA  1 
ATOM   2138 C  C   . PRO A 1 286 ? 0.554   13.328 -20.081 1.00 25.17 ? 286  PRO A C   1 
ATOM   2139 O  O   . PRO A 1 286 ? 0.255   14.267 -19.347 1.00 24.44 ? 286  PRO A O   1 
ATOM   2140 C  CB  . PRO A 1 286 ? 0.467   13.886 -22.545 1.00 26.45 ? 286  PRO A CB  1 
ATOM   2141 C  CG  . PRO A 1 286 ? 1.255   13.385 -23.709 1.00 26.94 ? 286  PRO A CG  1 
ATOM   2142 C  CD  . PRO A 1 286 ? 1.764   12.054 -23.218 1.00 27.86 ? 286  PRO A CD  1 
ATOM   2143 N  N   . GLU A 1 287 ? 0.184   12.079 -19.832 1.00 24.04 ? 287  GLU A N   1 
ATOM   2144 C  CA  . GLU A 1 287 ? -0.569  11.755 -18.637 1.00 23.76 ? 287  GLU A CA  1 
ATOM   2145 C  C   . GLU A 1 287 ? 0.406   11.548 -17.474 1.00 22.37 ? 287  GLU A C   1 
ATOM   2146 O  O   . GLU A 1 287 ? 0.035   11.723 -16.320 1.00 21.19 ? 287  GLU A O   1 
ATOM   2147 C  CB  . GLU A 1 287 ? -1.421  10.505 -18.870 1.00 24.95 ? 287  GLU A CB  1 
ATOM   2148 C  CG  . GLU A 1 287 ? -0.646  9.210  -18.951 1.00 28.45 ? 287  GLU A CG  1 
ATOM   2149 C  CD  . GLU A 1 287 ? -0.243  8.687  -17.582 1.00 29.66 ? 287  GLU A CD  1 
ATOM   2150 O  OE1 . GLU A 1 287 ? -1.119  8.624  -16.689 1.00 26.66 ? 287  GLU A OE1 1 
ATOM   2151 O  OE2 . GLU A 1 287 ? 0.945   8.333  -17.409 1.00 30.85 ? 287  GLU A OE2 1 
ATOM   2152 N  N   . GLU A 1 288 ? 1.646   11.170 -17.782 1.00 22.10 ? 288  GLU A N   1 
ATOM   2153 C  CA  . GLU A 1 288 ? 2.661   10.982 -16.748 1.00 22.24 ? 288  GLU A CA  1 
ATOM   2154 C  C   . GLU A 1 288 ? 2.978   12.339 -16.153 1.00 23.05 ? 288  GLU A C   1 
ATOM   2155 O  O   . GLU A 1 288 ? 3.345   12.452 -14.986 1.00 22.55 ? 288  GLU A O   1 
ATOM   2156 C  CB  . GLU A 1 288 ? 3.947   10.415 -17.326 1.00 20.96 ? 288  GLU A CB  1 
ATOM   2157 C  CG  . GLU A 1 288 ? 3.882   8.970  -17.731 1.00 22.26 ? 288  GLU A CG  1 
ATOM   2158 C  CD  . GLU A 1 288 ? 5.112   8.222  -17.284 1.00 22.19 ? 288  GLU A CD  1 
ATOM   2159 O  OE1 . GLU A 1 288 ? 6.195   8.844  -17.232 1.00 20.77 ? 288  GLU A OE1 1 
ATOM   2160 O  OE2 . GLU A 1 288 ? 4.999   7.016  -16.988 1.00 25.31 ? 288  GLU A OE2 1 
ATOM   2161 N  N   . VAL A 1 289 ? 2.845   13.367 -16.986 1.00 24.23 ? 289  VAL A N   1 
ATOM   2162 C  CA  . VAL A 1 289 ? 3.094   14.745 -16.585 1.00 24.73 ? 289  VAL A CA  1 
ATOM   2163 C  C   . VAL A 1 289 ? 1.910   15.243 -15.768 1.00 25.51 ? 289  VAL A C   1 
ATOM   2164 O  O   . VAL A 1 289 ? 2.080   15.915 -14.748 1.00 26.09 ? 289  VAL A O   1 
ATOM   2165 C  CB  . VAL A 1 289 ? 3.246   15.649 -17.814 1.00 25.48 ? 289  VAL A CB  1 
ATOM   2166 C  CG1 . VAL A 1 289 ? 3.404   17.099 -17.375 1.00 27.22 ? 289  VAL A CG1 1 
ATOM   2167 C  CG2 . VAL A 1 289 ? 4.431   15.187 -18.650 1.00 23.66 ? 289  VAL A CG2 1 
ATOM   2168 N  N   . THR A 1 290 ? 0.708   14.911 -16.234 1.00 24.59 ? 290  THR A N   1 
ATOM   2169 C  CA  . THR A 1 290 ? -0.526  15.309 -15.563 1.00 24.38 ? 290  THR A CA  1 
ATOM   2170 C  C   . THR A 1 290 ? -0.669  14.610 -14.208 1.00 23.18 ? 290  THR A C   1 
ATOM   2171 O  O   . THR A 1 290 ? -1.219  15.175 -13.261 1.00 22.16 ? 290  THR A O   1 
ATOM   2172 C  CB  . THR A 1 290 ? -1.747  14.984 -16.444 1.00 24.76 ? 290  THR A CB  1 
ATOM   2173 O  OG1 . THR A 1 290 ? -1.758  15.867 -17.567 1.00 28.79 ? 290  THR A OG1 1 
ATOM   2174 C  CG2 . THR A 1 290 ? -3.039  15.155 -15.674 1.00 28.45 ? 290  THR A CG2 1 
ATOM   2175 N  N   . ARG A 1 291 ? -0.173  13.380 -14.122 1.00 22.09 ? 291  ARG A N   1 
ATOM   2176 C  CA  . ARG A 1 291 ? -0.243  12.620 -12.881 1.00 22.39 ? 291  ARG A CA  1 
ATOM   2177 C  C   . ARG A 1 291 ? 0.681   13.225 -11.838 1.00 21.96 ? 291  ARG A C   1 
ATOM   2178 O  O   . ARG A 1 291 ? 0.314   13.345 -10.671 1.00 22.43 ? 291  ARG A O   1 
ATOM   2179 C  CB  . ARG A 1 291 ? 0.168   11.167 -13.101 1.00 21.01 ? 291  ARG A CB  1 
ATOM   2180 C  CG  . ARG A 1 291 ? -0.078  10.292 -11.885 1.00 22.01 ? 291  ARG A CG  1 
ATOM   2181 C  CD  . ARG A 1 291 ? 0.670   8.987  -12.009 1.00 23.30 ? 291  ARG A CD  1 
ATOM   2182 N  NE  . ARG A 1 291 ? 0.480   8.396  -13.327 1.00 23.88 ? 291  ARG A NE  1 
ATOM   2183 C  CZ  . ARG A 1 291 ? 1.234   7.421  -13.816 1.00 24.44 ? 291  ARG A CZ  1 
ATOM   2184 N  NH1 . ARG A 1 291 ? 2.229   6.931  -13.090 1.00 24.64 ? 291  ARG A NH1 1 
ATOM   2185 N  NH2 . ARG A 1 291 ? 0.996   6.941  -15.028 1.00 26.63 ? 291  ARG A NH2 1 
ATOM   2186 N  N   . THR A 1 292 ? 1.884   13.593 -12.272 1.00 20.32 ? 292  THR A N   1 
ATOM   2187 C  CA  . THR A 1 292 ? 2.882   14.174 -11.385 1.00 19.09 ? 292  THR A CA  1 
ATOM   2188 C  C   . THR A 1 292 ? 2.483   15.559 -10.892 1.00 17.81 ? 292  THR A C   1 
ATOM   2189 O  O   . THR A 1 292 ? 2.705   15.894 -9.731  1.00 17.47 ? 292  THR A O   1 
ATOM   2190 C  CB  . THR A 1 292 ? 4.253   14.272 -12.092 1.00 18.97 ? 292  THR A CB  1 
ATOM   2191 O  OG1 . THR A 1 292 ? 4.646   12.973 -12.542 1.00 18.28 ? 292  THR A OG1 1 
ATOM   2192 C  CG2 . THR A 1 292 ? 5.310   14.819 -11.142 1.00 17.40 ? 292  THR A CG2 1 
ATOM   2193 N  N   . VAL A 1 293 ? 1.893   16.355 -11.781 1.00 17.14 ? 293  VAL A N   1 
ATOM   2194 C  CA  . VAL A 1 293 ? 1.463   17.711 -11.448 1.00 16.18 ? 293  VAL A CA  1 
ATOM   2195 C  C   . VAL A 1 293 ? 0.233   17.771 -10.536 1.00 16.42 ? 293  VAL A C   1 
ATOM   2196 O  O   . VAL A 1 293 ? 0.180   18.581 -9.609  1.00 15.61 ? 293  VAL A O   1 
ATOM   2197 C  CB  . VAL A 1 293 ? 1.166   18.522 -12.737 1.00 17.47 ? 293  VAL A CB  1 
ATOM   2198 C  CG1 . VAL A 1 293 ? 0.486   19.856 -12.386 1.00 16.19 ? 293  VAL A CG1 1 
ATOM   2199 C  CG2 . VAL A 1 293 ? 2.464   18.765 -13.500 1.00 15.85 ? 293  VAL A CG2 1 
ATOM   2200 N  N   . ASN A 1 294 ? -0.757  16.929 -10.811 1.00 15.81 ? 294  ASN A N   1 
ATOM   2201 C  CA  . ASN A 1 294 ? -1.974  16.902 -10.011 1.00 16.22 ? 294  ASN A CA  1 
ATOM   2202 C  C   . ASN A 1 294 ? -1.694  16.390 -8.604  1.00 15.68 ? 294  ASN A C   1 
ATOM   2203 O  O   . ASN A 1 294 ? -2.311  16.841 -7.638  1.00 14.65 ? 294  ASN A O   1 
ATOM   2204 C  CB  . ASN A 1 294 ? -3.034  16.031 -10.687 1.00 16.22 ? 294  ASN A CB  1 
ATOM   2205 C  CG  . ASN A 1 294 ? -3.557  16.646 -11.972 1.00 18.24 ? 294  ASN A CG  1 
ATOM   2206 O  OD1 . ASN A 1 294 ? -3.198  17.770 -12.328 1.00 18.47 ? 294  ASN A OD1 1 
ATOM   2207 N  ND2 . ASN A 1 294 ? -4.417  15.913 -12.672 1.00 19.16 ? 294  ASN A ND2 1 
ATOM   2208 N  N   . THR A 1 295 ? -0.765  15.443 -8.494  1.00 15.59 ? 295  THR A N   1 
ATOM   2209 C  CA  . THR A 1 295 ? -0.400  14.892 -7.198  1.00 14.98 ? 295  THR A CA  1 
ATOM   2210 C  C   . THR A 1 295 ? 0.329   15.973 -6.412  1.00 15.94 ? 295  THR A C   1 
ATOM   2211 O  O   . THR A 1 295 ? 0.234   16.035 -5.186  1.00 16.42 ? 295  THR A O   1 
ATOM   2212 C  CB  . THR A 1 295 ? 0.497   13.643 -7.357  1.00 15.34 ? 295  THR A CB  1 
ATOM   2213 O  OG1 . THR A 1 295 ? -0.229  12.635 -8.072  1.00 14.29 ? 295  THR A OG1 1 
ATOM   2214 C  CG2 . THR A 1 295 ? 0.915   13.086 -5.995  1.00 11.42 ? 295  THR A CG2 1 
ATOM   2215 N  N   . ALA A 1 296 ? 1.040   16.842 -7.128  1.00 16.41 ? 296  ALA A N   1 
ATOM   2216 C  CA  . ALA A 1 296 ? 1.774   17.933 -6.495  1.00 14.11 ? 296  ALA A CA  1 
ATOM   2217 C  C   . ALA A 1 296 ? 0.795   18.992 -6.001  1.00 12.69 ? 296  ALA A C   1 
ATOM   2218 O  O   . ALA A 1 296 ? 0.981   19.560 -4.934  1.00 13.00 ? 296  ALA A O   1 
ATOM   2219 C  CB  . ALA A 1 296 ? 2.780   18.547 -7.481  1.00 14.44 ? 296  ALA A CB  1 
ATOM   2220 N  N   . VAL A 1 297 ? -0.253  19.249 -6.773  1.00 13.09 ? 297  VAL A N   1 
ATOM   2221 C  CA  . VAL A 1 297 ? -1.263  20.230 -6.383  1.00 13.47 ? 297  VAL A CA  1 
ATOM   2222 C  C   . VAL A 1 297 ? -2.107  19.683 -5.237  1.00 14.11 ? 297  VAL A C   1 
ATOM   2223 O  O   . VAL A 1 297 ? -2.433  20.404 -4.295  1.00 14.60 ? 297  VAL A O   1 
ATOM   2224 C  CB  . VAL A 1 297 ? -2.194  20.571 -7.562  1.00 14.46 ? 297  VAL A CB  1 
ATOM   2225 C  CG1 . VAL A 1 297 ? -3.394  21.367 -7.074  1.00 15.14 ? 297  VAL A CG1 1 
ATOM   2226 C  CG2 . VAL A 1 297 ? -1.426  21.356 -8.616  1.00 17.57 ? 297  VAL A CG2 1 
ATOM   2227 N  N   . ALA A 1 298 ? -2.471  18.407 -5.328  1.00 15.11 ? 298  ALA A N   1 
ATOM   2228 C  CA  . ALA A 1 298 ? -3.266  17.771 -4.282  1.00 14.35 ? 298  ALA A CA  1 
ATOM   2229 C  C   . ALA A 1 298 ? -2.495  17.883 -2.976  1.00 14.47 ? 298  ALA A C   1 
ATOM   2230 O  O   . ALA A 1 298 ? -3.076  18.155 -1.935  1.00 14.57 ? 298  ALA A O   1 
ATOM   2231 C  CB  . ALA A 1 298 ? -3.506  16.310 -4.623  1.00 15.49 ? 298  ALA A CB  1 
ATOM   2232 N  N   . ILE A 1 299 ? -1.183  17.665 -3.054  1.00 13.84 ? 299  ILE A N   1 
ATOM   2233 C  CA  . ILE A 1 299 ? -0.278  17.748 -1.907  1.00 15.02 ? 299  ILE A CA  1 
ATOM   2234 C  C   . ILE A 1 299 ? -0.288  19.161 -1.311  1.00 12.28 ? 299  ILE A C   1 
ATOM   2235 O  O   . ILE A 1 299 ? -0.490  19.339 -0.117  1.00 13.11 ? 299  ILE A O   1 
ATOM   2236 C  CB  . ILE A 1 299 ? 1.191   17.370 -2.334  1.00 16.92 ? 299  ILE A CB  1 
ATOM   2237 C  CG1 . ILE A 1 299 ? 1.373   15.847 -2.337  1.00 16.37 ? 299  ILE A CG1 1 
ATOM   2238 C  CG2 . ILE A 1 299 ? 2.217   18.025 -1.407  1.00 18.03 ? 299  ILE A CG2 1 
ATOM   2239 C  CD1 . ILE A 1 299 ? 1.708   15.254 -0.991  1.00 17.70 ? 299  ILE A CD1 1 
ATOM   2240 N  N   . THR A 1 300 ? -0.062  20.157 -2.154  1.00 11.35 ? 300  THR A N   1 
ATOM   2241 C  CA  . THR A 1 300 ? -0.046  21.548 -1.721  1.00 11.64 ? 300  THR A CA  1 
ATOM   2242 C  C   . THR A 1 300 ? -1.378  21.944 -1.065  1.00 11.36 ? 300  THR A C   1 
ATOM   2243 O  O   . THR A 1 300 ? -1.383  22.643 -0.053  1.00 12.20 ? 300  THR A O   1 
ATOM   2244 C  CB  . THR A 1 300 ? 0.243   22.500 -2.926  1.00 10.63 ? 300  THR A CB  1 
ATOM   2245 O  OG1 . THR A 1 300 ? 1.461   22.104 -3.563  1.00 12.55 ? 300  THR A OG1 1 
ATOM   2246 C  CG2 . THR A 1 300 ? 0.390   23.935 -2.470  1.00 8.71  ? 300  THR A CG2 1 
ATOM   2247 N  N   . LEU A 1 301 ? -2.493  21.483 -1.637  1.00 13.00 ? 301  LEU A N   1 
ATOM   2248 C  CA  . LEU A 1 301 ? -3.831  21.805 -1.127  1.00 13.04 ? 301  LEU A CA  1 
ATOM   2249 C  C   . LEU A 1 301 ? -4.107  21.260 0.281   1.00 12.92 ? 301  LEU A C   1 
ATOM   2250 O  O   . LEU A 1 301 ? -4.816  21.888 1.056   1.00 12.60 ? 301  LEU A O   1 
ATOM   2251 C  CB  . LEU A 1 301 ? -4.920  21.313 -2.102  1.00 12.29 ? 301  LEU A CB  1 
ATOM   2252 C  CG  . LEU A 1 301 ? -5.042  21.961 -3.494  1.00 13.08 ? 301  LEU A CG  1 
ATOM   2253 C  CD1 . LEU A 1 301 ? -6.272  21.425 -4.189  1.00 12.81 ? 301  LEU A CD1 1 
ATOM   2254 C  CD2 . LEU A 1 301 ? -5.139  23.476 -3.392  1.00 11.28 ? 301  LEU A CD2 1 
ATOM   2255 N  N   . ALA A 1 302 ? -3.548  20.096 0.608   1.00 13.14 ? 302  ALA A N   1 
ATOM   2256 C  CA  . ALA A 1 302 ? -3.734  19.495 1.927   1.00 13.09 ? 302  ALA A CA  1 
ATOM   2257 C  C   . ALA A 1 302 ? -2.937  20.291 2.949   1.00 13.11 ? 302  ALA A C   1 
ATOM   2258 O  O   . ALA A 1 302 ? -3.269  20.329 4.131   1.00 13.85 ? 302  ALA A O   1 
ATOM   2259 C  CB  . ALA A 1 302 ? -3.270  18.033 1.916   1.00 11.37 ? 302  ALA A CB  1 
ATOM   2260 N  N   . CYS A 1 303 ? -1.872  20.933 2.490   1.00 13.78 ? 303  CYS A N   1 
ATOM   2261 C  CA  . CYS A 1 303 ? -1.054  21.732 3.380   1.00 14.45 ? 303  CYS A CA  1 
ATOM   2262 C  C   . CYS A 1 303 ? -1.867  22.925 3.858   1.00 14.79 ? 303  CYS A C   1 
ATOM   2263 O  O   . CYS A 1 303 ? -1.625  23.469 4.938   1.00 16.62 ? 303  CYS A O   1 
ATOM   2264 C  CB  . CYS A 1 303 ? 0.204   22.210 2.649   1.00 14.91 ? 303  CYS A CB  1 
ATOM   2265 S  SG  . CYS A 1 303 ? 1.367   20.862 2.242   1.00 18.70 ? 303  CYS A SG  1 
ATOM   2266 N  N   . PHE A 1 304 ? -2.855  23.310 3.060   1.00 14.53 ? 304  PHE A N   1 
ATOM   2267 C  CA  . PHE A 1 304 ? -3.682  24.457 3.391   1.00 15.06 ? 304  PHE A CA  1 
ATOM   2268 C  C   . PHE A 1 304 ? -5.125  24.163 3.762   1.00 16.55 ? 304  PHE A C   1 
ATOM   2269 O  O   . PHE A 1 304 ? -6.001  25.005 3.576   1.00 18.50 ? 304  PHE A O   1 
ATOM   2270 C  CB  . PHE A 1 304 ? -3.608  25.476 2.251   1.00 12.92 ? 304  PHE A CB  1 
ATOM   2271 C  CG  . PHE A 1 304 ? -2.221  26.016 2.039   1.00 11.83 ? 304  PHE A CG  1 
ATOM   2272 C  CD1 . PHE A 1 304 ? -1.635  26.847 2.994   1.00 9.75  ? 304  PHE A CD1 1 
ATOM   2273 C  CD2 . PHE A 1 304 ? -1.461  25.609 0.946   1.00 9.66  ? 304  PHE A CD2 1 
ATOM   2274 C  CE1 . PHE A 1 304 ? -0.307  27.258 2.866   1.00 10.57 ? 304  PHE A CE1 1 
ATOM   2275 C  CE2 . PHE A 1 304 ? -0.132  26.014 0.808   1.00 9.07  ? 304  PHE A CE2 1 
ATOM   2276 C  CZ  . PHE A 1 304 ? 0.448   26.836 1.766   1.00 8.26  ? 304  PHE A CZ  1 
ATOM   2277 N  N   . GLY A 1 305 ? -5.378  22.967 4.285   1.00 16.79 ? 305  GLY A N   1 
ATOM   2278 C  CA  . GLY A 1 305 ? -6.723  22.652 4.731   1.00 17.55 ? 305  GLY A CA  1 
ATOM   2279 C  C   . GLY A 1 305 ? -7.570  21.624 4.022   1.00 16.76 ? 305  GLY A C   1 
ATOM   2280 O  O   . GLY A 1 305 ? -8.560  21.151 4.578   1.00 15.58 ? 305  GLY A O   1 
ATOM   2281 N  N   . LEU A 1 306 ? -7.216  21.285 2.792   1.00 18.75 ? 306  LEU A N   1 
ATOM   2282 C  CA  . LEU A 1 306 ? -8.004  20.304 2.071   1.00 19.25 ? 306  LEU A CA  1 
ATOM   2283 C  C   . LEU A 1 306 ? -7.871  18.978 2.807   1.00 18.53 ? 306  LEU A C   1 
ATOM   2284 O  O   . LEU A 1 306 ? -6.774  18.423 2.898   1.00 19.13 ? 306  LEU A O   1 
ATOM   2285 C  CB  . LEU A 1 306 ? -7.507  20.170 0.629   1.00 20.19 ? 306  LEU A CB  1 
ATOM   2286 C  CG  . LEU A 1 306 ? -8.540  19.656 -0.379  1.00 21.22 ? 306  LEU A CG  1 
ATOM   2287 C  CD1 . LEU A 1 306 ? -7.941  19.650 -1.773  1.00 21.95 ? 306  LEU A CD1 1 
ATOM   2288 C  CD2 . LEU A 1 306 ? -8.990  18.266 0.009   1.00 24.65 ? 306  LEU A CD2 1 
ATOM   2289 N  N   . ALA A 1 307 ? -8.992  18.487 3.343   1.00 18.49 ? 307  ALA A N   1 
ATOM   2290 C  CA  . ALA A 1 307 ? -9.024  17.218 4.078   1.00 16.33 ? 307  ALA A CA  1 
ATOM   2291 C  C   . ALA A 1 307 ? -9.944  16.226 3.374   1.00 14.76 ? 307  ALA A C   1 
ATOM   2292 O  O   . ALA A 1 307 ? -10.979 16.607 2.832   1.00 13.20 ? 307  ALA A O   1 
ATOM   2293 C  CB  . ALA A 1 307 ? -9.496  17.447 5.511   1.00 13.95 ? 307  ALA A CB  1 
ATOM   2294 N  N   . ARG A 1 308 ? -9.557  14.954 3.387   1.00 15.04 ? 308  ARG A N   1 
ATOM   2295 C  CA  . ARG A 1 308 ? -10.336 13.907 2.733   1.00 15.87 ? 308  ARG A CA  1 
ATOM   2296 C  C   . ARG A 1 308 ? -11.673 13.607 3.392   1.00 15.28 ? 308  ARG A C   1 
ATOM   2297 O  O   . ARG A 1 308 ? -12.559 13.015 2.767   1.00 15.45 ? 308  ARG A O   1 
ATOM   2298 C  CB  . ARG A 1 308 ? -9.503  12.625 2.616   1.00 13.44 ? 308  ARG A CB  1 
ATOM   2299 C  CG  . ARG A 1 308 ? -8.503  12.688 1.479   1.00 12.80 ? 308  ARG A CG  1 
ATOM   2300 C  CD  . ARG A 1 308 ? -7.520  11.537 1.514   1.00 13.95 ? 308  ARG A CD  1 
ATOM   2301 N  NE  . ARG A 1 308 ? -6.487  11.728 2.526   1.00 11.22 ? 308  ARG A NE  1 
ATOM   2302 C  CZ  . ARG A 1 308 ? -5.575  10.819 2.836   1.00 10.43 ? 308  ARG A CZ  1 
ATOM   2303 N  NH1 . ARG A 1 308 ? -5.567  9.648  2.211   1.00 10.83 ? 308  ARG A NH1 1 
ATOM   2304 N  NH2 . ARG A 1 308 ? -4.666  11.084 3.762   1.00 10.16 ? 308  ARG A NH2 1 
ATOM   2305 N  N   . GLU A 1 309 ? -11.830 14.002 4.651   1.00 17.49 ? 309  GLU A N   1 
ATOM   2306 C  CA  . GLU A 1 309 ? -13.106 13.769 5.335   1.00 16.39 ? 309  GLU A CA  1 
ATOM   2307 C  C   . GLU A 1 309 ? -14.089 14.836 4.861   1.00 15.29 ? 309  GLU A C   1 
ATOM   2308 O  O   . GLU A 1 309 ? -15.308 14.690 4.977   1.00 15.50 ? 309  GLU A O   1 
ATOM   2309 C  CB  . GLU A 1 309 ? -12.937 13.854 6.850   1.00 13.20 ? 309  GLU A CB  1 
ATOM   2310 C  CG  . GLU A 1 309 ? -12.559 15.222 7.367   1.00 10.95 ? 309  GLU A CG  1 
ATOM   2311 C  CD  . GLU A 1 309 ? -12.795 15.343 8.859   1.00 13.75 ? 309  GLU A CD  1 
ATOM   2312 O  OE1 . GLU A 1 309 ? -12.262 14.512 9.622   1.00 14.44 ? 309  GLU A OE1 1 
ATOM   2313 O  OE2 . GLU A 1 309 ? -13.517 16.268 9.277   1.00 14.45 ? 309  GLU A OE2 1 
ATOM   2314 N  N   . GLY A 1 310 ? -13.533 15.907 4.311   1.00 15.56 ? 310  GLY A N   1 
ATOM   2315 C  CA  . GLY A 1 310 ? -14.341 17.003 3.817   1.00 17.79 ? 310  GLY A CA  1 
ATOM   2316 C  C   . GLY A 1 310 ? -14.036 18.315 4.521   1.00 19.05 ? 310  GLY A C   1 
ATOM   2317 O  O   . GLY A 1 310 ? -13.311 18.355 5.523   1.00 17.03 ? 310  GLY A O   1 
ATOM   2318 N  N   . ASN A 1 311 ? -14.597 19.395 3.984   1.00 21.53 ? 311  ASN A N   1 
ATOM   2319 C  CA  . ASN A 1 311 ? -14.428 20.730 4.547   1.00 24.00 ? 311  ASN A CA  1 
ATOM   2320 C  C   . ASN A 1 311 ? -15.749 21.501 4.381   1.00 27.03 ? 311  ASN A C   1 
ATOM   2321 O  O   . ASN A 1 311 ? -16.652 21.061 3.667   1.00 26.84 ? 311  ASN A O   1 
ATOM   2322 C  CB  . ASN A 1 311 ? -13.311 21.490 3.817   1.00 23.48 ? 311  ASN A CB  1 
ATOM   2323 C  CG  . ASN A 1 311 ? -11.980 20.734 3.796   1.00 23.48 ? 311  ASN A CG  1 
ATOM   2324 O  OD1 . ASN A 1 311 ? -11.792 19.790 3.025   1.00 22.83 ? 311  ASN A OD1 1 
ATOM   2325 N  ND2 . ASN A 1 311 ? -11.050 21.157 4.641   1.00 24.40 ? 311  ASN A ND2 1 
ATOM   2326 N  N   . HIS A 1 312 ? -15.862 22.645 5.050   1.00 30.09 ? 312  HIS A N   1 
ATOM   2327 C  CA  . HIS A 1 312 ? -17.053 23.482 4.943   1.00 31.95 ? 312  HIS A CA  1 
ATOM   2328 C  C   . HIS A 1 312 ? -16.877 24.775 5.743   1.00 33.18 ? 312  HIS A C   1 
ATOM   2329 O  O   . HIS A 1 312 ? -16.139 24.805 6.729   1.00 34.06 ? 312  HIS A O   1 
ATOM   2330 C  CB  . HIS A 1 312 ? -18.312 22.719 5.402   1.00 31.73 ? 312  HIS A CB  1 
ATOM   2331 C  CG  . HIS A 1 312 ? -18.378 22.464 6.877   1.00 31.96 ? 312  HIS A CG  1 
ATOM   2332 N  ND1 . HIS A 1 312 ? -17.734 21.407 7.482   1.00 30.60 ? 312  HIS A ND1 1 
ATOM   2333 C  CD2 . HIS A 1 312 ? -19.015 23.133 7.869   1.00 31.84 ? 312  HIS A CD2 1 
ATOM   2334 C  CE1 . HIS A 1 312 ? -17.972 21.435 8.782   1.00 30.37 ? 312  HIS A CE1 1 
ATOM   2335 N  NE2 . HIS A 1 312 ? -18.747 22.472 9.043   1.00 30.31 ? 312  HIS A NE2 1 
ATOM   2336 N  N   . LYS A 1 313 ? -17.549 25.839 5.300   1.00 34.36 ? 313  LYS A N   1 
ATOM   2337 C  CA  . LYS A 1 313 ? -17.474 27.157 5.940   1.00 34.89 ? 313  LYS A CA  1 
ATOM   2338 C  C   . LYS A 1 313 ? -18.567 27.432 6.971   1.00 35.21 ? 313  LYS A C   1 
ATOM   2339 O  O   . LYS A 1 313 ? -18.358 28.295 7.860   1.00 34.04 ? 313  LYS A O   1 
ATOM   2340 C  CB  . LYS A 1 313 ? -17.504 28.253 4.872   1.00 35.53 ? 313  LYS A CB  1 
ATOM   2341 C  CG  . LYS A 1 313 ? -16.134 28.669 4.377   1.00 36.53 ? 313  LYS A CG  1 
ATOM   2342 C  CD  . LYS A 1 313 ? -15.377 27.516 3.749   1.00 37.22 ? 313  LYS A CD  1 
ATOM   2343 C  CE  . LYS A 1 313 ? -13.913 27.873 3.575   1.00 37.36 ? 313  LYS A CE  1 
ATOM   2344 N  NZ  . LYS A 1 313 ? -13.303 28.194 4.893   1.00 37.99 ? 313  LYS A NZ  1 
ATOM   2345 N  N   . SER B 1 5   ? 72.554  44.463 44.994  1.00 39.29 ? 5    SER B N   1 
ATOM   2346 C  CA  . SER B 1 5   ? 72.545  44.202 43.527  1.00 40.08 ? 5    SER B CA  1 
ATOM   2347 C  C   . SER B 1 5   ? 73.263  42.892 43.211  1.00 40.49 ? 5    SER B C   1 
ATOM   2348 O  O   . SER B 1 5   ? 74.183  42.484 43.922  1.00 40.71 ? 5    SER B O   1 
ATOM   2349 C  CB  . SER B 1 5   ? 73.200  45.370 42.871  1.00 39.28 ? 5    SER B CB  1 
ATOM   2350 O  OG  . SER B 1 5   ? 73.159  45.154 41.385  1.00 41.70 ? 5    SER B OG  1 
ATOM   2351 N  N   . ARG B 1 6   ? 72.832  42.237 42.140  1.00 40.82 ? 6    ARG B N   1 
ATOM   2352 C  CA  . ARG B 1 6   ? 73.409  40.967 41.727  1.00 40.91 ? 6    ARG B CA  1 
ATOM   2353 C  C   . ARG B 1 6   ? 73.785  40.991 40.251  1.00 40.46 ? 6    ARG B C   1 
ATOM   2354 O  O   . ARG B 1 6   ? 72.921  41.071 39.378  1.00 39.30 ? 6    ARG B O   1 
ATOM   2355 C  CB  . ARG B 1 6   ? 72.417  39.839 42.002  1.00 43.98 ? 6    ARG B CB  1 
ATOM   2356 C  CG  . ARG B 1 6   ? 72.378  39.402 43.449  1.00 46.44 ? 6    ARG B CG  1 
ATOM   2357 C  CD  . ARG B 1 6   ? 73.764  38.923 43.851  1.00 51.42 ? 6    ARG B CD  1 
ATOM   2358 N  NE  . ARG B 1 6   ? 73.787  38.187 45.113  1.00 55.38 ? 6    ARG B NE  1 
ATOM   2359 C  CZ  . ARG B 1 6   ? 73.083  37.083 45.354  1.00 57.30 ? 6    ARG B CZ  1 
ATOM   2360 N  NH1 . ARG B 1 6   ? 72.283  36.579 44.418  1.00 56.51 ? 6    ARG B NH1 1 
ATOM   2361 N  NH2 . ARG B 1 6   ? 73.194  36.471 46.529  1.00 57.24 ? 6    ARG B NH2 1 
ATOM   2362 N  N   . THR B 1 7   ? 75.086  40.918 39.985  1.00 38.38 ? 7    THR B N   1 
ATOM   2363 C  CA  . THR B 1 7   ? 75.603  40.954 38.625  1.00 35.01 ? 7    THR B CA  1 
ATOM   2364 C  C   . THR B 1 7   ? 75.322  39.657 37.883  1.00 33.33 ? 7    THR B C   1 
ATOM   2365 O  O   . THR B 1 7   ? 75.147  38.600 38.490  1.00 33.43 ? 7    THR B O   1 
ATOM   2366 C  CB  . THR B 1 7   ? 77.120  41.210 38.627  1.00 35.11 ? 7    THR B CB  1 
ATOM   2367 O  OG1 . THR B 1 7   ? 77.420  42.254 39.558  1.00 32.54 ? 7    THR B OG1 1 
ATOM   2368 C  CG2 . THR B 1 7   ? 77.595  41.630 37.241  1.00 34.61 ? 7    THR B CG2 1 
ATOM   2369 N  N   . ILE B 1 8   ? 75.294  39.752 36.560  1.00 31.83 ? 8    ILE B N   1 
ATOM   2370 C  CA  . ILE B 1 8   ? 75.022  38.608 35.700  1.00 30.28 ? 8    ILE B CA  1 
ATOM   2371 C  C   . ILE B 1 8   ? 76.214  38.311 34.791  1.00 28.99 ? 8    ILE B C   1 
ATOM   2372 O  O   . ILE B 1 8   ? 76.815  39.223 34.221  1.00 28.33 ? 8    ILE B O   1 
ATOM   2373 C  CB  . ILE B 1 8   ? 73.783  38.876 34.807  1.00 29.22 ? 8    ILE B CB  1 
ATOM   2374 C  CG1 . ILE B 1 8   ? 72.659  39.493 35.647  1.00 29.07 ? 8    ILE B CG1 1 
ATOM   2375 C  CG2 . ILE B 1 8   ? 73.303  37.572 34.171  1.00 28.98 ? 8    ILE B CG2 1 
ATOM   2376 C  CD1 . ILE B 1 8   ? 71.530  40.077 34.830  1.00 27.07 ? 8    ILE B CD1 1 
ATOM   2377 N  N   . GLY B 1 9   ? 76.549  37.029 34.678  1.00 28.05 ? 9    GLY B N   1 
ATOM   2378 C  CA  . GLY B 1 9   ? 77.640  36.595 33.823  1.00 25.45 ? 9    GLY B CA  1 
ATOM   2379 C  C   . GLY B 1 9   ? 77.031  35.629 32.825  1.00 24.77 ? 9    GLY B C   1 
ATOM   2380 O  O   . GLY B 1 9   ? 76.798  34.467 33.159  1.00 23.91 ? 9    GLY B O   1 
ATOM   2381 N  N   . ILE B 1 10  ? 76.750  36.113 31.613  1.00 24.35 ? 10   ILE B N   1 
ATOM   2382 C  CA  . ILE B 1 10  ? 76.140  35.294 30.562  1.00 24.64 ? 10   ILE B CA  1 
ATOM   2383 C  C   . ILE B 1 10  ? 77.125  34.340 29.889  1.00 24.59 ? 10   ILE B C   1 
ATOM   2384 O  O   . ILE B 1 10  ? 78.171  34.757 29.396  1.00 22.85 ? 10   ILE B O   1 
ATOM   2385 C  CB  . ILE B 1 10  ? 75.477  36.177 29.465  1.00 25.33 ? 10   ILE B CB  1 
ATOM   2386 C  CG1 . ILE B 1 10  ? 74.218  36.839 30.018  1.00 25.74 ? 10   ILE B CG1 1 
ATOM   2387 C  CG2 . ILE B 1 10  ? 75.091  35.325 28.249  1.00 24.37 ? 10   ILE B CG2 1 
ATOM   2388 C  CD1 . ILE B 1 10  ? 74.469  37.739 31.179  1.00 30.39 ? 10   ILE B CD1 1 
ATOM   2389 N  N   . ILE B 1 11  ? 76.759  33.059 29.869  1.00 25.06 ? 11   ILE B N   1 
ATOM   2390 C  CA  . ILE B 1 11  ? 77.575  32.005 29.276  1.00 24.94 ? 11   ILE B CA  1 
ATOM   2391 C  C   . ILE B 1 11  ? 76.759  31.259 28.225  1.00 24.63 ? 11   ILE B C   1 
ATOM   2392 O  O   . ILE B 1 11  ? 75.786  30.578 28.562  1.00 24.64 ? 11   ILE B O   1 
ATOM   2393 C  CB  . ILE B 1 11  ? 78.003  30.942 30.322  1.00 27.37 ? 11   ILE B CB  1 
ATOM   2394 C  CG1 . ILE B 1 11  ? 78.469  31.602 31.625  1.00 28.78 ? 11   ILE B CG1 1 
ATOM   2395 C  CG2 . ILE B 1 11  ? 79.109  30.065 29.737  1.00 27.67 ? 11   ILE B CG2 1 
ATOM   2396 C  CD1 . ILE B 1 11  ? 79.742  32.401 31.487  1.00 31.77 ? 11   ILE B CD1 1 
ATOM   2397 N  N   . GLY B 1 12  ? 77.147  31.383 26.959  1.00 23.42 ? 12   GLY B N   1 
ATOM   2398 C  CA  . GLY B 1 12  ? 76.437  30.667 25.911  1.00 21.82 ? 12   GLY B CA  1 
ATOM   2399 C  C   . GLY B 1 12  ? 77.035  29.274 25.802  1.00 20.90 ? 12   GLY B C   1 
ATOM   2400 O  O   . GLY B 1 12  ? 78.262  29.129 25.814  1.00 18.24 ? 12   GLY B O   1 
ATOM   2401 N  N   . ALA B 1 13  ? 76.185  28.251 25.705  1.00 19.96 ? 13   ALA B N   1 
ATOM   2402 C  CA  . ALA B 1 13  ? 76.664  26.874 25.609  1.00 19.46 ? 13   ALA B CA  1 
ATOM   2403 C  C   . ALA B 1 13  ? 76.009  26.081 24.476  1.00 20.66 ? 13   ALA B C   1 
ATOM   2404 O  O   . ALA B 1 13  ? 75.210  25.173 24.717  1.00 20.92 ? 13   ALA B O   1 
ATOM   2405 C  CB  . ALA B 1 13  ? 76.452  26.158 26.933  1.00 19.56 ? 13   ALA B CB  1 
ATOM   2406 N  N   . PRO B 1 14  ? 76.352  26.412 23.222  1.00 20.16 ? 14   PRO B N   1 
ATOM   2407 C  CA  . PRO B 1 14  ? 75.813  25.745 22.034  1.00 19.57 ? 14   PRO B CA  1 
ATOM   2408 C  C   . PRO B 1 14  ? 76.245  24.283 21.927  1.00 18.87 ? 14   PRO B C   1 
ATOM   2409 O  O   . PRO B 1 14  ? 76.969  23.909 21.011  1.00 20.33 ? 14   PRO B O   1 
ATOM   2410 C  CB  . PRO B 1 14  ? 76.353  26.603 20.887  1.00 20.56 ? 14   PRO B CB  1 
ATOM   2411 C  CG  . PRO B 1 14  ? 77.654  27.129 21.434  1.00 19.99 ? 14   PRO B CG  1 
ATOM   2412 C  CD  . PRO B 1 14  ? 77.274  27.500 22.844  1.00 22.02 ? 14   PRO B CD  1 
ATOM   2413 N  N   . PHE B 1 15  ? 75.773  23.457 22.853  1.00 18.34 ? 15   PHE B N   1 
ATOM   2414 C  CA  . PHE B 1 15  ? 76.132  22.043 22.885  1.00 16.86 ? 15   PHE B CA  1 
ATOM   2415 C  C   . PHE B 1 15  ? 74.902  21.149 22.755  1.00 17.97 ? 15   PHE B C   1 
ATOM   2416 O  O   . PHE B 1 15  ? 73.850  21.444 23.323  1.00 18.85 ? 15   PHE B O   1 
ATOM   2417 C  CB  . PHE B 1 15  ? 76.853  21.742 24.192  1.00 14.27 ? 15   PHE B CB  1 
ATOM   2418 C  CG  . PHE B 1 15  ? 77.408  20.366 24.266  1.00 13.25 ? 15   PHE B CG  1 
ATOM   2419 C  CD1 . PHE B 1 15  ? 78.496  20.001 23.481  1.00 13.82 ? 15   PHE B CD1 1 
ATOM   2420 C  CD2 . PHE B 1 15  ? 76.833  19.421 25.102  1.00 11.30 ? 15   PHE B CD2 1 
ATOM   2421 C  CE1 . PHE B 1 15  ? 78.999  18.709 23.531  1.00 11.37 ? 15   PHE B CE1 1 
ATOM   2422 C  CE2 . PHE B 1 15  ? 77.325  18.138 25.157  1.00 10.29 ? 15   PHE B CE2 1 
ATOM   2423 C  CZ  . PHE B 1 15  ? 78.413  17.780 24.369  1.00 10.92 ? 15   PHE B CZ  1 
ATOM   2424 N  N   . SER B 1 16  ? 75.040  20.040 22.031  1.00 18.65 ? 16   SER B N   1 
ATOM   2425 C  CA  . SER B 1 16  ? 73.908  19.136 21.821  1.00 18.15 ? 16   SER B CA  1 
ATOM   2426 C  C   . SER B 1 16  ? 74.204  17.639 21.918  1.00 17.93 ? 16   SER B C   1 
ATOM   2427 O  O   . SER B 1 16  ? 73.287  16.828 21.840  1.00 17.71 ? 16   SER B O   1 
ATOM   2428 C  CB  . SER B 1 16  ? 73.302  19.403 20.444  1.00 17.77 ? 16   SER B CB  1 
ATOM   2429 O  OG  . SER B 1 16  ? 74.230  19.053 19.426  1.00 16.20 ? 16   SER B OG  1 
ATOM   2430 N  N   . LYS B 1 17  ? 75.470  17.271 22.074  1.00 18.88 ? 17   LYS B N   1 
ATOM   2431 C  CA  . LYS B 1 17  ? 75.855  15.861 22.137  1.00 18.65 ? 17   LYS B CA  1 
ATOM   2432 C  C   . LYS B 1 17  ? 75.267  15.077 23.302  1.00 18.08 ? 17   LYS B C   1 
ATOM   2433 O  O   . LYS B 1 17  ? 75.566  13.894 23.465  1.00 17.81 ? 17   LYS B O   1 
ATOM   2434 C  CB  . LYS B 1 17  ? 77.380  15.737 22.166  1.00 20.83 ? 17   LYS B CB  1 
ATOM   2435 C  CG  . LYS B 1 17  ? 78.076  16.127 20.875  1.00 24.10 ? 17   LYS B CG  1 
ATOM   2436 C  CD  . LYS B 1 17  ? 77.817  15.098 19.791  1.00 26.32 ? 17   LYS B CD  1 
ATOM   2437 C  CE  . LYS B 1 17  ? 78.683  15.345 18.567  1.00 28.46 ? 17   LYS B CE  1 
ATOM   2438 N  NZ  . LYS B 1 17  ? 78.468  14.291 17.532  1.00 30.78 ? 17   LYS B NZ  1 
ATOM   2439 N  N   . GLY B 1 18  ? 74.439  15.737 24.109  1.00 19.50 ? 18   GLY B N   1 
ATOM   2440 C  CA  . GLY B 1 18  ? 73.807  15.083 25.246  1.00 17.29 ? 18   GLY B CA  1 
ATOM   2441 C  C   . GLY B 1 18  ? 72.528  14.365 24.846  1.00 17.19 ? 18   GLY B C   1 
ATOM   2442 O  O   . GLY B 1 18  ? 71.930  13.639 25.637  1.00 15.41 ? 18   GLY B O   1 
ATOM   2443 N  N   . GLN B 1 19  ? 72.100  14.588 23.607  1.00 17.74 ? 19   GLN B N   1 
ATOM   2444 C  CA  . GLN B 1 19  ? 70.906  13.958 23.055  1.00 17.32 ? 19   GLN B CA  1 
ATOM   2445 C  C   . GLN B 1 19  ? 71.023  13.933 21.525  1.00 17.52 ? 19   GLN B C   1 
ATOM   2446 O  O   . GLN B 1 19  ? 71.885  14.601 20.952  1.00 14.42 ? 19   GLN B O   1 
ATOM   2447 C  CB  . GLN B 1 19  ? 69.643  14.685 23.539  1.00 19.17 ? 19   GLN B CB  1 
ATOM   2448 C  CG  . GLN B 1 19  ? 69.770  16.201 23.664  1.00 21.54 ? 19   GLN B CG  1 
ATOM   2449 C  CD  . GLN B 1 19  ? 69.234  16.925 22.444  1.00 22.87 ? 19   GLN B CD  1 
ATOM   2450 O  OE1 . GLN B 1 19  ? 68.027  16.916 22.187  1.00 22.45 ? 19   GLN B OE1 1 
ATOM   2451 N  NE2 . GLN B 1 19  ? 70.130  17.550 21.680  1.00 20.96 ? 19   GLN B NE2 1 
ATOM   2452 N  N   . PRO B 1 20  ? 70.168  13.147 20.845  1.00 18.77 ? 20   PRO B N   1 
ATOM   2453 C  CA  . PRO B 1 20  ? 70.147  12.987 19.381  1.00 19.99 ? 20   PRO B CA  1 
ATOM   2454 C  C   . PRO B 1 20  ? 69.925  14.201 18.463  1.00 20.92 ? 20   PRO B C   1 
ATOM   2455 O  O   . PRO B 1 20  ? 70.613  14.352 17.447  1.00 20.48 ? 20   PRO B O   1 
ATOM   2456 C  CB  . PRO B 1 20  ? 69.068  11.923 19.171  1.00 20.83 ? 20   PRO B CB  1 
ATOM   2457 C  CG  . PRO B 1 20  ? 69.108  11.141 20.450  1.00 20.49 ? 20   PRO B CG  1 
ATOM   2458 C  CD  . PRO B 1 20  ? 69.198  12.234 21.473  1.00 18.54 ? 20   PRO B CD  1 
ATOM   2459 N  N   . ARG B 1 21  ? 68.958  15.044 18.810  1.00 20.84 ? 21   ARG B N   1 
ATOM   2460 C  CA  . ARG B 1 21  ? 68.615  16.229 18.025  1.00 20.11 ? 21   ARG B CA  1 
ATOM   2461 C  C   . ARG B 1 21  ? 69.656  17.353 18.135  1.00 19.56 ? 21   ARG B C   1 
ATOM   2462 O  O   . ARG B 1 21  ? 70.168  17.637 19.215  1.00 19.40 ? 21   ARG B O   1 
ATOM   2463 C  CB  . ARG B 1 21  ? 67.231  16.700 18.463  1.00 19.99 ? 21   ARG B CB  1 
ATOM   2464 C  CG  . ARG B 1 21  ? 66.168  15.605 18.283  1.00 21.60 ? 21   ARG B CG  1 
ATOM   2465 C  CD  . ARG B 1 21  ? 64.919  15.830 19.133  1.00 21.01 ? 21   ARG B CD  1 
ATOM   2466 N  NE  . ARG B 1 21  ? 65.072  15.396 20.523  1.00 24.26 ? 21   ARG B NE  1 
ATOM   2467 C  CZ  . ARG B 1 21  ? 65.177  14.126 20.914  1.00 24.93 ? 21   ARG B CZ  1 
ATOM   2468 N  NH1 . ARG B 1 21  ? 65.154  13.145 20.024  1.00 25.97 ? 21   ARG B NH1 1 
ATOM   2469 N  NH2 . ARG B 1 21  ? 65.279  13.833 22.202  1.00 25.13 ? 21   ARG B NH2 1 
ATOM   2470 N  N   . GLY B 1 22  ? 69.962  17.998 17.012  1.00 19.22 ? 22   GLY B N   1 
ATOM   2471 C  CA  . GLY B 1 22  ? 70.975  19.044 17.029  1.00 19.95 ? 22   GLY B CA  1 
ATOM   2472 C  C   . GLY B 1 22  ? 70.560  20.498 17.222  1.00 18.66 ? 22   GLY B C   1 
ATOM   2473 O  O   . GLY B 1 22  ? 71.388  21.337 17.597  1.00 17.92 ? 22   GLY B O   1 
ATOM   2474 N  N   . GLY B 1 23  ? 69.288  20.794 16.984  1.00 17.29 ? 23   GLY B N   1 
ATOM   2475 C  CA  . GLY B 1 23  ? 68.795  22.160 17.105  1.00 18.29 ? 23   GLY B CA  1 
ATOM   2476 C  C   . GLY B 1 23  ? 69.009  22.941 18.394  1.00 18.08 ? 23   GLY B C   1 
ATOM   2477 O  O   . GLY B 1 23  ? 68.899  24.176 18.381  1.00 17.69 ? 23   GLY B O   1 
ATOM   2478 N  N   . VAL B 1 24  ? 69.302  22.245 19.495  1.00 17.69 ? 24   VAL B N   1 
ATOM   2479 C  CA  . VAL B 1 24  ? 69.520  22.888 20.797  1.00 17.53 ? 24   VAL B CA  1 
ATOM   2480 C  C   . VAL B 1 24  ? 70.759  23.766 20.834  1.00 18.94 ? 24   VAL B C   1 
ATOM   2481 O  O   . VAL B 1 24  ? 70.806  24.751 21.580  1.00 16.54 ? 24   VAL B O   1 
ATOM   2482 C  CB  . VAL B 1 24  ? 69.669  21.857 21.935  1.00 16.28 ? 24   VAL B CB  1 
ATOM   2483 C  CG1 . VAL B 1 24  ? 68.370  21.105 22.143  1.00 18.70 ? 24   VAL B CG1 1 
ATOM   2484 C  CG2 . VAL B 1 24  ? 70.788  20.903 21.610  1.00 15.77 ? 24   VAL B CG2 1 
ATOM   2485 N  N   . GLU B 1 25  ? 71.764  23.398 20.042  1.00 19.97 ? 25   GLU B N   1 
ATOM   2486 C  CA  . GLU B 1 25  ? 73.010  24.151 19.979  1.00 23.74 ? 25   GLU B CA  1 
ATOM   2487 C  C   . GLU B 1 25  ? 72.748  25.626 19.671  1.00 25.46 ? 25   GLU B C   1 
ATOM   2488 O  O   . GLU B 1 25  ? 73.611  26.478 19.896  1.00 25.78 ? 25   GLU B O   1 
ATOM   2489 C  CB  . GLU B 1 25  ? 73.924  23.588 18.889  1.00 25.76 ? 25   GLU B CB  1 
ATOM   2490 C  CG  . GLU B 1 25  ? 74.060  22.087 18.866  1.00 29.01 ? 25   GLU B CG  1 
ATOM   2491 C  CD  . GLU B 1 25  ? 74.921  21.615 17.705  1.00 31.91 ? 25   GLU B CD  1 
ATOM   2492 O  OE1 . GLU B 1 25  ? 74.649  22.043 16.559  1.00 32.01 ? 25   GLU B OE1 1 
ATOM   2493 O  OE2 . GLU B 1 25  ? 75.861  20.820 17.935  1.00 32.16 ? 25   GLU B OE2 1 
ATOM   2494 N  N   . GLU B 1 26  ? 71.558  25.926 19.155  1.00 26.46 ? 26   GLU B N   1 
ATOM   2495 C  CA  . GLU B 1 26  ? 71.211  27.294 18.801  1.00 27.50 ? 26   GLU B CA  1 
ATOM   2496 C  C   . GLU B 1 26  ? 70.240  27.985 19.743  1.00 25.78 ? 26   GLU B C   1 
ATOM   2497 O  O   . GLU B 1 26  ? 69.483  28.857 19.335  1.00 27.22 ? 26   GLU B O   1 
ATOM   2498 C  CB  . GLU B 1 26  ? 70.693  27.319 17.366  1.00 32.03 ? 26   GLU B CB  1 
ATOM   2499 C  CG  . GLU B 1 26  ? 71.809  26.987 16.373  1.00 37.19 ? 26   GLU B CG  1 
ATOM   2500 C  CD  . GLU B 1 26  ? 71.303  26.470 15.048  1.00 41.43 ? 26   GLU B CD  1 
ATOM   2501 O  OE1 . GLU B 1 26  ? 70.618  27.233 14.333  1.00 43.59 ? 26   GLU B OE1 1 
ATOM   2502 O  OE2 . GLU B 1 26  ? 71.596  25.293 14.723  1.00 44.26 ? 26   GLU B OE2 1 
ATOM   2503 N  N   . GLY B 1 27  ? 70.278  27.593 21.011  1.00 25.26 ? 27   GLY B N   1 
ATOM   2504 C  CA  . GLY B 1 27  ? 69.422  28.205 22.007  1.00 23.90 ? 27   GLY B CA  1 
ATOM   2505 C  C   . GLY B 1 27  ? 69.990  29.565 22.376  1.00 25.18 ? 27   GLY B C   1 
ATOM   2506 O  O   . GLY B 1 27  ? 69.248  30.550 22.434  1.00 25.10 ? 27   GLY B O   1 
ATOM   2507 N  N   . PRO B 1 28  ? 71.310  29.659 22.624  1.00 24.23 ? 28   PRO B N   1 
ATOM   2508 C  CA  . PRO B 1 28  ? 71.929  30.940 22.983  1.00 24.90 ? 28   PRO B CA  1 
ATOM   2509 C  C   . PRO B 1 28  ? 71.606  32.005 21.939  1.00 24.94 ? 28   PRO B C   1 
ATOM   2510 O  O   . PRO B 1 28  ? 71.130  33.092 22.257  1.00 24.65 ? 28   PRO B O   1 
ATOM   2511 C  CB  . PRO B 1 28  ? 73.416  30.607 23.011  1.00 23.56 ? 28   PRO B CB  1 
ATOM   2512 C  CG  . PRO B 1 28  ? 73.431  29.174 23.419  1.00 24.33 ? 28   PRO B CG  1 
ATOM   2513 C  CD  . PRO B 1 28  ? 72.317  28.584 22.599  1.00 23.29 ? 28   PRO B CD  1 
ATOM   2514 N  N   . THR B 1 29  ? 71.865  31.660 20.685  1.00 25.85 ? 29   THR B N   1 
ATOM   2515 C  CA  . THR B 1 29  ? 71.625  32.544 19.558  1.00 25.54 ? 29   THR B CA  1 
ATOM   2516 C  C   . THR B 1 29  ? 70.199  33.086 19.486  1.00 24.75 ? 29   THR B C   1 
ATOM   2517 O  O   . THR B 1 29  ? 69.997  34.290 19.328  1.00 25.48 ? 29   THR B O   1 
ATOM   2518 C  CB  . THR B 1 29  ? 71.952  31.822 18.241  1.00 25.98 ? 29   THR B CB  1 
ATOM   2519 O  OG1 . THR B 1 29  ? 73.333  31.434 18.244  1.00 25.86 ? 29   THR B OG1 1 
ATOM   2520 C  CG2 . THR B 1 29  ? 71.679  32.729 17.054  1.00 27.37 ? 29   THR B CG2 1 
ATOM   2521 N  N   . VAL B 1 30  ? 69.212  32.207 19.601  1.00 24.16 ? 30   VAL B N   1 
ATOM   2522 C  CA  . VAL B 1 30  ? 67.820  32.640 19.525  1.00 24.44 ? 30   VAL B CA  1 
ATOM   2523 C  C   . VAL B 1 30  ? 67.382  33.419 20.759  1.00 23.48 ? 30   VAL B C   1 
ATOM   2524 O  O   . VAL B 1 30  ? 66.519  34.287 20.669  1.00 23.64 ? 30   VAL B O   1 
ATOM   2525 C  CB  . VAL B 1 30  ? 66.868  31.443 19.322  1.00 24.33 ? 30   VAL B CB  1 
ATOM   2526 C  CG1 . VAL B 1 30  ? 65.478  31.940 18.971  1.00 26.16 ? 30   VAL B CG1 1 
ATOM   2527 C  CG2 . VAL B 1 30  ? 67.387  30.558 18.211  1.00 26.11 ? 30   VAL B CG2 1 
ATOM   2528 N  N   . LEU B 1 31  ? 67.981  33.117 21.909  1.00 24.17 ? 31   LEU B N   1 
ATOM   2529 C  CA  . LEU B 1 31  ? 67.634  33.818 23.144  1.00 24.66 ? 31   LEU B CA  1 
ATOM   2530 C  C   . LEU B 1 31  ? 68.263  35.200 23.166  1.00 25.19 ? 31   LEU B C   1 
ATOM   2531 O  O   . LEU B 1 31  ? 67.647  36.153 23.629  1.00 25.08 ? 31   LEU B O   1 
ATOM   2532 C  CB  . LEU B 1 31  ? 68.088  33.019 24.370  1.00 25.33 ? 31   LEU B CB  1 
ATOM   2533 C  CG  . LEU B 1 31  ? 67.272  31.761 24.701  1.00 25.18 ? 31   LEU B CG  1 
ATOM   2534 C  CD1 . LEU B 1 31  ? 68.022  30.900 25.705  1.00 24.97 ? 31   LEU B CD1 1 
ATOM   2535 C  CD2 . LEU B 1 31  ? 65.908  32.162 25.238  1.00 22.13 ? 31   LEU B CD2 1 
ATOM   2536 N  N   . ARG B 1 32  ? 69.494  35.303 22.669  1.00 26.34 ? 32   ARG B N   1 
ATOM   2537 C  CA  . ARG B 1 32  ? 70.189  36.586 22.617  1.00 26.20 ? 32   ARG B CA  1 
ATOM   2538 C  C   . ARG B 1 32  ? 69.509  37.496 21.598  1.00 26.12 ? 32   ARG B C   1 
ATOM   2539 O  O   . ARG B 1 32  ? 69.452  38.712 21.782  1.00 25.50 ? 32   ARG B O   1 
ATOM   2540 C  CB  . ARG B 1 32  ? 71.655  36.398 22.224  1.00 26.34 ? 32   ARG B CB  1 
ATOM   2541 C  CG  . ARG B 1 32  ? 72.621  36.217 23.386  1.00 27.75 ? 32   ARG B CG  1 
ATOM   2542 C  CD  . ARG B 1 32  ? 73.902  37.018 23.130  1.00 28.26 ? 32   ARG B CD  1 
ATOM   2543 N  NE  . ARG B 1 32  ? 75.017  36.621 23.990  1.00 26.64 ? 32   ARG B NE  1 
ATOM   2544 C  CZ  . ARG B 1 32  ? 75.567  35.410 23.979  1.00 26.34 ? 32   ARG B CZ  1 
ATOM   2545 N  NH1 . ARG B 1 32  ? 75.100  34.478 23.155  1.00 24.06 ? 32   ARG B NH1 1 
ATOM   2546 N  NH2 . ARG B 1 32  ? 76.592  35.135 24.778  1.00 25.43 ? 32   ARG B NH2 1 
ATOM   2547 N  N   . LYS B 1 33  ? 69.005  36.898 20.521  1.00 26.78 ? 33   LYS B N   1 
ATOM   2548 C  CA  . LYS B 1 33  ? 68.315  37.644 19.474  1.00 28.17 ? 33   LYS B CA  1 
ATOM   2549 C  C   . LYS B 1 33  ? 66.972  38.151 19.981  1.00 27.27 ? 33   LYS B C   1 
ATOM   2550 O  O   . LYS B 1 33  ? 66.474  39.181 19.524  1.00 27.48 ? 33   LYS B O   1 
ATOM   2551 C  CB  . LYS B 1 33  ? 68.106  36.767 18.232  1.00 30.88 ? 33   LYS B CB  1 
ATOM   2552 C  CG  . LYS B 1 33  ? 69.396  36.442 17.483  1.00 34.07 ? 33   LYS B CG  1 
ATOM   2553 C  CD  . LYS B 1 33  ? 69.151  35.579 16.244  1.00 36.69 ? 33   LYS B CD  1 
ATOM   2554 C  CE  . LYS B 1 33  ? 68.336  36.310 15.191  1.00 36.83 ? 33   LYS B CE  1 
ATOM   2555 N  NZ  . LYS B 1 33  ? 68.312  35.574 13.895  1.00 37.68 ? 33   LYS B NZ  1 
ATOM   2556 N  N   . ALA B 1 34  ? 66.385  37.418 20.919  1.00 25.75 ? 34   ALA B N   1 
ATOM   2557 C  CA  . ALA B 1 34  ? 65.113  37.813 21.508  1.00 24.43 ? 34   ALA B CA  1 
ATOM   2558 C  C   . ALA B 1 34  ? 65.341  39.091 22.330  1.00 23.34 ? 34   ALA B C   1 
ATOM   2559 O  O   . ALA B 1 34  ? 64.392  39.771 22.718  1.00 23.32 ? 34   ALA B O   1 
ATOM   2560 C  CB  . ALA B 1 34  ? 64.578  36.688 22.399  1.00 25.37 ? 34   ALA B CB  1 
ATOM   2561 N  N   . GLY B 1 35  ? 66.611  39.401 22.589  1.00 20.86 ? 35   GLY B N   1 
ATOM   2562 C  CA  . GLY B 1 35  ? 66.976  40.594 23.335  1.00 19.34 ? 35   GLY B CA  1 
ATOM   2563 C  C   . GLY B 1 35  ? 67.208  40.409 24.828  1.00 18.94 ? 35   GLY B C   1 
ATOM   2564 O  O   . GLY B 1 35  ? 66.961  41.335 25.604  1.00 19.97 ? 35   GLY B O   1 
ATOM   2565 N  N   . LEU B 1 36  ? 67.704  39.242 25.232  1.00 17.47 ? 36   LEU B N   1 
ATOM   2566 C  CA  . LEU B 1 36  ? 67.935  38.945 26.648  1.00 17.48 ? 36   LEU B CA  1 
ATOM   2567 C  C   . LEU B 1 36  ? 68.890  39.867 27.399  1.00 17.88 ? 36   LEU B C   1 
ATOM   2568 O  O   . LEU B 1 36  ? 68.596  40.289 28.519  1.00 17.80 ? 36   LEU B O   1 
ATOM   2569 C  CB  . LEU B 1 36  ? 68.412  37.499 26.807  1.00 18.04 ? 36   LEU B CB  1 
ATOM   2570 C  CG  . LEU B 1 36  ? 68.662  36.988 28.235  1.00 14.00 ? 36   LEU B CG  1 
ATOM   2571 C  CD1 . LEU B 1 36  ? 67.377  37.042 29.042  1.00 17.07 ? 36   LEU B CD1 1 
ATOM   2572 C  CD2 . LEU B 1 36  ? 69.181  35.573 28.170  1.00 11.80 ? 36   LEU B CD2 1 
ATOM   2573 N  N   . LEU B 1 37  ? 70.036  40.168 26.800  1.00 19.12 ? 37   LEU B N   1 
ATOM   2574 C  CA  . LEU B 1 37  ? 71.023  41.039 27.439  1.00 21.17 ? 37   LEU B CA  1 
ATOM   2575 C  C   . LEU B 1 37  ? 70.478  42.444 27.588  1.00 22.00 ? 37   LEU B C   1 
ATOM   2576 O  O   . LEU B 1 37  ? 70.744  43.127 28.569  1.00 22.90 ? 37   LEU B O   1 
ATOM   2577 C  CB  . LEU B 1 37  ? 72.308  41.105 26.610  1.00 22.25 ? 37   LEU B CB  1 
ATOM   2578 C  CG  . LEU B 1 37  ? 73.259  39.910 26.593  1.00 23.14 ? 37   LEU B CG  1 
ATOM   2579 C  CD1 . LEU B 1 37  ? 74.306  40.122 25.504  1.00 23.43 ? 37   LEU B CD1 1 
ATOM   2580 C  CD2 . LEU B 1 37  ? 73.924  39.756 27.947  1.00 23.95 ? 37   LEU B CD2 1 
ATOM   2581 N  N   . GLU B 1 38  ? 69.730  42.871 26.584  1.00 23.50 ? 38   GLU B N   1 
ATOM   2582 C  CA  . GLU B 1 38  ? 69.141  44.196 26.571  1.00 25.71 ? 38   GLU B CA  1 
ATOM   2583 C  C   . GLU B 1 38  ? 68.010  44.275 27.591  1.00 24.89 ? 38   GLU B C   1 
ATOM   2584 O  O   . GLU B 1 38  ? 67.976  45.175 28.426  1.00 24.74 ? 38   GLU B O   1 
ATOM   2585 C  CB  . GLU B 1 38  ? 68.618  44.506 25.166  1.00 27.35 ? 38   GLU B CB  1 
ATOM   2586 C  CG  . GLU B 1 38  ? 69.689  44.459 24.056  1.00 32.79 ? 38   GLU B CG  1 
ATOM   2587 C  CD  . GLU B 1 38  ? 70.314  43.071 23.845  1.00 33.37 ? 38   GLU B CD  1 
ATOM   2588 O  OE1 . GLU B 1 38  ? 69.560  42.084 23.722  1.00 35.59 ? 38   GLU B OE1 1 
ATOM   2589 O  OE2 . GLU B 1 38  ? 71.561  42.969 23.782  1.00 34.21 ? 38   GLU B OE2 1 
ATOM   2590 N  N   . LYS B 1 39  ? 67.085  43.326 27.525  1.00 25.75 ? 39   LYS B N   1 
ATOM   2591 C  CA  . LYS B 1 39  ? 65.969  43.301 28.456  1.00 26.59 ? 39   LYS B CA  1 
ATOM   2592 C  C   . LYS B 1 39  ? 66.453  43.126 29.899  1.00 26.29 ? 39   LYS B C   1 
ATOM   2593 O  O   . LYS B 1 39  ? 65.772  43.543 30.838  1.00 27.45 ? 39   LYS B O   1 
ATOM   2594 C  CB  . LYS B 1 39  ? 64.995  42.186 28.069  1.00 28.54 ? 39   LYS B CB  1 
ATOM   2595 C  CG  . LYS B 1 39  ? 64.416  42.362 26.670  1.00 28.26 ? 39   LYS B CG  1 
ATOM   2596 C  CD  . LYS B 1 39  ? 63.432  41.259 26.317  1.00 29.38 ? 39   LYS B CD  1 
ATOM   2597 C  CE  . LYS B 1 39  ? 62.911  41.424 24.895  1.00 28.12 ? 39   LYS B CE  1 
ATOM   2598 N  NZ  . LYS B 1 39  ? 61.851  40.434 24.579  1.00 28.38 ? 39   LYS B NZ  1 
ATOM   2599 N  N   . LEU B 1 40  ? 67.622  42.511 30.074  1.00 25.14 ? 40   LEU B N   1 
ATOM   2600 C  CA  . LEU B 1 40  ? 68.197  42.322 31.406  1.00 24.24 ? 40   LEU B CA  1 
ATOM   2601 C  C   . LEU B 1 40  ? 68.738  43.656 31.912  1.00 25.20 ? 40   LEU B C   1 
ATOM   2602 O  O   . LEU B 1 40  ? 68.486  44.051 33.052  1.00 25.03 ? 40   LEU B O   1 
ATOM   2603 C  CB  . LEU B 1 40  ? 69.337  41.293 31.381  1.00 22.69 ? 40   LEU B CB  1 
ATOM   2604 C  CG  . LEU B 1 40  ? 69.032  39.788 31.418  1.00 22.81 ? 40   LEU B CG  1 
ATOM   2605 C  CD1 . LEU B 1 40  ? 70.346  39.022 31.444  1.00 21.41 ? 40   LEU B CD1 1 
ATOM   2606 C  CD2 . LEU B 1 40  ? 68.198  39.429 32.656  1.00 21.74 ? 40   LEU B CD2 1 
ATOM   2607 N  N   . LYS B 1 41  ? 69.483  44.349 31.055  1.00 25.71 ? 41   LYS B N   1 
ATOM   2608 C  CA  . LYS B 1 41  ? 70.054  45.639 31.413  1.00 27.97 ? 41   LYS B CA  1 
ATOM   2609 C  C   . LYS B 1 41  ? 68.976  46.686 31.695  1.00 29.98 ? 41   LYS B C   1 
ATOM   2610 O  O   . LYS B 1 41  ? 69.232  47.680 32.386  1.00 28.73 ? 41   LYS B O   1 
ATOM   2611 C  CB  . LYS B 1 41  ? 71.002  46.120 30.305  1.00 27.33 ? 41   LYS B CB  1 
ATOM   2612 C  CG  . LYS B 1 41  ? 72.314  45.340 30.261  1.00 24.30 ? 41   LYS B CG  1 
ATOM   2613 C  CD  . LYS B 1 41  ? 73.111  45.614 29.003  1.00 22.83 ? 41   LYS B CD  1 
ATOM   2614 C  CE  . LYS B 1 41  ? 74.310  44.679 28.906  1.00 20.39 ? 41   LYS B CE  1 
ATOM   2615 N  NZ  . LYS B 1 41  ? 74.881  44.626 27.535  1.00 16.85 ? 41   LYS B NZ  1 
ATOM   2616 N  N   . GLU B 1 42  ? 67.774  46.464 31.162  1.00 32.30 ? 42   GLU B N   1 
ATOM   2617 C  CA  . GLU B 1 42  ? 66.659  47.383 31.392  1.00 34.22 ? 42   GLU B CA  1 
ATOM   2618 C  C   . GLU B 1 42  ? 66.295  47.308 32.870  1.00 34.75 ? 42   GLU B C   1 
ATOM   2619 O  O   . GLU B 1 42  ? 65.684  48.223 33.423  1.00 34.57 ? 42   GLU B O   1 
ATOM   2620 C  CB  . GLU B 1 42  ? 65.436  46.989 30.557  1.00 35.90 ? 42   GLU B CB  1 
ATOM   2621 C  CG  . GLU B 1 42  ? 65.577  47.180 29.052  1.00 37.74 ? 42   GLU B CG  1 
ATOM   2622 C  CD  . GLU B 1 42  ? 64.261  46.945 28.316  1.00 38.52 ? 42   GLU B CD  1 
ATOM   2623 O  OE1 . GLU B 1 42  ? 63.272  47.638 28.643  1.00 38.48 ? 42   GLU B OE1 1 
ATOM   2624 O  OE2 . GLU B 1 42  ? 64.212  46.074 27.418  1.00 38.78 ? 42   GLU B OE2 1 
ATOM   2625 N  N   . GLN B 1 43  ? 66.675  46.199 33.496  1.00 35.39 ? 43   GLN B N   1 
ATOM   2626 C  CA  . GLN B 1 43  ? 66.413  45.978 34.909  1.00 37.31 ? 43   GLN B CA  1 
ATOM   2627 C  C   . GLN B 1 43  ? 67.523  46.570 35.792  1.00 40.02 ? 43   GLN B C   1 
ATOM   2628 O  O   . GLN B 1 43  ? 68.120  47.583 35.426  1.00 39.16 ? 43   GLN B O   1 
ATOM   2629 C  CB  . GLN B 1 43  ? 66.207  44.478 35.162  1.00 35.81 ? 43   GLN B CB  1 
ATOM   2630 C  CG  . GLN B 1 43  ? 64.783  44.013 34.823  1.00 30.95 ? 43   GLN B CG  1 
ATOM   2631 C  CD  . GLN B 1 43  ? 64.685  42.541 34.444  1.00 27.28 ? 43   GLN B CD  1 
ATOM   2632 O  OE1 . GLN B 1 43  ? 65.117  41.656 35.187  1.00 24.18 ? 43   GLN B OE1 1 
ATOM   2633 N  NE2 . GLN B 1 43  ? 64.100  42.276 33.283  1.00 24.89 ? 43   GLN B NE2 1 
ATOM   2634 N  N   . GLU B 1 44  ? 67.820  45.944 36.929  1.00 43.79 ? 44   GLU B N   1 
ATOM   2635 C  CA  . GLU B 1 44  ? 68.818  46.504 37.851  1.00 47.89 ? 44   GLU B CA  1 
ATOM   2636 C  C   . GLU B 1 44  ? 70.164  45.810 38.101  1.00 48.71 ? 44   GLU B C   1 
ATOM   2637 O  O   . GLU B 1 44  ? 70.786  46.062 39.137  1.00 49.87 ? 44   GLU B O   1 
ATOM   2638 C  CB  . GLU B 1 44  ? 68.148  46.746 39.214  1.00 50.10 ? 44   GLU B CB  1 
ATOM   2639 C  CG  . GLU B 1 44  ? 67.538  45.480 39.849  1.00 53.84 ? 44   GLU B CG  1 
ATOM   2640 C  CD  . GLU B 1 44  ? 68.254  45.031 41.126  1.00 54.93 ? 44   GLU B CD  1 
ATOM   2641 O  OE1 . GLU B 1 44  ? 67.887  43.963 41.669  1.00 54.89 ? 44   GLU B OE1 1 
ATOM   2642 O  OE2 . GLU B 1 44  ? 69.175  45.745 41.587  1.00 54.60 ? 44   GLU B OE2 1 
ATOM   2643 N  N   . CYS B 1 45  ? 70.640  44.968 37.185  1.00 49.71 ? 45   CYS B N   1 
ATOM   2644 C  CA  . CYS B 1 45  ? 71.919  44.282 37.417  1.00 49.17 ? 45   CYS B CA  1 
ATOM   2645 C  C   . CYS B 1 45  ? 72.934  44.373 36.275  1.00 46.92 ? 45   CYS B C   1 
ATOM   2646 O  O   . CYS B 1 45  ? 72.563  44.476 35.104  1.00 46.73 ? 45   CYS B O   1 
ATOM   2647 C  CB  . CYS B 1 45  ? 71.666  42.810 37.768  1.00 50.45 ? 45   CYS B CB  1 
ATOM   2648 S  SG  . CYS B 1 45  ? 70.735  42.545 39.324  1.00 55.82 ? 45   CYS B SG  1 
ATOM   2649 N  N   . ASP B 1 46  ? 74.218  44.340 36.634  1.00 44.94 ? 46   ASP B N   1 
ATOM   2650 C  CA  . ASP B 1 46  ? 75.302  44.420 35.655  1.00 42.38 ? 46   ASP B CA  1 
ATOM   2651 C  C   . ASP B 1 46  ? 75.302  43.146 34.828  1.00 40.19 ? 46   ASP B C   1 
ATOM   2652 O  O   . ASP B 1 46  ? 75.319  42.045 35.375  1.00 39.03 ? 46   ASP B O   1 
ATOM   2653 C  CB  . ASP B 1 46  ? 76.671  44.561 36.339  1.00 43.78 ? 46   ASP B CB  1 
ATOM   2654 C  CG  . ASP B 1 46  ? 76.630  45.435 37.581  1.00 46.47 ? 46   ASP B CG  1 
ATOM   2655 O  OD1 . ASP B 1 46  ? 76.069  46.550 37.519  1.00 49.27 ? 46   ASP B OD1 1 
ATOM   2656 O  OD2 . ASP B 1 46  ? 77.173  45.007 38.625  1.00 46.48 ? 46   ASP B OD2 1 
ATOM   2657 N  N   . VAL B 1 47  ? 75.292  43.298 33.509  1.00 37.15 ? 47   VAL B N   1 
ATOM   2658 C  CA  . VAL B 1 47  ? 75.280  42.147 32.623  1.00 35.03 ? 47   VAL B CA  1 
ATOM   2659 C  C   . VAL B 1 47  ? 76.587  42.040 31.837  1.00 34.58 ? 47   VAL B C   1 
ATOM   2660 O  O   . VAL B 1 47  ? 76.850  42.840 30.935  1.00 34.16 ? 47   VAL B O   1 
ATOM   2661 C  CB  . VAL B 1 47  ? 74.091  42.238 31.637  1.00 34.68 ? 47   VAL B CB  1 
ATOM   2662 C  CG1 . VAL B 1 47  ? 73.975  40.954 30.835  1.00 33.13 ? 47   VAL B CG1 1 
ATOM   2663 C  CG2 . VAL B 1 47  ? 72.806  42.510 32.400  1.00 32.30 ? 47   VAL B CG2 1 
ATOM   2664 N  N   . LYS B 1 48  ? 77.409  41.055 32.194  1.00 33.91 ? 48   LYS B N   1 
ATOM   2665 C  CA  . LYS B 1 48  ? 78.687  40.829 31.517  1.00 33.36 ? 48   LYS B CA  1 
ATOM   2666 C  C   . LYS B 1 48  ? 78.571  39.565 30.669  1.00 32.24 ? 48   LYS B C   1 
ATOM   2667 O  O   . LYS B 1 48  ? 78.210  38.499 31.172  1.00 32.45 ? 48   LYS B O   1 
ATOM   2668 C  CB  . LYS B 1 48  ? 79.814  40.668 32.538  1.00 33.53 ? 48   LYS B CB  1 
ATOM   2669 C  CG  . LYS B 1 48  ? 79.866  41.753 33.619  1.00 37.14 ? 48   LYS B CG  1 
ATOM   2670 C  CD  . LYS B 1 48  ? 80.286  43.140 33.100  1.00 38.91 ? 48   LYS B CD  1 
ATOM   2671 C  CE  . LYS B 1 48  ? 79.134  43.918 32.463  1.00 40.44 ? 48   LYS B CE  1 
ATOM   2672 N  NZ  . LYS B 1 48  ? 78.005  44.163 33.409  1.00 40.55 ? 48   LYS B NZ  1 
ATOM   2673 N  N   . ASP B 1 49  ? 78.873  39.695 29.381  1.00 30.57 ? 49   ASP B N   1 
ATOM   2674 C  CA  . ASP B 1 49  ? 78.781  38.579 28.445  1.00 29.36 ? 49   ASP B CA  1 
ATOM   2675 C  C   . ASP B 1 49  ? 80.101  37.822 28.314  1.00 29.49 ? 49   ASP B C   1 
ATOM   2676 O  O   . ASP B 1 49  ? 81.075  38.349 27.775  1.00 30.00 ? 49   ASP B O   1 
ATOM   2677 C  CB  . ASP B 1 49  ? 78.374  39.102 27.069  1.00 30.16 ? 49   ASP B CB  1 
ATOM   2678 C  CG  . ASP B 1 49  ? 77.785  38.026 26.186  1.00 30.35 ? 49   ASP B CG  1 
ATOM   2679 O  OD1 . ASP B 1 49  ? 78.157  36.841 26.352  1.00 30.90 ? 49   ASP B OD1 1 
ATOM   2680 O  OD2 . ASP B 1 49  ? 76.953  38.373 25.319  1.00 30.65 ? 49   ASP B OD2 1 
ATOM   2681 N  N   . TYR B 1 50  ? 80.136  36.585 28.795  1.00 28.33 ? 50   TYR B N   1 
ATOM   2682 C  CA  . TYR B 1 50  ? 81.355  35.795 28.697  1.00 28.10 ? 50   TYR B CA  1 
ATOM   2683 C  C   . TYR B 1 50  ? 81.419  35.058 27.365  1.00 27.44 ? 50   TYR B C   1 
ATOM   2684 O  O   . TYR B 1 50  ? 82.337  34.271 27.122  1.00 27.09 ? 50   TYR B O   1 
ATOM   2685 C  CB  . TYR B 1 50  ? 81.456  34.807 29.862  1.00 27.42 ? 50   TYR B CB  1 
ATOM   2686 C  CG  . TYR B 1 50  ? 81.775  35.472 31.183  1.00 28.28 ? 50   TYR B CG  1 
ATOM   2687 C  CD1 . TYR B 1 50  ? 80.854  36.322 31.801  1.00 27.95 ? 50   TYR B CD1 1 
ATOM   2688 C  CD2 . TYR B 1 50  ? 83.012  35.269 31.812  1.00 28.06 ? 50   TYR B CD2 1 
ATOM   2689 C  CE1 . TYR B 1 50  ? 81.156  36.956 33.014  1.00 27.51 ? 50   TYR B CE1 1 
ATOM   2690 C  CE2 . TYR B 1 50  ? 83.321  35.895 33.025  1.00 25.18 ? 50   TYR B CE2 1 
ATOM   2691 C  CZ  . TYR B 1 50  ? 82.389  36.736 33.615  1.00 25.83 ? 50   TYR B CZ  1 
ATOM   2692 O  OH  . TYR B 1 50  ? 82.686  37.366 34.798  1.00 23.54 ? 50   TYR B OH  1 
ATOM   2693 N  N   . GLY B 1 51  ? 80.435  35.327 26.510  1.00 26.72 ? 51   GLY B N   1 
ATOM   2694 C  CA  . GLY B 1 51  ? 80.381  34.711 25.197  1.00 26.01 ? 51   GLY B CA  1 
ATOM   2695 C  C   . GLY B 1 51  ? 79.910  33.270 25.164  1.00 26.97 ? 51   GLY B C   1 
ATOM   2696 O  O   . GLY B 1 51  ? 79.612  32.671 26.201  1.00 27.07 ? 51   GLY B O   1 
ATOM   2697 N  N   . ASP B 1 52  ? 79.840  32.726 23.951  1.00 26.38 ? 52   ASP B N   1 
ATOM   2698 C  CA  . ASP B 1 52  ? 79.424  31.348 23.703  1.00 26.99 ? 52   ASP B CA  1 
ATOM   2699 C  C   . ASP B 1 52  ? 80.657  30.458 23.744  1.00 28.48 ? 52   ASP B C   1 
ATOM   2700 O  O   . ASP B 1 52  ? 81.616  30.688 23.003  1.00 29.74 ? 52   ASP B O   1 
ATOM   2701 C  CB  . ASP B 1 52  ? 78.775  31.247 22.325  1.00 26.11 ? 52   ASP B CB  1 
ATOM   2702 C  CG  . ASP B 1 52  ? 77.355  31.770 22.309  1.00 25.00 ? 52   ASP B CG  1 
ATOM   2703 O  OD1 . ASP B 1 52  ? 77.039  32.657 23.127  1.00 23.15 ? 52   ASP B OD1 1 
ATOM   2704 O  OD2 . ASP B 1 52  ? 76.558  31.300 21.468  1.00 26.12 ? 52   ASP B OD2 1 
ATOM   2705 N  N   . LEU B 1 53  ? 80.643  29.446 24.606  1.00 29.19 ? 53   LEU B N   1 
ATOM   2706 C  CA  . LEU B 1 53  ? 81.793  28.561 24.717  1.00 29.12 ? 53   LEU B CA  1 
ATOM   2707 C  C   . LEU B 1 53  ? 82.057  27.797 23.425  1.00 30.40 ? 53   LEU B C   1 
ATOM   2708 O  O   . LEU B 1 53  ? 81.170  27.126 22.894  1.00 29.99 ? 53   LEU B O   1 
ATOM   2709 C  CB  . LEU B 1 53  ? 81.607  27.572 25.874  1.00 28.96 ? 53   LEU B CB  1 
ATOM   2710 C  CG  . LEU B 1 53  ? 81.593  28.134 27.303  1.00 29.08 ? 53   LEU B CG  1 
ATOM   2711 C  CD1 . LEU B 1 53  ? 81.716  26.980 28.300  1.00 28.50 ? 53   LEU B CD1 1 
ATOM   2712 C  CD2 . LEU B 1 53  ? 82.743  29.113 27.500  1.00 27.57 ? 53   LEU B CD2 1 
ATOM   2713 N  N   . PRO B 1 54  ? 83.284  27.915 22.887  1.00 31.68 ? 54   PRO B N   1 
ATOM   2714 C  CA  . PRO B 1 54  ? 83.676  27.230 21.650  1.00 32.03 ? 54   PRO B CA  1 
ATOM   2715 C  C   . PRO B 1 54  ? 84.046  25.793 22.020  1.00 32.64 ? 54   PRO B C   1 
ATOM   2716 O  O   . PRO B 1 54  ? 85.128  25.537 22.558  1.00 32.50 ? 54   PRO B O   1 
ATOM   2717 C  CB  . PRO B 1 54  ? 84.872  28.050 21.177  1.00 31.66 ? 54   PRO B CB  1 
ATOM   2718 C  CG  . PRO B 1 54  ? 85.539  28.410 22.475  1.00 30.93 ? 54   PRO B CG  1 
ATOM   2719 C  CD  . PRO B 1 54  ? 84.369  28.797 23.365  1.00 32.45 ? 54   PRO B CD  1 
ATOM   2720 N  N   . PHE B 1 55  ? 83.136  24.864 21.739  1.00 33.32 ? 55   PHE B N   1 
ATOM   2721 C  CA  . PHE B 1 55  ? 83.344  23.464 22.085  1.00 34.09 ? 55   PHE B CA  1 
ATOM   2722 C  C   . PHE B 1 55  ? 84.210  22.656 21.128  1.00 36.51 ? 55   PHE B C   1 
ATOM   2723 O  O   . PHE B 1 55  ? 83.975  22.628 19.916  1.00 37.44 ? 55   PHE B O   1 
ATOM   2724 C  CB  . PHE B 1 55  ? 81.990  22.774 22.269  1.00 31.28 ? 55   PHE B CB  1 
ATOM   2725 C  CG  . PHE B 1 55  ? 81.167  23.352 23.384  1.00 28.33 ? 55   PHE B CG  1 
ATOM   2726 C  CD1 . PHE B 1 55  ? 81.661  23.375 24.690  1.00 27.07 ? 55   PHE B CD1 1 
ATOM   2727 C  CD2 . PHE B 1 55  ? 79.906  23.878 23.135  1.00 25.06 ? 55   PHE B CD2 1 
ATOM   2728 C  CE1 . PHE B 1 55  ? 80.907  23.914 25.728  1.00 25.62 ? 55   PHE B CE1 1 
ATOM   2729 C  CE2 . PHE B 1 55  ? 79.147  24.417 24.168  1.00 26.07 ? 55   PHE B CE2 1 
ATOM   2730 C  CZ  . PHE B 1 55  ? 79.646  24.437 25.465  1.00 24.45 ? 55   PHE B CZ  1 
ATOM   2731 N  N   . ALA B 1 56  ? 85.213  21.992 21.697  1.00 38.70 ? 56   ALA B N   1 
ATOM   2732 C  CA  . ALA B 1 56  ? 86.133  21.160 20.930  1.00 40.39 ? 56   ALA B CA  1 
ATOM   2733 C  C   . ALA B 1 56  ? 85.357  20.087 20.167  1.00 40.12 ? 56   ALA B C   1 
ATOM   2734 O  O   . ALA B 1 56  ? 84.314  19.618 20.621  1.00 40.23 ? 56   ALA B O   1 
ATOM   2735 C  CB  . ALA B 1 56  ? 87.155  20.508 21.872  1.00 40.62 ? 56   ALA B CB  1 
ATOM   2736 N  N   . ASP B 1 57  ? 85.867  19.704 19.004  1.00 40.58 ? 57   ASP B N   1 
ATOM   2737 C  CA  . ASP B 1 57  ? 85.208  18.686 18.201  1.00 40.07 ? 57   ASP B CA  1 
ATOM   2738 C  C   . ASP B 1 57  ? 85.911  17.351 18.404  1.00 38.59 ? 57   ASP B C   1 
ATOM   2739 O  O   . ASP B 1 57  ? 87.102  17.211 18.111  1.00 38.47 ? 57   ASP B O   1 
ATOM   2740 C  CB  . ASP B 1 57  ? 85.238  19.076 16.720  1.00 42.27 ? 57   ASP B CB  1 
ATOM   2741 C  CG  . ASP B 1 57  ? 84.396  18.157 15.854  1.00 43.59 ? 57   ASP B CG  1 
ATOM   2742 O  OD1 . ASP B 1 57  ? 84.459  18.287 14.612  1.00 43.98 ? 57   ASP B OD1 1 
ATOM   2743 O  OD2 . ASP B 1 57  ? 83.666  17.309 16.415  1.00 45.83 ? 57   ASP B OD2 1 
ATOM   2744 N  N   . ILE B 1 58  ? 85.171  16.376 18.921  1.00 37.31 ? 58   ILE B N   1 
ATOM   2745 C  CA  . ILE B 1 58  ? 85.723  15.049 19.155  1.00 35.40 ? 58   ILE B CA  1 
ATOM   2746 C  C   . ILE B 1 58  ? 85.162  14.090 18.116  1.00 33.82 ? 58   ILE B C   1 
ATOM   2747 O  O   . ILE B 1 58  ? 84.230  13.339 18.398  1.00 35.22 ? 58   ILE B O   1 
ATOM   2748 C  CB  . ILE B 1 58  ? 85.347  14.510 20.544  1.00 34.85 ? 58   ILE B CB  1 
ATOM   2749 C  CG1 . ILE B 1 58  ? 85.383  15.638 21.580  1.00 35.88 ? 58   ILE B CG1 1 
ATOM   2750 C  CG2 . ILE B 1 58  ? 86.295  13.388 20.927  1.00 34.32 ? 58   ILE B CG2 1 
ATOM   2751 C  CD1 . ILE B 1 58  ? 86.734  16.286 21.774  1.00 35.21 ? 58   ILE B CD1 1 
ATOM   2752 N  N   . PRO B 1 59  ? 85.706  14.117 16.889  1.00 31.54 ? 59   PRO B N   1 
ATOM   2753 C  CA  . PRO B 1 59  ? 85.193  13.206 15.867  1.00 29.28 ? 59   PRO B CA  1 
ATOM   2754 C  C   . PRO B 1 59  ? 85.283  11.744 16.307  1.00 27.61 ? 59   PRO B C   1 
ATOM   2755 O  O   . PRO B 1 59  ? 84.425  10.936 15.962  1.00 26.86 ? 59   PRO B O   1 
ATOM   2756 C  CB  . PRO B 1 59  ? 86.054  13.533 14.643  1.00 29.32 ? 59   PRO B CB  1 
ATOM   2757 C  CG  . PRO B 1 59  ? 87.308  14.098 15.230  1.00 31.46 ? 59   PRO B CG  1 
ATOM   2758 C  CD  . PRO B 1 59  ? 86.790  14.955 16.349  1.00 31.10 ? 59   PRO B CD  1 
ATOM   2759 N  N   . ASN B 1 60  ? 86.318  11.412 17.074  1.00 26.45 ? 60   ASN B N   1 
ATOM   2760 C  CA  . ASN B 1 60  ? 86.488  10.053 17.573  1.00 25.40 ? 60   ASN B CA  1 
ATOM   2761 C  C   . ASN B 1 60  ? 85.841  9.947  18.954  1.00 25.49 ? 60   ASN B C   1 
ATOM   2762 O  O   . ASN B 1 60  ? 86.460  10.272 19.971  1.00 26.96 ? 60   ASN B O   1 
ATOM   2763 C  CB  . ASN B 1 60  ? 87.973  9.698  17.657  1.00 24.60 ? 60   ASN B CB  1 
ATOM   2764 C  CG  . ASN B 1 60  ? 88.587  9.426  16.293  1.00 24.30 ? 60   ASN B CG  1 
ATOM   2765 O  OD1 . ASN B 1 60  ? 88.310  8.401  15.666  1.00 22.83 ? 60   ASN B OD1 1 
ATOM   2766 N  ND2 . ASN B 1 60  ? 89.416  10.349 15.824  1.00 24.29 ? 60   ASN B ND2 1 
ATOM   2767 N  N   . ASP B 1 61  ? 84.595  9.487  18.989  1.00 23.14 ? 61   ASP B N   1 
ATOM   2768 C  CA  . ASP B 1 61  ? 83.882  9.370  20.249  1.00 21.37 ? 61   ASP B CA  1 
ATOM   2769 C  C   . ASP B 1 61  ? 82.761  8.331  20.187  1.00 19.74 ? 61   ASP B C   1 
ATOM   2770 O  O   . ASP B 1 61  ? 81.579  8.669  20.237  1.00 19.68 ? 61   ASP B O   1 
ATOM   2771 C  CB  . ASP B 1 61  ? 83.344  10.758 20.628  1.00 21.16 ? 61   ASP B CB  1 
ATOM   2772 C  CG  . ASP B 1 61  ? 82.740  10.804 22.019  1.00 19.08 ? 61   ASP B CG  1 
ATOM   2773 O  OD1 . ASP B 1 61  ? 83.107  9.977  22.871  1.00 17.22 ? 61   ASP B OD1 1 
ATOM   2774 O  OD2 . ASP B 1 61  ? 81.898  11.694 22.256  1.00 21.28 ? 61   ASP B OD2 1 
ATOM   2775 N  N   . SER B 1 62  ? 83.152  7.064  20.081  1.00 19.12 ? 62   SER B N   1 
ATOM   2776 C  CA  . SER B 1 62  ? 82.212  5.943  20.024  1.00 19.65 ? 62   SER B CA  1 
ATOM   2777 C  C   . SER B 1 62  ? 81.541  5.704  21.383  1.00 20.35 ? 62   SER B C   1 
ATOM   2778 O  O   . SER B 1 62  ? 82.082  6.076  22.424  1.00 19.71 ? 62   SER B O   1 
ATOM   2779 C  CB  . SER B 1 62  ? 82.942  4.669  19.586  1.00 18.64 ? 62   SER B CB  1 
ATOM   2780 O  OG  . SER B 1 62  ? 83.461  4.808  18.277  1.00 18.22 ? 62   SER B OG  1 
ATOM   2781 N  N   . PRO B 1 63  ? 80.362  5.053  21.387  1.00 20.46 ? 63   PRO B N   1 
ATOM   2782 C  CA  . PRO B 1 63  ? 79.629  4.778  22.629  1.00 21.11 ? 63   PRO B CA  1 
ATOM   2783 C  C   . PRO B 1 63  ? 80.439  4.088  23.721  1.00 21.36 ? 63   PRO B C   1 
ATOM   2784 O  O   . PRO B 1 63  ? 81.425  3.397  23.447  1.00 22.46 ? 63   PRO B O   1 
ATOM   2785 C  CB  . PRO B 1 63  ? 78.463  3.894  22.167  1.00 18.65 ? 63   PRO B CB  1 
ATOM   2786 C  CG  . PRO B 1 63  ? 78.250  4.307  20.756  1.00 20.47 ? 63   PRO B CG  1 
ATOM   2787 C  CD  . PRO B 1 63  ? 79.662  4.461  20.231  1.00 21.52 ? 63   PRO B CD  1 
ATOM   2788 N  N   . PHE B 1 64  ? 80.015  4.307  24.963  1.00 20.96 ? 64   PHE B N   1 
ATOM   2789 C  CA  . PHE B 1 64  ? 80.614  3.675  26.128  1.00 18.99 ? 64   PHE B CA  1 
ATOM   2790 C  C   . PHE B 1 64  ? 79.478  2.755  26.523  1.00 18.98 ? 64   PHE B C   1 
ATOM   2791 O  O   . PHE B 1 64  ? 78.541  3.179  27.197  1.00 18.66 ? 64   PHE B O   1 
ATOM   2792 C  CB  . PHE B 1 64  ? 80.878  4.694  27.232  1.00 20.12 ? 64   PHE B CB  1 
ATOM   2793 C  CG  . PHE B 1 64  ? 81.345  4.080  28.521  1.00 21.10 ? 64   PHE B CG  1 
ATOM   2794 C  CD1 . PHE B 1 64  ? 82.532  3.355  28.574  1.00 21.36 ? 64   PHE B CD1 1 
ATOM   2795 C  CD2 . PHE B 1 64  ? 80.584  4.205  29.681  1.00 23.31 ? 64   PHE B CD2 1 
ATOM   2796 C  CE1 . PHE B 1 64  ? 82.957  2.760  29.764  1.00 23.82 ? 64   PHE B CE1 1 
ATOM   2797 C  CE2 . PHE B 1 64  ? 80.998  3.614  30.877  1.00 24.39 ? 64   PHE B CE2 1 
ATOM   2798 C  CZ  . PHE B 1 64  ? 82.189  2.888  30.916  1.00 24.64 ? 64   PHE B CZ  1 
ATOM   2799 N  N   . GLN B 1 65  ? 79.551  1.500  26.089  1.00 21.33 ? 65   GLN B N   1 
ATOM   2800 C  CA  . GLN B 1 65  ? 78.474  0.550  26.355  1.00 23.22 ? 65   GLN B CA  1 
ATOM   2801 C  C   . GLN B 1 65  ? 77.268  1.175  25.652  1.00 23.75 ? 65   GLN B C   1 
ATOM   2802 O  O   . GLN B 1 65  ? 77.235  1.234  24.426  1.00 23.55 ? 65   GLN B O   1 
ATOM   2803 C  CB  . GLN B 1 65  ? 78.212  0.412  27.861  1.00 24.56 ? 65   GLN B CB  1 
ATOM   2804 C  CG  . GLN B 1 65  ? 79.371  -0.189 28.646  1.00 28.98 ? 65   GLN B CG  1 
ATOM   2805 C  CD  . GLN B 1 65  ? 79.038  -0.423 30.114  1.00 32.38 ? 65   GLN B CD  1 
ATOM   2806 O  OE1 . GLN B 1 65  ? 78.159  -1.221 30.446  1.00 34.58 ? 65   GLN B OE1 1 
ATOM   2807 N  NE2 . GLN B 1 65  ? 79.743  0.276  31.000  1.00 34.24 ? 65   GLN B NE2 1 
ATOM   2808 N  N   . ILE B 1 66  ? 76.293  1.667  26.411  1.00 23.63 ? 66   ILE B N   1 
ATOM   2809 C  CA  . ILE B 1 66  ? 75.139  2.298  25.784  1.00 23.78 ? 66   ILE B CA  1 
ATOM   2810 C  C   . ILE B 1 66  ? 75.286  3.821  25.687  1.00 21.43 ? 66   ILE B C   1 
ATOM   2811 O  O   . ILE B 1 66  ? 74.703  4.449  24.810  1.00 20.88 ? 66   ILE B O   1 
ATOM   2812 C  CB  . ILE B 1 66  ? 73.824  1.984  26.540  1.00 24.86 ? 66   ILE B CB  1 
ATOM   2813 C  CG1 . ILE B 1 66  ? 72.655  2.659  25.819  1.00 24.47 ? 66   ILE B CG1 1 
ATOM   2814 C  CG2 . ILE B 1 66  ? 73.905  2.476  27.977  1.00 24.48 ? 66   ILE B CG2 1 
ATOM   2815 C  CD1 . ILE B 1 66  ? 71.296  2.254  26.319  1.00 24.18 ? 66   ILE B CD1 1 
ATOM   2816 N  N   . VAL B 1 67  ? 76.070  4.402  26.590  1.00 20.42 ? 67   VAL B N   1 
ATOM   2817 C  CA  . VAL B 1 67  ? 76.280  5.846  26.624  1.00 17.58 ? 67   VAL B CA  1 
ATOM   2818 C  C   . VAL B 1 67  ? 76.786  6.375  25.289  1.00 19.53 ? 67   VAL B C   1 
ATOM   2819 O  O   . VAL B 1 67  ? 77.681  5.791  24.691  1.00 21.92 ? 67   VAL B O   1 
ATOM   2820 C  CB  . VAL B 1 67  ? 77.279  6.221  27.741  1.00 15.12 ? 67   VAL B CB  1 
ATOM   2821 C  CG1 . VAL B 1 67  ? 77.663  7.681  27.635  1.00 14.04 ? 67   VAL B CG1 1 
ATOM   2822 C  CG2 . VAL B 1 67  ? 76.664  5.938  29.097  1.00 13.35 ? 67   VAL B CG2 1 
ATOM   2823 N  N   . LYS B 1 68  ? 76.211  7.489  24.832  1.00 20.28 ? 68   LYS B N   1 
ATOM   2824 C  CA  . LYS B 1 68  ? 76.584  8.101  23.553  1.00 18.50 ? 68   LYS B CA  1 
ATOM   2825 C  C   . LYS B 1 68  ? 77.331  9.437  23.712  1.00 17.73 ? 68   LYS B C   1 
ATOM   2826 O  O   . LYS B 1 68  ? 77.015  10.234 24.593  1.00 17.10 ? 68   LYS B O   1 
ATOM   2827 C  CB  . LYS B 1 68  ? 75.325  8.309  22.701  1.00 18.49 ? 68   LYS B CB  1 
ATOM   2828 C  CG  . LYS B 1 68  ? 74.581  7.030  22.349  1.00 17.50 ? 68   LYS B CG  1 
ATOM   2829 C  CD  . LYS B 1 68  ? 73.132  7.311  21.960  1.00 19.24 ? 68   LYS B CD  1 
ATOM   2830 C  CE  . LYS B 1 68  ? 72.407  6.022  21.598  1.00 21.73 ? 68   LYS B CE  1 
ATOM   2831 N  NZ  . LYS B 1 68  ? 70.954  6.212  21.370  1.00 23.67 ? 68   LYS B NZ  1 
ATOM   2832 N  N   . ASN B 1 69  ? 78.309  9.664  22.834  1.00 17.87 ? 69   ASN B N   1 
ATOM   2833 C  CA  . ASN B 1 69  ? 79.159  10.871 22.815  1.00 17.37 ? 69   ASN B CA  1 
ATOM   2834 C  C   . ASN B 1 69  ? 79.618  11.326 24.206  1.00 15.50 ? 69   ASN B C   1 
ATOM   2835 O  O   . ASN B 1 69  ? 79.566  12.516 24.524  1.00 15.30 ? 69   ASN B O   1 
ATOM   2836 C  CB  . ASN B 1 69  ? 78.447  12.052 22.130  1.00 18.02 ? 69   ASN B CB  1 
ATOM   2837 C  CG  . ASN B 1 69  ? 77.410  11.613 21.100  1.00 18.70 ? 69   ASN B CG  1 
ATOM   2838 O  OD1 . ASN B 1 69  ? 77.614  10.654 20.351  1.00 19.74 ? 69   ASN B OD1 1 
ATOM   2839 N  ND2 . ASN B 1 69  ? 76.291  12.334 21.053  1.00 16.63 ? 69   ASN B ND2 1 
ATOM   2840 N  N   . PRO B 1 70  ? 80.088  10.384 25.043  1.00 14.88 ? 70   PRO B N   1 
ATOM   2841 C  CA  . PRO B 1 70  ? 80.557  10.672 26.403  1.00 13.83 ? 70   PRO B CA  1 
ATOM   2842 C  C   . PRO B 1 70  ? 81.758  11.615 26.506  1.00 14.75 ? 70   PRO B C   1 
ATOM   2843 O  O   . PRO B 1 70  ? 81.839  12.439 27.420  1.00 16.16 ? 70   PRO B O   1 
ATOM   2844 C  CB  . PRO B 1 70  ? 80.872  9.284  26.948  1.00 14.76 ? 70   PRO B CB  1 
ATOM   2845 C  CG  . PRO B 1 70  ? 81.345  8.556  25.729  1.00 12.98 ? 70   PRO B CG  1 
ATOM   2846 C  CD  . PRO B 1 70  ? 80.328  8.967  24.701  1.00 12.02 ? 70   PRO B CD  1 
ATOM   2847 N  N   . ARG B 1 71  ? 82.700  11.477 25.582  1.00 16.29 ? 71   ARG B N   1 
ATOM   2848 C  CA  . ARG B 1 71  ? 83.891  12.318 25.569  1.00 16.66 ? 71   ARG B CA  1 
ATOM   2849 C  C   . ARG B 1 71  ? 83.543  13.749 25.184  1.00 16.29 ? 71   ARG B C   1 
ATOM   2850 O  O   . ARG B 1 71  ? 84.070  14.698 25.769  1.00 14.86 ? 71   ARG B O   1 
ATOM   2851 C  CB  . ARG B 1 71  ? 84.922  11.750 24.599  1.00 18.22 ? 71   ARG B CB  1 
ATOM   2852 C  CG  . ARG B 1 71  ? 85.302  10.322 24.914  1.00 21.20 ? 71   ARG B CG  1 
ATOM   2853 C  CD  . ARG B 1 71  ? 86.336  9.789  23.934  1.00 24.04 ? 71   ARG B CD  1 
ATOM   2854 N  NE  . ARG B 1 71  ? 86.494  8.343  24.073  1.00 24.11 ? 71   ARG B NE  1 
ATOM   2855 C  CZ  . ARG B 1 71  ? 85.569  7.453  23.731  1.00 24.42 ? 71   ARG B CZ  1 
ATOM   2856 N  NH1 . ARG B 1 71  ? 84.413  7.856  23.217  1.00 20.95 ? 71   ARG B NH1 1 
ATOM   2857 N  NH2 . ARG B 1 71  ? 85.793  6.159  23.924  1.00 23.70 ? 71   ARG B NH2 1 
ATOM   2858 N  N   . SER B 1 72  ? 82.656  13.900 24.202  1.00 16.25 ? 72   SER B N   1 
ATOM   2859 C  CA  . SER B 1 72  ? 82.229  15.225 23.772  1.00 16.82 ? 72   SER B CA  1 
ATOM   2860 C  C   . SER B 1 72  ? 81.424  15.874 24.906  1.00 18.06 ? 72   SER B C   1 
ATOM   2861 O  O   . SER B 1 72  ? 81.608  17.054 25.213  1.00 19.38 ? 72   SER B O   1 
ATOM   2862 C  CB  . SER B 1 72  ? 81.371  15.134 22.503  1.00 15.35 ? 72   SER B CB  1 
ATOM   2863 O  OG  . SER B 1 72  ? 82.127  14.685 21.389  1.00 14.27 ? 72   SER B OG  1 
ATOM   2864 N  N   . VAL B 1 73  ? 80.536  15.106 25.530  1.00 17.33 ? 73   VAL B N   1 
ATOM   2865 C  CA  . VAL B 1 73  ? 79.742  15.639 26.633  1.00 18.07 ? 73   VAL B CA  1 
ATOM   2866 C  C   . VAL B 1 73  ? 80.620  15.910 27.856  1.00 17.25 ? 73   VAL B C   1 
ATOM   2867 O  O   . VAL B 1 73  ? 80.431  16.908 28.551  1.00 17.08 ? 73   VAL B O   1 
ATOM   2868 C  CB  . VAL B 1 73  ? 78.593  14.674 27.031  1.00 18.38 ? 73   VAL B CB  1 
ATOM   2869 C  CG1 . VAL B 1 73  ? 77.902  15.166 28.310  1.00 17.10 ? 73   VAL B CG1 1 
ATOM   2870 C  CG2 . VAL B 1 73  ? 77.581  14.584 25.899  1.00 15.03 ? 73   VAL B CG2 1 
ATOM   2871 N  N   . GLY B 1 74  ? 81.583  15.025 28.107  1.00 16.96 ? 74   GLY B N   1 
ATOM   2872 C  CA  . GLY B 1 74  ? 82.470  15.195 29.247  1.00 18.42 ? 74   GLY B CA  1 
ATOM   2873 C  C   . GLY B 1 74  ? 83.356  16.434 29.179  1.00 19.80 ? 74   GLY B C   1 
ATOM   2874 O  O   . GLY B 1 74  ? 83.558  17.125 30.189  1.00 17.53 ? 74   GLY B O   1 
ATOM   2875 N  N   . LYS B 1 75  ? 83.893  16.720 27.990  1.00 21.49 ? 75   LYS B N   1 
ATOM   2876 C  CA  . LYS B 1 75  ? 84.758  17.886 27.807  1.00 23.29 ? 75   LYS B CA  1 
ATOM   2877 C  C   . LYS B 1 75  ? 83.921  19.166 27.695  1.00 22.63 ? 75   LYS B C   1 
ATOM   2878 O  O   . LYS B 1 75  ? 84.422  20.267 27.934  1.00 21.58 ? 75   LYS B O   1 
ATOM   2879 C  CB  . LYS B 1 75  ? 85.621  17.722 26.550  1.00 25.57 ? 75   LYS B CB  1 
ATOM   2880 C  CG  . LYS B 1 75  ? 86.922  18.534 26.564  1.00 27.40 ? 75   LYS B CG  1 
ATOM   2881 C  CD  . LYS B 1 75  ? 87.963  17.884 27.475  1.00 31.02 ? 75   LYS B CD  1 
ATOM   2882 C  CE  . LYS B 1 75  ? 89.350  18.515 27.330  1.00 31.87 ? 75   LYS B CE  1 
ATOM   2883 N  NZ  . LYS B 1 75  ? 89.349  19.971 27.645  1.00 33.98 ? 75   LYS B NZ  1 
ATOM   2884 N  N   . ALA B 1 76  ? 82.648  19.010 27.330  1.00 22.54 ? 76   ALA B N   1 
ATOM   2885 C  CA  . ALA B 1 76  ? 81.735  20.142 27.198  1.00 22.43 ? 76   ALA B CA  1 
ATOM   2886 C  C   . ALA B 1 76  ? 81.374  20.672 28.576  1.00 21.65 ? 76   ALA B C   1 
ATOM   2887 O  O   . ALA B 1 76  ? 81.358  21.883 28.803  1.00 22.58 ? 76   ALA B O   1 
ATOM   2888 C  CB  . ALA B 1 76  ? 80.475  19.727 26.455  1.00 22.26 ? 76   ALA B CB  1 
ATOM   2889 N  N   . SER B 1 77  ? 81.076  19.770 29.499  1.00 19.25 ? 77   SER B N   1 
ATOM   2890 C  CA  . SER B 1 77  ? 80.746  20.208 30.839  1.00 19.88 ? 77   SER B CA  1 
ATOM   2891 C  C   . SER B 1 77  ? 82.034  20.569 31.598  1.00 19.49 ? 77   SER B C   1 
ATOM   2892 O  O   . SER B 1 77  ? 82.005  21.396 32.509  1.00 19.69 ? 77   SER B O   1 
ATOM   2893 C  CB  . SER B 1 77  ? 79.927  19.134 31.569  1.00 20.60 ? 77   SER B CB  1 
ATOM   2894 O  OG  . SER B 1 77  ? 80.481  17.847 31.393  1.00 24.10 ? 77   SER B OG  1 
ATOM   2895 N  N   . GLU B 1 78  ? 83.168  19.974 31.215  1.00 19.02 ? 78   GLU B N   1 
ATOM   2896 C  CA  . GLU B 1 78  ? 84.440  20.304 31.866  1.00 18.61 ? 78   GLU B CA  1 
ATOM   2897 C  C   . GLU B 1 78  ? 84.838  21.726 31.466  1.00 19.09 ? 78   GLU B C   1 
ATOM   2898 O  O   . GLU B 1 78  ? 85.304  22.509 32.290  1.00 18.91 ? 78   GLU B O   1 
ATOM   2899 C  CB  . GLU B 1 78  ? 85.552  19.336 31.449  1.00 20.43 ? 78   GLU B CB  1 
ATOM   2900 C  CG  . GLU B 1 78  ? 86.938  19.689 32.023  1.00 21.53 ? 78   GLU B CG  1 
ATOM   2901 C  CD  . GLU B 1 78  ? 88.053  18.794 31.492  1.00 24.22 ? 78   GLU B CD  1 
ATOM   2902 O  OE1 . GLU B 1 78  ? 88.025  18.466 30.287  1.00 24.77 ? 78   GLU B OE1 1 
ATOM   2903 O  OE2 . GLU B 1 78  ? 88.965  18.429 32.269  1.00 22.84 ? 78   GLU B OE2 1 
ATOM   2904 N  N   . GLN B 1 79  ? 84.636  22.045 30.192  1.00 19.77 ? 79   GLN B N   1 
ATOM   2905 C  CA  . GLN B 1 79  ? 84.954  23.358 29.638  1.00 21.39 ? 79   GLN B CA  1 
ATOM   2906 C  C   . GLN B 1 79  ? 84.036  24.390 30.279  1.00 22.22 ? 79   GLN B C   1 
ATOM   2907 O  O   . GLN B 1 79  ? 84.460  25.492 30.632  1.00 23.81 ? 79   GLN B O   1 
ATOM   2908 C  CB  . GLN B 1 79  ? 84.732  23.331 28.121  1.00 22.08 ? 79   GLN B CB  1 
ATOM   2909 C  CG  . GLN B 1 79  ? 85.733  24.119 27.293  1.00 25.68 ? 79   GLN B CG  1 
ATOM   2910 C  CD  . GLN B 1 79  ? 85.629  23.798 25.799  1.00 27.28 ? 79   GLN B CD  1 
ATOM   2911 O  OE1 . GLN B 1 79  ? 84.638  24.127 25.147  1.00 28.17 ? 79   GLN B OE1 1 
ATOM   2912 N  NE2 . GLN B 1 79  ? 86.653  23.144 25.259  1.00 26.70 ? 79   GLN B NE2 1 
ATOM   2913 N  N   . LEU B 1 80  ? 82.769  24.016 30.425  1.00 22.86 ? 80   LEU B N   1 
ATOM   2914 C  CA  . LEU B 1 80  ? 81.752  24.876 31.020  1.00 21.31 ? 80   LEU B CA  1 
ATOM   2915 C  C   . LEU B 1 80  ? 82.038  25.201 32.482  1.00 21.10 ? 80   LEU B C   1 
ATOM   2916 O  O   . LEU B 1 80  ? 81.959  26.356 32.901  1.00 21.35 ? 80   LEU B O   1 
ATOM   2917 C  CB  . LEU B 1 80  ? 80.387  24.196 30.903  1.00 21.54 ? 80   LEU B CB  1 
ATOM   2918 C  CG  . LEU B 1 80  ? 79.233  24.750 31.734  1.00 19.42 ? 80   LEU B CG  1 
ATOM   2919 C  CD1 . LEU B 1 80  ? 79.121  26.253 31.535  1.00 21.25 ? 80   LEU B CD1 1 
ATOM   2920 C  CD2 . LEU B 1 80  ? 77.957  24.050 31.321  1.00 18.93 ? 80   LEU B CD2 1 
ATOM   2921 N  N   . ALA B 1 81  ? 82.361  24.168 33.252  1.00 21.44 ? 81   ALA B N   1 
ATOM   2922 C  CA  . ALA B 1 81  ? 82.645  24.309 34.671  1.00 21.96 ? 81   ALA B CA  1 
ATOM   2923 C  C   . ALA B 1 81  ? 83.734  25.338 34.956  1.00 23.56 ? 81   ALA B C   1 
ATOM   2924 O  O   . ALA B 1 81  ? 83.601  26.157 35.870  1.00 23.44 ? 81   ALA B O   1 
ATOM   2925 C  CB  . ALA B 1 81  ? 83.037  22.957 35.252  1.00 20.91 ? 81   ALA B CB  1 
ATOM   2926 N  N   . GLY B 1 82  ? 84.814  25.289 34.182  1.00 24.27 ? 82   GLY B N   1 
ATOM   2927 C  CA  . GLY B 1 82  ? 85.903  26.228 34.385  1.00 25.51 ? 82   GLY B CA  1 
ATOM   2928 C  C   . GLY B 1 82  ? 85.438  27.655 34.190  1.00 26.17 ? 82   GLY B C   1 
ATOM   2929 O  O   . GLY B 1 82  ? 85.851  28.562 34.908  1.00 26.82 ? 82   GLY B O   1 
ATOM   2930 N  N   . LYS B 1 83  ? 84.561  27.846 33.212  1.00 27.10 ? 83   LYS B N   1 
ATOM   2931 C  CA  . LYS B 1 83  ? 84.026  29.162 32.896  1.00 28.29 ? 83   LYS B CA  1 
ATOM   2932 C  C   . LYS B 1 83  ? 83.009  29.629 33.932  1.00 27.20 ? 83   LYS B C   1 
ATOM   2933 O  O   . LYS B 1 83  ? 82.885  30.828 34.200  1.00 26.96 ? 83   LYS B O   1 
ATOM   2934 C  CB  . LYS B 1 83  ? 83.403  29.134 31.504  1.00 30.04 ? 83   LYS B CB  1 
ATOM   2935 C  CG  . LYS B 1 83  ? 84.441  29.114 30.390  1.00 34.07 ? 83   LYS B CG  1 
ATOM   2936 C  CD  . LYS B 1 83  ? 85.550  28.085 30.620  1.00 33.25 ? 83   LYS B CD  1 
ATOM   2937 C  CE  . LYS B 1 83  ? 86.552  28.094 29.474  1.00 34.40 ? 83   LYS B CE  1 
ATOM   2938 N  NZ  . LYS B 1 83  ? 87.102  29.462 29.229  1.00 32.87 ? 83   LYS B NZ  1 
ATOM   2939 N  N   . VAL B 1 84  ? 82.280  28.679 34.507  1.00 25.69 ? 84   VAL B N   1 
ATOM   2940 C  CA  . VAL B 1 84  ? 81.303  28.995 35.537  1.00 24.33 ? 84   VAL B CA  1 
ATOM   2941 C  C   . VAL B 1 84  ? 82.043  29.346 36.833  1.00 23.56 ? 84   VAL B C   1 
ATOM   2942 O  O   . VAL B 1 84  ? 81.584  30.180 37.615  1.00 23.53 ? 84   VAL B O   1 
ATOM   2943 C  CB  . VAL B 1 84  ? 80.350  27.806 35.792  1.00 22.15 ? 84   VAL B CB  1 
ATOM   2944 C  CG1 . VAL B 1 84  ? 79.530  28.057 37.055  1.00 22.33 ? 84   VAL B CG1 1 
ATOM   2945 C  CG2 . VAL B 1 84  ? 79.429  27.623 34.599  1.00 18.82 ? 84   VAL B CG2 1 
ATOM   2946 N  N   . ALA B 1 85  ? 83.185  28.702 37.058  1.00 22.63 ? 85   ALA B N   1 
ATOM   2947 C  CA  . ALA B 1 85  ? 83.987  28.974 38.246  1.00 23.07 ? 85   ALA B CA  1 
ATOM   2948 C  C   . ALA B 1 85  ? 84.523  30.396 38.119  1.00 23.79 ? 85   ALA B C   1 
ATOM   2949 O  O   . ALA B 1 85  ? 84.473  31.184 39.067  1.00 23.73 ? 85   ALA B O   1 
ATOM   2950 C  CB  . ALA B 1 85  ? 85.145  27.984 38.341  1.00 23.06 ? 85   ALA B CB  1 
ATOM   2951 N  N   . GLU B 1 86  ? 85.031  30.715 36.934  1.00 23.69 ? 86   GLU B N   1 
ATOM   2952 C  CA  . GLU B 1 86  ? 85.567  32.037 36.666  1.00 24.15 ? 86   GLU B CA  1 
ATOM   2953 C  C   . GLU B 1 86  ? 84.506  33.112 36.883  1.00 23.88 ? 86   GLU B C   1 
ATOM   2954 O  O   . GLU B 1 86  ? 84.776  34.111 37.547  1.00 22.01 ? 86   GLU B O   1 
ATOM   2955 C  CB  . GLU B 1 86  ? 86.107  32.115 35.235  1.00 25.17 ? 86   GLU B CB  1 
ATOM   2956 C  CG  . GLU B 1 86  ? 86.463  33.524 34.771  1.00 29.33 ? 86   GLU B CG  1 
ATOM   2957 C  CD  . GLU B 1 86  ? 87.410  34.251 35.718  1.00 33.88 ? 86   GLU B CD  1 
ATOM   2958 O  OE1 . GLU B 1 86  ? 88.578  33.828 35.857  1.00 36.79 ? 86   GLU B OE1 1 
ATOM   2959 O  OE2 . GLU B 1 86  ? 86.986  35.249 36.338  1.00 35.76 ? 86   GLU B OE2 1 
ATOM   2960 N  N   . VAL B 1 87  ? 83.305  32.917 36.335  1.00 23.03 ? 87   VAL B N   1 
ATOM   2961 C  CA  . VAL B 1 87  ? 82.246  33.916 36.510  1.00 23.15 ? 87   VAL B CA  1 
ATOM   2962 C  C   . VAL B 1 87  ? 81.884  34.103 37.989  1.00 22.60 ? 87   VAL B C   1 
ATOM   2963 O  O   . VAL B 1 87  ? 81.658  35.229 38.437  1.00 23.78 ? 87   VAL B O   1 
ATOM   2964 C  CB  . VAL B 1 87  ? 80.954  33.565 35.713  1.00 21.63 ? 87   VAL B CB  1 
ATOM   2965 C  CG1 . VAL B 1 87  ? 81.269  33.422 34.250  1.00 18.40 ? 87   VAL B CG1 1 
ATOM   2966 C  CG2 . VAL B 1 87  ? 80.338  32.298 36.243  1.00 25.54 ? 87   VAL B CG2 1 
ATOM   2967 N  N   . LYS B 1 88  ? 81.829  33.009 38.745  1.00 22.50 ? 88   LYS B N   1 
ATOM   2968 C  CA  . LYS B 1 88  ? 81.509  33.091 40.169  1.00 24.62 ? 88   LYS B CA  1 
ATOM   2969 C  C   . LYS B 1 88  ? 82.682  33.731 40.907  1.00 25.78 ? 88   LYS B C   1 
ATOM   2970 O  O   . LYS B 1 88  ? 82.498  34.390 41.925  1.00 25.19 ? 88   LYS B O   1 
ATOM   2971 C  CB  . LYS B 1 88  ? 81.226  31.697 40.747  1.00 22.79 ? 88   LYS B CB  1 
ATOM   2972 C  CG  . LYS B 1 88  ? 79.848  31.108 40.410  1.00 20.84 ? 88   LYS B CG  1 
ATOM   2973 C  CD  . LYS B 1 88  ? 78.736  31.647 41.319  1.00 20.83 ? 88   LYS B CD  1 
ATOM   2974 C  CE  . LYS B 1 88  ? 78.447  33.107 41.075  1.00 18.54 ? 88   LYS B CE  1 
ATOM   2975 N  NZ  . LYS B 1 88  ? 77.235  33.590 41.773  1.00 17.75 ? 88   LYS B NZ  1 
ATOM   2976 N  N   . LYS B 1 89  ? 83.884  33.531 40.375  1.00 28.77 ? 89   LYS B N   1 
ATOM   2977 C  CA  . LYS B 1 89  ? 85.106  34.084 40.950  1.00 30.66 ? 89   LYS B CA  1 
ATOM   2978 C  C   . LYS B 1 89  ? 85.056  35.603 40.802  1.00 31.75 ? 89   LYS B C   1 
ATOM   2979 O  O   . LYS B 1 89  ? 85.767  36.339 41.491  1.00 33.74 ? 89   LYS B O   1 
ATOM   2980 C  CB  . LYS B 1 89  ? 86.317  33.524 40.198  1.00 33.02 ? 89   LYS B CB  1 
ATOM   2981 C  CG  . LYS B 1 89  ? 87.647  33.610 40.923  1.00 33.91 ? 89   LYS B CG  1 
ATOM   2982 C  CD  . LYS B 1 89  ? 88.795  33.251 39.973  1.00 36.08 ? 89   LYS B CD  1 
ATOM   2983 C  CE  . LYS B 1 89  ? 88.564  31.926 39.231  1.00 36.06 ? 89   LYS B CE  1 
ATOM   2984 N  NZ  . LYS B 1 89  ? 88.586  30.731 40.129  1.00 37.19 ? 89   LYS B NZ  1 
ATOM   2985 N  N   . ASN B 1 90  ? 84.210  36.066 39.889  1.00 31.51 ? 90   ASN B N   1 
ATOM   2986 C  CA  . ASN B 1 90  ? 84.048  37.491 39.636  1.00 31.10 ? 90   ASN B CA  1 
ATOM   2987 C  C   . ASN B 1 90  ? 82.849  38.079 40.367  1.00 30.30 ? 90   ASN B C   1 
ATOM   2988 O  O   . ASN B 1 90  ? 82.478  39.223 40.119  1.00 30.98 ? 90   ASN B O   1 
ATOM   2989 C  CB  . ASN B 1 90  ? 83.883  37.745 38.143  1.00 32.86 ? 90   ASN B CB  1 
ATOM   2990 C  CG  . ASN B 1 90  ? 85.105  37.355 37.354  1.00 33.65 ? 90   ASN B CG  1 
ATOM   2991 O  OD1 . ASN B 1 90  ? 86.213  37.800 37.651  1.00 37.02 ? 90   ASN B OD1 1 
ATOM   2992 N  ND2 . ASN B 1 90  ? 84.915  36.524 36.340  1.00 34.14 ? 90   ASN B ND2 1 
ATOM   2993 N  N   . GLY B 1 91  ? 82.245  37.293 41.253  1.00 28.52 ? 91   GLY B N   1 
ATOM   2994 C  CA  . GLY B 1 91  ? 81.095  37.762 42.008  1.00 27.50 ? 91   GLY B CA  1 
ATOM   2995 C  C   . GLY B 1 91  ? 79.836  38.035 41.204  1.00 25.13 ? 91   GLY B C   1 
ATOM   2996 O  O   . GLY B 1 91  ? 79.042  38.900 41.565  1.00 24.06 ? 91   GLY B O   1 
ATOM   2997 N  N   . ARG B 1 92  ? 79.646  37.296 40.117  1.00 25.17 ? 92   ARG B N   1 
ATOM   2998 C  CA  . ARG B 1 92  ? 78.470  37.471 39.271  1.00 24.34 ? 92   ARG B CA  1 
ATOM   2999 C  C   . ARG B 1 92  ? 77.657  36.186 39.216  1.00 22.93 ? 92   ARG B C   1 
ATOM   3000 O  O   . ARG B 1 92  ? 78.221  35.091 39.262  1.00 21.91 ? 92   ARG B O   1 
ATOM   3001 C  CB  . ARG B 1 92  ? 78.876  37.833 37.839  1.00 25.91 ? 92   ARG B CB  1 
ATOM   3002 C  CG  . ARG B 1 92  ? 79.741  39.062 37.696  1.00 28.37 ? 92   ARG B CG  1 
ATOM   3003 C  CD  . ARG B 1 92  ? 79.884  39.444 36.229  1.00 30.52 ? 92   ARG B CD  1 
ATOM   3004 N  NE  . ARG B 1 92  ? 81.151  40.119 35.963  1.00 36.10 ? 92   ARG B NE  1 
ATOM   3005 C  CZ  . ARG B 1 92  ? 81.485  41.329 36.411  1.00 39.04 ? 92   ARG B CZ  1 
ATOM   3006 N  NH1 . ARG B 1 92  ? 80.636  42.031 37.156  1.00 40.24 ? 92   ARG B NH1 1 
ATOM   3007 N  NH2 . ARG B 1 92  ? 82.686  41.829 36.128  1.00 39.33 ? 92   ARG B NH2 1 
ATOM   3008 N  N   . ILE B 1 93  ? 76.336  36.321 39.111  1.00 20.90 ? 93   ILE B N   1 
ATOM   3009 C  CA  . ILE B 1 93  ? 75.474  35.149 39.008  1.00 20.64 ? 93   ILE B CA  1 
ATOM   3010 C  C   . ILE B 1 93  ? 75.748  34.564 37.625  1.00 20.03 ? 93   ILE B C   1 
ATOM   3011 O  O   . ILE B 1 93  ? 75.678  35.276 36.617  1.00 19.84 ? 93   ILE B O   1 
ATOM   3012 C  CB  . ILE B 1 93  ? 73.961  35.500 39.076  1.00 20.36 ? 93   ILE B CB  1 
ATOM   3013 C  CG1 . ILE B 1 93  ? 73.660  36.362 40.302  1.00 20.69 ? 93   ILE B CG1 1 
ATOM   3014 C  CG2 . ILE B 1 93  ? 73.144  34.225 39.121  1.00 17.98 ? 93   ILE B CG2 1 
ATOM   3015 C  CD1 . ILE B 1 93  ? 74.155  35.786 41.598  1.00 23.69 ? 93   ILE B CD1 1 
ATOM   3016 N  N   . SER B 1 94  ? 76.073  33.279 37.579  1.00 18.52 ? 94   SER B N   1 
ATOM   3017 C  CA  . SER B 1 94  ? 76.344  32.614 36.315  1.00 17.92 ? 94   SER B CA  1 
ATOM   3018 C  C   . SER B 1 94  ? 75.041  32.290 35.581  1.00 16.48 ? 94   SER B C   1 
ATOM   3019 O  O   . SER B 1 94  ? 74.146  31.675 36.146  1.00 15.93 ? 94   SER B O   1 
ATOM   3020 C  CB  . SER B 1 94  ? 77.140  31.332 36.571  1.00 17.65 ? 94   SER B CB  1 
ATOM   3021 O  OG  . SER B 1 94  ? 76.541  30.568 37.605  1.00 16.55 ? 94   SER B OG  1 
ATOM   3022 N  N   . LEU B 1 95  ? 74.941  32.712 34.323  1.00 16.79 ? 95   LEU B N   1 
ATOM   3023 C  CA  . LEU B 1 95  ? 73.749  32.461 33.523  1.00 16.76 ? 95   LEU B CA  1 
ATOM   3024 C  C   . LEU B 1 95  ? 74.146  31.682 32.279  1.00 17.59 ? 95   LEU B C   1 
ATOM   3025 O  O   . LEU B 1 95  ? 74.702  32.241 31.333  1.00 15.34 ? 95   LEU B O   1 
ATOM   3026 C  CB  . LEU B 1 95  ? 73.085  33.775 33.106  1.00 16.52 ? 95   LEU B CB  1 
ATOM   3027 C  CG  . LEU B 1 95  ? 71.572  33.765 32.847  1.00 16.96 ? 95   LEU B CG  1 
ATOM   3028 C  CD1 . LEU B 1 95  ? 71.303  34.685 31.685  1.00 15.38 ? 95   LEU B CD1 1 
ATOM   3029 C  CD2 . LEU B 1 95  ? 71.041  32.366 32.541  1.00 16.33 ? 95   LEU B CD2 1 
ATOM   3030 N  N   . VAL B 1 96  ? 73.841  30.388 32.287  1.00 18.31 ? 96   VAL B N   1 
ATOM   3031 C  CA  . VAL B 1 96  ? 74.182  29.511 31.178  1.00 18.45 ? 96   VAL B CA  1 
ATOM   3032 C  C   . VAL B 1 96  ? 73.016  29.223 30.235  1.00 18.79 ? 96   VAL B C   1 
ATOM   3033 O  O   . VAL B 1 96  ? 72.052  28.548 30.610  1.00 17.93 ? 96   VAL B O   1 
ATOM   3034 C  CB  . VAL B 1 96  ? 74.746  28.152 31.699  1.00 18.76 ? 96   VAL B CB  1 
ATOM   3035 C  CG1 . VAL B 1 96  ? 74.990  27.181 30.534  1.00 17.63 ? 96   VAL B CG1 1 
ATOM   3036 C  CG2 . VAL B 1 96  ? 76.047  28.392 32.464  1.00 17.85 ? 96   VAL B CG2 1 
ATOM   3037 N  N   . LEU B 1 97  ? 73.113  29.750 29.016  1.00 16.78 ? 97   LEU B N   1 
ATOM   3038 C  CA  . LEU B 1 97  ? 72.102  29.510 27.993  1.00 16.55 ? 97   LEU B CA  1 
ATOM   3039 C  C   . LEU B 1 97  ? 72.643  28.260 27.327  1.00 16.72 ? 97   LEU B C   1 
ATOM   3040 O  O   . LEU B 1 97  ? 73.684  28.299 26.676  1.00 15.09 ? 97   LEU B O   1 
ATOM   3041 C  CB  . LEU B 1 97  ? 72.060  30.668 27.003  1.00 15.81 ? 97   LEU B CB  1 
ATOM   3042 C  CG  . LEU B 1 97  ? 72.053  32.044 27.681  1.00 16.58 ? 97   LEU B CG  1 
ATOM   3043 C  CD1 . LEU B 1 97  ? 71.802  33.120 26.628  1.00 12.48 ? 97   LEU B CD1 1 
ATOM   3044 C  CD2 . LEU B 1 97  ? 70.983  32.077 28.789  1.00 13.20 ? 97   LEU B CD2 1 
ATOM   3045 N  N   . GLY B 1 98  ? 71.952  27.141 27.488  1.00 16.44 ? 98   GLY B N   1 
ATOM   3046 C  CA  . GLY B 1 98  ? 72.499  25.935 26.922  1.00 17.58 ? 98   GLY B CA  1 
ATOM   3047 C  C   . GLY B 1 98  ? 71.918  25.281 25.696  1.00 19.66 ? 98   GLY B C   1 
ATOM   3048 O  O   . GLY B 1 98  ? 71.136  25.838 24.915  1.00 20.44 ? 98   GLY B O   1 
ATOM   3049 N  N   . GLY B 1 99  ? 72.406  24.067 25.520  1.00 19.16 ? 99   GLY B N   1 
ATOM   3050 C  CA  . GLY B 1 99  ? 71.958  23.206 24.466  1.00 19.81 ? 99   GLY B CA  1 
ATOM   3051 C  C   . GLY B 1 99  ? 71.235  22.207 25.330  1.00 18.59 ? 99   GLY B C   1 
ATOM   3052 O  O   . GLY B 1 99  ? 70.304  22.584 26.043  1.00 19.59 ? 99   GLY B O   1 
ATOM   3053 N  N   . ASP B 1 100 ? 71.689  20.960 25.327  1.00 18.27 ? 100  ASP B N   1 
ATOM   3054 C  CA  . ASP B 1 100 ? 71.039  19.936 26.134  1.00 17.65 ? 100  ASP B CA  1 
ATOM   3055 C  C   . ASP B 1 100 ? 71.428  20.071 27.600  1.00 17.32 ? 100  ASP B C   1 
ATOM   3056 O  O   . ASP B 1 100 ? 72.430  20.712 27.934  1.00 16.07 ? 100  ASP B O   1 
ATOM   3057 C  CB  . ASP B 1 100 ? 71.374  18.533 25.606  1.00 17.19 ? 100  ASP B CB  1 
ATOM   3058 C  CG  . ASP B 1 100 ? 72.821  18.166 25.800  1.00 12.87 ? 100  ASP B CG  1 
ATOM   3059 O  OD1 . ASP B 1 100 ? 73.206  17.871 26.940  1.00 12.38 ? 100  ASP B OD1 1 
ATOM   3060 O  OD2 . ASP B 1 100 ? 73.575  18.176 24.813  1.00 14.02 ? 100  ASP B OD2 1 
ATOM   3061 N  N   . HIS B 1 101 ? 70.622  19.454 28.461  1.00 16.59 ? 101  HIS B N   1 
ATOM   3062 C  CA  . HIS B 1 101 ? 70.802  19.500 29.911  1.00 16.19 ? 101  HIS B CA  1 
ATOM   3063 C  C   . HIS B 1 101 ? 72.005  18.743 30.467  1.00 15.45 ? 101  HIS B C   1 
ATOM   3064 O  O   . HIS B 1 101 ? 72.233  18.773 31.676  1.00 16.67 ? 101  HIS B O   1 
ATOM   3065 C  CB  . HIS B 1 101 ? 69.519  18.999 30.603  1.00 15.72 ? 101  HIS B CB  1 
ATOM   3066 C  CG  . HIS B 1 101 ? 69.193  19.716 31.878  1.00 15.28 ? 101  HIS B CG  1 
ATOM   3067 N  ND1 . HIS B 1 101 ? 68.001  19.539 32.545  1.00 15.16 ? 101  HIS B ND1 1 
ATOM   3068 C  CD2 . HIS B 1 101 ? 69.903  20.608 32.610  1.00 14.09 ? 101  HIS B CD2 1 
ATOM   3069 C  CE1 . HIS B 1 101 ? 67.990  20.288 33.632  1.00 14.16 ? 101  HIS B CE1 1 
ATOM   3070 N  NE2 . HIS B 1 101 ? 69.133  20.945 33.696  1.00 13.18 ? 101  HIS B NE2 1 
ATOM   3071 N  N   . SER B 1 102 ? 72.776  18.071 29.614  1.00 14.72 ? 102  SER B N   1 
ATOM   3072 C  CA  . SER B 1 102 ? 73.947  17.343 30.116  1.00 15.49 ? 102  SER B CA  1 
ATOM   3073 C  C   . SER B 1 102 ? 74.952  18.361 30.640  1.00 15.54 ? 102  SER B C   1 
ATOM   3074 O  O   . SER B 1 102 ? 75.752  18.071 31.528  1.00 17.83 ? 102  SER B O   1 
ATOM   3075 C  CB  . SER B 1 102 ? 74.605  16.506 29.013  1.00 15.13 ? 102  SER B CB  1 
ATOM   3076 O  OG  . SER B 1 102 ? 75.320  17.314 28.091  1.00 15.57 ? 102  SER B OG  1 
ATOM   3077 N  N   . LEU B 1 103 ? 74.892  19.561 30.080  1.00 16.53 ? 103  LEU B N   1 
ATOM   3078 C  CA  . LEU B 1 103 ? 75.777  20.655 30.448  1.00 15.75 ? 103  LEU B CA  1 
ATOM   3079 C  C   . LEU B 1 103 ? 75.642  21.016 31.920  1.00 15.77 ? 103  LEU B C   1 
ATOM   3080 O  O   . LEU B 1 103 ? 76.505  21.684 32.485  1.00 16.82 ? 103  LEU B O   1 
ATOM   3081 C  CB  . LEU B 1 103 ? 75.474  21.871 29.561  1.00 15.92 ? 103  LEU B CB  1 
ATOM   3082 C  CG  . LEU B 1 103 ? 75.762  21.679 28.065  1.00 14.02 ? 103  LEU B CG  1 
ATOM   3083 C  CD1 . LEU B 1 103 ? 74.978  22.677 27.227  1.00 13.64 ? 103  LEU B CD1 1 
ATOM   3084 C  CD2 . LEU B 1 103 ? 77.257  21.824 27.825  1.00 13.92 ? 103  LEU B CD2 1 
ATOM   3085 N  N   . ALA B 1 104 ? 74.553  20.571 32.541  1.00 16.75 ? 104  ALA B N   1 
ATOM   3086 C  CA  . ALA B 1 104 ? 74.316  20.845 33.953  1.00 15.51 ? 104  ALA B CA  1 
ATOM   3087 C  C   . ALA B 1 104 ? 75.491  20.317 34.779  1.00 14.73 ? 104  ALA B C   1 
ATOM   3088 O  O   . ALA B 1 104 ? 75.887  20.919 35.779  1.00 11.96 ? 104  ALA B O   1 
ATOM   3089 C  CB  . ALA B 1 104 ? 73.015  20.184 34.399  1.00 16.33 ? 104  ALA B CB  1 
ATOM   3090 N  N   . ILE B 1 105 ? 76.044  19.189 34.342  1.00 13.26 ? 105  ILE B N   1 
ATOM   3091 C  CA  . ILE B 1 105 ? 77.168  18.567 35.017  1.00 11.35 ? 105  ILE B CA  1 
ATOM   3092 C  C   . ILE B 1 105 ? 78.310  19.541 35.257  1.00 12.06 ? 105  ILE B C   1 
ATOM   3093 O  O   . ILE B 1 105 ? 78.838  19.614 36.364  1.00 12.92 ? 105  ILE B O   1 
ATOM   3094 C  CB  . ILE B 1 105 ? 77.707  17.379 34.212  1.00 12.02 ? 105  ILE B CB  1 
ATOM   3095 C  CG1 . ILE B 1 105 ? 76.575  16.392 33.934  1.00 10.83 ? 105  ILE B CG1 1 
ATOM   3096 C  CG2 . ILE B 1 105 ? 78.834  16.696 34.977  1.00 11.63 ? 105  ILE B CG2 1 
ATOM   3097 C  CD1 . ILE B 1 105 ? 76.991  15.201 33.110  1.00 13.25 ? 105  ILE B CD1 1 
ATOM   3098 N  N   . GLY B 1 106 ? 78.692  20.286 34.224  1.00 11.61 ? 106  GLY B N   1 
ATOM   3099 C  CA  . GLY B 1 106 ? 79.785  21.236 34.360  1.00 12.93 ? 106  GLY B CA  1 
ATOM   3100 C  C   . GLY B 1 106 ? 79.360  22.551 34.987  1.00 14.18 ? 106  GLY B C   1 
ATOM   3101 O  O   . GLY B 1 106 ? 80.164  23.260 35.589  1.00 15.57 ? 106  GLY B O   1 
ATOM   3102 N  N   . SER B 1 107 ? 78.081  22.875 34.848  1.00 15.59 ? 107  SER B N   1 
ATOM   3103 C  CA  . SER B 1 107 ? 77.533  24.108 35.391  1.00 15.33 ? 107  SER B CA  1 
ATOM   3104 C  C   . SER B 1 107 ? 77.453  24.046 36.908  1.00 15.92 ? 107  SER B C   1 
ATOM   3105 O  O   . SER B 1 107 ? 77.861  24.983 37.603  1.00 17.58 ? 107  SER B O   1 
ATOM   3106 C  CB  . SER B 1 107 ? 76.138  24.348 34.819  1.00 13.51 ? 107  SER B CB  1 
ATOM   3107 O  OG  . SER B 1 107 ? 75.651  25.624 35.199  1.00 19.07 ? 107  SER B OG  1 
ATOM   3108 N  N   . ILE B 1 108 ? 76.925  22.935 37.416  1.00 14.75 ? 108  ILE B N   1 
ATOM   3109 C  CA  . ILE B 1 108 ? 76.764  22.744 38.848  1.00 13.63 ? 108  ILE B CA  1 
ATOM   3110 C  C   . ILE B 1 108 ? 78.104  22.398 39.476  1.00 15.16 ? 108  ILE B C   1 
ATOM   3111 O  O   . ILE B 1 108 ? 78.294  22.561 40.683  1.00 17.50 ? 108  ILE B O   1 
ATOM   3112 C  CB  . ILE B 1 108 ? 75.705  21.646 39.130  1.00 14.18 ? 108  ILE B CB  1 
ATOM   3113 C  CG1 . ILE B 1 108 ? 74.381  22.033 38.453  1.00 11.86 ? 108  ILE B CG1 1 
ATOM   3114 C  CG2 . ILE B 1 108 ? 75.491  21.486 40.629  1.00 15.78 ? 108  ILE B CG2 1 
ATOM   3115 C  CD1 . ILE B 1 108 ? 73.306  20.993 38.538  1.00 13.10 ? 108  ILE B CD1 1 
ATOM   3116 N  N   . SER B 1 109 ? 79.042  21.938 38.649  1.00 15.17 ? 109  SER B N   1 
ATOM   3117 C  CA  . SER B 1 109 ? 80.384  21.607 39.117  1.00 16.72 ? 109  SER B CA  1 
ATOM   3118 C  C   . SER B 1 109 ? 81.227  22.879 39.345  1.00 16.59 ? 109  SER B C   1 
ATOM   3119 O  O   . SER B 1 109 ? 81.797  23.072 40.423  1.00 18.00 ? 109  SER B O   1 
ATOM   3120 C  CB  . SER B 1 109 ? 81.090  20.685 38.112  1.00 16.57 ? 109  SER B CB  1 
ATOM   3121 O  OG  . SER B 1 109 ? 80.610  19.358 38.213  1.00 17.12 ? 109  SER B OG  1 
ATOM   3122 N  N   . GLY B 1 110 ? 81.294  23.742 38.334  1.00 16.13 ? 110  GLY B N   1 
ATOM   3123 C  CA  . GLY B 1 110 ? 82.068  24.972 38.447  1.00 15.25 ? 110  GLY B CA  1 
ATOM   3124 C  C   . GLY B 1 110 ? 81.557  25.892 39.542  1.00 15.47 ? 110  GLY B C   1 
ATOM   3125 O  O   . GLY B 1 110 ? 82.327  26.603 40.189  1.00 13.83 ? 110  GLY B O   1 
ATOM   3126 N  N   . HIS B 1 111 ? 80.243  25.885 39.738  1.00 17.37 ? 111  HIS B N   1 
ATOM   3127 C  CA  . HIS B 1 111 ? 79.600  26.699 40.764  1.00 17.98 ? 111  HIS B CA  1 
ATOM   3128 C  C   . HIS B 1 111 ? 80.044  26.217 42.145  1.00 18.28 ? 111  HIS B C   1 
ATOM   3129 O  O   . HIS B 1 111 ? 80.455  27.015 42.983  1.00 19.07 ? 111  HIS B O   1 
ATOM   3130 C  CB  . HIS B 1 111 ? 78.077  26.579 40.634  1.00 17.93 ? 111  HIS B CB  1 
ATOM   3131 C  CG  . HIS B 1 111 ? 77.310  27.526 41.506  1.00 17.67 ? 111  HIS B CG  1 
ATOM   3132 N  ND1 . HIS B 1 111 ? 75.955  27.732 41.361  1.00 18.12 ? 111  HIS B ND1 1 
ATOM   3133 C  CD2 . HIS B 1 111 ? 77.702  28.315 42.534  1.00 18.52 ? 111  HIS B CD2 1 
ATOM   3134 C  CE1 . HIS B 1 111 ? 75.545  28.605 42.263  1.00 17.83 ? 111  HIS B CE1 1 
ATOM   3135 N  NE2 . HIS B 1 111 ? 76.585  28.974 42.988  1.00 16.49 ? 111  HIS B NE2 1 
ATOM   3136 N  N   . ALA B 1 112 ? 79.970  24.905 42.360  1.00 19.23 ? 112  ALA B N   1 
ATOM   3137 C  CA  . ALA B 1 112 ? 80.343  24.286 43.630  1.00 20.04 ? 112  ALA B CA  1 
ATOM   3138 C  C   . ALA B 1 112 ? 81.801  24.522 44.014  1.00 22.72 ? 112  ALA B C   1 
ATOM   3139 O  O   . ALA B 1 112 ? 82.134  24.541 45.199  1.00 24.34 ? 112  ALA B O   1 
ATOM   3140 C  CB  . ALA B 1 112 ? 80.057  22.801 43.582  1.00 18.59 ? 112  ALA B CB  1 
ATOM   3141 N  N   . ARG B 1 113 ? 82.673  24.689 43.022  1.00 24.03 ? 113  ARG B N   1 
ATOM   3142 C  CA  . ARG B 1 113 ? 84.083  24.946 43.299  1.00 25.63 ? 113  ARG B CA  1 
ATOM   3143 C  C   . ARG B 1 113 ? 84.191  26.196 44.148  1.00 26.26 ? 113  ARG B C   1 
ATOM   3144 O  O   . ARG B 1 113 ? 84.969  26.258 45.095  1.00 27.75 ? 113  ARG B O   1 
ATOM   3145 C  CB  . ARG B 1 113 ? 84.867  25.186 42.008  1.00 25.40 ? 113  ARG B CB  1 
ATOM   3146 C  CG  . ARG B 1 113 ? 85.036  23.975 41.136  1.00 26.11 ? 113  ARG B CG  1 
ATOM   3147 C  CD  . ARG B 1 113 ? 85.821  24.338 39.888  1.00 26.75 ? 113  ARG B CD  1 
ATOM   3148 N  NE  . ARG B 1 113 ? 85.775  23.269 38.901  1.00 28.47 ? 113  ARG B NE  1 
ATOM   3149 C  CZ  . ARG B 1 113 ? 86.241  23.374 37.660  1.00 31.47 ? 113  ARG B CZ  1 
ATOM   3150 N  NH1 . ARG B 1 113 ? 86.799  24.509 37.250  1.00 32.97 ? 113  ARG B NH1 1 
ATOM   3151 N  NH2 . ARG B 1 113 ? 86.133  22.347 36.823  1.00 31.51 ? 113  ARG B NH2 1 
ATOM   3152 N  N   . VAL B 1 114 ? 83.396  27.195 43.787  1.00 27.23 ? 114  VAL B N   1 
ATOM   3153 C  CA  . VAL B 1 114 ? 83.397  28.466 44.489  1.00 28.18 ? 114  VAL B CA  1 
ATOM   3154 C  C   . VAL B 1 114 ? 82.460  28.442 45.704  1.00 28.56 ? 114  VAL B C   1 
ATOM   3155 O  O   . VAL B 1 114 ? 82.779  28.997 46.756  1.00 28.05 ? 114  VAL B O   1 
ATOM   3156 C  CB  . VAL B 1 114 ? 82.984  29.618 43.523  1.00 27.79 ? 114  VAL B CB  1 
ATOM   3157 C  CG1 . VAL B 1 114 ? 83.364  30.968 44.119  1.00 28.16 ? 114  VAL B CG1 1 
ATOM   3158 C  CG2 . VAL B 1 114 ? 83.659  29.427 42.165  1.00 25.96 ? 114  VAL B CG2 1 
ATOM   3159 N  N   . HIS B 1 115 ? 81.308  27.795 45.564  1.00 27.91 ? 115  HIS B N   1 
ATOM   3160 C  CA  . HIS B 1 115 ? 80.349  27.727 46.663  1.00 27.26 ? 115  HIS B CA  1 
ATOM   3161 C  C   . HIS B 1 115 ? 79.921  26.286 46.894  1.00 26.10 ? 115  HIS B C   1 
ATOM   3162 O  O   . HIS B 1 115 ? 78.823  25.887 46.513  1.00 28.20 ? 115  HIS B O   1 
ATOM   3163 C  CB  . HIS B 1 115 ? 79.128  28.593 46.344  1.00 28.01 ? 115  HIS B CB  1 
ATOM   3164 C  CG  . HIS B 1 115 ? 79.475  30.001 45.967  1.00 27.88 ? 115  HIS B CG  1 
ATOM   3165 N  ND1 . HIS B 1 115 ? 80.020  30.331 44.745  1.00 30.51 ? 115  HIS B ND1 1 
ATOM   3166 C  CD2 . HIS B 1 115 ? 79.393  31.157 46.665  1.00 27.85 ? 115  HIS B CD2 1 
ATOM   3167 C  CE1 . HIS B 1 115 ? 80.260  31.630 44.707  1.00 29.57 ? 115  HIS B CE1 1 
ATOM   3168 N  NE2 . HIS B 1 115 ? 79.888  32.154 45.860  1.00 27.24 ? 115  HIS B NE2 1 
ATOM   3169 N  N   . PRO B 1 116 ? 80.783  25.490 47.540  1.00 23.66 ? 116  PRO B N   1 
ATOM   3170 C  CA  . PRO B 1 116 ? 80.505  24.080 47.822  1.00 22.32 ? 116  PRO B CA  1 
ATOM   3171 C  C   . PRO B 1 116 ? 79.304  23.808 48.730  1.00 22.24 ? 116  PRO B C   1 
ATOM   3172 O  O   . PRO B 1 116 ? 78.931  22.654 48.936  1.00 21.16 ? 116  PRO B O   1 
ATOM   3173 C  CB  . PRO B 1 116 ? 81.817  23.597 48.433  1.00 22.70 ? 116  PRO B CB  1 
ATOM   3174 C  CG  . PRO B 1 116 ? 82.290  24.804 49.171  1.00 21.05 ? 116  PRO B CG  1 
ATOM   3175 C  CD  . PRO B 1 116 ? 82.046  25.911 48.174  1.00 22.63 ? 116  PRO B CD  1 
ATOM   3176 N  N   . ASP B 1 117 ? 78.699  24.871 49.255  1.00 21.92 ? 117  ASP B N   1 
ATOM   3177 C  CA  . ASP B 1 117 ? 77.562  24.760 50.164  1.00 22.03 ? 117  ASP B CA  1 
ATOM   3178 C  C   . ASP B 1 117 ? 76.245  25.020 49.445  1.00 21.99 ? 117  ASP B C   1 
ATOM   3179 O  O   . ASP B 1 117 ? 75.196  25.180 50.078  1.00 21.32 ? 117  ASP B O   1 
ATOM   3180 C  CB  . ASP B 1 117 ? 77.723  25.774 51.298  1.00 23.19 ? 117  ASP B CB  1 
ATOM   3181 C  CG  . ASP B 1 117 ? 77.703  27.219 50.804  1.00 25.70 ? 117  ASP B CG  1 
ATOM   3182 O  OD1 . ASP B 1 117 ? 78.405  27.542 49.821  1.00 25.09 ? 117  ASP B OD1 1 
ATOM   3183 O  OD2 . ASP B 1 117 ? 76.987  28.045 51.406  1.00 28.54 ? 117  ASP B OD2 1 
ATOM   3184 N  N   . LEU B 1 118 ? 76.308  25.054 48.119  1.00 20.23 ? 118  LEU B N   1 
ATOM   3185 C  CA  . LEU B 1 118 ? 75.137  25.345 47.301  1.00 18.98 ? 118  LEU B CA  1 
ATOM   3186 C  C   . LEU B 1 118 ? 73.994  24.325 47.327  1.00 17.04 ? 118  LEU B C   1 
ATOM   3187 O  O   . LEU B 1 118 ? 74.191  23.128 47.544  1.00 15.13 ? 118  LEU B O   1 
ATOM   3188 C  CB  . LEU B 1 118 ? 75.576  25.595 45.844  1.00 20.40 ? 118  LEU B CB  1 
ATOM   3189 C  CG  . LEU B 1 118 ? 76.161  24.449 45.012  1.00 17.16 ? 118  LEU B CG  1 
ATOM   3190 C  CD1 . LEU B 1 118 ? 75.062  23.509 44.573  1.00 20.37 ? 118  LEU B CD1 1 
ATOM   3191 C  CD2 . LEU B 1 118 ? 76.840  25.021 43.790  1.00 19.31 ? 118  LEU B CD2 1 
ATOM   3192 N  N   . GLY B 1 119 ? 72.791  24.843 47.105  1.00 16.62 ? 119  GLY B N   1 
ATOM   3193 C  CA  . GLY B 1 119 ? 71.600  24.026 47.053  1.00 15.96 ? 119  GLY B CA  1 
ATOM   3194 C  C   . GLY B 1 119 ? 71.096  24.124 45.624  1.00 15.56 ? 119  GLY B C   1 
ATOM   3195 O  O   . GLY B 1 119 ? 71.261  25.151 44.964  1.00 15.13 ? 119  GLY B O   1 
ATOM   3196 N  N   . VAL B 1 120 ? 70.480  23.056 45.138  1.00 16.61 ? 120  VAL B N   1 
ATOM   3197 C  CA  . VAL B 1 120 ? 69.988  23.035 43.772  1.00 15.71 ? 120  VAL B CA  1 
ATOM   3198 C  C   . VAL B 1 120 ? 68.485  22.841 43.671  1.00 15.53 ? 120  VAL B C   1 
ATOM   3199 O  O   . VAL B 1 120 ? 67.919  21.981 44.337  1.00 14.72 ? 120  VAL B O   1 
ATOM   3200 C  CB  . VAL B 1 120 ? 70.664  21.896 42.965  1.00 16.19 ? 120  VAL B CB  1 
ATOM   3201 C  CG1 . VAL B 1 120 ? 70.160  21.897 41.525  1.00 13.72 ? 120  VAL B CG1 1 
ATOM   3202 C  CG2 . VAL B 1 120 ? 72.175  22.043 43.013  1.00 13.63 ? 120  VAL B CG2 1 
ATOM   3203 N  N   . ILE B 1 121 ? 67.845  23.661 42.843  1.00 15.56 ? 121  ILE B N   1 
ATOM   3204 C  CA  . ILE B 1 121 ? 66.413  23.534 42.587  1.00 14.29 ? 121  ILE B CA  1 
ATOM   3205 C  C   . ILE B 1 121 ? 66.372  23.112 41.123  1.00 13.47 ? 121  ILE B C   1 
ATOM   3206 O  O   . ILE B 1 121 ? 66.826  23.851 40.248  1.00 12.58 ? 121  ILE B O   1 
ATOM   3207 C  CB  . ILE B 1 121 ? 65.667  24.864 42.764  1.00 13.50 ? 121  ILE B CB  1 
ATOM   3208 C  CG1 . ILE B 1 121 ? 65.794  25.335 44.215  1.00 13.71 ? 121  ILE B CG1 1 
ATOM   3209 C  CG2 . ILE B 1 121 ? 64.195  24.684 42.370  1.00 14.98 ? 121  ILE B CG2 1 
ATOM   3210 C  CD1 . ILE B 1 121 ? 65.089  26.636 44.510  1.00 12.20 ? 121  ILE B CD1 1 
ATOM   3211 N  N   . TRP B 1 122 ? 65.844  21.919 40.864  1.00 14.28 ? 122  TRP B N   1 
ATOM   3212 C  CA  . TRP B 1 122 ? 65.792  21.366 39.509  1.00 12.81 ? 122  TRP B CA  1 
ATOM   3213 C  C   . TRP B 1 122 ? 64.373  21.331 38.930  1.00 12.11 ? 122  TRP B C   1 
ATOM   3214 O  O   . TRP B 1 122 ? 63.580  20.457 39.258  1.00 12.51 ? 122  TRP B O   1 
ATOM   3215 C  CB  . TRP B 1 122 ? 66.420  19.958 39.551  1.00 12.97 ? 122  TRP B CB  1 
ATOM   3216 C  CG  . TRP B 1 122 ? 66.745  19.298 38.233  1.00 12.77 ? 122  TRP B CG  1 
ATOM   3217 C  CD1 . TRP B 1 122 ? 65.875  18.661 37.394  1.00 12.06 ? 122  TRP B CD1 1 
ATOM   3218 C  CD2 . TRP B 1 122 ? 68.047  19.137 37.655  1.00 12.92 ? 122  TRP B CD2 1 
ATOM   3219 N  NE1 . TRP B 1 122 ? 66.553  18.106 36.340  1.00 13.15 ? 122  TRP B NE1 1 
ATOM   3220 C  CE2 . TRP B 1 122 ? 67.889  18.382 36.471  1.00 11.72 ? 122  TRP B CE2 1 
ATOM   3221 C  CE3 . TRP B 1 122 ? 69.333  19.555 38.024  1.00 13.81 ? 122  TRP B CE3 1 
ATOM   3222 C  CZ2 . TRP B 1 122 ? 68.969  18.028 35.648  1.00 11.56 ? 122  TRP B CZ2 1 
ATOM   3223 C  CZ3 . TRP B 1 122 ? 70.418  19.201 37.199  1.00 16.70 ? 122  TRP B CZ3 1 
ATOM   3224 C  CH2 . TRP B 1 122 ? 70.219  18.443 36.023  1.00 13.54 ? 122  TRP B CH2 1 
ATOM   3225 N  N   . VAL B 1 123 ? 64.065  22.299 38.069  1.00 13.62 ? 123  VAL B N   1 
ATOM   3226 C  CA  . VAL B 1 123 ? 62.757  22.399 37.420  1.00 12.93 ? 123  VAL B CA  1 
ATOM   3227 C  C   . VAL B 1 123 ? 62.835  21.574 36.130  1.00 13.81 ? 123  VAL B C   1 
ATOM   3228 O  O   . VAL B 1 123 ? 63.604  21.901 35.218  1.00 14.85 ? 123  VAL B O   1 
ATOM   3229 C  CB  . VAL B 1 123 ? 62.415  23.878 37.104  1.00 11.18 ? 123  VAL B CB  1 
ATOM   3230 C  CG1 . VAL B 1 123 ? 61.022  23.977 36.487  1.00 11.91 ? 123  VAL B CG1 1 
ATOM   3231 C  CG2 . VAL B 1 123 ? 62.481  24.703 38.382  1.00 9.99  ? 123  VAL B CG2 1 
ATOM   3232 N  N   . ASP B 1 124 ? 62.030  20.515 36.051  1.00 13.77 ? 124  ASP B N   1 
ATOM   3233 C  CA  . ASP B 1 124 ? 62.085  19.614 34.904  1.00 12.54 ? 124  ASP B CA  1 
ATOM   3234 C  C   . ASP B 1 124 ? 60.914  18.621 34.935  1.00 10.89 ? 124  ASP B C   1 
ATOM   3235 O  O   . ASP B 1 124 ? 60.333  18.368 35.988  1.00 12.38 ? 124  ASP B O   1 
ATOM   3236 C  CB  . ASP B 1 124 ? 63.400  18.832 35.007  1.00 13.98 ? 124  ASP B CB  1 
ATOM   3237 C  CG  . ASP B 1 124 ? 63.896  18.307 33.682  1.00 13.51 ? 124  ASP B CG  1 
ATOM   3238 O  OD1 . ASP B 1 124 ? 63.094  17.800 32.873  1.00 12.85 ? 124  ASP B OD1 1 
ATOM   3239 O  OD2 . ASP B 1 124 ? 65.117  18.384 33.471  1.00 10.62 ? 124  ASP B OD2 1 
ATOM   3240 N  N   . ALA B 1 125 ? 60.583  18.038 33.788  1.00 8.66  ? 125  ALA B N   1 
ATOM   3241 C  CA  . ALA B 1 125 ? 59.508  17.052 33.733  1.00 8.42  ? 125  ALA B CA  1 
ATOM   3242 C  C   . ALA B 1 125 ? 60.165  15.706 33.998  1.00 7.19  ? 125  ALA B C   1 
ATOM   3243 O  O   . ALA B 1 125 ? 59.492  14.702 34.243  1.00 7.34  ? 125  ALA B O   1 
ATOM   3244 C  CB  . ALA B 1 125 ? 58.834  17.055 32.352  1.00 7.64  ? 125  ALA B CB  1 
ATOM   3245 N  N   . HIS B 1 126 ? 61.497  15.723 33.974  1.00 8.81  ? 126  HIS B N   1 
ATOM   3246 C  CA  . HIS B 1 126 ? 62.318  14.535 34.191  1.00 8.89  ? 126  HIS B CA  1 
ATOM   3247 C  C   . HIS B 1 126 ? 63.295  14.752 35.352  1.00 11.46 ? 126  HIS B C   1 
ATOM   3248 O  O   . HIS B 1 126 ? 63.614  15.888 35.717  1.00 9.25  ? 126  HIS B O   1 
ATOM   3249 C  CB  . HIS B 1 126 ? 63.097  14.202 32.912  1.00 9.50  ? 126  HIS B CB  1 
ATOM   3250 C  CG  . HIS B 1 126 ? 62.249  14.179 31.678  1.00 6.33  ? 126  HIS B CG  1 
ATOM   3251 N  ND1 . HIS B 1 126 ? 62.236  15.209 30.762  1.00 6.07  ? 126  HIS B ND1 1 
ATOM   3252 C  CD2 . HIS B 1 126 ? 61.344  13.274 31.237  1.00 5.86  ? 126  HIS B CD2 1 
ATOM   3253 C  CE1 . HIS B 1 126 ? 61.355  14.942 29.814  1.00 4.43  ? 126  HIS B CE1 1 
ATOM   3254 N  NE2 . HIS B 1 126 ? 60.800  13.773 30.080  1.00 4.50  ? 126  HIS B NE2 1 
ATOM   3255 N  N   . THR B 1 127 ? 63.761  13.655 35.941  1.00 12.76 ? 127  THR B N   1 
ATOM   3256 C  CA  . THR B 1 127 ? 64.692  13.744 37.060  1.00 12.66 ? 127  THR B CA  1 
ATOM   3257 C  C   . THR B 1 127 ? 66.144  13.694 36.600  1.00 12.48 ? 127  THR B C   1 
ATOM   3258 O  O   . THR B 1 127 ? 67.054  14.000 37.374  1.00 14.03 ? 127  THR B O   1 
ATOM   3259 C  CB  . THR B 1 127 ? 64.427  12.622 38.100  1.00 11.98 ? 127  THR B CB  1 
ATOM   3260 O  OG1 . THR B 1 127 ? 64.120  11.393 37.431  1.00 13.38 ? 127  THR B OG1 1 
ATOM   3261 C  CG2 . THR B 1 127 ? 63.261  12.987 38.972  1.00 9.62  ? 127  THR B CG2 1 
ATOM   3262 N  N   . ASP B 1 128 ? 66.355  13.329 35.335  1.00 12.36 ? 128  ASP B N   1 
ATOM   3263 C  CA  . ASP B 1 128 ? 67.702  13.242 34.764  1.00 11.70 ? 128  ASP B CA  1 
ATOM   3264 C  C   . ASP B 1 128 ? 68.714  12.636 35.721  1.00 9.59  ? 128  ASP B C   1 
ATOM   3265 O  O   . ASP B 1 128 ? 69.842  13.112 35.827  1.00 10.96 ? 128  ASP B O   1 
ATOM   3266 C  CB  . ASP B 1 128 ? 68.204  14.627 34.364  1.00 11.94 ? 128  ASP B CB  1 
ATOM   3267 C  CG  . ASP B 1 128 ? 67.332  15.286 33.334  1.00 10.92 ? 128  ASP B CG  1 
ATOM   3268 O  OD1 . ASP B 1 128 ? 66.522  14.578 32.688  1.00 10.42 ? 128  ASP B OD1 1 
ATOM   3269 O  OD2 . ASP B 1 128 ? 67.480  16.515 33.168  1.00 12.15 ? 128  ASP B OD2 1 
ATOM   3270 N  N   . ILE B 1 129 ? 68.325  11.585 36.414  1.00 9.52  ? 129  ILE B N   1 
ATOM   3271 C  CA  . ILE B 1 129 ? 69.226  10.974 37.375  1.00 11.39 ? 129  ILE B CA  1 
ATOM   3272 C  C   . ILE B 1 129 ? 69.612  9.552  36.977  1.00 12.95 ? 129  ILE B C   1 
ATOM   3273 O  O   . ILE B 1 129 ? 70.055  8.760  37.808  1.00 13.70 ? 129  ILE B O   1 
ATOM   3274 C  CB  . ILE B 1 129 ? 68.596  10.992 38.792  1.00 10.25 ? 129  ILE B CB  1 
ATOM   3275 C  CG1 . ILE B 1 129 ? 69.662  10.648 39.834  1.00 11.29 ? 129  ILE B CG1 1 
ATOM   3276 C  CG2 . ILE B 1 129 ? 67.389  10.045 38.848  1.00 6.88  ? 129  ILE B CG2 1 
ATOM   3277 C  CD1 . ILE B 1 129 ? 69.187  10.787 41.276  1.00 14.93 ? 129  ILE B CD1 1 
ATOM   3278 N  N   . ASN B 1 130 ? 69.438  9.230  35.698  1.00 13.66 ? 130  ASN B N   1 
ATOM   3279 C  CA  . ASN B 1 130 ? 69.814  7.911  35.196  1.00 15.24 ? 130  ASN B CA  1 
ATOM   3280 C  C   . ASN B 1 130 ? 71.339  7.782  35.234  1.00 15.62 ? 130  ASN B C   1 
ATOM   3281 O  O   . ASN B 1 130 ? 72.063  8.762  35.086  1.00 15.89 ? 130  ASN B O   1 
ATOM   3282 C  CB  . ASN B 1 130 ? 69.332  7.707  33.750  1.00 13.13 ? 130  ASN B CB  1 
ATOM   3283 C  CG  . ASN B 1 130 ? 68.012  6.972  33.670  1.00 13.37 ? 130  ASN B CG  1 
ATOM   3284 O  OD1 . ASN B 1 130 ? 67.824  5.947  34.311  1.00 14.09 ? 130  ASN B OD1 1 
ATOM   3285 N  ND2 . ASN B 1 130 ? 67.095  7.486  32.863  1.00 12.00 ? 130  ASN B ND2 1 
ATOM   3286 N  N   . THR B 1 131 ? 71.818  6.562  35.433  1.00 18.11 ? 131  THR B N   1 
ATOM   3287 C  CA  . THR B 1 131 ? 73.248  6.300  35.477  1.00 20.06 ? 131  THR B CA  1 
ATOM   3288 C  C   . THR B 1 131 ? 73.614  5.654  34.151  1.00 20.06 ? 131  THR B C   1 
ATOM   3289 O  O   . THR B 1 131 ? 72.731  5.230  33.396  1.00 22.18 ? 131  THR B O   1 
ATOM   3290 C  CB  . THR B 1 131 ? 73.610  5.314  36.612  1.00 20.74 ? 131  THR B CB  1 
ATOM   3291 O  OG1 . THR B 1 131 ? 73.056  4.026  36.314  1.00 20.55 ? 131  THR B OG1 1 
ATOM   3292 C  CG2 . THR B 1 131 ? 73.058  5.806  37.958  1.00 20.02 ? 131  THR B CG2 1 
ATOM   3293 N  N   . PRO B 1 132 ? 74.917  5.578  33.839  1.00 19.39 ? 132  PRO B N   1 
ATOM   3294 C  CA  . PRO B 1 132 ? 75.325  4.962  32.577  1.00 18.41 ? 132  PRO B CA  1 
ATOM   3295 C  C   . PRO B 1 132 ? 74.853  3.517  32.526  1.00 18.37 ? 132  PRO B C   1 
ATOM   3296 O  O   . PRO B 1 132 ? 74.706  2.926  31.453  1.00 18.01 ? 132  PRO B O   1 
ATOM   3297 C  CB  . PRO B 1 132 ? 76.842  5.072  32.624  1.00 18.38 ? 132  PRO B CB  1 
ATOM   3298 C  CG  . PRO B 1 132 ? 77.048  6.356  33.365  1.00 20.00 ? 132  PRO B CG  1 
ATOM   3299 C  CD  . PRO B 1 132 ? 76.068  6.224  34.500  1.00 18.88 ? 132  PRO B CD  1 
ATOM   3300 N  N   . LEU B 1 133 ? 74.599  2.960  33.704  1.00 17.63 ? 133  LEU B N   1 
ATOM   3301 C  CA  . LEU B 1 133 ? 74.169  1.578  33.813  1.00 18.80 ? 133  LEU B CA  1 
ATOM   3302 C  C   . LEU B 1 133 ? 72.652  1.407  33.903  1.00 19.11 ? 133  LEU B C   1 
ATOM   3303 O  O   . LEU B 1 133 ? 72.142  0.308  33.703  1.00 18.99 ? 133  LEU B O   1 
ATOM   3304 C  CB  . LEU B 1 133 ? 74.885  0.915  35.003  1.00 19.92 ? 133  LEU B CB  1 
ATOM   3305 C  CG  . LEU B 1 133 ? 76.417  1.014  34.896  1.00 18.75 ? 133  LEU B CG  1 
ATOM   3306 C  CD1 . LEU B 1 133 ? 77.098  0.523  36.158  1.00 16.25 ? 133  LEU B CD1 1 
ATOM   3307 C  CD2 . LEU B 1 133 ? 76.882  0.206  33.696  1.00 19.54 ? 133  LEU B CD2 1 
ATOM   3308 N  N   . THR B 1 134 ? 71.925  2.485  34.186  1.00 19.10 ? 134  THR B N   1 
ATOM   3309 C  CA  . THR B 1 134 ? 70.473  2.387  34.255  1.00 18.29 ? 134  THR B CA  1 
ATOM   3310 C  C   . THR B 1 134 ? 69.836  3.016  33.025  1.00 18.83 ? 134  THR B C   1 
ATOM   3311 O  O   . THR B 1 134 ? 68.698  2.720  32.696  1.00 18.21 ? 134  THR B O   1 
ATOM   3312 C  CB  . THR B 1 134 ? 69.882  3.094  35.507  1.00 18.47 ? 134  THR B CB  1 
ATOM   3313 O  OG1 . THR B 1 134 ? 70.177  4.495  35.461  1.00 16.53 ? 134  THR B OG1 1 
ATOM   3314 C  CG2 . THR B 1 134 ? 70.446  2.496  36.777  1.00 17.23 ? 134  THR B CG2 1 
ATOM   3315 N  N   . THR B 1 135 ? 70.572  3.891  32.350  1.00 21.32 ? 135  THR B N   1 
ATOM   3316 C  CA  . THR B 1 135 ? 70.050  4.560  31.160  1.00 22.41 ? 135  THR B CA  1 
ATOM   3317 C  C   . THR B 1 135 ? 69.804  3.576  30.018  1.00 23.69 ? 135  THR B C   1 
ATOM   3318 O  O   . THR B 1 135 ? 70.697  2.813  29.652  1.00 24.50 ? 135  THR B O   1 
ATOM   3319 C  CB  . THR B 1 135 ? 71.032  5.662  30.660  1.00 23.07 ? 135  THR B CB  1 
ATOM   3320 O  OG1 . THR B 1 135 ? 70.483  6.310  29.506  1.00 20.18 ? 135  THR B OG1 1 
ATOM   3321 C  CG2 . THR B 1 135 ? 72.391  5.058  30.293  1.00 22.16 ? 135  THR B CG2 1 
ATOM   3322 N  N   . THR B 1 136 ? 68.595  3.582  29.461  1.00 23.50 ? 136  THR B N   1 
ATOM   3323 C  CA  . THR B 1 136 ? 68.297  2.692  28.338  1.00 24.49 ? 136  THR B CA  1 
ATOM   3324 C  C   . THR B 1 136 ? 68.376  3.475  27.022  1.00 23.48 ? 136  THR B C   1 
ATOM   3325 O  O   . THR B 1 136 ? 68.382  2.886  25.940  1.00 23.93 ? 136  THR B O   1 
ATOM   3326 C  CB  . THR B 1 136 ? 66.897  2.041  28.456  1.00 25.03 ? 136  THR B CB  1 
ATOM   3327 O  OG1 . THR B 1 136 ? 65.891  3.060  28.446  1.00 27.30 ? 136  THR B OG1 1 
ATOM   3328 C  CG2 . THR B 1 136 ? 66.785  1.238  29.747  1.00 25.04 ? 136  THR B CG2 1 
ATOM   3329 N  N   . SER B 1 137 ? 68.449  4.801  27.118  1.00 21.90 ? 137  SER B N   1 
ATOM   3330 C  CA  . SER B 1 137 ? 68.542  5.639  25.927  1.00 21.32 ? 137  SER B CA  1 
ATOM   3331 C  C   . SER B 1 137 ? 70.005  5.962  25.567  1.00 22.04 ? 137  SER B C   1 
ATOM   3332 O  O   . SER B 1 137 ? 70.349  6.117  24.394  1.00 20.62 ? 137  SER B O   1 
ATOM   3333 C  CB  . SER B 1 137 ? 67.747  6.943  26.117  1.00 19.75 ? 137  SER B CB  1 
ATOM   3334 O  OG  . SER B 1 137 ? 68.338  7.804  27.079  1.00 17.44 ? 137  SER B OG  1 
ATOM   3335 N  N   . GLY B 1 138 ? 70.864  6.051  26.579  1.00 21.58 ? 138  GLY B N   1 
ATOM   3336 C  CA  . GLY B 1 138 ? 72.259  6.370  26.325  1.00 20.09 ? 138  GLY B CA  1 
ATOM   3337 C  C   . GLY B 1 138 ? 72.469  7.869  26.203  1.00 19.16 ? 138  GLY B C   1 
ATOM   3338 O  O   . GLY B 1 138 ? 73.606  8.340  26.222  1.00 17.64 ? 138  GLY B O   1 
ATOM   3339 N  N   . ASN B 1 139 ? 71.369  8.616  26.075  1.00 18.86 ? 139  ASN B N   1 
ATOM   3340 C  CA  . ASN B 1 139 ? 71.428  10.076 25.948  1.00 16.83 ? 139  ASN B CA  1 
ATOM   3341 C  C   . ASN B 1 139 ? 71.788  10.683 27.288  1.00 15.02 ? 139  ASN B C   1 
ATOM   3342 O  O   . ASN B 1 139 ? 71.039  10.564 28.252  1.00 13.78 ? 139  ASN B O   1 
ATOM   3343 C  CB  . ASN B 1 139 ? 70.083  10.643 25.478  1.00 18.80 ? 139  ASN B CB  1 
ATOM   3344 C  CG  . ASN B 1 139 ? 69.577  9.980  24.205  1.00 19.23 ? 139  ASN B CG  1 
ATOM   3345 O  OD1 . ASN B 1 139 ? 70.327  9.773  23.247  1.00 18.06 ? 139  ASN B OD1 1 
ATOM   3346 N  ND2 . ASN B 1 139 ? 68.298  9.648  24.191  1.00 19.53 ? 139  ASN B ND2 1 
ATOM   3347 N  N   . LEU B 1 140 ? 72.943  11.337 27.336  1.00 13.47 ? 140  LEU B N   1 
ATOM   3348 C  CA  . LEU B 1 140 ? 73.439  11.944 28.563  1.00 12.73 ? 140  LEU B CA  1 
ATOM   3349 C  C   . LEU B 1 140 ? 72.663  13.132 29.154  1.00 12.40 ? 140  LEU B C   1 
ATOM   3350 O  O   . LEU B 1 140 ? 72.931  13.529 30.287  1.00 13.86 ? 140  LEU B O   1 
ATOM   3351 C  CB  . LEU B 1 140 ? 74.911  12.330 28.384  1.00 13.19 ? 140  LEU B CB  1 
ATOM   3352 C  CG  . LEU B 1 140 ? 75.935  11.191 28.300  1.00 14.09 ? 140  LEU B CG  1 
ATOM   3353 C  CD1 . LEU B 1 140 ? 77.294  11.764 27.928  1.00 11.65 ? 140  LEU B CD1 1 
ATOM   3354 C  CD2 . LEU B 1 140 ? 76.010  10.448 29.640  1.00 14.66 ? 140  LEU B CD2 1 
ATOM   3355 N  N   . HIS B 1 141 ? 71.721  13.719 28.422  1.00 12.00 ? 141  HIS B N   1 
ATOM   3356 C  CA  . HIS B 1 141 ? 70.981  14.834 29.010  1.00 10.77 ? 141  HIS B CA  1 
ATOM   3357 C  C   . HIS B 1 141 ? 69.993  14.298 30.046  1.00 10.99 ? 141  HIS B C   1 
ATOM   3358 O  O   . HIS B 1 141 ? 69.377  15.057 30.769  1.00 10.89 ? 141  HIS B O   1 
ATOM   3359 C  CB  . HIS B 1 141 ? 70.256  15.670 27.939  1.00 9.75  ? 141  HIS B CB  1 
ATOM   3360 C  CG  . HIS B 1 141 ? 69.117  14.969 27.259  1.00 11.37 ? 141  HIS B CG  1 
ATOM   3361 N  ND1 . HIS B 1 141 ? 68.148  15.651 26.550  1.00 9.82  ? 141  HIS B ND1 1 
ATOM   3362 C  CD2 . HIS B 1 141 ? 68.798  13.656 27.161  1.00 11.14 ? 141  HIS B CD2 1 
ATOM   3363 C  CE1 . HIS B 1 141 ? 67.283  14.789 26.046  1.00 8.29  ? 141  HIS B CE1 1 
ATOM   3364 N  NE2 . HIS B 1 141 ? 67.654  13.573 26.402  1.00 10.74 ? 141  HIS B NE2 1 
ATOM   3365 N  N   . GLY B 1 142 ? 69.872  12.973 30.113  1.00 12.22 ? 142  GLY B N   1 
ATOM   3366 C  CA  . GLY B 1 142 ? 68.989  12.335 31.070  1.00 11.40 ? 142  GLY B CA  1 
ATOM   3367 C  C   . GLY B 1 142 ? 69.782  11.627 32.163  1.00 12.69 ? 142  GLY B C   1 
ATOM   3368 O  O   . GLY B 1 142 ? 69.275  10.716 32.809  1.00 13.68 ? 142  GLY B O   1 
ATOM   3369 N  N   . GLN B 1 143 ? 71.025  12.058 32.374  1.00 12.78 ? 143  GLN B N   1 
ATOM   3370 C  CA  . GLN B 1 143 ? 71.911  11.478 33.393  1.00 13.78 ? 143  GLN B CA  1 
ATOM   3371 C  C   . GLN B 1 143 ? 72.750  12.456 34.251  1.00 14.16 ? 143  GLN B C   1 
ATOM   3372 O  O   . GLN B 1 143 ? 73.356  12.022 35.232  1.00 14.11 ? 143  GLN B O   1 
ATOM   3373 C  CB  . GLN B 1 143 ? 72.903  10.508 32.740  1.00 14.14 ? 143  GLN B CB  1 
ATOM   3374 C  CG  . GLN B 1 143 ? 72.289  9.367  31.966  1.00 15.64 ? 143  GLN B CG  1 
ATOM   3375 C  CD  . GLN B 1 143 ? 73.334  8.559  31.221  1.00 15.47 ? 143  GLN B CD  1 
ATOM   3376 O  OE1 . GLN B 1 143 ? 74.384  8.221  31.773  1.00 18.05 ? 143  GLN B OE1 1 
ATOM   3377 N  NE2 . GLN B 1 143 ? 73.048  8.236  29.963  1.00 16.51 ? 143  GLN B NE2 1 
ATOM   3378 N  N   . PRO B 1 144 ? 72.798  13.768 33.906  1.00 12.54 ? 144  PRO B N   1 
ATOM   3379 C  CA  . PRO B 1 144 ? 73.610  14.693 34.708  1.00 12.81 ? 144  PRO B CA  1 
ATOM   3380 C  C   . PRO B 1 144 ? 73.568  14.599 36.229  1.00 13.51 ? 144  PRO B C   1 
ATOM   3381 O  O   . PRO B 1 144 ? 74.612  14.725 36.881  1.00 13.80 ? 144  PRO B O   1 
ATOM   3382 C  CB  . PRO B 1 144 ? 73.173  16.076 34.208  1.00 10.85 ? 144  PRO B CB  1 
ATOM   3383 C  CG  . PRO B 1 144 ? 71.794  15.856 33.710  1.00 10.78 ? 144  PRO B CG  1 
ATOM   3384 C  CD  . PRO B 1 144 ? 71.950  14.535 32.977  1.00 12.51 ? 144  PRO B CD  1 
ATOM   3385 N  N   . VAL B 1 145 ? 72.384  14.370 36.790  1.00 13.58 ? 145  VAL B N   1 
ATOM   3386 C  CA  . VAL B 1 145 ? 72.234  14.315 38.236  1.00 15.76 ? 145  VAL B CA  1 
ATOM   3387 C  C   . VAL B 1 145 ? 72.985  13.183 38.921  1.00 16.10 ? 145  VAL B C   1 
ATOM   3388 O  O   . VAL B 1 145 ? 73.418  13.344 40.063  1.00 15.84 ? 145  VAL B O   1 
ATOM   3389 C  CB  . VAL B 1 145 ? 70.742  14.244 38.643  1.00 16.37 ? 145  VAL B CB  1 
ATOM   3390 C  CG1 . VAL B 1 145 ? 70.621  14.297 40.162  1.00 15.89 ? 145  VAL B CG1 1 
ATOM   3391 C  CG2 . VAL B 1 145 ? 69.972  15.399 37.996  1.00 13.68 ? 145  VAL B CG2 1 
ATOM   3392 N  N   . SER B 1 146 ? 73.139  12.053 38.228  1.00 15.98 ? 146  SER B N   1 
ATOM   3393 C  CA  . SER B 1 146 ? 73.840  10.885 38.774  1.00 16.56 ? 146  SER B CA  1 
ATOM   3394 C  C   . SER B 1 146 ? 75.346  11.095 38.896  1.00 16.74 ? 146  SER B C   1 
ATOM   3395 O  O   . SER B 1 146 ? 75.985  10.495 39.761  1.00 18.54 ? 146  SER B O   1 
ATOM   3396 C  CB  . SER B 1 146 ? 73.574  9.631  37.922  1.00 15.32 ? 146  SER B CB  1 
ATOM   3397 O  OG  . SER B 1 146 ? 74.142  9.735  36.626  1.00 15.68 ? 146  SER B OG  1 
ATOM   3398 N  N   . PHE B 1 147 ? 75.909  11.942 38.036  1.00 17.14 ? 147  PHE B N   1 
ATOM   3399 C  CA  . PHE B 1 147 ? 77.346  12.231 38.069  1.00 17.56 ? 147  PHE B CA  1 
ATOM   3400 C  C   . PHE B 1 147 ? 77.713  13.227 39.173  1.00 17.17 ? 147  PHE B C   1 
ATOM   3401 O  O   . PHE B 1 147 ? 78.879  13.332 39.564  1.00 15.84 ? 147  PHE B O   1 
ATOM   3402 C  CB  . PHE B 1 147 ? 77.815  12.800 36.719  1.00 18.29 ? 147  PHE B CB  1 
ATOM   3403 C  CG  . PHE B 1 147 ? 77.910  11.775 35.616  1.00 20.87 ? 147  PHE B CG  1 
ATOM   3404 C  CD1 . PHE B 1 147 ? 76.765  11.300 34.977  1.00 19.76 ? 147  PHE B CD1 1 
ATOM   3405 C  CD2 . PHE B 1 147 ? 79.150  11.277 35.218  1.00 20.18 ? 147  PHE B CD2 1 
ATOM   3406 C  CE1 . PHE B 1 147 ? 76.854  10.347 33.955  1.00 20.21 ? 147  PHE B CE1 1 
ATOM   3407 C  CE2 . PHE B 1 147 ? 79.245  10.326 34.201  1.00 19.24 ? 147  PHE B CE2 1 
ATOM   3408 C  CZ  . PHE B 1 147 ? 78.093  9.862  33.569  1.00 20.02 ? 147  PHE B CZ  1 
ATOM   3409 N  N   . LEU B 1 148 ? 76.706  13.948 39.670  1.00 16.45 ? 148  LEU B N   1 
ATOM   3410 C  CA  . LEU B 1 148 ? 76.894  14.974 40.691  1.00 17.61 ? 148  LEU B CA  1 
ATOM   3411 C  C   . LEU B 1 148 ? 76.618  14.549 42.131  1.00 18.47 ? 148  LEU B C   1 
ATOM   3412 O  O   . LEU B 1 148 ? 77.080  15.198 43.071  1.00 17.94 ? 148  LEU B O   1 
ATOM   3413 C  CB  . LEU B 1 148 ? 76.013  16.182 40.362  1.00 17.79 ? 148  LEU B CB  1 
ATOM   3414 C  CG  . LEU B 1 148 ? 76.231  16.915 39.034  1.00 16.49 ? 148  LEU B CG  1 
ATOM   3415 C  CD1 . LEU B 1 148 ? 75.035  17.821 38.751  1.00 16.98 ? 148  LEU B CD1 1 
ATOM   3416 C  CD2 . LEU B 1 148 ? 77.506  17.722 39.096  1.00 13.92 ? 148  LEU B CD2 1 
ATOM   3417 N  N   . LEU B 1 149 ? 75.865  13.468 42.308  1.00 19.07 ? 149  LEU B N   1 
ATOM   3418 C  CA  . LEU B 1 149 ? 75.527  13.000 43.651  1.00 19.55 ? 149  LEU B CA  1 
ATOM   3419 C  C   . LEU B 1 149 ? 76.566  12.097 44.285  1.00 18.17 ? 149  LEU B C   1 
ATOM   3420 O  O   . LEU B 1 149 ? 76.910  11.050 43.743  1.00 17.53 ? 149  LEU B O   1 
ATOM   3421 C  CB  . LEU B 1 149 ? 74.183  12.259 43.654  1.00 18.41 ? 149  LEU B CB  1 
ATOM   3422 C  CG  . LEU B 1 149 ? 72.891  13.021 43.388  1.00 18.37 ? 149  LEU B CG  1 
ATOM   3423 C  CD1 . LEU B 1 149 ? 71.741  12.055 43.592  1.00 17.66 ? 149  LEU B CD1 1 
ATOM   3424 C  CD2 . LEU B 1 149 ? 72.760  14.214 44.323  1.00 18.58 ? 149  LEU B CD2 1 
ATOM   3425 N  N   . LYS B 1 150 ? 77.027  12.511 45.460  1.00 19.49 ? 150  LYS B N   1 
ATOM   3426 C  CA  . LYS B 1 150 ? 78.013  11.776 46.238  1.00 20.14 ? 150  LYS B CA  1 
ATOM   3427 C  C   . LYS B 1 150 ? 77.520  10.373 46.590  1.00 20.72 ? 150  LYS B C   1 
ATOM   3428 O  O   . LYS B 1 150 ? 78.296  9.422  46.612  1.00 21.32 ? 150  LYS B O   1 
ATOM   3429 C  CB  . LYS B 1 150 ? 78.313  12.544 47.531  1.00 20.58 ? 150  LYS B CB  1 
ATOM   3430 C  CG  . LYS B 1 150 ? 78.889  13.935 47.306  1.00 22.18 ? 150  LYS B CG  1 
ATOM   3431 C  CD  . LYS B 1 150 ? 78.969  14.731 48.588  1.00 22.08 ? 150  LYS B CD  1 
ATOM   3432 C  CE  . LYS B 1 150 ? 79.704  16.037 48.357  1.00 23.77 ? 150  LYS B CE  1 
ATOM   3433 N  NZ  . LYS B 1 150 ? 79.709  16.900 49.565  1.00 26.65 ? 150  LYS B NZ  1 
ATOM   3434 N  N   . GLU B 1 151 ? 76.226  10.255 46.868  1.00 20.35 ? 151  GLU B N   1 
ATOM   3435 C  CA  . GLU B 1 151 ? 75.639  8.980  47.249  1.00 21.60 ? 151  GLU B CA  1 
ATOM   3436 C  C   . GLU B 1 151 ? 75.672  7.941  46.145  1.00 23.26 ? 151  GLU B C   1 
ATOM   3437 O  O   . GLU B 1 151 ? 75.658  6.742  46.427  1.00 24.78 ? 151  GLU B O   1 
ATOM   3438 C  CB  . GLU B 1 151 ? 74.191  9.170  47.709  1.00 20.79 ? 151  GLU B CB  1 
ATOM   3439 C  CG  . GLU B 1 151 ? 74.032  10.082 48.910  1.00 21.85 ? 151  GLU B CG  1 
ATOM   3440 C  CD  . GLU B 1 151 ? 73.535  11.469 48.537  1.00 22.27 ? 151  GLU B CD  1 
ATOM   3441 O  OE1 . GLU B 1 151 ? 74.081  12.079 47.592  1.00 21.13 ? 151  GLU B OE1 1 
ATOM   3442 O  OE2 . GLU B 1 151 ? 72.595  11.952 49.200  1.00 24.28 ? 151  GLU B OE2 1 
ATOM   3443 N  N   . LEU B 1 152 ? 75.709  8.398  44.895  1.00 24.30 ? 152  LEU B N   1 
ATOM   3444 C  CA  . LEU B 1 152 ? 75.727  7.499  43.746  1.00 25.73 ? 152  LEU B CA  1 
ATOM   3445 C  C   . LEU B 1 152 ? 77.155  7.208  43.302  1.00 28.59 ? 152  LEU B C   1 
ATOM   3446 O  O   . LEU B 1 152 ? 77.389  6.510  42.314  1.00 27.23 ? 152  LEU B O   1 
ATOM   3447 C  CB  . LEU B 1 152 ? 74.904  8.103  42.601  1.00 24.91 ? 152  LEU B CB  1 
ATOM   3448 C  CG  . LEU B 1 152 ? 73.500  7.532  42.311  1.00 24.38 ? 152  LEU B CG  1 
ATOM   3449 C  CD1 . LEU B 1 152 ? 72.892  6.849  43.533  1.00 20.96 ? 152  LEU B CD1 1 
ATOM   3450 C  CD2 . LEU B 1 152 ? 72.606  8.666  41.822  1.00 23.28 ? 152  LEU B CD2 1 
ATOM   3451 N  N   . LYS B 1 153 ? 78.108  7.750  44.054  1.00 32.00 ? 153  LYS B N   1 
ATOM   3452 C  CA  . LYS B 1 153 ? 79.527  7.546  43.783  1.00 34.93 ? 153  LYS B CA  1 
ATOM   3453 C  C   . LYS B 1 153 ? 79.774  6.074  44.092  1.00 35.93 ? 153  LYS B C   1 
ATOM   3454 O  O   . LYS B 1 153 ? 79.467  5.607  45.191  1.00 36.80 ? 153  LYS B O   1 
ATOM   3455 C  CB  . LYS B 1 153 ? 80.367  8.434  44.710  1.00 36.81 ? 153  LYS B CB  1 
ATOM   3456 C  CG  . LYS B 1 153 ? 81.876  8.357  44.506  1.00 38.82 ? 153  LYS B CG  1 
ATOM   3457 C  CD  . LYS B 1 153 ? 82.600  9.142  45.596  1.00 39.93 ? 153  LYS B CD  1 
ATOM   3458 C  CE  . LYS B 1 153 ? 84.113  9.117  45.414  1.00 41.37 ? 153  LYS B CE  1 
ATOM   3459 N  NZ  . LYS B 1 153 ? 84.823  9.887  46.478  1.00 39.70 ? 153  LYS B NZ  1 
ATOM   3460 N  N   . GLY B 1 154 ? 80.313  5.344  43.121  1.00 36.39 ? 154  GLY B N   1 
ATOM   3461 C  CA  . GLY B 1 154 ? 80.566  3.929  43.309  1.00 35.52 ? 154  GLY B CA  1 
ATOM   3462 C  C   . GLY B 1 154 ? 79.615  3.141  42.437  1.00 34.62 ? 154  GLY B C   1 
ATOM   3463 O  O   . GLY B 1 154 ? 79.834  1.967  42.148  1.00 34.89 ? 154  GLY B O   1 
ATOM   3464 N  N   . LYS B 1 155 ? 78.546  3.800  42.011  1.00 34.33 ? 155  LYS B N   1 
ATOM   3465 C  CA  . LYS B 1 155 ? 77.557  3.170  41.157  1.00 33.19 ? 155  LYS B CA  1 
ATOM   3466 C  C   . LYS B 1 155 ? 77.723  3.725  39.748  1.00 33.33 ? 155  LYS B C   1 
ATOM   3467 O  O   . LYS B 1 155 ? 77.187  3.181  38.789  1.00 34.60 ? 155  LYS B O   1 
ATOM   3468 C  CB  . LYS B 1 155 ? 76.162  3.477  41.680  1.00 33.27 ? 155  LYS B CB  1 
ATOM   3469 C  CG  . LYS B 1 155 ? 76.050  3.397  43.192  1.00 34.13 ? 155  LYS B CG  1 
ATOM   3470 C  CD  . LYS B 1 155 ? 76.170  1.976  43.709  1.00 34.11 ? 155  LYS B CD  1 
ATOM   3471 C  CE  . LYS B 1 155 ? 75.958  1.937  45.220  1.00 34.15 ? 155  LYS B CE  1 
ATOM   3472 N  NZ  . LYS B 1 155 ? 75.940  0.547  45.753  1.00 32.65 ? 155  LYS B NZ  1 
ATOM   3473 N  N   . ILE B 1 156 ? 78.471  4.817  39.638  1.00 32.90 ? 156  ILE B N   1 
ATOM   3474 C  CA  . ILE B 1 156 ? 78.735  5.465  38.355  1.00 32.84 ? 156  ILE B CA  1 
ATOM   3475 C  C   . ILE B 1 156 ? 80.013  4.881  37.749  1.00 33.89 ? 156  ILE B C   1 
ATOM   3476 O  O   . ILE B 1 156 ? 81.087  4.946  38.359  1.00 33.77 ? 156  ILE B O   1 
ATOM   3477 C  CB  . ILE B 1 156 ? 78.900  7.015  38.532  1.00 32.60 ? 156  ILE B CB  1 
ATOM   3478 C  CG1 . ILE B 1 156 ? 77.577  7.731  38.231  1.00 31.31 ? 156  ILE B CG1 1 
ATOM   3479 C  CG2 . ILE B 1 156 ? 79.990  7.549  37.613  1.00 31.25 ? 156  ILE B CG2 1 
ATOM   3480 C  CD1 . ILE B 1 156 ? 76.457  7.401  39.177  1.00 30.17 ? 156  ILE B CD1 1 
ATOM   3481 N  N   . PRO B 1 157 ? 79.918  4.302  36.535  1.00 33.71 ? 157  PRO B N   1 
ATOM   3482 C  CA  . PRO B 1 157 ? 81.106  3.722  35.900  1.00 33.17 ? 157  PRO B CA  1 
ATOM   3483 C  C   . PRO B 1 157 ? 82.101  4.765  35.368  1.00 32.70 ? 157  PRO B C   1 
ATOM   3484 O  O   . PRO B 1 157 ? 81.775  5.950  35.233  1.00 32.14 ? 157  PRO B O   1 
ATOM   3485 C  CB  . PRO B 1 157 ? 80.510  2.850  34.795  1.00 32.01 ? 157  PRO B CB  1 
ATOM   3486 C  CG  . PRO B 1 157 ? 79.311  3.637  34.378  1.00 33.71 ? 157  PRO B CG  1 
ATOM   3487 C  CD  . PRO B 1 157 ? 78.717  4.086  35.704  1.00 33.93 ? 157  PRO B CD  1 
ATOM   3488 N  N   . ASP B 1 158 ? 83.319  4.311  35.085  1.00 31.90 ? 158  ASP B N   1 
ATOM   3489 C  CA  . ASP B 1 158 ? 84.375  5.172  34.560  1.00 31.17 ? 158  ASP B CA  1 
ATOM   3490 C  C   . ASP B 1 158 ? 84.111  5.532  33.105  1.00 28.97 ? 158  ASP B C   1 
ATOM   3491 O  O   . ASP B 1 158 ? 84.748  4.989  32.204  1.00 29.07 ? 158  ASP B O   1 
ATOM   3492 C  CB  . ASP B 1 158 ? 85.728  4.460  34.662  1.00 34.31 ? 158  ASP B CB  1 
ATOM   3493 C  CG  . ASP B 1 158 ? 86.622  5.047  35.733  1.00 35.16 ? 158  ASP B CG  1 
ATOM   3494 O  OD1 . ASP B 1 158 ? 86.083  5.638  36.694  1.00 36.27 ? 158  ASP B OD1 1 
ATOM   3495 O  OD2 . ASP B 1 158 ? 87.859  4.903  35.616  1.00 35.82 ? 158  ASP B OD2 1 
ATOM   3496 N  N   . VAL B 1 159 ? 83.182  6.455  32.877  1.00 27.91 ? 159  VAL B N   1 
ATOM   3497 C  CA  . VAL B 1 159 ? 82.845  6.882  31.518  1.00 26.00 ? 159  VAL B CA  1 
ATOM   3498 C  C   . VAL B 1 159 ? 83.887  7.853  30.956  1.00 26.00 ? 159  VAL B C   1 
ATOM   3499 O  O   . VAL B 1 159 ? 84.191  8.877  31.582  1.00 28.12 ? 159  VAL B O   1 
ATOM   3500 C  CB  . VAL B 1 159 ? 81.470  7.576  31.483  1.00 25.20 ? 159  VAL B CB  1 
ATOM   3501 C  CG1 . VAL B 1 159 ? 81.045  7.803  30.044  1.00 24.86 ? 159  VAL B CG1 1 
ATOM   3502 C  CG2 . VAL B 1 159 ? 80.447  6.737  32.220  1.00 23.20 ? 159  VAL B CG2 1 
ATOM   3503 N  N   . PRO B 1 160 ? 84.448  7.547  29.768  1.00 24.16 ? 160  PRO B N   1 
ATOM   3504 C  CA  . PRO B 1 160 ? 85.455  8.407  29.138  1.00 22.31 ? 160  PRO B CA  1 
ATOM   3505 C  C   . PRO B 1 160 ? 84.977  9.849  28.961  1.00 22.39 ? 160  PRO B C   1 
ATOM   3506 O  O   . PRO B 1 160 ? 83.894  10.098 28.437  1.00 21.73 ? 160  PRO B O   1 
ATOM   3507 C  CB  . PRO B 1 160 ? 85.718  7.712  27.806  1.00 23.79 ? 160  PRO B CB  1 
ATOM   3508 C  CG  . PRO B 1 160 ? 85.503  6.272  28.141  1.00 24.33 ? 160  PRO B CG  1 
ATOM   3509 C  CD  . PRO B 1 160 ? 84.255  6.312  28.984  1.00 23.31 ? 160  PRO B CD  1 
ATOM   3510 N  N   . GLY B 1 161 ? 85.807  10.789 29.406  1.00 22.57 ? 161  GLY B N   1 
ATOM   3511 C  CA  . GLY B 1 161 ? 85.482  12.201 29.321  1.00 21.43 ? 161  GLY B CA  1 
ATOM   3512 C  C   . GLY B 1 161 ? 84.984  12.758 30.647  1.00 21.79 ? 161  GLY B C   1 
ATOM   3513 O  O   . GLY B 1 161 ? 84.719  13.956 30.757  1.00 21.31 ? 161  GLY B O   1 
ATOM   3514 N  N   . PHE B 1 162 ? 84.862  11.904 31.663  1.00 21.16 ? 162  PHE B N   1 
ATOM   3515 C  CA  . PHE B 1 162 ? 84.366  12.360 32.956  1.00 22.23 ? 162  PHE B CA  1 
ATOM   3516 C  C   . PHE B 1 162 ? 85.287  12.125 34.159  1.00 22.29 ? 162  PHE B C   1 
ATOM   3517 O  O   . PHE B 1 162 ? 84.858  12.284 35.306  1.00 22.10 ? 162  PHE B O   1 
ATOM   3518 C  CB  . PHE B 1 162 ? 82.992  11.734 33.241  1.00 23.21 ? 162  PHE B CB  1 
ATOM   3519 C  CG  . PHE B 1 162 ? 81.946  12.065 32.208  1.00 25.28 ? 162  PHE B CG  1 
ATOM   3520 C  CD1 . PHE B 1 162 ? 81.832  11.308 31.042  1.00 25.33 ? 162  PHE B CD1 1 
ATOM   3521 C  CD2 . PHE B 1 162 ? 81.084  13.150 32.391  1.00 24.86 ? 162  PHE B CD2 1 
ATOM   3522 C  CE1 . PHE B 1 162 ? 80.877  11.624 30.070  1.00 26.06 ? 162  PHE B CE1 1 
ATOM   3523 C  CE2 . PHE B 1 162 ? 80.126  13.475 31.423  1.00 25.71 ? 162  PHE B CE2 1 
ATOM   3524 C  CZ  . PHE B 1 162 ? 80.024  12.709 30.260  1.00 25.75 ? 162  PHE B CZ  1 
ATOM   3525 N  N   . SER B 1 163 ? 86.546  11.772 33.911  1.00 20.92 ? 163  SER B N   1 
ATOM   3526 C  CA  . SER B 1 163 ? 87.488  11.531 35.005  1.00 19.92 ? 163  SER B CA  1 
ATOM   3527 C  C   . SER B 1 163 ? 87.680  12.785 35.870  1.00 19.14 ? 163  SER B C   1 
ATOM   3528 O  O   . SER B 1 163 ? 88.041  12.699 37.047  1.00 19.27 ? 163  SER B O   1 
ATOM   3529 C  CB  . SER B 1 163 ? 88.843  11.060 34.454  1.00 20.53 ? 163  SER B CB  1 
ATOM   3530 O  OG  . SER B 1 163 ? 89.509  12.089 33.738  1.00 22.09 ? 163  SER B OG  1 
ATOM   3531 N  N   . TRP B 1 164 ? 87.430  13.947 35.282  1.00 16.84 ? 164  TRP B N   1 
ATOM   3532 C  CA  . TRP B 1 164 ? 87.575  15.209 35.993  1.00 16.58 ? 164  TRP B CA  1 
ATOM   3533 C  C   . TRP B 1 164 ? 86.452  15.431 37.023  1.00 18.08 ? 164  TRP B C   1 
ATOM   3534 O  O   . TRP B 1 164 ? 86.590  16.259 37.929  1.00 18.22 ? 164  TRP B O   1 
ATOM   3535 C  CB  . TRP B 1 164 ? 87.567  16.365 34.991  1.00 16.09 ? 164  TRP B CB  1 
ATOM   3536 C  CG  . TRP B 1 164 ? 86.265  16.473 34.254  1.00 16.34 ? 164  TRP B CG  1 
ATOM   3537 C  CD1 . TRP B 1 164 ? 85.881  15.759 33.158  1.00 16.87 ? 164  TRP B CD1 1 
ATOM   3538 C  CD2 . TRP B 1 164 ? 85.137  17.273 34.626  1.00 15.51 ? 164  TRP B CD2 1 
ATOM   3539 N  NE1 . TRP B 1 164 ? 84.580  16.060 32.826  1.00 15.57 ? 164  TRP B NE1 1 
ATOM   3540 C  CE2 . TRP B 1 164 ? 84.100  16.987 33.711  1.00 15.87 ? 164  TRP B CE2 1 
ATOM   3541 C  CE3 . TRP B 1 164 ? 84.900  18.207 35.646  1.00 14.90 ? 164  TRP B CE3 1 
ATOM   3542 C  CZ2 . TRP B 1 164 ? 82.840  17.603 33.787  1.00 16.80 ? 164  TRP B CZ2 1 
ATOM   3543 C  CZ3 . TRP B 1 164 ? 83.645  18.819 35.720  1.00 13.35 ? 164  TRP B CZ3 1 
ATOM   3544 C  CH2 . TRP B 1 164 ? 82.636  18.514 34.797  1.00 14.13 ? 164  TRP B CH2 1 
ATOM   3545 N  N   . VAL B 1 165 ? 85.350  14.691 36.882  1.00 17.84 ? 165  VAL B N   1 
ATOM   3546 C  CA  . VAL B 1 165 ? 84.202  14.836 37.770  1.00 17.05 ? 165  VAL B CA  1 
ATOM   3547 C  C   . VAL B 1 165 ? 84.357  14.306 39.186  1.00 18.95 ? 165  VAL B C   1 
ATOM   3548 O  O   . VAL B 1 165 ? 84.926  13.240 39.432  1.00 19.66 ? 165  VAL B O   1 
ATOM   3549 C  CB  . VAL B 1 165 ? 82.916  14.167 37.187  1.00 17.62 ? 165  VAL B CB  1 
ATOM   3550 C  CG1 . VAL B 1 165 ? 81.714  14.513 38.067  1.00 17.03 ? 165  VAL B CG1 1 
ATOM   3551 C  CG2 . VAL B 1 165 ? 82.671  14.613 35.767  1.00 13.70 ? 165  VAL B CG2 1 
ATOM   3552 N  N   . THR B 1 166 ? 83.811  15.077 40.113  1.00 21.31 ? 166  THR B N   1 
ATOM   3553 C  CA  . THR B 1 166 ? 83.793  14.744 41.525  1.00 23.15 ? 166  THR B CA  1 
ATOM   3554 C  C   . THR B 1 166 ? 82.407  15.179 41.992  1.00 22.97 ? 166  THR B C   1 
ATOM   3555 O  O   . THR B 1 166 ? 82.061  16.357 41.906  1.00 24.53 ? 166  THR B O   1 
ATOM   3556 C  CB  . THR B 1 166 ? 84.880  15.517 42.308  1.00 24.08 ? 166  THR B CB  1 
ATOM   3557 O  OG1 . THR B 1 166 ? 86.177  15.037 41.925  1.00 27.66 ? 166  THR B OG1 1 
ATOM   3558 C  CG2 . THR B 1 166 ? 84.701  15.323 43.807  1.00 24.45 ? 166  THR B CG2 1 
ATOM   3559 N  N   . PRO B 1 167 ? 81.585  14.227 42.463  1.00 22.07 ? 167  PRO B N   1 
ATOM   3560 C  CA  . PRO B 1 167 ? 80.232  14.520 42.940  1.00 23.04 ? 167  PRO B CA  1 
ATOM   3561 C  C   . PRO B 1 167 ? 80.250  15.640 43.976  1.00 23.55 ? 167  PRO B C   1 
ATOM   3562 O  O   . PRO B 1 167 ? 80.948  15.544 44.981  1.00 23.71 ? 167  PRO B O   1 
ATOM   3563 C  CB  . PRO B 1 167 ? 79.782  13.184 43.521  1.00 23.38 ? 167  PRO B CB  1 
ATOM   3564 C  CG  . PRO B 1 167 ? 80.483  12.192 42.643  1.00 22.83 ? 167  PRO B CG  1 
ATOM   3565 C  CD  . PRO B 1 167 ? 81.868  12.785 42.559  1.00 23.42 ? 167  PRO B CD  1 
ATOM   3566 N  N   . CYS B 1 168 ? 79.465  16.686 43.735  1.00 24.17 ? 168  CYS B N   1 
ATOM   3567 C  CA  . CYS B 1 168 ? 79.434  17.838 44.624  1.00 24.76 ? 168  CYS B CA  1 
ATOM   3568 C  C   . CYS B 1 168 ? 78.201  18.080 45.493  1.00 23.97 ? 168  CYS B C   1 
ATOM   3569 O  O   . CYS B 1 168 ? 78.262  18.886 46.424  1.00 23.75 ? 168  CYS B O   1 
ATOM   3570 C  CB  . CYS B 1 168 ? 79.715  19.100 43.812  1.00 26.67 ? 168  CYS B CB  1 
ATOM   3571 S  SG  . CYS B 1 168 ? 78.629  19.315 42.394  1.00 29.50 ? 168  CYS B SG  1 
ATOM   3572 N  N   . ILE B 1 169 ? 77.084  17.419 45.207  1.00 23.41 ? 169  ILE B N   1 
ATOM   3573 C  CA  . ILE B 1 169 ? 75.889  17.638 46.025  1.00 22.09 ? 169  ILE B CA  1 
ATOM   3574 C  C   . ILE B 1 169 ? 75.352  16.347 46.631  1.00 21.80 ? 169  ILE B C   1 
ATOM   3575 O  O   . ILE B 1 169 ? 75.606  15.258 46.129  1.00 21.68 ? 169  ILE B O   1 
ATOM   3576 C  CB  . ILE B 1 169 ? 74.735  18.317 45.223  1.00 19.57 ? 169  ILE B CB  1 
ATOM   3577 C  CG1 . ILE B 1 169 ? 74.300  17.417 44.068  1.00 20.27 ? 169  ILE B CG1 1 
ATOM   3578 C  CG2 . ILE B 1 169 ? 75.174  19.671 44.698  1.00 17.24 ? 169  ILE B CG2 1 
ATOM   3579 C  CD1 . ILE B 1 169 ? 73.021  17.871 43.392  1.00 19.08 ? 169  ILE B CD1 1 
ATOM   3580 N  N   . SER B 1 170 ? 74.609  16.490 47.724  1.00 21.85 ? 170  SER B N   1 
ATOM   3581 C  CA  . SER B 1 170 ? 74.012  15.359 48.414  1.00 21.99 ? 170  SER B CA  1 
ATOM   3582 C  C   . SER B 1 170 ? 72.519  15.373 48.144  1.00 23.01 ? 170  SER B C   1 
ATOM   3583 O  O   . SER B 1 170 ? 71.986  16.335 47.595  1.00 21.10 ? 170  SER B O   1 
ATOM   3584 C  CB  . SER B 1 170 ? 74.236  15.478 49.919  1.00 22.30 ? 170  SER B CB  1 
ATOM   3585 O  OG  . SER B 1 170 ? 75.597  15.718 50.206  1.00 25.52 ? 170  SER B OG  1 
ATOM   3586 N  N   . ALA B 1 171 ? 71.841  14.305 48.539  1.00 25.36 ? 171  ALA B N   1 
ATOM   3587 C  CA  . ALA B 1 171 ? 70.404  14.226 48.356  1.00 26.27 ? 171  ALA B CA  1 
ATOM   3588 C  C   . ALA B 1 171 ? 69.755  15.401 49.085  1.00 27.50 ? 171  ALA B C   1 
ATOM   3589 O  O   . ALA B 1 171 ? 68.732  15.925 48.651  1.00 29.89 ? 171  ALA B O   1 
ATOM   3590 C  CB  . ALA B 1 171 ? 69.882  12.907 48.912  1.00 27.37 ? 171  ALA B CB  1 
ATOM   3591 N  N   . LYS B 1 172 ? 70.358  15.828 50.188  1.00 26.88 ? 172  LYS B N   1 
ATOM   3592 C  CA  . LYS B 1 172 ? 69.799  16.929 50.953  1.00 27.27 ? 172  LYS B CA  1 
ATOM   3593 C  C   . LYS B 1 172 ? 70.222  18.301 50.430  1.00 26.29 ? 172  LYS B C   1 
ATOM   3594 O  O   . LYS B 1 172 ? 70.159  19.293 51.157  1.00 28.05 ? 172  LYS B O   1 
ATOM   3595 C  CB  . LYS B 1 172 ? 70.184  16.795 52.427  1.00 28.19 ? 172  LYS B CB  1 
ATOM   3596 C  CG  . LYS B 1 172 ? 71.654  17.029 52.719  1.00 30.74 ? 172  LYS B CG  1 
ATOM   3597 C  CD  . LYS B 1 172 ? 71.945  16.843 54.209  1.00 31.62 ? 172  LYS B CD  1 
ATOM   3598 C  CE  . LYS B 1 172 ? 73.399  17.149 54.542  1.00 30.05 ? 172  LYS B CE  1 
ATOM   3599 N  NZ  . LYS B 1 172 ? 74.348  16.324 53.743  1.00 30.14 ? 172  LYS B NZ  1 
ATOM   3600 N  N   . ASP B 1 173 ? 70.655  18.362 49.176  1.00 23.33 ? 173  ASP B N   1 
ATOM   3601 C  CA  . ASP B 1 173 ? 71.068  19.633 48.591  1.00 20.87 ? 173  ASP B CA  1 
ATOM   3602 C  C   . ASP B 1 173 ? 70.342  19.884 47.282  1.00 18.71 ? 173  ASP B C   1 
ATOM   3603 O  O   . ASP B 1 173 ? 70.680  20.812 46.552  1.00 17.62 ? 173  ASP B O   1 
ATOM   3604 C  CB  . ASP B 1 173 ? 72.576  19.659 48.313  1.00 22.32 ? 173  ASP B CB  1 
ATOM   3605 C  CG  . ASP B 1 173 ? 73.405  19.377 49.541  1.00 23.02 ? 173  ASP B CG  1 
ATOM   3606 O  OD1 . ASP B 1 173 ? 73.047  19.882 50.632  1.00 22.39 ? 173  ASP B OD1 1 
ATOM   3607 O  OD2 . ASP B 1 173 ? 74.424  18.660 49.400  1.00 23.84 ? 173  ASP B OD2 1 
ATOM   3608 N  N   . ILE B 1 174 ? 69.358  19.048 46.980  1.00 16.58 ? 174  ILE B N   1 
ATOM   3609 C  CA  . ILE B 1 174 ? 68.601  19.190 45.742  1.00 16.84 ? 174  ILE B CA  1 
ATOM   3610 C  C   . ILE B 1 174 ? 67.104  18.960 45.944  1.00 16.17 ? 174  ILE B C   1 
ATOM   3611 O  O   . ILE B 1 174 ? 66.693  18.141 46.765  1.00 14.17 ? 174  ILE B O   1 
ATOM   3612 C  CB  . ILE B 1 174 ? 69.090  18.186 44.657  1.00 17.26 ? 174  ILE B CB  1 
ATOM   3613 C  CG1 . ILE B 1 174 ? 68.297  18.386 43.360  1.00 18.34 ? 174  ILE B CG1 1 
ATOM   3614 C  CG2 . ILE B 1 174 ? 68.926  16.758 45.155  1.00 18.45 ? 174  ILE B CG2 1 
ATOM   3615 C  CD1 . ILE B 1 174 ? 68.699  17.468 42.228  1.00 14.17 ? 174  ILE B CD1 1 
ATOM   3616 N  N   . VAL B 1 175 ? 66.303  19.697 45.180  1.00 15.52 ? 175  VAL B N   1 
ATOM   3617 C  CA  . VAL B 1 175 ? 64.852  19.580 45.211  1.00 13.59 ? 175  VAL B CA  1 
ATOM   3618 C  C   . VAL B 1 175 ? 64.395  19.623 43.747  1.00 13.48 ? 175  VAL B C   1 
ATOM   3619 O  O   . VAL B 1 175 ? 64.869  20.450 42.964  1.00 12.57 ? 175  VAL B O   1 
ATOM   3620 C  CB  . VAL B 1 175 ? 64.183  20.762 45.980  1.00 13.52 ? 175  VAL B CB  1 
ATOM   3621 C  CG1 . VAL B 1 175 ? 62.657  20.614 45.950  1.00 9.81  ? 175  VAL B CG1 1 
ATOM   3622 C  CG2 . VAL B 1 175 ? 64.692  20.816 47.414  1.00 11.60 ? 175  VAL B CG2 1 
ATOM   3623 N  N   . TYR B 1 176 ? 63.494  18.719 43.384  1.00 12.26 ? 176  TYR B N   1 
ATOM   3624 C  CA  . TYR B 1 176 ? 62.950  18.659 42.029  1.00 12.97 ? 176  TYR B CA  1 
ATOM   3625 C  C   . TYR B 1 176 ? 61.552  19.273 42.019  1.00 12.05 ? 176  TYR B C   1 
ATOM   3626 O  O   . TYR B 1 176 ? 60.793  19.104 42.980  1.00 13.89 ? 176  TYR B O   1 
ATOM   3627 C  CB  . TYR B 1 176 ? 62.821  17.208 41.565  1.00 13.80 ? 176  TYR B CB  1 
ATOM   3628 C  CG  . TYR B 1 176 ? 64.101  16.529 41.127  1.00 14.36 ? 176  TYR B CG  1 
ATOM   3629 C  CD1 . TYR B 1 176 ? 64.669  16.803 39.880  1.00 11.97 ? 176  TYR B CD1 1 
ATOM   3630 C  CD2 . TYR B 1 176 ? 64.710  15.566 41.934  1.00 15.04 ? 176  TYR B CD2 1 
ATOM   3631 C  CE1 . TYR B 1 176 ? 65.807  16.132 39.444  1.00 13.95 ? 176  TYR B CE1 1 
ATOM   3632 C  CE2 . TYR B 1 176 ? 65.851  14.885 41.509  1.00 16.41 ? 176  TYR B CE2 1 
ATOM   3633 C  CZ  . TYR B 1 176 ? 66.397  15.174 40.258  1.00 16.66 ? 176  TYR B CZ  1 
ATOM   3634 O  OH  . TYR B 1 176 ? 67.535  14.517 39.833  1.00 15.67 ? 176  TYR B OH  1 
ATOM   3635 N  N   . ILE B 1 177 ? 61.230  20.003 40.950  1.00 11.83 ? 177  ILE B N   1 
ATOM   3636 C  CA  . ILE B 1 177 ? 59.902  20.601 40.763  1.00 11.34 ? 177  ILE B CA  1 
ATOM   3637 C  C   . ILE B 1 177 ? 59.450  20.370 39.316  1.00 9.76  ? 177  ILE B C   1 
ATOM   3638 O  O   . ILE B 1 177 ? 60.208  20.649 38.388  1.00 8.17  ? 177  ILE B O   1 
ATOM   3639 C  CB  . ILE B 1 177 ? 59.855  22.152 41.002  1.00 12.88 ? 177  ILE B CB  1 
ATOM   3640 C  CG1 . ILE B 1 177 ? 60.206  22.509 42.446  1.00 14.31 ? 177  ILE B CG1 1 
ATOM   3641 C  CG2 . ILE B 1 177 ? 58.445  22.677 40.699  1.00 12.04 ? 177  ILE B CG2 1 
ATOM   3642 C  CD1 . ILE B 1 177 ? 61.671  22.340 42.770  1.00 20.39 ? 177  ILE B CD1 1 
ATOM   3643 N  N   . GLY B 1 178 ? 58.227  19.851 39.147  1.00 12.00 ? 178  GLY B N   1 
ATOM   3644 C  CA  . GLY B 1 178 ? 57.649  19.617 37.825  1.00 12.03 ? 178  GLY B CA  1 
ATOM   3645 C  C   . GLY B 1 178 ? 57.673  18.210 37.238  1.00 13.64 ? 178  GLY B C   1 
ATOM   3646 O  O   . GLY B 1 178 ? 57.161  17.983 36.141  1.00 12.95 ? 178  GLY B O   1 
ATOM   3647 N  N   . LEU B 1 179 ? 58.244  17.256 37.963  1.00 13.56 ? 179  LEU B N   1 
ATOM   3648 C  CA  . LEU B 1 179 ? 58.362  15.888 37.468  1.00 13.16 ? 179  LEU B CA  1 
ATOM   3649 C  C   . LEU B 1 179 ? 57.059  15.211 37.039  1.00 13.68 ? 179  LEU B C   1 
ATOM   3650 O  O   . LEU B 1 179 ? 56.059  15.239 37.761  1.00 12.92 ? 179  LEU B O   1 
ATOM   3651 C  CB  . LEU B 1 179 ? 59.069  15.025 38.517  1.00 10.86 ? 179  LEU B CB  1 
ATOM   3652 C  CG  . LEU B 1 179 ? 60.399  15.592 39.019  1.00 12.71 ? 179  LEU B CG  1 
ATOM   3653 C  CD1 . LEU B 1 179 ? 60.860  14.785 40.215  1.00 15.16 ? 179  LEU B CD1 1 
ATOM   3654 C  CD2 . LEU B 1 179 ? 61.436  15.570 37.918  1.00 12.08 ? 179  LEU B CD2 1 
ATOM   3655 N  N   . ARG B 1 180 ? 57.088  14.582 35.865  1.00 13.40 ? 180  ARG B N   1 
ATOM   3656 C  CA  . ARG B 1 180 ? 55.915  13.880 35.351  1.00 14.67 ? 180  ARG B CA  1 
ATOM   3657 C  C   . ARG B 1 180 ? 56.266  12.774 34.343  1.00 15.61 ? 180  ARG B C   1 
ATOM   3658 O  O   . ARG B 1 180 ? 55.369  12.185 33.742  1.00 16.97 ? 180  ARG B O   1 
ATOM   3659 C  CB  . ARG B 1 180 ? 54.946  14.883 34.717  1.00 14.65 ? 180  ARG B CB  1 
ATOM   3660 C  CG  . ARG B 1 180 ? 55.130  15.090 33.234  1.00 16.57 ? 180  ARG B CG  1 
ATOM   3661 C  CD  . ARG B 1 180 ? 54.609  16.438 32.806  1.00 16.48 ? 180  ARG B CD  1 
ATOM   3662 N  NE  . ARG B 1 180 ? 55.478  17.460 33.347  1.00 20.15 ? 180  ARG B NE  1 
ATOM   3663 C  CZ  . ARG B 1 180 ? 55.857  18.551 32.700  1.00 19.06 ? 180  ARG B CZ  1 
ATOM   3664 N  NH1 . ARG B 1 180 ? 55.439  18.787 31.466  1.00 18.69 ? 180  ARG B NH1 1 
ATOM   3665 N  NH2 . ARG B 1 180 ? 56.680  19.398 33.294  1.00 23.31 ? 180  ARG B NH2 1 
ATOM   3666 N  N   . ASP B 1 181 ? 57.567  12.494 34.180  1.00 16.26 ? 181  ASP B N   1 
ATOM   3667 C  CA  . ASP B 1 181 ? 58.071  11.465 33.257  1.00 15.86 ? 181  ASP B CA  1 
ATOM   3668 C  C   . ASP B 1 181 ? 59.393  10.889 33.817  1.00 15.75 ? 181  ASP B C   1 
ATOM   3669 O  O   . ASP B 1 181 ? 60.476  11.164 33.307  1.00 16.35 ? 181  ASP B O   1 
ATOM   3670 C  CB  . ASP B 1 181 ? 58.286  12.103 31.871  1.00 17.94 ? 181  ASP B CB  1 
ATOM   3671 C  CG  . ASP B 1 181 ? 58.459  11.082 30.755  1.00 19.23 ? 181  ASP B CG  1 
ATOM   3672 O  OD1 . ASP B 1 181 ? 58.027  9.920  30.916  1.00 19.35 ? 181  ASP B OD1 1 
ATOM   3673 O  OD2 . ASP B 1 181 ? 59.020  11.458 29.698  1.00 22.87 ? 181  ASP B OD2 1 
ATOM   3674 N  N   . VAL B 1 182 ? 59.283  10.078 34.866  1.00 15.55 ? 182  VAL B N   1 
ATOM   3675 C  CA  . VAL B 1 182 ? 60.439  9.482  35.546  1.00 15.74 ? 182  VAL B CA  1 
ATOM   3676 C  C   . VAL B 1 182 ? 60.589  7.960  35.322  1.00 17.68 ? 182  VAL B C   1 
ATOM   3677 O  O   . VAL B 1 182 ? 59.668  7.191  35.608  1.00 16.26 ? 182  VAL B O   1 
ATOM   3678 C  CB  . VAL B 1 182 ? 60.341  9.749  37.082  1.00 15.01 ? 182  VAL B CB  1 
ATOM   3679 C  CG1 . VAL B 1 182 ? 61.552  9.157  37.806  1.00 14.32 ? 182  VAL B CG1 1 
ATOM   3680 C  CG2 . VAL B 1 182 ? 60.213  11.257 37.350  1.00 12.05 ? 182  VAL B CG2 1 
ATOM   3681 N  N   . ASP B 1 183 ? 61.750  7.527  34.830  1.00 17.46 ? 183  ASP B N   1 
ATOM   3682 C  CA  . ASP B 1 183 ? 61.986  6.099  34.588  1.00 17.95 ? 183  ASP B CA  1 
ATOM   3683 C  C   . ASP B 1 183 ? 61.877  5.299  35.886  1.00 17.48 ? 183  ASP B C   1 
ATOM   3684 O  O   . ASP B 1 183 ? 61.925  5.869  36.980  1.00 17.87 ? 183  ASP B O   1 
ATOM   3685 C  CB  . ASP B 1 183 ? 63.369  5.869  33.965  1.00 18.42 ? 183  ASP B CB  1 
ATOM   3686 C  CG  . ASP B 1 183 ? 63.489  6.475  32.584  1.00 19.77 ? 183  ASP B CG  1 
ATOM   3687 O  OD1 . ASP B 1 183 ? 62.508  6.402  31.817  1.00 16.07 ? 183  ASP B OD1 1 
ATOM   3688 O  OD2 . ASP B 1 183 ? 64.569  7.011  32.262  1.00 22.19 ? 183  ASP B OD2 1 
ATOM   3689 N  N   . PRO B 1 184 ? 61.727  3.966  35.780  1.00 17.02 ? 184  PRO B N   1 
ATOM   3690 C  CA  . PRO B 1 184 ? 61.612  3.119  36.976  1.00 16.30 ? 184  PRO B CA  1 
ATOM   3691 C  C   . PRO B 1 184 ? 62.883  3.106  37.828  1.00 14.60 ? 184  PRO B C   1 
ATOM   3692 O  O   . PRO B 1 184 ? 62.817  3.127  39.055  1.00 14.96 ? 184  PRO B O   1 
ATOM   3693 C  CB  . PRO B 1 184 ? 61.278  1.741  36.392  1.00 17.51 ? 184  PRO B CB  1 
ATOM   3694 C  CG  . PRO B 1 184 ? 60.594  2.075  35.086  1.00 17.45 ? 184  PRO B CG  1 
ATOM   3695 C  CD  . PRO B 1 184 ? 61.469  3.182  34.560  1.00 15.04 ? 184  PRO B CD  1 
ATOM   3696 N  N   . GLY B 1 185 ? 64.032  3.068  37.160  1.00 14.71 ? 185  GLY B N   1 
ATOM   3697 C  CA  . GLY B 1 185 ? 65.313  3.062  37.846  1.00 15.33 ? 185  GLY B CA  1 
ATOM   3698 C  C   . GLY B 1 185 ? 65.606  4.391  38.515  1.00 14.07 ? 185  GLY B C   1 
ATOM   3699 O  O   . GLY B 1 185 ? 66.309  4.443  39.523  1.00 15.44 ? 185  GLY B O   1 
ATOM   3700 N  N   . GLU B 1 186 ? 65.087  5.470  37.941  1.00 12.97 ? 186  GLU B N   1 
ATOM   3701 C  CA  . GLU B 1 186 ? 65.264  6.801  38.517  1.00 11.89 ? 186  GLU B CA  1 
ATOM   3702 C  C   . GLU B 1 186 ? 64.374  6.911  39.751  1.00 11.88 ? 186  GLU B C   1 
ATOM   3703 O  O   . GLU B 1 186 ? 64.774  7.456  40.774  1.00 12.46 ? 186  GLU B O   1 
ATOM   3704 C  CB  . GLU B 1 186 ? 64.864  7.882  37.515  1.00 10.41 ? 186  GLU B CB  1 
ATOM   3705 C  CG  . GLU B 1 186 ? 65.839  8.067  36.374  1.00 10.62 ? 186  GLU B CG  1 
ATOM   3706 C  CD  . GLU B 1 186 ? 65.357  9.090  35.370  1.00 10.77 ? 186  GLU B CD  1 
ATOM   3707 O  OE1 . GLU B 1 186 ? 64.343  8.822  34.694  1.00 12.75 ? 186  GLU B OE1 1 
ATOM   3708 O  OE2 . GLU B 1 186 ? 65.982  10.161 35.257  1.00 9.60  ? 186  GLU B OE2 1 
ATOM   3709 N  N   . HIS B 1 187 ? 63.158  6.389  39.650  1.00 12.44 ? 187  HIS B N   1 
ATOM   3710 C  CA  . HIS B 1 187 ? 62.230  6.440  40.775  1.00 13.26 ? 187  HIS B CA  1 
ATOM   3711 C  C   . HIS B 1 187 ? 62.795  5.604  41.916  1.00 12.53 ? 187  HIS B C   1 
ATOM   3712 O  O   . HIS B 1 187 ? 62.606  5.921  43.083  1.00 13.58 ? 187  HIS B O   1 
ATOM   3713 C  CB  . HIS B 1 187 ? 60.853  5.918  40.351  1.00 11.60 ? 187  HIS B CB  1 
ATOM   3714 C  CG  . HIS B 1 187 ? 59.797  6.066  41.402  1.00 10.39 ? 187  HIS B CG  1 
ATOM   3715 N  ND1 . HIS B 1 187 ? 59.201  4.985  42.014  1.00 12.27 ? 187  HIS B ND1 1 
ATOM   3716 C  CD2 . HIS B 1 187 ? 59.215  7.166  41.934  1.00 12.86 ? 187  HIS B CD2 1 
ATOM   3717 C  CE1 . HIS B 1 187 ? 58.293  5.412  42.874  1.00 12.07 ? 187  HIS B CE1 1 
ATOM   3718 N  NE2 . HIS B 1 187 ? 58.282  6.733  42.845  1.00 11.44 ? 187  HIS B NE2 1 
ATOM   3719 N  N   . TYR B 1 188 ? 63.486  4.525  41.571  1.00 14.33 ? 188  TYR B N   1 
ATOM   3720 C  CA  . TYR B 1 188 ? 64.097  3.668  42.575  1.00 15.66 ? 188  TYR B CA  1 
ATOM   3721 C  C   . TYR B 1 188 ? 65.132  4.513  43.332  1.00 16.30 ? 188  TYR B C   1 
ATOM   3722 O  O   . TYR B 1 188 ? 65.180  4.499  44.566  1.00 16.33 ? 188  TYR B O   1 
ATOM   3723 C  CB  . TYR B 1 188 ? 64.770  2.465  41.900  1.00 17.10 ? 188  TYR B CB  1 
ATOM   3724 C  CG  . TYR B 1 188 ? 65.606  1.639  42.846  1.00 17.67 ? 188  TYR B CG  1 
ATOM   3725 C  CD1 . TYR B 1 188 ? 65.016  0.784  43.773  1.00 16.52 ? 188  TYR B CD1 1 
ATOM   3726 C  CD2 . TYR B 1 188 ? 66.992  1.779  42.868  1.00 18.72 ? 188  TYR B CD2 1 
ATOM   3727 C  CE1 . TYR B 1 188 ? 65.794  0.096  44.708  1.00 16.83 ? 188  TYR B CE1 1 
ATOM   3728 C  CE2 . TYR B 1 188 ? 67.769  1.106  43.790  1.00 16.54 ? 188  TYR B CE2 1 
ATOM   3729 C  CZ  . TYR B 1 188 ? 67.170  0.273  44.710  1.00 16.04 ? 188  TYR B CZ  1 
ATOM   3730 O  OH  . TYR B 1 188 ? 67.961  -0.340 45.656  1.00 19.50 ? 188  TYR B OH  1 
ATOM   3731 N  N   . ILE B 1 189 ? 65.938  5.264  42.578  1.00 16.04 ? 189  ILE B N   1 
ATOM   3732 C  CA  . ILE B 1 189 ? 66.970  6.143  43.139  1.00 16.09 ? 189  ILE B CA  1 
ATOM   3733 C  C   . ILE B 1 189 ? 66.349  7.220  44.023  1.00 14.96 ? 189  ILE B C   1 
ATOM   3734 O  O   . ILE B 1 189 ? 66.887  7.547  45.089  1.00 15.04 ? 189  ILE B O   1 
ATOM   3735 C  CB  . ILE B 1 189 ? 67.785  6.879  42.028  1.00 16.68 ? 189  ILE B CB  1 
ATOM   3736 C  CG1 . ILE B 1 189 ? 68.424  5.879  41.057  1.00 18.25 ? 189  ILE B CG1 1 
ATOM   3737 C  CG2 . ILE B 1 189 ? 68.863  7.729  42.660  1.00 15.54 ? 189  ILE B CG2 1 
ATOM   3738 C  CD1 . ILE B 1 189 ? 69.460  4.980  41.686  1.00 22.81 ? 189  ILE B CD1 1 
ATOM   3739 N  N   . LEU B 1 190 ? 65.224  7.776  43.582  1.00 13.48 ? 190  LEU B N   1 
ATOM   3740 C  CA  . LEU B 1 190 ? 64.558  8.831  44.353  1.00 14.17 ? 190  LEU B CA  1 
ATOM   3741 C  C   . LEU B 1 190 ? 64.165  8.402  45.749  1.00 12.67 ? 190  LEU B C   1 
ATOM   3742 O  O   . LEU B 1 190 ? 64.372  9.138  46.705  1.00 13.15 ? 190  LEU B O   1 
ATOM   3743 C  CB  . LEU B 1 190 ? 63.301  9.344  43.635  1.00 13.85 ? 190  LEU B CB  1 
ATOM   3744 C  CG  . LEU B 1 190 ? 63.481  10.363 42.507  1.00 14.58 ? 190  LEU B CG  1 
ATOM   3745 C  CD1 . LEU B 1 190 ? 62.111  10.849 42.038  1.00 15.05 ? 190  LEU B CD1 1 
ATOM   3746 C  CD2 . LEU B 1 190 ? 64.313  11.538 42.995  1.00 13.40 ? 190  LEU B CD2 1 
ATOM   3747 N  N   . LYS B 1 191 ? 63.584  7.212  45.846  1.00 13.79 ? 191  LYS B N   1 
ATOM   3748 C  CA  . LYS B 1 191 ? 63.123  6.645  47.107  1.00 14.06 ? 191  LYS B CA  1 
ATOM   3749 C  C   . LYS B 1 191 ? 64.257  6.082  47.955  1.00 14.87 ? 191  LYS B C   1 
ATOM   3750 O  O   . LYS B 1 191 ? 64.236  6.181  49.176  1.00 15.21 ? 191  LYS B O   1 
ATOM   3751 C  CB  . LYS B 1 191 ? 62.109  5.531  46.832  1.00 13.33 ? 191  LYS B CB  1 
ATOM   3752 C  CG  . LYS B 1 191 ? 60.803  5.987  46.213  1.00 16.34 ? 191  LYS B CG  1 
ATOM   3753 C  CD  . LYS B 1 191 ? 59.992  6.824  47.185  1.00 21.37 ? 191  LYS B CD  1 
ATOM   3754 C  CE  . LYS B 1 191 ? 58.615  7.144  46.635  1.00 24.54 ? 191  LYS B CE  1 
ATOM   3755 N  NZ  . LYS B 1 191 ? 57.836  8.015  47.563  1.00 27.00 ? 191  LYS B NZ  1 
ATOM   3756 N  N   . THR B 1 192 ? 65.239  5.472  47.308  1.00 15.78 ? 192  THR B N   1 
ATOM   3757 C  CA  . THR B 1 192 ? 66.370  4.890  48.027  1.00 16.52 ? 192  THR B CA  1 
ATOM   3758 C  C   . THR B 1 192 ? 67.232  5.956  48.699  1.00 17.12 ? 192  THR B C   1 
ATOM   3759 O  O   . THR B 1 192 ? 67.666  5.792  49.847  1.00 17.96 ? 192  THR B O   1 
ATOM   3760 C  CB  . THR B 1 192 ? 67.241  4.049  47.074  1.00 15.48 ? 192  THR B CB  1 
ATOM   3761 O  OG1 . THR B 1 192 ? 66.488  2.913  46.633  1.00 15.36 ? 192  THR B OG1 1 
ATOM   3762 C  CG2 . THR B 1 192 ? 68.505  3.575  47.764  1.00 17.46 ? 192  THR B CG2 1 
ATOM   3763 N  N   . LEU B 1 193 ? 67.459  7.055  47.987  1.00 15.70 ? 193  LEU B N   1 
ATOM   3764 C  CA  . LEU B 1 193 ? 68.278  8.136  48.508  1.00 15.23 ? 193  LEU B CA  1 
ATOM   3765 C  C   . LEU B 1 193 ? 67.499  9.237  49.189  1.00 13.82 ? 193  LEU B C   1 
ATOM   3766 O  O   . LEU B 1 193 ? 68.065  10.264 49.532  1.00 15.59 ? 193  LEU B O   1 
ATOM   3767 C  CB  . LEU B 1 193 ? 69.136  8.734  47.390  1.00 16.47 ? 193  LEU B CB  1 
ATOM   3768 C  CG  . LEU B 1 193 ? 70.379  7.943  46.969  1.00 16.37 ? 193  LEU B CG  1 
ATOM   3769 C  CD1 . LEU B 1 193 ? 69.986  6.613  46.366  1.00 17.60 ? 193  LEU B CD1 1 
ATOM   3770 C  CD2 . LEU B 1 193 ? 71.163  8.766  45.974  1.00 16.64 ? 193  LEU B CD2 1 
ATOM   3771 N  N   . GLY B 1 194 ? 66.205  9.022  49.396  1.00 15.21 ? 194  GLY B N   1 
ATOM   3772 C  CA  . GLY B 1 194 ? 65.383  10.027 50.049  1.00 14.65 ? 194  GLY B CA  1 
ATOM   3773 C  C   . GLY B 1 194 ? 65.524  11.409 49.435  1.00 15.03 ? 194  GLY B C   1 
ATOM   3774 O  O   . GLY B 1 194 ? 65.798  12.392 50.130  1.00 12.88 ? 194  GLY B O   1 
ATOM   3775 N  N   . ILE B 1 195 ? 65.324  11.487 48.126  1.00 15.16 ? 195  ILE B N   1 
ATOM   3776 C  CA  . ILE B 1 195 ? 65.430  12.747 47.408  1.00 16.10 ? 195  ILE B CA  1 
ATOM   3777 C  C   . ILE B 1 195 ? 64.176  13.618 47.579  1.00 15.32 ? 195  ILE B C   1 
ATOM   3778 O  O   . ILE B 1 195 ? 63.051  13.141 47.438  1.00 15.65 ? 195  ILE B O   1 
ATOM   3779 C  CB  . ILE B 1 195 ? 65.657  12.491 45.897  1.00 16.13 ? 195  ILE B CB  1 
ATOM   3780 C  CG1 . ILE B 1 195 ? 66.919  11.643 45.688  1.00 16.82 ? 195  ILE B CG1 1 
ATOM   3781 C  CG2 . ILE B 1 195 ? 65.754  13.815 45.153  1.00 16.87 ? 195  ILE B CG2 1 
ATOM   3782 C  CD1 . ILE B 1 195 ? 68.208  12.333 46.046  1.00 16.00 ? 195  ILE B CD1 1 
ATOM   3783 N  N   . LYS B 1 196 ? 64.376  14.895 47.886  1.00 15.28 ? 196  LYS B N   1 
ATOM   3784 C  CA  . LYS B 1 196 ? 63.254  15.814 48.051  1.00 16.60 ? 196  LYS B CA  1 
ATOM   3785 C  C   . LYS B 1 196 ? 62.770  16.215 46.675  1.00 15.33 ? 196  LYS B C   1 
ATOM   3786 O  O   . LYS B 1 196 ? 63.552  16.688 45.859  1.00 15.70 ? 196  LYS B O   1 
ATOM   3787 C  CB  . LYS B 1 196 ? 63.675  17.073 48.815  1.00 17.39 ? 196  LYS B CB  1 
ATOM   3788 C  CG  . LYS B 1 196 ? 62.512  18.002 49.170  1.00 18.16 ? 196  LYS B CG  1 
ATOM   3789 C  CD  . LYS B 1 196 ? 61.445  17.254 49.968  1.00 18.80 ? 196  LYS B CD  1 
ATOM   3790 C  CE  . LYS B 1 196 ? 60.342  18.176 50.481  1.00 19.30 ? 196  LYS B CE  1 
ATOM   3791 N  NZ  . LYS B 1 196 ? 59.291  17.402 51.220  1.00 21.93 ? 196  LYS B NZ  1 
ATOM   3792 N  N   . TYR B 1 197 ? 61.479  16.038 46.424  1.00 15.45 ? 197  TYR B N   1 
ATOM   3793 C  CA  . TYR B 1 197 ? 60.916  16.379 45.125  1.00 14.84 ? 197  TYR B CA  1 
ATOM   3794 C  C   . TYR B 1 197 ? 59.423  16.685 45.194  1.00 14.07 ? 197  TYR B C   1 
ATOM   3795 O  O   . TYR B 1 197 ? 58.713  16.261 46.108  1.00 15.01 ? 197  TYR B O   1 
ATOM   3796 C  CB  . TYR B 1 197 ? 61.179  15.236 44.115  1.00 13.69 ? 197  TYR B CB  1 
ATOM   3797 C  CG  . TYR B 1 197 ? 60.430  13.945 44.391  1.00 15.47 ? 197  TYR B CG  1 
ATOM   3798 C  CD1 . TYR B 1 197 ? 59.141  13.742 43.891  1.00 15.54 ? 197  TYR B CD1 1 
ATOM   3799 C  CD2 . TYR B 1 197 ? 60.977  12.958 45.217  1.00 15.64 ? 197  TYR B CD2 1 
ATOM   3800 C  CE1 . TYR B 1 197 ? 58.414  12.604 44.212  1.00 14.90 ? 197  TYR B CE1 1 
ATOM   3801 C  CE2 . TYR B 1 197 ? 60.254  11.811 45.547  1.00 15.70 ? 197  TYR B CE2 1 
ATOM   3802 C  CZ  . TYR B 1 197 ? 58.970  11.647 45.044  1.00 16.08 ? 197  TYR B CZ  1 
ATOM   3803 O  OH  . TYR B 1 197 ? 58.219  10.563 45.422  1.00 16.32 ? 197  TYR B OH  1 
ATOM   3804 N  N   . PHE B 1 198 ? 58.956  17.445 44.218  1.00 13.63 ? 198  PHE B N   1 
ATOM   3805 C  CA  . PHE B 1 198 ? 57.548  17.793 44.127  1.00 12.61 ? 198  PHE B CA  1 
ATOM   3806 C  C   . PHE B 1 198 ? 57.154  17.529 42.685  1.00 11.98 ? 198  PHE B C   1 
ATOM   3807 O  O   . PHE B 1 198 ? 57.385  18.355 41.805  1.00 13.28 ? 198  PHE B O   1 
ATOM   3808 C  CB  . PHE B 1 198 ? 57.315  19.270 44.481  1.00 10.90 ? 198  PHE B CB  1 
ATOM   3809 C  CG  . PHE B 1 198 ? 57.581  19.604 45.930  1.00 10.11 ? 198  PHE B CG  1 
ATOM   3810 C  CD1 . PHE B 1 198 ? 58.846  20.000 46.348  1.00 7.12  ? 198  PHE B CD1 1 
ATOM   3811 C  CD2 . PHE B 1 198 ? 56.565  19.514 46.877  1.00 11.41 ? 198  PHE B CD2 1 
ATOM   3812 C  CE1 . PHE B 1 198 ? 59.098  20.303 47.688  1.00 7.23  ? 198  PHE B CE1 1 
ATOM   3813 C  CE2 . PHE B 1 198 ? 56.811  19.816 48.227  1.00 11.83 ? 198  PHE B CE2 1 
ATOM   3814 C  CZ  . PHE B 1 198 ? 58.078  20.211 48.628  1.00 5.66  ? 198  PHE B CZ  1 
ATOM   3815 N  N   . SER B 1 199 ? 56.600  16.354 42.435  1.00 11.21 ? 199  SER B N   1 
ATOM   3816 C  CA  . SER B 1 199 ? 56.185  16.012 41.087  1.00 9.48  ? 199  SER B CA  1 
ATOM   3817 C  C   . SER B 1 199 ? 54.912  16.804 40.828  1.00 10.35 ? 199  SER B C   1 
ATOM   3818 O  O   . SER B 1 199 ? 54.455  17.551 41.698  1.00 9.29  ? 199  SER B O   1 
ATOM   3819 C  CB  . SER B 1 199 ? 55.922  14.508 40.976  1.00 7.80  ? 199  SER B CB  1 
ATOM   3820 O  OG  . SER B 1 199 ? 54.746  14.153 41.673  1.00 8.89  ? 199  SER B OG  1 
ATOM   3821 N  N   . MET B 1 200 ? 54.336  16.655 39.641  1.00 13.26 ? 200  MET B N   1 
ATOM   3822 C  CA  . MET B 1 200 ? 53.114  17.385 39.320  1.00 13.70 ? 200  MET B CA  1 
ATOM   3823 C  C   . MET B 1 200 ? 51.967  17.014 40.254  1.00 12.85 ? 200  MET B C   1 
ATOM   3824 O  O   . MET B 1 200 ? 51.043  17.805 40.449  1.00 14.28 ? 200  MET B O   1 
ATOM   3825 C  CB  . MET B 1 200 ? 52.721  17.156 37.862  1.00 12.77 ? 200  MET B CB  1 
ATOM   3826 C  CG  . MET B 1 200 ? 53.690  17.809 36.875  1.00 13.53 ? 200  MET B CG  1 
ATOM   3827 S  SD  . MET B 1 200 ? 54.008  19.572 37.244  1.00 13.59 ? 200  MET B SD  1 
ATOM   3828 C  CE  . MET B 1 200 ? 52.516  20.317 36.663  1.00 10.17 ? 200  MET B CE  1 
ATOM   3829 N  N   . THR B 1 201 ? 52.033  15.821 40.839  1.00 12.13 ? 201  THR B N   1 
ATOM   3830 C  CA  . THR B 1 201 ? 50.998  15.379 41.771  1.00 11.68 ? 201  THR B CA  1 
ATOM   3831 C  C   . THR B 1 201 ? 51.015  16.273 43.018  1.00 10.21 ? 201  THR B C   1 
ATOM   3832 O  O   . THR B 1 201 ? 49.970  16.692 43.500  1.00 9.67  ? 201  THR B O   1 
ATOM   3833 C  CB  . THR B 1 201 ? 51.202  13.888 42.193  1.00 11.71 ? 201  THR B CB  1 
ATOM   3834 O  OG1 . THR B 1 201 ? 51.244  13.056 41.026  1.00 11.83 ? 201  THR B OG1 1 
ATOM   3835 C  CG2 . THR B 1 201 ? 50.044  13.410 43.086  1.00 11.19 ? 201  THR B CG2 1 
ATOM   3836 N  N   . GLU B 1 202 ? 52.208  16.576 43.520  1.00 10.80 ? 202  GLU B N   1 
ATOM   3837 C  CA  . GLU B 1 202 ? 52.368  17.422 44.705  1.00 12.20 ? 202  GLU B CA  1 
ATOM   3838 C  C   . GLU B 1 202 ? 52.012  18.883 44.462  1.00 12.13 ? 202  GLU B C   1 
ATOM   3839 O  O   . GLU B 1 202 ? 51.555  19.566 45.383  1.00 12.46 ? 202  GLU B O   1 
ATOM   3840 C  CB  . GLU B 1 202 ? 53.804  17.342 45.240  1.00 11.65 ? 202  GLU B CB  1 
ATOM   3841 C  CG  . GLU B 1 202 ? 54.134  16.031 45.917  1.00 12.29 ? 202  GLU B CG  1 
ATOM   3842 C  CD  . GLU B 1 202 ? 54.189  14.872 44.950  1.00 14.10 ? 202  GLU B CD  1 
ATOM   3843 O  OE1 . GLU B 1 202 ? 55.098  14.864 44.098  1.00 14.83 ? 202  GLU B OE1 1 
ATOM   3844 O  OE2 . GLU B 1 202 ? 53.330  13.971 45.038  1.00 14.13 ? 202  GLU B OE2 1 
ATOM   3845 N  N   . VAL B 1 203 ? 52.238  19.361 43.238  1.00 12.89 ? 203  VAL B N   1 
ATOM   3846 C  CA  . VAL B 1 203 ? 51.908  20.740 42.870  1.00 12.22 ? 203  VAL B CA  1 
ATOM   3847 C  C   . VAL B 1 203 ? 50.388  20.864 42.776  1.00 13.71 ? 203  VAL B C   1 
ATOM   3848 O  O   . VAL B 1 203 ? 49.826  21.922 43.077  1.00 15.41 ? 203  VAL B O   1 
ATOM   3849 C  CB  . VAL B 1 203 ? 52.550  21.145 41.505  1.00 12.87 ? 203  VAL B CB  1 
ATOM   3850 C  CG1 . VAL B 1 203 ? 52.161  22.580 41.133  1.00 8.76  ? 203  VAL B CG1 1 
ATOM   3851 C  CG2 . VAL B 1 203 ? 54.070  21.038 41.597  1.00 13.39 ? 203  VAL B CG2 1 
ATOM   3852 N  N   . ASP B 1 204 ? 49.721  19.786 42.357  1.00 14.20 ? 204  ASP B N   1 
ATOM   3853 C  CA  . ASP B 1 204 ? 48.252  19.780 42.263  1.00 15.12 ? 204  ASP B CA  1 
ATOM   3854 C  C   . ASP B 1 204 ? 47.661  19.748 43.671  1.00 15.56 ? 204  ASP B C   1 
ATOM   3855 O  O   . ASP B 1 204 ? 46.694  20.450 43.970  1.00 17.89 ? 204  ASP B O   1 
ATOM   3856 C  CB  . ASP B 1 204 ? 47.728  18.551 41.508  1.00 12.43 ? 204  ASP B CB  1 
ATOM   3857 C  CG  . ASP B 1 204 ? 48.030  18.591 40.030  1.00 10.39 ? 204  ASP B CG  1 
ATOM   3858 O  OD1 . ASP B 1 204 ? 48.244  19.687 39.488  1.00 11.89 ? 204  ASP B OD1 1 
ATOM   3859 O  OD2 . ASP B 1 204 ? 48.034  17.517 39.404  1.00 10.36 ? 204  ASP B OD2 1 
ATOM   3860 N  N   . ARG B 1 205 ? 48.259  18.921 44.523  1.00 15.28 ? 205  ARG B N   1 
ATOM   3861 C  CA  . ARG B 1 205 ? 47.830  18.752 45.907  1.00 14.05 ? 205  ARG B CA  1 
ATOM   3862 C  C   . ARG B 1 205 ? 48.013  19.981 46.796  1.00 13.26 ? 205  ARG B C   1 
ATOM   3863 O  O   . ARG B 1 205 ? 47.089  20.407 47.484  1.00 11.01 ? 205  ARG B O   1 
ATOM   3864 C  CB  . ARG B 1 205 ? 48.595  17.588 46.529  1.00 14.77 ? 205  ARG B CB  1 
ATOM   3865 C  CG  . ARG B 1 205 ? 48.219  17.273 47.977  1.00 18.14 ? 205  ARG B CG  1 
ATOM   3866 C  CD  . ARG B 1 205 ? 49.361  16.547 48.677  1.00 17.25 ? 205  ARG B CD  1 
ATOM   3867 N  NE  . ARG B 1 205 ? 49.889  15.475 47.840  1.00 23.53 ? 205  ARG B NE  1 
ATOM   3868 C  CZ  . ARG B 1 205 ? 49.227  14.361 47.547  1.00 22.64 ? 205  ARG B CZ  1 
ATOM   3869 N  NH1 . ARG B 1 205 ? 48.010  14.167 48.027  1.00 27.13 ? 205  ARG B NH1 1 
ATOM   3870 N  NH2 . ARG B 1 205 ? 49.774  13.446 46.763  1.00 23.75 ? 205  ARG B NH2 1 
ATOM   3871 N  N   . LEU B 1 206 ? 49.211  20.553 46.773  1.00 13.86 ? 206  LEU B N   1 
ATOM   3872 C  CA  . LEU B 1 206 ? 49.528  21.698 47.621  1.00 15.15 ? 206  LEU B CA  1 
ATOM   3873 C  C   . LEU B 1 206 ? 49.404  23.068 46.969  1.00 15.78 ? 206  LEU B C   1 
ATOM   3874 O  O   . LEU B 1 206 ? 49.036  24.047 47.623  1.00 16.00 ? 206  LEU B O   1 
ATOM   3875 C  CB  . LEU B 1 206 ? 50.951  21.534 48.164  1.00 16.63 ? 206  LEU B CB  1 
ATOM   3876 C  CG  . LEU B 1 206 ? 51.232  20.156 48.763  1.00 15.97 ? 206  LEU B CG  1 
ATOM   3877 C  CD1 . LEU B 1 206 ? 52.706  20.024 49.123  1.00 17.71 ? 206  LEU B CD1 1 
ATOM   3878 C  CD2 . LEU B 1 206 ? 50.345  19.951 49.989  1.00 17.52 ? 206  LEU B CD2 1 
ATOM   3879 N  N   . GLY B 1 207 ? 49.706  23.131 45.679  1.00 15.88 ? 207  GLY B N   1 
ATOM   3880 C  CA  . GLY B 1 207 ? 49.670  24.396 44.977  1.00 15.64 ? 207  GLY B CA  1 
ATOM   3881 C  C   . GLY B 1 207 ? 51.116  24.842 44.907  1.00 15.07 ? 207  GLY B C   1 
ATOM   3882 O  O   . GLY B 1 207 ? 51.903  24.464 45.768  1.00 12.45 ? 207  GLY B O   1 
ATOM   3883 N  N   . ILE B 1 208 ? 51.464  25.640 43.897  1.00 15.14 ? 208  ILE B N   1 
ATOM   3884 C  CA  . ILE B 1 208 ? 52.841  26.111 43.712  1.00 13.93 ? 208  ILE B CA  1 
ATOM   3885 C  C   . ILE B 1 208 ? 53.329  27.029 44.843  1.00 11.89 ? 208  ILE B C   1 
ATOM   3886 O  O   . ILE B 1 208 ? 54.525  27.098 45.118  1.00 11.97 ? 208  ILE B O   1 
ATOM   3887 C  CB  . ILE B 1 208 ? 52.986  26.836 42.335  1.00 13.30 ? 208  ILE B CB  1 
ATOM   3888 C  CG1 . ILE B 1 208 ? 54.467  26.949 41.936  1.00 10.81 ? 208  ILE B CG1 1 
ATOM   3889 C  CG2 . ILE B 1 208 ? 52.314  28.204 42.391  1.00 11.92 ? 208  ILE B CG2 1 
ATOM   3890 C  CD1 . ILE B 1 208 ? 55.156  25.624 41.726  1.00 9.98  ? 208  ILE B CD1 1 
ATOM   3891 N  N   . GLY B 1 209 ? 52.404  27.726 45.497  1.00 12.84 ? 209  GLY B N   1 
ATOM   3892 C  CA  . GLY B 1 209 ? 52.775  28.610 46.592  1.00 13.32 ? 209  GLY B CA  1 
ATOM   3893 C  C   . GLY B 1 209 ? 53.373  27.844 47.764  1.00 13.31 ? 209  GLY B C   1 
ATOM   3894 O  O   . GLY B 1 209 ? 54.445  28.179 48.268  1.00 11.65 ? 209  GLY B O   1 
ATOM   3895 N  N   . LYS B 1 210 ? 52.670  26.800 48.190  1.00 15.74 ? 210  LYS B N   1 
ATOM   3896 C  CA  . LYS B 1 210 ? 53.116  25.964 49.298  1.00 18.12 ? 210  LYS B CA  1 
ATOM   3897 C  C   . LYS B 1 210 ? 54.349  25.162 48.881  1.00 18.35 ? 210  LYS B C   1 
ATOM   3898 O  O   . LYS B 1 210 ? 55.295  25.003 49.659  1.00 19.77 ? 210  LYS B O   1 
ATOM   3899 C  CB  . LYS B 1 210 ? 51.993  25.009 49.712  1.00 20.28 ? 210  LYS B CB  1 
ATOM   3900 C  CG  . LYS B 1 210 ? 52.282  24.197 50.958  1.00 24.17 ? 210  LYS B CG  1 
ATOM   3901 C  CD  . LYS B 1 210 ? 52.045  25.010 52.219  1.00 27.39 ? 210  LYS B CD  1 
ATOM   3902 C  CE  . LYS B 1 210 ? 52.562  24.273 53.446  1.00 28.99 ? 210  LYS B CE  1 
ATOM   3903 N  NZ  . LYS B 1 210 ? 54.053  24.164 53.431  1.00 31.19 ? 210  LYS B NZ  1 
ATOM   3904 N  N   . VAL B 1 211 ? 54.332  24.656 47.650  1.00 18.27 ? 211  VAL B N   1 
ATOM   3905 C  CA  . VAL B 1 211 ? 55.449  23.876 47.117  1.00 16.63 ? 211  VAL B CA  1 
ATOM   3906 C  C   . VAL B 1 211 ? 56.754  24.668 47.191  1.00 17.13 ? 211  VAL B C   1 
ATOM   3907 O  O   . VAL B 1 211 ? 57.771  24.154 47.651  1.00 17.71 ? 211  VAL B O   1 
ATOM   3908 C  CB  . VAL B 1 211 ? 55.187  23.458 45.641  1.00 16.52 ? 211  VAL B CB  1 
ATOM   3909 C  CG1 . VAL B 1 211 ? 56.489  23.049 44.962  1.00 15.20 ? 211  VAL B CG1 1 
ATOM   3910 C  CG2 . VAL B 1 211 ? 54.188  22.300 45.598  1.00 14.95 ? 211  VAL B CG2 1 
ATOM   3911 N  N   . MET B 1 212 ? 56.724  25.915 46.727  1.00 16.09 ? 212  MET B N   1 
ATOM   3912 C  CA  . MET B 1 212 ? 57.909  26.761 46.756  1.00 16.67 ? 212  MET B CA  1 
ATOM   3913 C  C   . MET B 1 212 ? 58.321  27.019 48.199  1.00 17.91 ? 212  MET B C   1 
ATOM   3914 O  O   . MET B 1 212 ? 59.483  26.862 48.576  1.00 17.87 ? 212  MET B O   1 
ATOM   3915 C  CB  . MET B 1 212 ? 57.634  28.090 46.035  1.00 16.93 ? 212  MET B CB  1 
ATOM   3916 C  CG  . MET B 1 212 ? 57.814  28.015 44.523  1.00 13.38 ? 212  MET B CG  1 
ATOM   3917 S  SD  . MET B 1 212 ? 59.385  27.190 44.121  1.00 14.87 ? 212  MET B SD  1 
ATOM   3918 C  CE  . MET B 1 212 ? 60.561  28.317 44.835  1.00 15.22 ? 212  MET B CE  1 
ATOM   3919 N  N   . GLU B 1 213 ? 57.348  27.406 49.008  1.00 19.04 ? 213  GLU B N   1 
ATOM   3920 C  CA  . GLU B 1 213 ? 57.588  27.678 50.412  1.00 19.30 ? 213  GLU B CA  1 
ATOM   3921 C  C   . GLU B 1 213 ? 58.395  26.518 51.004  1.00 18.27 ? 213  GLU B C   1 
ATOM   3922 O  O   . GLU B 1 213 ? 59.374  26.738 51.715  1.00 16.08 ? 213  GLU B O   1 
ATOM   3923 C  CB  . GLU B 1 213 ? 56.237  27.835 51.110  1.00 21.68 ? 213  GLU B CB  1 
ATOM   3924 C  CG  . GLU B 1 213 ? 56.278  28.393 52.513  1.00 24.45 ? 213  GLU B CG  1 
ATOM   3925 C  CD  . GLU B 1 213 ? 54.894  28.791 52.985  1.00 25.77 ? 213  GLU B CD  1 
ATOM   3926 O  OE1 . GLU B 1 213 ? 54.413  29.867 52.567  1.00 27.81 ? 213  GLU B OE1 1 
ATOM   3927 O  OE2 . GLU B 1 213 ? 54.281  28.021 53.753  1.00 26.16 ? 213  GLU B OE2 1 
ATOM   3928 N  N   . GLU B 1 214 ? 57.998  25.289 50.672  1.00 18.21 ? 214  GLU B N   1 
ATOM   3929 C  CA  . GLU B 1 214 ? 58.668  24.089 51.158  1.00 17.16 ? 214  GLU B CA  1 
ATOM   3930 C  C   . GLU B 1 214 ? 60.050  23.802 50.563  1.00 17.34 ? 214  GLU B C   1 
ATOM   3931 O  O   . GLU B 1 214 ? 60.955  23.393 51.284  1.00 18.28 ? 214  GLU B O   1 
ATOM   3932 C  CB  . GLU B 1 214 ? 57.789  22.859 50.935  1.00 19.12 ? 214  GLU B CB  1 
ATOM   3933 C  CG  . GLU B 1 214 ? 56.597  22.732 51.857  1.00 22.45 ? 214  GLU B CG  1 
ATOM   3934 C  CD  . GLU B 1 214 ? 55.985  21.335 51.815  1.00 24.69 ? 214  GLU B CD  1 
ATOM   3935 O  OE1 . GLU B 1 214 ? 56.733  20.345 51.981  1.00 25.93 ? 214  GLU B OE1 1 
ATOM   3936 O  OE2 . GLU B 1 214 ? 54.758  21.221 51.621  1.00 28.03 ? 214  GLU B OE2 1 
ATOM   3937 N  N   . THR B 1 215 ? 60.229  23.991 49.259  1.00 18.14 ? 215  THR B N   1 
ATOM   3938 C  CA  . THR B 1 215 ? 61.539  23.709 48.669  1.00 18.18 ? 215  THR B CA  1 
ATOM   3939 C  C   . THR B 1 215 ? 62.587  24.642 49.268  1.00 18.29 ? 215  THR B C   1 
ATOM   3940 O  O   . THR B 1 215 ? 63.734  24.247 49.490  1.00 16.32 ? 215  THR B O   1 
ATOM   3941 C  CB  . THR B 1 215 ? 61.574  23.902 47.117  1.00 18.71 ? 215  THR B CB  1 
ATOM   3942 O  OG1 . THR B 1 215 ? 61.548  25.299 46.814  1.00 18.98 ? 215  THR B OG1 1 
ATOM   3943 C  CG2 . THR B 1 215 ? 60.397  23.208 46.439  1.00 13.16 ? 215  THR B CG2 1 
ATOM   3944 N  N   . LEU B 1 216 ? 62.178  25.884 49.524  1.00 19.54 ? 216  LEU B N   1 
ATOM   3945 C  CA  . LEU B 1 216 ? 63.066  26.902 50.079  1.00 20.51 ? 216  LEU B CA  1 
ATOM   3946 C  C   . LEU B 1 216 ? 63.425  26.642 51.543  1.00 20.53 ? 216  LEU B C   1 
ATOM   3947 O  O   . LEU B 1 216 ? 64.568  26.837 51.950  1.00 20.47 ? 216  LEU B O   1 
ATOM   3948 C  CB  . LEU B 1 216 ? 62.430  28.296 49.918  1.00 20.07 ? 216  LEU B CB  1 
ATOM   3949 C  CG  . LEU B 1 216 ? 62.287  28.792 48.471  1.00 20.82 ? 216  LEU B CG  1 
ATOM   3950 C  CD1 . LEU B 1 216 ? 61.584  30.154 48.417  1.00 20.05 ? 216  LEU B CD1 1 
ATOM   3951 C  CD2 . LEU B 1 216 ? 63.669  28.883 47.843  1.00 21.42 ? 216  LEU B CD2 1 
ATOM   3952 N  N   . SER B 1 217 ? 62.451  26.199 52.331  1.00 22.59 ? 217  SER B N   1 
ATOM   3953 C  CA  . SER B 1 217 ? 62.702  25.911 53.735  1.00 21.96 ? 217  SER B CA  1 
ATOM   3954 C  C   . SER B 1 217 ? 63.511  24.627 53.814  1.00 22.14 ? 217  SER B C   1 
ATOM   3955 O  O   . SER B 1 217 ? 64.278  24.423 54.756  1.00 22.57 ? 217  SER B O   1 
ATOM   3956 C  CB  . SER B 1 217 ? 61.385  25.754 54.501  1.00 24.57 ? 217  SER B CB  1 
ATOM   3957 O  OG  . SER B 1 217 ? 60.621  24.676 53.991  1.00 31.08 ? 217  SER B OG  1 
ATOM   3958 N  N   . TYR B 1 218 ? 63.334  23.757 52.824  1.00 21.31 ? 218  TYR B N   1 
ATOM   3959 C  CA  . TYR B 1 218 ? 64.085  22.508 52.789  1.00 21.55 ? 218  TYR B CA  1 
ATOM   3960 C  C   . TYR B 1 218 ? 65.548  22.811 52.474  1.00 21.39 ? 218  TYR B C   1 
ATOM   3961 O  O   . TYR B 1 218 ? 66.450  22.326 53.151  1.00 23.43 ? 218  TYR B O   1 
ATOM   3962 C  CB  . TYR B 1 218 ? 63.534  21.547 51.730  1.00 20.15 ? 218  TYR B CB  1 
ATOM   3963 C  CG  . TYR B 1 218 ? 64.331  20.260 51.645  1.00 19.84 ? 218  TYR B CG  1 
ATOM   3964 C  CD1 . TYR B 1 218 ? 64.188  19.268 52.612  1.00 20.89 ? 218  TYR B CD1 1 
ATOM   3965 C  CD2 . TYR B 1 218 ? 65.262  20.053 50.624  1.00 18.52 ? 218  TYR B CD2 1 
ATOM   3966 C  CE1 . TYR B 1 218 ? 64.953  18.098 52.568  1.00 21.43 ? 218  TYR B CE1 1 
ATOM   3967 C  CE2 . TYR B 1 218 ? 66.031  18.892 50.570  1.00 19.20 ? 218  TYR B CE2 1 
ATOM   3968 C  CZ  . TYR B 1 218 ? 65.869  17.917 51.546  1.00 20.61 ? 218  TYR B CZ  1 
ATOM   3969 O  OH  . TYR B 1 218 ? 66.602  16.757 51.501  1.00 21.07 ? 218  TYR B OH  1 
ATOM   3970 N  N   . LEU B 1 219 ? 65.784  23.622 51.449  1.00 22.07 ? 219  LEU B N   1 
ATOM   3971 C  CA  . LEU B 1 219 ? 67.147  23.965 51.072  1.00 23.95 ? 219  LEU B CA  1 
ATOM   3972 C  C   . LEU B 1 219 ? 67.793  25.035 51.944  1.00 25.42 ? 219  LEU B C   1 
ATOM   3973 O  O   . LEU B 1 219 ? 69.020  25.071 52.068  1.00 26.30 ? 219  LEU B O   1 
ATOM   3974 C  CB  . LEU B 1 219 ? 67.206  24.417 49.612  1.00 22.90 ? 219  LEU B CB  1 
ATOM   3975 C  CG  . LEU B 1 219 ? 67.019  23.340 48.547  1.00 21.35 ? 219  LEU B CG  1 
ATOM   3976 C  CD1 . LEU B 1 219 ? 67.320  23.949 47.194  1.00 21.83 ? 219  LEU B CD1 1 
ATOM   3977 C  CD2 . LEU B 1 219 ? 67.935  22.164 48.811  1.00 18.99 ? 219  LEU B CD2 1 
ATOM   3978 N  N   . LEU B 1 220 ? 66.983  25.906 52.538  1.00 25.05 ? 220  LEU B N   1 
ATOM   3979 C  CA  . LEU B 1 220 ? 67.519  26.970 53.381  1.00 27.68 ? 220  LEU B CA  1 
ATOM   3980 C  C   . LEU B 1 220 ? 67.060  26.817 54.823  1.00 29.96 ? 220  LEU B C   1 
ATOM   3981 O  O   . LEU B 1 220 ? 66.690  27.790 55.482  1.00 29.96 ? 220  LEU B O   1 
ATOM   3982 C  CB  . LEU B 1 220 ? 67.096  28.332 52.832  1.00 27.38 ? 220  LEU B CB  1 
ATOM   3983 C  CG  . LEU B 1 220 ? 67.479  28.553 51.365  1.00 28.97 ? 220  LEU B CG  1 
ATOM   3984 C  CD1 . LEU B 1 220 ? 66.962  29.898 50.886  1.00 28.14 ? 220  LEU B CD1 1 
ATOM   3985 C  CD2 . LEU B 1 220 ? 68.998  28.463 51.214  1.00 28.16 ? 220  LEU B CD2 1 
ATOM   3986 N  N   . GLY B 1 221 ? 67.089  25.578 55.305  1.00 32.45 ? 221  GLY B N   1 
ATOM   3987 C  CA  . GLY B 1 221 ? 66.680  25.299 56.668  1.00 35.01 ? 221  GLY B CA  1 
ATOM   3988 C  C   . GLY B 1 221 ? 67.738  25.732 57.659  1.00 36.10 ? 221  GLY B C   1 
ATOM   3989 O  O   . GLY B 1 221 ? 67.564  26.725 58.364  1.00 36.48 ? 221  GLY B O   1 
ATOM   3990 N  N   . ARG B 1 222 ? 68.837  24.985 57.711  1.00 37.82 ? 222  ARG B N   1 
ATOM   3991 C  CA  . ARG B 1 222 ? 69.944  25.290 58.616  1.00 39.37 ? 222  ARG B CA  1 
ATOM   3992 C  C   . ARG B 1 222 ? 70.349  26.760 58.509  1.00 39.18 ? 222  ARG B C   1 
ATOM   3993 O  O   . ARG B 1 222 ? 70.106  27.563 59.419  1.00 39.83 ? 222  ARG B O   1 
ATOM   3994 C  CB  . ARG B 1 222 ? 71.157  24.415 58.283  1.00 40.52 ? 222  ARG B CB  1 
ATOM   3995 C  CG  . ARG B 1 222 ? 70.929  22.916 58.414  1.00 42.01 ? 222  ARG B CG  1 
ATOM   3996 C  CD  . ARG B 1 222 ? 71.683  22.342 59.608  1.00 42.98 ? 222  ARG B CD  1 
ATOM   3997 N  NE  . ARG B 1 222 ? 71.897  20.901 59.477  1.00 43.35 ? 222  ARG B NE  1 
ATOM   3998 C  CZ  . ARG B 1 222 ? 72.552  20.150 60.360  1.00 42.69 ? 222  ARG B CZ  1 
ATOM   3999 N  NH1 . ARG B 1 222 ? 73.065  20.697 61.457  1.00 40.45 ? 222  ARG B NH1 1 
ATOM   4000 N  NH2 . ARG B 1 222 ? 72.700  18.848 60.141  1.00 42.14 ? 222  ARG B NH2 1 
ATOM   4001 N  N   . LYS B 1 223 ? 70.971  27.098 57.384  1.00 37.95 ? 223  LYS B N   1 
ATOM   4002 C  CA  . LYS B 1 223 ? 71.428  28.456 57.136  1.00 37.38 ? 223  LYS B CA  1 
ATOM   4003 C  C   . LYS B 1 223 ? 71.143  28.810 55.685  1.00 35.80 ? 223  LYS B C   1 
ATOM   4004 O  O   . LYS B 1 223 ? 70.696  27.966 54.903  1.00 35.72 ? 223  LYS B O   1 
ATOM   4005 C  CB  . LYS B 1 223 ? 72.936  28.557 57.387  1.00 39.05 ? 223  LYS B CB  1 
ATOM   4006 C  CG  . LYS B 1 223 ? 73.414  27.920 58.692  1.00 41.96 ? 223  LYS B CG  1 
ATOM   4007 C  CD  . LYS B 1 223 ? 72.904  28.662 59.923  1.00 41.76 ? 223  LYS B CD  1 
ATOM   4008 C  CE  . LYS B 1 223 ? 73.266  27.909 61.187  1.00 42.82 ? 223  LYS B CE  1 
ATOM   4009 N  NZ  . LYS B 1 223 ? 72.668  26.539 61.184  1.00 44.42 ? 223  LYS B NZ  1 
ATOM   4010 N  N   . LYS B 1 224 ? 71.397  30.063 55.327  1.00 33.28 ? 224  LYS B N   1 
ATOM   4011 C  CA  . LYS B 1 224 ? 71.190  30.490 53.955  1.00 31.36 ? 224  LYS B CA  1 
ATOM   4012 C  C   . LYS B 1 224 ? 72.416  30.014 53.193  1.00 28.64 ? 224  LYS B C   1 
ATOM   4013 O  O   . LYS B 1 224 ? 73.469  29.805 53.790  1.00 27.75 ? 224  LYS B O   1 
ATOM   4014 C  CB  . LYS B 1 224 ? 71.057  32.014 53.872  1.00 32.11 ? 224  LYS B CB  1 
ATOM   4015 C  CG  . LYS B 1 224 ? 69.680  32.563 54.255  1.00 34.99 ? 224  LYS B CG  1 
ATOM   4016 C  CD  . LYS B 1 224 ? 69.266  32.181 55.673  1.00 37.82 ? 224  LYS B CD  1 
ATOM   4017 C  CE  . LYS B 1 224 ? 68.632  30.794 55.725  1.00 38.30 ? 224  LYS B CE  1 
ATOM   4018 N  NZ  . LYS B 1 224 ? 68.532  30.288 57.122  1.00 39.57 ? 224  LYS B NZ  1 
ATOM   4019 N  N   . ARG B 1 225 ? 72.269  29.821 51.886  1.00 25.90 ? 225  ARG B N   1 
ATOM   4020 C  CA  . ARG B 1 225 ? 73.368  29.360 51.054  1.00 22.47 ? 225  ARG B CA  1 
ATOM   4021 C  C   . ARG B 1 225 ? 73.114  29.693 49.594  1.00 21.83 ? 225  ARG B C   1 
ATOM   4022 O  O   . ARG B 1 225 ? 71.986  29.983 49.201  1.00 22.99 ? 225  ARG B O   1 
ATOM   4023 C  CB  . ARG B 1 225 ? 73.544  27.855 51.220  1.00 23.55 ? 225  ARG B CB  1 
ATOM   4024 C  CG  . ARG B 1 225 ? 72.245  27.070 51.172  1.00 23.52 ? 225  ARG B CG  1 
ATOM   4025 C  CD  . ARG B 1 225 ? 72.544  25.590 51.215  1.00 26.48 ? 225  ARG B CD  1 
ATOM   4026 N  NE  . ARG B 1 225 ? 71.346  24.761 51.237  1.00 24.77 ? 225  ARG B NE  1 
ATOM   4027 C  CZ  . ARG B 1 225 ? 71.344  23.461 50.967  1.00 25.26 ? 225  ARG B CZ  1 
ATOM   4028 N  NH1 . ARG B 1 225 ? 72.475  22.847 50.649  1.00 25.37 ? 225  ARG B NH1 1 
ATOM   4029 N  NH2 . ARG B 1 225 ? 70.211  22.773 51.017  1.00 25.92 ? 225  ARG B NH2 1 
ATOM   4030 N  N   . PRO B 1 226 ? 74.164  29.657 48.763  1.00 20.24 ? 226  PRO B N   1 
ATOM   4031 C  CA  . PRO B 1 226 ? 73.987  29.966 47.344  1.00 19.27 ? 226  PRO B CA  1 
ATOM   4032 C  C   . PRO B 1 226 ? 73.023  28.994 46.663  1.00 18.68 ? 226  PRO B C   1 
ATOM   4033 O  O   . PRO B 1 226 ? 73.072  27.788 46.910  1.00 16.96 ? 226  PRO B O   1 
ATOM   4034 C  CB  . PRO B 1 226 ? 75.407  29.855 46.795  1.00 21.03 ? 226  PRO B CB  1 
ATOM   4035 C  CG  . PRO B 1 226 ? 76.261  30.223 47.986  1.00 17.54 ? 226  PRO B CG  1 
ATOM   4036 C  CD  . PRO B 1 226 ? 75.588  29.452 49.079  1.00 18.54 ? 226  PRO B CD  1 
ATOM   4037 N  N   . ILE B 1 227 ? 72.148  29.523 45.811  1.00 17.45 ? 227  ILE B N   1 
ATOM   4038 C  CA  . ILE B 1 227 ? 71.188  28.691 45.092  1.00 18.13 ? 227  ILE B CA  1 
ATOM   4039 C  C   . ILE B 1 227 ? 71.574  28.517 43.627  1.00 17.55 ? 227  ILE B C   1 
ATOM   4040 O  O   . ILE B 1 227 ? 72.105  29.434 42.995  1.00 18.17 ? 227  ILE B O   1 
ATOM   4041 C  CB  . ILE B 1 227 ? 69.749  29.288 45.134  1.00 18.00 ? 227  ILE B CB  1 
ATOM   4042 C  CG1 . ILE B 1 227 ? 69.180  29.202 46.550  1.00 17.21 ? 227  ILE B CG1 1 
ATOM   4043 C  CG2 . ILE B 1 227 ? 68.833  28.534 44.151  1.00 16.79 ? 227  ILE B CG2 1 
ATOM   4044 C  CD1 . ILE B 1 227 ? 69.020  27.777 47.055  1.00 18.22 ? 227  ILE B CD1 1 
ATOM   4045 N  N   . HIS B 1 228 ? 71.308  27.326 43.103  1.00 17.10 ? 228  HIS B N   1 
ATOM   4046 C  CA  . HIS B 1 228 ? 71.570  27.015 41.705  1.00 15.26 ? 228  HIS B CA  1 
ATOM   4047 C  C   . HIS B 1 228 ? 70.270  26.499 41.096  1.00 15.79 ? 228  HIS B C   1 
ATOM   4048 O  O   . HIS B 1 228 ? 69.777  25.441 41.486  1.00 15.56 ? 228  HIS B O   1 
ATOM   4049 C  CB  . HIS B 1 228 ? 72.637  25.926 41.560  1.00 15.34 ? 228  HIS B CB  1 
ATOM   4050 C  CG  . HIS B 1 228 ? 72.964  25.606 40.136  1.00 14.65 ? 228  HIS B CG  1 
ATOM   4051 N  ND1 . HIS B 1 228 ? 74.024  26.181 39.468  1.00 16.68 ? 228  HIS B ND1 1 
ATOM   4052 C  CD2 . HIS B 1 228 ? 72.316  24.844 39.222  1.00 17.93 ? 228  HIS B CD2 1 
ATOM   4053 C  CE1 . HIS B 1 228 ? 74.012  25.790 38.206  1.00 16.31 ? 228  HIS B CE1 1 
ATOM   4054 N  NE2 . HIS B 1 228 ? 72.985  24.979 38.030  1.00 16.10 ? 228  HIS B NE2 1 
ATOM   4055 N  N   . LEU B 1 229 ? 69.711  27.239 40.144  1.00 15.07 ? 229  LEU B N   1 
ATOM   4056 C  CA  . LEU B 1 229 ? 68.472  26.813 39.498  1.00 14.43 ? 229  LEU B CA  1 
ATOM   4057 C  C   . LEU B 1 229 ? 68.767  26.195 38.122  1.00 14.27 ? 229  LEU B C   1 
ATOM   4058 O  O   . LEU B 1 229 ? 69.315  26.850 37.234  1.00 11.82 ? 229  LEU B O   1 
ATOM   4059 C  CB  . LEU B 1 229 ? 67.507  28.008 39.358  1.00 12.77 ? 229  LEU B CB  1 
ATOM   4060 C  CG  . LEU B 1 229 ? 66.145  27.818 38.667  1.00 12.62 ? 229  LEU B CG  1 
ATOM   4061 C  CD1 . LEU B 1 229 ? 65.284  26.807 39.424  1.00 13.38 ? 229  LEU B CD1 1 
ATOM   4062 C  CD2 . LEU B 1 229 ? 65.428  29.154 38.595  1.00 10.70 ? 229  LEU B CD2 1 
ATOM   4063 N  N   . SER B 1 230 ? 68.444  24.914 37.969  1.00 14.97 ? 230  SER B N   1 
ATOM   4064 C  CA  . SER B 1 230 ? 68.638  24.236 36.696  1.00 16.09 ? 230  SER B CA  1 
ATOM   4065 C  C   . SER B 1 230 ? 67.249  24.224 36.092  1.00 15.74 ? 230  SER B C   1 
ATOM   4066 O  O   . SER B 1 230 ? 66.391  23.454 36.509  1.00 14.25 ? 230  SER B O   1 
ATOM   4067 C  CB  . SER B 1 230 ? 69.145  22.809 36.905  1.00 18.38 ? 230  SER B CB  1 
ATOM   4068 O  OG  . SER B 1 230 ? 70.378  22.813 37.604  1.00 22.64 ? 230  SER B OG  1 
ATOM   4069 N  N   . PHE B 1 231 ? 67.022  25.102 35.125  1.00 15.87 ? 231  PHE B N   1 
ATOM   4070 C  CA  . PHE B 1 231 ? 65.713  25.196 34.516  1.00 16.18 ? 231  PHE B CA  1 
ATOM   4071 C  C   . PHE B 1 231 ? 65.635  24.534 33.146  1.00 16.50 ? 231  PHE B C   1 
ATOM   4072 O  O   . PHE B 1 231 ? 66.206  25.022 32.165  1.00 15.98 ? 231  PHE B O   1 
ATOM   4073 C  CB  . PHE B 1 231 ? 65.294  26.673 34.417  1.00 16.47 ? 231  PHE B CB  1 
ATOM   4074 C  CG  . PHE B 1 231 ? 63.807  26.880 34.304  1.00 16.70 ? 231  PHE B CG  1 
ATOM   4075 C  CD1 . PHE B 1 231 ? 63.105  26.444 33.187  1.00 17.64 ? 231  PHE B CD1 1 
ATOM   4076 C  CD2 . PHE B 1 231 ? 63.101  27.496 35.329  1.00 19.13 ? 231  PHE B CD2 1 
ATOM   4077 C  CE1 . PHE B 1 231 ? 61.722  26.617 33.097  1.00 18.30 ? 231  PHE B CE1 1 
ATOM   4078 C  CE2 . PHE B 1 231 ? 61.717  27.673 35.248  1.00 19.81 ? 231  PHE B CE2 1 
ATOM   4079 C  CZ  . PHE B 1 231 ? 61.027  27.232 34.130  1.00 16.72 ? 231  PHE B CZ  1 
ATOM   4080 N  N   . ASP B 1 232 ? 64.938  23.401 33.095  1.00 17.23 ? 232  ASP B N   1 
ATOM   4081 C  CA  . ASP B 1 232 ? 64.722  22.695 31.844  1.00 15.33 ? 232  ASP B CA  1 
ATOM   4082 C  C   . ASP B 1 232 ? 63.394  23.255 31.353  1.00 14.74 ? 232  ASP B C   1 
ATOM   4083 O  O   . ASP B 1 232 ? 62.400  23.269 32.078  1.00 13.66 ? 232  ASP B O   1 
ATOM   4084 C  CB  . ASP B 1 232 ? 64.601  21.184 32.047  1.00 14.73 ? 232  ASP B CB  1 
ATOM   4085 C  CG  . ASP B 1 232 ? 64.496  20.425 30.729  1.00 16.02 ? 232  ASP B CG  1 
ATOM   4086 O  OD1 . ASP B 1 232 ? 64.253  21.074 29.691  1.00 13.35 ? 232  ASP B OD1 1 
ATOM   4087 O  OD2 . ASP B 1 232 ? 64.644  19.180 30.728  1.00 16.96 ? 232  ASP B OD2 1 
ATOM   4088 N  N   . VAL B 1 233 ? 63.410  23.740 30.123  1.00 14.36 ? 233  VAL B N   1 
ATOM   4089 C  CA  . VAL B 1 233 ? 62.249  24.324 29.479  1.00 14.89 ? 233  VAL B CA  1 
ATOM   4090 C  C   . VAL B 1 233 ? 61.035  23.380 29.405  1.00 13.75 ? 233  VAL B C   1 
ATOM   4091 O  O   . VAL B 1 233 ? 59.887  23.834 29.426  1.00 11.29 ? 233  VAL B O   1 
ATOM   4092 C  CB  . VAL B 1 233 ? 62.669  24.799 28.069  1.00 16.98 ? 233  VAL B CB  1 
ATOM   4093 C  CG1 . VAL B 1 233 ? 61.468  25.117 27.221  1.00 19.38 ? 233  VAL B CG1 1 
ATOM   4094 C  CG2 . VAL B 1 233 ? 63.558  26.019 28.205  1.00 16.88 ? 233  VAL B CG2 1 
ATOM   4095 N  N   . ASP B 1 234 ? 61.283  22.074 29.335  1.00 12.40 ? 234  ASP B N   1 
ATOM   4096 C  CA  . ASP B 1 234 ? 60.186  21.121 29.254  1.00 12.62 ? 234  ASP B CA  1 
ATOM   4097 C  C   . ASP B 1 234 ? 59.518  20.875 30.604  1.00 12.68 ? 234  ASP B C   1 
ATOM   4098 O  O   . ASP B 1 234 ? 58.576  20.088 30.716  1.00 11.17 ? 234  ASP B O   1 
ATOM   4099 C  CB  . ASP B 1 234 ? 60.650  19.806 28.599  1.00 12.60 ? 234  ASP B CB  1 
ATOM   4100 C  CG  . ASP B 1 234 ? 61.514  18.936 29.507  1.00 14.46 ? 234  ASP B CG  1 
ATOM   4101 O  OD1 . ASP B 1 234 ? 62.251  18.098 28.939  1.00 16.70 ? 234  ASP B OD1 1 
ATOM   4102 O  OD2 . ASP B 1 234 ? 61.458  19.047 30.755  1.00 8.84  ? 234  ASP B OD2 1 
ATOM   4103 N  N   . GLY B 1 235 ? 60.013  21.555 31.633  1.00 13.46 ? 235  GLY B N   1 
ATOM   4104 C  CA  . GLY B 1 235 ? 59.391  21.429 32.935  1.00 14.52 ? 235  GLY B CA  1 
ATOM   4105 C  C   . GLY B 1 235 ? 58.027  22.090 32.807  1.00 14.80 ? 235  GLY B C   1 
ATOM   4106 O  O   . GLY B 1 235 ? 57.061  21.683 33.461  1.00 14.26 ? 235  GLY B O   1 
ATOM   4107 N  N   . LEU B 1 236 ? 57.953  23.115 31.952  1.00 14.69 ? 236  LEU B N   1 
ATOM   4108 C  CA  . LEU B 1 236 ? 56.704  23.842 31.701  1.00 14.54 ? 236  LEU B CA  1 
ATOM   4109 C  C   . LEU B 1 236 ? 55.890  23.105 30.643  1.00 13.28 ? 236  LEU B C   1 
ATOM   4110 O  O   . LEU B 1 236 ? 56.447  22.457 29.760  1.00 11.12 ? 236  LEU B O   1 
ATOM   4111 C  CB  . LEU B 1 236 ? 56.976  25.269 31.199  1.00 14.39 ? 236  LEU B CB  1 
ATOM   4112 C  CG  . LEU B 1 236 ? 57.823  26.264 32.000  1.00 14.83 ? 236  LEU B CG  1 
ATOM   4113 C  CD1 . LEU B 1 236 ? 57.701  27.625 31.321  1.00 15.72 ? 236  LEU B CD1 1 
ATOM   4114 C  CD2 . LEU B 1 236 ? 57.357  26.363 33.442  1.00 13.90 ? 236  LEU B CD2 1 
ATOM   4115 N  N   . ASP B 1 237 ? 54.570  23.222 30.727  1.00 12.93 ? 237  ASP B N   1 
ATOM   4116 C  CA  . ASP B 1 237 ? 53.692  22.555 29.781  1.00 12.80 ? 237  ASP B CA  1 
ATOM   4117 C  C   . ASP B 1 237 ? 54.049  22.922 28.335  1.00 14.34 ? 237  ASP B C   1 
ATOM   4118 O  O   . ASP B 1 237 ? 54.447  24.044 28.052  1.00 13.14 ? 237  ASP B O   1 
ATOM   4119 C  CB  . ASP B 1 237 ? 52.236  22.918 30.082  1.00 10.83 ? 237  ASP B CB  1 
ATOM   4120 C  CG  . ASP B 1 237 ? 51.255  22.049 29.329  1.00 10.88 ? 237  ASP B CG  1 
ATOM   4121 O  OD1 . ASP B 1 237 ? 50.722  22.500 28.297  1.00 13.68 ? 237  ASP B OD1 1 
ATOM   4122 O  OD2 . ASP B 1 237 ? 51.027  20.904 29.763  1.00 10.93 ? 237  ASP B OD2 1 
ATOM   4123 N  N   . PRO B 1 238 ? 53.933  21.958 27.409  1.00 15.28 ? 238  PRO B N   1 
ATOM   4124 C  CA  . PRO B 1 238 ? 54.231  22.150 25.985  1.00 16.29 ? 238  PRO B CA  1 
ATOM   4125 C  C   . PRO B 1 238 ? 53.459  23.315 25.342  1.00 16.92 ? 238  PRO B C   1 
ATOM   4126 O  O   . PRO B 1 238 ? 53.857  23.844 24.300  1.00 16.66 ? 238  PRO B O   1 
ATOM   4127 C  CB  . PRO B 1 238 ? 53.844  20.809 25.372  1.00 17.51 ? 238  PRO B CB  1 
ATOM   4128 C  CG  . PRO B 1 238 ? 54.147  19.846 26.458  1.00 16.66 ? 238  PRO B CG  1 
ATOM   4129 C  CD  . PRO B 1 238 ? 53.652  20.540 27.702  1.00 14.17 ? 238  PRO B CD  1 
ATOM   4130 N  N   . SER B 1 239 ? 52.352  23.709 25.961  1.00 17.20 ? 239  SER B N   1 
ATOM   4131 C  CA  . SER B 1 239 ? 51.558  24.803 25.427  1.00 17.04 ? 239  SER B CA  1 
ATOM   4132 C  C   . SER B 1 239 ? 52.280  26.126 25.614  1.00 15.64 ? 239  SER B C   1 
ATOM   4133 O  O   . SER B 1 239 ? 51.903  27.127 25.015  1.00 16.50 ? 239  SER B O   1 
ATOM   4134 C  CB  . SER B 1 239 ? 50.173  24.853 26.092  1.00 15.67 ? 239  SER B CB  1 
ATOM   4135 O  OG  . SER B 1 239 ? 50.267  24.957 27.500  1.00 20.50 ? 239  SER B OG  1 
ATOM   4136 N  N   . PHE B 1 240 ? 53.333  26.120 26.427  1.00 14.85 ? 240  PHE B N   1 
ATOM   4137 C  CA  . PHE B 1 240 ? 54.101  27.331 26.688  1.00 13.00 ? 240  PHE B CA  1 
ATOM   4138 C  C   . PHE B 1 240 ? 55.507  27.230 26.108  1.00 13.51 ? 240  PHE B C   1 
ATOM   4139 O  O   . PHE B 1 240 ? 56.090  28.227 25.677  1.00 14.06 ? 240  PHE B O   1 
ATOM   4140 C  CB  . PHE B 1 240 ? 54.171  27.591 28.198  1.00 12.64 ? 240  PHE B CB  1 
ATOM   4141 C  CG  . PHE B 1 240 ? 52.822  27.712 28.860  1.00 11.45 ? 240  PHE B CG  1 
ATOM   4142 C  CD1 . PHE B 1 240 ? 51.948  28.737 28.514  1.00 13.67 ? 240  PHE B CD1 1 
ATOM   4143 C  CD2 . PHE B 1 240 ? 52.429  26.803 29.839  1.00 13.17 ? 240  PHE B CD2 1 
ATOM   4144 C  CE1 . PHE B 1 240 ? 50.700  28.857 29.136  1.00 13.08 ? 240  PHE B CE1 1 
ATOM   4145 C  CE2 . PHE B 1 240 ? 51.190  26.910 30.468  1.00 9.79  ? 240  PHE B CE2 1 
ATOM   4146 C  CZ  . PHE B 1 240 ? 50.321  27.938 30.118  1.00 11.73 ? 240  PHE B CZ  1 
ATOM   4147 N  N   . THR B 1 241 ? 56.049  26.022 26.091  1.00 12.85 ? 241  THR B N   1 
ATOM   4148 C  CA  . THR B 1 241 ? 57.389  25.795 25.558  1.00 13.97 ? 241  THR B CA  1 
ATOM   4149 C  C   . THR B 1 241 ? 57.438  24.572 24.634  1.00 13.61 ? 241  THR B C   1 
ATOM   4150 O  O   . THR B 1 241 ? 58.118  23.583 24.925  1.00 13.00 ? 241  THR B O   1 
ATOM   4151 C  CB  . THR B 1 241 ? 58.418  25.598 26.694  1.00 14.15 ? 241  THR B CB  1 
ATOM   4152 O  OG1 . THR B 1 241 ? 57.924  24.627 27.624  1.00 11.24 ? 241  THR B OG1 1 
ATOM   4153 C  CG2 . THR B 1 241 ? 58.689  26.922 27.414  1.00 13.27 ? 241  THR B CG2 1 
ATOM   4154 N  N   . PRO B 1 242 ? 56.715  24.634 23.500  1.00 12.45 ? 242  PRO B N   1 
ATOM   4155 C  CA  . PRO B 1 242 ? 56.679  23.528 22.540  1.00 11.48 ? 242  PRO B CA  1 
ATOM   4156 C  C   . PRO B 1 242 ? 57.994  23.169 21.854  1.00 10.86 ? 242  PRO B C   1 
ATOM   4157 O  O   . PRO B 1 242 ? 58.205  22.011 21.487  1.00 10.55 ? 242  PRO B O   1 
ATOM   4158 C  CB  . PRO B 1 242 ? 55.605  23.973 21.538  1.00 11.76 ? 242  PRO B CB  1 
ATOM   4159 C  CG  . PRO B 1 242 ? 55.693  25.478 21.585  1.00 9.52  ? 242  PRO B CG  1 
ATOM   4160 C  CD  . PRO B 1 242 ? 55.843  25.743 23.061  1.00 10.18 ? 242  PRO B CD  1 
ATOM   4161 N  N   . ALA B 1 243 ? 58.877  24.148 21.683  1.00 11.69 ? 243  ALA B N   1 
ATOM   4162 C  CA  . ALA B 1 243 ? 60.147  23.915 20.992  1.00 11.15 ? 243  ALA B CA  1 
ATOM   4163 C  C   . ALA B 1 243 ? 61.258  23.305 21.847  1.00 11.69 ? 243  ALA B C   1 
ATOM   4164 O  O   . ALA B 1 243 ? 62.261  23.956 22.147  1.00 10.64 ? 243  ALA B O   1 
ATOM   4165 C  CB  . ALA B 1 243 ? 60.626  25.215 20.355  1.00 12.46 ? 243  ALA B CB  1 
ATOM   4166 N  N   . THR B 1 244 ? 61.072  22.043 22.221  1.00 12.84 ? 244  THR B N   1 
ATOM   4167 C  CA  . THR B 1 244 ? 62.042  21.310 23.034  1.00 13.60 ? 244  THR B CA  1 
ATOM   4168 C  C   . THR B 1 244 ? 62.015  19.830 22.655  1.00 13.03 ? 244  THR B C   1 
ATOM   4169 O  O   . THR B 1 244 ? 61.067  19.358 22.030  1.00 14.42 ? 244  THR B O   1 
ATOM   4170 C  CB  . THR B 1 244 ? 61.751  21.447 24.555  1.00 13.48 ? 244  THR B CB  1 
ATOM   4171 O  OG1 . THR B 1 244 ? 60.441  20.942 24.847  1.00 14.27 ? 244  THR B OG1 1 
ATOM   4172 C  CG2 . THR B 1 244 ? 61.832  22.894 24.982  1.00 16.55 ? 244  THR B CG2 1 
ATOM   4173 N  N   . GLY B 1 245 ? 63.058  19.104 23.042  1.00 13.35 ? 245  GLY B N   1 
ATOM   4174 C  CA  . GLY B 1 245 ? 63.158  17.697 22.703  1.00 11.96 ? 245  GLY B CA  1 
ATOM   4175 C  C   . GLY B 1 245 ? 62.213  16.690 23.330  1.00 11.85 ? 245  GLY B C   1 
ATOM   4176 O  O   . GLY B 1 245 ? 61.674  15.850 22.615  1.00 10.26 ? 245  GLY B O   1 
ATOM   4177 N  N   . THR B 1 246 ? 62.003  16.764 24.645  1.00 13.20 ? 246  THR B N   1 
ATOM   4178 C  CA  . THR B 1 246 ? 61.149  15.796 25.342  1.00 14.51 ? 246  THR B CA  1 
ATOM   4179 C  C   . THR B 1 246 ? 59.953  16.382 26.113  1.00 15.14 ? 246  THR B C   1 
ATOM   4180 O  O   . THR B 1 246 ? 59.899  16.301 27.345  1.00 13.60 ? 246  THR B O   1 
ATOM   4181 C  CB  . THR B 1 246 ? 61.980  14.967 26.350  1.00 14.83 ? 246  THR B CB  1 
ATOM   4182 O  OG1 . THR B 1 246 ? 63.242  14.618 25.773  1.00 12.45 ? 246  THR B OG1 1 
ATOM   4183 C  CG2 . THR B 1 246 ? 61.226  13.696 26.728  1.00 16.08 ? 246  THR B CG2 1 
ATOM   4184 N  N   . PRO B 1 247 ? 58.962  16.941 25.397  1.00 15.88 ? 247  PRO B N   1 
ATOM   4185 C  CA  . PRO B 1 247 ? 57.773  17.535 26.031  1.00 16.77 ? 247  PRO B CA  1 
ATOM   4186 C  C   . PRO B 1 247 ? 56.746  16.544 26.598  1.00 15.60 ? 247  PRO B C   1 
ATOM   4187 O  O   . PRO B 1 247 ? 56.422  15.534 25.978  1.00 16.42 ? 247  PRO B O   1 
ATOM   4188 C  CB  . PRO B 1 247 ? 57.188  18.393 24.916  1.00 16.86 ? 247  PRO B CB  1 
ATOM   4189 C  CG  . PRO B 1 247 ? 57.502  17.561 23.687  1.00 18.13 ? 247  PRO B CG  1 
ATOM   4190 C  CD  . PRO B 1 247 ? 58.922  17.108 23.931  1.00 17.18 ? 247  PRO B CD  1 
ATOM   4191 N  N   . VAL B 1 248 ? 56.234  16.846 27.783  1.00 13.94 ? 248  VAL B N   1 
ATOM   4192 C  CA  . VAL B 1 248 ? 55.251  15.985 28.417  1.00 11.91 ? 248  VAL B CA  1 
ATOM   4193 C  C   . VAL B 1 248 ? 54.054  16.830 28.832  1.00 11.90 ? 248  VAL B C   1 
ATOM   4194 O  O   . VAL B 1 248 ? 54.206  17.869 29.472  1.00 9.95  ? 248  VAL B O   1 
ATOM   4195 C  CB  . VAL B 1 248 ? 55.830  15.278 29.674  1.00 11.39 ? 248  VAL B CB  1 
ATOM   4196 C  CG1 . VAL B 1 248 ? 54.917  14.127 30.090  1.00 10.13 ? 248  VAL B CG1 1 
ATOM   4197 C  CG2 . VAL B 1 248 ? 57.231  14.770 29.398  1.00 12.43 ? 248  VAL B CG2 1 
ATOM   4198 N  N   . VAL B 1 249 ? 52.864  16.376 28.459  1.00 13.22 ? 249  VAL B N   1 
ATOM   4199 C  CA  . VAL B 1 249 ? 51.634  17.091 28.784  1.00 14.50 ? 249  VAL B CA  1 
ATOM   4200 C  C   . VAL B 1 249 ? 51.421  17.158 30.291  1.00 13.44 ? 249  VAL B C   1 
ATOM   4201 O  O   . VAL B 1 249 ? 51.929  16.322 31.027  1.00 14.01 ? 249  VAL B O   1 
ATOM   4202 C  CB  . VAL B 1 249 ? 50.417  16.409 28.135  1.00 13.42 ? 249  VAL B CB  1 
ATOM   4203 C  CG1 . VAL B 1 249 ? 50.590  16.394 26.618  1.00 17.53 ? 249  VAL B CG1 1 
ATOM   4204 C  CG2 . VAL B 1 249 ? 50.270  14.995 28.663  1.00 15.51 ? 249  VAL B CG2 1 
ATOM   4205 N  N   . GLY B 1 250 ? 50.681  18.167 30.744  1.00 14.34 ? 250  GLY B N   1 
ATOM   4206 C  CA  . GLY B 1 250 ? 50.404  18.309 32.165  1.00 14.50 ? 250  GLY B CA  1 
ATOM   4207 C  C   . GLY B 1 250 ? 51.509  19.000 32.928  1.00 14.82 ? 250  GLY B C   1 
ATOM   4208 O  O   . GLY B 1 250 ? 51.689  18.777 34.124  1.00 15.78 ? 250  GLY B O   1 
ATOM   4209 N  N   . GLY B 1 251 ? 52.241  19.860 32.234  1.00 15.12 ? 251  GLY B N   1 
ATOM   4210 C  CA  . GLY B 1 251 ? 53.338  20.563 32.863  1.00 16.38 ? 251  GLY B CA  1 
ATOM   4211 C  C   . GLY B 1 251 ? 52.978  21.810 33.648  1.00 17.16 ? 251  GLY B C   1 
ATOM   4212 O  O   . GLY B 1 251 ? 51.811  22.193 33.772  1.00 16.69 ? 251  GLY B O   1 
ATOM   4213 N  N   . LEU B 1 252 ? 54.015  22.433 34.198  1.00 17.86 ? 252  LEU B N   1 
ATOM   4214 C  CA  . LEU B 1 252 ? 53.877  23.649 34.972  1.00 15.64 ? 252  LEU B CA  1 
ATOM   4215 C  C   . LEU B 1 252 ? 53.330  24.738 34.078  1.00 17.30 ? 252  LEU B C   1 
ATOM   4216 O  O   . LEU B 1 252 ? 53.680  24.836 32.893  1.00 15.75 ? 252  LEU B O   1 
ATOM   4217 C  CB  . LEU B 1 252 ? 55.230  24.075 35.537  1.00 14.01 ? 252  LEU B CB  1 
ATOM   4218 C  CG  . LEU B 1 252 ? 55.760  23.184 36.664  1.00 14.83 ? 252  LEU B CG  1 
ATOM   4219 C  CD1 . LEU B 1 252 ? 57.242  23.449 36.873  1.00 13.72 ? 252  LEU B CD1 1 
ATOM   4220 C  CD2 . LEU B 1 252 ? 54.965  23.445 37.943  1.00 12.88 ? 252  LEU B CD2 1 
ATOM   4221 N  N   . THR B 1 253 ? 52.458  25.548 34.663  1.00 17.31 ? 253  THR B N   1 
ATOM   4222 C  CA  . THR B 1 253 ? 51.830  26.649 33.966  1.00 17.54 ? 253  THR B CA  1 
ATOM   4223 C  C   . THR B 1 253 ? 52.820  27.809 33.773  1.00 16.92 ? 253  THR B C   1 
ATOM   4224 O  O   . THR B 1 253 ? 53.847  27.881 34.445  1.00 15.90 ? 253  THR B O   1 
ATOM   4225 C  CB  . THR B 1 253 ? 50.587  27.109 34.755  1.00 16.72 ? 253  THR B CB  1 
ATOM   4226 O  OG1 . THR B 1 253 ? 49.613  26.053 34.751  1.00 18.73 ? 253  THR B OG1 1 
ATOM   4227 C  CG2 . THR B 1 253 ? 49.981  28.336 34.141  1.00 20.45 ? 253  THR B CG2 1 
ATOM   4228 N  N   . TYR B 1 254 ? 52.517  28.688 32.825  1.00 16.21 ? 254  TYR B N   1 
ATOM   4229 C  CA  . TYR B 1 254 ? 53.357  29.838 32.544  1.00 17.68 ? 254  TYR B CA  1 
ATOM   4230 C  C   . TYR B 1 254 ? 53.462  30.567 33.878  1.00 18.40 ? 254  TYR B C   1 
ATOM   4231 O  O   . TYR B 1 254 ? 54.534  31.016 34.276  1.00 16.82 ? 254  TYR B O   1 
ATOM   4232 C  CB  . TYR B 1 254 ? 52.677  30.735 31.500  1.00 19.32 ? 254  TYR B CB  1 
ATOM   4233 C  CG  . TYR B 1 254 ? 53.571  31.793 30.877  1.00 21.67 ? 254  TYR B CG  1 
ATOM   4234 C  CD1 . TYR B 1 254 ? 54.456  31.471 29.844  1.00 22.90 ? 254  TYR B CD1 1 
ATOM   4235 C  CD2 . TYR B 1 254 ? 53.516  33.122 31.305  1.00 22.35 ? 254  TYR B CD2 1 
ATOM   4236 C  CE1 . TYR B 1 254 ? 55.268  32.455 29.242  1.00 22.06 ? 254  TYR B CE1 1 
ATOM   4237 C  CE2 . TYR B 1 254 ? 54.319  34.112 30.717  1.00 23.73 ? 254  TYR B CE2 1 
ATOM   4238 C  CZ  . TYR B 1 254 ? 55.193  33.774 29.681  1.00 24.74 ? 254  TYR B CZ  1 
ATOM   4239 O  OH  . TYR B 1 254 ? 55.962  34.761 29.072  1.00 21.61 ? 254  TYR B OH  1 
ATOM   4240 N  N   . ARG B 1 255 ? 52.324  30.643 34.568  1.00 17.59 ? 255  ARG B N   1 
ATOM   4241 C  CA  . ARG B 1 255 ? 52.205  31.300 35.862  1.00 14.50 ? 255  ARG B CA  1 
ATOM   4242 C  C   . ARG B 1 255 ? 53.048  30.636 36.959  1.00 13.15 ? 255  ARG B C   1 
ATOM   4243 O  O   . ARG B 1 255 ? 53.683  31.323 37.762  1.00 13.66 ? 255  ARG B O   1 
ATOM   4244 C  CB  . ARG B 1 255 ? 50.718  31.357 36.248  1.00 13.27 ? 255  ARG B CB  1 
ATOM   4245 C  CG  . ARG B 1 255 ? 49.911  32.375 35.403  1.00 15.75 ? 255  ARG B CG  1 
ATOM   4246 C  CD  . ARG B 1 255 ? 48.391  32.256 35.575  1.00 13.90 ? 255  ARG B CD  1 
ATOM   4247 N  NE  . ARG B 1 255 ? 47.994  32.196 36.980  1.00 12.51 ? 255  ARG B NE  1 
ATOM   4248 C  CZ  . ARG B 1 255 ? 46.739  32.083 37.401  1.00 12.44 ? 255  ARG B CZ  1 
ATOM   4249 N  NH1 . ARG B 1 255 ? 45.742  32.026 36.531  1.00 12.55 ? 255  ARG B NH1 1 
ATOM   4250 N  NH2 . ARG B 1 255 ? 46.484  31.999 38.696  1.00 13.11 ? 255  ARG B NH2 1 
ATOM   4251 N  N   . GLU B 1 256 ? 53.059  29.308 37.002  1.00 11.27 ? 256  GLU B N   1 
ATOM   4252 C  CA  . GLU B 1 256 ? 53.865  28.609 37.994  1.00 10.75 ? 256  GLU B CA  1 
ATOM   4253 C  C   . GLU B 1 256 ? 55.354  28.789 37.652  1.00 10.21 ? 256  GLU B C   1 
ATOM   4254 O  O   . GLU B 1 256 ? 56.203  28.902 38.542  1.00 9.67  ? 256  GLU B O   1 
ATOM   4255 C  CB  . GLU B 1 256 ? 53.468  27.139 38.039  1.00 7.54  ? 256  GLU B CB  1 
ATOM   4256 C  CG  . GLU B 1 256 ? 52.018  26.968 38.414  1.00 7.31  ? 256  GLU B CG  1 
ATOM   4257 C  CD  . GLU B 1 256 ? 51.554  25.542 38.329  1.00 12.27 ? 256  GLU B CD  1 
ATOM   4258 O  OE1 . GLU B 1 256 ? 51.986  24.851 37.370  1.00 12.78 ? 256  GLU B OE1 1 
ATOM   4259 O  OE2 . GLU B 1 256 ? 50.751  25.119 39.205  1.00 10.69 ? 256  GLU B OE2 1 
ATOM   4260 N  N   . GLY B 1 257 ? 55.663  28.837 36.361  1.00 11.21 ? 257  GLY B N   1 
ATOM   4261 C  CA  . GLY B 1 257 ? 57.039  29.061 35.949  1.00 10.46 ? 257  GLY B CA  1 
ATOM   4262 C  C   . GLY B 1 257 ? 57.532  30.412 36.458  1.00 10.09 ? 257  GLY B C   1 
ATOM   4263 O  O   . GLY B 1 257 ? 58.674  30.542 36.895  1.00 11.00 ? 257  GLY B O   1 
ATOM   4264 N  N   . LEU B 1 258 ? 56.673  31.423 36.398  1.00 9.10  ? 258  LEU B N   1 
ATOM   4265 C  CA  . LEU B 1 258 ? 57.021  32.757 36.868  1.00 9.05  ? 258  LEU B CA  1 
ATOM   4266 C  C   . LEU B 1 258 ? 56.960  32.880 38.395  1.00 9.60  ? 258  LEU B C   1 
ATOM   4267 O  O   . LEU B 1 258 ? 57.665  33.701 38.981  1.00 9.20  ? 258  LEU B O   1 
ATOM   4268 C  CB  . LEU B 1 258 ? 56.105  33.816 36.230  1.00 7.93  ? 258  LEU B CB  1 
ATOM   4269 C  CG  . LEU B 1 258 ? 56.282  34.110 34.735  1.00 8.32  ? 258  LEU B CG  1 
ATOM   4270 C  CD1 . LEU B 1 258 ? 55.431  35.311 34.341  1.00 9.10  ? 258  LEU B CD1 1 
ATOM   4271 C  CD2 . LEU B 1 258 ? 57.743  34.391 34.440  1.00 6.79  ? 258  LEU B CD2 1 
ATOM   4272 N  N   . TYR B 1 259 ? 56.126  32.070 39.042  1.00 10.91 ? 259  TYR B N   1 
ATOM   4273 C  CA  . TYR B 1 259 ? 56.017  32.128 40.495  1.00 12.30 ? 259  TYR B CA  1 
ATOM   4274 C  C   . TYR B 1 259 ? 57.264  31.503 41.136  1.00 14.25 ? 259  TYR B C   1 
ATOM   4275 O  O   . TYR B 1 259 ? 57.794  32.015 42.133  1.00 12.82 ? 259  TYR B O   1 
ATOM   4276 C  CB  . TYR B 1 259 ? 54.757  31.398 40.989  1.00 13.36 ? 259  TYR B CB  1 
ATOM   4277 C  CG  . TYR B 1 259 ? 54.546  31.585 42.482  1.00 15.11 ? 259  TYR B CG  1 
ATOM   4278 C  CD1 . TYR B 1 259 ? 54.136  32.819 42.997  1.00 16.81 ? 259  TYR B CD1 1 
ATOM   4279 C  CD2 . TYR B 1 259 ? 54.873  30.574 43.387  1.00 15.41 ? 259  TYR B CD2 1 
ATOM   4280 C  CE1 . TYR B 1 259 ? 54.069  33.046 44.375  1.00 16.77 ? 259  TYR B CE1 1 
ATOM   4281 C  CE2 . TYR B 1 259 ? 54.809  30.787 44.768  1.00 17.78 ? 259  TYR B CE2 1 
ATOM   4282 C  CZ  . TYR B 1 259 ? 54.407  32.028 45.253  1.00 17.47 ? 259  TYR B CZ  1 
ATOM   4283 O  OH  . TYR B 1 259 ? 54.335  32.245 46.612  1.00 19.36 ? 259  TYR B OH  1 
ATOM   4284 N  N   . ILE B 1 260 ? 57.719  30.389 40.566  1.00 13.14 ? 260  ILE B N   1 
ATOM   4285 C  CA  . ILE B 1 260 ? 58.913  29.705 41.054  1.00 13.01 ? 260  ILE B CA  1 
ATOM   4286 C  C   . ILE B 1 260 ? 60.132  30.614 40.965  1.00 11.56 ? 260  ILE B C   1 
ATOM   4287 O  O   . ILE B 1 260 ? 60.966  30.656 41.866  1.00 11.58 ? 260  ILE B O   1 
ATOM   4288 C  CB  . ILE B 1 260 ? 59.243  28.455 40.203  1.00 14.03 ? 260  ILE B CB  1 
ATOM   4289 C  CG1 . ILE B 1 260 ? 58.143  27.407 40.356  1.00 14.27 ? 260  ILE B CG1 1 
ATOM   4290 C  CG2 . ILE B 1 260 ? 60.620  27.901 40.605  1.00 13.16 ? 260  ILE B CG2 1 
ATOM   4291 C  CD1 . ILE B 1 260 ? 58.292  26.239 39.406  1.00 17.53 ? 260  ILE B CD1 1 
ATOM   4292 N  N   . THR B 1 261 ? 60.235  31.341 39.864  1.00 10.04 ? 261  THR B N   1 
ATOM   4293 C  CA  . THR B 1 261 ? 61.382  32.201 39.653  1.00 10.14 ? 261  THR B CA  1 
ATOM   4294 C  C   . THR B 1 261 ? 61.333  33.551 40.362  1.00 10.08 ? 261  THR B C   1 
ATOM   4295 O  O   . THR B 1 261 ? 62.378  34.119 40.688  1.00 9.93  ? 261  THR B O   1 
ATOM   4296 C  CB  . THR B 1 261 ? 61.603  32.386 38.157  1.00 10.11 ? 261  THR B CB  1 
ATOM   4297 O  OG1 . THR B 1 261 ? 60.363  32.754 37.536  1.00 14.40 ? 261  THR B OG1 1 
ATOM   4298 C  CG2 . THR B 1 261 ? 62.119  31.082 37.544  1.00 8.81  ? 261  THR B CG2 1 
ATOM   4299 N  N   . GLU B 1 262 ? 60.128  34.064 40.597  1.00 9.58  ? 262  GLU B N   1 
ATOM   4300 C  CA  . GLU B 1 262 ? 59.968  35.331 41.289  1.00 9.85  ? 262  GLU B CA  1 
ATOM   4301 C  C   . GLU B 1 262 ? 60.354  35.075 42.726  1.00 11.67 ? 262  GLU B C   1 
ATOM   4302 O  O   . GLU B 1 262 ? 61.071  35.864 43.342  1.00 14.20 ? 262  GLU B O   1 
ATOM   4303 C  CB  . GLU B 1 262 ? 58.515  35.804 41.231  1.00 10.68 ? 262  GLU B CB  1 
ATOM   4304 C  CG  . GLU B 1 262 ? 58.020  36.178 39.852  1.00 11.46 ? 262  GLU B CG  1 
ATOM   4305 C  CD  . GLU B 1 262 ? 56.599  36.730 39.870  1.00 13.96 ? 262  GLU B CD  1 
ATOM   4306 O  OE1 . GLU B 1 262 ? 55.767  36.242 40.675  1.00 10.67 ? 262  GLU B OE1 1 
ATOM   4307 O  OE2 . GLU B 1 262 ? 56.311  37.645 39.060  1.00 14.25 ? 262  GLU B OE2 1 
ATOM   4308 N  N   . GLU B 1 263 ? 59.874  33.956 43.259  1.00 11.27 ? 263  GLU B N   1 
ATOM   4309 C  CA  . GLU B 1 263 ? 60.176  33.573 44.630  1.00 12.92 ? 263  GLU B CA  1 
ATOM   4310 C  C   . GLU B 1 263 ? 61.667  33.320 44.861  1.00 12.01 ? 263  GLU B C   1 
ATOM   4311 O  O   . GLU B 1 263 ? 62.188  33.591 45.944  1.00 8.17  ? 263  GLU B O   1 
ATOM   4312 C  CB  . GLU B 1 263 ? 59.370  32.329 45.015  1.00 13.31 ? 263  GLU B CB  1 
ATOM   4313 C  CG  . GLU B 1 263 ? 57.894  32.616 45.241  1.00 16.50 ? 263  GLU B CG  1 
ATOM   4314 C  CD  . GLU B 1 263 ? 57.664  33.604 46.379  1.00 16.02 ? 263  GLU B CD  1 
ATOM   4315 O  OE1 . GLU B 1 263 ? 58.082  33.299 47.515  1.00 15.01 ? 263  GLU B OE1 1 
ATOM   4316 O  OE2 . GLU B 1 263 ? 57.072  34.684 46.135  1.00 18.59 ? 263  GLU B OE2 1 
ATOM   4317 N  N   . ILE B 1 264 ? 62.343  32.792 43.845  1.00 13.38 ? 264  ILE B N   1 
ATOM   4318 C  CA  . ILE B 1 264 ? 63.772  32.512 43.937  1.00 16.00 ? 264  ILE B CA  1 
ATOM   4319 C  C   . ILE B 1 264 ? 64.537  33.825 44.002  1.00 17.74 ? 264  ILE B C   1 
ATOM   4320 O  O   . ILE B 1 264 ? 65.451  33.990 44.821  1.00 19.55 ? 264  ILE B O   1 
ATOM   4321 C  CB  . ILE B 1 264 ? 64.280  31.694 42.714  1.00 15.30 ? 264  ILE B CB  1 
ATOM   4322 C  CG1 . ILE B 1 264 ? 63.641  30.305 42.712  1.00 16.19 ? 264  ILE B CG1 1 
ATOM   4323 C  CG2 . ILE B 1 264 ? 65.799  31.557 42.760  1.00 14.06 ? 264  ILE B CG2 1 
ATOM   4324 C  CD1 . ILE B 1 264 ? 63.842  29.544 43.996  1.00 17.67 ? 264  ILE B CD1 1 
ATOM   4325 N  N   . TYR B 1 265 ? 64.162  34.757 43.133  1.00 18.15 ? 265  TYR B N   1 
ATOM   4326 C  CA  . TYR B 1 265 ? 64.814  36.049 43.102  1.00 18.54 ? 265  TYR B CA  1 
ATOM   4327 C  C   . TYR B 1 265 ? 64.669  36.753 44.436  1.00 20.15 ? 265  TYR B C   1 
ATOM   4328 O  O   . TYR B 1 265 ? 65.600  37.404 44.909  1.00 20.54 ? 265  TYR B O   1 
ATOM   4329 C  CB  . TYR B 1 265 ? 64.213  36.944 42.030  1.00 18.57 ? 265  TYR B CB  1 
ATOM   4330 C  CG  . TYR B 1 265 ? 64.637  38.382 42.209  1.00 19.43 ? 265  TYR B CG  1 
ATOM   4331 C  CD1 . TYR B 1 265 ? 65.955  38.777 41.970  1.00 19.60 ? 265  TYR B CD1 1 
ATOM   4332 C  CD2 . TYR B 1 265 ? 63.738  39.339 42.680  1.00 20.20 ? 265  TYR B CD2 1 
ATOM   4333 C  CE1 . TYR B 1 265 ? 66.363  40.092 42.197  1.00 19.31 ? 265  TYR B CE1 1 
ATOM   4334 C  CE2 . TYR B 1 265 ? 64.135  40.650 42.911  1.00 19.42 ? 265  TYR B CE2 1 
ATOM   4335 C  CZ  . TYR B 1 265 ? 65.443  41.020 42.666  1.00 19.49 ? 265  TYR B CZ  1 
ATOM   4336 O  OH  . TYR B 1 265 ? 65.822  42.324 42.871  1.00 22.48 ? 265  TYR B OH  1 
ATOM   4337 N  N   . LYS B 1 266 ? 63.490  36.630 45.036  1.00 20.40 ? 266  LYS B N   1 
ATOM   4338 C  CA  . LYS B 1 266 ? 63.224  37.278 46.306  1.00 18.85 ? 266  LYS B CA  1 
ATOM   4339 C  C   . LYS B 1 266 ? 64.049  36.714 47.461  1.00 17.74 ? 266  LYS B C   1 
ATOM   4340 O  O   . LYS B 1 266 ? 64.126  37.329 48.523  1.00 17.28 ? 266  LYS B O   1 
ATOM   4341 C  CB  . LYS B 1 266 ? 61.725  37.220 46.603  1.00 19.74 ? 266  LYS B CB  1 
ATOM   4342 C  CG  . LYS B 1 266 ? 60.904  37.932 45.524  1.00 20.75 ? 266  LYS B CG  1 
ATOM   4343 C  CD  . LYS B 1 266 ? 59.405  37.752 45.691  1.00 24.24 ? 266  LYS B CD  1 
ATOM   4344 C  CE  . LYS B 1 266 ? 58.875  38.489 46.910  1.00 27.16 ? 266  LYS B CE  1 
ATOM   4345 N  NZ  . LYS B 1 266 ? 57.380  38.360 47.051  1.00 30.31 ? 266  LYS B NZ  1 
ATOM   4346 N  N   . THR B 1 267 ? 64.676  35.557 47.257  1.00 16.49 ? 267  THR B N   1 
ATOM   4347 C  CA  . THR B 1 267 ? 65.520  34.975 48.302  1.00 17.07 ? 267  THR B CA  1 
ATOM   4348 C  C   . THR B 1 267 ? 66.798  35.806 48.334  1.00 17.61 ? 267  THR B C   1 
ATOM   4349 O  O   . THR B 1 267 ? 67.456  35.935 49.367  1.00 17.00 ? 267  THR B O   1 
ATOM   4350 C  CB  . THR B 1 267 ? 65.948  33.513 47.996  1.00 17.77 ? 267  THR B CB  1 
ATOM   4351 O  OG1 . THR B 1 267 ? 66.804  33.494 46.843  1.00 11.65 ? 267  THR B OG1 1 
ATOM   4352 C  CG2 . THR B 1 267 ? 64.728  32.625 47.770  1.00 15.59 ? 267  THR B CG2 1 
ATOM   4353 N  N   . GLY B 1 268 ? 67.137  36.363 47.178  1.00 16.58 ? 268  GLY B N   1 
ATOM   4354 C  CA  . GLY B 1 268 ? 68.331  37.170 47.067  1.00 18.60 ? 268  GLY B CA  1 
ATOM   4355 C  C   . GLY B 1 268 ? 69.554  36.284 47.035  1.00 18.11 ? 268  GLY B C   1 
ATOM   4356 O  O   . GLY B 1 268 ? 70.680  36.777 46.991  1.00 17.17 ? 268  GLY B O   1 
ATOM   4357 N  N   . LEU B 1 269 ? 69.326  34.971 47.038  1.00 19.30 ? 269  LEU B N   1 
ATOM   4358 C  CA  . LEU B 1 269 ? 70.414  33.997 47.030  1.00 18.25 ? 269  LEU B CA  1 
ATOM   4359 C  C   . LEU B 1 269 ? 70.688  33.300 45.699  1.00 19.11 ? 269  LEU B C   1 
ATOM   4360 O  O   . LEU B 1 269 ? 71.574  32.445 45.646  1.00 20.19 ? 269  LEU B O   1 
ATOM   4361 C  CB  . LEU B 1 269 ? 70.176  32.932 48.107  1.00 18.21 ? 269  LEU B CB  1 
ATOM   4362 C  CG  . LEU B 1 269 ? 70.286  33.349 49.577  1.00 15.79 ? 269  LEU B CG  1 
ATOM   4363 C  CD1 . LEU B 1 269 ? 69.779  32.219 50.479  1.00 16.49 ? 269  LEU B CD1 1 
ATOM   4364 C  CD2 . LEU B 1 269 ? 71.735  33.691 49.892  1.00 14.75 ? 269  LEU B CD2 1 
ATOM   4365 N  N   . LEU B 1 270 ? 69.954  33.634 44.632  1.00 18.26 ? 270  LEU B N   1 
ATOM   4366 C  CA  . LEU B 1 270 ? 70.232  32.978 43.346  1.00 17.61 ? 270  LEU B CA  1 
ATOM   4367 C  C   . LEU B 1 270 ? 71.704  33.192 43.030  1.00 18.96 ? 270  LEU B C   1 
ATOM   4368 O  O   . LEU B 1 270 ? 72.198  34.326 43.030  1.00 19.68 ? 270  LEU B O   1 
ATOM   4369 C  CB  . LEU B 1 270 ? 69.387  33.532 42.194  1.00 14.96 ? 270  LEU B CB  1 
ATOM   4370 C  CG  . LEU B 1 270 ? 69.639  32.797 40.860  1.00 13.48 ? 270  LEU B CG  1 
ATOM   4371 C  CD1 . LEU B 1 270 ? 69.286  31.309 40.997  1.00 8.83  ? 270  LEU B CD1 1 
ATOM   4372 C  CD2 . LEU B 1 270 ? 68.827  33.438 39.735  1.00 11.91 ? 270  LEU B CD2 1 
ATOM   4373 N  N   . SER B 1 271 ? 72.398  32.093 42.766  1.00 18.23 ? 271  SER B N   1 
ATOM   4374 C  CA  . SER B 1 271 ? 73.820  32.127 42.492  1.00 16.92 ? 271  SER B CA  1 
ATOM   4375 C  C   . SER B 1 271 ? 74.116  31.600 41.081  1.00 18.38 ? 271  SER B C   1 
ATOM   4376 O  O   . SER B 1 271 ? 74.998  32.111 40.389  1.00 20.05 ? 271  SER B O   1 
ATOM   4377 C  CB  . SER B 1 271 ? 74.524  31.293 43.572  1.00 15.43 ? 271  SER B CB  1 
ATOM   4378 O  OG  . SER B 1 271 ? 75.930  31.372 43.493  1.00 13.30 ? 271  SER B OG  1 
ATOM   4379 N  N   . GLY B 1 272 ? 73.368  30.583 40.658  1.00 18.16 ? 272  GLY B N   1 
ATOM   4380 C  CA  . GLY B 1 272 ? 73.563  30.010 39.338  1.00 15.55 ? 272  GLY B CA  1 
ATOM   4381 C  C   . GLY B 1 272 ? 72.258  29.691 38.621  1.00 15.25 ? 272  GLY B C   1 
ATOM   4382 O  O   . GLY B 1 272 ? 71.306  29.187 39.219  1.00 13.70 ? 272  GLY B O   1 
ATOM   4383 N  N   . LEU B 1 273 ? 72.207  29.984 37.330  1.00 14.93 ? 273  LEU B N   1 
ATOM   4384 C  CA  . LEU B 1 273 ? 71.004  29.717 36.559  1.00 15.48 ? 273  LEU B CA  1 
ATOM   4385 C  C   . LEU B 1 273 ? 71.298  28.941 35.264  1.00 16.34 ? 273  LEU B C   1 
ATOM   4386 O  O   . LEU B 1 273 ? 72.235  29.261 34.523  1.00 17.16 ? 273  LEU B O   1 
ATOM   4387 C  CB  . LEU B 1 273 ? 70.313  31.038 36.213  1.00 13.73 ? 273  LEU B CB  1 
ATOM   4388 C  CG  . LEU B 1 273 ? 68.784  31.120 36.138  1.00 14.58 ? 273  LEU B CG  1 
ATOM   4389 C  CD1 . LEU B 1 273 ? 68.416  32.276 35.215  1.00 9.72  ? 273  LEU B CD1 1 
ATOM   4390 C  CD2 . LEU B 1 273 ? 68.175  29.835 35.630  1.00 14.33 ? 273  LEU B CD2 1 
ATOM   4391 N  N   . ASP B 1 274 ? 70.501  27.910 35.010  1.00 15.92 ? 274  ASP B N   1 
ATOM   4392 C  CA  . ASP B 1 274 ? 70.627  27.115 33.795  1.00 15.48 ? 274  ASP B CA  1 
ATOM   4393 C  C   . ASP B 1 274 ? 69.284  27.203 33.072  1.00 13.89 ? 274  ASP B C   1 
ATOM   4394 O  O   . ASP B 1 274 ? 68.256  26.892 33.657  1.00 15.53 ? 274  ASP B O   1 
ATOM   4395 C  CB  . ASP B 1 274 ? 70.904  25.627 34.096  1.00 15.85 ? 274  ASP B CB  1 
ATOM   4396 C  CG  . ASP B 1 274 ? 72.235  25.385 34.785  1.00 16.49 ? 274  ASP B CG  1 
ATOM   4397 O  OD1 . ASP B 1 274 ? 73.192  26.154 34.552  1.00 18.14 ? 274  ASP B OD1 1 
ATOM   4398 O  OD2 . ASP B 1 274 ? 72.335  24.398 35.546  1.00 14.61 ? 274  ASP B OD2 1 
ATOM   4399 N  N   . ILE B 1 275 ? 69.291  27.650 31.821  1.00 14.31 ? 275  ILE B N   1 
ATOM   4400 C  CA  . ILE B 1 275 ? 68.074  27.726 31.011  1.00 15.20 ? 275  ILE B CA  1 
ATOM   4401 C  C   . ILE B 1 275 ? 68.368  26.738 29.876  1.00 15.64 ? 275  ILE B C   1 
ATOM   4402 O  O   . ILE B 1 275 ? 69.051  27.082 28.909  1.00 15.36 ? 275  ILE B O   1 
ATOM   4403 C  CB  . ILE B 1 275 ? 67.852  29.151 30.448  1.00 17.64 ? 275  ILE B CB  1 
ATOM   4404 C  CG1 . ILE B 1 275 ? 67.635  30.138 31.603  1.00 17.73 ? 275  ILE B CG1 1 
ATOM   4405 C  CG2 . ILE B 1 275 ? 66.638  29.169 29.508  1.00 17.45 ? 275  ILE B CG2 1 
ATOM   4406 C  CD1 . ILE B 1 275 ? 66.345  29.900 32.400  1.00 19.18 ? 275  ILE B CD1 1 
ATOM   4407 N  N   . MET B 1 276 ? 67.845  25.515 30.004  1.00 14.45 ? 276  MET B N   1 
ATOM   4408 C  CA  . MET B 1 276 ? 68.126  24.440 29.057  1.00 14.29 ? 276  MET B CA  1 
ATOM   4409 C  C   . MET B 1 276 ? 67.023  23.838 28.197  1.00 14.41 ? 276  MET B C   1 
ATOM   4410 O  O   . MET B 1 276 ? 65.829  23.966 28.480  1.00 14.65 ? 276  MET B O   1 
ATOM   4411 C  CB  . MET B 1 276 ? 68.782  23.279 29.814  1.00 15.20 ? 276  MET B CB  1 
ATOM   4412 C  CG  . MET B 1 276 ? 69.812  23.697 30.855  1.00 14.54 ? 276  MET B CG  1 
ATOM   4413 S  SD  . MET B 1 276 ? 71.248  24.583 30.203  1.00 19.26 ? 276  MET B SD  1 
ATOM   4414 C  CE  . MET B 1 276 ? 72.227  23.234 29.652  1.00 16.40 ? 276  MET B CE  1 
ATOM   4415 N  N   . GLU B 1 277 ? 67.475  23.154 27.147  1.00 15.23 ? 277  GLU B N   1 
ATOM   4416 C  CA  . GLU B 1 277 ? 66.633  22.428 26.194  1.00 16.44 ? 277  GLU B CA  1 
ATOM   4417 C  C   . GLU B 1 277 ? 65.724  23.183 25.217  1.00 16.21 ? 277  GLU B C   1 
ATOM   4418 O  O   . GLU B 1 277 ? 64.753  22.612 24.715  1.00 17.02 ? 277  GLU B O   1 
ATOM   4419 C  CB  . GLU B 1 277 ? 65.794  21.380 26.937  1.00 16.97 ? 277  GLU B CB  1 
ATOM   4420 C  CG  . GLU B 1 277 ? 66.605  20.343 27.720  1.00 18.56 ? 277  GLU B CG  1 
ATOM   4421 C  CD  . GLU B 1 277 ? 67.502  19.474 26.847  1.00 19.89 ? 277  GLU B CD  1 
ATOM   4422 O  OE1 . GLU B 1 277 ? 67.325  19.452 25.610  1.00 19.13 ? 277  GLU B OE1 1 
ATOM   4423 O  OE2 . GLU B 1 277 ? 68.385  18.793 27.410  1.00 20.54 ? 277  GLU B OE2 1 
ATOM   4424 N  N   . VAL B 1 278 ? 66.006  24.453 24.949  1.00 15.32 ? 278  VAL B N   1 
ATOM   4425 C  CA  . VAL B 1 278 ? 65.195  25.174 23.978  1.00 16.19 ? 278  VAL B CA  1 
ATOM   4426 C  C   . VAL B 1 278 ? 65.747  24.722 22.613  1.00 17.63 ? 278  VAL B C   1 
ATOM   4427 O  O   . VAL B 1 278 ? 66.947  24.809 22.364  1.00 15.75 ? 278  VAL B O   1 
ATOM   4428 C  CB  . VAL B 1 278 ? 65.347  26.707 24.111  1.00 16.87 ? 278  VAL B CB  1 
ATOM   4429 C  CG1 . VAL B 1 278 ? 64.437  27.398 23.109  1.00 17.13 ? 278  VAL B CG1 1 
ATOM   4430 C  CG2 . VAL B 1 278 ? 65.009  27.158 25.528  1.00 16.52 ? 278  VAL B CG2 1 
ATOM   4431 N  N   . ASN B 1 279 ? 64.875  24.208 21.749  1.00 18.54 ? 279  ASN B N   1 
ATOM   4432 C  CA  . ASN B 1 279 ? 65.289  23.734 20.431  1.00 18.88 ? 279  ASN B CA  1 
ATOM   4433 C  C   . ASN B 1 279 ? 64.374  24.366 19.382  1.00 20.21 ? 279  ASN B C   1 
ATOM   4434 O  O   . ASN B 1 279 ? 63.343  23.797 19.018  1.00 19.50 ? 279  ASN B O   1 
ATOM   4435 C  CB  . ASN B 1 279 ? 65.185  22.203 20.369  1.00 18.45 ? 279  ASN B CB  1 
ATOM   4436 C  CG  . ASN B 1 279 ? 65.793  21.624 19.106  1.00 17.40 ? 279  ASN B CG  1 
ATOM   4437 O  OD1 . ASN B 1 279 ? 65.602  22.156 18.019  1.00 18.81 ? 279  ASN B OD1 1 
ATOM   4438 N  ND2 . ASN B 1 279 ? 66.519  20.522 19.246  1.00 16.94 ? 279  ASN B ND2 1 
ATOM   4439 N  N   . PRO B 1 280 ? 64.748  25.554 18.881  1.00 21.19 ? 280  PRO B N   1 
ATOM   4440 C  CA  . PRO B 1 280 ? 63.965  26.282 17.876  1.00 22.63 ? 280  PRO B CA  1 
ATOM   4441 C  C   . PRO B 1 280 ? 63.545  25.496 16.631  1.00 24.61 ? 280  PRO B C   1 
ATOM   4442 O  O   . PRO B 1 280 ? 62.581  25.866 15.966  1.00 26.73 ? 280  PRO B O   1 
ATOM   4443 C  CB  . PRO B 1 280 ? 64.859  27.483 17.543  1.00 22.21 ? 280  PRO B CB  1 
ATOM   4444 C  CG  . PRO B 1 280 ? 66.235  26.994 17.851  1.00 21.81 ? 280  PRO B CG  1 
ATOM   4445 C  CD  . PRO B 1 280 ? 66.033  26.229 19.131  1.00 19.58 ? 280  PRO B CD  1 
ATOM   4446 N  N   . SER B 1 281 ? 64.254  24.413 16.327  1.00 23.92 ? 281  SER B N   1 
ATOM   4447 C  CA  . SER B 1 281 ? 63.946  23.604 15.157  1.00 23.19 ? 281  SER B CA  1 
ATOM   4448 C  C   . SER B 1 281 ? 62.865  22.565 15.416  1.00 24.56 ? 281  SER B C   1 
ATOM   4449 O  O   . SER B 1 281 ? 62.465  21.843 14.499  1.00 25.06 ? 281  SER B O   1 
ATOM   4450 C  CB  . SER B 1 281 ? 65.200  22.890 14.656  1.00 23.21 ? 281  SER B CB  1 
ATOM   4451 O  OG  . SER B 1 281 ? 65.524  21.814 15.512  1.00 22.72 ? 281  SER B OG  1 
ATOM   4452 N  N   . LEU B 1 282 ? 62.402  22.462 16.658  1.00 24.52 ? 282  LEU B N   1 
ATOM   4453 C  CA  . LEU B 1 282 ? 61.350  21.501 16.965  1.00 23.15 ? 282  LEU B CA  1 
ATOM   4454 C  C   . LEU B 1 282 ? 60.001  22.203 17.004  1.00 23.95 ? 282  LEU B C   1 
ATOM   4455 O  O   . LEU B 1 282 ? 58.968  21.564 17.194  1.00 23.90 ? 282  LEU B O   1 
ATOM   4456 C  CB  . LEU B 1 282 ? 61.630  20.779 18.292  1.00 21.92 ? 282  LEU B CB  1 
ATOM   4457 C  CG  . LEU B 1 282 ? 62.882  19.888 18.300  1.00 22.37 ? 282  LEU B CG  1 
ATOM   4458 C  CD1 . LEU B 1 282 ? 62.912  19.012 19.543  1.00 19.93 ? 282  LEU B CD1 1 
ATOM   4459 C  CD2 . LEU B 1 282 ? 62.884  19.013 17.068  1.00 22.55 ? 282  LEU B CD2 1 
ATOM   4460 N  N   . GLY B 1 283 ? 60.019  23.523 16.823  1.00 25.34 ? 283  GLY B N   1 
ATOM   4461 C  CA  . GLY B 1 283 ? 58.787  24.287 16.802  1.00 27.77 ? 283  GLY B CA  1 
ATOM   4462 C  C   . GLY B 1 283 ? 58.006  23.906 15.551  1.00 30.41 ? 283  GLY B C   1 
ATOM   4463 O  O   . GLY B 1 283 ? 58.456  24.134 14.420  1.00 30.43 ? 283  GLY B O   1 
ATOM   4464 N  N   . LYS B 1 284 ? 56.834  23.313 15.749  1.00 31.13 ? 284  LYS B N   1 
ATOM   4465 C  CA  . LYS B 1 284 ? 55.999  22.875 14.636  1.00 32.10 ? 284  LYS B CA  1 
ATOM   4466 C  C   . LYS B 1 284 ? 55.627  24.038 13.724  1.00 32.03 ? 284  LYS B C   1 
ATOM   4467 O  O   . LYS B 1 284 ? 55.322  23.839 12.548  1.00 32.36 ? 284  LYS B O   1 
ATOM   4468 C  CB  . LYS B 1 284 ? 54.734  22.196 15.175  1.00 33.62 ? 284  LYS B CB  1 
ATOM   4469 C  CG  . LYS B 1 284 ? 54.314  20.954 14.401  1.00 38.35 ? 284  LYS B CG  1 
ATOM   4470 C  CD  . LYS B 1 284 ? 53.271  20.113 15.158  1.00 41.12 ? 284  LYS B CD  1 
ATOM   4471 C  CE  . LYS B 1 284 ? 53.865  19.429 16.393  1.00 42.75 ? 284  LYS B CE  1 
ATOM   4472 N  NZ  . LYS B 1 284 ? 52.917  18.471 17.031  1.00 41.68 ? 284  LYS B NZ  1 
ATOM   4473 N  N   . THR B 1 285 ? 55.668  25.249 14.273  1.00 30.84 ? 285  THR B N   1 
ATOM   4474 C  CA  . THR B 1 285 ? 55.335  26.458 13.528  1.00 29.35 ? 285  THR B CA  1 
ATOM   4475 C  C   . THR B 1 285 ? 56.254  27.605 13.947  1.00 29.31 ? 285  THR B C   1 
ATOM   4476 O  O   . THR B 1 285 ? 57.017  27.481 14.908  1.00 29.05 ? 285  THR B O   1 
ATOM   4477 C  CB  . THR B 1 285 ? 53.872  26.883 13.783  1.00 30.05 ? 285  THR B CB  1 
ATOM   4478 O  OG1 . THR B 1 285 ? 53.662  27.081 15.188  1.00 31.69 ? 285  THR B OG1 1 
ATOM   4479 C  CG2 . THR B 1 285 ? 52.917  25.819 13.284  1.00 30.97 ? 285  THR B CG2 1 
ATOM   4480 N  N   . PRO B 1 286 ? 56.203  28.736 13.223  1.00 29.04 ? 286  PRO B N   1 
ATOM   4481 C  CA  . PRO B 1 286 ? 57.057  29.873 13.577  1.00 28.13 ? 286  PRO B CA  1 
ATOM   4482 C  C   . PRO B 1 286 ? 56.715  30.504 14.933  1.00 27.17 ? 286  PRO B C   1 
ATOM   4483 O  O   . PRO B 1 286 ? 57.603  31.017 15.620  1.00 26.67 ? 286  PRO B O   1 
ATOM   4484 C  CB  . PRO B 1 286 ? 56.843  30.840 12.412  1.00 28.96 ? 286  PRO B CB  1 
ATOM   4485 C  CG  . PRO B 1 286 ? 56.592  29.914 11.260  1.00 29.39 ? 286  PRO B CG  1 
ATOM   4486 C  CD  . PRO B 1 286 ? 55.627  28.925 11.879  1.00 29.71 ? 286  PRO B CD  1 
ATOM   4487 N  N   . GLU B 1 287 ? 55.444  30.476 15.331  1.00 24.66 ? 287  GLU B N   1 
ATOM   4488 C  CA  . GLU B 1 287 ? 55.101  31.067 16.617  1.00 24.03 ? 287  GLU B CA  1 
ATOM   4489 C  C   . GLU B 1 287 ? 55.321  30.093 17.775  1.00 22.37 ? 287  GLU B C   1 
ATOM   4490 O  O   . GLU B 1 287 ? 55.299  30.491 18.941  1.00 20.45 ? 287  GLU B O   1 
ATOM   4491 C  CB  . GLU B 1 287 ? 53.667  31.624 16.614  1.00 24.18 ? 287  GLU B CB  1 
ATOM   4492 C  CG  . GLU B 1 287 ? 52.549  30.652 16.932  1.00 26.52 ? 287  GLU B CG  1 
ATOM   4493 C  CD  . GLU B 1 287 ? 52.533  30.211 18.382  1.00 24.90 ? 287  GLU B CD  1 
ATOM   4494 O  OE1 . GLU B 1 287 ? 52.527  31.077 19.281  1.00 24.65 ? 287  GLU B OE1 1 
ATOM   4495 O  OE2 . GLU B 1 287 ? 52.522  28.988 18.618  1.00 26.64 ? 287  GLU B OE2 1 
ATOM   4496 N  N   . GLU B 1 288 ? 55.533  28.818 17.459  1.00 21.92 ? 288  GLU B N   1 
ATOM   4497 C  CA  . GLU B 1 288 ? 55.803  27.836 18.506  1.00 20.68 ? 288  GLU B CA  1 
ATOM   4498 C  C   . GLU B 1 288 ? 57.220  28.089 18.990  1.00 20.00 ? 288  GLU B C   1 
ATOM   4499 O  O   . GLU B 1 288 ? 57.513  27.947 20.176  1.00 21.07 ? 288  GLU B O   1 
ATOM   4500 C  CB  . GLU B 1 288 ? 55.691  26.408 17.979  1.00 19.96 ? 288  GLU B CB  1 
ATOM   4501 C  CG  . GLU B 1 288 ? 54.308  25.805 18.113  1.00 19.44 ? 288  GLU B CG  1 
ATOM   4502 C  CD  . GLU B 1 288 ? 54.321  24.300 17.894  1.00 20.91 ? 288  GLU B CD  1 
ATOM   4503 O  OE1 . GLU B 1 288 ? 55.402  23.690 18.032  1.00 22.56 ? 288  GLU B OE1 1 
ATOM   4504 O  OE2 . GLU B 1 288 ? 53.254  23.722 17.601  1.00 21.02 ? 288  GLU B OE2 1 
ATOM   4505 N  N   . VAL B 1 289 ? 58.094  28.460 18.059  1.00 19.09 ? 289  VAL B N   1 
ATOM   4506 C  CA  . VAL B 1 289 ? 59.483  28.769 18.373  1.00 19.88 ? 289  VAL B CA  1 
ATOM   4507 C  C   . VAL B 1 289 ? 59.481  30.083 19.135  1.00 20.11 ? 289  VAL B C   1 
ATOM   4508 O  O   . VAL B 1 289 ? 60.090  30.214 20.194  1.00 20.09 ? 289  VAL B O   1 
ATOM   4509 C  CB  . VAL B 1 289 ? 60.330  28.976 17.102  1.00 20.92 ? 289  VAL B CB  1 
ATOM   4510 C  CG1 . VAL B 1 289 ? 61.754  29.319 17.495  1.00 21.71 ? 289  VAL B CG1 1 
ATOM   4511 C  CG2 . VAL B 1 289 ? 60.297  27.726 16.226  1.00 20.62 ? 289  VAL B CG2 1 
ATOM   4512 N  N   . THR B 1 290 ? 58.786  31.064 18.575  1.00 19.63 ? 290  THR B N   1 
ATOM   4513 C  CA  . THR B 1 290 ? 58.687  32.365 19.199  1.00 18.88 ? 290  THR B CA  1 
ATOM   4514 C  C   . THR B 1 290 ? 58.068  32.248 20.591  1.00 18.61 ? 290  THR B C   1 
ATOM   4515 O  O   . THR B 1 290 ? 58.496  32.915 21.520  1.00 18.53 ? 290  THR B O   1 
ATOM   4516 C  CB  . THR B 1 290 ? 57.859  33.326 18.301  1.00 19.29 ? 290  THR B CB  1 
ATOM   4517 O  OG1 . THR B 1 290 ? 58.743  34.288 17.715  1.00 19.27 ? 290  THR B OG1 1 
ATOM   4518 C  CG2 . THR B 1 290 ? 56.762  34.039 19.088  1.00 18.16 ? 290  THR B CG2 1 
ATOM   4519 N  N   . ARG B 1 291 ? 57.075  31.378 20.734  1.00 19.30 ? 291  ARG B N   1 
ATOM   4520 C  CA  . ARG B 1 291 ? 56.398  31.194 22.011  1.00 17.86 ? 291  ARG B CA  1 
ATOM   4521 C  C   . ARG B 1 291 ? 57.326  30.551 23.042  1.00 17.57 ? 291  ARG B C   1 
ATOM   4522 O  O   . ARG B 1 291 ? 57.241  30.843 24.238  1.00 17.85 ? 291  ARG B O   1 
ATOM   4523 C  CB  . ARG B 1 291 ? 55.163  30.316 21.819  1.00 17.01 ? 291  ARG B CB  1 
ATOM   4524 C  CG  . ARG B 1 291 ? 54.189  30.358 22.980  1.00 16.88 ? 291  ARG B CG  1 
ATOM   4525 C  CD  . ARG B 1 291 ? 53.335  29.115 23.002  1.00 16.80 ? 291  ARG B CD  1 
ATOM   4526 N  NE  . ARG B 1 291 ? 52.761  28.816 21.695  1.00 17.36 ? 291  ARG B NE  1 
ATOM   4527 C  CZ  . ARG B 1 291 ? 52.190  27.656 21.380  1.00 16.60 ? 291  ARG B CZ  1 
ATOM   4528 N  NH1 . ARG B 1 291 ? 52.119  26.682 22.273  1.00 14.80 ? 291  ARG B NH1 1 
ATOM   4529 N  NH2 . ARG B 1 291 ? 51.685  27.469 20.172  1.00 19.33 ? 291  ARG B NH2 1 
ATOM   4530 N  N   . THR B 1 292 ? 58.200  29.667 22.567  1.00 15.38 ? 292  THR B N   1 
ATOM   4531 C  CA  . THR B 1 292 ? 59.152  28.978 23.428  1.00 13.91 ? 292  THR B CA  1 
ATOM   4532 C  C   . THR B 1 292 ? 60.211  29.937 23.928  1.00 14.44 ? 292  THR B C   1 
ATOM   4533 O  O   . THR B 1 292 ? 60.505  29.995 25.122  1.00 13.61 ? 292  THR B O   1 
ATOM   4534 C  CB  . THR B 1 292 ? 59.858  27.858 22.681  1.00 10.25 ? 292  THR B CB  1 
ATOM   4535 O  OG1 . THR B 1 292 ? 58.901  26.867 22.305  1.00 13.08 ? 292  THR B OG1 1 
ATOM   4536 C  CG2 . THR B 1 292 ? 60.906  27.221 23.562  1.00 12.05 ? 292  THR B CG2 1 
ATOM   4537 N  N   . VAL B 1 293 ? 60.784  30.681 22.988  1.00 15.00 ? 293  VAL B N   1 
ATOM   4538 C  CA  . VAL B 1 293 ? 61.821  31.652 23.280  1.00 13.83 ? 293  VAL B CA  1 
ATOM   4539 C  C   . VAL B 1 293 ? 61.303  32.729 24.232  1.00 14.68 ? 293  VAL B C   1 
ATOM   4540 O  O   . VAL B 1 293 ? 61.984  33.085 25.196  1.00 13.61 ? 293  VAL B O   1 
ATOM   4541 C  CB  . VAL B 1 293 ? 62.327  32.321 21.973  1.00 14.69 ? 293  VAL B CB  1 
ATOM   4542 C  CG1 . VAL B 1 293 ? 63.391  33.375 22.290  1.00 13.45 ? 293  VAL B CG1 1 
ATOM   4543 C  CG2 . VAL B 1 293 ? 62.878  31.261 21.026  1.00 14.34 ? 293  VAL B CG2 1 
ATOM   4544 N  N   . ASN B 1 294 ? 60.100  33.244 23.972  1.00 15.15 ? 294  ASN B N   1 
ATOM   4545 C  CA  . ASN B 1 294 ? 59.552  34.289 24.834  1.00 15.91 ? 294  ASN B CA  1 
ATOM   4546 C  C   . ASN B 1 294 ? 59.319  33.809 26.254  1.00 14.76 ? 294  ASN B C   1 
ATOM   4547 O  O   . ASN B 1 294 ? 59.486  34.575 27.199  1.00 15.60 ? 294  ASN B O   1 
ATOM   4548 C  CB  . ASN B 1 294 ? 58.247  34.853 24.267  1.00 16.50 ? 294  ASN B CB  1 
ATOM   4549 C  CG  . ASN B 1 294 ? 58.460  35.630 22.984  1.00 16.95 ? 294  ASN B CG  1 
ATOM   4550 O  OD1 . ASN B 1 294 ? 59.558  36.143 22.727  1.00 16.73 ? 294  ASN B OD1 1 
ATOM   4551 N  ND2 . ASN B 1 294 ? 57.408  35.731 22.173  1.00 14.62 ? 294  ASN B ND2 1 
ATOM   4552 N  N   . THR B 1 295 ? 58.938  32.542 26.399  1.00 15.45 ? 295  THR B N   1 
ATOM   4553 C  CA  . THR B 1 295 ? 58.688  31.968 27.713  1.00 14.42 ? 295  THR B CA  1 
ATOM   4554 C  C   . THR B 1 295 ? 60.013  31.762 28.421  1.00 13.21 ? 295  THR B C   1 
ATOM   4555 O  O   . THR B 1 295 ? 60.125  32.039 29.600  1.00 14.25 ? 295  THR B O   1 
ATOM   4556 C  CB  . THR B 1 295 ? 57.952  30.605 27.629  1.00 16.15 ? 295  THR B CB  1 
ATOM   4557 O  OG1 . THR B 1 295 ? 56.684  30.766 26.980  1.00 17.00 ? 295  THR B OG1 1 
ATOM   4558 C  CG2 . THR B 1 295 ? 57.715  30.062 29.016  1.00 14.97 ? 295  THR B CG2 1 
ATOM   4559 N  N   . ALA B 1 296 ? 61.021  31.288 27.695  1.00 13.22 ? 296  ALA B N   1 
ATOM   4560 C  CA  . ALA B 1 296 ? 62.346  31.061 28.283  1.00 14.11 ? 296  ALA B CA  1 
ATOM   4561 C  C   . ALA B 1 296 ? 62.992  32.377 28.745  1.00 13.53 ? 296  ALA B C   1 
ATOM   4562 O  O   . ALA B 1 296 ? 63.710  32.410 29.745  1.00 13.46 ? 296  ALA B O   1 
ATOM   4563 C  CB  . ALA B 1 296 ? 63.257  30.335 27.280  1.00 11.73 ? 296  ALA B CB  1 
ATOM   4564 N  N   . VAL B 1 297 ? 62.731  33.459 28.021  1.00 13.24 ? 297  VAL B N   1 
ATOM   4565 C  CA  . VAL B 1 297 ? 63.271  34.762 28.394  1.00 15.64 ? 297  VAL B CA  1 
ATOM   4566 C  C   . VAL B 1 297 ? 62.539  35.313 29.615  1.00 16.91 ? 297  VAL B C   1 
ATOM   4567 O  O   . VAL B 1 297 ? 63.164  35.884 30.518  1.00 16.88 ? 297  VAL B O   1 
ATOM   4568 C  CB  . VAL B 1 297 ? 63.140  35.778 27.241  1.00 17.95 ? 297  VAL B CB  1 
ATOM   4569 C  CG1 . VAL B 1 297 ? 63.130  37.207 27.799  1.00 17.75 ? 297  VAL B CG1 1 
ATOM   4570 C  CG2 . VAL B 1 297 ? 64.306  35.601 26.260  1.00 17.97 ? 297  VAL B CG2 1 
ATOM   4571 N  N   . ALA B 1 298 ? 61.215  35.135 29.622  1.00 15.12 ? 298  ALA B N   1 
ATOM   4572 C  CA  . ALA B 1 298 ? 60.342  35.588 30.698  1.00 14.91 ? 298  ALA B CA  1 
ATOM   4573 C  C   . ALA B 1 298 ? 60.725  34.956 32.029  1.00 14.22 ? 298  ALA B C   1 
ATOM   4574 O  O   . ALA B 1 298 ? 60.699  35.623 33.065  1.00 11.54 ? 298  ALA B O   1 
ATOM   4575 C  CB  . ALA B 1 298 ? 58.878  35.260 30.357  1.00 15.49 ? 298  ALA B CB  1 
ATOM   4576 N  N   . ILE B 1 299 ? 61.063  33.668 31.995  1.00 14.35 ? 299  ILE B N   1 
ATOM   4577 C  CA  . ILE B 1 299 ? 61.486  32.944 33.196  1.00 16.91 ? 299  ILE B CA  1 
ATOM   4578 C  C   . ILE B 1 299 ? 62.827  33.500 33.672  1.00 16.05 ? 299  ILE B C   1 
ATOM   4579 O  O   . ILE B 1 299 ? 63.087  33.592 34.872  1.00 14.82 ? 299  ILE B O   1 
ATOM   4580 C  CB  . ILE B 1 299 ? 61.659  31.412 32.926  1.00 17.06 ? 299  ILE B CB  1 
ATOM   4581 C  CG1 . ILE B 1 299 ? 60.320  30.685 33.077  1.00 18.35 ? 299  ILE B CG1 1 
ATOM   4582 C  CG2 . ILE B 1 299 ? 62.647  30.812 33.917  1.00 15.88 ? 299  ILE B CG2 1 
ATOM   4583 C  CD1 . ILE B 1 299 ? 59.232  31.187 32.178  1.00 21.56 ? 299  ILE B CD1 1 
ATOM   4584 N  N   . THR B 1 300 ? 63.669  33.871 32.713  1.00 15.10 ? 300  THR B N   1 
ATOM   4585 C  CA  . THR B 1 300 ? 64.995  34.409 33.007  1.00 15.29 ? 300  THR B CA  1 
ATOM   4586 C  C   . THR B 1 300 ? 64.934  35.790 33.678  1.00 14.43 ? 300  THR B C   1 
ATOM   4587 O  O   . THR B 1 300 ? 65.652  36.047 34.646  1.00 14.24 ? 300  THR B O   1 
ATOM   4588 C  CB  . THR B 1 300 ? 65.847  34.483 31.701  1.00 14.89 ? 300  THR B CB  1 
ATOM   4589 O  OG1 . THR B 1 300 ? 65.984  33.162 31.150  1.00 13.77 ? 300  THR B OG1 1 
ATOM   4590 C  CG2 . THR B 1 300 ? 67.235  35.060 31.982  1.00 14.67 ? 300  THR B CG2 1 
ATOM   4591 N  N   . LEU B 1 301 ? 64.080  36.670 33.164  1.00 13.14 ? 301  LEU B N   1 
ATOM   4592 C  CA  . LEU B 1 301 ? 63.931  38.006 33.728  1.00 13.28 ? 301  LEU B CA  1 
ATOM   4593 C  C   . LEU B 1 301 ? 63.317  37.941 35.130  1.00 13.92 ? 301  LEU B C   1 
ATOM   4594 O  O   . LEU B 1 301 ? 63.568  38.809 35.971  1.00 15.62 ? 301  LEU B O   1 
ATOM   4595 C  CB  . LEU B 1 301 ? 63.066  38.881 32.803  1.00 11.68 ? 301  LEU B CB  1 
ATOM   4596 C  CG  . LEU B 1 301 ? 63.589  39.124 31.379  1.00 11.93 ? 301  LEU B CG  1 
ATOM   4597 C  CD1 . LEU B 1 301 ? 62.660  40.081 30.644  1.00 15.17 ? 301  LEU B CD1 1 
ATOM   4598 C  CD2 . LEU B 1 301 ? 64.988  39.712 31.423  1.00 11.48 ? 301  LEU B CD2 1 
ATOM   4599 N  N   . ALA B 1 302 ? 62.507  36.915 35.371  1.00 14.56 ? 302  ALA B N   1 
ATOM   4600 C  CA  . ALA B 1 302 ? 61.876  36.707 36.672  1.00 14.23 ? 302  ALA B CA  1 
ATOM   4601 C  C   . ALA B 1 302 ? 62.954  36.411 37.721  1.00 14.90 ? 302  ALA B C   1 
ATOM   4602 O  O   . ALA B 1 302 ? 62.855  36.823 38.876  1.00 15.09 ? 302  ALA B O   1 
ATOM   4603 C  CB  . ALA B 1 302 ? 60.900  35.544 36.595  1.00 10.16 ? 302  ALA B CB  1 
ATOM   4604 N  N   . CYS B 1 303 ? 63.986  35.690 37.305  1.00 15.44 ? 303  CYS B N   1 
ATOM   4605 C  CA  . CYS B 1 303 ? 65.073  35.339 38.194  1.00 15.50 ? 303  CYS B CA  1 
ATOM   4606 C  C   . CYS B 1 303 ? 65.862  36.571 38.614  1.00 16.67 ? 303  CYS B C   1 
ATOM   4607 O  O   . CYS B 1 303 ? 66.402  36.622 39.720  1.00 17.62 ? 303  CYS B O   1 
ATOM   4608 C  CB  . CYS B 1 303 ? 66.000  34.343 37.499  1.00 16.29 ? 303  CYS B CB  1 
ATOM   4609 S  SG  . CYS B 1 303 ? 65.181  32.785 37.067  1.00 19.64 ? 303  CYS B SG  1 
ATOM   4610 N  N   . PHE B 1 304 ? 65.912  37.572 37.739  1.00 14.93 ? 304  PHE B N   1 
ATOM   4611 C  CA  . PHE B 1 304 ? 66.666  38.780 38.034  1.00 16.28 ? 304  PHE B CA  1 
ATOM   4612 C  C   . PHE B 1 304 ? 65.882  40.030 38.410  1.00 16.12 ? 304  PHE B C   1 
ATOM   4613 O  O   . PHE B 1 304 ? 66.365  41.141 38.201  1.00 17.60 ? 304  PHE B O   1 
ATOM   4614 C  CB  . PHE B 1 304 ? 67.613  39.089 36.873  1.00 16.44 ? 304  PHE B CB  1 
ATOM   4615 C  CG  . PHE B 1 304 ? 68.599  37.990 36.607  1.00 18.48 ? 304  PHE B CG  1 
ATOM   4616 C  CD1 . PHE B 1 304 ? 69.501  37.597 37.597  1.00 17.67 ? 304  PHE B CD1 1 
ATOM   4617 C  CD2 . PHE B 1 304 ? 68.597  37.311 35.385  1.00 18.52 ? 304  PHE B CD2 1 
ATOM   4618 C  CE1 . PHE B 1 304 ? 70.389  36.539 37.378  1.00 18.48 ? 304  PHE B CE1 1 
ATOM   4619 C  CE2 . PHE B 1 304 ? 69.483  36.247 35.153  1.00 18.60 ? 304  PHE B CE2 1 
ATOM   4620 C  CZ  . PHE B 1 304 ? 70.379  35.861 36.150  1.00 17.38 ? 304  PHE B CZ  1 
ATOM   4621 N  N   . GLY B 1 305 ? 64.679  39.860 38.956  1.00 14.98 ? 305  GLY B N   1 
ATOM   4622 C  CA  . GLY B 1 305 ? 63.928  41.019 39.395  1.00 13.11 ? 305  GLY B CA  1 
ATOM   4623 C  C   . GLY B 1 305 ? 62.597  41.370 38.775  1.00 13.97 ? 305  GLY B C   1 
ATOM   4624 O  O   . GLY B 1 305 ? 61.783  42.021 39.430  1.00 13.07 ? 305  GLY B O   1 
ATOM   4625 N  N   . LEU B 1 306 ? 62.356  40.982 37.529  1.00 14.26 ? 306  LEU B N   1 
ATOM   4626 C  CA  . LEU B 1 306 ? 61.074  41.316 36.921  1.00 14.81 ? 306  LEU B CA  1 
ATOM   4627 C  C   . LEU B 1 306 ? 59.945  40.680 37.718  1.00 14.08 ? 306  LEU B C   1 
ATOM   4628 O  O   . LEU B 1 306 ? 59.874  39.457 37.840  1.00 15.03 ? 306  LEU B O   1 
ATOM   4629 C  CB  . LEU B 1 306 ? 61.001  40.839 35.472  1.00 15.20 ? 306  LEU B CB  1 
ATOM   4630 C  CG  . LEU B 1 306 ? 60.876  41.930 34.401  1.00 19.46 ? 306  LEU B CG  1 
ATOM   4631 C  CD1 . LEU B 1 306 ? 60.398  41.291 33.113  1.00 19.00 ? 306  LEU B CD1 1 
ATOM   4632 C  CD2 . LEU B 1 306 ? 59.902  43.008 34.828  1.00 18.59 ? 306  LEU B CD2 1 
ATOM   4633 N  N   . ALA B 1 307 ? 59.071  41.521 38.263  1.00 12.53 ? 307  ALA B N   1 
ATOM   4634 C  CA  . ALA B 1 307 ? 57.931  41.060 39.048  1.00 12.26 ? 307  ALA B CA  1 
ATOM   4635 C  C   . ALA B 1 307 ? 56.633  41.406 38.320  1.00 11.65 ? 307  ALA B C   1 
ATOM   4636 O  O   . ALA B 1 307 ? 56.518  42.471 37.714  1.00 12.36 ? 307  ALA B O   1 
ATOM   4637 C  CB  . ALA B 1 307 ? 57.946  41.714 40.435  1.00 10.31 ? 307  ALA B CB  1 
ATOM   4638 N  N   . ARG B 1 308 ? 55.661  40.504 38.370  1.00 10.67 ? 308  ARG B N   1 
ATOM   4639 C  CA  . ARG B 1 308 ? 54.381  40.748 37.722  1.00 10.72 ? 308  ARG B CA  1 
ATOM   4640 C  C   . ARG B 1 308 ? 53.593  41.902 38.337  1.00 11.30 ? 308  ARG B C   1 
ATOM   4641 O  O   . ARG B 1 308 ? 52.807  42.557 37.642  1.00 8.11  ? 308  ARG B O   1 
ATOM   4642 C  CB  . ARG B 1 308 ? 53.536  39.476 37.727  1.00 12.53 ? 308  ARG B CB  1 
ATOM   4643 C  CG  . ARG B 1 308 ? 53.867  38.565 36.570  1.00 12.78 ? 308  ARG B CG  1 
ATOM   4644 C  CD  . ARG B 1 308 ? 53.089  37.280 36.631  1.00 13.60 ? 308  ARG B CD  1 
ATOM   4645 N  NE  . ARG B 1 308 ? 53.618  36.378 37.648  1.00 12.64 ? 308  ARG B NE  1 
ATOM   4646 C  CZ  . ARG B 1 308 ? 53.048  35.226 37.973  1.00 12.59 ? 308  ARG B CZ  1 
ATOM   4647 N  NH1 . ARG B 1 308 ? 51.938  34.848 37.353  1.00 10.86 ? 308  ARG B NH1 1 
ATOM   4648 N  NH2 . ARG B 1 308 ? 53.571  34.466 38.926  1.00 13.47 ? 308  ARG B NH2 1 
ATOM   4649 N  N   . GLU B 1 309 ? 53.797  42.158 39.631  1.00 12.15 ? 309  GLU B N   1 
ATOM   4650 C  CA  . GLU B 1 309 ? 53.096  43.254 40.287  1.00 11.99 ? 309  GLU B CA  1 
ATOM   4651 C  C   . GLU B 1 309 ? 53.706  44.589 39.849  1.00 12.66 ? 309  GLU B C   1 
ATOM   4652 O  O   . GLU B 1 309 ? 53.106  45.657 40.040  1.00 10.41 ? 309  GLU B O   1 
ATOM   4653 C  CB  . GLU B 1 309 ? 53.174  43.128 41.810  1.00 13.17 ? 309  GLU B CB  1 
ATOM   4654 C  CG  . GLU B 1 309 ? 54.553  43.376 42.386  1.00 14.80 ? 309  GLU B CG  1 
ATOM   4655 C  CD  . GLU B 1 309 ? 54.501  43.802 43.843  1.00 17.14 ? 309  GLU B CD  1 
ATOM   4656 O  OE1 . GLU B 1 309 ? 53.933  43.061 44.673  1.00 18.09 ? 309  GLU B OE1 1 
ATOM   4657 O  OE2 . GLU B 1 309 ? 55.031  44.887 44.160  1.00 18.35 ? 309  GLU B OE2 1 
ATOM   4658 N  N   . GLY B 1 310 ? 54.904  44.523 39.272  1.00 11.79 ? 310  GLY B N   1 
ATOM   4659 C  CA  . GLY B 1 310 ? 55.572  45.723 38.800  1.00 12.00 ? 310  GLY B CA  1 
ATOM   4660 C  C   . GLY B 1 310 ? 56.912  46.011 39.453  1.00 14.81 ? 310  GLY B C   1 
ATOM   4661 O  O   . GLY B 1 310 ? 57.301  45.357 40.420  1.00 13.25 ? 310  GLY B O   1 
ATOM   4662 N  N   . ASN B 1 311 ? 57.620  46.999 38.906  1.00 17.14 ? 311  ASN B N   1 
ATOM   4663 C  CA  . ASN B 1 311 ? 58.920  47.426 39.420  1.00 19.96 ? 311  ASN B CA  1 
ATOM   4664 C  C   . ASN B 1 311 ? 59.045  48.939 39.239  1.00 21.04 ? 311  ASN B C   1 
ATOM   4665 O  O   . ASN B 1 311 ? 58.390  49.521 38.379  1.00 19.90 ? 311  ASN B O   1 
ATOM   4666 C  CB  . ASN B 1 311 ? 60.072  46.754 38.653  1.00 21.94 ? 311  ASN B CB  1 
ATOM   4667 C  CG  . ASN B 1 311 ? 60.075  45.236 38.782  1.00 23.12 ? 311  ASN B CG  1 
ATOM   4668 O  OD1 . ASN B 1 311 ? 59.330  44.537 38.096  1.00 21.63 ? 311  ASN B OD1 1 
ATOM   4669 N  ND2 . ASN B 1 311 ? 60.919  44.723 39.669  1.00 23.48 ? 311  ASN B ND2 1 
ATOM   4670 N  N   . HIS B 1 312 ? 59.876  49.574 40.058  1.00 22.68 ? 312  HIS B N   1 
ATOM   4671 C  CA  . HIS B 1 312 ? 60.108  51.009 39.942  1.00 24.20 ? 312  HIS B CA  1 
ATOM   4672 C  C   . HIS B 1 312 ? 61.432  51.369 40.604  1.00 25.49 ? 312  HIS B C   1 
ATOM   4673 O  O   . HIS B 1 312 ? 61.944  50.613 41.432  1.00 26.06 ? 312  HIS B O   1 
ATOM   4674 C  CB  . HIS B 1 312 ? 58.960  51.820 40.560  1.00 23.69 ? 312  HIS B CB  1 
ATOM   4675 C  CG  . HIS B 1 312 ? 58.927  51.805 42.058  1.00 24.28 ? 312  HIS B CG  1 
ATOM   4676 N  ND1 . HIS B 1 312 ? 58.572  50.690 42.788  1.00 23.60 ? 312  HIS B ND1 1 
ATOM   4677 C  CD2 . HIS B 1 312 ? 59.160  52.787 42.961  1.00 22.83 ? 312  HIS B CD2 1 
ATOM   4678 C  CE1 . HIS B 1 312 ? 58.584  50.987 44.075  1.00 23.03 ? 312  HIS B CE1 1 
ATOM   4679 N  NE2 . HIS B 1 312 ? 58.936  52.253 44.207  1.00 22.55 ? 312  HIS B NE2 1 
ATOM   4680 N  N   . LYS B 1 313 ? 61.988  52.519 40.231  1.00 26.74 ? 313  LYS B N   1 
ATOM   4681 C  CA  . LYS B 1 313 ? 63.266  52.961 40.781  1.00 28.94 ? 313  LYS B CA  1 
ATOM   4682 C  C   . LYS B 1 313 ? 63.154  53.584 42.168  1.00 30.02 ? 313  LYS B C   1 
ATOM   4683 O  O   . LYS B 1 313 ? 64.201  53.675 42.855  1.00 30.90 ? 313  LYS B O   1 
ATOM   4684 C  CB  . LYS B 1 313 ? 63.948  53.940 39.816  1.00 29.35 ? 313  LYS B CB  1 
ATOM   4685 C  CG  . LYS B 1 313 ? 64.555  53.279 38.578  1.00 28.76 ? 313  LYS B CG  1 
ATOM   4686 C  CD  . LYS B 1 313 ? 63.537  52.412 37.843  1.00 32.03 ? 313  LYS B CD  1 
ATOM   4687 C  CE  . LYS B 1 313 ? 64.150  51.708 36.639  1.00 33.92 ? 313  LYS B CE  1 
ATOM   4688 N  NZ  . LYS B 1 313 ? 65.258  50.773 36.999  1.00 32.83 ? 313  LYS B NZ  1 
HETATM 4689 MN MN  . MN  C 2 .   ? 15.588  16.808 -2.858  1.00 18.18 ? 2314 MN  A MN  1 
HETATM 4690 MN MN  . MN  D 2 .   ? 15.019  13.690 -4.041  1.00 14.07 ? 2315 MN  A MN  1 
HETATM 4691 O  OXT . S2C E 3 .   ? 23.401  13.715 -6.366  1.00 23.30 ? 1317 S2C A OXT 1 
HETATM 4692 N  N   . S2C E 3 .   ? 22.573  11.507 -3.505  1.00 26.00 ? 1317 S2C A N   1 
HETATM 4693 C  CA  . S2C E 3 .   ? 22.403  12.081 -4.868  1.00 25.07 ? 1317 S2C A CA  1 
HETATM 4694 C  C   . S2C E 3 .   ? 23.498  13.182 -5.144  1.00 24.49 ? 1317 S2C A C   1 
HETATM 4695 O  O   . S2C E 3 .   ? 24.358  13.538 -4.376  1.00 23.36 ? 1317 S2C A O   1 
HETATM 4696 C  CB  . S2C E 3 .   ? 20.953  12.571 -4.835  1.00 24.76 ? 1317 S2C A CB  1 
HETATM 4697 S  SG  . S2C E 3 .   ? 20.457  13.376 -6.352  1.00 25.75 ? 1317 S2C A SG  1 
HETATM 4698 C  CD  . S2C E 3 .   ? 18.777  13.735 -5.861  1.00 23.30 ? 1317 S2C A CD  1 
HETATM 4699 C  CE  . S2C E 3 .   ? 18.613  15.222 -5.571  1.00 21.28 ? 1317 S2C A CE  1 
HETATM 4700 B  B   . S2C E 3 .   ? 17.183  15.636 -5.139  1.00 19.40 ? 1317 S2C A B   1 
HETATM 4701 O  O1  . S2C E 3 .   ? 16.769  15.013 -3.914  1.00 21.67 ? 1317 S2C A O1  1 
HETATM 4702 O  O2  . S2C E 3 .   ? 17.109  17.048 -4.930  1.00 19.58 ? 1317 S2C A O2  1 
HETATM 4703 O  O3  . S2C E 3 .   ? 16.195  15.309 -6.157  1.00 17.86 ? 1317 S2C A O3  1 
HETATM 4704 MN MN  . MN  F 2 .   ? 66.422  17.993 31.916  1.00 15.10 ? 1314 MN  B MN  1 
HETATM 4705 MN MN  . MN  G 2 .   ? 63.218  17.261 30.727  1.00 15.56 ? 1315 MN  B MN  1 
HETATM 4706 O  OXT . S2C H 3 .   ? 66.359  9.530  28.408  1.00 30.97 ? 1316 S2C B OXT 1 
HETATM 4707 N  N   . S2C H 3 .   ? 64.372  9.488  31.542  1.00 29.59 ? 1316 S2C B N   1 
HETATM 4708 C  CA  . S2C H 3 .   ? 64.653  9.836  30.128  1.00 29.05 ? 1316 S2C B CA  1 
HETATM 4709 C  C   . S2C H 3 .   ? 66.060  9.257  29.690  1.00 30.90 ? 1316 S2C B C   1 
HETATM 4710 O  O   . S2C H 3 .   ? 66.825  8.620  30.389  1.00 31.30 ? 1316 S2C B O   1 
HETATM 4711 C  CB  . S2C H 3 .   ? 64.519  11.360 30.139  1.00 28.02 ? 1316 S2C B CB  1 
HETATM 4712 S  SG  . S2C H 3 .   ? 65.213  12.122 28.681  1.00 26.64 ? 1316 S2C B SG  1 
HETATM 4713 C  CD  . S2C H 3 .   ? 64.837  13.806 29.111  1.00 23.38 ? 1316 S2C B CD  1 
HETATM 4714 C  CE  . S2C H 3 .   ? 66.126  14.568 29.354  1.00 20.44 ? 1316 S2C B CE  1 
HETATM 4715 B  B   . S2C H 3 .   ? 65.929  16.057 29.734  1.00 18.35 ? 1316 S2C B B   1 
HETATM 4716 O  O1  . S2C H 3 .   ? 65.312  16.219 31.009  1.00 18.96 ? 1316 S2C B O1  1 
HETATM 4717 O  O2  . S2C H 3 .   ? 67.184  16.726 29.797  1.00 16.25 ? 1316 S2C B O2  1 
HETATM 4718 O  O3  . S2C H 3 .   ? 65.120  16.777 28.758  1.00 16.40 ? 1316 S2C B O3  1 
HETATM 4719 O  O   . HOH I 4 .   ? 17.036  15.819 14.017  1.00 10.99 ? 2316 HOH A O   1 
HETATM 4720 O  O   . HOH I 4 .   ? 19.590  27.770 -5.415  1.00 9.65  ? 2317 HOH A O   1 
HETATM 4721 O  O   . HOH I 4 .   ? 1.892   3.918  6.354   1.00 5.13  ? 2318 HOH A O   1 
HETATM 4722 O  O   . HOH I 4 .   ? 25.665  16.526 -4.816  1.00 11.35 ? 2319 HOH A O   1 
HETATM 4723 O  O   . HOH I 4 .   ? 19.894  4.492  0.932   1.00 9.25  ? 2320 HOH A O   1 
HETATM 4724 O  O   . HOH I 4 .   ? 3.569   -1.622 9.726   1.00 7.29  ? 2321 HOH A O   1 
HETATM 4725 O  O   . HOH I 4 .   ? 12.869  10.747 -14.604 1.00 12.94 ? 2322 HOH A O   1 
HETATM 4726 O  O   . HOH I 4 .   ? 27.825  10.198 -8.629  1.00 29.10 ? 2323 HOH A O   1 
HETATM 4727 O  O   . HOH I 4 .   ? 8.171   21.732 -8.503  1.00 12.84 ? 2324 HOH A O   1 
HETATM 4728 O  O   . HOH I 4 .   ? 22.262  14.748 -8.987  1.00 15.96 ? 2325 HOH A O   1 
HETATM 4729 O  O   . HOH I 4 .   ? 28.459  25.943 6.089   1.00 32.00 ? 2326 HOH A O   1 
HETATM 4730 O  O   . HOH I 4 .   ? -19.902 25.133 3.694   1.00 19.62 ? 2327 HOH A O   1 
HETATM 4731 O  O   . HOH I 4 .   ? 15.034  26.317 15.507  1.00 24.62 ? 2328 HOH A O   1 
HETATM 4732 O  O   . HOH I 4 .   ? 27.046  24.102 7.430   1.00 9.13  ? 2329 HOH A O   1 
HETATM 4733 O  O   . HOH I 4 .   ? 20.579  10.939 -1.042  1.00 19.37 ? 2330 HOH A O   1 
HETATM 4734 O  O   . HOH I 4 .   ? 17.700  25.271 14.526  1.00 12.80 ? 2331 HOH A O   1 
HETATM 4735 O  O   . HOH I 4 .   ? 10.533  9.051  17.194  1.00 14.69 ? 2332 HOH A O   1 
HETATM 4736 O  O   . HOH I 4 .   ? 21.588  13.858 -1.948  1.00 39.02 ? 2333 HOH A O   1 
HETATM 4737 O  O   . HOH I 4 .   ? 33.404  17.986 3.801   1.00 18.72 ? 2334 HOH A O   1 
HETATM 4738 O  O   . HOH I 4 .   ? -20.615 28.944 7.940   1.00 20.96 ? 2335 HOH A O   1 
HETATM 4739 O  O   . HOH I 4 .   ? 18.048  27.751 -14.258 1.00 15.72 ? 2336 HOH A O   1 
HETATM 4740 O  O   . HOH I 4 .   ? 1.743   2.152  2.860   1.00 11.11 ? 2337 HOH A O   1 
HETATM 4741 O  O   . HOH I 4 .   ? 8.542   36.356 14.162  1.00 32.06 ? 2338 HOH A O   1 
HETATM 4742 O  O   . HOH I 4 .   ? -14.168 22.411 7.557   1.00 24.50 ? 2339 HOH A O   1 
HETATM 4743 O  O   . HOH I 4 .   ? -0.259  10.707 13.247  1.00 11.70 ? 2340 HOH A O   1 
HETATM 4744 O  O   . HOH I 4 .   ? -4.109  13.499 8.324   1.00 33.32 ? 2341 HOH A O   1 
HETATM 4745 O  O   . HOH I 4 .   ? 15.906  -0.013 10.568  1.00 16.22 ? 2342 HOH A O   1 
HETATM 4746 O  O   . HOH I 4 .   ? 13.406  7.424  13.787  1.00 11.50 ? 2343 HOH A O   1 
HETATM 4747 O  O   . HOH I 4 .   ? -6.041  28.231 1.530   1.00 5.30  ? 2344 HOH A O   1 
HETATM 4748 O  O   . HOH I 4 .   ? -10.060 13.180 9.077   1.00 10.15 ? 2345 HOH A O   1 
HETATM 4749 O  O   . HOH I 4 .   ? 0.097   13.354 13.629  1.00 11.37 ? 2346 HOH A O   1 
HETATM 4750 O  O   . HOH I 4 .   ? 13.464  13.831 -8.449  1.00 12.97 ? 2347 HOH A O   1 
HETATM 4751 O  O   . HOH I 4 .   ? 10.812  8.779  -6.743  1.00 8.25  ? 2348 HOH A O   1 
HETATM 4752 O  O   . HOH I 4 .   ? 15.186  17.380 -13.348 1.00 14.28 ? 2349 HOH A O   1 
HETATM 4753 O  O   . HOH I 4 .   ? 13.349  1.573  -2.182  1.00 12.44 ? 2350 HOH A O   1 
HETATM 4754 O  O   . HOH I 4 .   ? 2.511   0.848  0.699   1.00 12.00 ? 2351 HOH A O   1 
HETATM 4755 O  O   . HOH I 4 .   ? 28.377  32.966 6.788   1.00 20.14 ? 2352 HOH A O   1 
HETATM 4756 O  O   . HOH I 4 .   ? 8.134   28.095 -14.785 1.00 23.19 ? 2353 HOH A O   1 
HETATM 4757 O  O   . HOH I 4 .   ? 16.186  14.877 -8.729  1.00 16.16 ? 2354 HOH A O   1 
HETATM 4758 O  O   . HOH I 4 .   ? 2.475   14.174 17.980  1.00 13.64 ? 2355 HOH A O   1 
HETATM 4759 O  O   . HOH I 4 .   ? -0.503  3.874  1.701   1.00 11.69 ? 2356 HOH A O   1 
HETATM 4760 O  O   . HOH I 4 .   ? 11.429  1.654  -0.695  1.00 12.62 ? 2357 HOH A O   1 
HETATM 4761 O  O   . HOH I 4 .   ? 24.736  4.960  1.587   1.00 24.86 ? 2358 HOH A O   1 
HETATM 4762 O  O   . HOH I 4 .   ? 19.651  26.580 16.384  1.00 21.76 ? 2359 HOH A O   1 
HETATM 4763 O  O   . HOH I 4 .   ? -4.373  13.637 -8.176  1.00 11.00 ? 2360 HOH A O   1 
HETATM 4764 O  O   . HOH I 4 .   ? 16.598  1.190  6.563   1.00 9.74  ? 2361 HOH A O   1 
HETATM 4765 O  O   . HOH I 4 .   ? 16.233  40.255 -2.237  1.00 26.48 ? 2362 HOH A O   1 
HETATM 4766 O  O   . HOH I 4 .   ? 9.321   28.888 1.475   1.00 16.58 ? 2363 HOH A O   1 
HETATM 4767 O  O   . HOH I 4 .   ? -0.420  24.759 9.304   1.00 16.73 ? 2364 HOH A O   1 
HETATM 4768 O  O   . HOH I 4 .   ? 8.718   9.961  -7.697  1.00 10.92 ? 2365 HOH A O   1 
HETATM 4769 O  O   . HOH I 4 .   ? -5.606  19.379 5.133   1.00 7.07  ? 2366 HOH A O   1 
HETATM 4770 O  O   . HOH I 4 .   ? -4.789  19.865 -10.753 1.00 29.05 ? 2367 HOH A O   1 
HETATM 4771 O  O   . HOH I 4 .   ? 17.012  25.773 18.833  1.00 27.26 ? 2368 HOH A O   1 
HETATM 4772 O  O   . HOH I 4 .   ? -1.196  4.798  4.508   1.00 14.00 ? 2369 HOH A O   1 
HETATM 4773 O  O   . HOH I 4 .   ? 18.413  29.669 13.349  1.00 23.61 ? 2370 HOH A O   1 
HETATM 4774 O  O   . HOH I 4 .   ? -9.582  21.236 7.059   1.00 10.12 ? 2371 HOH A O   1 
HETATM 4775 O  O   . HOH I 4 .   ? 20.567  10.016 12.742  1.00 19.45 ? 2372 HOH A O   1 
HETATM 4776 O  O   . HOH I 4 .   ? 31.675  36.063 -18.553 1.00 18.70 ? 2373 HOH A O   1 
HETATM 4777 O  O   . HOH I 4 .   ? -1.078  22.951 -15.723 1.00 27.83 ? 2374 HOH A O   1 
HETATM 4778 O  O   . HOH I 4 .   ? -8.284  19.541 8.667   1.00 14.34 ? 2375 HOH A O   1 
HETATM 4779 O  O   . HOH I 4 .   ? -12.159 32.644 0.307   1.00 33.46 ? 2376 HOH A O   1 
HETATM 4780 O  O   . HOH I 4 .   ? -6.849  13.558 -4.621  1.00 24.55 ? 2377 HOH A O   1 
HETATM 4781 O  O   . HOH I 4 .   ? 13.424  16.675 -11.175 1.00 12.20 ? 2378 HOH A O   1 
HETATM 4782 O  O   . HOH I 4 .   ? 32.252  31.350 -19.679 1.00 33.91 ? 2379 HOH A O   1 
HETATM 4783 O  O   . HOH I 4 .   ? -1.341  25.574 6.644   1.00 20.44 ? 2380 HOH A O   1 
HETATM 4784 O  O   . HOH I 4 .   ? -12.209 23.845 6.658   1.00 27.92 ? 2381 HOH A O   1 
HETATM 4785 O  O   . HOH I 4 .   ? 29.996  32.423 -20.524 1.00 41.34 ? 2382 HOH A O   1 
HETATM 4786 O  O   . HOH I 4 .   ? 17.431  -0.636 -0.794  1.00 20.86 ? 2383 HOH A O   1 
HETATM 4787 O  O   . HOH I 4 .   ? -8.641  24.204 -12.951 1.00 33.89 ? 2384 HOH A O   1 
HETATM 4788 O  O   . HOH I 4 .   ? 26.941  13.194 -5.041  1.00 20.03 ? 2385 HOH A O   1 
HETATM 4789 O  O   . HOH I 4 .   ? 0.470   32.958 7.691   1.00 20.40 ? 2386 HOH A O   1 
HETATM 4790 O  O   . HOH I 4 .   ? 29.948  27.752 0.922   1.00 23.37 ? 2387 HOH A O   1 
HETATM 4791 O  O   . HOH I 4 .   ? 22.195  31.248 16.620  1.00 22.49 ? 2388 HOH A O   1 
HETATM 4792 O  O   . HOH I 4 .   ? -3.940  12.553 -11.996 1.00 17.66 ? 2389 HOH A O   1 
HETATM 4793 O  O   . HOH I 4 .   ? -3.822  12.205 -14.745 1.00 25.57 ? 2390 HOH A O   1 
HETATM 4794 O  O   . HOH I 4 .   ? 14.622  22.011 19.203  1.00 18.43 ? 2391 HOH A O   1 
HETATM 4795 O  O   . HOH I 4 .   ? 7.524   39.867 -5.455  1.00 24.98 ? 2392 HOH A O   1 
HETATM 4796 O  O   . HOH I 4 .   ? -6.836  16.763 -3.803  1.00 26.19 ? 2393 HOH A O   1 
HETATM 4797 O  O   . HOH I 4 .   ? 0.702   4.331  12.596  1.00 13.84 ? 2394 HOH A O   1 
HETATM 4798 O  O   . HOH I 4 .   ? 23.298  24.316 15.963  1.00 19.84 ? 2395 HOH A O   1 
HETATM 4799 O  O   . HOH I 4 .   ? -1.165  26.452 16.466  1.00 20.55 ? 2396 HOH A O   1 
HETATM 4800 O  O   . HOH I 4 .   ? 25.149  22.233 -9.915  1.00 17.21 ? 2397 HOH A O   1 
HETATM 4801 O  O   . HOH I 4 .   ? 5.829   9.855  20.051  1.00 21.03 ? 2398 HOH A O   1 
HETATM 4802 O  O   . HOH I 4 .   ? -1.682  17.525 13.308  1.00 13.54 ? 2399 HOH A O   1 
HETATM 4803 O  O   . HOH I 4 .   ? 23.566  19.460 -18.147 1.00 24.41 ? 2400 HOH A O   1 
HETATM 4804 O  O   . HOH I 4 .   ? 24.547  20.439 -11.740 1.00 15.37 ? 2401 HOH A O   1 
HETATM 4805 O  O   . HOH I 4 .   ? 25.244  34.619 -4.398  1.00 22.51 ? 2402 HOH A O   1 
HETATM 4806 O  O   . HOH I 4 .   ? -2.399  3.386  -1.925  1.00 21.74 ? 2403 HOH A O   1 
HETATM 4807 O  O   . HOH I 4 .   ? 10.563  19.211 20.846  1.00 16.99 ? 2404 HOH A O   1 
HETATM 4808 O  O   . HOH I 4 .   ? 17.332  2.679  -3.515  1.00 21.21 ? 2405 HOH A O   1 
HETATM 4809 O  O   . HOH I 4 .   ? 17.279  29.230 16.898  1.00 16.02 ? 2406 HOH A O   1 
HETATM 4810 O  O   . HOH I 4 .   ? 30.261  34.271 -2.793  1.00 23.87 ? 2407 HOH A O   1 
HETATM 4811 O  O   . HOH I 4 .   ? 30.337  25.487 -13.574 1.00 18.14 ? 2408 HOH A O   1 
HETATM 4812 O  O   . HOH I 4 .   ? -15.673 24.842 9.274   1.00 22.55 ? 2409 HOH A O   1 
HETATM 4813 O  O   . HOH I 4 .   ? 4.747   2.861  -3.398  1.00 19.06 ? 2410 HOH A O   1 
HETATM 4814 O  O   . HOH I 4 .   ? -9.269  25.295 5.521   1.00 27.67 ? 2411 HOH A O   1 
HETATM 4815 O  O   . HOH I 4 .   ? 28.062  35.473 -2.202  1.00 24.25 ? 2412 HOH A O   1 
HETATM 4816 O  O   . HOH I 4 .   ? 34.104  13.032 -4.404  1.00 27.92 ? 2413 HOH A O   1 
HETATM 4817 O  O   . HOH I 4 .   ? -0.298  16.680 15.870  1.00 23.14 ? 2414 HOH A O   1 
HETATM 4818 O  O   . HOH I 4 .   ? -9.562  23.809 -3.428  1.00 45.00 ? 2415 HOH A O   1 
HETATM 4819 O  O   . HOH I 4 .   ? 18.183  15.159 19.215  1.00 19.42 ? 2416 HOH A O   1 
HETATM 4820 O  O   . HOH I 4 .   ? -0.808  1.401  -2.706  1.00 25.62 ? 2417 HOH A O   1 
HETATM 4821 O  O   . HOH I 4 .   ? 5.591   35.766 9.641   1.00 24.86 ? 2418 HOH A O   1 
HETATM 4822 O  O   . HOH I 4 .   ? 21.989  9.015  -3.549  1.00 18.84 ? 2419 HOH A O   1 
HETATM 4823 O  O   . HOH I 4 .   ? 15.226  0.190  -2.147  1.00 33.45 ? 2420 HOH A O   1 
HETATM 4824 O  O   . HOH I 4 .   ? 20.797  9.539  -6.210  1.00 25.03 ? 2421 HOH A O   1 
HETATM 4825 O  O   . HOH J 4 .   ? 78.269  18.609 28.668  1.00 15.52 ? 1317 HOH B O   1 
HETATM 4826 O  O   . HOH J 4 .   ? 65.408  20.202 23.597  1.00 6.16  ? 1318 HOH B O   1 
HETATM 4827 O  O   . HOH J 4 .   ? 63.283  18.480 26.302  1.00 15.16 ? 1319 HOH B O   1 
HETATM 4828 O  O   . HOH J 4 .   ? 61.071  38.285 39.962  1.00 9.75  ? 1320 HOH B O   1 
HETATM 4829 O  O   . HOH J 4 .   ? 45.879  20.773 39.442  1.00 9.51  ? 1321 HOH B O   1 
HETATM 4830 O  O   . HOH J 4 .   ? 54.615  40.057 41.546  1.00 7.69  ? 1322 HOH B O   1 
HETATM 4831 O  O   . HOH J 4 .   ? 70.735  39.686 23.818  1.00 12.54 ? 1323 HOH B O   1 
HETATM 4832 O  O   . HOH J 4 .   ? 82.082  21.119 41.824  1.00 38.52 ? 1324 HOH B O   1 
HETATM 4833 O  O   . HOH J 4 .   ? 66.894  11.440 25.740  1.00 13.19 ? 1325 HOH B O   1 
HETATM 4834 O  O   . HOH J 4 .   ? 51.369  14.525 32.678  1.00 17.78 ? 1326 HOH B O   1 
HETATM 4835 O  O   . HOH J 4 .   ? 66.549  10.546 32.770  1.00 11.38 ? 1327 HOH B O   1 
HETATM 4836 O  O   . HOH J 4 .   ? 53.145  13.637 26.674  1.00 10.05 ? 1328 HOH B O   1 
HETATM 4837 O  O   . HOH J 4 .   ? 63.007  11.647 34.231  1.00 15.82 ? 1329 HOH B O   1 
HETATM 4838 O  O   . HOH J 4 .   ? 78.248  10.239 41.410  1.00 9.74  ? 1330 HOH B O   1 
HETATM 4839 O  O   . HOH J 4 .   ? 65.335  16.925 26.068  1.00 17.83 ? 1331 HOH B O   1 
HETATM 4840 O  O   . HOH J 4 .   ? 60.147  38.733 42.449  1.00 16.46 ? 1332 HOH B O   1 
HETATM 4841 O  O   . HOH J 4 .   ? 73.087  11.549 22.710  1.00 9.31  ? 1333 HOH B O   1 
HETATM 4842 O  O   . HOH J 4 .   ? 61.204  12.709 22.481  1.00 20.58 ? 1334 HOH B O   1 
HETATM 4843 O  O   . HOH J 4 .   ? 75.203  46.063 32.379  1.00 18.42 ? 1335 HOH B O   1 
HETATM 4844 O  O   . HOH J 4 .   ? 61.449  6.490  50.501  1.00 6.49  ? 1336 HOH B O   1 
HETATM 4845 O  O   . HOH J 4 .   ? 57.211  21.892 26.760  1.00 15.32 ? 1337 HOH B O   1 
HETATM 4846 O  O   . HOH J 4 .   ? 60.524  13.517 48.367  1.00 9.19  ? 1338 HOH B O   1 
HETATM 4847 O  O   . HOH J 4 .   ? 88.774  7.988  20.542  1.00 19.84 ? 1339 HOH B O   1 
HETATM 4848 O  O   . HOH J 4 .   ? 67.664  0.530  32.837  1.00 24.12 ? 1340 HOH B O   1 
HETATM 4849 O  O   . HOH J 4 .   ? 66.623  15.792 47.603  1.00 22.23 ? 1341 HOH B O   1 
HETATM 4850 O  O   . HOH J 4 .   ? 81.054  6.407  41.121  1.00 15.52 ? 1342 HOH B O   1 
HETATM 4851 O  O   . HOH J 4 .   ? 51.315  11.833 32.786  1.00 13.66 ? 1343 HOH B O   1 
HETATM 4852 O  O   . HOH J 4 .   ? 73.403  26.543 63.872  1.00 21.83 ? 1344 HOH B O   1 
HETATM 4853 O  O   . HOH J 4 .   ? 48.458  20.359 30.849  1.00 14.56 ? 1345 HOH B O   1 
HETATM 4854 O  O   . HOH J 4 .   ? 56.969  9.312  35.884  1.00 14.69 ? 1346 HOH B O   1 
HETATM 4855 O  O   . HOH J 4 .   ? 69.922  39.477 40.778  1.00 19.62 ? 1347 HOH B O   1 
HETATM 4856 O  O   . HOH J 4 .   ? 57.143  19.438 28.634  1.00 16.56 ? 1348 HOH B O   1 
HETATM 4857 O  O   . HOH J 4 .   ? 69.630  8.575  29.835  1.00 17.21 ? 1349 HOH B O   1 
HETATM 4858 O  O   . HOH J 4 .   ? 65.893  16.588 23.491  1.00 18.84 ? 1350 HOH B O   1 
HETATM 4859 O  O   . HOH J 4 .   ? 74.794  2.391  37.994  1.00 15.24 ? 1351 HOH B O   1 
HETATM 4860 O  O   . HOH J 4 .   ? 61.711  9.469  31.523  1.00 17.09 ? 1352 HOH B O   1 
HETATM 4861 O  O   . HOH J 4 .   ? 49.770  25.895 41.567  1.00 12.78 ? 1353 HOH B O   1 
HETATM 4862 O  O   . HOH J 4 .   ? 64.853  2.592  32.124  1.00 20.93 ? 1354 HOH B O   1 
HETATM 4863 O  O   . HOH J 4 .   ? 49.933  30.659 32.793  1.00 17.35 ? 1355 HOH B O   1 
HETATM 4864 O  O   . HOH J 4 .   ? 60.342  54.962 38.114  1.00 15.17 ? 1356 HOH B O   1 
HETATM 4865 O  O   . HOH J 4 .   ? 45.418  22.169 37.517  1.00 12.86 ? 1357 HOH B O   1 
HETATM 4866 O  O   . HOH J 4 .   ? 74.706  11.571 24.964  1.00 12.88 ? 1358 HOH B O   1 
HETATM 4867 O  O   . HOH J 4 .   ? 64.929  44.324 40.681  1.00 24.79 ? 1359 HOH B O   1 
HETATM 4868 O  O   . HOH J 4 .   ? 57.366  39.134 43.039  1.00 15.10 ? 1360 HOH B O   1 
HETATM 4869 O  O   . HOH J 4 .   ? 57.942  37.989 36.603  1.00 6.45  ? 1361 HOH B O   1 
HETATM 4870 O  O   . HOH J 4 .   ? 64.500  12.131 24.739  1.00 20.01 ? 1362 HOH B O   1 
HETATM 4871 O  O   . HOH J 4 .   ? 60.081  3.677  50.246  1.00 32.08 ? 1363 HOH B O   1 
HETATM 4872 O  O   . HOH J 4 .   ? 53.142  11.560 44.166  1.00 7.79  ? 1364 HOH B O   1 
HETATM 4873 O  O   . HOH J 4 .   ? 62.941  57.237 42.473  1.00 19.49 ? 1365 HOH B O   1 
HETATM 4874 O  O   . HOH J 4 .   ? 56.838  39.246 40.922  1.00 34.97 ? 1366 HOH B O   1 
HETATM 4875 O  O   . HOH J 4 .   ? 66.454  5.853  30.009  1.00 24.58 ? 1367 HOH B O   1 
HETATM 4876 O  O   . HOH J 4 .   ? 80.675  34.308 43.421  1.00 19.34 ? 1368 HOH B O   1 
HETATM 4877 O  O   . HOH J 4 .   ? 68.359  26.474 26.210  1.00 12.19 ? 1369 HOH B O   1 
HETATM 4878 O  O   . HOH J 4 .   ? 47.233  24.167 36.209  1.00 14.42 ? 1370 HOH B O   1 
HETATM 4879 O  O   . HOH J 4 .   ? 59.360  55.805 40.365  1.00 11.78 ? 1371 HOH B O   1 
HETATM 4880 O  O   . HOH J 4 .   ? 55.393  30.449 48.448  1.00 17.48 ? 1372 HOH B O   1 
HETATM 4881 O  O   . HOH J 4 .   ? 57.834  30.672 48.277  1.00 12.99 ? 1373 HOH B O   1 
HETATM 4882 O  O   . HOH J 4 .   ? 69.182  42.254 35.789  1.00 7.22  ? 1374 HOH B O   1 
HETATM 4883 O  O   . HOH J 4 .   ? 51.007  9.642  34.288  1.00 11.44 ? 1375 HOH B O   1 
HETATM 4884 O  O   . HOH J 4 .   ? 68.812  36.692 41.399  1.00 13.21 ? 1376 HOH B O   1 
HETATM 4885 O  O   . HOH J 4 .   ? 61.012  33.988 48.544  1.00 10.33 ? 1377 HOH B O   1 
HETATM 4886 O  O   . HOH J 4 .   ? 52.899  33.351 20.577  1.00 21.91 ? 1378 HOH B O   1 
HETATM 4887 O  O   . HOH J 4 .   ? 76.766  2.105  30.323  1.00 23.07 ? 1379 HOH B O   1 
HETATM 4888 O  O   . HOH J 4 .   ? 56.074  20.302 20.798  1.00 11.29 ? 1380 HOH B O   1 
HETATM 4889 O  O   . HOH J 4 .   ? 75.651  43.216 40.949  1.00 22.53 ? 1381 HOH B O   1 
HETATM 4890 O  O   . HOH J 4 .   ? 44.849  21.904 45.244  1.00 8.15  ? 1382 HOH B O   1 
HETATM 4891 O  O   . HOH J 4 .   ? 82.034  0.560  25.556  1.00 25.03 ? 1383 HOH B O   1 
HETATM 4892 O  O   . HOH J 4 .   ? 65.283  10.798 17.597  1.00 20.42 ? 1384 HOH B O   1 
HETATM 4893 O  O   . HOH J 4 .   ? 82.501  8.736  35.233  1.00 27.52 ? 1385 HOH B O   1 
HETATM 4894 O  O   . HOH J 4 .   ? 70.530  25.148 54.766  1.00 20.21 ? 1386 HOH B O   1 
HETATM 4895 O  O   . HOH J 4 .   ? 87.979  27.026 36.705  1.00 20.65 ? 1387 HOH B O   1 
HETATM 4896 O  O   . HOH J 4 .   ? 45.302  26.154 35.024  0.50 12.18 ? 1388 HOH B O   1 
HETATM 4897 O  O   . HOH J 4 .   ? 57.398  16.436 48.456  1.00 13.70 ? 1389 HOH B O   1 
HETATM 4898 O  O   . HOH J 4 .   ? 76.144  21.817 48.727  1.00 21.11 ? 1390 HOH B O   1 
HETATM 4899 O  O   . HOH J 4 .   ? 76.831  19.392 48.915  1.00 33.43 ? 1391 HOH B O   1 
HETATM 4900 O  O   . HOH J 4 .   ? 54.856  34.382 21.958  1.00 24.08 ? 1392 HOH B O   1 
HETATM 4901 O  O   . HOH J 4 .   ? 60.320  41.236 43.396  1.00 21.54 ? 1393 HOH B O   1 
HETATM 4902 O  O   . HOH J 4 .   ? 59.769  9.757  48.315  1.00 11.67 ? 1394 HOH B O   1 
HETATM 4903 O  O   . HOH J 4 .   ? 79.209  7.633  21.080  1.00 10.32 ? 1395 HOH B O   1 
HETATM 4904 O  O   . HOH J 4 .   ? 48.113  25.507 38.170  1.00 13.99 ? 1396 HOH B O   1 
HETATM 4905 O  O   . HOH J 4 .   ? 61.938  15.959 19.581  1.00 30.26 ? 1397 HOH B O   1 
HETATM 4906 O  O   . HOH J 4 .   ? 89.013  12.389 17.350  1.00 16.03 ? 1398 HOH B O   1 
HETATM 4907 O  O   . HOH J 4 .   ? 74.439  47.704 35.596  1.00 15.63 ? 1399 HOH B O   1 
HETATM 4908 O  O   . HOH J 4 .   ? 61.521  10.560 28.720  1.00 21.86 ? 1400 HOH B O   1 
HETATM 4909 O  O   . HOH J 4 .   ? 43.441  21.973 47.742  1.00 22.61 ? 1401 HOH B O   1 
HETATM 4910 O  O   . HOH J 4 .   ? 64.105  8.971  26.426  1.00 16.30 ? 1402 HOH B O   1 
HETATM 4911 O  O   . HOH J 4 .   ? 79.855  29.636 49.328  1.00 23.51 ? 1403 HOH B O   1 
HETATM 4912 O  O   . HOH J 4 .   ? 64.812  56.222 43.947  1.00 21.74 ? 1404 HOH B O   1 
HETATM 4913 O  O   . HOH J 4 .   ? 66.279  18.740 21.079  1.00 17.99 ? 1405 HOH B O   1 
HETATM 4914 O  O   . HOH J 4 .   ? 60.727  58.159 43.217  1.00 27.77 ? 1406 HOH B O   1 
HETATM 4915 O  O   . HOH J 4 .   ? 81.074  11.243 46.848  1.00 23.07 ? 1407 HOH B O   1 
HETATM 4916 O  O   . HOH J 4 .   ? 75.315  28.464 35.823  1.00 11.60 ? 1408 HOH B O   1 
HETATM 4917 O  O   . HOH J 4 .   ? 59.030  59.747 41.662  1.00 15.26 ? 1409 HOH B O   1 
HETATM 4918 O  O   . HOH J 4 .   ? 81.745  34.557 22.284  1.00 20.67 ? 1410 HOH B O   1 
HETATM 4919 O  O   . HOH J 4 .   ? 48.389  27.962 41.750  1.00 19.29 ? 1411 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   LYS 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  CYS 45  45  45  CYS CYS A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  ASP 57  57  57  ASP ASP A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ASN 69  69  69  ASN ASN A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 HIS 101 101 101 HIS HIS A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 HIS 111 111 111 HIS HIS A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 HIS 115 115 115 HIS HIS A . n 
A 1 116 PRO 116 116 116 PRO PRO A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 TRP 122 122 122 TRP TRP A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 ASP 124 124 124 ASP ASP A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 PRO 132 132 132 PRO PRO A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 HIS 141 141 141 HIS HIS A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 PHE 162 162 162 PHE PHE A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 TRP 164 164 164 TRP TRP A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 THR 166 166 166 THR THR A . n 
A 1 167 PRO 167 167 167 PRO PRO A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 HIS 187 187 187 HIS HIS A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 THR 192 192 192 THR THR A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 GLY 194 194 194 GLY GLY A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 TYR 197 197 197 TYR TYR A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 MET 200 200 200 MET MET A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 ILE 208 208 208 ILE ILE A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 MET 212 212 212 MET MET A . n 
A 1 213 GLU 213 213 213 GLU GLU A . n 
A 1 214 GLU 214 214 214 GLU GLU A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 SER 217 217 217 SER SER A . n 
A 1 218 TYR 218 218 218 TYR TYR A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 LYS 224 224 224 LYS LYS A . n 
A 1 225 ARG 225 225 225 ARG ARG A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 HIS 228 228 228 HIS HIS A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 PRO 238 238 238 PRO PRO A . n 
A 1 239 SER 239 239 239 SER SER A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 THR 241 241 241 THR THR A . n 
A 1 242 PRO 242 242 242 PRO PRO A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 THR 246 246 246 THR THR A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 GLY 250 250 250 GLY GLY A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 TYR 254 254 254 TYR TYR A . n 
A 1 255 ARG 255 255 255 ARG ARG A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 GLY 257 257 257 GLY GLY A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 TYR 259 259 259 TYR TYR A . n 
A 1 260 ILE 260 260 260 ILE ILE A . n 
A 1 261 THR 261 261 261 THR THR A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 GLU 263 263 263 GLU GLU A . n 
A 1 264 ILE 264 264 264 ILE ILE A . n 
A 1 265 TYR 265 265 265 TYR TYR A . n 
A 1 266 LYS 266 266 266 LYS LYS A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 SER 271 271 271 SER SER A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ASP 274 274 274 ASP ASP A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 MET 276 276 276 MET MET A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 VAL 278 278 278 VAL VAL A . n 
A 1 279 ASN 279 279 279 ASN ASN A . n 
A 1 280 PRO 280 280 280 PRO PRO A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 LYS 284 284 284 LYS LYS A . n 
A 1 285 THR 285 285 285 THR THR A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 VAL 289 289 289 VAL VAL A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 THR 292 292 292 THR THR A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 THR 295 295 295 THR THR A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 VAL 297 297 297 VAL VAL A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 ILE 299 299 299 ILE ILE A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 ALA 302 302 302 ALA ALA A . n 
A 1 303 CYS 303 303 303 CYS CYS A . n 
A 1 304 PHE 304 304 304 PHE PHE A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 ALA 307 307 307 ALA ALA A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 GLU 309 309 309 GLU GLU A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 ASN 311 311 311 ASN ASN A . n 
A 1 312 HIS 312 312 312 HIS HIS A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 PRO 314 314 ?   ?   ?   A . n 
A 1 315 ILE 315 315 ?   ?   ?   A . n 
A 1 316 ASP 316 316 ?   ?   ?   A . n 
A 1 317 TYR 317 317 ?   ?   ?   A . n 
A 1 318 LEU 318 318 ?   ?   ?   A . n 
A 1 319 ASN 319 319 ?   ?   ?   A . n 
A 1 320 PRO 320 320 ?   ?   ?   A . n 
A 1 321 PRO 321 321 ?   ?   ?   A . n 
A 1 322 LYS 322 322 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   ALA 3   3   ?   ?   ?   B . n 
B 1 4   LYS 4   4   ?   ?   ?   B . n 
B 1 5   SER 5   5   5   SER SER B . n 
B 1 6   ARG 6   6   6   ARG ARG B . n 
B 1 7   THR 7   7   7   THR THR B . n 
B 1 8   ILE 8   8   8   ILE ILE B . n 
B 1 9   GLY 9   9   9   GLY GLY B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  ILE 11  11  11  ILE ILE B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  PRO 14  14  14  PRO PRO B . n 
B 1 15  PHE 15  15  15  PHE PHE B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  LYS 17  17  17  LYS LYS B . n 
B 1 18  GLY 18  18  18  GLY GLY B . n 
B 1 19  GLN 19  19  19  GLN GLN B . n 
B 1 20  PRO 20  20  20  PRO PRO B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  GLY 22  22  22  GLY GLY B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  THR 29  29  29  THR THR B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  ARG 32  32  32  ARG ARG B . n 
B 1 33  LYS 33  33  33  LYS LYS B . n 
B 1 34  ALA 34  34  34  ALA ALA B . n 
B 1 35  GLY 35  35  35  GLY GLY B . n 
B 1 36  LEU 36  36  36  LEU LEU B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  GLU 38  38  38  GLU GLU B . n 
B 1 39  LYS 39  39  39  LYS LYS B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  GLN 43  43  43  GLN GLN B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  CYS 45  45  45  CYS CYS B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  LYS 48  48  48  LYS LYS B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  TYR 50  50  50  TYR TYR B . n 
B 1 51  GLY 51  51  51  GLY GLY B . n 
B 1 52  ASP 52  52  52  ASP ASP B . n 
B 1 53  LEU 53  53  53  LEU LEU B . n 
B 1 54  PRO 54  54  54  PRO PRO B . n 
B 1 55  PHE 55  55  55  PHE PHE B . n 
B 1 56  ALA 56  56  56  ALA ALA B . n 
B 1 57  ASP 57  57  57  ASP ASP B . n 
B 1 58  ILE 58  58  58  ILE ILE B . n 
B 1 59  PRO 59  59  59  PRO PRO B . n 
B 1 60  ASN 60  60  60  ASN ASN B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  GLN 65  65  65  GLN GLN B . n 
B 1 66  ILE 66  66  66  ILE ILE B . n 
B 1 67  VAL 67  67  67  VAL VAL B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  ASN 69  69  69  ASN ASN B . n 
B 1 70  PRO 70  70  70  PRO PRO B . n 
B 1 71  ARG 71  71  71  ARG ARG B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  GLY 74  74  74  GLY GLY B . n 
B 1 75  LYS 75  75  75  LYS LYS B . n 
B 1 76  ALA 76  76  76  ALA ALA B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  GLU 78  78  78  GLU GLU B . n 
B 1 79  GLN 79  79  79  GLN GLN B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  LYS 83  83  83  LYS LYS B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  VAL 87  87  87  VAL VAL B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  ASN 90  90  90  ASN ASN B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  ILE 93  93  93  ILE ILE B . n 
B 1 94  SER 94  94  94  SER SER B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  GLY 98  98  98  GLY GLY B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 HIS 101 101 101 HIS HIS B . n 
B 1 102 SER 102 102 102 SER SER B . n 
B 1 103 LEU 103 103 103 LEU LEU B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 ILE 105 105 105 ILE ILE B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 SER 107 107 107 SER SER B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 GLY 110 110 110 GLY GLY B . n 
B 1 111 HIS 111 111 111 HIS HIS B . n 
B 1 112 ALA 112 112 112 ALA ALA B . n 
B 1 113 ARG 113 113 113 ARG ARG B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 HIS 115 115 115 HIS HIS B . n 
B 1 116 PRO 116 116 116 PRO PRO B . n 
B 1 117 ASP 117 117 117 ASP ASP B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 GLY 119 119 119 GLY GLY B . n 
B 1 120 VAL 120 120 120 VAL VAL B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 TRP 122 122 122 TRP TRP B . n 
B 1 123 VAL 123 123 123 VAL VAL B . n 
B 1 124 ASP 124 124 124 ASP ASP B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 HIS 126 126 126 HIS HIS B . n 
B 1 127 THR 127 127 127 THR THR B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 ILE 129 129 129 ILE ILE B . n 
B 1 130 ASN 130 130 130 ASN ASN B . n 
B 1 131 THR 131 131 131 THR THR B . n 
B 1 132 PRO 132 132 132 PRO PRO B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 THR 134 134 134 THR THR B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 THR 136 136 136 THR THR B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 ASN 139 139 139 ASN ASN B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 HIS 141 141 141 HIS HIS B . n 
B 1 142 GLY 142 142 142 GLY GLY B . n 
B 1 143 GLN 143 143 143 GLN GLN B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 SER 146 146 146 SER SER B . n 
B 1 147 PHE 147 147 147 PHE PHE B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 LYS 150 150 150 LYS LYS B . n 
B 1 151 GLU 151 151 151 GLU GLU B . n 
B 1 152 LEU 152 152 152 LEU LEU B . n 
B 1 153 LYS 153 153 153 LYS LYS B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 LYS 155 155 155 LYS LYS B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 PRO 157 157 157 PRO PRO B . n 
B 1 158 ASP 158 158 158 ASP ASP B . n 
B 1 159 VAL 159 159 159 VAL VAL B . n 
B 1 160 PRO 160 160 160 PRO PRO B . n 
B 1 161 GLY 161 161 161 GLY GLY B . n 
B 1 162 PHE 162 162 162 PHE PHE B . n 
B 1 163 SER 163 163 163 SER SER B . n 
B 1 164 TRP 164 164 164 TRP TRP B . n 
B 1 165 VAL 165 165 165 VAL VAL B . n 
B 1 166 THR 166 166 166 THR THR B . n 
B 1 167 PRO 167 167 167 PRO PRO B . n 
B 1 168 CYS 168 168 168 CYS CYS B . n 
B 1 169 ILE 169 169 169 ILE ILE B . n 
B 1 170 SER 170 170 170 SER SER B . n 
B 1 171 ALA 171 171 171 ALA ALA B . n 
B 1 172 LYS 172 172 172 LYS LYS B . n 
B 1 173 ASP 173 173 173 ASP ASP B . n 
B 1 174 ILE 174 174 174 ILE ILE B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 TYR 176 176 176 TYR TYR B . n 
B 1 177 ILE 177 177 177 ILE ILE B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 LEU 179 179 179 LEU LEU B . n 
B 1 180 ARG 180 180 180 ARG ARG B . n 
B 1 181 ASP 181 181 181 ASP ASP B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 PRO 184 184 184 PRO PRO B . n 
B 1 185 GLY 185 185 185 GLY GLY B . n 
B 1 186 GLU 186 186 186 GLU GLU B . n 
B 1 187 HIS 187 187 187 HIS HIS B . n 
B 1 188 TYR 188 188 188 TYR TYR B . n 
B 1 189 ILE 189 189 189 ILE ILE B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 LYS 191 191 191 LYS LYS B . n 
B 1 192 THR 192 192 192 THR THR B . n 
B 1 193 LEU 193 193 193 LEU LEU B . n 
B 1 194 GLY 194 194 194 GLY GLY B . n 
B 1 195 ILE 195 195 195 ILE ILE B . n 
B 1 196 LYS 196 196 196 LYS LYS B . n 
B 1 197 TYR 197 197 197 TYR TYR B . n 
B 1 198 PHE 198 198 198 PHE PHE B . n 
B 1 199 SER 199 199 199 SER SER B . n 
B 1 200 MET 200 200 200 MET MET B . n 
B 1 201 THR 201 201 201 THR THR B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 VAL 203 203 203 VAL VAL B . n 
B 1 204 ASP 204 204 204 ASP ASP B . n 
B 1 205 ARG 205 205 205 ARG ARG B . n 
B 1 206 LEU 206 206 206 LEU LEU B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 ILE 208 208 208 ILE ILE B . n 
B 1 209 GLY 209 209 209 GLY GLY B . n 
B 1 210 LYS 210 210 210 LYS LYS B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 MET 212 212 212 MET MET B . n 
B 1 213 GLU 213 213 213 GLU GLU B . n 
B 1 214 GLU 214 214 214 GLU GLU B . n 
B 1 215 THR 215 215 215 THR THR B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 SER 217 217 217 SER SER B . n 
B 1 218 TYR 218 218 218 TYR TYR B . n 
B 1 219 LEU 219 219 219 LEU LEU B . n 
B 1 220 LEU 220 220 220 LEU LEU B . n 
B 1 221 GLY 221 221 221 GLY GLY B . n 
B 1 222 ARG 222 222 222 ARG ARG B . n 
B 1 223 LYS 223 223 223 LYS LYS B . n 
B 1 224 LYS 224 224 224 LYS LYS B . n 
B 1 225 ARG 225 225 225 ARG ARG B . n 
B 1 226 PRO 226 226 226 PRO PRO B . n 
B 1 227 ILE 227 227 227 ILE ILE B . n 
B 1 228 HIS 228 228 228 HIS HIS B . n 
B 1 229 LEU 229 229 229 LEU LEU B . n 
B 1 230 SER 230 230 230 SER SER B . n 
B 1 231 PHE 231 231 231 PHE PHE B . n 
B 1 232 ASP 232 232 232 ASP ASP B . n 
B 1 233 VAL 233 233 233 VAL VAL B . n 
B 1 234 ASP 234 234 234 ASP ASP B . n 
B 1 235 GLY 235 235 235 GLY GLY B . n 
B 1 236 LEU 236 236 236 LEU LEU B . n 
B 1 237 ASP 237 237 237 ASP ASP B . n 
B 1 238 PRO 238 238 238 PRO PRO B . n 
B 1 239 SER 239 239 239 SER SER B . n 
B 1 240 PHE 240 240 240 PHE PHE B . n 
B 1 241 THR 241 241 241 THR THR B . n 
B 1 242 PRO 242 242 242 PRO PRO B . n 
B 1 243 ALA 243 243 243 ALA ALA B . n 
B 1 244 THR 244 244 244 THR THR B . n 
B 1 245 GLY 245 245 245 GLY GLY B . n 
B 1 246 THR 246 246 246 THR THR B . n 
B 1 247 PRO 247 247 247 PRO PRO B . n 
B 1 248 VAL 248 248 248 VAL VAL B . n 
B 1 249 VAL 249 249 249 VAL VAL B . n 
B 1 250 GLY 250 250 250 GLY GLY B . n 
B 1 251 GLY 251 251 251 GLY GLY B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 THR 253 253 253 THR THR B . n 
B 1 254 TYR 254 254 254 TYR TYR B . n 
B 1 255 ARG 255 255 255 ARG ARG B . n 
B 1 256 GLU 256 256 256 GLU GLU B . n 
B 1 257 GLY 257 257 257 GLY GLY B . n 
B 1 258 LEU 258 258 258 LEU LEU B . n 
B 1 259 TYR 259 259 259 TYR TYR B . n 
B 1 260 ILE 260 260 260 ILE ILE B . n 
B 1 261 THR 261 261 261 THR THR B . n 
B 1 262 GLU 262 262 262 GLU GLU B . n 
B 1 263 GLU 263 263 263 GLU GLU B . n 
B 1 264 ILE 264 264 264 ILE ILE B . n 
B 1 265 TYR 265 265 265 TYR TYR B . n 
B 1 266 LYS 266 266 266 LYS LYS B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 LEU 270 270 270 LEU LEU B . n 
B 1 271 SER 271 271 271 SER SER B . n 
B 1 272 GLY 272 272 272 GLY GLY B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ASP 274 274 274 ASP ASP B . n 
B 1 275 ILE 275 275 275 ILE ILE B . n 
B 1 276 MET 276 276 276 MET MET B . n 
B 1 277 GLU 277 277 277 GLU GLU B . n 
B 1 278 VAL 278 278 278 VAL VAL B . n 
B 1 279 ASN 279 279 279 ASN ASN B . n 
B 1 280 PRO 280 280 280 PRO PRO B . n 
B 1 281 SER 281 281 281 SER SER B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 GLY 283 283 283 GLY GLY B . n 
B 1 284 LYS 284 284 284 LYS LYS B . n 
B 1 285 THR 285 285 285 THR THR B . n 
B 1 286 PRO 286 286 286 PRO PRO B . n 
B 1 287 GLU 287 287 287 GLU GLU B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 VAL 289 289 289 VAL VAL B . n 
B 1 290 THR 290 290 290 THR THR B . n 
B 1 291 ARG 291 291 291 ARG ARG B . n 
B 1 292 THR 292 292 292 THR THR B . n 
B 1 293 VAL 293 293 293 VAL VAL B . n 
B 1 294 ASN 294 294 294 ASN ASN B . n 
B 1 295 THR 295 295 295 THR THR B . n 
B 1 296 ALA 296 296 296 ALA ALA B . n 
B 1 297 VAL 297 297 297 VAL VAL B . n 
B 1 298 ALA 298 298 298 ALA ALA B . n 
B 1 299 ILE 299 299 299 ILE ILE B . n 
B 1 300 THR 300 300 300 THR THR B . n 
B 1 301 LEU 301 301 301 LEU LEU B . n 
B 1 302 ALA 302 302 302 ALA ALA B . n 
B 1 303 CYS 303 303 303 CYS CYS B . n 
B 1 304 PHE 304 304 304 PHE PHE B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 LEU 306 306 306 LEU LEU B . n 
B 1 307 ALA 307 307 307 ALA ALA B . n 
B 1 308 ARG 308 308 308 ARG ARG B . n 
B 1 309 GLU 309 309 309 GLU GLU B . n 
B 1 310 GLY 310 310 310 GLY GLY B . n 
B 1 311 ASN 311 311 311 ASN ASN B . n 
B 1 312 HIS 312 312 312 HIS HIS B . n 
B 1 313 LYS 313 313 313 LYS LYS B . n 
B 1 314 PRO 314 314 ?   ?   ?   B . n 
B 1 315 ILE 315 315 ?   ?   ?   B . n 
B 1 316 ASP 316 316 ?   ?   ?   B . n 
B 1 317 TYR 317 317 ?   ?   ?   B . n 
B 1 318 LEU 318 318 ?   ?   ?   B . n 
B 1 319 ASN 319 319 ?   ?   ?   B . n 
B 1 320 PRO 320 320 ?   ?   ?   B . n 
B 1 321 PRO 321 321 ?   ?   ?   B . n 
B 1 322 LYS 322 322 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2,3 A,C,D,E,I 
2 1,4,5 B,F,G,H,J 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -y,x-y,z      -0.5000000000 -0.8660254038 0.0000000000 0.0000000000  0.8660254038  
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -x+y,-x,z     -0.5000000000 0.8660254038  0.0000000000 0.0000000000  -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 2_655 -y+1,x-y,z    -0.5000000000 -0.8660254038 0.0000000000 90.6020000000 0.8660254038  
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
5 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038  0.0000000000 45.3010000000 -0.8660254038 
-0.5000000000 0.0000000000 78.4636336337 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     1388 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   J 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? A HIS 101 ? A HIS 101  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 OD2 ? A ASP 124 ? A ASP 124  ? 1_555 87.3  ? 
2  ND1 ? A HIS 101 ? A HIS 101  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 OD2 ? A ASP 128 ? A ASP 128  ? 1_555 91.9  ? 
3  OD2 ? A ASP 124 ? A ASP 124  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 OD2 ? A ASP 128 ? A ASP 128  ? 1_555 81.3  ? 
4  ND1 ? A HIS 101 ? A HIS 101  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 OD2 ? A ASP 232 ? A ASP 232  ? 1_555 103.0 ? 
5  OD2 ? A ASP 124 ? A ASP 124  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 OD2 ? A ASP 232 ? A ASP 232  ? 1_555 85.2  ? 
6  OD2 ? A ASP 128 ? A ASP 128  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 OD2 ? A ASP 232 ? A ASP 232  ? 1_555 159.4 ? 
7  ND1 ? A HIS 101 ? A HIS 101  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 O1  ? E S2C .   ? A S2C 1317 ? 1_555 171.6 ? 
8  OD2 ? A ASP 124 ? A ASP 124  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 O1  ? E S2C .   ? A S2C 1317 ? 1_555 100.7 ? 
9  OD2 ? A ASP 128 ? A ASP 128  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 O1  ? E S2C .   ? A S2C 1317 ? 1_555 87.0  ? 
10 OD2 ? A ASP 232 ? A ASP 232  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 O1  ? E S2C .   ? A S2C 1317 ? 1_555 80.3  ? 
11 ND1 ? A HIS 101 ? A HIS 101  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 O2  ? E S2C .   ? A S2C 1317 ? 1_555 117.1 ? 
12 OD2 ? A ASP 124 ? A ASP 124  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 O2  ? E S2C .   ? A S2C 1317 ? 1_555 155.6 ? 
13 OD2 ? A ASP 128 ? A ASP 128  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 O2  ? E S2C .   ? A S2C 1317 ? 1_555 96.4  ? 
14 OD2 ? A ASP 232 ? A ASP 232  ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 O2  ? E S2C .   ? A S2C 1317 ? 1_555 89.6  ? 
15 O1  ? E S2C .   ? A S2C 1317 ? 1_555 MN ? C MN . ? A MN 2314 ? 1_555 O2  ? E S2C .   ? A S2C 1317 ? 1_555 54.9  ? 
16 ND1 ? A HIS 126 ? A HIS 126  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 OD1 ? A ASP 124 ? A ASP 124  ? 1_555 95.9  ? 
17 ND1 ? A HIS 126 ? A HIS 126  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 OD2 ? A ASP 232 ? A ASP 232  ? 1_555 164.1 ? 
18 OD1 ? A ASP 124 ? A ASP 124  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 OD2 ? A ASP 232 ? A ASP 232  ? 1_555 91.4  ? 
19 ND1 ? A HIS 126 ? A HIS 126  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 OD1 ? A ASP 234 ? A ASP 234  ? 1_555 105.1 ? 
20 OD1 ? A ASP 124 ? A ASP 124  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 OD1 ? A ASP 234 ? A ASP 234  ? 1_555 80.1  ? 
21 OD2 ? A ASP 232 ? A ASP 232  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 OD1 ? A ASP 234 ? A ASP 234  ? 1_555 90.0  ? 
22 ND1 ? A HIS 126 ? A HIS 126  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 OD2 ? A ASP 234 ? A ASP 234  ? 1_555 100.9 ? 
23 OD1 ? A ASP 124 ? A ASP 124  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 OD2 ? A ASP 234 ? A ASP 234  ? 1_555 138.0 ? 
24 OD2 ? A ASP 232 ? A ASP 232  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 OD2 ? A ASP 234 ? A ASP 234  ? 1_555 82.6  ? 
25 OD1 ? A ASP 234 ? A ASP 234  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 OD2 ? A ASP 234 ? A ASP 234  ? 1_555 58.5  ? 
26 ND1 ? A HIS 126 ? A HIS 126  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 O1  ? E S2C .   ? A S2C 1317 ? 1_555 86.0  ? 
27 OD1 ? A ASP 124 ? A ASP 124  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 O1  ? E S2C .   ? A S2C 1317 ? 1_555 95.7  ? 
28 OD2 ? A ASP 232 ? A ASP 232  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 O1  ? E S2C .   ? A S2C 1317 ? 1_555 79.3  ? 
29 OD1 ? A ASP 234 ? A ASP 234  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 O1  ? E S2C .   ? A S2C 1317 ? 1_555 168.5 ? 
30 OD2 ? A ASP 234 ? A ASP 234  ? 1_555 MN ? D MN . ? A MN 2315 ? 1_555 O1  ? E S2C .   ? A S2C 1317 ? 1_555 123.4 ? 
31 ND1 ? B HIS 101 ? B HIS 101  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 OD2 ? B ASP 124 ? B ASP 124  ? 1_555 95.8  ? 
32 ND1 ? B HIS 101 ? B HIS 101  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 OD2 ? B ASP 128 ? B ASP 128  ? 1_555 88.0  ? 
33 OD2 ? B ASP 124 ? B ASP 124  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 OD2 ? B ASP 128 ? B ASP 128  ? 1_555 90.1  ? 
34 ND1 ? B HIS 101 ? B HIS 101  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 OD2 ? B ASP 232 ? B ASP 232  ? 1_555 107.8 ? 
35 OD2 ? B ASP 124 ? B ASP 124  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 OD2 ? B ASP 232 ? B ASP 232  ? 1_555 79.3  ? 
36 OD2 ? B ASP 128 ? B ASP 128  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 OD2 ? B ASP 232 ? B ASP 232  ? 1_555 161.6 ? 
37 ND1 ? B HIS 101 ? B HIS 101  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 O1  ? H S2C .   ? B S2C 1316 ? 1_555 165.2 ? 
38 OD2 ? B ASP 124 ? B ASP 124  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 O1  ? H S2C .   ? B S2C 1316 ? 1_555 98.0  ? 
39 OD2 ? B ASP 128 ? B ASP 128  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 O1  ? H S2C .   ? B S2C 1316 ? 1_555 86.4  ? 
40 OD2 ? B ASP 232 ? B ASP 232  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 O1  ? H S2C .   ? B S2C 1316 ? 1_555 80.2  ? 
41 ND1 ? B HIS 101 ? B HIS 101  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 O2  ? H S2C .   ? B S2C 1316 ? 1_555 110.6 ? 
42 OD2 ? B ASP 124 ? B ASP 124  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 O2  ? H S2C .   ? B S2C 1316 ? 1_555 153.6 ? 
43 OD2 ? B ASP 128 ? B ASP 128  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 O2  ? H S2C .   ? B S2C 1316 ? 1_555 89.7  ? 
44 OD2 ? B ASP 232 ? B ASP 232  ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 O2  ? H S2C .   ? B S2C 1316 ? 1_555 93.1  ? 
45 O1  ? H S2C .   ? B S2C 1316 ? 1_555 MN ? F MN . ? B MN 1314 ? 1_555 O2  ? H S2C .   ? B S2C 1316 ? 1_555 55.7  ? 
46 ND1 ? B HIS 126 ? B HIS 126  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 OD1 ? B ASP 124 ? B ASP 124  ? 1_555 100.4 ? 
47 ND1 ? B HIS 126 ? B HIS 126  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 OD2 ? B ASP 232 ? B ASP 232  ? 1_555 168.9 ? 
48 OD1 ? B ASP 124 ? B ASP 124  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 OD2 ? B ASP 232 ? B ASP 232  ? 1_555 80.7  ? 
49 ND1 ? B HIS 126 ? B HIS 126  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 OD2 ? B ASP 234 ? B ASP 234  ? 1_555 109.8 ? 
50 OD1 ? B ASP 124 ? B ASP 124  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 OD2 ? B ASP 234 ? B ASP 234  ? 1_555 77.1  ? 
51 OD2 ? B ASP 232 ? B ASP 232  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 OD2 ? B ASP 234 ? B ASP 234  ? 1_555 81.2  ? 
52 ND1 ? B HIS 126 ? B HIS 126  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 OD1 ? B ASP 234 ? B ASP 234  ? 1_555 99.6  ? 
53 OD1 ? B ASP 124 ? B ASP 124  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 OD1 ? B ASP 234 ? B ASP 234  ? 1_555 132.1 ? 
54 OD2 ? B ASP 232 ? B ASP 232  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 OD1 ? B ASP 234 ? B ASP 234  ? 1_555 87.5  ? 
55 OD2 ? B ASP 234 ? B ASP 234  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 OD1 ? B ASP 234 ? B ASP 234  ? 1_555 55.2  ? 
56 ND1 ? B HIS 126 ? B HIS 126  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 O1  ? H S2C .   ? B S2C 1316 ? 1_555 89.0  ? 
57 OD1 ? B ASP 124 ? B ASP 124  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 O1  ? H S2C .   ? B S2C 1316 ? 1_555 92.4  ? 
58 OD2 ? B ASP 232 ? B ASP 232  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 O1  ? H S2C .   ? B S2C 1316 ? 1_555 79.9  ? 
59 OD2 ? B ASP 234 ? B ASP 234  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 O1  ? H S2C .   ? B S2C 1316 ? 1_555 159.6 ? 
60 OD1 ? B ASP 234 ? B ASP 234  ? 1_555 MN ? G MN . ? B MN 1315 ? 1_555 O1  ? H S2C .   ? B S2C 1316 ? 1_555 131.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-09-06 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .         ? 1 
SCALA    'data scaling'    .         ? 2 
AMoRE    phasing           .         ? 3 
CNS      refinement        .         ? 4 
HKL-2000 'data reduction'  .         ? 5 
CCP4     'data scaling'    '(SCALA)' ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    1360 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1366 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_1             5 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_2             5 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.502 
_pdbx_validate_rmsd_bond.bond_target_value         1.418 
_pdbx_validate_rmsd_bond.bond_deviation            0.084 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.013 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_1              99 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_2              99 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_3              99 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                97.28 
_pdbx_validate_rmsd_angle.angle_target_value         113.10 
_pdbx_validate_rmsd_angle.angle_deviation            -15.82 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 14  ? ? -69.36  68.41   
2  1 GLN A 43  ? ? -78.35  -140.84 
3  1 ASN A 60  ? ? -103.40 69.99   
4  1 ASP A 61  ? ? -100.73 78.72   
5  1 GLN A 65  ? ? 57.82   -107.99 
6  1 HIS A 101 ? ? -54.49  -4.07   
7  1 ARG A 180 ? ? -160.26 0.30    
8  1 ASP A 181 ? ? -151.31 71.76   
9  1 PRO B 14  ? ? -66.02  66.82   
10 1 LYS B 17  ? ? -62.19  2.06    
11 1 GLN B 43  ? ? -86.99  -146.95 
12 1 ILE B 58  ? ? -106.78 78.88   
13 1 ASP B 61  ? ? -156.16 68.78   
14 1 GLN B 65  ? ? 61.51   -110.10 
15 1 ARG B 180 ? ? -156.12 7.24    
16 1 ASP B 181 ? ? -150.14 73.52   
17 1 ARG B 222 ? ? -49.36  -71.37  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A LYS 4   ? A LYS 4   
5  1 Y 1 A PRO 314 ? A PRO 314 
6  1 Y 1 A ILE 315 ? A ILE 315 
7  1 Y 1 A ASP 316 ? A ASP 316 
8  1 Y 1 A TYR 317 ? A TYR 317 
9  1 Y 1 A LEU 318 ? A LEU 318 
10 1 Y 1 A ASN 319 ? A ASN 319 
11 1 Y 1 A PRO 320 ? A PRO 320 
12 1 Y 1 A PRO 321 ? A PRO 321 
13 1 Y 1 A LYS 322 ? A LYS 322 
14 1 Y 1 B MET 1   ? B MET 1   
15 1 Y 1 B SER 2   ? B SER 2   
16 1 Y 1 B ALA 3   ? B ALA 3   
17 1 Y 1 B LYS 4   ? B LYS 4   
18 1 Y 1 B PRO 314 ? B PRO 314 
19 1 Y 1 B ILE 315 ? B ILE 315 
20 1 Y 1 B ASP 316 ? B ASP 316 
21 1 Y 1 B TYR 317 ? B TYR 317 
22 1 Y 1 B LEU 318 ? B LEU 318 
23 1 Y 1 B ASN 319 ? B ASN 319 
24 1 Y 1 B PRO 320 ? B PRO 320 
25 1 Y 1 B PRO 321 ? B PRO 321 
26 1 Y 1 B LYS 322 ? B LYS 322 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION'           MN  
3 'S-2-(BORONOETHYL)-L-CYSTEINE' S2C 
4 water                          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MN  1   2314 2314 MN  MN  A . 
D 2 MN  1   2315 2315 MN  MN  A . 
E 3 S2C 1   1317 1317 S2C S2C A . 
F 2 MN  1   1314 1314 MN  MN  B . 
G 2 MN  1   1315 1315 MN  MN  B . 
H 3 S2C 1   1316 1316 S2C S2C B . 
I 4 HOH 1   2316 2    HOH HOH A . 
I 4 HOH 2   2317 3    HOH HOH A . 
I 4 HOH 3   2318 5    HOH HOH A . 
I 4 HOH 4   2319 9    HOH HOH A . 
I 4 HOH 5   2320 13   HOH HOH A . 
I 4 HOH 6   2321 14   HOH HOH A . 
I 4 HOH 7   2322 15   HOH HOH A . 
I 4 HOH 8   2323 17   HOH HOH A . 
I 4 HOH 9   2324 18   HOH HOH A . 
I 4 HOH 10  2325 26   HOH HOH A . 
I 4 HOH 11  2326 29   HOH HOH A . 
I 4 HOH 12  2327 30   HOH HOH A . 
I 4 HOH 13  2328 32   HOH HOH A . 
I 4 HOH 14  2329 34   HOH HOH A . 
I 4 HOH 15  2330 35   HOH HOH A . 
I 4 HOH 16  2331 36   HOH HOH A . 
I 4 HOH 17  2332 37   HOH HOH A . 
I 4 HOH 18  2333 38   HOH HOH A . 
I 4 HOH 19  2334 39   HOH HOH A . 
I 4 HOH 20  2335 40   HOH HOH A . 
I 4 HOH 21  2336 41   HOH HOH A . 
I 4 HOH 22  2337 42   HOH HOH A . 
I 4 HOH 23  2338 44   HOH HOH A . 
I 4 HOH 24  2339 45   HOH HOH A . 
I 4 HOH 25  2340 47   HOH HOH A . 
I 4 HOH 26  2341 51   HOH HOH A . 
I 4 HOH 27  2342 53   HOH HOH A . 
I 4 HOH 28  2343 54   HOH HOH A . 
I 4 HOH 29  2344 56   HOH HOH A . 
I 4 HOH 30  2345 58   HOH HOH A . 
I 4 HOH 31  2346 60   HOH HOH A . 
I 4 HOH 32  2347 61   HOH HOH A . 
I 4 HOH 33  2348 62   HOH HOH A . 
I 4 HOH 34  2349 64   HOH HOH A . 
I 4 HOH 35  2350 66   HOH HOH A . 
I 4 HOH 36  2351 67   HOH HOH A . 
I 4 HOH 37  2352 75   HOH HOH A . 
I 4 HOH 38  2353 78   HOH HOH A . 
I 4 HOH 39  2354 80   HOH HOH A . 
I 4 HOH 40  2355 84   HOH HOH A . 
I 4 HOH 41  2356 85   HOH HOH A . 
I 4 HOH 42  2357 87   HOH HOH A . 
I 4 HOH 43  2358 88   HOH HOH A . 
I 4 HOH 44  2359 91   HOH HOH A . 
I 4 HOH 45  2360 92   HOH HOH A . 
I 4 HOH 46  2361 93   HOH HOH A . 
I 4 HOH 47  2362 94   HOH HOH A . 
I 4 HOH 48  2363 95   HOH HOH A . 
I 4 HOH 49  2364 97   HOH HOH A . 
I 4 HOH 50  2365 98   HOH HOH A . 
I 4 HOH 51  2366 99   HOH HOH A . 
I 4 HOH 52  2367 100  HOH HOH A . 
I 4 HOH 53  2368 103  HOH HOH A . 
I 4 HOH 54  2369 107  HOH HOH A . 
I 4 HOH 55  2370 111  HOH HOH A . 
I 4 HOH 56  2371 112  HOH HOH A . 
I 4 HOH 57  2372 113  HOH HOH A . 
I 4 HOH 58  2373 117  HOH HOH A . 
I 4 HOH 59  2374 123  HOH HOH A . 
I 4 HOH 60  2375 125  HOH HOH A . 
I 4 HOH 61  2376 127  HOH HOH A . 
I 4 HOH 62  2377 129  HOH HOH A . 
I 4 HOH 63  2378 132  HOH HOH A . 
I 4 HOH 64  2379 134  HOH HOH A . 
I 4 HOH 65  2380 135  HOH HOH A . 
I 4 HOH 66  2381 138  HOH HOH A . 
I 4 HOH 67  2382 140  HOH HOH A . 
I 4 HOH 68  2383 141  HOH HOH A . 
I 4 HOH 69  2384 142  HOH HOH A . 
I 4 HOH 70  2385 144  HOH HOH A . 
I 4 HOH 71  2386 145  HOH HOH A . 
I 4 HOH 72  2387 146  HOH HOH A . 
I 4 HOH 73  2388 148  HOH HOH A . 
I 4 HOH 74  2389 149  HOH HOH A . 
I 4 HOH 75  2390 150  HOH HOH A . 
I 4 HOH 76  2391 151  HOH HOH A . 
I 4 HOH 77  2392 152  HOH HOH A . 
I 4 HOH 78  2393 153  HOH HOH A . 
I 4 HOH 79  2394 155  HOH HOH A . 
I 4 HOH 80  2395 156  HOH HOH A . 
I 4 HOH 81  2396 157  HOH HOH A . 
I 4 HOH 82  2397 158  HOH HOH A . 
I 4 HOH 83  2398 160  HOH HOH A . 
I 4 HOH 84  2399 163  HOH HOH A . 
I 4 HOH 85  2400 165  HOH HOH A . 
I 4 HOH 86  2401 166  HOH HOH A . 
I 4 HOH 87  2402 167  HOH HOH A . 
I 4 HOH 88  2403 168  HOH HOH A . 
I 4 HOH 89  2404 170  HOH HOH A . 
I 4 HOH 90  2405 171  HOH HOH A . 
I 4 HOH 91  2406 172  HOH HOH A . 
I 4 HOH 92  2407 173  HOH HOH A . 
I 4 HOH 93  2408 178  HOH HOH A . 
I 4 HOH 94  2409 179  HOH HOH A . 
I 4 HOH 95  2410 180  HOH HOH A . 
I 4 HOH 96  2411 181  HOH HOH A . 
I 4 HOH 97  2412 184  HOH HOH A . 
I 4 HOH 98  2413 189  HOH HOH A . 
I 4 HOH 99  2414 192  HOH HOH A . 
I 4 HOH 100 2415 194  HOH HOH A . 
I 4 HOH 101 2416 196  HOH HOH A . 
I 4 HOH 102 2417 197  HOH HOH A . 
I 4 HOH 103 2418 198  HOH HOH A . 
I 4 HOH 104 2419 199  HOH HOH A . 
I 4 HOH 105 2420 200  HOH HOH A . 
I 4 HOH 106 2421 201  HOH HOH A . 
J 4 HOH 1   1317 1    HOH HOH B . 
J 4 HOH 2   1318 4    HOH HOH B . 
J 4 HOH 3   1319 6    HOH HOH B . 
J 4 HOH 4   1320 7    HOH HOH B . 
J 4 HOH 5   1321 8    HOH HOH B . 
J 4 HOH 6   1322 10   HOH HOH B . 
J 4 HOH 7   1323 11   HOH HOH B . 
J 4 HOH 8   1324 12   HOH HOH B . 
J 4 HOH 9   1325 16   HOH HOH B . 
J 4 HOH 10  1326 19   HOH HOH B . 
J 4 HOH 11  1327 20   HOH HOH B . 
J 4 HOH 12  1328 21   HOH HOH B . 
J 4 HOH 13  1329 22   HOH HOH B . 
J 4 HOH 14  1330 23   HOH HOH B . 
J 4 HOH 15  1331 24   HOH HOH B . 
J 4 HOH 16  1332 25   HOH HOH B . 
J 4 HOH 17  1333 27   HOH HOH B . 
J 4 HOH 18  1334 28   HOH HOH B . 
J 4 HOH 19  1335 31   HOH HOH B . 
J 4 HOH 20  1336 33   HOH HOH B . 
J 4 HOH 21  1337 43   HOH HOH B . 
J 4 HOH 22  1338 46   HOH HOH B . 
J 4 HOH 23  1339 48   HOH HOH B . 
J 4 HOH 24  1340 49   HOH HOH B . 
J 4 HOH 25  1341 50   HOH HOH B . 
J 4 HOH 26  1342 52   HOH HOH B . 
J 4 HOH 27  1343 55   HOH HOH B . 
J 4 HOH 28  1344 57   HOH HOH B . 
J 4 HOH 29  1345 59   HOH HOH B . 
J 4 HOH 30  1346 63   HOH HOH B . 
J 4 HOH 31  1347 65   HOH HOH B . 
J 4 HOH 32  1348 68   HOH HOH B . 
J 4 HOH 33  1349 69   HOH HOH B . 
J 4 HOH 34  1350 70   HOH HOH B . 
J 4 HOH 35  1351 71   HOH HOH B . 
J 4 HOH 36  1352 72   HOH HOH B . 
J 4 HOH 37  1353 73   HOH HOH B . 
J 4 HOH 38  1354 74   HOH HOH B . 
J 4 HOH 39  1355 76   HOH HOH B . 
J 4 HOH 40  1356 77   HOH HOH B . 
J 4 HOH 41  1357 79   HOH HOH B . 
J 4 HOH 42  1358 81   HOH HOH B . 
J 4 HOH 43  1359 82   HOH HOH B . 
J 4 HOH 44  1360 83   HOH HOH B . 
J 4 HOH 45  1361 86   HOH HOH B . 
J 4 HOH 46  1362 89   HOH HOH B . 
J 4 HOH 47  1363 90   HOH HOH B . 
J 4 HOH 48  1364 96   HOH HOH B . 
J 4 HOH 49  1365 101  HOH HOH B . 
J 4 HOH 50  1366 102  HOH HOH B . 
J 4 HOH 51  1367 104  HOH HOH B . 
J 4 HOH 52  1368 105  HOH HOH B . 
J 4 HOH 53  1369 106  HOH HOH B . 
J 4 HOH 54  1370 108  HOH HOH B . 
J 4 HOH 55  1371 109  HOH HOH B . 
J 4 HOH 56  1372 110  HOH HOH B . 
J 4 HOH 57  1373 114  HOH HOH B . 
J 4 HOH 58  1374 115  HOH HOH B . 
J 4 HOH 59  1375 116  HOH HOH B . 
J 4 HOH 60  1376 118  HOH HOH B . 
J 4 HOH 61  1377 119  HOH HOH B . 
J 4 HOH 62  1378 120  HOH HOH B . 
J 4 HOH 63  1379 121  HOH HOH B . 
J 4 HOH 64  1380 122  HOH HOH B . 
J 4 HOH 65  1381 124  HOH HOH B . 
J 4 HOH 66  1382 126  HOH HOH B . 
J 4 HOH 67  1383 128  HOH HOH B . 
J 4 HOH 68  1384 130  HOH HOH B . 
J 4 HOH 69  1385 131  HOH HOH B . 
J 4 HOH 70  1386 133  HOH HOH B . 
J 4 HOH 71  1387 136  HOH HOH B . 
J 4 HOH 72  1388 137  HOH HOH B . 
J 4 HOH 73  1389 139  HOH HOH B . 
J 4 HOH 74  1390 143  HOH HOH B . 
J 4 HOH 75  1391 147  HOH HOH B . 
J 4 HOH 76  1392 154  HOH HOH B . 
J 4 HOH 77  1393 159  HOH HOH B . 
J 4 HOH 78  1394 161  HOH HOH B . 
J 4 HOH 79  1395 162  HOH HOH B . 
J 4 HOH 80  1396 164  HOH HOH B . 
J 4 HOH 81  1397 169  HOH HOH B . 
J 4 HOH 82  1398 174  HOH HOH B . 
J 4 HOH 83  1399 175  HOH HOH B . 
J 4 HOH 84  1400 176  HOH HOH B . 
J 4 HOH 85  1401 177  HOH HOH B . 
J 4 HOH 86  1402 182  HOH HOH B . 
J 4 HOH 87  1403 183  HOH HOH B . 
J 4 HOH 88  1404 185  HOH HOH B . 
J 4 HOH 89  1405 186  HOH HOH B . 
J 4 HOH 90  1406 187  HOH HOH B . 
J 4 HOH 91  1407 188  HOH HOH B . 
J 4 HOH 92  1408 190  HOH HOH B . 
J 4 HOH 93  1409 191  HOH HOH B . 
J 4 HOH 94  1410 193  HOH HOH B . 
J 4 HOH 95  1411 195  HOH HOH B . 
#