data_1WYN
# 
_entry.id   1WYN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1WYN         
RCSB  RCSB024158   
WWPDB D_1000024158 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001001945.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WYN 
_pdbx_database_status.recvd_initial_deposition_date   2005-02-15 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tomizawa, T.'                                           1 
'Kigawa, T.'                                             2 
'Koshiba, S.'                                            3 
'Inoue, M.'                                              4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the CH domain of human calponin-2' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tomizawa, T.' 1 
primary 'Kigawa, T.'   2 
primary 'Koshiba, S.'  3 
primary 'Inoue, M.'    4 
primary 'Yokoyama, S.' 5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Calponin-2 
_entity.formula_weight             15810.903 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'CH domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Calponin H2, smooth muscle, Neutral calponin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFI
KAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFI
KAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001001945.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ASN n 
1 9   ARG n 
1 10  LEU n 
1 11  LEU n 
1 12  SER n 
1 13  LYS n 
1 14  TYR n 
1 15  ASP n 
1 16  PRO n 
1 17  GLN n 
1 18  LYS n 
1 19  GLU n 
1 20  ALA n 
1 21  GLU n 
1 22  LEU n 
1 23  ARG n 
1 24  THR n 
1 25  TRP n 
1 26  ILE n 
1 27  GLU n 
1 28  GLY n 
1 29  LEU n 
1 30  THR n 
1 31  GLY n 
1 32  LEU n 
1 33  SER n 
1 34  ILE n 
1 35  GLY n 
1 36  PRO n 
1 37  ASP n 
1 38  PHE n 
1 39  GLN n 
1 40  LYS n 
1 41  GLY n 
1 42  LEU n 
1 43  LYS n 
1 44  ASP n 
1 45  GLY n 
1 46  THR n 
1 47  ILE n 
1 48  LEU n 
1 49  CYS n 
1 50  THR n 
1 51  LEU n 
1 52  MET n 
1 53  ASN n 
1 54  LYS n 
1 55  LEU n 
1 56  GLN n 
1 57  PRO n 
1 58  GLY n 
1 59  SER n 
1 60  VAL n 
1 61  PRO n 
1 62  LYS n 
1 63  ILE n 
1 64  ASN n 
1 65  ARG n 
1 66  SER n 
1 67  MET n 
1 68  GLN n 
1 69  ASN n 
1 70  TRP n 
1 71  HIS n 
1 72  GLN n 
1 73  LEU n 
1 74  GLU n 
1 75  ASN n 
1 76  LEU n 
1 77  SER n 
1 78  ASN n 
1 79  PHE n 
1 80  ILE n 
1 81  LYS n 
1 82  ALA n 
1 83  MET n 
1 84  VAL n 
1 85  SER n 
1 86  TYR n 
1 87  GLY n 
1 88  MET n 
1 89  ASN n 
1 90  PRO n 
1 91  VAL n 
1 92  ASP n 
1 93  LEU n 
1 94  PHE n 
1 95  GLU n 
1 96  ALA n 
1 97  ASN n 
1 98  ASP n 
1 99  LEU n 
1 100 PHE n 
1 101 GLU n 
1 102 SER n 
1 103 GLY n 
1 104 ASN n 
1 105 MET n 
1 106 THR n 
1 107 GLN n 
1 108 VAL n 
1 109 GLN n 
1 110 VAL n 
1 111 SER n 
1 112 LEU n 
1 113 LEU n 
1 114 ALA n 
1 115 LEU n 
1 116 ALA n 
1 117 GLY n 
1 118 LYS n 
1 119 ALA n 
1 120 LYS n 
1 121 THR n 
1 122 LYS n 
1 123 GLY n 
1 124 LEU n 
1 125 GLN n 
1 126 SER n 
1 127 GLY n 
1 128 VAL n 
1 129 ASP n 
1 130 ILE n 
1 131 GLY n 
1 132 VAL n 
1 133 LYS n 
1 134 TYR n 
1 135 SER n 
1 136 GLU n 
1 137 LYS n 
1 138 GLN n 
1 139 GLU n 
1 140 ARG n 
1 141 SER n 
1 142 GLY n 
1 143 PRO n 
1 144 SER n 
1 145 SER n 
1 146 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CNN2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040607-10 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CNN2_HUMAN 
_struct_ref.pdbx_db_accession          Q99439 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYG
MNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQER
;
_struct_ref.pdbx_align_begin           19 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WYN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 140 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99439 
_struct_ref_seq.db_align_beg                  19 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  151 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       140 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WYN GLY A 1   ? UNP Q99439 ? ? 'CLONING ARTIFACT' 1   1  
1 1WYN SER A 2   ? UNP Q99439 ? ? 'CLONING ARTIFACT' 2   2  
1 1WYN SER A 3   ? UNP Q99439 ? ? 'CLONING ARTIFACT' 3   3  
1 1WYN GLY A 4   ? UNP Q99439 ? ? 'CLONING ARTIFACT' 4   4  
1 1WYN SER A 5   ? UNP Q99439 ? ? 'CLONING ARTIFACT' 5   5  
1 1WYN SER A 6   ? UNP Q99439 ? ? 'CLONING ARTIFACT' 6   6  
1 1WYN GLY A 7   ? UNP Q99439 ? ? 'CLONING ARTIFACT' 7   7  
1 1WYN SER A 141 ? UNP Q99439 ? ? 'CLONING ARTIFACT' 141 8  
1 1WYN GLY A 142 ? UNP Q99439 ? ? 'CLONING ARTIFACT' 142 9  
1 1WYN PRO A 143 ? UNP Q99439 ? ? 'CLONING ARTIFACT' 143 10 
1 1WYN SER A 144 ? UNP Q99439 ? ? 'CLONING ARTIFACT' 144 11 
1 1WYN SER A 145 ? UNP Q99439 ? ? 'CLONING ARTIFACT' 145 12 
1 1WYN GLY A 146 ? UNP Q99439 ? ? 'CLONING ARTIFACT' 146 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.30mM CH domain U-15N,13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           1WYN 
_pdbx_nmr_refine.method             'torsion angle dynamics, restrainted molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1WYN 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function,structures with the lowest energy,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1WYN 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker          1 
processing           NMRPipe 20030801 'Delaglio, F.'  2 
'data analysis'      NMRview 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9295   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guentert, P.'  5 
refinement           CYANA   2.0.17   'Guentert, P.'  6 
# 
_exptl.entry_id          1WYN 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1WYN 
_struct.title                     'Solution structure of the CH domain of human calponin-2' 
_struct.pdbx_descriptor           Calponin-2 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WYN 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            
;CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 17  ? GLY A 31  ? GLN A 17  GLY A 31  1 ? 15 
HELX_P HELX_P2 2 ASP A 37  ? ASP A 44  ? ASP A 37  ASP A 44  1 ? 8  
HELX_P HELX_P3 3 THR A 46  ? GLN A 56  ? THR A 46  GLN A 56  1 ? 11 
HELX_P HELX_P4 4 GLN A 68  ? GLY A 87  ? GLN A 68  GLY A 87  1 ? 20 
HELX_P HELX_P5 5 GLU A 95  ? GLU A 101 ? GLU A 95  GLU A 101 1 ? 7  
HELX_P HELX_P6 6 MET A 105 ? LYS A 120 ? MET A 105 LYS A 120 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1WYN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WYN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -8.445  -2.413  -17.537 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -7.608  -2.168  -16.376 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -6.756  -3.367  -16.012 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -5.711  -3.601  -16.619 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -9.005  -1.693  -17.896 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -6.961  -1.329  -16.584 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -8.242  -1.923  -15.536 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -7.202  -4.128  -15.018 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -6.470  -5.308  -14.570 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -6.780  -6.510  -15.457 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -7.828  -7.140  -15.323 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -6.820  -5.630  -13.116 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -5.891  -6.542  -12.557 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -8.043  -3.890  -14.574 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -5.415  -5.088  -14.637 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -6.806  -4.719  -12.536 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -7.807  -6.067  -13.074 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -5.096  -6.560  -13.096 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -5.860  -6.819  -16.365 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -6.035  -7.943  -17.278 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -6.332  -9.227  -16.510 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -7.266  -9.958  -16.836 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -4.784  -8.129  -18.139 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -5.078  -8.859  -19.317 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -5.045  -6.279  -16.423 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -6.873  -7.720  -17.921 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -4.395  -7.161  -18.417 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -4.038  -8.667  -17.573 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -4.819  -8.346  -20.085 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -5.530  -9.495  -15.484 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -5.721  -10.690 -14.684 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -4.927  -10.658 -13.393 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -3.981  -9.881  -13.258 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -4.800  -8.876  -15.269 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -6.770  -10.786 -14.446 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -5.413  -11.549 -15.261 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -5.311  -11.503 -12.443 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -4.631  -11.564 -11.154 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -4.875  -12.907 -10.473 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -6.020  -13.305 -10.253 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -5.107  -10.426 -10.248 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -4.626  -9.175  -10.704 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -6.073  -12.096 -12.610 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -3.572  -11.451 -11.332 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -6.186  -10.403 -10.239 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -4.744  -10.594 -9.243  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -3.671  -9.144  -10.608 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -3.792  -13.603 -10.144 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -3.887  -14.904 -9.492  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -4.822  -14.841 -8.288  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -5.709  -15.679 -8.133  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -2.501  -15.380 -9.053  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -2.512  -16.764 -8.744  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -2.907  -13.233 -10.347 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -4.289  -15.605 -10.209 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -1.795  -15.208 -9.851  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -2.196  -14.829 -8.176  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -2.515  -17.274 -9.558  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -4.613  -13.841 -7.437  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -5.444  -13.686 -6.257  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -4.810  -14.288 -5.019  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -4.772  -15.509 -4.864  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -3.890  -13.203 -7.612  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -5.615  -12.634 -6.086  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -6.393  -14.171 -6.433  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ASN A 1 8   ? -4.309  -13.431 -4.135  1.00 0.00 ? 8   ASN A N    1  
ATOM 67    C CA   . ASN A 1 8   ? -3.671  -13.886 -2.906  1.00 0.00 ? 8   ASN A CA   1  
ATOM 68    C C    . ASN A 1 8   ? -4.653  -13.849 -1.737  1.00 0.00 ? 8   ASN A C    1  
ATOM 69    O O    . ASN A 1 8   ? -5.354  -12.859 -1.534  1.00 0.00 ? 8   ASN A O    1  
ATOM 70    C CB   . ASN A 1 8   ? -2.451  -13.019 -2.588  1.00 0.00 ? 8   ASN A CB   1  
ATOM 71    C CG   . ASN A 1 8   ? -1.207  -13.480 -3.323  1.00 0.00 ? 8   ASN A CG   1  
ATOM 72    O OD1  . ASN A 1 8   ? -1.288  -14.015 -4.429  1.00 0.00 ? 8   ASN A OD1  1  
ATOM 73    N ND2  . ASN A 1 8   ? -0.047  -13.273 -2.710  1.00 0.00 ? 8   ASN A ND2  1  
ATOM 74    H H    . ASN A 1 8   ? -4.369  -12.469 -4.315  1.00 0.00 ? 8   ASN A H    1  
ATOM 75    H HA   . ASN A 1 8   ? -3.348  -14.905 -3.057  1.00 0.00 ? 8   ASN A HA   1  
ATOM 76    H HB2  . ASN A 1 8   ? -2.658  -11.998 -2.876  1.00 0.00 ? 8   ASN A HB2  1  
ATOM 77    H HB3  . ASN A 1 8   ? -2.256  -13.057 -1.527  1.00 0.00 ? 8   ASN A HB3  1  
ATOM 78    H HD21 . ASN A 1 8   ? -0.059  -12.841 -1.830  1.00 0.00 ? 8   ASN A HD21 1  
ATOM 79    H HD22 . ASN A 1 8   ? 0.772   -13.561 -3.163  1.00 0.00 ? 8   ASN A HD22 1  
ATOM 80    N N    . ARG A 1 9   ? -4.695  -14.935 -0.974  1.00 0.00 ? 9   ARG A N    1  
ATOM 81    C CA   . ARG A 1 9   ? -5.591  -15.029 0.173   1.00 0.00 ? 9   ARG A CA   1  
ATOM 82    C C    . ARG A 1 9   ? -4.805  -15.277 1.457   1.00 0.00 ? 9   ARG A C    1  
ATOM 83    O O    . ARG A 1 9   ? -5.218  -16.064 2.308   1.00 0.00 ? 9   ARG A O    1  
ATOM 84    C CB   . ARG A 1 9   ? -6.610  -16.150 -0.038  1.00 0.00 ? 9   ARG A CB   1  
ATOM 85    C CG   . ARG A 1 9   ? -5.988  -17.535 -0.100  1.00 0.00 ? 9   ARG A CG   1  
ATOM 86    C CD   . ARG A 1 9   ? -6.954  -18.602 0.390   1.00 0.00 ? 9   ARG A CD   1  
ATOM 87    N NE   . ARG A 1 9   ? -7.828  -19.080 -0.678  1.00 0.00 ? 9   ARG A NE   1  
ATOM 88    C CZ   . ARG A 1 9   ? -8.502  -20.223 -0.621  1.00 0.00 ? 9   ARG A CZ   1  
ATOM 89    N NH1  . ARG A 1 9   ? -8.403  -21.002 0.448   1.00 0.00 ? 9   ARG A NH1  1  
ATOM 90    N NH2  . ARG A 1 9   ? -9.278  -20.589 -1.634  1.00 0.00 ? 9   ARG A NH2  1  
ATOM 91    H H    . ARG A 1 9   ? -4.111  -15.694 -1.187  1.00 0.00 ? 9   ARG A H    1  
ATOM 92    H HA   . ARG A 1 9   ? -6.115  -14.089 0.262   1.00 0.00 ? 9   ARG A HA   1  
ATOM 93    H HB2  . ARG A 1 9   ? -7.320  -16.134 0.776   1.00 0.00 ? 9   ARG A HB2  1  
ATOM 94    H HB3  . ARG A 1 9   ? -7.134  -15.973 -0.965  1.00 0.00 ? 9   ARG A HB3  1  
ATOM 95    H HG2  . ARG A 1 9   ? -5.716  -17.753 -1.122  1.00 0.00 ? 9   ARG A HG2  1  
ATOM 96    H HG3  . ARG A 1 9   ? -5.104  -17.550 0.521   1.00 0.00 ? 9   ARG A HG3  1  
ATOM 97    H HD2  . ARG A 1 9   ? -6.385  -19.435 0.775   1.00 0.00 ? 9   ARG A HD2  1  
ATOM 98    H HD3  . ARG A 1 9   ? -7.561  -18.184 1.179   1.00 0.00 ? 9   ARG A HD3  1  
ATOM 99    H HE   . ARG A 1 9   ? -7.916  -18.520 -1.478  1.00 0.00 ? 9   ARG A HE   1  
ATOM 100   H HH11 . ARG A 1 9   ? -7.821  -20.727 1.212   1.00 0.00 ? 9   ARG A HH11 1  
ATOM 101   H HH12 . ARG A 1 9   ? -8.913  -21.861 0.489   1.00 0.00 ? 9   ARG A HH12 1  
ATOM 102   H HH21 . ARG A 1 9   ? -9.354  -20.005 -2.441  1.00 0.00 ? 9   ARG A HH21 1  
ATOM 103   H HH22 . ARG A 1 9   ? -9.784  -21.450 -1.589  1.00 0.00 ? 9   ARG A HH22 1  
ATOM 104   N N    . LEU A 1 10  ? -3.670  -14.599 1.590   1.00 0.00 ? 10  LEU A N    1  
ATOM 105   C CA   . LEU A 1 10  ? -2.825  -14.745 2.770   1.00 0.00 ? 10  LEU A CA   1  
ATOM 106   C C    . LEU A 1 10  ? -3.482  -14.109 3.992   1.00 0.00 ? 10  LEU A C    1  
ATOM 107   O O    . LEU A 1 10  ? -3.488  -12.886 4.140   1.00 0.00 ? 10  LEU A O    1  
ATOM 108   C CB   . LEU A 1 10  ? -1.455  -14.110 2.524   1.00 0.00 ? 10  LEU A CB   1  
ATOM 109   C CG   . LEU A 1 10  ? -0.625  -14.722 1.395   1.00 0.00 ? 10  LEU A CG   1  
ATOM 110   C CD1  . LEU A 1 10  ? 0.628   -13.897 1.148   1.00 0.00 ? 10  LEU A CD1  1  
ATOM 111   C CD2  . LEU A 1 10  ? -0.263  -16.163 1.721   1.00 0.00 ? 10  LEU A CD2  1  
ATOM 112   H H    . LEU A 1 10  ? -3.392  -13.985 0.878   1.00 0.00 ? 10  LEU A H    1  
ATOM 113   H HA   . LEU A 1 10  ? -2.695  -15.801 2.956   1.00 0.00 ? 10  LEU A HA   1  
ATOM 114   H HB2  . LEU A 1 10  ? -1.612  -13.068 2.292   1.00 0.00 ? 10  LEU A HB2  1  
ATOM 115   H HB3  . LEU A 1 10  ? -0.885  -14.192 3.438   1.00 0.00 ? 10  LEU A HB3  1  
ATOM 116   H HG   . LEU A 1 10  ? -1.210  -14.720 0.485   1.00 0.00 ? 10  LEU A HG   1  
ATOM 117   H HD11 . LEU A 1 10  ? 1.499   -14.486 1.391   1.00 0.00 ? 10  LEU A HD11 1  
ATOM 118   H HD12 . LEU A 1 10  ? 0.607   -13.014 1.769   1.00 0.00 ? 10  LEU A HD12 1  
ATOM 119   H HD13 . LEU A 1 10  ? 0.668   -13.606 0.108   1.00 0.00 ? 10  LEU A HD13 1  
ATOM 120   H HD21 . LEU A 1 10  ? -0.226  -16.291 2.793   1.00 0.00 ? 10  LEU A HD21 1  
ATOM 121   H HD22 . LEU A 1 10  ? 0.704   -16.396 1.298   1.00 0.00 ? 10  LEU A HD22 1  
ATOM 122   H HD23 . LEU A 1 10  ? -1.008  -16.825 1.304   1.00 0.00 ? 10  LEU A HD23 1  
ATOM 123   N N    . LEU A 1 11  ? -4.031  -14.946 4.865   1.00 0.00 ? 11  LEU A N    1  
ATOM 124   C CA   . LEU A 1 11  ? -4.688  -14.466 6.076   1.00 0.00 ? 11  LEU A CA   1  
ATOM 125   C C    . LEU A 1 11  ? -3.732  -13.625 6.917   1.00 0.00 ? 11  LEU A C    1  
ATOM 126   O O    . LEU A 1 11  ? -2.548  -13.941 7.032   1.00 0.00 ? 11  LEU A O    1  
ATOM 127   C CB   . LEU A 1 11  ? -5.208  -15.645 6.899   1.00 0.00 ? 11  LEU A CB   1  
ATOM 128   C CG   . LEU A 1 11  ? -6.334  -16.462 6.266   1.00 0.00 ? 11  LEU A CG   1  
ATOM 129   C CD1  . LEU A 1 11  ? -5.771  -17.461 5.267   1.00 0.00 ? 11  LEU A CD1  1  
ATOM 130   C CD2  . LEU A 1 11  ? -7.144  -17.175 7.339   1.00 0.00 ? 11  LEU A CD2  1  
ATOM 131   H H    . LEU A 1 11  ? -3.994  -15.910 4.693   1.00 0.00 ? 11  LEU A H    1  
ATOM 132   H HA   . LEU A 1 11  ? -5.523  -13.850 5.778   1.00 0.00 ? 11  LEU A HA   1  
ATOM 133   H HB2  . LEU A 1 11  ? -4.378  -16.312 7.082   1.00 0.00 ? 11  LEU A HB2  1  
ATOM 134   H HB3  . LEU A 1 11  ? -5.569  -15.256 7.842   1.00 0.00 ? 11  LEU A HB3  1  
ATOM 135   H HG   . LEU A 1 11  ? -6.997  -15.795 5.732   1.00 0.00 ? 11  LEU A HG   1  
ATOM 136   H HD11 . LEU A 1 11  ? -5.927  -17.094 4.264   1.00 0.00 ? 11  LEU A HD11 1  
ATOM 137   H HD12 . LEU A 1 11  ? -6.275  -18.410 5.385   1.00 0.00 ? 11  LEU A HD12 1  
ATOM 138   H HD13 . LEU A 1 11  ? -4.714  -17.591 5.443   1.00 0.00 ? 11  LEU A HD13 1  
ATOM 139   H HD21 . LEU A 1 11  ? -6.502  -17.852 7.883   1.00 0.00 ? 11  LEU A HD21 1  
ATOM 140   H HD22 . LEU A 1 11  ? -7.944  -17.734 6.873   1.00 0.00 ? 11  LEU A HD22 1  
ATOM 141   H HD23 . LEU A 1 11  ? -7.561  -16.447 8.019   1.00 0.00 ? 11  LEU A HD23 1  
ATOM 142   N N    . SER A 1 12  ? -4.256  -12.554 7.506   1.00 0.00 ? 12  SER A N    1  
ATOM 143   C CA   . SER A 1 12  ? -3.449  -11.668 8.335   1.00 0.00 ? 12  SER A CA   1  
ATOM 144   C C    . SER A 1 12  ? -2.394  -12.455 9.107   1.00 0.00 ? 12  SER A C    1  
ATOM 145   O O    . SER A 1 12  ? -2.713  -13.399 9.830   1.00 0.00 ? 12  SER A O    1  
ATOM 146   C CB   . SER A 1 12  ? -4.341  -10.896 9.311   1.00 0.00 ? 12  SER A CB   1  
ATOM 147   O OG   . SER A 1 12  ? -3.564  -10.136 10.219  1.00 0.00 ? 12  SER A OG   1  
ATOM 148   H H    . SER A 1 12  ? -5.207  -12.356 7.377   1.00 0.00 ? 12  SER A H    1  
ATOM 149   H HA   . SER A 1 12  ? -2.951  -10.965 7.683   1.00 0.00 ? 12  SER A HA   1  
ATOM 150   H HB2  . SER A 1 12  ? -4.982  -10.227 8.756   1.00 0.00 ? 12  SER A HB2  1  
ATOM 151   H HB3  . SER A 1 12  ? -4.947  -11.594 9.870   1.00 0.00 ? 12  SER A HB3  1  
ATOM 152   H HG   . SER A 1 12  ? -2.645  -10.144 9.941   1.00 0.00 ? 12  SER A HG   1  
ATOM 153   N N    . LYS A 1 13  ? -1.137  -12.059 8.948   1.00 0.00 ? 13  LYS A N    1  
ATOM 154   C CA   . LYS A 1 13  ? -0.032  -12.725 9.630   1.00 0.00 ? 13  LYS A CA   1  
ATOM 155   C C    . LYS A 1 13  ? 1.213   -11.844 9.637   1.00 0.00 ? 13  LYS A C    1  
ATOM 156   O O    . LYS A 1 13  ? 1.259   -10.812 8.968   1.00 0.00 ? 13  LYS A O    1  
ATOM 157   C CB   . LYS A 1 13  ? 0.280   -14.062 8.953   1.00 0.00 ? 13  LYS A CB   1  
ATOM 158   C CG   . LYS A 1 13  ? 0.783   -13.918 7.527   1.00 0.00 ? 13  LYS A CG   1  
ATOM 159   C CD   . LYS A 1 13  ? 2.298   -13.801 7.480   1.00 0.00 ? 13  LYS A CD   1  
ATOM 160   C CE   . LYS A 1 13  ? 2.969   -15.146 7.709   1.00 0.00 ? 13  LYS A CE   1  
ATOM 161   N NZ   . LYS A 1 13  ? 3.137   -15.906 6.439   1.00 0.00 ? 13  LYS A NZ   1  
ATOM 162   H H    . LYS A 1 13  ? -0.945  -11.300 8.359   1.00 0.00 ? 13  LYS A H    1  
ATOM 163   H HA   . LYS A 1 13  ? -0.335  -12.909 10.649  1.00 0.00 ? 13  LYS A HA   1  
ATOM 164   H HB2  . LYS A 1 13  ? 1.034   -14.576 9.529   1.00 0.00 ? 13  LYS A HB2  1  
ATOM 165   H HB3  . LYS A 1 13  ? -0.620  -14.661 8.936   1.00 0.00 ? 13  LYS A HB3  1  
ATOM 166   H HG2  . LYS A 1 13  ? 0.483   -14.787 6.959   1.00 0.00 ? 13  LYS A HG2  1  
ATOM 167   H HG3  . LYS A 1 13  ? 0.349   -13.032 7.089   1.00 0.00 ? 13  LYS A HG3  1  
ATOM 168   H HD2  . LYS A 1 13  ? 2.592   -13.426 6.510   1.00 0.00 ? 13  LYS A HD2  1  
ATOM 169   H HD3  . LYS A 1 13  ? 2.621   -13.111 8.247   1.00 0.00 ? 13  LYS A HD3  1  
ATOM 170   H HE2  . LYS A 1 13  ? 3.939   -14.979 8.150   1.00 0.00 ? 13  LYS A HE2  1  
ATOM 171   H HE3  . LYS A 1 13  ? 2.361   -15.726 8.388   1.00 0.00 ? 13  LYS A HE3  1  
ATOM 172   H HZ1  . LYS A 1 13  ? 2.216   -16.261 6.111   1.00 0.00 ? 13  LYS A HZ1  1  
ATOM 173   H HZ2  . LYS A 1 13  ? 3.775   -16.714 6.588   1.00 0.00 ? 13  LYS A HZ2  1  
ATOM 174   H HZ3  . LYS A 1 13  ? 3.540   -15.290 5.704   1.00 0.00 ? 13  LYS A HZ3  1  
ATOM 175   N N    . TYR A 1 14  ? 2.221   -12.259 10.395  1.00 0.00 ? 14  TYR A N    1  
ATOM 176   C CA   . TYR A 1 14  ? 3.467   -11.507 10.491  1.00 0.00 ? 14  TYR A CA   1  
ATOM 177   C C    . TYR A 1 14  ? 4.673   -12.430 10.339  1.00 0.00 ? 14  TYR A C    1  
ATOM 178   O O    . TYR A 1 14  ? 4.630   -13.596 10.731  1.00 0.00 ? 14  TYR A O    1  
ATOM 179   C CB   . TYR A 1 14  ? 3.540   -10.769 11.828  1.00 0.00 ? 14  TYR A CB   1  
ATOM 180   C CG   . TYR A 1 14  ? 4.454   -9.565  11.807  1.00 0.00 ? 14  TYR A CG   1  
ATOM 181   C CD1  . TYR A 1 14  ? 5.835   -9.716  11.825  1.00 0.00 ? 14  TYR A CD1  1  
ATOM 182   C CD2  . TYR A 1 14  ? 3.936   -8.276  11.765  1.00 0.00 ? 14  TYR A CD2  1  
ATOM 183   C CE1  . TYR A 1 14  ? 6.674   -8.619  11.805  1.00 0.00 ? 14  TYR A CE1  1  
ATOM 184   C CE2  . TYR A 1 14  ? 4.767   -7.173  11.743  1.00 0.00 ? 14  TYR A CE2  1  
ATOM 185   C CZ   . TYR A 1 14  ? 6.135   -7.349  11.764  1.00 0.00 ? 14  TYR A CZ   1  
ATOM 186   O OH   . TYR A 1 14  ? 6.967   -6.254  11.743  1.00 0.00 ? 14  TYR A OH   1  
ATOM 187   H H    . TYR A 1 14  ? 2.125   -13.091 10.906  1.00 0.00 ? 14  TYR A H    1  
ATOM 188   H HA   . TYR A 1 14  ? 3.478   -10.783 9.690   1.00 0.00 ? 14  TYR A HA   1  
ATOM 189   H HB2  . TYR A 1 14  ? 2.552   -10.430 12.100  1.00 0.00 ? 14  TYR A HB2  1  
ATOM 190   H HB3  . TYR A 1 14  ? 3.904   -11.448 12.586  1.00 0.00 ? 14  TYR A HB3  1  
ATOM 191   H HD1  . TYR A 1 14  ? 6.254   -10.711 11.857  1.00 0.00 ? 14  TYR A HD1  1  
ATOM 192   H HD2  . TYR A 1 14  ? 2.865   -8.142  11.748  1.00 0.00 ? 14  TYR A HD2  1  
ATOM 193   H HE1  . TYR A 1 14  ? 7.745   -8.756  11.821  1.00 0.00 ? 14  TYR A HE1  1  
ATOM 194   H HE2  . TYR A 1 14  ? 4.346   -6.179  11.711  1.00 0.00 ? 14  TYR A HE2  1  
ATOM 195   H HH   . TYR A 1 14  ? 6.565   -5.556  11.218  1.00 0.00 ? 14  TYR A HH   1  
ATOM 196   N N    . ASP A 1 15  ? 5.746   -11.898 9.766   1.00 0.00 ? 15  ASP A N    1  
ATOM 197   C CA   . ASP A 1 15  ? 6.967   -12.671 9.562   1.00 0.00 ? 15  ASP A CA   1  
ATOM 198   C C    . ASP A 1 15  ? 8.187   -11.758 9.518   1.00 0.00 ? 15  ASP A C    1  
ATOM 199   O O    . ASP A 1 15  ? 8.251   -10.803 8.742   1.00 0.00 ? 15  ASP A O    1  
ATOM 200   C CB   . ASP A 1 15  ? 6.872   -13.481 8.268   1.00 0.00 ? 15  ASP A CB   1  
ATOM 201   C CG   . ASP A 1 15  ? 7.683   -14.760 8.326   1.00 0.00 ? 15  ASP A CG   1  
ATOM 202   O OD1  . ASP A 1 15  ? 8.870   -14.695 8.711   1.00 0.00 ? 15  ASP A OD1  1  
ATOM 203   O OD2  . ASP A 1 15  ? 7.130   -15.828 7.988   1.00 0.00 ? 15  ASP A OD2  1  
ATOM 204   H H    . ASP A 1 15  ? 5.719   -10.963 9.473   1.00 0.00 ? 15  ASP A H    1  
ATOM 205   H HA   . ASP A 1 15  ? 7.071   -13.350 10.394  1.00 0.00 ? 15  ASP A HA   1  
ATOM 206   H HB2  . ASP A 1 15  ? 5.839   -13.739 8.087   1.00 0.00 ? 15  ASP A HB2  1  
ATOM 207   H HB3  . ASP A 1 15  ? 7.238   -12.881 7.448   1.00 0.00 ? 15  ASP A HB3  1  
ATOM 208   N N    . PRO A 1 16  ? 9.181   -12.055 10.368  1.00 0.00 ? 16  PRO A N    1  
ATOM 209   C CA   . PRO A 1 16  ? 10.417  -11.271 10.446  1.00 0.00 ? 16  PRO A CA   1  
ATOM 210   C C    . PRO A 1 16  ? 11.293  -11.447 9.210   1.00 0.00 ? 16  PRO A C    1  
ATOM 211   O O    . PRO A 1 16  ? 12.296  -10.753 9.045   1.00 0.00 ? 16  PRO A O    1  
ATOM 212   C CB   . PRO A 1 16  ? 11.119  -11.838 11.683  1.00 0.00 ? 16  PRO A CB   1  
ATOM 213   C CG   . PRO A 1 16  ? 10.592  -13.225 11.816  1.00 0.00 ? 16  PRO A CG   1  
ATOM 214   C CD   . PRO A 1 16  ? 9.172   -13.177 11.321  1.00 0.00 ? 16  PRO A CD   1  
ATOM 215   H HA   . PRO A 1 16  ? 10.214  -10.221 10.595  1.00 0.00 ? 16  PRO A HA   1  
ATOM 216   H HB2  . PRO A 1 16  ? 12.188  -11.835 11.526  1.00 0.00 ? 16  PRO A HB2  1  
ATOM 217   H HB3  . PRO A 1 16  ? 10.874  -11.239 12.547  1.00 0.00 ? 16  PRO A HB3  1  
ATOM 218   H HG2  . PRO A 1 16  ? 11.177  -13.901 11.211  1.00 0.00 ? 16  PRO A HG2  1  
ATOM 219   H HG3  . PRO A 1 16  ? 10.617  -13.529 12.852  1.00 0.00 ? 16  PRO A HG3  1  
ATOM 220   H HD2  . PRO A 1 16  ? 8.915   -14.101 10.826  1.00 0.00 ? 16  PRO A HD2  1  
ATOM 221   H HD3  . PRO A 1 16  ? 8.495   -12.983 12.139  1.00 0.00 ? 16  PRO A HD3  1  
ATOM 222   N N    . GLN A 1 17  ? 10.906  -12.379 8.344   1.00 0.00 ? 17  GLN A N    1  
ATOM 223   C CA   . GLN A 1 17  ? 11.657  -12.645 7.123   1.00 0.00 ? 17  GLN A CA   1  
ATOM 224   C C    . GLN A 1 17  ? 10.978  -12.007 5.916   1.00 0.00 ? 17  GLN A C    1  
ATOM 225   O O    . GLN A 1 17  ? 11.643  -11.540 4.991   1.00 0.00 ? 17  GLN A O    1  
ATOM 226   C CB   . GLN A 1 17  ? 11.800  -14.152 6.905   1.00 0.00 ? 17  GLN A CB   1  
ATOM 227   C CG   . GLN A 1 17  ? 10.624  -14.775 6.171   1.00 0.00 ? 17  GLN A CG   1  
ATOM 228   C CD   . GLN A 1 17  ? 10.703  -16.289 6.119   1.00 0.00 ? 17  GLN A CD   1  
ATOM 229   O OE1  . GLN A 1 17  ? 11.050  -16.938 7.106   1.00 0.00 ? 17  GLN A OE1  1  
ATOM 230   N NE2  . GLN A 1 17  ? 10.380  -16.859 4.964   1.00 0.00 ? 17  GLN A NE2  1  
ATOM 231   H H    . GLN A 1 17  ? 10.098  -12.900 8.532   1.00 0.00 ? 17  GLN A H    1  
ATOM 232   H HA   . GLN A 1 17  ? 12.640  -12.212 7.237   1.00 0.00 ? 17  GLN A HA   1  
ATOM 233   H HB2  . GLN A 1 17  ? 12.695  -14.338 6.331   1.00 0.00 ? 17  GLN A HB2  1  
ATOM 234   H HB3  . GLN A 1 17  ? 11.892  -14.636 7.867   1.00 0.00 ? 17  GLN A HB3  1  
ATOM 235   H HG2  . GLN A 1 17  ? 9.712   -14.495 6.675   1.00 0.00 ? 17  GLN A HG2  1  
ATOM 236   H HG3  . GLN A 1 17  ? 10.606  -14.395 5.160   1.00 0.00 ? 17  GLN A HG3  1  
ATOM 237   H HE21 . GLN A 1 17  ? 10.114  -16.278 4.220   1.00 0.00 ? 17  GLN A HE21 1  
ATOM 238   H HE22 . GLN A 1 17  ? 10.424  -17.835 4.902   1.00 0.00 ? 17  GLN A HE22 1  
ATOM 239   N N    . LYS A 1 18  ? 9.650   -11.991 5.932   1.00 0.00 ? 18  LYS A N    1  
ATOM 240   C CA   . LYS A 1 18  ? 8.878   -11.410 4.840   1.00 0.00 ? 18  LYS A CA   1  
ATOM 241   C C    . LYS A 1 18  ? 9.033   -9.893  4.811   1.00 0.00 ? 18  LYS A C    1  
ATOM 242   O O    . LYS A 1 18  ? 9.228   -9.300  3.750   1.00 0.00 ? 18  LYS A O    1  
ATOM 243   C CB   . LYS A 1 18  ? 7.400   -11.779 4.979   1.00 0.00 ? 18  LYS A CB   1  
ATOM 244   C CG   . LYS A 1 18  ? 7.132   -13.270 4.864   1.00 0.00 ? 18  LYS A CG   1  
ATOM 245   C CD   . LYS A 1 18  ? 7.226   -13.744 3.422   1.00 0.00 ? 18  LYS A CD   1  
ATOM 246   C CE   . LYS A 1 18  ? 5.882   -13.645 2.715   1.00 0.00 ? 18  LYS A CE   1  
ATOM 247   N NZ   . LYS A 1 18  ? 4.943   -14.713 3.158   1.00 0.00 ? 18  LYS A NZ   1  
ATOM 248   H H    . LYS A 1 18  ? 9.175   -12.380 6.697   1.00 0.00 ? 18  LYS A H    1  
ATOM 249   H HA   . LYS A 1 18  ? 9.256   -11.816 3.913   1.00 0.00 ? 18  LYS A HA   1  
ATOM 250   H HB2  . LYS A 1 18  ? 7.046   -11.445 5.943   1.00 0.00 ? 18  LYS A HB2  1  
ATOM 251   H HB3  . LYS A 1 18  ? 6.840   -11.274 4.205   1.00 0.00 ? 18  LYS A HB3  1  
ATOM 252   H HG2  . LYS A 1 18  ? 7.860   -13.805 5.454   1.00 0.00 ? 18  LYS A HG2  1  
ATOM 253   H HG3  . LYS A 1 18  ? 6.139   -13.478 5.237   1.00 0.00 ? 18  LYS A HG3  1  
ATOM 254   H HD2  . LYS A 1 18  ? 7.942   -13.130 2.896   1.00 0.00 ? 18  LYS A HD2  1  
ATOM 255   H HD3  . LYS A 1 18  ? 7.553   -14.774 3.412   1.00 0.00 ? 18  LYS A HD3  1  
ATOM 256   H HE2  . LYS A 1 18  ? 5.446   -12.682 2.930   1.00 0.00 ? 18  LYS A HE2  1  
ATOM 257   H HE3  . LYS A 1 18  ? 6.043   -13.737 1.651   1.00 0.00 ? 18  LYS A HE3  1  
ATOM 258   H HZ1  . LYS A 1 18  ? 4.740   -15.359 2.369   1.00 0.00 ? 18  LYS A HZ1  1  
ATOM 259   H HZ2  . LYS A 1 18  ? 4.050   -14.291 3.483   1.00 0.00 ? 18  LYS A HZ2  1  
ATOM 260   H HZ3  . LYS A 1 18  ? 5.362   -15.256 3.939   1.00 0.00 ? 18  LYS A HZ3  1  
ATOM 261   N N    . GLU A 1 19  ? 8.946   -9.271  5.983   1.00 0.00 ? 19  GLU A N    1  
ATOM 262   C CA   . GLU A 1 19  ? 9.078   -7.823  6.091   1.00 0.00 ? 19  GLU A CA   1  
ATOM 263   C C    . GLU A 1 19  ? 10.191  -7.308  5.182   1.00 0.00 ? 19  GLU A C    1  
ATOM 264   O O    . GLU A 1 19  ? 10.011  -6.334  4.453   1.00 0.00 ? 19  GLU A O    1  
ATOM 265   C CB   . GLU A 1 19  ? 9.361   -7.420  7.540   1.00 0.00 ? 19  GLU A CB   1  
ATOM 266   C CG   . GLU A 1 19  ? 9.688   -5.947  7.709   1.00 0.00 ? 19  GLU A CG   1  
ATOM 267   C CD   . GLU A 1 19  ? 11.170  -5.658  7.572   1.00 0.00 ? 19  GLU A CD   1  
ATOM 268   O OE1  . GLU A 1 19  ? 11.979  -6.414  8.150   1.00 0.00 ? 19  GLU A OE1  1  
ATOM 269   O OE2  . GLU A 1 19  ? 11.522  -4.676  6.885   1.00 0.00 ? 19  GLU A OE2  1  
ATOM 270   H H    . GLU A 1 19  ? 8.790   -9.799  6.794   1.00 0.00 ? 19  GLU A H    1  
ATOM 271   H HA   . GLU A 1 19  ? 8.143   -7.381  5.780   1.00 0.00 ? 19  GLU A HA   1  
ATOM 272   H HB2  . GLU A 1 19  ? 8.493   -7.647  8.140   1.00 0.00 ? 19  GLU A HB2  1  
ATOM 273   H HB3  . GLU A 1 19  ? 10.200  -7.997  7.903   1.00 0.00 ? 19  GLU A HB3  1  
ATOM 274   H HG2  . GLU A 1 19  ? 9.157   -5.384  6.956   1.00 0.00 ? 19  GLU A HG2  1  
ATOM 275   H HG3  . GLU A 1 19  ? 9.363   -5.629  8.689   1.00 0.00 ? 19  GLU A HG3  1  
ATOM 276   N N    . ALA A 1 20  ? 11.341  -7.971  5.231   1.00 0.00 ? 20  ALA A N    1  
ATOM 277   C CA   . ALA A 1 20  ? 12.482  -7.584  4.413   1.00 0.00 ? 20  ALA A CA   1  
ATOM 278   C C    . ALA A 1 20  ? 12.145  -7.661  2.928   1.00 0.00 ? 20  ALA A C    1  
ATOM 279   O O    . ALA A 1 20  ? 12.549  -6.802  2.145   1.00 0.00 ? 20  ALA A O    1  
ATOM 280   C CB   . ALA A 1 20  ? 13.683  -8.464  4.728   1.00 0.00 ? 20  ALA A CB   1  
ATOM 281   H H    . ALA A 1 20  ? 11.424  -8.742  5.833   1.00 0.00 ? 20  ALA A H    1  
ATOM 282   H HA   . ALA A 1 20  ? 12.740  -6.564  4.660   1.00 0.00 ? 20  ALA A HA   1  
ATOM 283   H HB1  . ALA A 1 20  ? 14.111  -8.160  5.673   1.00 0.00 ? 20  ALA A HB1  1  
ATOM 284   H HB2  . ALA A 1 20  ? 13.367  -9.494  4.791   1.00 0.00 ? 20  ALA A HB2  1  
ATOM 285   H HB3  . ALA A 1 20  ? 14.421  -8.360  3.948   1.00 0.00 ? 20  ALA A HB3  1  
ATOM 286   N N    . GLU A 1 21  ? 11.401  -8.696  2.548   1.00 0.00 ? 21  GLU A N    1  
ATOM 287   C CA   . GLU A 1 21  ? 11.010  -8.885  1.155   1.00 0.00 ? 21  GLU A CA   1  
ATOM 288   C C    . GLU A 1 21  ? 10.250  -7.669  0.633   1.00 0.00 ? 21  GLU A C    1  
ATOM 289   O O    . GLU A 1 21  ? 10.417  -7.263  -0.517  1.00 0.00 ? 21  GLU A O    1  
ATOM 290   C CB   . GLU A 1 21  ? 10.149  -10.141 1.010   1.00 0.00 ? 21  GLU A CB   1  
ATOM 291   C CG   . GLU A 1 21  ? 10.849  -11.414 1.453   1.00 0.00 ? 21  GLU A CG   1  
ATOM 292   C CD   . GLU A 1 21  ? 10.255  -12.657 0.819   1.00 0.00 ? 21  GLU A CD   1  
ATOM 293   O OE1  . GLU A 1 21  ? 9.033   -12.661 0.556   1.00 0.00 ? 21  GLU A OE1  1  
ATOM 294   O OE2  . GLU A 1 21  ? 11.009  -13.624 0.587   1.00 0.00 ? 21  GLU A OE2  1  
ATOM 295   H H    . GLU A 1 21  ? 11.109  -9.347  3.219   1.00 0.00 ? 21  GLU A H    1  
ATOM 296   H HA   . GLU A 1 21  ? 11.911  -9.008  0.572   1.00 0.00 ? 21  GLU A HA   1  
ATOM 297   H HB2  . GLU A 1 21  ? 9.255   -10.020 1.605   1.00 0.00 ? 21  GLU A HB2  1  
ATOM 298   H HB3  . GLU A 1 21  ? 9.867   -10.251 -0.027  1.00 0.00 ? 21  GLU A HB3  1  
ATOM 299   H HG2  . GLU A 1 21  ? 11.891  -11.351 1.176   1.00 0.00 ? 21  GLU A HG2  1  
ATOM 300   H HG3  . GLU A 1 21  ? 10.767  -11.501 2.526   1.00 0.00 ? 21  GLU A HG3  1  
ATOM 301   N N    . LEU A 1 22  ? 9.413   -7.091  1.489   1.00 0.00 ? 22  LEU A N    1  
ATOM 302   C CA   . LEU A 1 22  ? 8.625   -5.921  1.116   1.00 0.00 ? 22  LEU A CA   1  
ATOM 303   C C    . LEU A 1 22  ? 9.526   -4.720  0.851   1.00 0.00 ? 22  LEU A C    1  
ATOM 304   O O    . LEU A 1 22  ? 9.644   -4.259  -0.285  1.00 0.00 ? 22  LEU A O    1  
ATOM 305   C CB   . LEU A 1 22  ? 7.619   -5.587  2.219   1.00 0.00 ? 22  LEU A CB   1  
ATOM 306   C CG   . LEU A 1 22  ? 6.528   -6.628  2.472   1.00 0.00 ? 22  LEU A CG   1  
ATOM 307   C CD1  . LEU A 1 22  ? 5.720   -6.264  3.707   1.00 0.00 ? 22  LEU A CD1  1  
ATOM 308   C CD2  . LEU A 1 22  ? 5.620   -6.753  1.257   1.00 0.00 ? 22  LEU A CD2  1  
ATOM 309   H H    . LEU A 1 22  ? 9.323   -7.459  2.392   1.00 0.00 ? 22  LEU A H    1  
ATOM 310   H HA   . LEU A 1 22  ? 8.087   -6.160  0.210   1.00 0.00 ? 22  LEU A HA   1  
ATOM 311   H HB2  . LEU A 1 22  ? 8.170   -5.455  3.138   1.00 0.00 ? 22  LEU A HB2  1  
ATOM 312   H HB3  . LEU A 1 22  ? 7.137   -4.657  1.954   1.00 0.00 ? 22  LEU A HB3  1  
ATOM 313   H HG   . LEU A 1 22  ? 6.990   -7.589  2.646   1.00 0.00 ? 22  LEU A HG   1  
ATOM 314   H HD11 . LEU A 1 22  ? 6.069   -6.844  4.549   1.00 0.00 ? 22  LEU A HD11 1  
ATOM 315   H HD12 . LEU A 1 22  ? 4.676   -6.479  3.531   1.00 0.00 ? 22  LEU A HD12 1  
ATOM 316   H HD13 . LEU A 1 22  ? 5.840   -5.212  3.920   1.00 0.00 ? 22  LEU A HD13 1  
ATOM 317   H HD21 . LEU A 1 22  ? 4.925   -7.566  1.410   1.00 0.00 ? 22  LEU A HD21 1  
ATOM 318   H HD22 . LEU A 1 22  ? 6.219   -6.952  0.380   1.00 0.00 ? 22  LEU A HD22 1  
ATOM 319   H HD23 . LEU A 1 22  ? 5.073   -5.833  1.119   1.00 0.00 ? 22  LEU A HD23 1  
ATOM 320   N N    . ARG A 1 23  ? 10.160  -4.218  1.905   1.00 0.00 ? 23  ARG A N    1  
ATOM 321   C CA   . ARG A 1 23  ? 11.051  -3.070  1.787   1.00 0.00 ? 23  ARG A CA   1  
ATOM 322   C C    . ARG A 1 23  ? 12.003  -3.242  0.607   1.00 0.00 ? 23  ARG A C    1  
ATOM 323   O O    . ARG A 1 23  ? 12.340  -2.277  -0.080  1.00 0.00 ? 23  ARG A O    1  
ATOM 324   C CB   . ARG A 1 23  ? 11.850  -2.882  3.077   1.00 0.00 ? 23  ARG A CB   1  
ATOM 325   C CG   . ARG A 1 23  ? 12.700  -4.087  3.449   1.00 0.00 ? 23  ARG A CG   1  
ATOM 326   C CD   . ARG A 1 23  ? 13.897  -3.683  4.296   1.00 0.00 ? 23  ARG A CD   1  
ATOM 327   N NE   . ARG A 1 23  ? 15.058  -3.346  3.477   1.00 0.00 ? 23  ARG A NE   1  
ATOM 328   C CZ   . ARG A 1 23  ? 16.058  -2.580  3.900   1.00 0.00 ? 23  ARG A CZ   1  
ATOM 329   N NH1  . ARG A 1 23  ? 16.039  -2.077  5.127   1.00 0.00 ? 23  ARG A NH1  1  
ATOM 330   N NH2  . ARG A 1 23  ? 17.080  -2.319  3.096   1.00 0.00 ? 23  ARG A NH2  1  
ATOM 331   H H    . ARG A 1 23  ? 10.025  -4.629  2.785   1.00 0.00 ? 23  ARG A H    1  
ATOM 332   H HA   . ARG A 1 23  ? 10.443  -2.194  1.618   1.00 0.00 ? 23  ARG A HA   1  
ATOM 333   H HB2  . ARG A 1 23  ? 12.503  -2.030  2.962   1.00 0.00 ? 23  ARG A HB2  1  
ATOM 334   H HB3  . ARG A 1 23  ? 11.162  -2.691  3.888   1.00 0.00 ? 23  ARG A HB3  1  
ATOM 335   H HG2  . ARG A 1 23  ? 12.094  -4.784  4.010   1.00 0.00 ? 23  ARG A HG2  1  
ATOM 336   H HG3  . ARG A 1 23  ? 13.052  -4.559  2.545   1.00 0.00 ? 23  ARG A HG3  1  
ATOM 337   H HD2  . ARG A 1 23  ? 13.626  -2.824  4.892   1.00 0.00 ? 23  ARG A HD2  1  
ATOM 338   H HD3  . ARG A 1 23  ? 14.153  -4.506  4.947   1.00 0.00 ? 23  ARG A HD3  1  
ATOM 339   H HE   . ARG A 1 23  ? 15.092  -3.707  2.568   1.00 0.00 ? 23  ARG A HE   1  
ATOM 340   H HH11 . ARG A 1 23  ? 15.271  -2.274  5.736   1.00 0.00 ? 23  ARG A HH11 1  
ATOM 341   H HH12 . ARG A 1 23  ? 16.794  -1.502  5.444   1.00 0.00 ? 23  ARG A HH12 1  
ATOM 342   H HH21 . ARG A 1 23  ? 17.098  -2.697  2.171   1.00 0.00 ? 23  ARG A HH21 1  
ATOM 343   H HH22 . ARG A 1 23  ? 17.832  -1.742  3.416   1.00 0.00 ? 23  ARG A HH22 1  
ATOM 344   N N    . THR A 1 24  ? 12.436  -4.477  0.377   1.00 0.00 ? 24  THR A N    1  
ATOM 345   C CA   . THR A 1 24  ? 13.351  -4.775  -0.718  1.00 0.00 ? 24  THR A CA   1  
ATOM 346   C C    . THR A 1 24  ? 12.647  -4.672  -2.067  1.00 0.00 ? 24  THR A C    1  
ATOM 347   O O    . THR A 1 24  ? 13.270  -4.352  -3.079  1.00 0.00 ? 24  THR A O    1  
ATOM 348   C CB   . THR A 1 24  ? 13.956  -6.185  -0.576  1.00 0.00 ? 24  THR A CB   1  
ATOM 349   O OG1  . THR A 1 24  ? 14.536  -6.340  0.725   1.00 0.00 ? 24  THR A OG1  1  
ATOM 350   C CG2  . THR A 1 24  ? 15.016  -6.428  -1.640  1.00 0.00 ? 24  THR A CG2  1  
ATOM 351   H H    . THR A 1 24  ? 12.133  -5.205  0.958   1.00 0.00 ? 24  THR A H    1  
ATOM 352   H HA   . THR A 1 24  ? 14.155  -4.056  -0.686  1.00 0.00 ? 24  THR A HA   1  
ATOM 353   H HB   . THR A 1 24  ? 13.169  -6.913  -0.699  1.00 0.00 ? 24  THR A HB   1  
ATOM 354   H HG1  . THR A 1 24  ? 14.928  -7.214  0.798   1.00 0.00 ? 24  THR A HG1  1  
ATOM 355   H HG21 . THR A 1 24  ? 14.970  -7.457  -1.965  1.00 0.00 ? 24  THR A HG21 1  
ATOM 356   H HG22 . THR A 1 24  ? 15.993  -6.224  -1.229  1.00 0.00 ? 24  THR A HG22 1  
ATOM 357   H HG23 . THR A 1 24  ? 14.836  -5.776  -2.482  1.00 0.00 ? 24  THR A HG23 1  
ATOM 358   N N    . TRP A 1 25  ? 11.347  -4.942  -2.072  1.00 0.00 ? 25  TRP A N    1  
ATOM 359   C CA   . TRP A 1 25  ? 10.558  -4.878  -3.297  1.00 0.00 ? 25  TRP A CA   1  
ATOM 360   C C    . TRP A 1 25  ? 10.019  -3.470  -3.524  1.00 0.00 ? 25  TRP A C    1  
ATOM 361   O O    . TRP A 1 25  ? 9.705   -3.090  -4.652  1.00 0.00 ? 25  TRP A O    1  
ATOM 362   C CB   . TRP A 1 25  ? 9.402   -5.878  -3.237  1.00 0.00 ? 25  TRP A CB   1  
ATOM 363   C CG   . TRP A 1 25  ? 8.285   -5.551  -4.181  1.00 0.00 ? 25  TRP A CG   1  
ATOM 364   C CD1  . TRP A 1 25  ? 8.273   -5.743  -5.534  1.00 0.00 ? 25  TRP A CD1  1  
ATOM 365   C CD2  . TRP A 1 25  ? 7.019   -4.974  -3.845  1.00 0.00 ? 25  TRP A CD2  1  
ATOM 366   N NE1  . TRP A 1 25  ? 7.075   -5.319  -6.058  1.00 0.00 ? 25  TRP A NE1  1  
ATOM 367   C CE2  . TRP A 1 25  ? 6.288   -4.844  -5.042  1.00 0.00 ? 25  TRP A CE2  1  
ATOM 368   C CE3  . TRP A 1 25  ? 6.431   -4.555  -2.649  1.00 0.00 ? 25  TRP A CE3  1  
ATOM 369   C CZ2  . TRP A 1 25  ? 5.002   -4.313  -5.075  1.00 0.00 ? 25  TRP A CZ2  1  
ATOM 370   C CZ3  . TRP A 1 25  ? 5.154   -4.028  -2.682  1.00 0.00 ? 25  TRP A CZ3  1  
ATOM 371   C CH2  . TRP A 1 25  ? 4.450   -3.912  -3.889  1.00 0.00 ? 25  TRP A CH2  1  
ATOM 372   H H    . TRP A 1 25  ? 10.906  -5.191  -1.232  1.00 0.00 ? 25  TRP A H    1  
ATOM 373   H HA   . TRP A 1 25  ? 11.206  -5.139  -4.121  1.00 0.00 ? 25  TRP A HA   1  
ATOM 374   H HB2  . TRP A 1 25  ? 9.771   -6.861  -3.485  1.00 0.00 ? 25  TRP A HB2  1  
ATOM 375   H HB3  . TRP A 1 25  ? 8.999   -5.890  -2.235  1.00 0.00 ? 25  TRP A HB3  1  
ATOM 376   H HD1  . TRP A 1 25  ? 9.092   -6.165  -6.095  1.00 0.00 ? 25  TRP A HD1  1  
ATOM 377   H HE1  . TRP A 1 25  ? 6.825   -5.355  -7.005  1.00 0.00 ? 25  TRP A HE1  1  
ATOM 378   H HE3  . TRP A 1 25  ? 6.957   -4.637  -1.709  1.00 0.00 ? 25  TRP A HE3  1  
ATOM 379   H HZ2  . TRP A 1 25  ? 4.445   -4.218  -5.997  1.00 0.00 ? 25  TRP A HZ2  1  
ATOM 380   H HZ3  . TRP A 1 25  ? 4.683   -3.699  -1.767  1.00 0.00 ? 25  TRP A HZ3  1  
ATOM 381   H HH2  . TRP A 1 25  ? 3.456   -3.494  -3.868  1.00 0.00 ? 25  TRP A HH2  1  
ATOM 382   N N    . ILE A 1 26  ? 9.913   -2.701  -2.446  1.00 0.00 ? 26  ILE A N    1  
ATOM 383   C CA   . ILE A 1 26  ? 9.412   -1.335  -2.528  1.00 0.00 ? 26  ILE A CA   1  
ATOM 384   C C    . ILE A 1 26  ? 10.547  -0.347  -2.778  1.00 0.00 ? 26  ILE A C    1  
ATOM 385   O O    . ILE A 1 26  ? 10.466  0.493   -3.673  1.00 0.00 ? 26  ILE A O    1  
ATOM 386   C CB   . ILE A 1 26  ? 8.666   -0.930  -1.244  1.00 0.00 ? 26  ILE A CB   1  
ATOM 387   C CG1  . ILE A 1 26  ? 7.546   -1.927  -0.942  1.00 0.00 ? 26  ILE A CG1  1  
ATOM 388   C CG2  . ILE A 1 26  ? 8.106   0.479   -1.379  1.00 0.00 ? 26  ILE A CG2  1  
ATOM 389   C CD1  . ILE A 1 26  ? 6.865   -1.686  0.387   1.00 0.00 ? 26  ILE A CD1  1  
ATOM 390   H H    . ILE A 1 26  ? 10.178  -3.060  -1.574  1.00 0.00 ? 26  ILE A H    1  
ATOM 391   H HA   . ILE A 1 26  ? 8.717   -1.285  -3.355  1.00 0.00 ? 26  ILE A HA   1  
ATOM 392   H HB   . ILE A 1 26  ? 9.372   -0.934  -0.427  1.00 0.00 ? 26  ILE A HB   1  
ATOM 393   H HG12 . ILE A 1 26  ? 6.797   -1.863  -1.715  1.00 0.00 ? 26  ILE A HG12 1  
ATOM 394   H HG13 . ILE A 1 26  ? 7.958   -2.926  -0.929  1.00 0.00 ? 26  ILE A HG13 1  
ATOM 395   H HG21 . ILE A 1 26  ? 8.880   1.142   -1.737  1.00 0.00 ? 26  ILE A HG21 1  
ATOM 396   H HG22 . ILE A 1 26  ? 7.285   0.474   -2.080  1.00 0.00 ? 26  ILE A HG22 1  
ATOM 397   H HG23 . ILE A 1 26  ? 7.757   0.821   -0.416  1.00 0.00 ? 26  ILE A HG23 1  
ATOM 398   H HD11 . ILE A 1 26  ? 7.184   -2.436  1.097   1.00 0.00 ? 26  ILE A HD11 1  
ATOM 399   H HD12 . ILE A 1 26  ? 7.128   -0.707  0.755   1.00 0.00 ? 26  ILE A HD12 1  
ATOM 400   H HD13 . ILE A 1 26  ? 5.794   -1.747  0.259   1.00 0.00 ? 26  ILE A HD13 1  
ATOM 401   N N    . GLU A 1 27  ? 11.605  -0.456  -1.981  1.00 0.00 ? 27  GLU A N    1  
ATOM 402   C CA   . GLU A 1 27  ? 12.757  0.426   -2.115  1.00 0.00 ? 27  GLU A CA   1  
ATOM 403   C C    . GLU A 1 27  ? 13.242  0.471   -3.562  1.00 0.00 ? 27  GLU A C    1  
ATOM 404   O O    . GLU A 1 27  ? 13.552  1.538   -4.091  1.00 0.00 ? 27  GLU A O    1  
ATOM 405   C CB   . GLU A 1 27  ? 13.893  -0.036  -1.200  1.00 0.00 ? 27  GLU A CB   1  
ATOM 406   C CG   . GLU A 1 27  ? 13.800  0.519   0.212   1.00 0.00 ? 27  GLU A CG   1  
ATOM 407   C CD   . GLU A 1 27  ? 15.076  0.311   1.005   1.00 0.00 ? 27  GLU A CD   1  
ATOM 408   O OE1  . GLU A 1 27  ? 16.058  1.039   0.751   1.00 0.00 ? 27  GLU A OE1  1  
ATOM 409   O OE2  . GLU A 1 27  ? 15.092  -0.581  1.881   1.00 0.00 ? 27  GLU A OE2  1  
ATOM 410   H H    . GLU A 1 27  ? 11.610  -1.147  -1.285  1.00 0.00 ? 27  GLU A H    1  
ATOM 411   H HA   . GLU A 1 27  ? 12.451  1.419   -1.820  1.00 0.00 ? 27  GLU A HA   1  
ATOM 412   H HB2  . GLU A 1 27  ? 13.876  -1.114  -1.141  1.00 0.00 ? 27  GLU A HB2  1  
ATOM 413   H HB3  . GLU A 1 27  ? 14.834  0.277   -1.626  1.00 0.00 ? 27  GLU A HB3  1  
ATOM 414   H HG2  . GLU A 1 27  ? 13.600  1.578   0.156   1.00 0.00 ? 27  GLU A HG2  1  
ATOM 415   H HG3  . GLU A 1 27  ? 12.989  0.027   0.728   1.00 0.00 ? 27  GLU A HG3  1  
ATOM 416   N N    . GLY A 1 28  ? 13.306  -0.697  -4.195  1.00 0.00 ? 28  GLY A N    1  
ATOM 417   C CA   . GLY A 1 28  ? 13.755  -0.770  -5.573  1.00 0.00 ? 28  GLY A CA   1  
ATOM 418   C C    . GLY A 1 28  ? 12.759  -0.160  -6.539  1.00 0.00 ? 28  GLY A C    1  
ATOM 419   O O    . GLY A 1 28  ? 13.143  0.399   -7.568  1.00 0.00 ? 28  GLY A O    1  
ATOM 420   H H    . GLY A 1 28  ? 13.046  -1.515  -3.722  1.00 0.00 ? 28  GLY A H    1  
ATOM 421   H HA2  . GLY A 1 28  ? 14.695  -0.246  -5.662  1.00 0.00 ? 28  GLY A HA2  1  
ATOM 422   H HA3  . GLY A 1 28  ? 13.905  -1.806  -5.836  1.00 0.00 ? 28  GLY A HA3  1  
ATOM 423   N N    . LEU A 1 29  ? 11.476  -0.266  -6.210  1.00 0.00 ? 29  LEU A N    1  
ATOM 424   C CA   . LEU A 1 29  ? 10.421  0.278   -7.059  1.00 0.00 ? 29  LEU A CA   1  
ATOM 425   C C    . LEU A 1 29  ? 10.516  1.799   -7.136  1.00 0.00 ? 29  LEU A C    1  
ATOM 426   O O    . LEU A 1 29  ? 10.691  2.367   -8.215  1.00 0.00 ? 29  LEU A O    1  
ATOM 427   C CB   . LEU A 1 29  ? 9.048   -0.132  -6.525  1.00 0.00 ? 29  LEU A CB   1  
ATOM 428   C CG   . LEU A 1 29  ? 8.482   -1.445  -7.068  1.00 0.00 ? 29  LEU A CG   1  
ATOM 429   C CD1  . LEU A 1 29  ? 7.506   -2.057  -6.075  1.00 0.00 ? 29  LEU A CD1  1  
ATOM 430   C CD2  . LEU A 1 29  ? 7.807   -1.220  -8.413  1.00 0.00 ? 29  LEU A CD2  1  
ATOM 431   H H    . LEU A 1 29  ? 11.232  -0.721  -5.379  1.00 0.00 ? 29  LEU A H    1  
ATOM 432   H HA   . LEU A 1 29  ? 10.550  -0.129  -8.051  1.00 0.00 ? 29  LEU A HA   1  
ATOM 433   H HB2  . LEU A 1 29  ? 9.124   -0.224  -5.452  1.00 0.00 ? 29  LEU A HB2  1  
ATOM 434   H HB3  . LEU A 1 29  ? 8.350   0.655   -6.769  1.00 0.00 ? 29  LEU A HB3  1  
ATOM 435   H HG   . LEU A 1 29  ? 9.293   -2.147  -7.212  1.00 0.00 ? 29  LEU A HG   1  
ATOM 436   H HD11 . LEU A 1 29  ? 7.726   -1.693  -5.083  1.00 0.00 ? 29  LEU A HD11 1  
ATOM 437   H HD12 . LEU A 1 29  ? 7.600   -3.133  -6.093  1.00 0.00 ? 29  LEU A HD12 1  
ATOM 438   H HD13 . LEU A 1 29  ? 6.498   -1.780  -6.345  1.00 0.00 ? 29  LEU A HD13 1  
ATOM 439   H HD21 . LEU A 1 29  ? 7.835   -0.169  -8.657  1.00 0.00 ? 29  LEU A HD21 1  
ATOM 440   H HD22 . LEU A 1 29  ? 6.780   -1.551  -8.360  1.00 0.00 ? 29  LEU A HD22 1  
ATOM 441   H HD23 . LEU A 1 29  ? 8.328   -1.781  -9.175  1.00 0.00 ? 29  LEU A HD23 1  
ATOM 442   N N    . THR A 1 30  ? 10.399  2.453   -5.984  1.00 0.00 ? 30  THR A N    1  
ATOM 443   C CA   . THR A 1 30  ? 10.472  3.907   -5.922  1.00 0.00 ? 30  THR A CA   1  
ATOM 444   C C    . THR A 1 30  ? 11.919  4.385   -5.885  1.00 0.00 ? 30  THR A C    1  
ATOM 445   O O    . THR A 1 30  ? 12.237  5.472   -6.365  1.00 0.00 ? 30  THR A O    1  
ATOM 446   C CB   . THR A 1 30  ? 9.731   4.453   -4.686  1.00 0.00 ? 30  THR A CB   1  
ATOM 447   O OG1  . THR A 1 30  ? 10.489  4.184   -3.502  1.00 0.00 ? 30  THR A OG1  1  
ATOM 448   C CG2  . THR A 1 30  ? 8.349   3.829   -4.564  1.00 0.00 ? 30  THR A CG2  1  
ATOM 449   H H    . THR A 1 30  ? 10.260  1.944   -5.159  1.00 0.00 ? 30  THR A H    1  
ATOM 450   H HA   . THR A 1 30  ? 9.995   4.304   -6.806  1.00 0.00 ? 30  THR A HA   1  
ATOM 451   H HB   . THR A 1 30  ? 9.618   5.523   -4.797  1.00 0.00 ? 30  THR A HB   1  
ATOM 452   H HG1  . THR A 1 30  ? 10.386  3.260   -3.260  1.00 0.00 ? 30  THR A HG1  1  
ATOM 453   H HG21 . THR A 1 30  ? 8.420   2.903   -4.013  1.00 0.00 ? 30  THR A HG21 1  
ATOM 454   H HG22 . THR A 1 30  ? 7.954   3.633   -5.549  1.00 0.00 ? 30  THR A HG22 1  
ATOM 455   H HG23 . THR A 1 30  ? 7.693   4.509   -4.042  1.00 0.00 ? 30  THR A HG23 1  
ATOM 456   N N    . GLY A 1 31  ? 12.793  3.563   -5.311  1.00 0.00 ? 31  GLY A N    1  
ATOM 457   C CA   . GLY A 1 31  ? 14.197  3.919   -5.222  1.00 0.00 ? 31  GLY A CA   1  
ATOM 458   C C    . GLY A 1 31  ? 14.505  4.767   -4.003  1.00 0.00 ? 31  GLY A C    1  
ATOM 459   O O    . GLY A 1 31  ? 15.577  5.367   -3.910  1.00 0.00 ? 31  GLY A O    1  
ATOM 460   H H    . GLY A 1 31  ? 12.483  2.709   -4.945  1.00 0.00 ? 31  GLY A H    1  
ATOM 461   H HA2  . GLY A 1 31  ? 14.785  3.015   -5.176  1.00 0.00 ? 31  GLY A HA2  1  
ATOM 462   H HA3  . GLY A 1 31  ? 14.473  4.471   -6.109  1.00 0.00 ? 31  GLY A HA3  1  
ATOM 463   N N    . LEU A 1 32  ? 13.563  4.820   -3.069  1.00 0.00 ? 32  LEU A N    1  
ATOM 464   C CA   . LEU A 1 32  ? 13.737  5.602   -1.850  1.00 0.00 ? 32  LEU A CA   1  
ATOM 465   C C    . LEU A 1 32  ? 14.235  4.725   -0.706  1.00 0.00 ? 32  LEU A C    1  
ATOM 466   O O    . LEU A 1 32  ? 14.474  3.530   -0.886  1.00 0.00 ? 32  LEU A O    1  
ATOM 467   C CB   . LEU A 1 32  ? 12.420  6.273   -1.459  1.00 0.00 ? 32  LEU A CB   1  
ATOM 468   C CG   . LEU A 1 32  ? 11.827  7.241   -2.484  1.00 0.00 ? 32  LEU A CG   1  
ATOM 469   C CD1  . LEU A 1 32  ? 10.362  7.511   -2.179  1.00 0.00 ? 32  LEU A CD1  1  
ATOM 470   C CD2  . LEU A 1 32  ? 12.618  8.541   -2.509  1.00 0.00 ? 32  LEU A CD2  1  
ATOM 471   H H    . LEU A 1 32  ? 12.729  4.322   -3.200  1.00 0.00 ? 32  LEU A H    1  
ATOM 472   H HA   . LEU A 1 32  ? 14.475  6.366   -2.049  1.00 0.00 ? 32  LEU A HA   1  
ATOM 473   H HB2  . LEU A 1 32  ? 11.693  5.496   -1.280  1.00 0.00 ? 32  LEU A HB2  1  
ATOM 474   H HB3  . LEU A 1 32  ? 12.589  6.823   -0.543  1.00 0.00 ? 32  LEU A HB3  1  
ATOM 475   H HG   . LEU A 1 32  ? 11.886  6.793   -3.467  1.00 0.00 ? 32  LEU A HG   1  
ATOM 476   H HD11 . LEU A 1 32  ? 10.162  8.567   -2.278  1.00 0.00 ? 32  LEU A HD11 1  
ATOM 477   H HD12 . LEU A 1 32  ? 10.141  7.195   -1.170  1.00 0.00 ? 32  LEU A HD12 1  
ATOM 478   H HD13 . LEU A 1 32  ? 9.743   6.960   -2.872  1.00 0.00 ? 32  LEU A HD13 1  
ATOM 479   H HD21 . LEU A 1 32  ? 12.661  8.954   -1.512  1.00 0.00 ? 32  LEU A HD21 1  
ATOM 480   H HD22 . LEU A 1 32  ? 12.132  9.245   -3.169  1.00 0.00 ? 32  LEU A HD22 1  
ATOM 481   H HD23 . LEU A 1 32  ? 13.619  8.346   -2.862  1.00 0.00 ? 32  LEU A HD23 1  
ATOM 482   N N    . SER A 1 33  ? 14.385  5.324   0.471   1.00 0.00 ? 33  SER A N    1  
ATOM 483   C CA   . SER A 1 33  ? 14.855  4.597   1.644   1.00 0.00 ? 33  SER A CA   1  
ATOM 484   C C    . SER A 1 33  ? 13.836  4.677   2.776   1.00 0.00 ? 33  SER A C    1  
ATOM 485   O O    . SER A 1 33  ? 13.391  5.762   3.150   1.00 0.00 ? 33  SER A O    1  
ATOM 486   C CB   . SER A 1 33  ? 16.200  5.158   2.113   1.00 0.00 ? 33  SER A CB   1  
ATOM 487   O OG   . SER A 1 33  ? 17.124  5.229   1.041   1.00 0.00 ? 33  SER A OG   1  
ATOM 488   H H    . SER A 1 33  ? 14.178  6.279   0.550   1.00 0.00 ? 33  SER A H    1  
ATOM 489   H HA   . SER A 1 33  ? 14.985  3.563   1.364   1.00 0.00 ? 33  SER A HA   1  
ATOM 490   H HB2  . SER A 1 33  ? 16.054  6.150   2.512   1.00 0.00 ? 33  SER A HB2  1  
ATOM 491   H HB3  . SER A 1 33  ? 16.606  4.517   2.881   1.00 0.00 ? 33  SER A HB3  1  
ATOM 492   H HG   . SER A 1 33  ? 18.018  5.263   1.390   1.00 0.00 ? 33  SER A HG   1  
ATOM 493   N N    . ILE A 1 34  ? 13.472  3.519   3.317   1.00 0.00 ? 34  ILE A N    1  
ATOM 494   C CA   . ILE A 1 34  ? 12.506  3.457   4.408   1.00 0.00 ? 34  ILE A CA   1  
ATOM 495   C C    . ILE A 1 34  ? 13.159  3.807   5.741   1.00 0.00 ? 34  ILE A C    1  
ATOM 496   O O    . ILE A 1 34  ? 12.683  4.678   6.468   1.00 0.00 ? 34  ILE A O    1  
ATOM 497   C CB   . ILE A 1 34  ? 11.866  2.061   4.513   1.00 0.00 ? 34  ILE A CB   1  
ATOM 498   C CG1  . ILE A 1 34  ? 11.124  1.717   3.220   1.00 0.00 ? 34  ILE A CG1  1  
ATOM 499   C CG2  . ILE A 1 34  ? 10.921  2.000   5.705   1.00 0.00 ? 34  ILE A CG2  1  
ATOM 500   C CD1  . ILE A 1 34  ? 11.046  0.232   2.945   1.00 0.00 ? 34  ILE A CD1  1  
ATOM 501   H H    . ILE A 1 34  ? 13.862  2.688   2.977   1.00 0.00 ? 34  ILE A H    1  
ATOM 502   H HA   . ILE A 1 34  ? 11.725  4.175   4.203   1.00 0.00 ? 34  ILE A HA   1  
ATOM 503   H HB   . ILE A 1 34  ? 12.652  1.339   4.671   1.00 0.00 ? 34  ILE A HB   1  
ATOM 504   H HG12 . ILE A 1 34  ? 10.116  2.096   3.279   1.00 0.00 ? 34  ILE A HG12 1  
ATOM 505   H HG13 . ILE A 1 34  ? 11.631  2.183   2.389   1.00 0.00 ? 34  ILE A HG13 1  
ATOM 506   H HG21 . ILE A 1 34  ? 10.298  1.122   5.625   1.00 0.00 ? 34  ILE A HG21 1  
ATOM 507   H HG22 . ILE A 1 34  ? 11.496  1.951   6.617   1.00 0.00 ? 34  ILE A HG22 1  
ATOM 508   H HG23 . ILE A 1 34  ? 10.299  2.882   5.717   1.00 0.00 ? 34  ILE A HG23 1  
ATOM 509   H HD11 . ILE A 1 34  ? 10.029  -0.107  3.080   1.00 0.00 ? 34  ILE A HD11 1  
ATOM 510   H HD12 . ILE A 1 34  ? 11.360  0.036   1.931   1.00 0.00 ? 34  ILE A HD12 1  
ATOM 511   H HD13 . ILE A 1 34  ? 11.694  -0.296  3.630   1.00 0.00 ? 34  ILE A HD13 1  
ATOM 512   N N    . GLY A 1 35  ? 14.255  3.122   6.055   1.00 0.00 ? 35  GLY A N    1  
ATOM 513   C CA   . GLY A 1 35  ? 14.957  3.375   7.300   1.00 0.00 ? 35  GLY A CA   1  
ATOM 514   C C    . GLY A 1 35  ? 15.048  2.141   8.175   1.00 0.00 ? 35  GLY A C    1  
ATOM 515   O O    . GLY A 1 35  ? 14.561  1.067   7.824   1.00 0.00 ? 35  GLY A O    1  
ATOM 516   H H    . GLY A 1 35  ? 14.589  2.439   5.437   1.00 0.00 ? 35  GLY A H    1  
ATOM 517   H HA2  . GLY A 1 35  ? 15.954  3.720   7.074   1.00 0.00 ? 35  GLY A HA2  1  
ATOM 518   H HA3  . GLY A 1 35  ? 14.434  4.150   7.843   1.00 0.00 ? 35  GLY A HA3  1  
ATOM 519   N N    . PRO A 1 36  ? 15.688  2.288   9.345   1.00 0.00 ? 36  PRO A N    1  
ATOM 520   C CA   . PRO A 1 36  ? 15.859  1.185   10.297  1.00 0.00 ? 36  PRO A CA   1  
ATOM 521   C C    . PRO A 1 36  ? 14.545  0.779   10.955  1.00 0.00 ? 36  PRO A C    1  
ATOM 522   O O    . PRO A 1 36  ? 14.325  -0.395  11.250  1.00 0.00 ? 36  PRO A O    1  
ATOM 523   C CB   . PRO A 1 36  ? 16.822  1.762   11.337  1.00 0.00 ? 36  PRO A CB   1  
ATOM 524   C CG   . PRO A 1 36  ? 16.621  3.237   11.265  1.00 0.00 ? 36  PRO A CG   1  
ATOM 525   C CD   . PRO A 1 36  ? 16.294  3.539   9.828   1.00 0.00 ? 36  PRO A CD   1  
ATOM 526   H HA   . PRO A 1 36  ? 16.308  0.322   9.828   1.00 0.00 ? 36  PRO A HA   1  
ATOM 527   H HB2  . PRO A 1 36  ? 16.573  1.376   12.316  1.00 0.00 ? 36  PRO A HB2  1  
ATOM 528   H HB3  . PRO A 1 36  ? 17.837  1.489   11.085  1.00 0.00 ? 36  PRO A HB3  1  
ATOM 529   H HG2  . PRO A 1 36  ? 15.801  3.526   11.905  1.00 0.00 ? 36  PRO A HG2  1  
ATOM 530   H HG3  . PRO A 1 36  ? 17.528  3.745   11.558  1.00 0.00 ? 36  PRO A HG3  1  
ATOM 531   H HD2  . PRO A 1 36  ? 15.592  4.357   9.766   1.00 0.00 ? 36  PRO A HD2  1  
ATOM 532   H HD3  . PRO A 1 36  ? 17.194  3.768   9.278   1.00 0.00 ? 36  PRO A HD3  1  
ATOM 533   N N    . ASP A 1 37  ? 13.675  1.758   11.181  1.00 0.00 ? 37  ASP A N    1  
ATOM 534   C CA   . ASP A 1 37  ? 12.381  1.501   11.803  1.00 0.00 ? 37  ASP A CA   1  
ATOM 535   C C    . ASP A 1 37  ? 11.274  1.457   10.755  1.00 0.00 ? 37  ASP A C    1  
ATOM 536   O O    . ASP A 1 37  ? 10.580  2.448   10.528  1.00 0.00 ? 37  ASP A O    1  
ATOM 537   C CB   . ASP A 1 37  ? 12.071  2.575   12.847  1.00 0.00 ? 37  ASP A CB   1  
ATOM 538   C CG   . ASP A 1 37  ? 13.104  2.622   13.956  1.00 0.00 ? 37  ASP A CG   1  
ATOM 539   O OD1  . ASP A 1 37  ? 13.266  1.601   14.656  1.00 0.00 ? 37  ASP A OD1  1  
ATOM 540   O OD2  . ASP A 1 37  ? 13.748  3.679   14.123  1.00 0.00 ? 37  ASP A OD2  1  
ATOM 541   H H    . ASP A 1 37  ? 13.909  2.674   10.923  1.00 0.00 ? 37  ASP A H    1  
ATOM 542   H HA   . ASP A 1 37  ? 12.433  0.540   12.294  1.00 0.00 ? 37  ASP A HA   1  
ATOM 543   H HB2  . ASP A 1 37  ? 12.046  3.541   12.363  1.00 0.00 ? 37  ASP A HB2  1  
ATOM 544   H HB3  . ASP A 1 37  ? 11.105  2.373   13.286  1.00 0.00 ? 37  ASP A HB3  1  
ATOM 545   N N    . PHE A 1 38  ? 11.115  0.301   10.118  1.00 0.00 ? 38  PHE A N    1  
ATOM 546   C CA   . PHE A 1 38  ? 10.093  0.128   9.092   1.00 0.00 ? 38  PHE A CA   1  
ATOM 547   C C    . PHE A 1 38  ? 8.846   0.942   9.424   1.00 0.00 ? 38  PHE A C    1  
ATOM 548   O O    . PHE A 1 38  ? 8.471   1.851   8.684   1.00 0.00 ? 38  PHE A O    1  
ATOM 549   C CB   . PHE A 1 38  ? 9.727   -1.351  8.951   1.00 0.00 ? 38  PHE A CB   1  
ATOM 550   C CG   . PHE A 1 38  ? 8.906   -1.652  7.730   1.00 0.00 ? 38  PHE A CG   1  
ATOM 551   C CD1  . PHE A 1 38  ? 9.387   -1.355  6.465   1.00 0.00 ? 38  PHE A CD1  1  
ATOM 552   C CD2  . PHE A 1 38  ? 7.653   -2.232  7.848   1.00 0.00 ? 38  PHE A CD2  1  
ATOM 553   C CE1  . PHE A 1 38  ? 8.633   -1.630  5.341   1.00 0.00 ? 38  PHE A CE1  1  
ATOM 554   C CE2  . PHE A 1 38  ? 6.894   -2.510  6.726   1.00 0.00 ? 38  PHE A CE2  1  
ATOM 555   C CZ   . PHE A 1 38  ? 7.386   -2.209  5.471   1.00 0.00 ? 38  PHE A CZ   1  
ATOM 556   H H    . PHE A 1 38  ? 11.699  -0.453  10.344  1.00 0.00 ? 38  PHE A H    1  
ATOM 557   H HA   . PHE A 1 38  ? 10.500  0.480   8.158   1.00 0.00 ? 38  PHE A HA   1  
ATOM 558   H HB2  . PHE A 1 38  ? 10.633  -1.935  8.893   1.00 0.00 ? 38  PHE A HB2  1  
ATOM 559   H HB3  . PHE A 1 38  ? 9.161   -1.659  9.818   1.00 0.00 ? 38  PHE A HB3  1  
ATOM 560   H HD1  . PHE A 1 38  ? 10.362  -0.903  6.362   1.00 0.00 ? 38  PHE A HD1  1  
ATOM 561   H HD2  . PHE A 1 38  ? 7.268   -2.469  8.830   1.00 0.00 ? 38  PHE A HD2  1  
ATOM 562   H HE1  . PHE A 1 38  ? 9.019   -1.394  4.360   1.00 0.00 ? 38  PHE A HE1  1  
ATOM 563   H HE2  . PHE A 1 38  ? 5.920   -2.962  6.831   1.00 0.00 ? 38  PHE A HE2  1  
ATOM 564   H HZ   . PHE A 1 38  ? 6.794   -2.424  4.593   1.00 0.00 ? 38  PHE A HZ   1  
ATOM 565   N N    . GLN A 1 39  ? 8.209   0.609   10.542  1.00 0.00 ? 39  GLN A N    1  
ATOM 566   C CA   . GLN A 1 39  ? 7.003   1.308   10.970  1.00 0.00 ? 39  GLN A CA   1  
ATOM 567   C C    . GLN A 1 39  ? 7.162   2.816   10.810  1.00 0.00 ? 39  GLN A C    1  
ATOM 568   O O    . GLN A 1 39  ? 6.265   3.497   10.312  1.00 0.00 ? 39  GLN A O    1  
ATOM 569   C CB   . GLN A 1 39  ? 6.682   0.969   12.428  1.00 0.00 ? 39  GLN A CB   1  
ATOM 570   C CG   . GLN A 1 39  ? 5.334   1.497   12.892  1.00 0.00 ? 39  GLN A CG   1  
ATOM 571   C CD   . GLN A 1 39  ? 5.423   2.894   13.472  1.00 0.00 ? 39  GLN A CD   1  
ATOM 572   O OE1  . GLN A 1 39  ? 5.873   3.083   14.602  1.00 0.00 ? 39  GLN A OE1  1  
ATOM 573   N NE2  . GLN A 1 39  ? 4.992   3.885   12.698  1.00 0.00 ? 39  GLN A NE2  1  
ATOM 574   H H    . GLN A 1 39  ? 8.556   -0.124  11.089  1.00 0.00 ? 39  GLN A H    1  
ATOM 575   H HA   . GLN A 1 39  ? 6.188   0.977   10.345  1.00 0.00 ? 39  GLN A HA   1  
ATOM 576   H HB2  . GLN A 1 39  ? 6.684   -0.104  12.544  1.00 0.00 ? 39  GLN A HB2  1  
ATOM 577   H HB3  . GLN A 1 39  ? 7.448   1.394   13.060  1.00 0.00 ? 39  GLN A HB3  1  
ATOM 578   H HG2  . GLN A 1 39  ? 4.659   1.516   12.049  1.00 0.00 ? 39  GLN A HG2  1  
ATOM 579   H HG3  . GLN A 1 39  ? 4.945   0.832   13.649  1.00 0.00 ? 39  GLN A HG3  1  
ATOM 580   H HE21 . GLN A 1 39  ? 4.646   3.659   11.810  1.00 0.00 ? 39  GLN A HE21 1  
ATOM 581   H HE22 . GLN A 1 39  ? 5.037   4.798   13.048  1.00 0.00 ? 39  GLN A HE22 1  
ATOM 582   N N    . LYS A 1 40  ? 8.310   3.334   11.235  1.00 0.00 ? 40  LYS A N    1  
ATOM 583   C CA   . LYS A 1 40  ? 8.589   4.761   11.139  1.00 0.00 ? 40  LYS A CA   1  
ATOM 584   C C    . LYS A 1 40  ? 8.708   5.195   9.681   1.00 0.00 ? 40  LYS A C    1  
ATOM 585   O O    . LYS A 1 40  ? 7.841   5.895   9.159   1.00 0.00 ? 40  LYS A O    1  
ATOM 586   C CB   . LYS A 1 40  ? 9.878   5.102   11.890  1.00 0.00 ? 40  LYS A CB   1  
ATOM 587   C CG   . LYS A 1 40  ? 9.889   4.618   13.330  1.00 0.00 ? 40  LYS A CG   1  
ATOM 588   C CD   . LYS A 1 40  ? 9.087   5.538   14.234  1.00 0.00 ? 40  LYS A CD   1  
ATOM 589   C CE   . LYS A 1 40  ? 9.132   5.075   15.682  1.00 0.00 ? 40  LYS A CE   1  
ATOM 590   N NZ   . LYS A 1 40  ? 8.320   3.845   15.896  1.00 0.00 ? 40  LYS A NZ   1  
ATOM 591   H H    . LYS A 1 40  ? 8.987   2.739   11.623  1.00 0.00 ? 40  LYS A H    1  
ATOM 592   H HA   . LYS A 1 40  ? 7.766   5.292   11.594  1.00 0.00 ? 40  LYS A HA   1  
ATOM 593   H HB2  . LYS A 1 40  ? 10.712  4.650   11.374  1.00 0.00 ? 40  LYS A HB2  1  
ATOM 594   H HB3  . LYS A 1 40  ? 10.006  6.175   11.893  1.00 0.00 ? 40  LYS A HB3  1  
ATOM 595   H HG2  . LYS A 1 40  ? 9.460   3.627   13.369  1.00 0.00 ? 40  LYS A HG2  1  
ATOM 596   H HG3  . LYS A 1 40  ? 10.911  4.585   13.680  1.00 0.00 ? 40  LYS A HG3  1  
ATOM 597   H HD2  . LYS A 1 40  ? 9.496   6.535   14.174  1.00 0.00 ? 40  LYS A HD2  1  
ATOM 598   H HD3  . LYS A 1 40  ? 8.058   5.549   13.900  1.00 0.00 ? 40  LYS A HD3  1  
ATOM 599   H HE2  . LYS A 1 40  ? 10.157  4.870   15.948  1.00 0.00 ? 40  LYS A HE2  1  
ATOM 600   H HE3  . LYS A 1 40  ? 8.747   5.864   16.310  1.00 0.00 ? 40  LYS A HE3  1  
ATOM 601   H HZ1  . LYS A 1 40  ? 7.427   3.910   15.367  1.00 0.00 ? 40  LYS A HZ1  1  
ATOM 602   H HZ2  . LYS A 1 40  ? 8.102   3.733   16.907  1.00 0.00 ? 40  LYS A HZ2  1  
ATOM 603   H HZ3  . LYS A 1 40  ? 8.844   3.009   15.570  1.00 0.00 ? 40  LYS A HZ3  1  
ATOM 604   N N    . GLY A 1 41  ? 9.787   4.774   9.028   1.00 0.00 ? 41  GLY A N    1  
ATOM 605   C CA   . GLY A 1 41  ? 9.998   5.127   7.638   1.00 0.00 ? 41  GLY A CA   1  
ATOM 606   C C    . GLY A 1 41  ? 8.700   5.223   6.860   1.00 0.00 ? 41  GLY A C    1  
ATOM 607   O O    . GLY A 1 41  ? 8.544   6.094   6.002   1.00 0.00 ? 41  GLY A O    1  
ATOM 608   H H    . GLY A 1 41  ? 10.446  4.217   9.496   1.00 0.00 ? 41  GLY A H    1  
ATOM 609   H HA2  . GLY A 1 41  ? 10.505  6.080   7.592   1.00 0.00 ? 41  GLY A HA2  1  
ATOM 610   H HA3  . GLY A 1 41  ? 10.625  4.376   7.178   1.00 0.00 ? 41  GLY A HA3  1  
ATOM 611   N N    . LEU A 1 42  ? 7.766   4.326   7.158   1.00 0.00 ? 42  LEU A N    1  
ATOM 612   C CA   . LEU A 1 42  ? 6.475   4.313   6.480   1.00 0.00 ? 42  LEU A CA   1  
ATOM 613   C C    . LEU A 1 42  ? 5.467   5.192   7.211   1.00 0.00 ? 42  LEU A C    1  
ATOM 614   O O    . LEU A 1 42  ? 4.615   5.829   6.589   1.00 0.00 ? 42  LEU A O    1  
ATOM 615   C CB   . LEU A 1 42  ? 5.944   2.882   6.382   1.00 0.00 ? 42  LEU A CB   1  
ATOM 616   C CG   . LEU A 1 42  ? 6.920   1.839   5.836   1.00 0.00 ? 42  LEU A CG   1  
ATOM 617   C CD1  . LEU A 1 42  ? 6.325   0.443   5.944   1.00 0.00 ? 42  LEU A CD1  1  
ATOM 618   C CD2  . LEU A 1 42  ? 7.286   2.155   4.393   1.00 0.00 ? 42  LEU A CD2  1  
ATOM 619   H H    . LEU A 1 42  ? 7.949   3.658   7.851   1.00 0.00 ? 42  LEU A H    1  
ATOM 620   H HA   . LEU A 1 42  ? 6.619   4.703   5.483   1.00 0.00 ? 42  LEU A HA   1  
ATOM 621   H HB2  . LEU A 1 42  ? 5.647   2.570   7.372   1.00 0.00 ? 42  LEU A HB2  1  
ATOM 622   H HB3  . LEU A 1 42  ? 5.077   2.894   5.737   1.00 0.00 ? 42  LEU A HB3  1  
ATOM 623   H HG   . LEU A 1 42  ? 7.827   1.862   6.425   1.00 0.00 ? 42  LEU A HG   1  
ATOM 624   H HD11 . LEU A 1 42  ? 6.955   -0.167  6.573   1.00 0.00 ? 42  LEU A HD11 1  
ATOM 625   H HD12 . LEU A 1 42  ? 6.263   0.002   4.960   1.00 0.00 ? 42  LEU A HD12 1  
ATOM 626   H HD13 . LEU A 1 42  ? 5.336   0.506   6.374   1.00 0.00 ? 42  LEU A HD13 1  
ATOM 627   H HD21 . LEU A 1 42  ? 7.798   1.309   3.958   1.00 0.00 ? 42  LEU A HD21 1  
ATOM 628   H HD22 . LEU A 1 42  ? 7.934   3.019   4.367   1.00 0.00 ? 42  LEU A HD22 1  
ATOM 629   H HD23 . LEU A 1 42  ? 6.387   2.360   3.831   1.00 0.00 ? 42  LEU A HD23 1  
ATOM 630   N N    . LYS A 1 43  ? 5.569   5.227   8.535   1.00 0.00 ? 43  LYS A N    1  
ATOM 631   C CA   . LYS A 1 43  ? 4.669   6.031   9.352   1.00 0.00 ? 43  LYS A CA   1  
ATOM 632   C C    . LYS A 1 43  ? 4.282   7.318   8.631   1.00 0.00 ? 43  LYS A C    1  
ATOM 633   O O    . LYS A 1 43  ? 3.136   7.488   8.214   1.00 0.00 ? 43  LYS A O    1  
ATOM 634   C CB   . LYS A 1 43  ? 5.325   6.364   10.694  1.00 0.00 ? 43  LYS A CB   1  
ATOM 635   C CG   . LYS A 1 43  ? 4.394   7.064   11.669  1.00 0.00 ? 43  LYS A CG   1  
ATOM 636   C CD   . LYS A 1 43  ? 5.170   7.840   12.721  1.00 0.00 ? 43  LYS A CD   1  
ATOM 637   C CE   . LYS A 1 43  ? 4.287   8.859   13.425  1.00 0.00 ? 43  LYS A CE   1  
ATOM 638   N NZ   . LYS A 1 43  ? 5.036   9.619   14.463  1.00 0.00 ? 43  LYS A NZ   1  
ATOM 639   H H    . LYS A 1 43  ? 6.268   4.697   8.974   1.00 0.00 ? 43  LYS A H    1  
ATOM 640   H HA   . LYS A 1 43  ? 3.776   5.452   9.532   1.00 0.00 ? 43  LYS A HA   1  
ATOM 641   H HB2  . LYS A 1 43  ? 5.668   5.447   11.150  1.00 0.00 ? 43  LYS A HB2  1  
ATOM 642   H HB3  . LYS A 1 43  ? 6.175   7.008   10.516  1.00 0.00 ? 43  LYS A HB3  1  
ATOM 643   H HG2  . LYS A 1 43  ? 3.764   7.749   11.124  1.00 0.00 ? 43  LYS A HG2  1  
ATOM 644   H HG3  . LYS A 1 43  ? 3.781   6.323   12.162  1.00 0.00 ? 43  LYS A HG3  1  
ATOM 645   H HD2  . LYS A 1 43  ? 5.556   7.149   13.455  1.00 0.00 ? 43  LYS A HD2  1  
ATOM 646   H HD3  . LYS A 1 43  ? 5.990   8.356   12.242  1.00 0.00 ? 43  LYS A HD3  1  
ATOM 647   H HE2  . LYS A 1 43  ? 3.903   9.552   12.691  1.00 0.00 ? 43  LYS A HE2  1  
ATOM 648   H HE3  . LYS A 1 43  ? 3.465   8.340   13.894  1.00 0.00 ? 43  LYS A HE3  1  
ATOM 649   H HZ1  . LYS A 1 43  ? 5.684   10.296  14.012  1.00 0.00 ? 43  LYS A HZ1  1  
ATOM 650   H HZ2  . LYS A 1 43  ? 5.591   8.967   15.053  1.00 0.00 ? 43  LYS A HZ2  1  
ATOM 651   H HZ3  . LYS A 1 43  ? 4.375   10.142  15.071  1.00 0.00 ? 43  LYS A HZ3  1  
ATOM 652   N N    . ASP A 1 44  ? 5.245   8.221   8.485   1.00 0.00 ? 44  ASP A N    1  
ATOM 653   C CA   . ASP A 1 44  ? 5.006   9.492   7.810   1.00 0.00 ? 44  ASP A CA   1  
ATOM 654   C C    . ASP A 1 44  ? 4.206   9.284   6.529   1.00 0.00 ? 44  ASP A C    1  
ATOM 655   O O    . ASP A 1 44  ? 3.379   10.118  6.159   1.00 0.00 ? 44  ASP A O    1  
ATOM 656   C CB   . ASP A 1 44  ? 6.333   10.182  7.491   1.00 0.00 ? 44  ASP A CB   1  
ATOM 657   C CG   . ASP A 1 44  ? 7.384   9.211   6.987   1.00 0.00 ? 44  ASP A CG   1  
ATOM 658   O OD1  . ASP A 1 44  ? 7.172   8.613   5.912   1.00 0.00 ? 44  ASP A OD1  1  
ATOM 659   O OD2  . ASP A 1 44  ? 8.418   9.052   7.668   1.00 0.00 ? 44  ASP A OD2  1  
ATOM 660   H H    . ASP A 1 44  ? 6.139   8.029   8.838   1.00 0.00 ? 44  ASP A H    1  
ATOM 661   H HA   . ASP A 1 44  ? 4.436   10.119  8.478   1.00 0.00 ? 44  ASP A HA   1  
ATOM 662   H HB2  . ASP A 1 44  ? 6.168   10.931  6.730   1.00 0.00 ? 44  ASP A HB2  1  
ATOM 663   H HB3  . ASP A 1 44  ? 6.708   10.658  8.385   1.00 0.00 ? 44  ASP A HB3  1  
ATOM 664   N N    . GLY A 1 45  ? 4.457   8.167   5.853   1.00 0.00 ? 45  GLY A N    1  
ATOM 665   C CA   . GLY A 1 45  ? 3.752   7.871   4.620   1.00 0.00 ? 45  GLY A CA   1  
ATOM 666   C C    . GLY A 1 45  ? 4.359   8.574   3.422   1.00 0.00 ? 45  GLY A C    1  
ATOM 667   O O    . GLY A 1 45  ? 3.643   9.137   2.594   1.00 0.00 ? 45  GLY A O    1  
ATOM 668   H H    . GLY A 1 45  ? 5.126   7.538   6.196   1.00 0.00 ? 45  GLY A H    1  
ATOM 669   H HA2  . GLY A 1 45  ? 3.779   6.805   4.450   1.00 0.00 ? 45  GLY A HA2  1  
ATOM 670   H HA3  . GLY A 1 45  ? 2.723   8.183   4.723   1.00 0.00 ? 45  GLY A HA3  1  
ATOM 671   N N    . THR A 1 46  ? 5.686   8.544   3.330   1.00 0.00 ? 46  THR A N    1  
ATOM 672   C CA   . THR A 1 46  ? 6.389   9.186   2.227   1.00 0.00 ? 46  THR A CA   1  
ATOM 673   C C    . THR A 1 46  ? 6.567   8.227   1.056   1.00 0.00 ? 46  THR A C    1  
ATOM 674   O O    . THR A 1 46  ? 6.195   8.539   -0.077  1.00 0.00 ? 46  THR A O    1  
ATOM 675   C CB   . THR A 1 46  ? 7.772   9.701   2.667   1.00 0.00 ? 46  THR A CB   1  
ATOM 676   O OG1  . THR A 1 46  ? 8.461   8.686   3.406   1.00 0.00 ? 46  THR A OG1  1  
ATOM 677   C CG2  . THR A 1 46  ? 7.637   10.953  3.521   1.00 0.00 ? 46  THR A CG2  1  
ATOM 678   H H    . THR A 1 46  ? 6.201   8.079   4.022   1.00 0.00 ? 46  THR A H    1  
ATOM 679   H HA   . THR A 1 46  ? 5.800   10.031  1.902   1.00 0.00 ? 46  THR A HA   1  
ATOM 680   H HB   . THR A 1 46  ? 8.346   9.946   1.784   1.00 0.00 ? 46  THR A HB   1  
ATOM 681   H HG1  . THR A 1 46  ? 9.402   8.878   3.413   1.00 0.00 ? 46  THR A HG1  1  
ATOM 682   H HG21 . THR A 1 46  ? 7.072   10.722  4.411   1.00 0.00 ? 46  THR A HG21 1  
ATOM 683   H HG22 . THR A 1 46  ? 7.124   11.719  2.958   1.00 0.00 ? 46  THR A HG22 1  
ATOM 684   H HG23 . THR A 1 46  ? 8.618   11.307  3.798   1.00 0.00 ? 46  THR A HG23 1  
ATOM 685   N N    . ILE A 1 47  ? 7.134   7.058   1.335   1.00 0.00 ? 47  ILE A N    1  
ATOM 686   C CA   . ILE A 1 47  ? 7.358   6.052   0.303   1.00 0.00 ? 47  ILE A CA   1  
ATOM 687   C C    . ILE A 1 47  ? 6.060   5.341   -0.062  1.00 0.00 ? 47  ILE A C    1  
ATOM 688   O O    . ILE A 1 47  ? 5.681   5.279   -1.233  1.00 0.00 ? 47  ILE A O    1  
ATOM 689   C CB   . ILE A 1 47  ? 8.395   5.006   0.753   1.00 0.00 ? 47  ILE A CB   1  
ATOM 690   C CG1  . ILE A 1 47  ? 9.725   5.685   1.088   1.00 0.00 ? 47  ILE A CG1  1  
ATOM 691   C CG2  . ILE A 1 47  ? 8.589   3.954   -0.328  1.00 0.00 ? 47  ILE A CG2  1  
ATOM 692   C CD1  . ILE A 1 47  ? 10.519  4.965   2.156   1.00 0.00 ? 47  ILE A CD1  1  
ATOM 693   H H    . ILE A 1 47  ? 7.408   6.868   2.256   1.00 0.00 ? 47  ILE A H    1  
ATOM 694   H HA   . ILE A 1 47  ? 7.741   6.555   -0.574  1.00 0.00 ? 47  ILE A HA   1  
ATOM 695   H HB   . ILE A 1 47  ? 8.018   4.515   1.637   1.00 0.00 ? 47  ILE A HB   1  
ATOM 696   H HG12 . ILE A 1 47  ? 10.332  5.732   0.198   1.00 0.00 ? 47  ILE A HG12 1  
ATOM 697   H HG13 . ILE A 1 47  ? 9.530   6.688   1.439   1.00 0.00 ? 47  ILE A HG13 1  
ATOM 698   H HG21 . ILE A 1 47  ? 8.075   4.262   -1.227  1.00 0.00 ? 47  ILE A HG21 1  
ATOM 699   H HG22 . ILE A 1 47  ? 9.642   3.843   -0.538  1.00 0.00 ? 47  ILE A HG22 1  
ATOM 700   H HG23 . ILE A 1 47  ? 8.188   3.010   0.010   1.00 0.00 ? 47  ILE A HG23 1  
ATOM 701   H HD11 . ILE A 1 47  ? 9.842   4.528   2.875   1.00 0.00 ? 47  ILE A HD11 1  
ATOM 702   H HD12 . ILE A 1 47  ? 11.113  4.187   1.699   1.00 0.00 ? 47  ILE A HD12 1  
ATOM 703   H HD13 . ILE A 1 47  ? 11.170  5.668   2.655   1.00 0.00 ? 47  ILE A HD13 1  
ATOM 704   N N    . LEU A 1 48  ? 5.381   4.806   0.947   1.00 0.00 ? 48  LEU A N    1  
ATOM 705   C CA   . LEU A 1 48  ? 4.123   4.100   0.732   1.00 0.00 ? 48  LEU A CA   1  
ATOM 706   C C    . LEU A 1 48  ? 3.333   4.728   -0.411  1.00 0.00 ? 48  LEU A C    1  
ATOM 707   O O    . LEU A 1 48  ? 2.676   4.029   -1.183  1.00 0.00 ? 48  LEU A O    1  
ATOM 708   C CB   . LEU A 1 48  ? 3.285   4.111   2.012   1.00 0.00 ? 48  LEU A CB   1  
ATOM 709   C CG   . LEU A 1 48  ? 3.640   3.051   3.056   1.00 0.00 ? 48  LEU A CG   1  
ATOM 710   C CD1  . LEU A 1 48  ? 2.649   3.085   4.210   1.00 0.00 ? 48  LEU A CD1  1  
ATOM 711   C CD2  . LEU A 1 48  ? 3.675   1.669   2.422   1.00 0.00 ? 48  LEU A CD2  1  
ATOM 712   H H    . LEU A 1 48  ? 5.733   4.887   1.857   1.00 0.00 ? 48  LEU A H    1  
ATOM 713   H HA   . LEU A 1 48  ? 4.357   3.078   0.473   1.00 0.00 ? 48  LEU A HA   1  
ATOM 714   H HB2  . LEU A 1 48  ? 3.398   5.080   2.473   1.00 0.00 ? 48  LEU A HB2  1  
ATOM 715   H HB3  . LEU A 1 48  ? 2.251   3.967   1.731   1.00 0.00 ? 48  LEU A HB3  1  
ATOM 716   H HG   . LEU A 1 48  ? 4.622   3.262   3.455   1.00 0.00 ? 48  LEU A HG   1  
ATOM 717   H HD11 . LEU A 1 48  ? 3.185   3.152   5.143   1.00 0.00 ? 48  LEU A HD11 1  
ATOM 718   H HD12 . LEU A 1 48  ? 2.054   2.184   4.199   1.00 0.00 ? 48  LEU A HD12 1  
ATOM 719   H HD13 . LEU A 1 48  ? 2.002   3.944   4.102   1.00 0.00 ? 48  LEU A HD13 1  
ATOM 720   H HD21 . LEU A 1 48  ? 3.184   0.961   3.074   1.00 0.00 ? 48  LEU A HD21 1  
ATOM 721   H HD22 . LEU A 1 48  ? 4.701   1.367   2.272   1.00 0.00 ? 48  LEU A HD22 1  
ATOM 722   H HD23 . LEU A 1 48  ? 3.164   1.696   1.470   1.00 0.00 ? 48  LEU A HD23 1  
ATOM 723   N N    . CYS A 1 49  ? 3.404   6.051   -0.515  1.00 0.00 ? 49  CYS A N    1  
ATOM 724   C CA   . CYS A 1 49  ? 2.697   6.774   -1.567  1.00 0.00 ? 49  CYS A CA   1  
ATOM 725   C C    . CYS A 1 49  ? 3.332   6.513   -2.928  1.00 0.00 ? 49  CYS A C    1  
ATOM 726   O O    . CYS A 1 49  ? 2.693   5.972   -3.831  1.00 0.00 ? 49  CYS A O    1  
ATOM 727   C CB   . CYS A 1 49  ? 2.696   8.275   -1.270  1.00 0.00 ? 49  CYS A CB   1  
ATOM 728   S SG   . CYS A 1 49  ? 1.575   8.763   0.061   1.00 0.00 ? 49  CYS A SG   1  
ATOM 729   H H    . CYS A 1 49  ? 3.944   6.553   0.130   1.00 0.00 ? 49  CYS A H    1  
ATOM 730   H HA   . CYS A 1 49  ? 1.678   6.418   -1.584  1.00 0.00 ? 49  CYS A HA   1  
ATOM 731   H HB2  . CYS A 1 49  ? 3.693   8.578   -0.987  1.00 0.00 ? 49  CYS A HB2  1  
ATOM 732   H HB3  . CYS A 1 49  ? 2.404   8.809   -2.161  1.00 0.00 ? 49  CYS A HB3  1  
ATOM 733   H HG   . CYS A 1 49  ? 1.920   8.095   1.151   1.00 0.00 ? 49  CYS A HG   1  
ATOM 734   N N    . THR A 1 50  ? 4.596   6.900   -3.071  1.00 0.00 ? 50  THR A N    1  
ATOM 735   C CA   . THR A 1 50  ? 5.317   6.711   -4.323  1.00 0.00 ? 50  THR A CA   1  
ATOM 736   C C    . THR A 1 50  ? 5.206   5.271   -4.810  1.00 0.00 ? 50  THR A C    1  
ATOM 737   O O    . THR A 1 50  ? 4.978   5.020   -5.994  1.00 0.00 ? 50  THR A O    1  
ATOM 738   C CB   . THR A 1 50  ? 6.806   7.077   -4.174  1.00 0.00 ? 50  THR A CB   1  
ATOM 739   O OG1  . THR A 1 50  ? 7.345   6.469   -2.995  1.00 0.00 ? 50  THR A OG1  1  
ATOM 740   C CG2  . THR A 1 50  ? 6.988   8.585   -4.103  1.00 0.00 ? 50  THR A CG2  1  
ATOM 741   H H    . THR A 1 50  ? 5.053   7.325   -2.315  1.00 0.00 ? 50  THR A H    1  
ATOM 742   H HA   . THR A 1 50  ? 4.879   7.365   -5.063  1.00 0.00 ? 50  THR A HA   1  
ATOM 743   H HB   . THR A 1 50  ? 7.340   6.706   -5.038  1.00 0.00 ? 50  THR A HB   1  
ATOM 744   H HG1  . THR A 1 50  ? 6.632   6.282   -2.378  1.00 0.00 ? 50  THR A HG1  1  
ATOM 745   H HG21 . THR A 1 50  ? 7.325   8.954   -5.060  1.00 0.00 ? 50  THR A HG21 1  
ATOM 746   H HG22 . THR A 1 50  ? 7.722   8.824   -3.346  1.00 0.00 ? 50  THR A HG22 1  
ATOM 747   H HG23 . THR A 1 50  ? 6.046   9.050   -3.850  1.00 0.00 ? 50  THR A HG23 1  
ATOM 748   N N    . LEU A 1 51  ? 5.366   4.326   -3.889  1.00 0.00 ? 51  LEU A N    1  
ATOM 749   C CA   . LEU A 1 51  ? 5.282   2.909   -4.224  1.00 0.00 ? 51  LEU A CA   1  
ATOM 750   C C    . LEU A 1 51  ? 4.103   2.638   -5.153  1.00 0.00 ? 51  LEU A C    1  
ATOM 751   O O    . LEU A 1 51  ? 4.261   2.028   -6.210  1.00 0.00 ? 51  LEU A O    1  
ATOM 752   C CB   . LEU A 1 51  ? 5.147   2.071   -2.951  1.00 0.00 ? 51  LEU A CB   1  
ATOM 753   C CG   . LEU A 1 51  ? 4.734   0.612   -3.149  1.00 0.00 ? 51  LEU A CG   1  
ATOM 754   C CD1  . LEU A 1 51  ? 5.798   -0.142  -3.931  1.00 0.00 ? 51  LEU A CD1  1  
ATOM 755   C CD2  . LEU A 1 51  ? 4.481   -0.057  -1.806  1.00 0.00 ? 51  LEU A CD2  1  
ATOM 756   H H    . LEU A 1 51  ? 5.545   4.587   -2.961  1.00 0.00 ? 51  LEU A H    1  
ATOM 757   H HA   . LEU A 1 51  ? 6.195   2.634   -4.732  1.00 0.00 ? 51  LEU A HA   1  
ATOM 758   H HB2  . LEU A 1 51  ? 6.101   2.079   -2.448  1.00 0.00 ? 51  LEU A HB2  1  
ATOM 759   H HB3  . LEU A 1 51  ? 4.406   2.544   -2.323  1.00 0.00 ? 51  LEU A HB3  1  
ATOM 760   H HG   . LEU A 1 51  ? 3.815   0.580   -3.719  1.00 0.00 ? 51  LEU A HG   1  
ATOM 761   H HD11 . LEU A 1 51  ? 6.663   0.489   -4.065  1.00 0.00 ? 51  LEU A HD11 1  
ATOM 762   H HD12 . LEU A 1 51  ? 5.403   -0.423  -4.897  1.00 0.00 ? 51  LEU A HD12 1  
ATOM 763   H HD13 . LEU A 1 51  ? 6.081   -1.032  -3.387  1.00 0.00 ? 51  LEU A HD13 1  
ATOM 764   H HD21 . LEU A 1 51  ? 3.931   0.617   -1.166  1.00 0.00 ? 51  LEU A HD21 1  
ATOM 765   H HD22 . LEU A 1 51  ? 5.425   -0.303  -1.343  1.00 0.00 ? 51  LEU A HD22 1  
ATOM 766   H HD23 . LEU A 1 51  ? 3.907   -0.959  -1.957  1.00 0.00 ? 51  LEU A HD23 1  
ATOM 767   N N    . MET A 1 52  ? 2.923   3.098   -4.752  1.00 0.00 ? 52  MET A N    1  
ATOM 768   C CA   . MET A 1 52  ? 1.717   2.907   -5.550  1.00 0.00 ? 52  MET A CA   1  
ATOM 769   C C    . MET A 1 52  ? 1.842   3.609   -6.898  1.00 0.00 ? 52  MET A C    1  
ATOM 770   O O    . MET A 1 52  ? 1.623   3.004   -7.947  1.00 0.00 ? 52  MET A O    1  
ATOM 771   C CB   . MET A 1 52  ? 0.493   3.435   -4.799  1.00 0.00 ? 52  MET A CB   1  
ATOM 772   C CG   . MET A 1 52  ? -0.828  2.958   -5.379  1.00 0.00 ? 52  MET A CG   1  
ATOM 773   S SD   . MET A 1 52  ? -1.059  1.177   -5.209  1.00 0.00 ? 52  MET A SD   1  
ATOM 774   C CE   . MET A 1 52  ? -1.798  0.779   -6.792  1.00 0.00 ? 52  MET A CE   1  
ATOM 775   H H    . MET A 1 52  ? 2.859   3.576   -3.899  1.00 0.00 ? 52  MET A H    1  
ATOM 776   H HA   . MET A 1 52  ? 1.596   1.847   -5.719  1.00 0.00 ? 52  MET A HA   1  
ATOM 777   H HB2  . MET A 1 52  ? 0.549   3.108   -3.771  1.00 0.00 ? 52  MET A HB2  1  
ATOM 778   H HB3  . MET A 1 52  ? 0.505   4.514   -4.827  1.00 0.00 ? 52  MET A HB3  1  
ATOM 779   H HG2  . MET A 1 52  ? -1.635  3.461   -4.867  1.00 0.00 ? 52  MET A HG2  1  
ATOM 780   H HG3  . MET A 1 52  ? -0.857  3.212   -6.429  1.00 0.00 ? 52  MET A HG3  1  
ATOM 781   H HE1  . MET A 1 52  ? -1.569  1.559   -7.502  1.00 0.00 ? 52  MET A HE1  1  
ATOM 782   H HE2  . MET A 1 52  ? -1.402  -0.160  -7.146  1.00 0.00 ? 52  MET A HE2  1  
ATOM 783   H HE3  . MET A 1 52  ? -2.870  0.699   -6.678  1.00 0.00 ? 52  MET A HE3  1  
ATOM 784   N N    . ASN A 1 53  ? 2.194   4.891   -6.863  1.00 0.00 ? 53  ASN A N    1  
ATOM 785   C CA   . ASN A 1 53  ? 2.347   5.675   -8.083  1.00 0.00 ? 53  ASN A CA   1  
ATOM 786   C C    . ASN A 1 53  ? 3.100   4.884   -9.148  1.00 0.00 ? 53  ASN A C    1  
ATOM 787   O O    . ASN A 1 53  ? 2.765   4.939   -10.331 1.00 0.00 ? 53  ASN A O    1  
ATOM 788   C CB   . ASN A 1 53  ? 3.085   6.982   -7.784  1.00 0.00 ? 53  ASN A CB   1  
ATOM 789   C CG   . ASN A 1 53  ? 2.138   8.113   -7.433  1.00 0.00 ? 53  ASN A CG   1  
ATOM 790   O OD1  . ASN A 1 53  ? 1.233   8.441   -8.200  1.00 0.00 ? 53  ASN A OD1  1  
ATOM 791   N ND2  . ASN A 1 53  ? 2.343   8.716   -6.267  1.00 0.00 ? 53  ASN A ND2  1  
ATOM 792   H H    . ASN A 1 53  ? 2.354   5.319   -5.996  1.00 0.00 ? 53  ASN A H    1  
ATOM 793   H HA   . ASN A 1 53  ? 1.359   5.906   -8.453  1.00 0.00 ? 53  ASN A HA   1  
ATOM 794   H HB2  . ASN A 1 53  ? 3.754   6.827   -6.951  1.00 0.00 ? 53  ASN A HB2  1  
ATOM 795   H HB3  . ASN A 1 53  ? 3.657   7.272   -8.653  1.00 0.00 ? 53  ASN A HB3  1  
ATOM 796   H HD21 . ASN A 1 53  ? 3.084   8.402   -5.708  1.00 0.00 ? 53  ASN A HD21 1  
ATOM 797   H HD22 . ASN A 1 53  ? 1.745   9.450   -6.015  1.00 0.00 ? 53  ASN A HD22 1  
ATOM 798   N N    . LYS A 1 54  ? 4.120   4.149   -8.719  1.00 0.00 ? 54  LYS A N    1  
ATOM 799   C CA   . LYS A 1 54  ? 4.921   3.344   -9.634  1.00 0.00 ? 54  LYS A CA   1  
ATOM 800   C C    . LYS A 1 54  ? 4.059   2.304   -10.342 1.00 0.00 ? 54  LYS A C    1  
ATOM 801   O O    . LYS A 1 54  ? 4.150   2.131   -11.558 1.00 0.00 ? 54  LYS A O    1  
ATOM 802   C CB   . LYS A 1 54  ? 6.056   2.651   -8.875  1.00 0.00 ? 54  LYS A CB   1  
ATOM 803   C CG   . LYS A 1 54  ? 6.967   3.612   -8.132  1.00 0.00 ? 54  LYS A CG   1  
ATOM 804   C CD   . LYS A 1 54  ? 7.784   4.461   -9.093  1.00 0.00 ? 54  LYS A CD   1  
ATOM 805   C CE   . LYS A 1 54  ? 8.154   5.800   -8.476  1.00 0.00 ? 54  LYS A CE   1  
ATOM 806   N NZ   . LYS A 1 54  ? 6.952   6.634   -8.194  1.00 0.00 ? 54  LYS A NZ   1  
ATOM 807   H H    . LYS A 1 54  ? 4.339   4.146   -7.763  1.00 0.00 ? 54  LYS A H    1  
ATOM 808   H HA   . LYS A 1 54  ? 5.346   4.006   -10.374 1.00 0.00 ? 54  LYS A HA   1  
ATOM 809   H HB2  . LYS A 1 54  ? 5.628   1.966   -8.159  1.00 0.00 ? 54  LYS A HB2  1  
ATOM 810   H HB3  . LYS A 1 54  ? 6.654   2.092   -9.581  1.00 0.00 ? 54  LYS A HB3  1  
ATOM 811   H HG2  . LYS A 1 54  ? 6.365   4.263   -7.517  1.00 0.00 ? 54  LYS A HG2  1  
ATOM 812   H HG3  . LYS A 1 54  ? 7.641   3.044   -7.507  1.00 0.00 ? 54  LYS A HG3  1  
ATOM 813   H HD2  . LYS A 1 54  ? 8.690   3.932   -9.348  1.00 0.00 ? 54  LYS A HD2  1  
ATOM 814   H HD3  . LYS A 1 54  ? 7.203   4.635   -9.988  1.00 0.00 ? 54  LYS A HD3  1  
ATOM 815   H HE2  . LYS A 1 54  ? 8.683   5.623   -7.552  1.00 0.00 ? 54  LYS A HE2  1  
ATOM 816   H HE3  . LYS A 1 54  ? 8.798   6.333   -9.161  1.00 0.00 ? 54  LYS A HE3  1  
ATOM 817   H HZ1  . LYS A 1 54  ? 7.240   7.561   -7.821  1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 818   H HZ2  . LYS A 1 54  ? 6.348   6.162   -7.492  1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 819   H HZ3  . LYS A 1 54  ? 6.404   6.776   -9.066  1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 820   N N    . LEU A 1 55  ? 3.221   1.615   -9.574  1.00 0.00 ? 55  LEU A N    1  
ATOM 821   C CA   . LEU A 1 55  ? 2.341   0.593   -10.129 1.00 0.00 ? 55  LEU A CA   1  
ATOM 822   C C    . LEU A 1 55  ? 1.222   1.225   -10.951 1.00 0.00 ? 55  LEU A C    1  
ATOM 823   O O    . LEU A 1 55  ? 0.966   0.817   -12.083 1.00 0.00 ? 55  LEU A O    1  
ATOM 824   C CB   . LEU A 1 55  ? 1.746   -0.258  -9.006  1.00 0.00 ? 55  LEU A CB   1  
ATOM 825   C CG   . LEU A 1 55  ? 2.729   -0.756  -7.946  1.00 0.00 ? 55  LEU A CG   1  
ATOM 826   C CD1  . LEU A 1 55  ? 1.991   -1.477  -6.830  1.00 0.00 ? 55  LEU A CD1  1  
ATOM 827   C CD2  . LEU A 1 55  ? 3.774   -1.666  -8.573  1.00 0.00 ? 55  LEU A CD2  1  
ATOM 828   H H    . LEU A 1 55  ? 3.194   1.797   -8.613  1.00 0.00 ? 55  LEU A H    1  
ATOM 829   H HA   . LEU A 1 55  ? 2.932   -0.040  -10.774 1.00 0.00 ? 55  LEU A HA   1  
ATOM 830   H HB2  . LEU A 1 55  ? 0.992   0.332   -8.507  1.00 0.00 ? 55  LEU A HB2  1  
ATOM 831   H HB3  . LEU A 1 55  ? 1.281   -1.123  -9.459  1.00 0.00 ? 55  LEU A HB3  1  
ATOM 832   H HG   . LEU A 1 55  ? 3.240   0.093   -7.512  1.00 0.00 ? 55  LEU A HG   1  
ATOM 833   H HD11 . LEU A 1 55  ? 1.761   -0.779  -6.039  1.00 0.00 ? 55  LEU A HD11 1  
ATOM 834   H HD12 . LEU A 1 55  ? 2.613   -2.270  -6.440  1.00 0.00 ? 55  LEU A HD12 1  
ATOM 835   H HD13 . LEU A 1 55  ? 1.075   -1.898  -7.217  1.00 0.00 ? 55  LEU A HD13 1  
ATOM 836   H HD21 . LEU A 1 55  ? 4.626   -1.077  -8.879  1.00 0.00 ? 55  LEU A HD21 1  
ATOM 837   H HD22 . LEU A 1 55  ? 3.350   -2.160  -9.436  1.00 0.00 ? 55  LEU A HD22 1  
ATOM 838   H HD23 . LEU A 1 55  ? 4.087   -2.406  -7.851  1.00 0.00 ? 55  LEU A HD23 1  
ATOM 839   N N    . GLN A 1 56  ? 0.563   2.224   -10.374 1.00 0.00 ? 56  GLN A N    1  
ATOM 840   C CA   . GLN A 1 56  ? -0.527  2.913   -11.054 1.00 0.00 ? 56  GLN A CA   1  
ATOM 841   C C    . GLN A 1 56  ? -0.154  4.363   -11.351 1.00 0.00 ? 56  GLN A C    1  
ATOM 842   O O    . GLN A 1 56  ? 0.218   5.127   -10.460 1.00 0.00 ? 56  GLN A O    1  
ATOM 843   C CB   . GLN A 1 56  ? -1.798  2.864   -10.206 1.00 0.00 ? 56  GLN A CB   1  
ATOM 844   C CG   . GLN A 1 56  ? -2.876  3.833   -10.667 1.00 0.00 ? 56  GLN A CG   1  
ATOM 845   C CD   . GLN A 1 56  ? -4.276  3.318   -10.402 1.00 0.00 ? 56  GLN A CD   1  
ATOM 846   O OE1  . GLN A 1 56  ? -5.060  3.112   -11.330 1.00 0.00 ? 56  GLN A OE1  1  
ATOM 847   N NE2  . GLN A 1 56  ? -4.599  3.107   -9.133  1.00 0.00 ? 56  GLN A NE2  1  
ATOM 848   H H    . GLN A 1 56  ? 0.813   2.503   -9.470  1.00 0.00 ? 56  GLN A H    1  
ATOM 849   H HA   . GLN A 1 56  ? -0.709  2.404   -11.989 1.00 0.00 ? 56  GLN A HA   1  
ATOM 850   H HB2  . GLN A 1 56  ? -2.204  1.865   -10.243 1.00 0.00 ? 56  GLN A HB2  1  
ATOM 851   H HB3  . GLN A 1 56  ? -1.544  3.104   -9.184  1.00 0.00 ? 56  GLN A HB3  1  
ATOM 852   H HG2  . GLN A 1 56  ? -2.748  4.769   -10.145 1.00 0.00 ? 56  GLN A HG2  1  
ATOM 853   H HG3  . GLN A 1 56  ? -2.763  3.998   -11.729 1.00 0.00 ? 56  GLN A HG3  1  
ATOM 854   H HE21 . GLN A 1 56  ? -3.924  3.294   -8.446  1.00 0.00 ? 56  GLN A HE21 1  
ATOM 855   H HE22 . GLN A 1 56  ? -5.498  2.775   -8.932  1.00 0.00 ? 56  GLN A HE22 1  
ATOM 856   N N    . PRO A 1 57  ? -0.254  4.750   -12.631 1.00 0.00 ? 57  PRO A N    1  
ATOM 857   C CA   . PRO A 1 57  ? 0.069   6.110   -13.073 1.00 0.00 ? 57  PRO A CA   1  
ATOM 858   C C    . PRO A 1 57  ? -0.947  7.136   -12.581 1.00 0.00 ? 57  PRO A C    1  
ATOM 859   O O    . PRO A 1 57  ? -0.862  8.317   -12.914 1.00 0.00 ? 57  PRO A O    1  
ATOM 860   C CB   . PRO A 1 57  ? 0.025   6.006   -14.600 1.00 0.00 ? 57  PRO A CB   1  
ATOM 861   C CG   . PRO A 1 57  ? -0.889  4.861   -14.876 1.00 0.00 ? 57  PRO A CG   1  
ATOM 862   C CD   . PRO A 1 57  ? -0.690  3.891   -13.744 1.00 0.00 ? 57  PRO A CD   1  
ATOM 863   H HA   . PRO A 1 57  ? 1.059   6.405   -12.759 1.00 0.00 ? 57  PRO A HA   1  
ATOM 864   H HB2  . PRO A 1 57  ? -0.357  6.927   -15.015 1.00 0.00 ? 57  PRO A HB2  1  
ATOM 865   H HB3  . PRO A 1 57  ? 1.018   5.817   -14.980 1.00 0.00 ? 57  PRO A HB3  1  
ATOM 866   H HG2  . PRO A 1 57  ? -1.912  5.206   -14.900 1.00 0.00 ? 57  PRO A HG2  1  
ATOM 867   H HG3  . PRO A 1 57  ? -0.625  4.399   -15.816 1.00 0.00 ? 57  PRO A HG3  1  
ATOM 868   H HD2  . PRO A 1 57  ? -1.619  3.394   -13.506 1.00 0.00 ? 57  PRO A HD2  1  
ATOM 869   H HD3  . PRO A 1 57  ? 0.073   3.169   -13.995 1.00 0.00 ? 57  PRO A HD3  1  
ATOM 870   N N    . GLY A 1 58  ? -1.906  6.677   -11.784 1.00 0.00 ? 58  GLY A N    1  
ATOM 871   C CA   . GLY A 1 58  ? -2.924  7.568   -11.258 1.00 0.00 ? 58  GLY A CA   1  
ATOM 872   C C    . GLY A 1 58  ? -3.486  7.089   -9.934  1.00 0.00 ? 58  GLY A C    1  
ATOM 873   O O    . GLY A 1 58  ? -4.694  6.902   -9.797  1.00 0.00 ? 58  GLY A O    1  
ATOM 874   H H    . GLY A 1 58  ? -1.924  5.725   -11.551 1.00 0.00 ? 58  GLY A H    1  
ATOM 875   H HA2  . GLY A 1 58  ? -2.492  8.548   -11.120 1.00 0.00 ? 58  GLY A HA2  1  
ATOM 876   H HA3  . GLY A 1 58  ? -3.730  7.638   -11.973 1.00 0.00 ? 58  GLY A HA3  1  
ATOM 877   N N    . SER A 1 59  ? -2.607  6.889   -8.957  1.00 0.00 ? 59  SER A N    1  
ATOM 878   C CA   . SER A 1 59  ? -3.021  6.424   -7.639  1.00 0.00 ? 59  SER A CA   1  
ATOM 879   C C    . SER A 1 59  ? -3.073  7.581   -6.646  1.00 0.00 ? 59  SER A C    1  
ATOM 880   O O    . SER A 1 59  ? -4.133  7.911   -6.113  1.00 0.00 ? 59  SER A O    1  
ATOM 881   C CB   . SER A 1 59  ? -2.063  5.344   -7.132  1.00 0.00 ? 59  SER A CB   1  
ATOM 882   O OG   . SER A 1 59  ? -0.757  5.541   -7.641  1.00 0.00 ? 59  SER A OG   1  
ATOM 883   H H    . SER A 1 59  ? -1.656  7.056   -9.128  1.00 0.00 ? 59  SER A H    1  
ATOM 884   H HA   . SER A 1 59  ? -4.010  6.001   -7.733  1.00 0.00 ? 59  SER A HA   1  
ATOM 885   H HB2  . SER A 1 59  ? -2.026  5.379   -6.053  1.00 0.00 ? 59  SER A HB2  1  
ATOM 886   H HB3  . SER A 1 59  ? -2.419  4.374   -7.448  1.00 0.00 ? 59  SER A HB3  1  
ATOM 887   H HG   . SER A 1 59  ? -0.725  5.262   -8.560  1.00 0.00 ? 59  SER A HG   1  
ATOM 888   N N    . VAL A 1 60  ? -1.919  8.195   -6.401  1.00 0.00 ? 60  VAL A N    1  
ATOM 889   C CA   . VAL A 1 60  ? -1.831  9.315   -5.472  1.00 0.00 ? 60  VAL A CA   1  
ATOM 890   C C    . VAL A 1 60  ? -1.586  10.624  -6.214  1.00 0.00 ? 60  VAL A C    1  
ATOM 891   O O    . VAL A 1 60  ? -0.719  10.721  -7.083  1.00 0.00 ? 60  VAL A O    1  
ATOM 892   C CB   . VAL A 1 60  ? -0.708  9.103   -4.442  1.00 0.00 ? 60  VAL A CB   1  
ATOM 893   C CG1  . VAL A 1 60  ? -0.596  10.307  -3.518  1.00 0.00 ? 60  VAL A CG1  1  
ATOM 894   C CG2  . VAL A 1 60  ? -0.950  7.830   -3.644  1.00 0.00 ? 60  VAL A CG2  1  
ATOM 895   H H    . VAL A 1 60  ? -1.108  7.885   -6.856  1.00 0.00 ? 60  VAL A H    1  
ATOM 896   H HA   . VAL A 1 60  ? -2.770  9.384   -4.942  1.00 0.00 ? 60  VAL A HA   1  
ATOM 897   H HB   . VAL A 1 60  ? 0.226   8.997   -4.972  1.00 0.00 ? 60  VAL A HB   1  
ATOM 898   H HG11 . VAL A 1 60  ? -0.547  11.210  -4.109  1.00 0.00 ? 60  VAL A HG11 1  
ATOM 899   H HG12 . VAL A 1 60  ? -1.458  10.345  -2.870  1.00 0.00 ? 60  VAL A HG12 1  
ATOM 900   H HG13 . VAL A 1 60  ? 0.300   10.221  -2.921  1.00 0.00 ? 60  VAL A HG13 1  
ATOM 901   H HG21 . VAL A 1 60  ? -0.821  6.973   -4.287  1.00 0.00 ? 60  VAL A HG21 1  
ATOM 902   H HG22 . VAL A 1 60  ? -0.244  7.776   -2.828  1.00 0.00 ? 60  VAL A HG22 1  
ATOM 903   H HG23 . VAL A 1 60  ? -1.955  7.838   -3.249  1.00 0.00 ? 60  VAL A HG23 1  
ATOM 904   N N    . PRO A 1 61  ? -2.366  11.658  -5.864  1.00 0.00 ? 61  PRO A N    1  
ATOM 905   C CA   . PRO A 1 61  ? -2.250  12.982  -6.483  1.00 0.00 ? 61  PRO A CA   1  
ATOM 906   C C    . PRO A 1 61  ? -0.962  13.696  -6.092  1.00 0.00 ? 61  PRO A C    1  
ATOM 907   O O    . PRO A 1 61  ? -0.218  14.173  -6.950  1.00 0.00 ? 61  PRO A O    1  
ATOM 908   C CB   . PRO A 1 61  ? -3.466  13.736  -5.937  1.00 0.00 ? 61  PRO A CB   1  
ATOM 909   C CG   . PRO A 1 61  ? -3.781  13.062  -4.647  1.00 0.00 ? 61  PRO A CG   1  
ATOM 910   C CD   . PRO A 1 61  ? -3.419  11.614  -4.836  1.00 0.00 ? 61  PRO A CD   1  
ATOM 911   H HA   . PRO A 1 61  ? -2.315  12.923  -7.560  1.00 0.00 ? 61  PRO A HA   1  
ATOM 912   H HB2  . PRO A 1 61  ? -3.211  14.775  -5.789  1.00 0.00 ? 61  PRO A HB2  1  
ATOM 913   H HB3  . PRO A 1 61  ? -4.286  13.657  -6.634  1.00 0.00 ? 61  PRO A HB3  1  
ATOM 914   H HG2  . PRO A 1 61  ? -3.192  13.495  -3.853  1.00 0.00 ? 61  PRO A HG2  1  
ATOM 915   H HG3  . PRO A 1 61  ? -4.834  13.158  -4.430  1.00 0.00 ? 61  PRO A HG3  1  
ATOM 916   H HD2  . PRO A 1 61  ? -3.041  11.196  -3.914  1.00 0.00 ? 61  PRO A HD2  1  
ATOM 917   H HD3  . PRO A 1 61  ? -4.274  11.054  -5.185  1.00 0.00 ? 61  PRO A HD3  1  
ATOM 918   N N    . LYS A 1 62  ? -0.700  13.763  -4.791  1.00 0.00 ? 62  LYS A N    1  
ATOM 919   C CA   . LYS A 1 62  ? 0.502   14.417  -4.285  1.00 0.00 ? 62  LYS A CA   1  
ATOM 920   C C    . LYS A 1 62  ? 0.862   13.894  -2.898  1.00 0.00 ? 62  LYS A C    1  
ATOM 921   O O    . LYS A 1 62  ? 0.001   13.404  -2.167  1.00 0.00 ? 62  LYS A O    1  
ATOM 922   C CB   . LYS A 1 62  ? 0.299   15.933  -4.234  1.00 0.00 ? 62  LYS A CB   1  
ATOM 923   C CG   . LYS A 1 62  ? 1.581   16.724  -4.427  1.00 0.00 ? 62  LYS A CG   1  
ATOM 924   C CD   . LYS A 1 62  ? 2.065   16.658  -5.866  1.00 0.00 ? 62  LYS A CD   1  
ATOM 925   C CE   . LYS A 1 62  ? 3.551   16.967  -5.968  1.00 0.00 ? 62  LYS A CE   1  
ATOM 926   N NZ   . LYS A 1 62  ? 3.818   18.431  -5.922  1.00 0.00 ? 62  LYS A NZ   1  
ATOM 927   H H    . LYS A 1 62  ? -1.330  13.363  -4.155  1.00 0.00 ? 62  LYS A H    1  
ATOM 928   H HA   . LYS A 1 62  ? 1.312   14.193  -4.962  1.00 0.00 ? 62  LYS A HA   1  
ATOM 929   H HB2  . LYS A 1 62  ? -0.396  16.217  -5.009  1.00 0.00 ? 62  LYS A HB2  1  
ATOM 930   H HB3  . LYS A 1 62  ? -0.120  16.196  -3.273  1.00 0.00 ? 62  LYS A HB3  1  
ATOM 931   H HG2  . LYS A 1 62  ? 1.399   17.757  -4.168  1.00 0.00 ? 62  LYS A HG2  1  
ATOM 932   H HG3  . LYS A 1 62  ? 2.345   16.319  -3.780  1.00 0.00 ? 62  LYS A HG3  1  
ATOM 933   H HD2  . LYS A 1 62  ? 1.889   15.664  -6.251  1.00 0.00 ? 62  LYS A HD2  1  
ATOM 934   H HD3  . LYS A 1 62  ? 1.516   17.378  -6.456  1.00 0.00 ? 62  LYS A HD3  1  
ATOM 935   H HE2  . LYS A 1 62  ? 4.062   16.491  -5.146  1.00 0.00 ? 62  LYS A HE2  1  
ATOM 936   H HE3  . LYS A 1 62  ? 3.925   16.570  -6.902  1.00 0.00 ? 62  LYS A HE3  1  
ATOM 937   H HZ1  . LYS A 1 62  ? 3.605   18.861  -6.845  1.00 0.00 ? 62  LYS A HZ1  1  
ATOM 938   H HZ2  . LYS A 1 62  ? 4.818   18.605  -5.693  1.00 0.00 ? 62  LYS A HZ2  1  
ATOM 939   H HZ3  . LYS A 1 62  ? 3.224   18.880  -5.196  1.00 0.00 ? 62  LYS A HZ3  1  
ATOM 940   N N    . ILE A 1 63  ? 2.137   14.005  -2.542  1.00 0.00 ? 63  ILE A N    1  
ATOM 941   C CA   . ILE A 1 63  ? 2.610   13.545  -1.242  1.00 0.00 ? 63  ILE A CA   1  
ATOM 942   C C    . ILE A 1 63  ? 3.029   14.719  -0.364  1.00 0.00 ? 63  ILE A C    1  
ATOM 943   O O    . ILE A 1 63  ? 3.709   15.637  -0.821  1.00 0.00 ? 63  ILE A O    1  
ATOM 944   C CB   . ILE A 1 63  ? 3.797   12.574  -1.385  1.00 0.00 ? 63  ILE A CB   1  
ATOM 945   C CG1  . ILE A 1 63  ? 3.381   11.341  -2.189  1.00 0.00 ? 63  ILE A CG1  1  
ATOM 946   C CG2  . ILE A 1 63  ? 4.317   12.169  -0.014  1.00 0.00 ? 63  ILE A CG2  1  
ATOM 947   C CD1  . ILE A 1 63  ? 4.545   10.612  -2.821  1.00 0.00 ? 63  ILE A CD1  1  
ATOM 948   H H    . ILE A 1 63  ? 2.776   14.404  -3.168  1.00 0.00 ? 63  ILE A H    1  
ATOM 949   H HA   . ILE A 1 63  ? 1.797   13.021  -0.759  1.00 0.00 ? 63  ILE A HA   1  
ATOM 950   H HB   . ILE A 1 63  ? 4.590   13.086  -1.907  1.00 0.00 ? 63  ILE A HB   1  
ATOM 951   H HG12 . ILE A 1 63  ? 2.871   10.649  -1.537  1.00 0.00 ? 63  ILE A HG12 1  
ATOM 952   H HG13 . ILE A 1 63  ? 2.711   11.646  -2.979  1.00 0.00 ? 63  ILE A HG13 1  
ATOM 953   H HG21 . ILE A 1 63  ? 5.025   12.905  0.335   1.00 0.00 ? 63  ILE A HG21 1  
ATOM 954   H HG22 . ILE A 1 63  ? 3.492   12.108  0.680   1.00 0.00 ? 63  ILE A HG22 1  
ATOM 955   H HG23 . ILE A 1 63  ? 4.801   11.207  -0.082  1.00 0.00 ? 63  ILE A HG23 1  
ATOM 956   H HD11 . ILE A 1 63  ? 5.425   11.236  -2.783  1.00 0.00 ? 63  ILE A HD11 1  
ATOM 957   H HD12 . ILE A 1 63  ? 4.731   9.694   -2.283  1.00 0.00 ? 63  ILE A HD12 1  
ATOM 958   H HD13 . ILE A 1 63  ? 4.311   10.384  -3.851  1.00 0.00 ? 63  ILE A HD13 1  
ATOM 959   N N    . ASN A 1 64  ? 2.622   14.682  0.901   1.00 0.00 ? 64  ASN A N    1  
ATOM 960   C CA   . ASN A 1 64  ? 2.958   15.741  1.845   1.00 0.00 ? 64  ASN A CA   1  
ATOM 961   C C    . ASN A 1 64  ? 4.296   15.463  2.522   1.00 0.00 ? 64  ASN A C    1  
ATOM 962   O O    . ASN A 1 64  ? 4.383   14.644  3.437   1.00 0.00 ? 64  ASN A O    1  
ATOM 963   C CB   . ASN A 1 64  ? 1.859   15.881  2.900   1.00 0.00 ? 64  ASN A CB   1  
ATOM 964   C CG   . ASN A 1 64  ? 0.483   16.042  2.283   1.00 0.00 ? 64  ASN A CG   1  
ATOM 965   O OD1  . ASN A 1 64  ? 0.348   16.507  1.152   1.00 0.00 ? 64  ASN A OD1  1  
ATOM 966   N ND2  . ASN A 1 64  ? -0.548  15.659  3.028   1.00 0.00 ? 64  ASN A ND2  1  
ATOM 967   H H    . ASN A 1 64  ? 2.083   13.923  1.207   1.00 0.00 ? 64  ASN A H    1  
ATOM 968   H HA   . ASN A 1 64  ? 3.032   16.666  1.292   1.00 0.00 ? 64  ASN A HA   1  
ATOM 969   H HB2  . ASN A 1 64  ? 1.852   14.997  3.522   1.00 0.00 ? 64  ASN A HB2  1  
ATOM 970   H HB3  . ASN A 1 64  ? 2.064   16.744  3.513   1.00 0.00 ? 64  ASN A HB3  1  
ATOM 971   H HD21 . ASN A 1 64  ? -0.366  15.298  3.921   1.00 0.00 ? 64  ASN A HD21 1  
ATOM 972   H HD22 . ASN A 1 64  ? -1.448  15.752  2.654   1.00 0.00 ? 64  ASN A HD22 1  
ATOM 973   N N    . ARG A 1 65  ? 5.338   16.151  2.065   1.00 0.00 ? 65  ARG A N    1  
ATOM 974   C CA   . ARG A 1 65  ? 6.673   15.977  2.627   1.00 0.00 ? 65  ARG A CA   1  
ATOM 975   C C    . ARG A 1 65  ? 6.874   16.883  3.838   1.00 0.00 ? 65  ARG A C    1  
ATOM 976   O O    . ARG A 1 65  ? 7.917   17.522  3.981   1.00 0.00 ? 65  ARG A O    1  
ATOM 977   C CB   . ARG A 1 65  ? 7.737   16.278  1.569   1.00 0.00 ? 65  ARG A CB   1  
ATOM 978   C CG   . ARG A 1 65  ? 9.024   15.494  1.759   1.00 0.00 ? 65  ARG A CG   1  
ATOM 979   C CD   . ARG A 1 65  ? 8.952   14.132  1.089   1.00 0.00 ? 65  ARG A CD   1  
ATOM 980   N NE   . ARG A 1 65  ? 8.754   14.243  -0.354  1.00 0.00 ? 65  ARG A NE   1  
ATOM 981   C CZ   . ARG A 1 65  ? 9.715   14.582  -1.205  1.00 0.00 ? 65  ARG A CZ   1  
ATOM 982   N NH1  . ARG A 1 65  ? 10.937  14.841  -0.759  1.00 0.00 ? 65  ARG A NH1  1  
ATOM 983   N NH2  . ARG A 1 65  ? 9.457   14.662  -2.504  1.00 0.00 ? 65  ARG A NH2  1  
ATOM 984   H H    . ARG A 1 65  ? 5.206   16.789  1.334   1.00 0.00 ? 65  ARG A H    1  
ATOM 985   H HA   . ARG A 1 65  ? 6.770   14.949  2.940   1.00 0.00 ? 65  ARG A HA   1  
ATOM 986   H HB2  . ARG A 1 65  ? 7.336   16.039  0.594   1.00 0.00 ? 65  ARG A HB2  1  
ATOM 987   H HB3  . ARG A 1 65  ? 7.973   17.331  1.603   1.00 0.00 ? 65  ARG A HB3  1  
ATOM 988   H HG2  . ARG A 1 65  ? 9.843   16.052  1.330   1.00 0.00 ? 65  ARG A HG2  1  
ATOM 989   H HG3  . ARG A 1 65  ? 9.197   15.356  2.817   1.00 0.00 ? 65  ARG A HG3  1  
ATOM 990   H HD2  . ARG A 1 65  ? 9.875   13.604  1.275   1.00 0.00 ? 65  ARG A HD2  1  
ATOM 991   H HD3  . ARG A 1 65  ? 8.129   13.578  1.514   1.00 0.00 ? 65  ARG A HD3  1  
ATOM 992   H HE   . ARG A 1 65  ? 7.858   14.056  -0.704  1.00 0.00 ? 65  ARG A HE   1  
ATOM 993   H HH11 . ARG A 1 65  ? 11.136  14.780  0.218   1.00 0.00 ? 65  ARG A HH11 1  
ATOM 994   H HH12 . ARG A 1 65  ? 11.661  15.095  -1.402  1.00 0.00 ? 65  ARG A HH12 1  
ATOM 995   H HH21 . ARG A 1 65  ? 8.537   14.467  -2.843  1.00 0.00 ? 65  ARG A HH21 1  
ATOM 996   H HH22 . ARG A 1 65  ? 10.182  14.918  -3.143  1.00 0.00 ? 65  ARG A HH22 1  
ATOM 997   N N    . SER A 1 66  ? 5.871   16.932  4.708   1.00 0.00 ? 66  SER A N    1  
ATOM 998   C CA   . SER A 1 66  ? 5.936   17.762  5.905   1.00 0.00 ? 66  SER A CA   1  
ATOM 999   C C    . SER A 1 66  ? 6.012   16.898  7.161   1.00 0.00 ? 66  SER A C    1  
ATOM 1000  O O    . SER A 1 66  ? 5.631   15.728  7.146   1.00 0.00 ? 66  SER A O    1  
ATOM 1001  C CB   . SER A 1 66  ? 4.717   18.684  5.979   1.00 0.00 ? 66  SER A CB   1  
ATOM 1002  O OG   . SER A 1 66  ? 4.619   19.493  4.820   1.00 0.00 ? 66  SER A OG   1  
ATOM 1003  H H    . SER A 1 66  ? 5.066   16.399  4.538   1.00 0.00 ? 66  SER A H    1  
ATOM 1004  H HA   . SER A 1 66  ? 6.830   18.364  5.842   1.00 0.00 ? 66  SER A HA   1  
ATOM 1005  H HB2  . SER A 1 66  ? 3.823   18.086  6.064   1.00 0.00 ? 66  SER A HB2  1  
ATOM 1006  H HB3  . SER A 1 66  ? 4.807   19.324  6.845   1.00 0.00 ? 66  SER A HB3  1  
ATOM 1007  H HG   . SER A 1 66  ? 3.782   19.962  4.827   1.00 0.00 ? 66  SER A HG   1  
ATOM 1008  N N    . MET A 1 67  ? 6.507   17.485  8.245   1.00 0.00 ? 67  MET A N    1  
ATOM 1009  C CA   . MET A 1 67  ? 6.633   16.771  9.510   1.00 0.00 ? 67  MET A CA   1  
ATOM 1010  C C    . MET A 1 67  ? 5.430   17.040  10.409  1.00 0.00 ? 67  MET A C    1  
ATOM 1011  O O    . MET A 1 67  ? 5.571   17.183  11.622  1.00 0.00 ? 67  MET A O    1  
ATOM 1012  C CB   . MET A 1 67  ? 7.920   17.182  10.227  1.00 0.00 ? 67  MET A CB   1  
ATOM 1013  C CG   . MET A 1 67  ? 8.370   16.189  11.288  1.00 0.00 ? 67  MET A CG   1  
ATOM 1014  S SD   . MET A 1 67  ? 10.011  16.559  11.934  1.00 0.00 ? 67  MET A SD   1  
ATOM 1015  C CE   . MET A 1 67  ? 9.932   15.761  13.536  1.00 0.00 ? 67  MET A CE   1  
ATOM 1016  H H    . MET A 1 67  ? 6.794   18.421  8.194   1.00 0.00 ? 67  MET A H    1  
ATOM 1017  H HA   . MET A 1 67  ? 6.675   15.715  9.292   1.00 0.00 ? 67  MET A HA   1  
ATOM 1018  H HB2  . MET A 1 67  ? 8.711   17.277  9.497   1.00 0.00 ? 67  MET A HB2  1  
ATOM 1019  H HB3  . MET A 1 67  ? 7.764   18.139  10.703  1.00 0.00 ? 67  MET A HB3  1  
ATOM 1020  H HG2  . MET A 1 67  ? 7.663   16.213  12.105  1.00 0.00 ? 67  MET A HG2  1  
ATOM 1021  H HG3  . MET A 1 67  ? 8.381   15.201  10.854  1.00 0.00 ? 67  MET A HG3  1  
ATOM 1022  H HE1  . MET A 1 67  ? 9.536   14.762  13.421  1.00 0.00 ? 67  MET A HE1  1  
ATOM 1023  H HE2  . MET A 1 67  ? 10.923  15.710  13.961  1.00 0.00 ? 67  MET A HE2  1  
ATOM 1024  H HE3  . MET A 1 67  ? 9.288   16.331  14.189  1.00 0.00 ? 67  MET A HE3  1  
ATOM 1025  N N    . GLN A 1 68  ? 4.249   17.108  9.803   1.00 0.00 ? 68  GLN A N    1  
ATOM 1026  C CA   . GLN A 1 68  ? 3.021   17.361  10.549  1.00 0.00 ? 68  GLN A CA   1  
ATOM 1027  C C    . GLN A 1 68  ? 2.148   16.112  10.601  1.00 0.00 ? 68  GLN A C    1  
ATOM 1028  O O    . GLN A 1 68  ? 2.254   15.233  9.746   1.00 0.00 ? 68  GLN A O    1  
ATOM 1029  C CB   . GLN A 1 68  ? 2.243   18.515  9.915   1.00 0.00 ? 68  GLN A CB   1  
ATOM 1030  C CG   . GLN A 1 68  ? 3.081   19.764  9.691   1.00 0.00 ? 68  GLN A CG   1  
ATOM 1031  C CD   . GLN A 1 68  ? 2.263   21.038  9.768   1.00 0.00 ? 68  GLN A CD   1  
ATOM 1032  O OE1  . GLN A 1 68  ? 2.085   21.610  10.845  1.00 0.00 ? 68  GLN A OE1  1  
ATOM 1033  N NE2  . GLN A 1 68  ? 1.760   21.489  8.625   1.00 0.00 ? 68  GLN A NE2  1  
ATOM 1034  H H    . GLN A 1 68  ? 4.201   16.986  8.832   1.00 0.00 ? 68  GLN A H    1  
ATOM 1035  H HA   . GLN A 1 68  ? 3.296   17.635  11.556  1.00 0.00 ? 68  GLN A HA   1  
ATOM 1036  H HB2  . GLN A 1 68  ? 1.856   18.192  8.960   1.00 0.00 ? 68  GLN A HB2  1  
ATOM 1037  H HB3  . GLN A 1 68  ? 1.417   18.774  10.561  1.00 0.00 ? 68  GLN A HB3  1  
ATOM 1038  H HG2  . GLN A 1 68  ? 3.853   19.804  10.444  1.00 0.00 ? 68  GLN A HG2  1  
ATOM 1039  H HG3  . GLN A 1 68  ? 3.537   19.705  8.713   1.00 0.00 ? 68  GLN A HG3  1  
ATOM 1040  H HE21 . GLN A 1 68  ? 1.942   20.981  7.807   1.00 0.00 ? 68  GLN A HE21 1  
ATOM 1041  H HE22 . GLN A 1 68  ? 1.227   22.310  8.646   1.00 0.00 ? 68  GLN A HE22 1  
ATOM 1042  N N    . ASN A 1 69  ? 1.287   16.039  11.610  1.00 0.00 ? 69  ASN A N    1  
ATOM 1043  C CA   . ASN A 1 69  ? 0.395   14.896  11.774  1.00 0.00 ? 69  ASN A CA   1  
ATOM 1044  C C    . ASN A 1 69  ? -0.584  14.799  10.609  1.00 0.00 ? 69  ASN A C    1  
ATOM 1045  O O    . ASN A 1 69  ? -0.468  13.918  9.758   1.00 0.00 ? 69  ASN A O    1  
ATOM 1046  C CB   . ASN A 1 69  ? -0.371  15.006  13.093  1.00 0.00 ? 69  ASN A CB   1  
ATOM 1047  C CG   . ASN A 1 69  ? 0.528   14.831  14.301  1.00 0.00 ? 69  ASN A CG   1  
ATOM 1048  O OD1  . ASN A 1 69  ? 1.689   15.241  14.290  1.00 0.00 ? 69  ASN A OD1  1  
ATOM 1049  N ND2  . ASN A 1 69  ? -0.005  14.218  15.351  1.00 0.00 ? 69  ASN A ND2  1  
ATOM 1050  H H    . ASN A 1 69  ? 1.250   16.771  12.260  1.00 0.00 ? 69  ASN A H    1  
ATOM 1051  H HA   . ASN A 1 69  ? 1.002   14.003  11.794  1.00 0.00 ? 69  ASN A HA   1  
ATOM 1052  H HB2  . ASN A 1 69  ? -0.835  15.981  13.153  1.00 0.00 ? 69  ASN A HB2  1  
ATOM 1053  H HB3  . ASN A 1 69  ? -1.137  14.246  13.123  1.00 0.00 ? 69  ASN A HB3  1  
ATOM 1054  H HD21 . ASN A 1 69  ? -0.936  13.917  15.289  1.00 0.00 ? 69  ASN A HD21 1  
ATOM 1055  H HD22 . ASN A 1 69  ? 0.554   14.092  16.146  1.00 0.00 ? 69  ASN A HD22 1  
ATOM 1056  N N    . TRP A 1 70  ? -1.550  15.712  10.578  1.00 0.00 ? 70  TRP A N    1  
ATOM 1057  C CA   . TRP A 1 70  ? -2.550  15.730  9.517   1.00 0.00 ? 70  TRP A CA   1  
ATOM 1058  C C    . TRP A 1 70  ? -1.917  15.416  8.166   1.00 0.00 ? 70  TRP A C    1  
ATOM 1059  O O    . TRP A 1 70  ? -2.462  14.641  7.379   1.00 0.00 ? 70  TRP A O    1  
ATOM 1060  C CB   . TRP A 1 70  ? -3.243  17.092  9.465   1.00 0.00 ? 70  TRP A CB   1  
ATOM 1061  C CG   . TRP A 1 70  ? -2.311  18.242  9.692   1.00 0.00 ? 70  TRP A CG   1  
ATOM 1062  C CD1  . TRP A 1 70  ? -1.359  18.708  8.830   1.00 0.00 ? 70  TRP A CD1  1  
ATOM 1063  C CD2  . TRP A 1 70  ? -2.239  19.071  10.857  1.00 0.00 ? 70  TRP A CD2  1  
ATOM 1064  N NE1  . TRP A 1 70  ? -0.700  19.776  9.390   1.00 0.00 ? 70  TRP A NE1  1  
ATOM 1065  C CE2  . TRP A 1 70  ? -1.222  20.019  10.633  1.00 0.00 ? 70  TRP A CE2  1  
ATOM 1066  C CE3  . TRP A 1 70  ? -2.936  19.105  12.068  1.00 0.00 ? 70  TRP A CE3  1  
ATOM 1067  C CZ2  . TRP A 1 70  ? -0.886  20.987  11.576  1.00 0.00 ? 70  TRP A CZ2  1  
ATOM 1068  C CZ3  . TRP A 1 70  ? -2.602  20.067  13.002  1.00 0.00 ? 70  TRP A CZ3  1  
ATOM 1069  C CH2  . TRP A 1 70  ? -1.585  20.998  12.751  1.00 0.00 ? 70  TRP A CH2  1  
ATOM 1070  H H    . TRP A 1 70  ? -1.590  16.389  11.284  1.00 0.00 ? 70  TRP A H    1  
ATOM 1071  H HA   . TRP A 1 70  ? -3.284  14.970  9.743   1.00 0.00 ? 70  TRP A HA   1  
ATOM 1072  H HB2  . TRP A 1 70  ? -3.701  17.219  8.495   1.00 0.00 ? 70  TRP A HB2  1  
ATOM 1073  H HB3  . TRP A 1 70  ? -4.009  17.126  10.227  1.00 0.00 ? 70  TRP A HB3  1  
ATOM 1074  H HD1  . TRP A 1 70  ? -1.163  18.287  7.856   1.00 0.00 ? 70  TRP A HD1  1  
ATOM 1075  H HE1  . TRP A 1 70  ? 0.025   20.282  8.966   1.00 0.00 ? 70  TRP A HE1  1  
ATOM 1076  H HE3  . TRP A 1 70  ? -3.723  18.396  12.280  1.00 0.00 ? 70  TRP A HE3  1  
ATOM 1077  H HZ2  . TRP A 1 70  ? -0.106  21.713  11.397  1.00 0.00 ? 70  TRP A HZ2  1  
ATOM 1078  H HZ3  . TRP A 1 70  ? -3.130  20.108  13.944  1.00 0.00 ? 70  TRP A HZ3  1  
ATOM 1079  H HH2  . TRP A 1 70  ? -1.358  21.730  13.510  1.00 0.00 ? 70  TRP A HH2  1  
ATOM 1080  N N    . HIS A 1 71  ? -0.763  16.021  7.903   1.00 0.00 ? 71  HIS A N    1  
ATOM 1081  C CA   . HIS A 1 71  ? -0.055  15.804  6.646   1.00 0.00 ? 71  HIS A CA   1  
ATOM 1082  C C    . HIS A 1 71  ? 0.385   14.348  6.515   1.00 0.00 ? 71  HIS A C    1  
ATOM 1083  O O    . HIS A 1 71  ? 0.106   13.695  5.510   1.00 0.00 ? 71  HIS A O    1  
ATOM 1084  C CB   . HIS A 1 71  ? 1.160   16.727  6.555   1.00 0.00 ? 71  HIS A CB   1  
ATOM 1085  C CG   . HIS A 1 71  ? 0.827   18.111  6.090   1.00 0.00 ? 71  HIS A CG   1  
ATOM 1086  N ND1  . HIS A 1 71  ? 1.604   19.212  6.387   1.00 0.00 ? 71  HIS A ND1  1  
ATOM 1087  C CD2  . HIS A 1 71  ? -0.205  18.570  5.344   1.00 0.00 ? 71  HIS A CD2  1  
ATOM 1088  C CE1  . HIS A 1 71  ? 1.062   20.288  5.844   1.00 0.00 ? 71  HIS A CE1  1  
ATOM 1089  N NE2  . HIS A 1 71  ? -0.035  19.926  5.205   1.00 0.00 ? 71  HIS A NE2  1  
ATOM 1090  H H    . HIS A 1 71  ? -0.378  16.626  8.570   1.00 0.00 ? 71  HIS A H    1  
ATOM 1091  H HA   . HIS A 1 71  ? -0.733  16.036  5.839   1.00 0.00 ? 71  HIS A HA   1  
ATOM 1092  H HB2  . HIS A 1 71  ? 1.618   16.806  7.530   1.00 0.00 ? 71  HIS A HB2  1  
ATOM 1093  H HB3  . HIS A 1 71  ? 1.874   16.306  5.862   1.00 0.00 ? 71  HIS A HB3  1  
ATOM 1094  H HD1  . HIS A 1 71  ? 2.427   19.205  6.917   1.00 0.00 ? 71  HIS A HD1  1  
ATOM 1095  H HD2  . HIS A 1 71  ? -1.011  17.980  4.933   1.00 0.00 ? 71  HIS A HD2  1  
ATOM 1096  H HE1  . HIS A 1 71  ? 1.451   21.293  5.911   1.00 0.00 ? 71  HIS A HE1  1  
ATOM 1097  H HE2  . HIS A 1 71  ? -0.674  20.540  4.788   1.00 0.00 ? 71  HIS A HE2  1  
ATOM 1098  N N    . GLN A 1 72  ? 1.076   13.850  7.536   1.00 0.00 ? 72  GLN A N    1  
ATOM 1099  C CA   . GLN A 1 72  ? 1.556   12.473  7.532   1.00 0.00 ? 72  GLN A CA   1  
ATOM 1100  C C    . GLN A 1 72  ? 0.400   11.494  7.358   1.00 0.00 ? 72  GLN A C    1  
ATOM 1101  O O    . GLN A 1 72  ? 0.519   10.498  6.642   1.00 0.00 ? 72  GLN A O    1  
ATOM 1102  C CB   . GLN A 1 72  ? 2.306   12.168  8.830   1.00 0.00 ? 72  GLN A CB   1  
ATOM 1103  C CG   . GLN A 1 72  ? 3.737   12.684  8.840   1.00 0.00 ? 72  GLN A CG   1  
ATOM 1104  C CD   . GLN A 1 72  ? 4.476   12.325  10.114  1.00 0.00 ? 72  GLN A CD   1  
ATOM 1105  O OE1  . GLN A 1 72  ? 4.568   11.154  10.483  1.00 0.00 ? 72  GLN A OE1  1  
ATOM 1106  N NE2  . GLN A 1 72  ? 5.011   13.333  10.793  1.00 0.00 ? 72  GLN A NE2  1  
ATOM 1107  H H    . GLN A 1 72  ? 1.267   14.421  8.308   1.00 0.00 ? 72  GLN A H    1  
ATOM 1108  H HA   . GLN A 1 72  ? 2.235   12.361  6.700   1.00 0.00 ? 72  GLN A HA   1  
ATOM 1109  H HB2  . GLN A 1 72  ? 1.776   12.624  9.653   1.00 0.00 ? 72  GLN A HB2  1  
ATOM 1110  H HB3  . GLN A 1 72  ? 2.332   11.099  8.975   1.00 0.00 ? 72  GLN A HB3  1  
ATOM 1111  H HG2  . GLN A 1 72  ? 4.266   12.256  8.002   1.00 0.00 ? 72  GLN A HG2  1  
ATOM 1112  H HG3  . GLN A 1 72  ? 3.719   13.760  8.742   1.00 0.00 ? 72  GLN A HG3  1  
ATOM 1113  H HE21 . GLN A 1 72  ? 4.897   14.241  10.439  1.00 0.00 ? 72  GLN A HE21 1  
ATOM 1114  H HE22 . GLN A 1 72  ? 5.493   13.130  11.620  1.00 0.00 ? 72  GLN A HE22 1  
ATOM 1115  N N    . LEU A 1 73  ? -0.717  11.783  8.016   1.00 0.00 ? 73  LEU A N    1  
ATOM 1116  C CA   . LEU A 1 73  ? -1.896  10.927  7.934   1.00 0.00 ? 73  LEU A CA   1  
ATOM 1117  C C    . LEU A 1 73  ? -2.454  10.902  6.515   1.00 0.00 ? 73  LEU A C    1  
ATOM 1118  O O    . LEU A 1 73  ? -2.594  9.839   5.912   1.00 0.00 ? 73  LEU A O    1  
ATOM 1119  C CB   . LEU A 1 73  ? -2.971  11.412  8.909   1.00 0.00 ? 73  LEU A CB   1  
ATOM 1120  C CG   . LEU A 1 73  ? -2.921  10.814  10.315  1.00 0.00 ? 73  LEU A CG   1  
ATOM 1121  C CD1  . LEU A 1 73  ? -3.258  9.331   10.277  1.00 0.00 ? 73  LEU A CD1  1  
ATOM 1122  C CD2  . LEU A 1 73  ? -1.552  11.036  10.940  1.00 0.00 ? 73  LEU A CD2  1  
ATOM 1123  H H    . LEU A 1 73  ? -0.752  12.590  8.570   1.00 0.00 ? 73  LEU A H    1  
ATOM 1124  H HA   . LEU A 1 73  ? -1.599  9.926   8.208   1.00 0.00 ? 73  LEU A HA   1  
ATOM 1125  H HB2  . LEU A 1 73  ? -2.875  12.483  9.001   1.00 0.00 ? 73  LEU A HB2  1  
ATOM 1126  H HB3  . LEU A 1 73  ? -3.935  11.175  8.481   1.00 0.00 ? 73  LEU A HB3  1  
ATOM 1127  H HG   . LEU A 1 73  ? -3.657  11.307  10.935  1.00 0.00 ? 73  LEU A HG   1  
ATOM 1128  H HD11 . LEU A 1 73  ? -2.834  8.888   9.389   1.00 0.00 ? 73  LEU A HD11 1  
ATOM 1129  H HD12 . LEU A 1 73  ? -4.331  9.207   10.266  1.00 0.00 ? 73  LEU A HD12 1  
ATOM 1130  H HD13 . LEU A 1 73  ? -2.850  8.848   11.152  1.00 0.00 ? 73  LEU A HD13 1  
ATOM 1131  H HD21 . LEU A 1 73  ? -1.619  10.900  12.010  1.00 0.00 ? 73  LEU A HD21 1  
ATOM 1132  H HD22 . LEU A 1 73  ? -1.215  12.039  10.725  1.00 0.00 ? 73  LEU A HD22 1  
ATOM 1133  H HD23 . LEU A 1 73  ? -0.849  10.324  10.530  1.00 0.00 ? 73  LEU A HD23 1  
ATOM 1134  N N    . GLU A 1 74  ? -2.768  12.081  5.987   1.00 0.00 ? 74  GLU A N    1  
ATOM 1135  C CA   . GLU A 1 74  ? -3.309  12.195  4.638   1.00 0.00 ? 74  GLU A CA   1  
ATOM 1136  C C    . GLU A 1 74  ? -2.597  11.239  3.684   1.00 0.00 ? 74  GLU A C    1  
ATOM 1137  O O    . GLU A 1 74  ? -3.225  10.616  2.830   1.00 0.00 ? 74  GLU A O    1  
ATOM 1138  C CB   . GLU A 1 74  ? -3.178  13.632  4.131   1.00 0.00 ? 74  GLU A CB   1  
ATOM 1139  C CG   . GLU A 1 74  ? -3.953  13.899  2.852   1.00 0.00 ? 74  GLU A CG   1  
ATOM 1140  C CD   . GLU A 1 74  ? -5.455  13.874  3.064   1.00 0.00 ? 74  GLU A CD   1  
ATOM 1141  O OE1  . GLU A 1 74  ? -6.027  12.767  3.128   1.00 0.00 ? 74  GLU A OE1  1  
ATOM 1142  O OE2  . GLU A 1 74  ? -6.056  14.963  3.167   1.00 0.00 ? 74  GLU A OE2  1  
ATOM 1143  H H    . GLU A 1 74  ? -2.633  12.894  6.518   1.00 0.00 ? 74  GLU A H    1  
ATOM 1144  H HA   . GLU A 1 74  ? -4.355  11.931  4.677   1.00 0.00 ? 74  GLU A HA   1  
ATOM 1145  H HB2  . GLU A 1 74  ? -3.538  14.305  4.894   1.00 0.00 ? 74  GLU A HB2  1  
ATOM 1146  H HB3  . GLU A 1 74  ? -2.134  13.840  3.943   1.00 0.00 ? 74  GLU A HB3  1  
ATOM 1147  H HG2  . GLU A 1 74  ? -3.675  14.871  2.473   1.00 0.00 ? 74  GLU A HG2  1  
ATOM 1148  H HG3  . GLU A 1 74  ? -3.695  13.144  2.124   1.00 0.00 ? 74  GLU A HG3  1  
ATOM 1149  N N    . ASN A 1 75  ? -1.281  11.131  3.838   1.00 0.00 ? 75  ASN A N    1  
ATOM 1150  C CA   . ASN A 1 75  ? -0.483  10.253  2.991   1.00 0.00 ? 75  ASN A CA   1  
ATOM 1151  C C    . ASN A 1 75  ? -1.049  8.837   2.987   1.00 0.00 ? 75  ASN A C    1  
ATOM 1152  O O    . ASN A 1 75  ? -1.411  8.304   1.936   1.00 0.00 ? 75  ASN A O    1  
ATOM 1153  C CB   . ASN A 1 75  ? 0.971   10.231  3.470   1.00 0.00 ? 75  ASN A CB   1  
ATOM 1154  C CG   . ASN A 1 75  ? 1.693   11.534  3.187   1.00 0.00 ? 75  ASN A CG   1  
ATOM 1155  O OD1  . ASN A 1 75  ? 1.233   12.351  2.390   1.00 0.00 ? 75  ASN A OD1  1  
ATOM 1156  N ND2  . ASN A 1 75  ? 2.831   11.733  3.841   1.00 0.00 ? 75  ASN A ND2  1  
ATOM 1157  H H    . ASN A 1 75  ? -0.836  11.654  4.538   1.00 0.00 ? 75  ASN A H    1  
ATOM 1158  H HA   . ASN A 1 75  ? -0.514  10.644  1.985   1.00 0.00 ? 75  ASN A HA   1  
ATOM 1159  H HB2  . ASN A 1 75  ? 0.990   10.057  4.536   1.00 0.00 ? 75  ASN A HB2  1  
ATOM 1160  H HB3  . ASN A 1 75  ? 1.497   9.432   2.970   1.00 0.00 ? 75  ASN A HB3  1  
ATOM 1161  H HD21 . ASN A 1 75  ? 3.138   11.039  4.461   1.00 0.00 ? 75  ASN A HD21 1  
ATOM 1162  H HD22 . ASN A 1 75  ? 3.319   12.568  3.677   1.00 0.00 ? 75  ASN A HD22 1  
ATOM 1163  N N    . LEU A 1 76  ? -1.126  8.233   4.167   1.00 0.00 ? 76  LEU A N    1  
ATOM 1164  C CA   . LEU A 1 76  ? -1.650  6.878   4.301   1.00 0.00 ? 76  LEU A CA   1  
ATOM 1165  C C    . LEU A 1 76  ? -3.067  6.785   3.744   1.00 0.00 ? 76  LEU A C    1  
ATOM 1166  O O    . LEU A 1 76  ? -3.393  5.862   2.998   1.00 0.00 ? 76  LEU A O    1  
ATOM 1167  C CB   . LEU A 1 76  ? -1.637  6.448   5.769   1.00 0.00 ? 76  LEU A CB   1  
ATOM 1168  C CG   . LEU A 1 76  ? -0.260  6.196   6.384   1.00 0.00 ? 76  LEU A CG   1  
ATOM 1169  C CD1  . LEU A 1 76  ? -0.397  5.641   7.792   1.00 0.00 ? 76  LEU A CD1  1  
ATOM 1170  C CD2  . LEU A 1 76  ? 0.547   5.247   5.510   1.00 0.00 ? 76  LEU A CD2  1  
ATOM 1171  H H    . LEU A 1 76  ? -0.823  8.708   4.969   1.00 0.00 ? 76  LEU A H    1  
ATOM 1172  H HA   . LEU A 1 76  ? -1.011  6.218   3.735   1.00 0.00 ? 76  LEU A HA   1  
ATOM 1173  H HB2  . LEU A 1 76  ? -2.119  7.223   6.345   1.00 0.00 ? 76  LEU A HB2  1  
ATOM 1174  H HB3  . LEU A 1 76  ? -2.209  5.534   5.850   1.00 0.00 ? 76  LEU A HB3  1  
ATOM 1175  H HG   . LEU A 1 76  ? 0.276   7.133   6.444   1.00 0.00 ? 76  LEU A HG   1  
ATOM 1176  H HD11 . LEU A 1 76  ? -1.352  5.933   8.202   1.00 0.00 ? 76  LEU A HD11 1  
ATOM 1177  H HD12 . LEU A 1 76  ? 0.397   6.033   8.412   1.00 0.00 ? 76  LEU A HD12 1  
ATOM 1178  H HD13 . LEU A 1 76  ? -0.331  4.564   7.762   1.00 0.00 ? 76  LEU A HD13 1  
ATOM 1179  H HD21 . LEU A 1 76  ? 1.003   4.489   6.130   1.00 0.00 ? 76  LEU A HD21 1  
ATOM 1180  H HD22 . LEU A 1 76  ? 1.319   5.801   4.993   1.00 0.00 ? 76  LEU A HD22 1  
ATOM 1181  H HD23 . LEU A 1 76  ? -0.105  4.778   4.788   1.00 0.00 ? 76  LEU A HD23 1  
ATOM 1182  N N    . SER A 1 77  ? -3.905  7.749   4.110   1.00 0.00 ? 77  SER A N    1  
ATOM 1183  C CA   . SER A 1 77  ? -5.288  7.776   3.648   1.00 0.00 ? 77  SER A CA   1  
ATOM 1184  C C    . SER A 1 77  ? -5.352  7.826   2.125   1.00 0.00 ? 77  SER A C    1  
ATOM 1185  O O    . SER A 1 77  ? -6.254  7.258   1.511   1.00 0.00 ? 77  SER A O    1  
ATOM 1186  C CB   . SER A 1 77  ? -6.023  8.981   4.240   1.00 0.00 ? 77  SER A CB   1  
ATOM 1187  O OG   . SER A 1 77  ? -6.128  8.872   5.649   1.00 0.00 ? 77  SER A OG   1  
ATOM 1188  H H    . SER A 1 77  ? -3.587  8.459   4.706   1.00 0.00 ? 77  SER A H    1  
ATOM 1189  H HA   . SER A 1 77  ? -5.769  6.870   3.987   1.00 0.00 ? 77  SER A HA   1  
ATOM 1190  H HB2  . SER A 1 77  ? -5.482  9.882   4.000   1.00 0.00 ? 77  SER A HB2  1  
ATOM 1191  H HB3  . SER A 1 77  ? -7.017  9.034   3.820   1.00 0.00 ? 77  SER A HB3  1  
ATOM 1192  H HG   . SER A 1 77  ? -5.253  8.930   6.040   1.00 0.00 ? 77  SER A HG   1  
ATOM 1193  N N    . ASN A 1 78  ? -4.385  8.510   1.521   1.00 0.00 ? 78  ASN A N    1  
ATOM 1194  C CA   . ASN A 1 78  ? -4.331  8.635   0.069   1.00 0.00 ? 78  ASN A CA   1  
ATOM 1195  C C    . ASN A 1 78  ? -3.895  7.322   -0.574  1.00 0.00 ? 78  ASN A C    1  
ATOM 1196  O O    . ASN A 1 78  ? -4.485  6.875   -1.559  1.00 0.00 ? 78  ASN A O    1  
ATOM 1197  C CB   . ASN A 1 78  ? -3.369  9.756   -0.331  1.00 0.00 ? 78  ASN A CB   1  
ATOM 1198  C CG   . ASN A 1 78  ? -3.963  11.134  -0.111  1.00 0.00 ? 78  ASN A CG   1  
ATOM 1199  O OD1  . ASN A 1 78  ? -5.182  11.298  -0.083  1.00 0.00 ? 78  ASN A OD1  1  
ATOM 1200  N ND2  . ASN A 1 78  ? -3.101  12.131  0.045   1.00 0.00 ? 78  ASN A ND2  1  
ATOM 1201  H H    . ASN A 1 78  ? -3.693  8.941   2.064   1.00 0.00 ? 78  ASN A H    1  
ATOM 1202  H HA   . ASN A 1 78  ? -5.322  8.882   -0.280  1.00 0.00 ? 78  ASN A HA   1  
ATOM 1203  H HB2  . ASN A 1 78  ? -2.467  9.675   0.258   1.00 0.00 ? 78  ASN A HB2  1  
ATOM 1204  H HB3  . ASN A 1 78  ? -3.121  9.653   -1.377  1.00 0.00 ? 78  ASN A HB3  1  
ATOM 1205  H HD21 . ASN A 1 78  ? -2.143  11.925  0.011   1.00 0.00 ? 78  ASN A HD21 1  
ATOM 1206  H HD22 . ASN A 1 78  ? -3.458  13.032  0.190   1.00 0.00 ? 78  ASN A HD22 1  
ATOM 1207  N N    . PHE A 1 79  ? -2.860  6.708   -0.011  1.00 0.00 ? 79  PHE A N    1  
ATOM 1208  C CA   . PHE A 1 79  ? -2.345  5.446   -0.529  1.00 0.00 ? 79  PHE A CA   1  
ATOM 1209  C C    . PHE A 1 79  ? -3.395  4.344   -0.421  1.00 0.00 ? 79  PHE A C    1  
ATOM 1210  O O    . PHE A 1 79  ? -3.703  3.668   -1.402  1.00 0.00 ? 79  PHE A O    1  
ATOM 1211  C CB   . PHE A 1 79  ? -1.081  5.038   0.230   1.00 0.00 ? 79  PHE A CB   1  
ATOM 1212  C CG   . PHE A 1 79  ? -0.644  3.627   -0.049  1.00 0.00 ? 79  PHE A CG   1  
ATOM 1213  C CD1  . PHE A 1 79  ? -0.525  3.170   -1.351  1.00 0.00 ? 79  PHE A CD1  1  
ATOM 1214  C CD2  . PHE A 1 79  ? -0.353  2.760   0.992   1.00 0.00 ? 79  PHE A CD2  1  
ATOM 1215  C CE1  . PHE A 1 79  ? -0.124  1.872   -1.610  1.00 0.00 ? 79  PHE A CE1  1  
ATOM 1216  C CE2  . PHE A 1 79  ? 0.049   1.462   0.739   1.00 0.00 ? 79  PHE A CE2  1  
ATOM 1217  C CZ   . PHE A 1 79  ? 0.164   1.018   -0.564  1.00 0.00 ? 79  PHE A CZ   1  
ATOM 1218  H H    . PHE A 1 79  ? -2.432  7.114   0.772   1.00 0.00 ? 79  PHE A H    1  
ATOM 1219  H HA   . PHE A 1 79  ? -2.098  5.593   -1.569  1.00 0.00 ? 79  PHE A HA   1  
ATOM 1220  H HB2  . PHE A 1 79  ? -0.272  5.696   -0.051  1.00 0.00 ? 79  PHE A HB2  1  
ATOM 1221  H HB3  . PHE A 1 79  ? -1.261  5.128   1.291   1.00 0.00 ? 79  PHE A HB3  1  
ATOM 1222  H HD1  . PHE A 1 79  ? -0.748  3.837   -2.170  1.00 0.00 ? 79  PHE A HD1  1  
ATOM 1223  H HD2  . PHE A 1 79  ? -0.442  3.107   2.012   1.00 0.00 ? 79  PHE A HD2  1  
ATOM 1224  H HE1  . PHE A 1 79  ? -0.034  1.528   -2.629  1.00 0.00 ? 79  PHE A HE1  1  
ATOM 1225  H HE2  . PHE A 1 79  ? 0.273   0.796   1.560   1.00 0.00 ? 79  PHE A HE2  1  
ATOM 1226  H HZ   . PHE A 1 79  ? 0.477   0.004   -0.763  1.00 0.00 ? 79  PHE A HZ   1  
ATOM 1227  N N    . ILE A 1 80  ? -3.939  4.170   0.778   1.00 0.00 ? 80  ILE A N    1  
ATOM 1228  C CA   . ILE A 1 80  ? -4.955  3.151   1.015   1.00 0.00 ? 80  ILE A CA   1  
ATOM 1229  C C    . ILE A 1 80  ? -6.035  3.191   -0.061  1.00 0.00 ? 80  ILE A C    1  
ATOM 1230  O O    . ILE A 1 80  ? -6.122  2.295   -0.902  1.00 0.00 ? 80  ILE A O    1  
ATOM 1231  C CB   . ILE A 1 80  ? -5.615  3.325   2.395   1.00 0.00 ? 80  ILE A CB   1  
ATOM 1232  C CG1  . ILE A 1 80  ? -4.563  3.246   3.502   1.00 0.00 ? 80  ILE A CG1  1  
ATOM 1233  C CG2  . ILE A 1 80  ? -6.692  2.269   2.604   1.00 0.00 ? 80  ILE A CG2  1  
ATOM 1234  C CD1  . ILE A 1 80  ? -4.959  3.977   4.766   1.00 0.00 ? 80  ILE A CD1  1  
ATOM 1235  H H    . ILE A 1 80  ? -3.652  4.740   1.521   1.00 0.00 ? 80  ILE A H    1  
ATOM 1236  H HA   . ILE A 1 80  ? -4.470  2.186   0.988   1.00 0.00 ? 80  ILE A HA   1  
ATOM 1237  H HB   . ILE A 1 80  ? -6.087  4.295   2.424   1.00 0.00 ? 80  ILE A HB   1  
ATOM 1238  H HG12 . ILE A 1 80  ? -4.392  2.213   3.757   1.00 0.00 ? 80  ILE A HG12 1  
ATOM 1239  H HG13 . ILE A 1 80  ? -3.640  3.680   3.143   1.00 0.00 ? 80  ILE A HG13 1  
ATOM 1240  H HG21 . ILE A 1 80  ? -7.116  1.995   1.650   1.00 0.00 ? 80  ILE A HG21 1  
ATOM 1241  H HG22 . ILE A 1 80  ? -6.254  1.398   3.067   1.00 0.00 ? 80  ILE A HG22 1  
ATOM 1242  H HG23 . ILE A 1 80  ? -7.467  2.666   3.242   1.00 0.00 ? 80  ILE A HG23 1  
ATOM 1243  H HD11 . ILE A 1 80  ? -5.222  3.260   5.530   1.00 0.00 ? 80  ILE A HD11 1  
ATOM 1244  H HD12 . ILE A 1 80  ? -4.133  4.581   5.108   1.00 0.00 ? 80  ILE A HD12 1  
ATOM 1245  H HD13 . ILE A 1 80  ? -5.809  4.612   4.563   1.00 0.00 ? 80  ILE A HD13 1  
ATOM 1246  N N    . LYS A 1 81  ? -6.854  4.236   -0.032  1.00 0.00 ? 81  LYS A N    1  
ATOM 1247  C CA   . LYS A 1 81  ? -7.926  4.397   -1.006  1.00 0.00 ? 81  LYS A CA   1  
ATOM 1248  C C    . LYS A 1 81  ? -7.441  4.053   -2.410  1.00 0.00 ? 81  LYS A C    1  
ATOM 1249  O O    . LYS A 1 81  ? -8.215  3.590   -3.249  1.00 0.00 ? 81  LYS A O    1  
ATOM 1250  C CB   . LYS A 1 81  ? -8.461  5.830   -0.976  1.00 0.00 ? 81  LYS A CB   1  
ATOM 1251  C CG   . LYS A 1 81  ? -7.438  6.869   -1.401  1.00 0.00 ? 81  LYS A CG   1  
ATOM 1252  C CD   . LYS A 1 81  ? -8.026  8.270   -1.383  1.00 0.00 ? 81  LYS A CD   1  
ATOM 1253  C CE   . LYS A 1 81  ? -8.987  8.487   -2.542  1.00 0.00 ? 81  LYS A CE   1  
ATOM 1254  N NZ   . LYS A 1 81  ? -8.291  9.015   -3.747  1.00 0.00 ? 81  LYS A NZ   1  
ATOM 1255  H H    . LYS A 1 81  ? -6.734  4.918   0.663   1.00 0.00 ? 81  LYS A H    1  
ATOM 1256  H HA   . LYS A 1 81  ? -8.722  3.719   -0.737  1.00 0.00 ? 81  LYS A HA   1  
ATOM 1257  H HB2  . LYS A 1 81  ? -9.311  5.899   -1.640  1.00 0.00 ? 81  LYS A HB2  1  
ATOM 1258  H HB3  . LYS A 1 81  ? -8.781  6.061   0.030   1.00 0.00 ? 81  LYS A HB3  1  
ATOM 1259  H HG2  . LYS A 1 81  ? -6.599  6.834   -0.723  1.00 0.00 ? 81  LYS A HG2  1  
ATOM 1260  H HG3  . LYS A 1 81  ? -7.103  6.643   -2.403  1.00 0.00 ? 81  LYS A HG3  1  
ATOM 1261  H HD2  . LYS A 1 81  ? -8.560  8.415   -0.455  1.00 0.00 ? 81  LYS A HD2  1  
ATOM 1262  H HD3  . LYS A 1 81  ? -7.222  8.990   -1.454  1.00 0.00 ? 81  LYS A HD3  1  
ATOM 1263  H HE2  . LYS A 1 81  ? -9.451  7.545   -2.788  1.00 0.00 ? 81  LYS A HE2  1  
ATOM 1264  H HE3  . LYS A 1 81  ? -9.745  9.193   -2.235  1.00 0.00 ? 81  LYS A HE3  1  
ATOM 1265  H HZ1  . LYS A 1 81  ? -8.831  8.777   -4.604  1.00 0.00 ? 81  LYS A HZ1  1  
ATOM 1266  H HZ2  . LYS A 1 81  ? -7.342  8.599   -3.823  1.00 0.00 ? 81  LYS A HZ2  1  
ATOM 1267  H HZ3  . LYS A 1 81  ? -8.201  10.050  -3.684  1.00 0.00 ? 81  LYS A HZ3  1  
ATOM 1268  N N    . ALA A 1 82  ? -6.156  4.280   -2.660  1.00 0.00 ? 82  ALA A N    1  
ATOM 1269  C CA   . ALA A 1 82  ? -5.568  3.991   -3.962  1.00 0.00 ? 82  ALA A CA   1  
ATOM 1270  C C    . ALA A 1 82  ? -5.483  2.488   -4.204  1.00 0.00 ? 82  ALA A C    1  
ATOM 1271  O O    . ALA A 1 82  ? -5.716  2.015   -5.317  1.00 0.00 ? 82  ALA A O    1  
ATOM 1272  C CB   . ALA A 1 82  ? -4.188  4.624   -4.069  1.00 0.00 ? 82  ALA A CB   1  
ATOM 1273  H H    . ALA A 1 82  ? -5.590  4.650   -1.951  1.00 0.00 ? 82  ALA A H    1  
ATOM 1274  H HA   . ALA A 1 82  ? -6.200  4.433   -4.719  1.00 0.00 ? 82  ALA A HA   1  
ATOM 1275  H HB1  . ALA A 1 82  ? -4.126  5.467   -3.397  1.00 0.00 ? 82  ALA A HB1  1  
ATOM 1276  H HB2  . ALA A 1 82  ? -3.437  3.895   -3.805  1.00 0.00 ? 82  ALA A HB2  1  
ATOM 1277  H HB3  . ALA A 1 82  ? -4.024  4.959   -5.083  1.00 0.00 ? 82  ALA A HB3  1  
ATOM 1278  N N    . MET A 1 83  ? -5.147  1.742   -3.157  1.00 0.00 ? 83  MET A N    1  
ATOM 1279  C CA   . MET A 1 83  ? -5.033  0.292   -3.257  1.00 0.00 ? 83  MET A CA   1  
ATOM 1280  C C    . MET A 1 83  ? -6.355  -0.330  -3.696  1.00 0.00 ? 83  MET A C    1  
ATOM 1281  O O    . MET A 1 83  ? -6.384  -1.207  -4.560  1.00 0.00 ? 83  MET A O    1  
ATOM 1282  C CB   . MET A 1 83  ? -4.597  -0.300  -1.916  1.00 0.00 ? 83  MET A CB   1  
ATOM 1283  C CG   . MET A 1 83  ? -3.155  0.014   -1.551  1.00 0.00 ? 83  MET A CG   1  
ATOM 1284  S SD   . MET A 1 83  ? -2.457  -1.175  -0.389  1.00 0.00 ? 83  MET A SD   1  
ATOM 1285  C CE   . MET A 1 83  ? -3.176  -0.606  1.150   1.00 0.00 ? 83  MET A CE   1  
ATOM 1286  H H    . MET A 1 83  ? -4.974  2.177   -2.296  1.00 0.00 ? 83  MET A H    1  
ATOM 1287  H HA   . MET A 1 83  ? -4.280  0.070   -3.999  1.00 0.00 ? 83  MET A HA   1  
ATOM 1288  H HB2  . MET A 1 83  ? -5.236  0.091   -1.138  1.00 0.00 ? 83  MET A HB2  1  
ATOM 1289  H HB3  . MET A 1 83  ? -4.709  -1.374  -1.955  1.00 0.00 ? 83  MET A HB3  1  
ATOM 1290  H HG2  . MET A 1 83  ? -2.561  0.006   -2.452  1.00 0.00 ? 83  MET A HG2  1  
ATOM 1291  H HG3  . MET A 1 83  ? -3.118  0.997   -1.106  1.00 0.00 ? 83  MET A HG3  1  
ATOM 1292  H HE1  . MET A 1 83  ? -2.782  -1.190  1.969   1.00 0.00 ? 83  MET A HE1  1  
ATOM 1293  H HE2  . MET A 1 83  ? -2.931  0.434   1.298   1.00 0.00 ? 83  MET A HE2  1  
ATOM 1294  H HE3  . MET A 1 83  ? -4.250  -0.723  1.109   1.00 0.00 ? 83  MET A HE3  1  
ATOM 1295  N N    . VAL A 1 84  ? -7.448  0.131   -3.095  1.00 0.00 ? 84  VAL A N    1  
ATOM 1296  C CA   . VAL A 1 84  ? -8.774  -0.379  -3.424  1.00 0.00 ? 84  VAL A CA   1  
ATOM 1297  C C    . VAL A 1 84  ? -9.017  -0.345  -4.928  1.00 0.00 ? 84  VAL A C    1  
ATOM 1298  O O    . VAL A 1 84  ? -9.580  -1.280  -5.498  1.00 0.00 ? 84  VAL A O    1  
ATOM 1299  C CB   . VAL A 1 84  ? -9.878  0.430   -2.717  1.00 0.00 ? 84  VAL A CB   1  
ATOM 1300  C CG1  . VAL A 1 84  ? -11.253 -0.086  -3.113  1.00 0.00 ? 84  VAL A CG1  1  
ATOM 1301  C CG2  . VAL A 1 84  ? -9.692  0.377   -1.208  1.00 0.00 ? 84  VAL A CG2  1  
ATOM 1302  H H    . VAL A 1 84  ? -7.360  0.831   -2.414  1.00 0.00 ? 84  VAL A H    1  
ATOM 1303  H HA   . VAL A 1 84  ? -8.832  -1.403  -3.083  1.00 0.00 ? 84  VAL A HA   1  
ATOM 1304  H HB   . VAL A 1 84  ? -9.799  1.460   -3.033  1.00 0.00 ? 84  VAL A HB   1  
ATOM 1305  H HG11 . VAL A 1 84  ? -11.144 -0.955  -3.743  1.00 0.00 ? 84  VAL A HG11 1  
ATOM 1306  H HG12 . VAL A 1 84  ? -11.807 -0.351  -2.224  1.00 0.00 ? 84  VAL A HG12 1  
ATOM 1307  H HG13 . VAL A 1 84  ? -11.784 0.685   -3.652  1.00 0.00 ? 84  VAL A HG13 1  
ATOM 1308  H HG21 . VAL A 1 84  ? -10.309 -0.408  -0.798  1.00 0.00 ? 84  VAL A HG21 1  
ATOM 1309  H HG22 . VAL A 1 84  ? -8.656  0.176   -0.978  1.00 0.00 ? 84  VAL A HG22 1  
ATOM 1310  H HG23 . VAL A 1 84  ? -9.979  1.324   -0.777  1.00 0.00 ? 84  VAL A HG23 1  
ATOM 1311  N N    . SER A 1 85  ? -8.590  0.740   -5.567  1.00 0.00 ? 85  SER A N    1  
ATOM 1312  C CA   . SER A 1 85  ? -8.765  0.899   -7.006  1.00 0.00 ? 85  SER A CA   1  
ATOM 1313  C C    . SER A 1 85  ? -7.961  -0.148  -7.770  1.00 0.00 ? 85  SER A C    1  
ATOM 1314  O O    . SER A 1 85  ? -8.427  -0.702  -8.766  1.00 0.00 ? 85  SER A O    1  
ATOM 1315  C CB   . SER A 1 85  ? -8.340  2.303   -7.441  1.00 0.00 ? 85  SER A CB   1  
ATOM 1316  O OG   . SER A 1 85  ? -8.373  2.431   -8.852  1.00 0.00 ? 85  SER A OG   1  
ATOM 1317  H H    . SER A 1 85  ? -8.149  1.452   -5.057  1.00 0.00 ? 85  SER A H    1  
ATOM 1318  H HA   . SER A 1 85  ? -9.814  0.764   -7.229  1.00 0.00 ? 85  SER A HA   1  
ATOM 1319  H HB2  . SER A 1 85  ? -9.012  3.029   -7.010  1.00 0.00 ? 85  SER A HB2  1  
ATOM 1320  H HB3  . SER A 1 85  ? -7.334  2.493   -7.097  1.00 0.00 ? 85  SER A HB3  1  
ATOM 1321  H HG   . SER A 1 85  ? -9.285  2.479   -9.148  1.00 0.00 ? 85  SER A HG   1  
ATOM 1322  N N    . TYR A 1 86  ? -6.749  -0.415  -7.295  1.00 0.00 ? 86  TYR A N    1  
ATOM 1323  C CA   . TYR A 1 86  ? -5.876  -1.394  -7.934  1.00 0.00 ? 86  TYR A CA   1  
ATOM 1324  C C    . TYR A 1 86  ? -6.595  -2.727  -8.116  1.00 0.00 ? 86  TYR A C    1  
ATOM 1325  O O    . TYR A 1 86  ? -6.501  -3.358  -9.167  1.00 0.00 ? 86  TYR A O    1  
ATOM 1326  C CB   . TYR A 1 86  ? -4.607  -1.595  -7.105  1.00 0.00 ? 86  TYR A CB   1  
ATOM 1327  C CG   . TYR A 1 86  ? -3.415  -2.037  -7.922  1.00 0.00 ? 86  TYR A CG   1  
ATOM 1328  C CD1  . TYR A 1 86  ? -2.913  -1.238  -8.943  1.00 0.00 ? 86  TYR A CD1  1  
ATOM 1329  C CD2  . TYR A 1 86  ? -2.789  -3.252  -7.674  1.00 0.00 ? 86  TYR A CD2  1  
ATOM 1330  C CE1  . TYR A 1 86  ? -1.823  -1.637  -9.692  1.00 0.00 ? 86  TYR A CE1  1  
ATOM 1331  C CE2  . TYR A 1 86  ? -1.698  -3.659  -8.418  1.00 0.00 ? 86  TYR A CE2  1  
ATOM 1332  C CZ   . TYR A 1 86  ? -1.219  -2.848  -9.426  1.00 0.00 ? 86  TYR A CZ   1  
ATOM 1333  O OH   . TYR A 1 86  ? -0.133  -3.251  -10.169 1.00 0.00 ? 86  TYR A OH   1  
ATOM 1334  H H    . TYR A 1 86  ? -6.432  0.058   -6.499  1.00 0.00 ? 86  TYR A H    1  
ATOM 1335  H HA   . TYR A 1 86  ? -5.603  -1.010  -8.907  1.00 0.00 ? 86  TYR A HA   1  
ATOM 1336  H HB2  . TYR A 1 86  ? -4.351  -0.666  -6.621  1.00 0.00 ? 86  TYR A HB2  1  
ATOM 1337  H HB3  . TYR A 1 86  ? -4.792  -2.348  -6.353  1.00 0.00 ? 86  TYR A HB3  1  
ATOM 1338  H HD1  . TYR A 1 86  ? -3.387  -0.290  -9.149  1.00 0.00 ? 86  TYR A HD1  1  
ATOM 1339  H HD2  . TYR A 1 86  ? -3.167  -3.884  -6.884  1.00 0.00 ? 86  TYR A HD2  1  
ATOM 1340  H HE1  . TYR A 1 86  ? -1.448  -1.003  -10.482 1.00 0.00 ? 86  TYR A HE1  1  
ATOM 1341  H HE2  . TYR A 1 86  ? -1.225  -4.607  -8.209  1.00 0.00 ? 86  TYR A HE2  1  
ATOM 1342  H HH   . TYR A 1 86  ? 0.671   -3.105  -9.665  1.00 0.00 ? 86  TYR A HH   1  
ATOM 1343  N N    . GLY A 1 87  ? -7.315  -3.150  -7.081  1.00 0.00 ? 87  GLY A N    1  
ATOM 1344  C CA   . GLY A 1 87  ? -8.041  -4.406  -7.145  1.00 0.00 ? 87  GLY A CA   1  
ATOM 1345  C C    . GLY A 1 87  ? -7.837  -5.257  -5.907  1.00 0.00 ? 87  GLY A C    1  
ATOM 1346  O O    . GLY A 1 87  ? -7.905  -6.484  -5.971  1.00 0.00 ? 87  GLY A O    1  
ATOM 1347  H H    . GLY A 1 87  ? -7.354  -2.605  -6.267  1.00 0.00 ? 87  GLY A H    1  
ATOM 1348  H HA2  . GLY A 1 87  ? -9.093  -4.195  -7.255  1.00 0.00 ? 87  GLY A HA2  1  
ATOM 1349  H HA3  . GLY A 1 87  ? -7.702  -4.960  -8.008  1.00 0.00 ? 87  GLY A HA3  1  
ATOM 1350  N N    . MET A 1 88  ? -7.585  -4.604  -4.777  1.00 0.00 ? 88  MET A N    1  
ATOM 1351  C CA   . MET A 1 88  ? -7.370  -5.309  -3.519  1.00 0.00 ? 88  MET A CA   1  
ATOM 1352  C C    . MET A 1 88  ? -8.700  -5.643  -2.849  1.00 0.00 ? 88  MET A C    1  
ATOM 1353  O O    . MET A 1 88  ? -9.764  -5.266  -3.339  1.00 0.00 ? 88  MET A O    1  
ATOM 1354  C CB   . MET A 1 88  ? -6.510  -4.466  -2.577  1.00 0.00 ? 88  MET A CB   1  
ATOM 1355  C CG   . MET A 1 88  ? -5.134  -4.142  -3.138  1.00 0.00 ? 88  MET A CG   1  
ATOM 1356  S SD   . MET A 1 88  ? -3.889  -3.937  -1.850  1.00 0.00 ? 88  MET A SD   1  
ATOM 1357  C CE   . MET A 1 88  ? -3.571  -5.645  -1.413  1.00 0.00 ? 88  MET A CE   1  
ATOM 1358  H H    . MET A 1 88  ? -7.544  -3.625  -4.788  1.00 0.00 ? 88  MET A H    1  
ATOM 1359  H HA   . MET A 1 88  ? -6.852  -6.230  -3.740  1.00 0.00 ? 88  MET A HA   1  
ATOM 1360  H HB2  . MET A 1 88  ? -7.021  -3.537  -2.376  1.00 0.00 ? 88  MET A HB2  1  
ATOM 1361  H HB3  . MET A 1 88  ? -6.378  -5.003  -1.649  1.00 0.00 ? 88  MET A HB3  1  
ATOM 1362  H HG2  . MET A 1 88  ? -4.827  -4.946  -3.790  1.00 0.00 ? 88  MET A HG2  1  
ATOM 1363  H HG3  . MET A 1 88  ? -5.199  -3.226  -3.705  1.00 0.00 ? 88  MET A HG3  1  
ATOM 1364  H HE1  . MET A 1 88  ? -4.266  -6.286  -1.933  1.00 0.00 ? 88  MET A HE1  1  
ATOM 1365  H HE2  . MET A 1 88  ? -2.561  -5.906  -1.695  1.00 0.00 ? 88  MET A HE2  1  
ATOM 1366  H HE3  . MET A 1 88  ? -3.691  -5.773  -0.346  1.00 0.00 ? 88  MET A HE3  1  
ATOM 1367  N N    . ASN A 1 89  ? -8.631  -6.352  -1.727  1.00 0.00 ? 89  ASN A N    1  
ATOM 1368  C CA   . ASN A 1 89  ? -9.830  -6.737  -0.991  1.00 0.00 ? 89  ASN A CA   1  
ATOM 1369  C C    . ASN A 1 89  ? -10.124 -5.742  0.128   1.00 0.00 ? 89  ASN A C    1  
ATOM 1370  O O    . ASN A 1 89  ? -9.253  -4.993  0.571   1.00 0.00 ? 89  ASN A O    1  
ATOM 1371  C CB   . ASN A 1 89  ? -9.666  -8.143  -0.409  1.00 0.00 ? 89  ASN A CB   1  
ATOM 1372  C CG   . ASN A 1 89  ? -10.147 -9.221  -1.361  1.00 0.00 ? 89  ASN A CG   1  
ATOM 1373  O OD1  . ASN A 1 89  ? -9.957  -9.126  -2.573  1.00 0.00 ? 89  ASN A OD1  1  
ATOM 1374  N ND2  . ASN A 1 89  ? -10.776 -10.255 -0.813  1.00 0.00 ? 89  ASN A ND2  1  
ATOM 1375  H H    . ASN A 1 89  ? -7.753  -6.624  -1.386  1.00 0.00 ? 89  ASN A H    1  
ATOM 1376  H HA   . ASN A 1 89  ? -10.657 -6.737  -1.683  1.00 0.00 ? 89  ASN A HA   1  
ATOM 1377  H HB2  . ASN A 1 89  ? -8.622  -8.319  -0.196  1.00 0.00 ? 89  ASN A HB2  1  
ATOM 1378  H HB3  . ASN A 1 89  ? -10.235 -8.216  0.507   1.00 0.00 ? 89  ASN A HB3  1  
ATOM 1379  H HD21 . ASN A 1 89  ? -10.893 -10.265 0.160   1.00 0.00 ? 89  ASN A HD21 1  
ATOM 1380  H HD22 . ASN A 1 89  ? -11.097 -10.967 -1.405  1.00 0.00 ? 89  ASN A HD22 1  
ATOM 1381  N N    . PRO A 1 90  ? -11.379 -5.736  0.598   1.00 0.00 ? 90  PRO A N    1  
ATOM 1382  C CA   . PRO A 1 90  ? -11.817 -4.839  1.673   1.00 0.00 ? 90  PRO A CA   1  
ATOM 1383  C C    . PRO A 1 90  ? -11.211 -5.210  3.021   1.00 0.00 ? 90  PRO A C    1  
ATOM 1384  O O    . PRO A 1 90  ? -11.397 -4.505  4.013   1.00 0.00 ? 90  PRO A O    1  
ATOM 1385  C CB   . PRO A 1 90  ? -13.335 -5.032  1.698   1.00 0.00 ? 90  PRO A CB   1  
ATOM 1386  C CG   . PRO A 1 90  ? -13.554 -6.394  1.138   1.00 0.00 ? 90  PRO A CG   1  
ATOM 1387  C CD   . PRO A 1 90  ? -12.469 -6.602  0.119   1.00 0.00 ? 90  PRO A CD   1  
ATOM 1388  H HA   . PRO A 1 90  ? -11.588 -3.808  1.448   1.00 0.00 ? 90  PRO A HA   1  
ATOM 1389  H HB2  . PRO A 1 90  ? -13.693 -4.961  2.716   1.00 0.00 ? 90  PRO A HB2  1  
ATOM 1390  H HB3  . PRO A 1 90  ? -13.809 -4.275  1.090   1.00 0.00 ? 90  PRO A HB3  1  
ATOM 1391  H HG2  . PRO A 1 90  ? -13.477 -7.131  1.923   1.00 0.00 ? 90  PRO A HG2  1  
ATOM 1392  H HG3  . PRO A 1 90  ? -14.525 -6.445  0.667   1.00 0.00 ? 90  PRO A HG3  1  
ATOM 1393  H HD2  . PRO A 1 90  ? -12.160 -7.636  0.101   1.00 0.00 ? 90  PRO A HD2  1  
ATOM 1394  H HD3  . PRO A 1 90  ? -12.806 -6.290  -0.860  1.00 0.00 ? 90  PRO A HD3  1  
ATOM 1395  N N    . VAL A 1 91  ? -10.484 -6.323  3.051   1.00 0.00 ? 91  VAL A N    1  
ATOM 1396  C CA   . VAL A 1 91  ? -9.848  -6.788  4.279   1.00 0.00 ? 91  VAL A CA   1  
ATOM 1397  C C    . VAL A 1 91  ? -8.330  -6.800  4.141   1.00 0.00 ? 91  VAL A C    1  
ATOM 1398  O O    . VAL A 1 91  ? -7.606  -6.809  5.137   1.00 0.00 ? 91  VAL A O    1  
ATOM 1399  C CB   . VAL A 1 91  ? -10.329 -8.201  4.659   1.00 0.00 ? 91  VAL A CB   1  
ATOM 1400  C CG1  . VAL A 1 91  ? -10.468 -9.070  3.419   1.00 0.00 ? 91  VAL A CG1  1  
ATOM 1401  C CG2  . VAL A 1 91  ? -9.375  -8.836  5.660   1.00 0.00 ? 91  VAL A CG2  1  
ATOM 1402  H H    . VAL A 1 91  ? -10.372 -6.844  2.229   1.00 0.00 ? 91  VAL A H    1  
ATOM 1403  H HA   . VAL A 1 91  ? -10.123 -6.111  5.074   1.00 0.00 ? 91  VAL A HA   1  
ATOM 1404  H HB   . VAL A 1 91  ? -11.300 -8.116  5.124   1.00 0.00 ? 91  VAL A HB   1  
ATOM 1405  H HG11 . VAL A 1 91  ? -11.288 -8.706  2.816   1.00 0.00 ? 91  VAL A HG11 1  
ATOM 1406  H HG12 . VAL A 1 91  ? -9.554  -9.031  2.846   1.00 0.00 ? 91  VAL A HG12 1  
ATOM 1407  H HG13 . VAL A 1 91  ? -10.665 -10.090 3.715   1.00 0.00 ? 91  VAL A HG13 1  
ATOM 1408  H HG21 . VAL A 1 91  ? -9.187  -8.143  6.467   1.00 0.00 ? 91  VAL A HG21 1  
ATOM 1409  H HG22 . VAL A 1 91  ? -9.817  -9.738  6.057   1.00 0.00 ? 91  VAL A HG22 1  
ATOM 1410  H HG23 . VAL A 1 91  ? -8.445  -9.078  5.168   1.00 0.00 ? 91  VAL A HG23 1  
ATOM 1411  N N    . ASP A 1 92  ? -7.854  -6.798  2.900   1.00 0.00 ? 92  ASP A N    1  
ATOM 1412  C CA   . ASP A 1 92  ? -6.421  -6.807  2.632   1.00 0.00 ? 92  ASP A CA   1  
ATOM 1413  C C    . ASP A 1 92  ? -5.844  -5.398  2.718   1.00 0.00 ? 92  ASP A C    1  
ATOM 1414  O O    . ASP A 1 92  ? -4.768  -5.122  2.186   1.00 0.00 ? 92  ASP A O    1  
ATOM 1415  C CB   . ASP A 1 92  ? -6.144  -7.402  1.250   1.00 0.00 ? 92  ASP A CB   1  
ATOM 1416  C CG   . ASP A 1 92  ? -6.334  -8.905  1.218   1.00 0.00 ? 92  ASP A CG   1  
ATOM 1417  O OD1  . ASP A 1 92  ? -7.172  -9.414  1.991   1.00 0.00 ? 92  ASP A OD1  1  
ATOM 1418  O OD2  . ASP A 1 92  ? -5.644  -9.573  0.419   1.00 0.00 ? 92  ASP A OD2  1  
ATOM 1419  H H    . ASP A 1 92  ? -8.482  -6.791  2.148   1.00 0.00 ? 92  ASP A H    1  
ATOM 1420  H HA   . ASP A 1 92  ? -5.947  -7.423  3.381   1.00 0.00 ? 92  ASP A HA   1  
ATOM 1421  H HB2  . ASP A 1 92  ? -6.817  -6.957  0.531   1.00 0.00 ? 92  ASP A HB2  1  
ATOM 1422  H HB3  . ASP A 1 92  ? -5.125  -7.179  0.967   1.00 0.00 ? 92  ASP A HB3  1  
ATOM 1423  N N    . LEU A 1 93  ? -6.566  -4.508  3.390   1.00 0.00 ? 93  LEU A N    1  
ATOM 1424  C CA   . LEU A 1 93  ? -6.126  -3.126  3.546   1.00 0.00 ? 93  LEU A CA   1  
ATOM 1425  C C    . LEU A 1 93  ? -5.731  -2.839  4.990   1.00 0.00 ? 93  LEU A C    1  
ATOM 1426  O O    . LEU A 1 93  ? -5.876  -3.693  5.867   1.00 0.00 ? 93  LEU A O    1  
ATOM 1427  C CB   . LEU A 1 93  ? -7.233  -2.166  3.108   1.00 0.00 ? 93  LEU A CB   1  
ATOM 1428  C CG   . LEU A 1 93  ? -7.791  -2.381  1.701   1.00 0.00 ? 93  LEU A CG   1  
ATOM 1429  C CD1  . LEU A 1 93  ? -9.095  -1.620  1.522   1.00 0.00 ? 93  LEU A CD1  1  
ATOM 1430  C CD2  . LEU A 1 93  ? -6.774  -1.954  0.652   1.00 0.00 ? 93  LEU A CD2  1  
ATOM 1431  H H    . LEU A 1 93  ? -7.415  -4.786  3.792   1.00 0.00 ? 93  LEU A H    1  
ATOM 1432  H HA   . LEU A 1 93  ? -5.263  -2.980  2.914   1.00 0.00 ? 93  LEU A HA   1  
ATOM 1433  H HB2  . LEU A 1 93  ? -8.051  -2.263  3.806   1.00 0.00 ? 93  LEU A HB2  1  
ATOM 1434  H HB3  . LEU A 1 93  ? -6.837  -1.161  3.158   1.00 0.00 ? 93  LEU A HB3  1  
ATOM 1435  H HG   . LEU A 1 93  ? -7.996  -3.434  1.559   1.00 0.00 ? 93  LEU A HG   1  
ATOM 1436  H HD11 . LEU A 1 93  ? -9.897  -2.319  1.335   1.00 0.00 ? 93  LEU A HD11 1  
ATOM 1437  H HD12 . LEU A 1 93  ? -9.005  -0.943  0.685   1.00 0.00 ? 93  LEU A HD12 1  
ATOM 1438  H HD13 . LEU A 1 93  ? -9.310  -1.057  2.418   1.00 0.00 ? 93  LEU A HD13 1  
ATOM 1439  H HD21 . LEU A 1 93  ? -5.796  -2.315  0.932   1.00 0.00 ? 93  LEU A HD21 1  
ATOM 1440  H HD22 . LEU A 1 93  ? -6.755  -0.876  0.588   1.00 0.00 ? 93  LEU A HD22 1  
ATOM 1441  H HD23 . LEU A 1 93  ? -7.050  -2.368  -0.306  1.00 0.00 ? 93  LEU A HD23 1  
ATOM 1442  N N    . PHE A 1 94  ? -5.231  -1.633  5.234   1.00 0.00 ? 94  PHE A N    1  
ATOM 1443  C CA   . PHE A 1 94  ? -4.816  -1.232  6.574   1.00 0.00 ? 94  PHE A CA   1  
ATOM 1444  C C    . PHE A 1 94  ? -5.193  0.221   6.849   1.00 0.00 ? 94  PHE A C    1  
ATOM 1445  O O    . PHE A 1 94  ? -5.152  1.062   5.952   1.00 0.00 ? 94  PHE A O    1  
ATOM 1446  C CB   . PHE A 1 94  ? -3.307  -1.420  6.740   1.00 0.00 ? 94  PHE A CB   1  
ATOM 1447  C CG   . PHE A 1 94  ? -2.490  -0.420  5.973   1.00 0.00 ? 94  PHE A CG   1  
ATOM 1448  C CD1  . PHE A 1 94  ? -2.187  -0.631  4.638   1.00 0.00 ? 94  PHE A CD1  1  
ATOM 1449  C CD2  . PHE A 1 94  ? -2.026  0.733   6.587   1.00 0.00 ? 94  PHE A CD2  1  
ATOM 1450  C CE1  . PHE A 1 94  ? -1.435  0.288   3.930   1.00 0.00 ? 94  PHE A CE1  1  
ATOM 1451  C CE2  . PHE A 1 94  ? -1.274  1.656   5.884   1.00 0.00 ? 94  PHE A CE2  1  
ATOM 1452  C CZ   . PHE A 1 94  ? -0.979  1.434   4.554   1.00 0.00 ? 94  PHE A CZ   1  
ATOM 1453  H H    . PHE A 1 94  ? -5.139  -0.995  4.494   1.00 0.00 ? 94  PHE A H    1  
ATOM 1454  H HA   . PHE A 1 94  ? -5.329  -1.865  7.281   1.00 0.00 ? 94  PHE A HA   1  
ATOM 1455  H HB2  . PHE A 1 94  ? -3.052  -1.324  7.785   1.00 0.00 ? 94  PHE A HB2  1  
ATOM 1456  H HB3  . PHE A 1 94  ? -3.034  -2.406  6.396   1.00 0.00 ? 94  PHE A HB3  1  
ATOM 1457  H HD1  . PHE A 1 94  ? -2.543  -1.525  4.148   1.00 0.00 ? 94  PHE A HD1  1  
ATOM 1458  H HD2  . PHE A 1 94  ? -2.257  0.908   7.629   1.00 0.00 ? 94  PHE A HD2  1  
ATOM 1459  H HE1  . PHE A 1 94  ? -1.206  0.112   2.890   1.00 0.00 ? 94  PHE A HE1  1  
ATOM 1460  H HE2  . PHE A 1 94  ? -0.920  2.550   6.376   1.00 0.00 ? 94  PHE A HE2  1  
ATOM 1461  H HZ   . PHE A 1 94  ? -0.392  2.152   4.003   1.00 0.00 ? 94  PHE A HZ   1  
ATOM 1462  N N    . GLU A 1 95  ? -5.559  0.505   8.094   1.00 0.00 ? 95  GLU A N    1  
ATOM 1463  C CA   . GLU A 1 95  ? -5.944  1.855   8.487   1.00 0.00 ? 95  GLU A CA   1  
ATOM 1464  C C    . GLU A 1 95  ? -4.720  2.760   8.601   1.00 0.00 ? 95  GLU A C    1  
ATOM 1465  O O    . GLU A 1 95  ? -3.591  2.282   8.711   1.00 0.00 ? 95  GLU A O    1  
ATOM 1466  C CB   . GLU A 1 95  ? -6.696  1.828   9.819   1.00 0.00 ? 95  GLU A CB   1  
ATOM 1467  C CG   . GLU A 1 95  ? -8.150  1.403   9.689   1.00 0.00 ? 95  GLU A CG   1  
ATOM 1468  C CD   . GLU A 1 95  ? -8.301  0.020   9.086   1.00 0.00 ? 95  GLU A CD   1  
ATOM 1469  O OE1  . GLU A 1 95  ? -8.228  -0.969  9.844   1.00 0.00 ? 95  GLU A OE1  1  
ATOM 1470  O OE2  . GLU A 1 95  ? -8.496  -0.071  7.855   1.00 0.00 ? 95  GLU A OE2  1  
ATOM 1471  H H    . GLU A 1 95  ? -5.571  -0.210  8.765   1.00 0.00 ? 95  GLU A H    1  
ATOM 1472  H HA   . GLU A 1 95  ? -6.598  2.250   7.724   1.00 0.00 ? 95  GLU A HA   1  
ATOM 1473  H HB2  . GLU A 1 95  ? -6.199  1.138   10.486  1.00 0.00 ? 95  GLU A HB2  1  
ATOM 1474  H HB3  . GLU A 1 95  ? -6.670  2.816   10.253  1.00 0.00 ? 95  GLU A HB3  1  
ATOM 1475  H HG2  . GLU A 1 95  ? -8.601  1.402   10.670  1.00 0.00 ? 95  GLU A HG2  1  
ATOM 1476  H HG3  . GLU A 1 95  ? -8.664  2.114   9.059   1.00 0.00 ? 95  GLU A HG3  1  
ATOM 1477  N N    . ALA A 1 96  ? -4.952  4.068   8.572   1.00 0.00 ? 96  ALA A N    1  
ATOM 1478  C CA   . ALA A 1 96  ? -3.870  5.038   8.672   1.00 0.00 ? 96  ALA A CA   1  
ATOM 1479  C C    . ALA A 1 96  ? -3.194  4.967   10.037  1.00 0.00 ? 96  ALA A C    1  
ATOM 1480  O O    . ALA A 1 96  ? -1.967  4.981   10.134  1.00 0.00 ? 96  ALA A O    1  
ATOM 1481  C CB   . ALA A 1 96  ? -4.396  6.443   8.415   1.00 0.00 ? 96  ALA A CB   1  
ATOM 1482  H H    . ALA A 1 96  ? -5.875  4.387   8.482   1.00 0.00 ? 96  ALA A H    1  
ATOM 1483  H HA   . ALA A 1 96  ? -3.142  4.807   7.908   1.00 0.00 ? 96  ALA A HA   1  
ATOM 1484  H HB1  . ALA A 1 96  ? -5.475  6.436   8.457   1.00 0.00 ? 96  ALA A HB1  1  
ATOM 1485  H HB2  . ALA A 1 96  ? -4.010  7.115   9.167   1.00 0.00 ? 96  ALA A HB2  1  
ATOM 1486  H HB3  . ALA A 1 96  ? -4.076  6.773   7.438   1.00 0.00 ? 96  ALA A HB3  1  
ATOM 1487  N N    . ASN A 1 97  ? -4.002  4.890   11.090  1.00 0.00 ? 97  ASN A N    1  
ATOM 1488  C CA   . ASN A 1 97  ? -3.480  4.818   12.450  1.00 0.00 ? 97  ASN A CA   1  
ATOM 1489  C C    . ASN A 1 97  ? -2.634  3.563   12.641  1.00 0.00 ? 97  ASN A C    1  
ATOM 1490  O O    . ASN A 1 97  ? -1.590  3.599   13.293  1.00 0.00 ? 97  ASN A O    1  
ATOM 1491  C CB   . ASN A 1 97  ? -4.628  4.832   13.461  1.00 0.00 ? 97  ASN A CB   1  
ATOM 1492  C CG   . ASN A 1 97  ? -5.770  5.731   13.026  1.00 0.00 ? 97  ASN A CG   1  
ATOM 1493  O OD1  . ASN A 1 97  ? -5.621  6.951   12.958  1.00 0.00 ? 97  ASN A OD1  1  
ATOM 1494  N ND2  . ASN A 1 97  ? -6.917  5.131   12.731  1.00 0.00 ? 97  ASN A ND2  1  
ATOM 1495  H H    . ASN A 1 97  ? -4.972  4.883   10.949  1.00 0.00 ? 97  ASN A H    1  
ATOM 1496  H HA   . ASN A 1 97  ? -2.858  5.685   12.613  1.00 0.00 ? 97  ASN A HA   1  
ATOM 1497  H HB2  . ASN A 1 97  ? -5.011  3.827   13.575  1.00 0.00 ? 97  ASN A HB2  1  
ATOM 1498  H HB3  . ASN A 1 97  ? -4.260  5.182   14.413  1.00 0.00 ? 97  ASN A HB3  1  
ATOM 1499  H HD21 . ASN A 1 97  ? -6.962  4.155   12.808  1.00 0.00 ? 97  ASN A HD21 1  
ATOM 1500  H HD22 . ASN A 1 97  ? -7.671  5.689   12.447  1.00 0.00 ? 97  ASN A HD22 1  
ATOM 1501  N N    . ASP A 1 98  ? -3.091  2.454   12.069  1.00 0.00 ? 98  ASP A N    1  
ATOM 1502  C CA   . ASP A 1 98  ? -2.377  1.188   12.176  1.00 0.00 ? 98  ASP A CA   1  
ATOM 1503  C C    . ASP A 1 98  ? -0.870  1.405   12.078  1.00 0.00 ? 98  ASP A C    1  
ATOM 1504  O O    . ASP A 1 98  ? -0.099  0.845   12.859  1.00 0.00 ? 98  ASP A O    1  
ATOM 1505  C CB   . ASP A 1 98  ? -2.838  0.224   11.081  1.00 0.00 ? 98  ASP A CB   1  
ATOM 1506  C CG   . ASP A 1 98  ? -4.195  -0.382  11.378  1.00 0.00 ? 98  ASP A CG   1  
ATOM 1507  O OD1  . ASP A 1 98  ? -4.631  -0.317  12.547  1.00 0.00 ? 98  ASP A OD1  1  
ATOM 1508  O OD2  . ASP A 1 98  ? -4.821  -0.922  10.442  1.00 0.00 ? 98  ASP A OD2  1  
ATOM 1509  H H    . ASP A 1 98  ? -3.930  2.489   11.563  1.00 0.00 ? 98  ASP A H    1  
ATOM 1510  H HA   . ASP A 1 98  ? -2.604  0.759   13.140  1.00 0.00 ? 98  ASP A HA   1  
ATOM 1511  H HB2  . ASP A 1 98  ? -2.900  0.757   10.143  1.00 0.00 ? 98  ASP A HB2  1  
ATOM 1512  H HB3  . ASP A 1 98  ? -2.118  -0.575  10.988  1.00 0.00 ? 98  ASP A HB3  1  
ATOM 1513  N N    . LEU A 1 99  ? -0.456  2.220   11.114  1.00 0.00 ? 99  LEU A N    1  
ATOM 1514  C CA   . LEU A 1 99  ? 0.960   2.510   10.912  1.00 0.00 ? 99  LEU A CA   1  
ATOM 1515  C C    . LEU A 1 99  ? 1.377   3.751   11.694  1.00 0.00 ? 99  LEU A C    1  
ATOM 1516  O O    . LEU A 1 99  ? 2.363   3.730   12.432  1.00 0.00 ? 99  LEU A O    1  
ATOM 1517  C CB   . LEU A 1 99  ? 1.253   2.709   9.425   1.00 0.00 ? 99  LEU A CB   1  
ATOM 1518  C CG   . LEU A 1 99  ? 2.728   2.672   9.020   1.00 0.00 ? 99  LEU A CG   1  
ATOM 1519  C CD1  . LEU A 1 99  ? 3.303   1.279   9.223   1.00 0.00 ? 99  LEU A CD1  1  
ATOM 1520  C CD2  . LEU A 1 99  ? 2.895   3.116   7.574   1.00 0.00 ? 99  LEU A CD2  1  
ATOM 1521  H H    . LEU A 1 99  ? -1.117  2.636   10.523  1.00 0.00 ? 99  LEU A H    1  
ATOM 1522  H HA   . LEU A 1 99  ? 1.526   1.664   11.273  1.00 0.00 ? 99  LEU A HA   1  
ATOM 1523  H HB2  . LEU A 1 99  ? 0.742   1.930   8.880   1.00 0.00 ? 99  LEU A HB2  1  
ATOM 1524  H HB3  . LEU A 1 99  ? 0.854   3.670   9.135   1.00 0.00 ? 99  LEU A HB3  1  
ATOM 1525  H HG   . LEU A 1 99  ? 3.283   3.356   9.647   1.00 0.00 ? 99  LEU A HG   1  
ATOM 1526  H HD11 . LEU A 1 99  ? 2.500   0.557   9.236   1.00 0.00 ? 99  LEU A HD11 1  
ATOM 1527  H HD12 . LEU A 1 99  ? 3.834   1.242   10.162  1.00 0.00 ? 99  LEU A HD12 1  
ATOM 1528  H HD13 . LEU A 1 99  ? 3.982   1.049   8.415   1.00 0.00 ? 99  LEU A HD13 1  
ATOM 1529  H HD21 . LEU A 1 99  ? 1.964   2.977   7.046   1.00 0.00 ? 99  LEU A HD21 1  
ATOM 1530  H HD22 . LEU A 1 99  ? 3.668   2.524   7.104   1.00 0.00 ? 99  LEU A HD22 1  
ATOM 1531  H HD23 . LEU A 1 99  ? 3.172   4.158   7.547   1.00 0.00 ? 99  LEU A HD23 1  
ATOM 1532  N N    . PHE A 1 100 ? 0.619   4.830   11.531  1.00 0.00 ? 100 PHE A N    1  
ATOM 1533  C CA   . PHE A 1 100 ? 0.911   6.081   12.222  1.00 0.00 ? 100 PHE A CA   1  
ATOM 1534  C C    . PHE A 1 100 ? 1.212   5.829   13.697  1.00 0.00 ? 100 PHE A C    1  
ATOM 1535  O O    . PHE A 1 100 ? 2.327   6.062   14.162  1.00 0.00 ? 100 PHE A O    1  
ATOM 1536  C CB   . PHE A 1 100 ? -0.267  7.048   12.088  1.00 0.00 ? 100 PHE A CB   1  
ATOM 1537  C CG   . PHE A 1 100 ? 0.077   8.465   12.448  1.00 0.00 ? 100 PHE A CG   1  
ATOM 1538  C CD1  . PHE A 1 100 ? 1.028   9.166   11.725  1.00 0.00 ? 100 PHE A CD1  1  
ATOM 1539  C CD2  . PHE A 1 100 ? -0.550  9.096   13.511  1.00 0.00 ? 100 PHE A CD2  1  
ATOM 1540  C CE1  . PHE A 1 100 ? 1.347   10.471  12.053  1.00 0.00 ? 100 PHE A CE1  1  
ATOM 1541  C CE2  . PHE A 1 100 ? -0.236  10.400  13.844  1.00 0.00 ? 100 PHE A CE2  1  
ATOM 1542  C CZ   . PHE A 1 100 ? 0.715   11.088  13.115  1.00 0.00 ? 100 PHE A CZ   1  
ATOM 1543  H H    . PHE A 1 100 ? -0.153  4.785   10.929  1.00 0.00 ? 100 PHE A H    1  
ATOM 1544  H HA   . PHE A 1 100 ? 1.780   6.521   11.760  1.00 0.00 ? 100 PHE A HA   1  
ATOM 1545  H HB2  . PHE A 1 100 ? -0.616  7.042   11.067  1.00 0.00 ? 100 PHE A HB2  1  
ATOM 1546  H HB3  . PHE A 1 100 ? -1.066  6.724   12.739  1.00 0.00 ? 100 PHE A HB3  1  
ATOM 1547  H HD1  . PHE A 1 100 ? 1.523   8.684   10.894  1.00 0.00 ? 100 PHE A HD1  1  
ATOM 1548  H HD2  . PHE A 1 100 ? -1.293  8.560   14.083  1.00 0.00 ? 100 PHE A HD2  1  
ATOM 1549  H HE1  . PHE A 1 100 ? 2.090   11.005  11.480  1.00 0.00 ? 100 PHE A HE1  1  
ATOM 1550  H HE2  . PHE A 1 100 ? -0.731  10.880  14.674  1.00 0.00 ? 100 PHE A HE2  1  
ATOM 1551  H HZ   . PHE A 1 100 ? 0.962   12.107  13.373  1.00 0.00 ? 100 PHE A HZ   1  
ATOM 1552  N N    . GLU A 1 101 ? 0.207   5.354   14.427  1.00 0.00 ? 101 GLU A N    1  
ATOM 1553  C CA   . GLU A 1 101 ? 0.365   5.072   15.850  1.00 0.00 ? 101 GLU A CA   1  
ATOM 1554  C C    . GLU A 1 101 ? 0.598   3.583   16.087  1.00 0.00 ? 101 GLU A C    1  
ATOM 1555  O O    . GLU A 1 101 ? 0.105   3.014   17.061  1.00 0.00 ? 101 GLU A O    1  
ATOM 1556  C CB   . GLU A 1 101 ? -0.872  5.536   16.623  1.00 0.00 ? 101 GLU A CB   1  
ATOM 1557  C CG   . GLU A 1 101 ? -1.253  6.982   16.352  1.00 0.00 ? 101 GLU A CG   1  
ATOM 1558  C CD   . GLU A 1 101 ? -1.954  7.631   17.529  1.00 0.00 ? 101 GLU A CD   1  
ATOM 1559  O OE1  . GLU A 1 101 ? -1.254  8.128   18.436  1.00 0.00 ? 101 GLU A OE1  1  
ATOM 1560  O OE2  . GLU A 1 101 ? -3.202  7.642   17.544  1.00 0.00 ? 101 GLU A OE2  1  
ATOM 1561  H H    . GLU A 1 101 ? -0.659  5.190   14.000  1.00 0.00 ? 101 GLU A H    1  
ATOM 1562  H HA   . GLU A 1 101 ? 1.225   5.619   16.202  1.00 0.00 ? 101 GLU A HA   1  
ATOM 1563  H HB2  . GLU A 1 101 ? -1.707  4.908   16.352  1.00 0.00 ? 101 GLU A HB2  1  
ATOM 1564  H HB3  . GLU A 1 101 ? -0.680  5.429   17.681  1.00 0.00 ? 101 GLU A HB3  1  
ATOM 1565  H HG2  . GLU A 1 101 ? -0.356  7.542   16.134  1.00 0.00 ? 101 GLU A HG2  1  
ATOM 1566  H HG3  . GLU A 1 101 ? -1.913  7.012   15.497  1.00 0.00 ? 101 GLU A HG3  1  
ATOM 1567  N N    . SER A 1 102 ? 1.350   2.957   15.188  1.00 0.00 ? 102 SER A N    1  
ATOM 1568  C CA   . SER A 1 102 ? 1.645   1.534   15.296  1.00 0.00 ? 102 SER A CA   1  
ATOM 1569  C C    . SER A 1 102 ? 0.420   0.759   15.773  1.00 0.00 ? 102 SER A C    1  
ATOM 1570  O O    . SER A 1 102 ? 0.541   -0.313  16.363  1.00 0.00 ? 102 SER A O    1  
ATOM 1571  C CB   . SER A 1 102 ? 2.813   1.305   16.257  1.00 0.00 ? 102 SER A CB   1  
ATOM 1572  O OG   . SER A 1 102 ? 2.460   1.660   17.582  1.00 0.00 ? 102 SER A OG   1  
ATOM 1573  H H    . SER A 1 102 ? 1.713   3.465   14.432  1.00 0.00 ? 102 SER A H    1  
ATOM 1574  H HA   . SER A 1 102 ? 1.923   1.177   14.315  1.00 0.00 ? 102 SER A HA   1  
ATOM 1575  H HB2  . SER A 1 102 ? 3.092   0.262   16.239  1.00 0.00 ? 102 SER A HB2  1  
ATOM 1576  H HB3  . SER A 1 102 ? 3.654   1.907   15.947  1.00 0.00 ? 102 SER A HB3  1  
ATOM 1577  H HG   . SER A 1 102 ? 3.226   2.028   18.030  1.00 0.00 ? 102 SER A HG   1  
ATOM 1578  N N    . GLY A 1 103 ? -0.761  1.312   15.511  1.00 0.00 ? 103 GLY A N    1  
ATOM 1579  C CA   . GLY A 1 103 ? -1.991  0.661   15.920  1.00 0.00 ? 103 GLY A CA   1  
ATOM 1580  C C    . GLY A 1 103 ? -2.129  -0.734  15.344  1.00 0.00 ? 103 GLY A C    1  
ATOM 1581  O O    . GLY A 1 103 ? -2.974  -1.512  15.781  1.00 0.00 ? 103 GLY A O    1  
ATOM 1582  H H    . GLY A 1 103 ? -0.796  2.169   15.036  1.00 0.00 ? 103 GLY A H    1  
ATOM 1583  H HA2  . GLY A 1 103 ? -2.011  0.598   16.998  1.00 0.00 ? 103 GLY A HA2  1  
ATOM 1584  H HA3  . GLY A 1 103 ? -2.828  1.259   15.590  1.00 0.00 ? 103 GLY A HA3  1  
ATOM 1585  N N    . ASN A 1 104 ? -1.296  -1.049  14.357  1.00 0.00 ? 104 ASN A N    1  
ATOM 1586  C CA   . ASN A 1 104 ? -1.331  -2.360  13.718  1.00 0.00 ? 104 ASN A CA   1  
ATOM 1587  C C    . ASN A 1 104 ? -0.199  -2.500  12.704  1.00 0.00 ? 104 ASN A C    1  
ATOM 1588  O O    . ASN A 1 104 ? -0.190  -1.830  11.672  1.00 0.00 ? 104 ASN A O    1  
ATOM 1589  C CB   . ASN A 1 104 ? -2.678  -2.577  13.027  1.00 0.00 ? 104 ASN A CB   1  
ATOM 1590  C CG   . ASN A 1 104 ? -3.081  -4.039  12.994  1.00 0.00 ? 104 ASN A CG   1  
ATOM 1591  O OD1  . ASN A 1 104 ? -2.241  -4.929  13.131  1.00 0.00 ? 104 ASN A OD1  1  
ATOM 1592  N ND2  . ASN A 1 104 ? -4.372  -4.293  12.813  1.00 0.00 ? 104 ASN A ND2  1  
ATOM 1593  H H    . ASN A 1 104 ? -0.643  -0.385  14.052  1.00 0.00 ? 104 ASN A H    1  
ATOM 1594  H HA   . ASN A 1 104 ? -1.205  -3.106  14.487  1.00 0.00 ? 104 ASN A HA   1  
ATOM 1595  H HB2  . ASN A 1 104 ? -3.441  -2.026  13.558  1.00 0.00 ? 104 ASN A HB2  1  
ATOM 1596  H HB3  . ASN A 1 104 ? -2.620  -2.216  12.012  1.00 0.00 ? 104 ASN A HB3  1  
ATOM 1597  H HD21 . ASN A 1 104 ? -4.983  -3.534  12.711  1.00 0.00 ? 104 ASN A HD21 1  
ATOM 1598  H HD22 . ASN A 1 104 ? -4.660  -5.230  12.788  1.00 0.00 ? 104 ASN A HD22 1  
ATOM 1599  N N    . MET A 1 105 ? 0.754   -3.376  13.007  1.00 0.00 ? 105 MET A N    1  
ATOM 1600  C CA   . MET A 1 105 ? 1.889   -3.606  12.122  1.00 0.00 ? 105 MET A CA   1  
ATOM 1601  C C    . MET A 1 105 ? 1.716   -4.905  11.341  1.00 0.00 ? 105 MET A C    1  
ATOM 1602  O O    . MET A 1 105 ? 2.514   -5.223  10.459  1.00 0.00 ? 105 MET A O    1  
ATOM 1603  C CB   . MET A 1 105 ? 3.190   -3.651  12.926  1.00 0.00 ? 105 MET A CB   1  
ATOM 1604  C CG   . MET A 1 105 ? 3.859   -2.295  13.075  1.00 0.00 ? 105 MET A CG   1  
ATOM 1605  S SD   . MET A 1 105 ? 5.035   -1.951  11.752  1.00 0.00 ? 105 MET A SD   1  
ATOM 1606  C CE   . MET A 1 105 ? 3.923   -1.652  10.380  1.00 0.00 ? 105 MET A CE   1  
ATOM 1607  H H    . MET A 1 105 ? 0.692   -3.881  13.845  1.00 0.00 ? 105 MET A H    1  
ATOM 1608  H HA   . MET A 1 105 ? 1.937   -2.784  11.424  1.00 0.00 ? 105 MET A HA   1  
ATOM 1609  H HB2  . MET A 1 105 ? 2.975   -4.032  13.914  1.00 0.00 ? 105 MET A HB2  1  
ATOM 1610  H HB3  . MET A 1 105 ? 3.881   -4.317  12.434  1.00 0.00 ? 105 MET A HB3  1  
ATOM 1611  H HG2  . MET A 1 105 ? 3.098   -1.529  13.067  1.00 0.00 ? 105 MET A HG2  1  
ATOM 1612  H HG3  . MET A 1 105 ? 4.383   -2.269  14.019  1.00 0.00 ? 105 MET A HG3  1  
ATOM 1613  H HE1  . MET A 1 105 ? 3.627   -2.595  9.944   1.00 0.00 ? 105 MET A HE1  1  
ATOM 1614  H HE2  . MET A 1 105 ? 3.048   -1.128  10.734  1.00 0.00 ? 105 MET A HE2  1  
ATOM 1615  H HE3  . MET A 1 105 ? 4.425   -1.053  9.634   1.00 0.00 ? 105 MET A HE3  1  
ATOM 1616  N N    . THR A 1 106 ? 0.668   -5.654  11.672  1.00 0.00 ? 106 THR A N    1  
ATOM 1617  C CA   . THR A 1 106 ? 0.391   -6.919  11.003  1.00 0.00 ? 106 THR A CA   1  
ATOM 1618  C C    . THR A 1 106 ? -0.491  -6.710  9.777   1.00 0.00 ? 106 THR A C    1  
ATOM 1619  O O    . THR A 1 106 ? -0.311  -7.370  8.754   1.00 0.00 ? 106 THR A O    1  
ATOM 1620  C CB   . THR A 1 106 ? -0.297  -7.917  11.952  1.00 0.00 ? 106 THR A CB   1  
ATOM 1621  O OG1  . THR A 1 106 ? -1.715  -7.713  11.935  1.00 0.00 ? 106 THR A OG1  1  
ATOM 1622  C CG2  . THR A 1 106 ? 0.226   -7.761  13.373  1.00 0.00 ? 106 THR A CG2  1  
ATOM 1623  H H    . THR A 1 106 ? 0.068   -5.348  12.384  1.00 0.00 ? 106 THR A H    1  
ATOM 1624  H HA   . THR A 1 106 ? 1.334   -7.344  10.689  1.00 0.00 ? 106 THR A HA   1  
ATOM 1625  H HB   . THR A 1 106 ? -0.081  -8.920  11.613  1.00 0.00 ? 106 THR A HB   1  
ATOM 1626  H HG1  . THR A 1 106 ? -1.903  -6.776  12.012  1.00 0.00 ? 106 THR A HG1  1  
ATOM 1627  H HG21 . THR A 1 106 ? -0.358  -8.377  14.041  1.00 0.00 ? 106 THR A HG21 1  
ATOM 1628  H HG22 . THR A 1 106 ? 0.147   -6.727  13.674  1.00 0.00 ? 106 THR A HG22 1  
ATOM 1629  H HG23 . THR A 1 106 ? 1.259   -8.071  13.411  1.00 0.00 ? 106 THR A HG23 1  
ATOM 1630  N N    . GLN A 1 107 ? -1.443  -5.790  9.888   1.00 0.00 ? 107 GLN A N    1  
ATOM 1631  C CA   . GLN A 1 107 ? -2.352  -5.496  8.787   1.00 0.00 ? 107 GLN A CA   1  
ATOM 1632  C C    . GLN A 1 107 ? -1.625  -4.773  7.658   1.00 0.00 ? 107 GLN A C    1  
ATOM 1633  O O    . GLN A 1 107 ? -1.905  -5.000  6.481   1.00 0.00 ? 107 GLN A O    1  
ATOM 1634  C CB   . GLN A 1 107 ? -3.525  -4.646  9.279   1.00 0.00 ? 107 GLN A CB   1  
ATOM 1635  C CG   . GLN A 1 107 ? -4.796  -4.835  8.467   1.00 0.00 ? 107 GLN A CG   1  
ATOM 1636  C CD   . GLN A 1 107 ? -5.457  -6.177  8.719   1.00 0.00 ? 107 GLN A CD   1  
ATOM 1637  O OE1  . GLN A 1 107 ? -6.240  -6.329  9.656   1.00 0.00 ? 107 GLN A OE1  1  
ATOM 1638  N NE2  . GLN A 1 107 ? -5.142  -7.158  7.881   1.00 0.00 ? 107 GLN A NE2  1  
ATOM 1639  H H    . GLN A 1 107 ? -1.536  -5.297  10.730  1.00 0.00 ? 107 GLN A H    1  
ATOM 1640  H HA   . GLN A 1 107 ? -2.732  -6.434  8.411   1.00 0.00 ? 107 GLN A HA   1  
ATOM 1641  H HB2  . GLN A 1 107 ? -3.737  -4.907  10.305  1.00 0.00 ? 107 GLN A HB2  1  
ATOM 1642  H HB3  . GLN A 1 107 ? -3.245  -3.604  9.231   1.00 0.00 ? 107 GLN A HB3  1  
ATOM 1643  H HG2  . GLN A 1 107 ? -5.495  -4.054  8.728   1.00 0.00 ? 107 GLN A HG2  1  
ATOM 1644  H HG3  . GLN A 1 107 ? -4.552  -4.762  7.418   1.00 0.00 ? 107 GLN A HG3  1  
ATOM 1645  H HE21 . GLN A 1 107 ? -4.509  -6.963  7.158   1.00 0.00 ? 107 GLN A HE21 1  
ATOM 1646  H HE22 . GLN A 1 107 ? -5.553  -8.036  8.021   1.00 0.00 ? 107 GLN A HE22 1  
ATOM 1647  N N    . VAL A 1 108 ? -0.690  -3.903  8.025   1.00 0.00 ? 108 VAL A N    1  
ATOM 1648  C CA   . VAL A 1 108 ? 0.079   -3.147  7.042   1.00 0.00 ? 108 VAL A CA   1  
ATOM 1649  C C    . VAL A 1 108 ? 1.082   -4.042  6.324   1.00 0.00 ? 108 VAL A C    1  
ATOM 1650  O O    . VAL A 1 108 ? 1.349   -3.860  5.136   1.00 0.00 ? 108 VAL A O    1  
ATOM 1651  C CB   . VAL A 1 108 ? 0.832   -1.975  7.700   1.00 0.00 ? 108 VAL A CB   1  
ATOM 1652  C CG1  . VAL A 1 108 ? 1.671   -1.234  6.670   1.00 0.00 ? 108 VAL A CG1  1  
ATOM 1653  C CG2  . VAL A 1 108 ? -0.146  -1.031  8.383   1.00 0.00 ? 108 VAL A CG2  1  
ATOM 1654  H H    . VAL A 1 108 ? -0.513  -3.766  8.978   1.00 0.00 ? 108 VAL A H    1  
ATOM 1655  H HA   . VAL A 1 108 ? -0.613  -2.742  6.318   1.00 0.00 ? 108 VAL A HA   1  
ATOM 1656  H HB   . VAL A 1 108 ? 1.496   -2.377  8.451   1.00 0.00 ? 108 VAL A HB   1  
ATOM 1657  H HG11 . VAL A 1 108 ? 2.074   -1.941  5.959   1.00 0.00 ? 108 VAL A HG11 1  
ATOM 1658  H HG12 . VAL A 1 108 ? 1.054   -0.514  6.154   1.00 0.00 ? 108 VAL A HG12 1  
ATOM 1659  H HG13 . VAL A 1 108 ? 2.482   -0.723  7.168   1.00 0.00 ? 108 VAL A HG13 1  
ATOM 1660  H HG21 . VAL A 1 108 ? 0.272   -0.035  8.405   1.00 0.00 ? 108 VAL A HG21 1  
ATOM 1661  H HG22 . VAL A 1 108 ? -1.077  -1.018  7.835   1.00 0.00 ? 108 VAL A HG22 1  
ATOM 1662  H HG23 . VAL A 1 108 ? -0.327  -1.368  9.393   1.00 0.00 ? 108 VAL A HG23 1  
ATOM 1663  N N    . GLN A 1 109 ? 1.632   -5.008  7.051   1.00 0.00 ? 109 GLN A N    1  
ATOM 1664  C CA   . GLN A 1 109 ? 2.607   -5.931  6.481   1.00 0.00 ? 109 GLN A CA   1  
ATOM 1665  C C    . GLN A 1 109 ? 1.977   -6.776  5.378   1.00 0.00 ? 109 GLN A C    1  
ATOM 1666  O O    . GLN A 1 109 ? 2.471   -6.812  4.252   1.00 0.00 ? 109 GLN A O    1  
ATOM 1667  C CB   . GLN A 1 109 ? 3.178   -6.840  7.572   1.00 0.00 ? 109 GLN A CB   1  
ATOM 1668  C CG   . GLN A 1 109 ? 4.378   -7.656  7.117   1.00 0.00 ? 109 GLN A CG   1  
ATOM 1669  C CD   . GLN A 1 109 ? 5.341   -7.957  8.249   1.00 0.00 ? 109 GLN A CD   1  
ATOM 1670  O OE1  . GLN A 1 109 ? 5.481   -7.170  9.186   1.00 0.00 ? 109 GLN A OE1  1  
ATOM 1671  N NE2  . GLN A 1 109 ? 6.010   -9.100  8.168   1.00 0.00 ? 109 GLN A NE2  1  
ATOM 1672  H H    . GLN A 1 109 ? 1.378   -5.102  7.992   1.00 0.00 ? 109 GLN A H    1  
ATOM 1673  H HA   . GLN A 1 109 ? 3.409   -5.347  6.057   1.00 0.00 ? 109 GLN A HA   1  
ATOM 1674  H HB2  . GLN A 1 109 ? 3.481   -6.230  8.410   1.00 0.00 ? 109 GLN A HB2  1  
ATOM 1675  H HB3  . GLN A 1 109 ? 2.407   -7.524  7.894   1.00 0.00 ? 109 GLN A HB3  1  
ATOM 1676  H HG2  . GLN A 1 109 ? 4.026   -8.591  6.706   1.00 0.00 ? 109 GLN A HG2  1  
ATOM 1677  H HG3  . GLN A 1 109 ? 4.904   -7.102  6.354   1.00 0.00 ? 109 GLN A HG3  1  
ATOM 1678  H HE21 . GLN A 1 109 ? 5.848   -9.677  7.391   1.00 0.00 ? 109 GLN A HE21 1  
ATOM 1679  H HE22 . GLN A 1 109 ? 6.640   -9.321  8.885   1.00 0.00 ? 109 GLN A HE22 1  
ATOM 1680  N N    . VAL A 1 110 ? 0.883   -7.453  5.711   1.00 0.00 ? 110 VAL A N    1  
ATOM 1681  C CA   . VAL A 1 110 ? 0.184   -8.297  4.748   1.00 0.00 ? 110 VAL A CA   1  
ATOM 1682  C C    . VAL A 1 110 ? -0.286  -7.486  3.546   1.00 0.00 ? 110 VAL A C    1  
ATOM 1683  O O    . VAL A 1 110 ? -0.115  -7.900  2.399   1.00 0.00 ? 110 VAL A O    1  
ATOM 1684  C CB   . VAL A 1 110 ? -1.030  -8.994  5.390   1.00 0.00 ? 110 VAL A CB   1  
ATOM 1685  C CG1  . VAL A 1 110 ? -0.579  -9.967  6.468   1.00 0.00 ? 110 VAL A CG1  1  
ATOM 1686  C CG2  . VAL A 1 110 ? -1.996  -7.966  5.957   1.00 0.00 ? 110 VAL A CG2  1  
ATOM 1687  H H    . VAL A 1 110 ? 0.537   -7.384  6.625   1.00 0.00 ? 110 VAL A H    1  
ATOM 1688  H HA   . VAL A 1 110 ? 0.873   -9.058  4.410   1.00 0.00 ? 110 VAL A HA   1  
ATOM 1689  H HB   . VAL A 1 110 ? -1.544  -9.555  4.623   1.00 0.00 ? 110 VAL A HB   1  
ATOM 1690  H HG11 . VAL A 1 110 ? 0.381   -10.384 6.199   1.00 0.00 ? 110 VAL A HG11 1  
ATOM 1691  H HG12 . VAL A 1 110 ? -0.494  -9.446  7.411   1.00 0.00 ? 110 VAL A HG12 1  
ATOM 1692  H HG13 . VAL A 1 110 ? -1.303  -10.763 6.560   1.00 0.00 ? 110 VAL A HG13 1  
ATOM 1693  H HG21 . VAL A 1 110 ? -2.707  -8.458  6.602   1.00 0.00 ? 110 VAL A HG21 1  
ATOM 1694  H HG22 . VAL A 1 110 ? -1.445  -7.229  6.525   1.00 0.00 ? 110 VAL A HG22 1  
ATOM 1695  H HG23 . VAL A 1 110 ? -2.519  -7.477  5.149   1.00 0.00 ? 110 VAL A HG23 1  
ATOM 1696  N N    . SER A 1 111 ? -0.879  -6.327  3.816   1.00 0.00 ? 111 SER A N    1  
ATOM 1697  C CA   . SER A 1 111 ? -1.377  -5.458  2.757   1.00 0.00 ? 111 SER A CA   1  
ATOM 1698  C C    . SER A 1 111 ? -0.370  -5.360  1.615   1.00 0.00 ? 111 SER A C    1  
ATOM 1699  O O    . SER A 1 111 ? -0.715  -5.548  0.448   1.00 0.00 ? 111 SER A O    1  
ATOM 1700  C CB   . SER A 1 111 ? -1.676  -4.063  3.310   1.00 0.00 ? 111 SER A CB   1  
ATOM 1701  O OG   . SER A 1 111 ? -2.697  -3.426  2.564   1.00 0.00 ? 111 SER A OG   1  
ATOM 1702  H H    . SER A 1 111 ? -0.985  -6.052  4.751   1.00 0.00 ? 111 SER A H    1  
ATOM 1703  H HA   . SER A 1 111 ? -2.291  -5.889  2.378   1.00 0.00 ? 111 SER A HA   1  
ATOM 1704  H HB2  . SER A 1 111 ? -1.996  -4.147  4.338   1.00 0.00 ? 111 SER A HB2  1  
ATOM 1705  H HB3  . SER A 1 111 ? -0.780  -3.460  3.260   1.00 0.00 ? 111 SER A HB3  1  
ATOM 1706  H HG   . SER A 1 111 ? -3.279  -4.089  2.186   1.00 0.00 ? 111 SER A HG   1  
ATOM 1707  N N    . LEU A 1 112 ? 0.878   -5.062  1.961   1.00 0.00 ? 112 LEU A N    1  
ATOM 1708  C CA   . LEU A 1 112 ? 1.939   -4.939  0.967   1.00 0.00 ? 112 LEU A CA   1  
ATOM 1709  C C    . LEU A 1 112 ? 2.252   -6.290  0.332   1.00 0.00 ? 112 LEU A C    1  
ATOM 1710  O O    . LEU A 1 112 ? 2.456   -6.388  -0.878  1.00 0.00 ? 112 LEU A O    1  
ATOM 1711  C CB   . LEU A 1 112 ? 3.201   -4.359  1.607   1.00 0.00 ? 112 LEU A CB   1  
ATOM 1712  C CG   . LEU A 1 112 ? 3.014   -3.072  2.412   1.00 0.00 ? 112 LEU A CG   1  
ATOM 1713  C CD1  . LEU A 1 112 ? 4.322   -2.659  3.069   1.00 0.00 ? 112 LEU A CD1  1  
ATOM 1714  C CD2  . LEU A 1 112 ? 2.488   -1.957  1.522   1.00 0.00 ? 112 LEU A CD2  1  
ATOM 1715  H H    . LEU A 1 112 ? 1.093   -4.923  2.907   1.00 0.00 ? 112 LEU A H    1  
ATOM 1716  H HA   . LEU A 1 112 ? 1.594   -4.264  0.197   1.00 0.00 ? 112 LEU A HA   1  
ATOM 1717  H HB2  . LEU A 1 112 ? 3.609   -5.107  2.269   1.00 0.00 ? 112 LEU A HB2  1  
ATOM 1718  H HB3  . LEU A 1 112 ? 3.909   -4.155  0.816   1.00 0.00 ? 112 LEU A HB3  1  
ATOM 1719  H HG   . LEU A 1 112 ? 2.289   -3.247  3.196   1.00 0.00 ? 112 LEU A HG   1  
ATOM 1720  H HD11 . LEU A 1 112 ? 4.945   -2.156  2.346   1.00 0.00 ? 112 LEU A HD11 1  
ATOM 1721  H HD12 . LEU A 1 112 ? 4.834   -3.537  3.436   1.00 0.00 ? 112 LEU A HD12 1  
ATOM 1722  H HD13 . LEU A 1 112 ? 4.117   -1.993  3.894   1.00 0.00 ? 112 LEU A HD13 1  
ATOM 1723  H HD21 . LEU A 1 112 ? 1.657   -1.469  2.011   1.00 0.00 ? 112 LEU A HD21 1  
ATOM 1724  H HD22 . LEU A 1 112 ? 2.157   -2.373  0.581   1.00 0.00 ? 112 LEU A HD22 1  
ATOM 1725  H HD23 . LEU A 1 112 ? 3.272   -1.238  1.343   1.00 0.00 ? 112 LEU A HD23 1  
ATOM 1726  N N    . LEU A 1 113 ? 2.285   -7.331  1.157   1.00 0.00 ? 113 LEU A N    1  
ATOM 1727  C CA   . LEU A 1 113 ? 2.571   -8.678  0.677   1.00 0.00 ? 113 LEU A CA   1  
ATOM 1728  C C    . LEU A 1 113 ? 1.507   -9.141  -0.313  1.00 0.00 ? 113 LEU A C    1  
ATOM 1729  O O    . LEU A 1 113 ? 1.756   -10.013 -1.144  1.00 0.00 ? 113 LEU A O    1  
ATOM 1730  C CB   . LEU A 1 113 ? 2.646   -9.655  1.853   1.00 0.00 ? 113 LEU A CB   1  
ATOM 1731  C CG   . LEU A 1 113 ? 3.930   -9.610  2.681   1.00 0.00 ? 113 LEU A CG   1  
ATOM 1732  C CD1  . LEU A 1 113 ? 3.766   -10.406 3.967   1.00 0.00 ? 113 LEU A CD1  1  
ATOM 1733  C CD2  . LEU A 1 113 ? 5.106   -10.139 1.871   1.00 0.00 ? 113 LEU A CD2  1  
ATOM 1734  H H    . LEU A 1 113 ? 2.115   -7.191  2.112   1.00 0.00 ? 113 LEU A H    1  
ATOM 1735  H HA   . LEU A 1 113 ? 3.527   -8.656  0.177   1.00 0.00 ? 113 LEU A HA   1  
ATOM 1736  H HB2  . LEU A 1 113 ? 1.819   -9.441  2.513   1.00 0.00 ? 113 LEU A HB2  1  
ATOM 1737  H HB3  . LEU A 1 113 ? 2.540   -10.655 1.459   1.00 0.00 ? 113 LEU A HB3  1  
ATOM 1738  H HG   . LEU A 1 113 ? 4.142   -8.584  2.950   1.00 0.00 ? 113 LEU A HG   1  
ATOM 1739  H HD11 . LEU A 1 113 ? 3.380   -9.761  4.742   1.00 0.00 ? 113 LEU A HD11 1  
ATOM 1740  H HD12 . LEU A 1 113 ? 4.723   -10.803 4.270   1.00 0.00 ? 113 LEU A HD12 1  
ATOM 1741  H HD13 . LEU A 1 113 ? 3.076   -11.221 3.798   1.00 0.00 ? 113 LEU A HD13 1  
ATOM 1742  H HD21 . LEU A 1 113 ? 6.020   -9.997  2.430   1.00 0.00 ? 113 LEU A HD21 1  
ATOM 1743  H HD22 . LEU A 1 113 ? 5.169   -9.601  0.936   1.00 0.00 ? 113 LEU A HD22 1  
ATOM 1744  H HD23 . LEU A 1 113 ? 4.962   -11.191 1.675   1.00 0.00 ? 113 LEU A HD23 1  
ATOM 1745  N N    . ALA A 1 114 ? 0.321   -8.547  -0.221  1.00 0.00 ? 114 ALA A N    1  
ATOM 1746  C CA   . ALA A 1 114 ? -0.778  -8.894  -1.113  1.00 0.00 ? 114 ALA A CA   1  
ATOM 1747  C C    . ALA A 1 114 ? -0.797  -7.989  -2.340  1.00 0.00 ? 114 ALA A C    1  
ATOM 1748  O O    . ALA A 1 114 ? -1.098  -8.434  -3.448  1.00 0.00 ? 114 ALA A O    1  
ATOM 1749  C CB   . ALA A 1 114 ? -2.104  -8.808  -0.372  1.00 0.00 ? 114 ALA A CB   1  
ATOM 1750  H H    . ALA A 1 114 ? 0.184   -7.858  0.461   1.00 0.00 ? 114 ALA A H    1  
ATOM 1751  H HA   . ALA A 1 114 ? -0.638  -9.916  -1.434  1.00 0.00 ? 114 ALA A HA   1  
ATOM 1752  H HB1  . ALA A 1 114 ? -2.891  -9.208  -0.997  1.00 0.00 ? 114 ALA A HB1  1  
ATOM 1753  H HB2  . ALA A 1 114 ? -2.044  -9.382  0.541   1.00 0.00 ? 114 ALA A HB2  1  
ATOM 1754  H HB3  . ALA A 1 114 ? -2.320  -7.777  -0.138  1.00 0.00 ? 114 ALA A HB3  1  
ATOM 1755  N N    . LEU A 1 115 ? -0.471  -6.717  -2.137  1.00 0.00 ? 115 LEU A N    1  
ATOM 1756  C CA   . LEU A 1 115 ? -0.451  -5.749  -3.228  1.00 0.00 ? 115 LEU A CA   1  
ATOM 1757  C C    . LEU A 1 115 ? 0.715   -6.018  -4.173  1.00 0.00 ? 115 LEU A C    1  
ATOM 1758  O O    . LEU A 1 115 ? 0.621   -5.775  -5.376  1.00 0.00 ? 115 LEU A O    1  
ATOM 1759  C CB   . LEU A 1 115 ? -0.355  -4.327  -2.672  1.00 0.00 ? 115 LEU A CB   1  
ATOM 1760  C CG   . LEU A 1 115 ? 0.128   -3.255  -3.650  1.00 0.00 ? 115 LEU A CG   1  
ATOM 1761  C CD1  . LEU A 1 115 ? -1.039  -2.702  -4.454  1.00 0.00 ? 115 LEU A CD1  1  
ATOM 1762  C CD2  . LEU A 1 115 ? 0.843   -2.137  -2.906  1.00 0.00 ? 115 LEU A CD2  1  
ATOM 1763  H H    . LEU A 1 115 ? -0.240  -6.421  -1.232  1.00 0.00 ? 115 LEU A H    1  
ATOM 1764  H HA   . LEU A 1 115 ? -1.375  -5.849  -3.777  1.00 0.00 ? 115 LEU A HA   1  
ATOM 1765  H HB2  . LEU A 1 115 ? -1.335  -4.040  -2.324  1.00 0.00 ? 115 LEU A HB2  1  
ATOM 1766  H HB3  . LEU A 1 115 ? 0.331   -4.345  -1.836  1.00 0.00 ? 115 LEU A HB3  1  
ATOM 1767  H HG   . LEU A 1 115 ? 0.830   -3.699  -4.343  1.00 0.00 ? 115 LEU A HG   1  
ATOM 1768  H HD11 . LEU A 1 115 ? -1.131  -1.642  -4.273  1.00 0.00 ? 115 LEU A HD11 1  
ATOM 1769  H HD12 . LEU A 1 115 ? -1.950  -3.198  -4.154  1.00 0.00 ? 115 LEU A HD12 1  
ATOM 1770  H HD13 . LEU A 1 115 ? -0.865  -2.876  -5.506  1.00 0.00 ? 115 LEU A HD13 1  
ATOM 1771  H HD21 . LEU A 1 115 ? 1.180   -2.501  -1.947  1.00 0.00 ? 115 LEU A HD21 1  
ATOM 1772  H HD22 . LEU A 1 115 ? 0.162   -1.310  -2.759  1.00 0.00 ? 115 LEU A HD22 1  
ATOM 1773  H HD23 . LEU A 1 115 ? 1.692   -1.805  -3.484  1.00 0.00 ? 115 LEU A HD23 1  
ATOM 1774  N N    . ALA A 1 116 ? 1.813   -6.524  -3.621  1.00 0.00 ? 116 ALA A N    1  
ATOM 1775  C CA   . ALA A 1 116 ? 2.996   -6.831  -4.416  1.00 0.00 ? 116 ALA A CA   1  
ATOM 1776  C C    . ALA A 1 116 ? 2.739   -8.008  -5.350  1.00 0.00 ? 116 ALA A C    1  
ATOM 1777  O O    . ALA A 1 116 ? 2.872   -7.887  -6.567  1.00 0.00 ? 116 ALA A O    1  
ATOM 1778  C CB   . ALA A 1 116 ? 4.181   -7.123  -3.507  1.00 0.00 ? 116 ALA A CB   1  
ATOM 1779  H H    . ALA A 1 116 ? 1.828   -6.696  -2.657  1.00 0.00 ? 116 ALA A H    1  
ATOM 1780  H HA   . ALA A 1 116 ? 3.234   -5.959  -5.009  1.00 0.00 ? 116 ALA A HA   1  
ATOM 1781  H HB1  . ALA A 1 116 ? 4.774   -7.917  -3.936  1.00 0.00 ? 116 ALA A HB1  1  
ATOM 1782  H HB2  . ALA A 1 116 ? 4.786   -6.234  -3.408  1.00 0.00 ? 116 ALA A HB2  1  
ATOM 1783  H HB3  . ALA A 1 116 ? 3.821   -7.426  -2.535  1.00 0.00 ? 116 ALA A HB3  1  
ATOM 1784  N N    . GLY A 1 117 ? 2.371   -9.147  -4.771  1.00 0.00 ? 117 GLY A N    1  
ATOM 1785  C CA   . GLY A 1 117 ? 2.103   -10.331 -5.568  1.00 0.00 ? 117 GLY A CA   1  
ATOM 1786  C C    . GLY A 1 117 ? 1.269   -10.026 -6.797  1.00 0.00 ? 117 GLY A C    1  
ATOM 1787  O O    . GLY A 1 117 ? 1.481   -10.607 -7.860  1.00 0.00 ? 117 GLY A O    1  
ATOM 1788  H H    . GLY A 1 117 ? 2.281   -9.185  -3.797  1.00 0.00 ? 117 GLY A H    1  
ATOM 1789  H HA2  . GLY A 1 117 ? 3.043   -10.760 -5.882  1.00 0.00 ? 117 GLY A HA2  1  
ATOM 1790  H HA3  . GLY A 1 117 ? 1.576   -11.048 -4.958  1.00 0.00 ? 117 GLY A HA3  1  
ATOM 1791  N N    . LYS A 1 118 ? 0.314   -9.113  -6.649  1.00 0.00 ? 118 LYS A N    1  
ATOM 1792  C CA   . LYS A 1 118 ? -0.556  -8.731  -7.755  1.00 0.00 ? 118 LYS A CA   1  
ATOM 1793  C C    . LYS A 1 118 ? 0.162   -7.787  -8.713  1.00 0.00 ? 118 LYS A C    1  
ATOM 1794  O O    . LYS A 1 118 ? 0.074   -7.938  -9.931  1.00 0.00 ? 118 LYS A O    1  
ATOM 1795  C CB   . LYS A 1 118 ? -1.829  -8.066  -7.223  1.00 0.00 ? 118 LYS A CB   1  
ATOM 1796  C CG   . LYS A 1 118 ? -2.716  -7.492  -8.314  1.00 0.00 ? 118 LYS A CG   1  
ATOM 1797  C CD   . LYS A 1 118 ? -4.180  -7.505  -7.906  1.00 0.00 ? 118 LYS A CD   1  
ATOM 1798  C CE   . LYS A 1 118 ? -4.569  -6.224  -7.185  1.00 0.00 ? 118 LYS A CE   1  
ATOM 1799  N NZ   . LYS A 1 118 ? -4.924  -5.136  -8.139  1.00 0.00 ? 118 LYS A NZ   1  
ATOM 1800  H H    . LYS A 1 118 ? 0.194   -8.684  -5.776  1.00 0.00 ? 118 LYS A H    1  
ATOM 1801  H HA   . LYS A 1 118 ? -0.828  -9.630  -8.290  1.00 0.00 ? 118 LYS A HA   1  
ATOM 1802  H HB2  . LYS A 1 118 ? -2.400  -8.798  -6.671  1.00 0.00 ? 118 LYS A HB2  1  
ATOM 1803  H HB3  . LYS A 1 118 ? -1.547  -7.263  -6.556  1.00 0.00 ? 118 LYS A HB3  1  
ATOM 1804  H HG2  . LYS A 1 118 ? -2.417  -6.473  -8.509  1.00 0.00 ? 118 LYS A HG2  1  
ATOM 1805  H HG3  . LYS A 1 118 ? -2.596  -8.082  -9.211  1.00 0.00 ? 118 LYS A HG3  1  
ATOM 1806  H HD2  . LYS A 1 118 ? -4.790  -7.607  -8.791  1.00 0.00 ? 118 LYS A HD2  1  
ATOM 1807  H HD3  . LYS A 1 118 ? -4.353  -8.345  -7.248  1.00 0.00 ? 118 LYS A HD3  1  
ATOM 1808  H HE2  . LYS A 1 118 ? -5.419  -6.426  -6.552  1.00 0.00 ? 118 LYS A HE2  1  
ATOM 1809  H HE3  . LYS A 1 118 ? -3.737  -5.900  -6.577  1.00 0.00 ? 118 LYS A HE3  1  
ATOM 1810  H HZ1  . LYS A 1 118 ? -4.879  -4.214  -7.662  1.00 0.00 ? 118 LYS A HZ1  1  
ATOM 1811  H HZ2  . LYS A 1 118 ? -5.888  -5.279  -8.501  1.00 0.00 ? 118 LYS A HZ2  1  
ATOM 1812  H HZ3  . LYS A 1 118 ? -4.261  -5.133  -8.940  1.00 0.00 ? 118 LYS A HZ3  1  
ATOM 1813  N N    . ALA A 1 119 ? 0.873   -6.814  -8.154  1.00 0.00 ? 119 ALA A N    1  
ATOM 1814  C CA   . ALA A 1 119 ? 1.610   -5.847  -8.959  1.00 0.00 ? 119 ALA A CA   1  
ATOM 1815  C C    . ALA A 1 119 ? 2.603   -6.544  -9.881  1.00 0.00 ? 119 ALA A C    1  
ATOM 1816  O O    . ALA A 1 119 ? 2.744   -6.179  -11.049 1.00 0.00 ? 119 ALA A O    1  
ATOM 1817  C CB   . ALA A 1 119 ? 2.329   -4.852  -8.061  1.00 0.00 ? 119 ALA A CB   1  
ATOM 1818  H H    . ALA A 1 119 ? 0.905   -6.745  -7.178  1.00 0.00 ? 119 ALA A H    1  
ATOM 1819  H HA   . ALA A 1 119 ? 0.897   -5.301  -9.560  1.00 0.00 ? 119 ALA A HA   1  
ATOM 1820  H HB1  . ALA A 1 119 ? 1.767   -3.929  -8.024  1.00 0.00 ? 119 ALA A HB1  1  
ATOM 1821  H HB2  . ALA A 1 119 ? 2.416   -5.262  -7.066  1.00 0.00 ? 119 ALA A HB2  1  
ATOM 1822  H HB3  . ALA A 1 119 ? 3.315   -4.657  -8.458  1.00 0.00 ? 119 ALA A HB3  1  
ATOM 1823  N N    . LYS A 1 120 ? 3.292   -7.549  -9.351  1.00 0.00 ? 120 LYS A N    1  
ATOM 1824  C CA   . LYS A 1 120 ? 4.273   -8.299  -10.126 1.00 0.00 ? 120 LYS A CA   1  
ATOM 1825  C C    . LYS A 1 120 ? 3.768   -8.551  -11.544 1.00 0.00 ? 120 LYS A C    1  
ATOM 1826  O O    . LYS A 1 120 ? 4.511   -8.402  -12.514 1.00 0.00 ? 120 LYS A O    1  
ATOM 1827  C CB   . LYS A 1 120 ? 4.585   -9.631  -9.441  1.00 0.00 ? 120 LYS A CB   1  
ATOM 1828  C CG   . LYS A 1 120 ? 5.654   -9.527  -8.368  1.00 0.00 ? 120 LYS A CG   1  
ATOM 1829  C CD   . LYS A 1 120 ? 7.047   -9.704  -8.949  1.00 0.00 ? 120 LYS A CD   1  
ATOM 1830  C CE   . LYS A 1 120 ? 8.122   -9.470  -7.900  1.00 0.00 ? 120 LYS A CE   1  
ATOM 1831  N NZ   . LYS A 1 120 ? 8.123   -10.534 -6.859  1.00 0.00 ? 120 LYS A NZ   1  
ATOM 1832  H H    . LYS A 1 120 ? 3.135   -7.793  -8.415  1.00 0.00 ? 120 LYS A H    1  
ATOM 1833  H HA   . LYS A 1 120 ? 5.176   -7.710  -10.178 1.00 0.00 ? 120 LYS A HA   1  
ATOM 1834  H HB2  . LYS A 1 120 ? 3.681   -10.007 -8.983  1.00 0.00 ? 120 LYS A HB2  1  
ATOM 1835  H HB3  . LYS A 1 120 ? 4.921   -10.336 -10.187 1.00 0.00 ? 120 LYS A HB3  1  
ATOM 1836  H HG2  . LYS A 1 120 ? 5.591   -8.554  -7.902  1.00 0.00 ? 120 LYS A HG2  1  
ATOM 1837  H HG3  . LYS A 1 120 ? 5.483   -10.294 -7.626  1.00 0.00 ? 120 LYS A HG3  1  
ATOM 1838  H HD2  . LYS A 1 120 ? 7.144   -10.709 -9.329  1.00 0.00 ? 120 LYS A HD2  1  
ATOM 1839  H HD3  . LYS A 1 120 ? 7.183   -8.997  -9.755  1.00 0.00 ? 120 LYS A HD3  1  
ATOM 1840  H HE2  . LYS A 1 120 ? 9.086   -9.455  -8.387  1.00 0.00 ? 120 LYS A HE2  1  
ATOM 1841  H HE3  . LYS A 1 120 ? 7.944   -8.516  -7.425  1.00 0.00 ? 120 LYS A HE3  1  
ATOM 1842  H HZ1  . LYS A 1 120 ? 8.033   -10.110 -5.913  1.00 0.00 ? 120 LYS A HZ1  1  
ATOM 1843  H HZ2  . LYS A 1 120 ? 9.010   -11.076 -6.900  1.00 0.00 ? 120 LYS A HZ2  1  
ATOM 1844  H HZ3  . LYS A 1 120 ? 7.326   -11.185 -7.012  1.00 0.00 ? 120 LYS A HZ3  1  
ATOM 1845  N N    . THR A 1 121 ? 2.499   -8.933  -11.657 1.00 0.00 ? 121 THR A N    1  
ATOM 1846  C CA   . THR A 1 121 ? 1.896   -9.205  -12.955 1.00 0.00 ? 121 THR A CA   1  
ATOM 1847  C C    . THR A 1 121 ? 2.445   -8.266  -14.024 1.00 0.00 ? 121 THR A C    1  
ATOM 1848  O O    . THR A 1 121 ? 2.709   -8.682  -15.153 1.00 0.00 ? 121 THR A O    1  
ATOM 1849  C CB   . THR A 1 121 ? 0.363   -9.064  -12.903 1.00 0.00 ? 121 THR A CB   1  
ATOM 1850  O OG1  . THR A 1 121 ? -0.204  -9.406  -14.172 1.00 0.00 ? 121 THR A OG1  1  
ATOM 1851  C CG2  . THR A 1 121 ? -0.037  -7.645  -12.528 1.00 0.00 ? 121 THR A CG2  1  
ATOM 1852  H H    . THR A 1 121 ? 1.959   -9.034  -10.847 1.00 0.00 ? 121 THR A H    1  
ATOM 1853  H HA   . THR A 1 121 ? 2.134   -10.222 -13.227 1.00 0.00 ? 121 THR A HA   1  
ATOM 1854  H HB   . THR A 1 121 ? -0.020  -9.740  -12.152 1.00 0.00 ? 121 THR A HB   1  
ATOM 1855  H HG1  . THR A 1 121 ? -0.212  -8.630  -14.738 1.00 0.00 ? 121 THR A HG1  1  
ATOM 1856  H HG21 . THR A 1 121 ? 0.740   -7.199  -11.925 1.00 0.00 ? 121 THR A HG21 1  
ATOM 1857  H HG22 . THR A 1 121 ? -0.960  -7.667  -11.968 1.00 0.00 ? 121 THR A HG22 1  
ATOM 1858  H HG23 . THR A 1 121 ? -0.175  -7.062  -13.425 1.00 0.00 ? 121 THR A HG23 1  
ATOM 1859  N N    . LYS A 1 122 ? 2.616   -7.000  -13.662 1.00 0.00 ? 122 LYS A N    1  
ATOM 1860  C CA   . LYS A 1 122 ? 3.136   -6.002  -14.589 1.00 0.00 ? 122 LYS A CA   1  
ATOM 1861  C C    . LYS A 1 122 ? 4.372   -6.524  -15.314 1.00 0.00 ? 122 LYS A C    1  
ATOM 1862  O O    . LYS A 1 122 ? 4.436   -6.509  -16.541 1.00 0.00 ? 122 LYS A O    1  
ATOM 1863  C CB   . LYS A 1 122 ? 3.477   -4.710  -13.842 1.00 0.00 ? 122 LYS A CB   1  
ATOM 1864  C CG   . LYS A 1 122 ? 2.293   -4.095  -13.117 1.00 0.00 ? 122 LYS A CG   1  
ATOM 1865  C CD   . LYS A 1 122 ? 1.299   -3.486  -14.091 1.00 0.00 ? 122 LYS A CD   1  
ATOM 1866  C CE   . LYS A 1 122 ? -0.107  -3.458  -13.510 1.00 0.00 ? 122 LYS A CE   1  
ATOM 1867  N NZ   . LYS A 1 122 ? -0.374  -2.197  -12.765 1.00 0.00 ? 122 LYS A NZ   1  
ATOM 1868  H H    . LYS A 1 122 ? 2.388   -6.729  -12.747 1.00 0.00 ? 122 LYS A H    1  
ATOM 1869  H HA   . LYS A 1 122 ? 2.367   -5.794  -15.317 1.00 0.00 ? 122 LYS A HA   1  
ATOM 1870  H HB2  . LYS A 1 122 ? 4.247   -4.922  -13.114 1.00 0.00 ? 122 LYS A HB2  1  
ATOM 1871  H HB3  . LYS A 1 122 ? 3.854   -3.988  -14.551 1.00 0.00 ? 122 LYS A HB3  1  
ATOM 1872  H HG2  . LYS A 1 122 ? 1.794   -4.863  -12.544 1.00 0.00 ? 122 LYS A HG2  1  
ATOM 1873  H HG3  . LYS A 1 122 ? 2.651   -3.322  -12.451 1.00 0.00 ? 122 LYS A HG3  1  
ATOM 1874  H HD2  . LYS A 1 122 ? 1.602   -2.475  -14.317 1.00 0.00 ? 122 LYS A HD2  1  
ATOM 1875  H HD3  . LYS A 1 122 ? 1.291   -4.074  -14.999 1.00 0.00 ? 122 LYS A HD3  1  
ATOM 1876  H HE2  . LYS A 1 122 ? -0.818  -3.548  -14.316 1.00 0.00 ? 122 LYS A HE2  1  
ATOM 1877  H HE3  . LYS A 1 122 ? -0.219  -4.295  -12.836 1.00 0.00 ? 122 LYS A HE3  1  
ATOM 1878  H HZ1  . LYS A 1 122 ? 0.172   -1.415  -13.181 1.00 0.00 ? 122 LYS A HZ1  1  
ATOM 1879  H HZ2  . LYS A 1 122 ? -0.098  -2.305  -11.768 1.00 0.00 ? 122 LYS A HZ2  1  
ATOM 1880  H HZ3  . LYS A 1 122 ? -1.387  -1.962  -12.811 1.00 0.00 ? 122 LYS A HZ3  1  
ATOM 1881  N N    . GLY A 1 123 ? 5.352   -6.988  -14.543 1.00 0.00 ? 123 GLY A N    1  
ATOM 1882  C CA   . GLY A 1 123 ? 6.572   -7.510  -15.131 1.00 0.00 ? 123 GLY A CA   1  
ATOM 1883  C C    . GLY A 1 123 ? 6.348   -8.814  -15.870 1.00 0.00 ? 123 GLY A C    1  
ATOM 1884  O O    . GLY A 1 123 ? 6.221   -8.829  -17.095 1.00 0.00 ? 123 GLY A O    1  
ATOM 1885  H H    . GLY A 1 123 ? 5.246   -6.976  -13.569 1.00 0.00 ? 123 GLY A H    1  
ATOM 1886  H HA2  . GLY A 1 123 ? 6.968   -6.780  -15.822 1.00 0.00 ? 123 GLY A HA2  1  
ATOM 1887  H HA3  . GLY A 1 123 ? 7.295   -7.674  -14.345 1.00 0.00 ? 123 GLY A HA3  1  
ATOM 1888  N N    . LEU A 1 124 ? 6.303   -9.913  -15.125 1.00 0.00 ? 124 LEU A N    1  
ATOM 1889  C CA   . LEU A 1 124 ? 6.094   -11.231 -15.717 1.00 0.00 ? 124 LEU A CA   1  
ATOM 1890  C C    . LEU A 1 124 ? 4.956   -11.198 -16.730 1.00 0.00 ? 124 LEU A C    1  
ATOM 1891  O O    . LEU A 1 124 ? 3.892   -10.640 -16.465 1.00 0.00 ? 124 LEU A O    1  
ATOM 1892  C CB   . LEU A 1 124 ? 5.792   -12.260 -14.627 1.00 0.00 ? 124 LEU A CB   1  
ATOM 1893  C CG   . LEU A 1 124 ? 4.416   -12.157 -13.970 1.00 0.00 ? 124 LEU A CG   1  
ATOM 1894  C CD1  . LEU A 1 124 ? 3.393   -12.972 -14.746 1.00 0.00 ? 124 LEU A CD1  1  
ATOM 1895  C CD2  . LEU A 1 124 ? 4.480   -12.618 -12.521 1.00 0.00 ? 124 LEU A CD2  1  
ATOM 1896  H H    . LEU A 1 124 ? 6.412   -9.839  -14.155 1.00 0.00 ? 124 LEU A H    1  
ATOM 1897  H HA   . LEU A 1 124 ? 7.005   -11.513 -16.225 1.00 0.00 ? 124 LEU A HA   1  
ATOM 1898  H HB2  . LEU A 1 124 ? 5.876   -13.242 -15.066 1.00 0.00 ? 124 LEU A HB2  1  
ATOM 1899  H HB3  . LEU A 1 124 ? 6.539   -12.149 -13.852 1.00 0.00 ? 124 LEU A HB3  1  
ATOM 1900  H HG   . LEU A 1 124 ? 4.095   -11.124 -13.979 1.00 0.00 ? 124 LEU A HG   1  
ATOM 1901  H HD11 . LEU A 1 124 ? 2.495   -12.388 -14.881 1.00 0.00 ? 124 LEU A HD11 1  
ATOM 1902  H HD12 . LEU A 1 124 ? 3.157   -13.871 -14.195 1.00 0.00 ? 124 LEU A HD12 1  
ATOM 1903  H HD13 . LEU A 1 124 ? 3.800   -13.237 -15.710 1.00 0.00 ? 124 LEU A HD13 1  
ATOM 1904  H HD21 . LEU A 1 124 ? 4.267   -13.676 -12.471 1.00 0.00 ? 124 LEU A HD21 1  
ATOM 1905  H HD22 . LEU A 1 124 ? 3.749   -12.077 -11.938 1.00 0.00 ? 124 LEU A HD22 1  
ATOM 1906  H HD23 . LEU A 1 124 ? 5.468   -12.430 -12.126 1.00 0.00 ? 124 LEU A HD23 1  
ATOM 1907  N N    . GLN A 1 125 ? 5.186   -11.802 -17.892 1.00 0.00 ? 125 GLN A N    1  
ATOM 1908  C CA   . GLN A 1 125 ? 4.178   -11.842 -18.945 1.00 0.00 ? 125 GLN A CA   1  
ATOM 1909  C C    . GLN A 1 125 ? 3.027   -12.766 -18.561 1.00 0.00 ? 125 GLN A C    1  
ATOM 1910  O O    . GLN A 1 125 ? 3.243   -13.909 -18.157 1.00 0.00 ? 125 GLN A O    1  
ATOM 1911  C CB   . GLN A 1 125 ? 4.804   -12.308 -20.261 1.00 0.00 ? 125 GLN A CB   1  
ATOM 1912  C CG   . GLN A 1 125 ? 5.345   -11.171 -21.113 1.00 0.00 ? 125 GLN A CG   1  
ATOM 1913  C CD   . GLN A 1 125 ? 5.522   -11.564 -22.567 1.00 0.00 ? 125 GLN A CD   1  
ATOM 1914  O OE1  . GLN A 1 125 ? 4.580   -11.496 -23.359 1.00 0.00 ? 125 GLN A OE1  1  
ATOM 1915  N NE2  . GLN A 1 125 ? 6.731   -11.978 -22.926 1.00 0.00 ? 125 GLN A NE2  1  
ATOM 1916  H H    . GLN A 1 125 ? 6.054   -12.229 -18.045 1.00 0.00 ? 125 GLN A H    1  
ATOM 1917  H HA   . GLN A 1 125 ? 3.793   -10.842 -19.074 1.00 0.00 ? 125 GLN A HA   1  
ATOM 1918  H HB2  . GLN A 1 125 ? 5.616   -12.983 -20.040 1.00 0.00 ? 125 GLN A HB2  1  
ATOM 1919  H HB3  . GLN A 1 125 ? 4.055   -12.834 -20.835 1.00 0.00 ? 125 GLN A HB3  1  
ATOM 1920  H HG2  . GLN A 1 125 ? 4.657   -10.341 -21.062 1.00 0.00 ? 125 GLN A HG2  1  
ATOM 1921  H HG3  . GLN A 1 125 ? 6.303   -10.868 -20.718 1.00 0.00 ? 125 GLN A HG3  1  
ATOM 1922  H HE21 . GLN A 1 125 ? 7.432   -12.008 -22.240 1.00 0.00 ? 125 GLN A HE21 1  
ATOM 1923  H HE22 . GLN A 1 125 ? 6.873   -12.239 -23.859 1.00 0.00 ? 125 GLN A HE22 1  
ATOM 1924  N N    . SER A 1 126 ? 1.803   -12.263 -18.689 1.00 0.00 ? 126 SER A N    1  
ATOM 1925  C CA   . SER A 1 126 ? 0.618   -13.041 -18.351 1.00 0.00 ? 126 SER A CA   1  
ATOM 1926  C C    . SER A 1 126 ? -0.268  -13.243 -19.577 1.00 0.00 ? 126 SER A C    1  
ATOM 1927  O O    . SER A 1 126 ? -0.102  -12.571 -20.595 1.00 0.00 ? 126 SER A O    1  
ATOM 1928  C CB   . SER A 1 126 ? -0.176  -12.346 -17.243 1.00 0.00 ? 126 SER A CB   1  
ATOM 1929  O OG   . SER A 1 126 ? 0.481   -12.467 -15.993 1.00 0.00 ? 126 SER A OG   1  
ATOM 1930  H H    . SER A 1 126 ? 1.696   -11.346 -19.017 1.00 0.00 ? 126 SER A H    1  
ATOM 1931  H HA   . SER A 1 126 ? 0.945   -14.008 -17.996 1.00 0.00 ? 126 SER A HA   1  
ATOM 1932  H HB2  . SER A 1 126 ? -0.281  -11.299 -17.482 1.00 0.00 ? 126 SER A HB2  1  
ATOM 1933  H HB3  . SER A 1 126 ? -1.154  -12.799 -17.167 1.00 0.00 ? 126 SER A HB3  1  
ATOM 1934  H HG   . SER A 1 126 ? 1.036   -13.250 -15.998 1.00 0.00 ? 126 SER A HG   1  
ATOM 1935  N N    . GLY A 1 127 ? -1.211  -14.174 -19.472 1.00 0.00 ? 127 GLY A N    1  
ATOM 1936  C CA   . GLY A 1 127 ? -2.109  -14.448 -20.579 1.00 0.00 ? 127 GLY A CA   1  
ATOM 1937  C C    . GLY A 1 127 ? -3.561  -14.195 -20.222 1.00 0.00 ? 127 GLY A C    1  
ATOM 1938  O O    . GLY A 1 127 ? -3.911  -13.118 -19.742 1.00 0.00 ? 127 GLY A O    1  
ATOM 1939  H H    . GLY A 1 127 ? -1.297  -14.679 -18.637 1.00 0.00 ? 127 GLY A H    1  
ATOM 1940  H HA2  . GLY A 1 127 ? -1.839  -13.818 -21.412 1.00 0.00 ? 127 GLY A HA2  1  
ATOM 1941  H HA3  . GLY A 1 127 ? -1.997  -15.482 -20.871 1.00 0.00 ? 127 GLY A HA3  1  
ATOM 1942  N N    . VAL A 1 128 ? -4.409  -15.191 -20.462 1.00 0.00 ? 128 VAL A N    1  
ATOM 1943  C CA   . VAL A 1 128 ? -5.832  -15.071 -20.163 1.00 0.00 ? 128 VAL A CA   1  
ATOM 1944  C C    . VAL A 1 128 ? -6.092  -15.201 -18.667 1.00 0.00 ? 128 VAL A C    1  
ATOM 1945  O O    . VAL A 1 128 ? -5.651  -16.158 -18.031 1.00 0.00 ? 128 VAL A O    1  
ATOM 1946  C CB   . VAL A 1 128 ? -6.653  -16.138 -20.911 1.00 0.00 ? 128 VAL A CB   1  
ATOM 1947  C CG1  . VAL A 1 128 ? -8.126  -16.033 -20.544 1.00 0.00 ? 128 VAL A CG1  1  
ATOM 1948  C CG2  . VAL A 1 128 ? -6.459  -16.002 -22.414 1.00 0.00 ? 128 VAL A CG2  1  
ATOM 1949  H H    . VAL A 1 128 ? -4.070  -16.026 -20.846 1.00 0.00 ? 128 VAL A H    1  
ATOM 1950  H HA   . VAL A 1 128 ? -6.161  -14.097 -20.493 1.00 0.00 ? 128 VAL A HA   1  
ATOM 1951  H HB   . VAL A 1 128 ? -6.298  -17.112 -20.611 1.00 0.00 ? 128 VAL A HB   1  
ATOM 1952  H HG11 . VAL A 1 128 ? -8.251  -16.257 -19.495 1.00 0.00 ? 128 VAL A HG11 1  
ATOM 1953  H HG12 . VAL A 1 128 ? -8.477  -15.031 -20.743 1.00 0.00 ? 128 VAL A HG12 1  
ATOM 1954  H HG13 . VAL A 1 128 ? -8.694  -16.738 -21.132 1.00 0.00 ? 128 VAL A HG13 1  
ATOM 1955  H HG21 . VAL A 1 128 ? -7.264  -16.507 -22.928 1.00 0.00 ? 128 VAL A HG21 1  
ATOM 1956  H HG22 . VAL A 1 128 ? -6.462  -14.956 -22.685 1.00 0.00 ? 128 VAL A HG22 1  
ATOM 1957  H HG23 . VAL A 1 128 ? -5.517  -16.445 -22.698 1.00 0.00 ? 128 VAL A HG23 1  
ATOM 1958  N N    . ASP A 1 129 ? -6.812  -14.233 -18.112 1.00 0.00 ? 129 ASP A N    1  
ATOM 1959  C CA   . ASP A 1 129 ? -7.135  -14.239 -16.690 1.00 0.00 ? 129 ASP A CA   1  
ATOM 1960  C C    . ASP A 1 129 ? -7.954  -15.473 -16.324 1.00 0.00 ? 129 ASP A C    1  
ATOM 1961  O O    . ASP A 1 129 ? -8.397  -16.217 -17.198 1.00 0.00 ? 129 ASP A O    1  
ATOM 1962  C CB   . ASP A 1 129 ? -7.902  -12.971 -16.313 1.00 0.00 ? 129 ASP A CB   1  
ATOM 1963  C CG   . ASP A 1 129 ? -9.091  -12.723 -17.220 1.00 0.00 ? 129 ASP A CG   1  
ATOM 1964  O OD1  . ASP A 1 129 ? -9.828  -13.687 -17.511 1.00 0.00 ? 129 ASP A OD1  1  
ATOM 1965  O OD2  . ASP A 1 129 ? -9.283  -11.562 -17.640 1.00 0.00 ? 129 ASP A OD2  1  
ATOM 1966  H H    . ASP A 1 129 ? -7.136  -13.497 -18.672 1.00 0.00 ? 129 ASP A H    1  
ATOM 1967  H HA   . ASP A 1 129 ? -6.206  -14.264 -16.140 1.00 0.00 ? 129 ASP A HA   1  
ATOM 1968  H HB2  . ASP A 1 129 ? -8.261  -13.063 -15.298 1.00 0.00 ? 129 ASP A HB2  1  
ATOM 1969  H HB3  . ASP A 1 129 ? -7.237  -12.123 -16.380 1.00 0.00 ? 129 ASP A HB3  1  
ATOM 1970  N N    . ILE A 1 130 ? -8.152  -15.681 -15.027 1.00 0.00 ? 130 ILE A N    1  
ATOM 1971  C CA   . ILE A 1 130 ? -8.918  -16.825 -14.545 1.00 0.00 ? 130 ILE A CA   1  
ATOM 1972  C C    . ILE A 1 130 ? -10.373 -16.740 -14.995 1.00 0.00 ? 130 ILE A C    1  
ATOM 1973  O O    . ILE A 1 130 ? -10.906 -17.676 -15.587 1.00 0.00 ? 130 ILE A O    1  
ATOM 1974  C CB   . ILE A 1 130 ? -8.874  -16.927 -13.009 1.00 0.00 ? 130 ILE A CB   1  
ATOM 1975  C CG1  . ILE A 1 130 ? -7.427  -17.048 -12.527 1.00 0.00 ? 130 ILE A CG1  1  
ATOM 1976  C CG2  . ILE A 1 130 ? -9.698  -18.113 -12.533 1.00 0.00 ? 130 ILE A CG2  1  
ATOM 1977  C CD1  . ILE A 1 130 ? -7.231  -16.617 -11.090 1.00 0.00 ? 130 ILE A CD1  1  
ATOM 1978  H H    . ILE A 1 130 ? -7.774  -15.053 -14.378 1.00 0.00 ? 130 ILE A H    1  
ATOM 1979  H HA   . ILE A 1 130 ? -8.476  -17.720 -14.959 1.00 0.00 ? 130 ILE A HA   1  
ATOM 1980  H HB   . ILE A 1 130 ? -9.309  -16.029 -12.599 1.00 0.00 ? 130 ILE A HB   1  
ATOM 1981  H HG12 . ILE A 1 130 ? -7.110  -18.076 -12.610 1.00 0.00 ? 130 ILE A HG12 1  
ATOM 1982  H HG13 . ILE A 1 130 ? -6.795  -16.430 -13.149 1.00 0.00 ? 130 ILE A HG13 1  
ATOM 1983  H HG21 . ILE A 1 130 ? -9.332  -18.443 -11.572 1.00 0.00 ? 130 ILE A HG21 1  
ATOM 1984  H HG22 . ILE A 1 130 ? -10.733 -17.818 -12.441 1.00 0.00 ? 130 ILE A HG22 1  
ATOM 1985  H HG23 . ILE A 1 130 ? -9.614  -18.919 -13.245 1.00 0.00 ? 130 ILE A HG23 1  
ATOM 1986  H HD11 . ILE A 1 130 ? -8.141  -16.172 -10.720 1.00 0.00 ? 130 ILE A HD11 1  
ATOM 1987  H HD12 . ILE A 1 130 ? -6.977  -17.476 -10.487 1.00 0.00 ? 130 ILE A HD12 1  
ATOM 1988  H HD13 . ILE A 1 130 ? -6.430  -15.893 -11.038 1.00 0.00 ? 130 ILE A HD13 1  
ATOM 1989  N N    . GLY A 1 131 ? -11.010 -15.607 -14.711 1.00 0.00 ? 131 GLY A N    1  
ATOM 1990  C CA   . GLY A 1 131 ? -12.397 -15.419 -15.096 1.00 0.00 ? 131 GLY A CA   1  
ATOM 1991  C C    . GLY A 1 131 ? -13.233 -14.829 -13.977 1.00 0.00 ? 131 GLY A C    1  
ATOM 1992  O O    . GLY A 1 131 ? -14.230 -15.418 -13.560 1.00 0.00 ? 131 GLY A O    1  
ATOM 1993  H H    . GLY A 1 131 ? -10.534 -14.893 -14.237 1.00 0.00 ? 131 GLY A H    1  
ATOM 1994  H HA2  . GLY A 1 131 ? -12.436 -14.759 -15.949 1.00 0.00 ? 131 GLY A HA2  1  
ATOM 1995  H HA3  . GLY A 1 131 ? -12.814 -16.376 -15.374 1.00 0.00 ? 131 GLY A HA3  1  
ATOM 1996  N N    . VAL A 1 132 ? -12.826 -13.661 -13.490 1.00 0.00 ? 132 VAL A N    1  
ATOM 1997  C CA   . VAL A 1 132 ? -13.544 -12.991 -12.413 1.00 0.00 ? 132 VAL A CA   1  
ATOM 1998  C C    . VAL A 1 132 ? -13.928 -11.569 -12.810 1.00 0.00 ? 132 VAL A C    1  
ATOM 1999  O O    . VAL A 1 132 ? -13.143 -10.853 -13.430 1.00 0.00 ? 132 VAL A O    1  
ATOM 2000  C CB   . VAL A 1 132 ? -12.705 -12.941 -11.123 1.00 0.00 ? 132 VAL A CB   1  
ATOM 2001  C CG1  . VAL A 1 132 ? -13.407 -12.113 -10.058 1.00 0.00 ? 132 VAL A CG1  1  
ATOM 2002  C CG2  . VAL A 1 132 ? -12.426 -14.349 -10.616 1.00 0.00 ? 132 VAL A CG2  1  
ATOM 2003  H H    . VAL A 1 132 ? -12.023 -13.241 -13.864 1.00 0.00 ? 132 VAL A H    1  
ATOM 2004  H HA   . VAL A 1 132 ? -14.444 -13.553 -12.211 1.00 0.00 ? 132 VAL A HA   1  
ATOM 2005  H HB   . VAL A 1 132 ? -11.760 -12.470 -11.349 1.00 0.00 ? 132 VAL A HB   1  
ATOM 2006  H HG11 . VAL A 1 132 ? -13.228 -12.548 -9.087  1.00 0.00 ? 132 VAL A HG11 1  
ATOM 2007  H HG12 . VAL A 1 132 ? -13.026 -11.103 -10.079 1.00 0.00 ? 132 VAL A HG12 1  
ATOM 2008  H HG13 . VAL A 1 132 ? -14.469 -12.100 -10.256 1.00 0.00 ? 132 VAL A HG13 1  
ATOM 2009  H HG21 . VAL A 1 132 ? -12.583 -14.384 -9.549  1.00 0.00 ? 132 VAL A HG21 1  
ATOM 2010  H HG22 . VAL A 1 132 ? -13.093 -15.046 -11.101 1.00 0.00 ? 132 VAL A HG22 1  
ATOM 2011  H HG23 . VAL A 1 132 ? -11.404 -14.616 -10.839 1.00 0.00 ? 132 VAL A HG23 1  
ATOM 2012  N N    . LYS A 1 133 ? -15.142 -11.167 -12.449 1.00 0.00 ? 133 LYS A N    1  
ATOM 2013  C CA   . LYS A 1 133 ? -15.632 -9.831  -12.765 1.00 0.00 ? 133 LYS A CA   1  
ATOM 2014  C C    . LYS A 1 133 ? -15.933 -9.046  -11.491 1.00 0.00 ? 133 LYS A C    1  
ATOM 2015  O O    . LYS A 1 133 ? -16.725 -9.482  -10.656 1.00 0.00 ? 133 LYS A O    1  
ATOM 2016  C CB   . LYS A 1 133 ? -16.889 -9.919  -13.632 1.00 0.00 ? 133 LYS A CB   1  
ATOM 2017  C CG   . LYS A 1 133 ? -17.117 -8.692  -14.499 1.00 0.00 ? 133 LYS A CG   1  
ATOM 2018  C CD   . LYS A 1 133 ? -17.901 -7.623  -13.759 1.00 0.00 ? 133 LYS A CD   1  
ATOM 2019  C CE   . LYS A 1 133 ? -19.400 -7.797  -13.954 1.00 0.00 ? 133 LYS A CE   1  
ATOM 2020  N NZ   . LYS A 1 133 ? -20.184 -7.034  -12.942 1.00 0.00 ? 133 LYS A NZ   1  
ATOM 2021  H H    . LYS A 1 133 ? -15.723 -11.785 -11.955 1.00 0.00 ? 133 LYS A H    1  
ATOM 2022  H HA   . LYS A 1 133 ? -14.859 -9.316  -13.316 1.00 0.00 ? 133 LYS A HA   1  
ATOM 2023  H HB2  . LYS A 1 133 ? -16.807 -10.779 -14.278 1.00 0.00 ? 133 LYS A HB2  1  
ATOM 2024  H HB3  . LYS A 1 133 ? -17.748 -10.042 -12.989 1.00 0.00 ? 133 LYS A HB3  1  
ATOM 2025  H HG2  . LYS A 1 133 ? -16.159 -8.284  -14.788 1.00 0.00 ? 133 LYS A HG2  1  
ATOM 2026  H HG3  . LYS A 1 133 ? -17.667 -8.984  -15.383 1.00 0.00 ? 133 LYS A HG3  1  
ATOM 2027  H HD2  . LYS A 1 133 ? -17.678 -7.689  -12.704 1.00 0.00 ? 133 LYS A HD2  1  
ATOM 2028  H HD3  . LYS A 1 133 ? -17.610 -6.651  -14.131 1.00 0.00 ? 133 LYS A HD3  1  
ATOM 2029  H HE2  . LYS A 1 133 ? -19.665 -7.447  -14.940 1.00 0.00 ? 133 LYS A HE2  1  
ATOM 2030  H HE3  . LYS A 1 133 ? -19.642 -8.846  -13.868 1.00 0.00 ? 133 LYS A HE3  1  
ATOM 2031  H HZ1  . LYS A 1 133 ? -20.611 -7.687  -12.255 1.00 0.00 ? 133 LYS A HZ1  1  
ATOM 2032  H HZ2  . LYS A 1 133 ? -20.941 -6.496  -13.409 1.00 0.00 ? 133 LYS A HZ2  1  
ATOM 2033  H HZ3  . LYS A 1 133 ? -19.563 -6.371  -12.436 1.00 0.00 ? 133 LYS A HZ3  1  
ATOM 2034  N N    . TYR A 1 134 ? -15.297 -7.888  -11.352 1.00 0.00 ? 134 TYR A N    1  
ATOM 2035  C CA   . TYR A 1 134 ? -15.497 -7.043  -10.181 1.00 0.00 ? 134 TYR A CA   1  
ATOM 2036  C C    . TYR A 1 134 ? -15.189 -5.585  -10.501 1.00 0.00 ? 134 TYR A C    1  
ATOM 2037  O O    . TYR A 1 134 ? -14.222 -5.282  -11.202 1.00 0.00 ? 134 TYR A O    1  
ATOM 2038  C CB   . TYR A 1 134 ? -14.614 -7.520  -9.026  1.00 0.00 ? 134 TYR A CB   1  
ATOM 2039  C CG   . TYR A 1 134 ? -13.133 -7.409  -9.309  1.00 0.00 ? 134 TYR A CG   1  
ATOM 2040  C CD1  . TYR A 1 134 ? -12.551 -8.114  -10.354 1.00 0.00 ? 134 TYR A CD1  1  
ATOM 2041  C CD2  . TYR A 1 134 ? -12.317 -6.595  -8.532  1.00 0.00 ? 134 TYR A CD2  1  
ATOM 2042  C CE1  . TYR A 1 134 ? -11.198 -8.015  -10.617 1.00 0.00 ? 134 TYR A CE1  1  
ATOM 2043  C CE2  . TYR A 1 134 ? -10.964 -6.489  -8.788  1.00 0.00 ? 134 TYR A CE2  1  
ATOM 2044  C CZ   . TYR A 1 134 ? -10.409 -7.202  -9.830  1.00 0.00 ? 134 TYR A CZ   1  
ATOM 2045  O OH   . TYR A 1 134 ? -9.061  -7.099  -10.090 1.00 0.00 ? 134 TYR A OH   1  
ATOM 2046  H H    . TYR A 1 134 ? -14.678 -7.595  -12.053 1.00 0.00 ? 134 TYR A H    1  
ATOM 2047  H HA   . TYR A 1 134 ? -16.533 -7.125  -9.885  1.00 0.00 ? 134 TYR A HA   1  
ATOM 2048  H HB2  . TYR A 1 134 ? -14.829 -6.929  -8.149  1.00 0.00 ? 134 TYR A HB2  1  
ATOM 2049  H HB3  . TYR A 1 134 ? -14.835 -8.557  -8.817  1.00 0.00 ? 134 TYR A HB3  1  
ATOM 2050  H HD1  . TYR A 1 134 ? -13.172 -8.750  -10.968 1.00 0.00 ? 134 TYR A HD1  1  
ATOM 2051  H HD2  . TYR A 1 134 ? -12.754 -6.039  -7.716  1.00 0.00 ? 134 TYR A HD2  1  
ATOM 2052  H HE1  . TYR A 1 134 ? -10.763 -8.573  -11.433 1.00 0.00 ? 134 TYR A HE1  1  
ATOM 2053  H HE2  . TYR A 1 134 ? -10.344 -5.853  -8.173  1.00 0.00 ? 134 TYR A HE2  1  
ATOM 2054  H HH   . TYR A 1 134 ? -8.650  -6.538  -9.427  1.00 0.00 ? 134 TYR A HH   1  
ATOM 2055  N N    . SER A 1 135 ? -16.018 -4.684  -9.984  1.00 0.00 ? 135 SER A N    1  
ATOM 2056  C CA   . SER A 1 135 ? -15.837 -3.256  -10.218 1.00 0.00 ? 135 SER A CA   1  
ATOM 2057  C C    . SER A 1 135 ? -16.584 -2.435  -9.170  1.00 0.00 ? 135 SER A C    1  
ATOM 2058  O O    . SER A 1 135 ? -17.808 -2.511  -9.065  1.00 0.00 ? 135 SER A O    1  
ATOM 2059  C CB   . SER A 1 135 ? -16.325 -2.881  -11.618 1.00 0.00 ? 135 SER A CB   1  
ATOM 2060  O OG   . SER A 1 135 ? -15.425 -3.342  -12.612 1.00 0.00 ? 135 SER A OG   1  
ATOM 2061  H H    . SER A 1 135 ? -16.770 -4.987  -9.434  1.00 0.00 ? 135 SER A H    1  
ATOM 2062  H HA   . SER A 1 135 ? -14.782 -3.038  -10.143 1.00 0.00 ? 135 SER A HA   1  
ATOM 2063  H HB2  . SER A 1 135 ? -17.292 -3.327  -11.791 1.00 0.00 ? 135 SER A HB2  1  
ATOM 2064  H HB3  . SER A 1 135 ? -16.406 -1.806  -11.693 1.00 0.00 ? 135 SER A HB3  1  
ATOM 2065  H HG   . SER A 1 135 ? -14.922 -2.600  -12.956 1.00 0.00 ? 135 SER A HG   1  
ATOM 2066  N N    . GLU A 1 136 ? -15.837 -1.651  -8.399  1.00 0.00 ? 136 GLU A N    1  
ATOM 2067  C CA   . GLU A 1 136 ? -16.429 -0.818  -7.359  1.00 0.00 ? 136 GLU A CA   1  
ATOM 2068  C C    . GLU A 1 136 ? -16.404 0.654   -7.762  1.00 0.00 ? 136 GLU A C    1  
ATOM 2069  O O    . GLU A 1 136 ? -15.634 1.058   -8.634  1.00 0.00 ? 136 GLU A O    1  
ATOM 2070  C CB   . GLU A 1 136 ? -15.683 -1.008  -6.036  1.00 0.00 ? 136 GLU A CB   1  
ATOM 2071  C CG   . GLU A 1 136 ? -14.402 -0.198  -5.938  1.00 0.00 ? 136 GLU A CG   1  
ATOM 2072  C CD   . GLU A 1 136 ? -13.287 -0.764  -6.796  1.00 0.00 ? 136 GLU A CD   1  
ATOM 2073  O OE1  . GLU A 1 136 ? -12.897 -1.929  -6.571  1.00 0.00 ? 136 GLU A OE1  1  
ATOM 2074  O OE2  . GLU A 1 136 ? -12.804 -0.041  -7.692  1.00 0.00 ? 136 GLU A OE2  1  
ATOM 2075  H H    . GLU A 1 136 ? -14.867 -1.634  -8.531  1.00 0.00 ? 136 GLU A H    1  
ATOM 2076  H HA   . GLU A 1 136 ? -17.455 -1.126  -7.230  1.00 0.00 ? 136 GLU A HA   1  
ATOM 2077  H HB2  . GLU A 1 136 ? -16.334 -0.715  -5.225  1.00 0.00 ? 136 GLU A HB2  1  
ATOM 2078  H HB3  . GLU A 1 136 ? -15.433 -2.053  -5.925  1.00 0.00 ? 136 GLU A HB3  1  
ATOM 2079  H HG2  . GLU A 1 136 ? -14.604 0.813   -6.258  1.00 0.00 ? 136 GLU A HG2  1  
ATOM 2080  H HG3  . GLU A 1 136 ? -14.075 -0.189  -4.909  1.00 0.00 ? 136 GLU A HG3  1  
ATOM 2081  N N    . LYS A 1 137 ? -17.252 1.451   -7.121  1.00 0.00 ? 137 LYS A N    1  
ATOM 2082  C CA   . LYS A 1 137 ? -17.328 2.878   -7.411  1.00 0.00 ? 137 LYS A CA   1  
ATOM 2083  C C    . LYS A 1 137 ? -16.585 3.689   -6.353  1.00 0.00 ? 137 LYS A C    1  
ATOM 2084  O O    . LYS A 1 137 ? -16.304 3.192   -5.263  1.00 0.00 ? 137 LYS A O    1  
ATOM 2085  C CB   . LYS A 1 137 ? -18.790 3.328   -7.479  1.00 0.00 ? 137 LYS A CB   1  
ATOM 2086  C CG   . LYS A 1 137 ? -18.982 4.670   -8.163  1.00 0.00 ? 137 LYS A CG   1  
ATOM 2087  C CD   . LYS A 1 137 ? -20.335 4.758   -8.849  1.00 0.00 ? 137 LYS A CD   1  
ATOM 2088  C CE   . LYS A 1 137 ? -20.366 3.934   -10.127 1.00 0.00 ? 137 LYS A CE   1  
ATOM 2089  N NZ   . LYS A 1 137 ? -21.686 4.020   -10.811 1.00 0.00 ? 137 LYS A NZ   1  
ATOM 2090  H H    . LYS A 1 137 ? -17.840 1.071   -6.435  1.00 0.00 ? 137 LYS A H    1  
ATOM 2091  H HA   . LYS A 1 137 ? -16.863 3.048   -8.370  1.00 0.00 ? 137 LYS A HA   1  
ATOM 2092  H HB2  . LYS A 1 137 ? -19.357 2.586   -8.023  1.00 0.00 ? 137 LYS A HB2  1  
ATOM 2093  H HB3  . LYS A 1 137 ? -19.179 3.400   -6.474  1.00 0.00 ? 137 LYS A HB3  1  
ATOM 2094  H HG2  . LYS A 1 137 ? -18.914 5.454   -7.423  1.00 0.00 ? 137 LYS A HG2  1  
ATOM 2095  H HG3  . LYS A 1 137 ? -18.204 4.802   -8.902  1.00 0.00 ? 137 LYS A HG3  1  
ATOM 2096  H HD2  . LYS A 1 137 ? -21.094 4.389   -8.177  1.00 0.00 ? 137 LYS A HD2  1  
ATOM 2097  H HD3  . LYS A 1 137 ? -20.539 5.792   -9.093  1.00 0.00 ? 137 LYS A HD3  1  
ATOM 2098  H HE2  . LYS A 1 137 ? -19.600 4.298   -10.793 1.00 0.00 ? 137 LYS A HE2  1  
ATOM 2099  H HE3  . LYS A 1 137 ? -20.166 2.902   -9.879  1.00 0.00 ? 137 LYS A HE3  1  
ATOM 2100  H HZ1  . LYS A 1 137 ? -22.347 4.587   -10.240 1.00 0.00 ? 137 LYS A HZ1  1  
ATOM 2101  H HZ2  . LYS A 1 137 ? -22.086 3.069   -10.939 1.00 0.00 ? 137 LYS A HZ2  1  
ATOM 2102  H HZ3  . LYS A 1 137 ? -21.578 4.469   -11.743 1.00 0.00 ? 137 LYS A HZ3  1  
ATOM 2103  N N    . GLN A 1 138 ? -16.274 4.938   -6.682  1.00 0.00 ? 138 GLN A N    1  
ATOM 2104  C CA   . GLN A 1 138 ? -15.565 5.816   -5.760  1.00 0.00 ? 138 GLN A CA   1  
ATOM 2105  C C    . GLN A 1 138 ? -15.461 7.229   -6.324  1.00 0.00 ? 138 GLN A C    1  
ATOM 2106  O O    . GLN A 1 138 ? -15.621 7.441   -7.525  1.00 0.00 ? 138 GLN A O    1  
ATOM 2107  C CB   . GLN A 1 138 ? -14.167 5.266   -5.470  1.00 0.00 ? 138 GLN A CB   1  
ATOM 2108  C CG   . GLN A 1 138 ? -13.299 5.131   -6.710  1.00 0.00 ? 138 GLN A CG   1  
ATOM 2109  C CD   . GLN A 1 138 ? -13.438 3.776   -7.377  1.00 0.00 ? 138 GLN A CD   1  
ATOM 2110  O OE1  . GLN A 1 138 ? -13.839 3.682   -8.538  1.00 0.00 ? 138 GLN A OE1  1  
ATOM 2111  N NE2  . GLN A 1 138 ? -13.109 2.718   -6.644  1.00 0.00 ? 138 GLN A NE2  1  
ATOM 2112  H H    . GLN A 1 138 ? -16.527 5.277   -7.566  1.00 0.00 ? 138 GLN A H    1  
ATOM 2113  H HA   . GLN A 1 138 ? -16.126 5.850   -4.837  1.00 0.00 ? 138 GLN A HA   1  
ATOM 2114  H HB2  . GLN A 1 138 ? -13.669 5.927   -4.778  1.00 0.00 ? 138 GLN A HB2  1  
ATOM 2115  H HB3  . GLN A 1 138 ? -14.264 4.290   -5.017  1.00 0.00 ? 138 GLN A HB3  1  
ATOM 2116  H HG2  . GLN A 1 138 ? -13.583 5.895   -7.419  1.00 0.00 ? 138 GLN A HG2  1  
ATOM 2117  H HG3  . GLN A 1 138 ? -12.266 5.271   -6.427  1.00 0.00 ? 138 GLN A HG3  1  
ATOM 2118  H HE21 . GLN A 1 138 ? -12.800 2.871   -5.726  1.00 0.00 ? 138 GLN A HE21 1  
ATOM 2119  H HE22 . GLN A 1 138 ? -13.191 1.831   -7.050  1.00 0.00 ? 138 GLN A HE22 1  
ATOM 2120  N N    . GLU A 1 139 ? -15.192 8.193   -5.448  1.00 0.00 ? 139 GLU A N    1  
ATOM 2121  C CA   . GLU A 1 139 ? -15.068 9.586   -5.861  1.00 0.00 ? 139 GLU A CA   1  
ATOM 2122  C C    . GLU A 1 139 ? -14.195 10.367  -4.884  1.00 0.00 ? 139 GLU A C    1  
ATOM 2123  O O    . GLU A 1 139 ? -14.269 10.166  -3.671  1.00 0.00 ? 139 GLU A O    1  
ATOM 2124  C CB   . GLU A 1 139 ? -16.449 10.236  -5.959  1.00 0.00 ? 139 GLU A CB   1  
ATOM 2125  C CG   . GLU A 1 139 ? -16.415 11.665  -6.478  1.00 0.00 ? 139 GLU A CG   1  
ATOM 2126  C CD   . GLU A 1 139 ? -16.132 11.739  -7.965  1.00 0.00 ? 139 GLU A CD   1  
ATOM 2127  O OE1  . GLU A 1 139 ? -15.043 11.293  -8.384  1.00 0.00 ? 139 GLU A OE1  1  
ATOM 2128  O OE2  . GLU A 1 139 ? -16.998 12.243  -8.710  1.00 0.00 ? 139 GLU A OE2  1  
ATOM 2129  H H    . GLU A 1 139 ? -15.074 7.962   -4.503  1.00 0.00 ? 139 GLU A H    1  
ATOM 2130  H HA   . GLU A 1 139 ? -14.602 9.603   -6.834  1.00 0.00 ? 139 GLU A HA   1  
ATOM 2131  H HB2  . GLU A 1 139 ? -17.064 9.649   -6.626  1.00 0.00 ? 139 GLU A HB2  1  
ATOM 2132  H HB3  . GLU A 1 139 ? -16.902 10.243  -4.979  1.00 0.00 ? 139 GLU A HB3  1  
ATOM 2133  H HG2  . GLU A 1 139 ? -17.370 12.128  -6.285  1.00 0.00 ? 139 GLU A HG2  1  
ATOM 2134  H HG3  . GLU A 1 139 ? -15.641 12.206  -5.952  1.00 0.00 ? 139 GLU A HG3  1  
ATOM 2135  N N    . ARG A 1 140 ? -13.368 11.258  -5.420  1.00 0.00 ? 140 ARG A N    1  
ATOM 2136  C CA   . ARG A 1 140 ? -12.479 12.069  -4.596  1.00 0.00 ? 140 ARG A CA   1  
ATOM 2137  C C    . ARG A 1 140 ? -12.977 13.508  -4.511  1.00 0.00 ? 140 ARG A C    1  
ATOM 2138  O O    . ARG A 1 140 ? -13.573 14.026  -5.457  1.00 0.00 ? 140 ARG A O    1  
ATOM 2139  C CB   . ARG A 1 140 ? -11.058 12.042  -5.164  1.00 0.00 ? 140 ARG A CB   1  
ATOM 2140  C CG   . ARG A 1 140 ? -10.959 12.576  -6.583  1.00 0.00 ? 140 ARG A CG   1  
ATOM 2141  C CD   . ARG A 1 140 ? -9.529  12.955  -6.938  1.00 0.00 ? 140 ARG A CD   1  
ATOM 2142  N NE   . ARG A 1 140 ? -9.424  13.484  -8.294  1.00 0.00 ? 140 ARG A NE   1  
ATOM 2143  C CZ   . ARG A 1 140 ? -9.798  14.712  -8.636  1.00 0.00 ? 140 ARG A CZ   1  
ATOM 2144  N NH1  . ARG A 1 140 ? -10.300 15.533  -7.723  1.00 0.00 ? 140 ARG A NH1  1  
ATOM 2145  N NH2  . ARG A 1 140 ? -9.671  15.121  -9.891  1.00 0.00 ? 140 ARG A NH2  1  
ATOM 2146  H H    . ARG A 1 140 ? -13.354 11.373  -6.393  1.00 0.00 ? 140 ARG A H    1  
ATOM 2147  H HA   . ARG A 1 140 ? -12.468 11.644  -3.604  1.00 0.00 ? 140 ARG A HA   1  
ATOM 2148  H HB2  . ARG A 1 140 ? -10.419 12.642  -4.532  1.00 0.00 ? 140 ARG A HB2  1  
ATOM 2149  H HB3  . ARG A 1 140 ? -10.700 11.024  -5.159  1.00 0.00 ? 140 ARG A HB3  1  
ATOM 2150  H HG2  . ARG A 1 140 ? -11.299 11.814  -7.270  1.00 0.00 ? 140 ARG A HG2  1  
ATOM 2151  H HG3  . ARG A 1 140 ? -11.586 13.450  -6.673  1.00 0.00 ? 140 ARG A HG3  1  
ATOM 2152  H HD2  . ARG A 1 140 ? -9.186  13.705  -6.242  1.00 0.00 ? 140 ARG A HD2  1  
ATOM 2153  H HD3  . ARG A 1 140 ? -8.908  12.075  -6.855  1.00 0.00 ? 140 ARG A HD3  1  
ATOM 2154  H HE   . ARG A 1 140 ? -9.056  12.894  -8.985  1.00 0.00 ? 140 ARG A HE   1  
ATOM 2155  H HH11 . ARG A 1 140 ? -10.396 15.227  -6.775  1.00 0.00 ? 140 ARG A HH11 1  
ATOM 2156  H HH12 . ARG A 1 140 ? -10.580 16.458  -7.981  1.00 0.00 ? 140 ARG A HH12 1  
ATOM 2157  H HH21 . ARG A 1 140 ? -9.293  14.505  -10.582 1.00 0.00 ? 140 ARG A HH21 1  
ATOM 2158  H HH22 . ARG A 1 140 ? -9.954  16.046  -10.146 1.00 0.00 ? 140 ARG A HH22 1  
ATOM 2159  N N    . SER A 1 141 ? -12.731 14.148  -3.374  1.00 0.00 ? 141 SER A N    1  
ATOM 2160  C CA   . SER A 1 141 ? -13.158 15.526  -3.164  1.00 0.00 ? 141 SER A CA   1  
ATOM 2161  C C    . SER A 1 141 ? -12.146 16.285  -2.310  1.00 0.00 ? 141 SER A C    1  
ATOM 2162  O O    . SER A 1 141 ? -11.424 15.693  -1.510  1.00 0.00 ? 141 SER A O    1  
ATOM 2163  C CB   . SER A 1 141 ? -14.534 15.560  -2.495  1.00 0.00 ? 141 SER A CB   1  
ATOM 2164  O OG   . SER A 1 141 ? -14.506 14.904  -1.240  1.00 0.00 ? 141 SER A OG   1  
ATOM 2165  H H    . SER A 1 141 ? -12.251 13.682  -2.658  1.00 0.00 ? 141 SER A H    1  
ATOM 2166  H HA   . SER A 1 141 ? -13.226 16.003  -4.130  1.00 0.00 ? 141 SER A HA   1  
ATOM 2167  H HB2  . SER A 1 141 ? -14.834 16.586  -2.346  1.00 0.00 ? 141 SER A HB2  1  
ATOM 2168  H HB3  . SER A 1 141 ? -15.252 15.064  -3.131  1.00 0.00 ? 141 SER A HB3  1  
ATOM 2169  H HG   . SER A 1 141 ? -14.894 15.475  -0.572  1.00 0.00 ? 141 SER A HG   1  
ATOM 2170  N N    . GLY A 1 142 ? -12.102 17.602  -2.487  1.00 0.00 ? 142 GLY A N    1  
ATOM 2171  C CA   . GLY A 1 142 ? -11.176 18.422  -1.727  1.00 0.00 ? 142 GLY A CA   1  
ATOM 2172  C C    . GLY A 1 142 ? -11.484 18.420  -0.242  1.00 0.00 ? 142 GLY A C    1  
ATOM 2173  O O    . GLY A 1 142 ? -11.093 17.513  0.493   1.00 0.00 ? 142 GLY A O    1  
ATOM 2174  H H    . GLY A 1 142 ? -12.703 18.021  -3.139  1.00 0.00 ? 142 GLY A H    1  
ATOM 2175  H HA2  . GLY A 1 142 ? -10.174 18.049  -1.877  1.00 0.00 ? 142 GLY A HA2  1  
ATOM 2176  H HA3  . GLY A 1 142 ? -11.229 19.437  -2.092  1.00 0.00 ? 142 GLY A HA3  1  
ATOM 2177  N N    . PRO A 1 143 ? -12.201 19.455  0.219   1.00 0.00 ? 143 PRO A N    1  
ATOM 2178  C CA   . PRO A 1 143 ? -12.576 19.594  1.630   1.00 0.00 ? 143 PRO A CA   1  
ATOM 2179  C C    . PRO A 1 143 ? -13.612 18.559  2.058   1.00 0.00 ? 143 PRO A C    1  
ATOM 2180  O O    . PRO A 1 143 ? -14.809 18.739  1.835   1.00 0.00 ? 143 PRO A O    1  
ATOM 2181  C CB   . PRO A 1 143 ? -13.165 21.004  1.704   1.00 0.00 ? 143 PRO A CB   1  
ATOM 2182  C CG   . PRO A 1 143 ? -13.648 21.286  0.323   1.00 0.00 ? 143 PRO A CG   1  
ATOM 2183  C CD   . PRO A 1 143 ? -12.700 20.572  -0.601  1.00 0.00 ? 143 PRO A CD   1  
ATOM 2184  H HA   . PRO A 1 143 ? -11.713 19.526  2.277   1.00 0.00 ? 143 PRO A HA   1  
ATOM 2185  H HB2  . PRO A 1 143 ? -13.976 21.021  2.419   1.00 0.00 ? 143 PRO A HB2  1  
ATOM 2186  H HB3  . PRO A 1 143 ? -12.398 21.703  2.004   1.00 0.00 ? 143 PRO A HB3  1  
ATOM 2187  H HG2  . PRO A 1 143 ? -14.650 20.905  0.200   1.00 0.00 ? 143 PRO A HG2  1  
ATOM 2188  H HG3  . PRO A 1 143 ? -13.623 22.349  0.136   1.00 0.00 ? 143 PRO A HG3  1  
ATOM 2189  H HD2  . PRO A 1 143 ? -13.225 20.207  -1.472  1.00 0.00 ? 143 PRO A HD2  1  
ATOM 2190  H HD3  . PRO A 1 143 ? -11.893 21.227  -0.893  1.00 0.00 ? 143 PRO A HD3  1  
ATOM 2191  N N    . SER A 1 144 ? -13.143 17.479  2.672   1.00 0.00 ? 144 SER A N    1  
ATOM 2192  C CA   . SER A 1 144 ? -14.029 16.414  3.128   1.00 0.00 ? 144 SER A CA   1  
ATOM 2193  C C    . SER A 1 144 ? -15.085 16.960  4.085   1.00 0.00 ? 144 SER A C    1  
ATOM 2194  O O    . SER A 1 144 ? -14.783 17.764  4.967   1.00 0.00 ? 144 SER A O    1  
ATOM 2195  C CB   . SER A 1 144 ? -13.224 15.310  3.814   1.00 0.00 ? 144 SER A CB   1  
ATOM 2196  O OG   . SER A 1 144 ? -12.807 15.711  5.108   1.00 0.00 ? 144 SER A OG   1  
ATOM 2197  H H    . SER A 1 144 ? -12.177 17.393  2.820   1.00 0.00 ? 144 SER A H    1  
ATOM 2198  H HA   . SER A 1 144 ? -14.525 16.001  2.262   1.00 0.00 ? 144 SER A HA   1  
ATOM 2199  H HB2  . SER A 1 144 ? -13.835 14.424  3.905   1.00 0.00 ? 144 SER A HB2  1  
ATOM 2200  H HB3  . SER A 1 144 ? -12.350 15.083  3.221   1.00 0.00 ? 144 SER A HB3  1  
ATOM 2201  H HG   . SER A 1 144 ? -12.828 16.668  5.168   1.00 0.00 ? 144 SER A HG   1  
ATOM 2202  N N    . SER A 1 145 ? -16.325 16.515  3.906   1.00 0.00 ? 145 SER A N    1  
ATOM 2203  C CA   . SER A 1 145 ? -17.427 16.960  4.749   1.00 0.00 ? 145 SER A CA   1  
ATOM 2204  C C    . SER A 1 145 ? -17.116 16.713  6.223   1.00 0.00 ? 145 SER A C    1  
ATOM 2205  O O    . SER A 1 145 ? -17.104 17.642  7.031   1.00 0.00 ? 145 SER A O    1  
ATOM 2206  C CB   . SER A 1 145 ? -18.719 16.240  4.360   1.00 0.00 ? 145 SER A CB   1  
ATOM 2207  O OG   . SER A 1 145 ? -19.855 16.926  4.855   1.00 0.00 ? 145 SER A OG   1  
ATOM 2208  H H    . SER A 1 145 ? -16.503 15.874  3.184   1.00 0.00 ? 145 SER A H    1  
ATOM 2209  H HA   . SER A 1 145 ? -17.555 18.021  4.594   1.00 0.00 ? 145 SER A HA   1  
ATOM 2210  H HB2  . SER A 1 145 ? -18.787 16.183  3.285   1.00 0.00 ? 145 SER A HB2  1  
ATOM 2211  H HB3  . SER A 1 145 ? -18.709 15.241  4.773   1.00 0.00 ? 145 SER A HB3  1  
ATOM 2212  H HG   . SER A 1 145 ? -19.582 17.555  5.528   1.00 0.00 ? 145 SER A HG   1  
ATOM 2213  N N    . GLY A 1 146 ? -16.866 15.453  6.564   1.00 0.00 ? 146 GLY A N    1  
ATOM 2214  C CA   . GLY A 1 146 ? -16.560 15.105  7.940   1.00 0.00 ? 146 GLY A CA   1  
ATOM 2215  C C    . GLY A 1 146 ? -15.748 13.830  8.048   1.00 0.00 ? 146 GLY A C    1  
ATOM 2216  O O    . GLY A 1 146 ? -15.632 13.075  7.082   1.00 0.00 ? 146 GLY A O    1  
ATOM 2217  H H    . GLY A 1 146 ? -16.890 14.754  5.878   1.00 0.00 ? 146 GLY A H    1  
ATOM 2218  H HA2  . GLY A 1 146 ? -16.002 15.913  8.388   1.00 0.00 ? 146 GLY A HA2  1  
ATOM 2219  H HA3  . GLY A 1 146 ? -17.485 14.975  8.481   1.00 0.00 ? 146 GLY A HA3  1  
ATOM 2220  N N    . GLY A 1 1   ? 13.671  -16.097 37.544  1.00 0.00 ? 1   GLY A N    2  
ATOM 2221  C CA   . GLY A 1 1   ? 12.945  -17.026 36.699  1.00 0.00 ? 1   GLY A CA   2  
ATOM 2222  C C    . GLY A 1 1   ? 13.751  -18.269 36.377  1.00 0.00 ? 1   GLY A C    2  
ATOM 2223  O O    . GLY A 1 1   ? 14.786  -18.522 36.993  1.00 0.00 ? 1   GLY A O    2  
ATOM 2224  H H1   . GLY A 1 1   ? 13.271  -15.233 37.777  1.00 0.00 ? 1   GLY A H1   2  
ATOM 2225  H HA2  . GLY A 1 1   ? 12.036  -17.320 37.203  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 2226  H HA3  . GLY A 1 1   ? 12.688  -16.528 35.775  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 2227  N N    . SER A 1 2   ? 13.275  -19.047 35.410  1.00 0.00 ? 2   SER A N    2  
ATOM 2228  C CA   . SER A 1 2   ? 13.956  -20.273 35.011  1.00 0.00 ? 2   SER A CA   2  
ATOM 2229  C C    . SER A 1 2   ? 13.520  -20.706 33.614  1.00 0.00 ? 2   SER A C    2  
ATOM 2230  O O    . SER A 1 2   ? 12.640  -20.095 33.009  1.00 0.00 ? 2   SER A O    2  
ATOM 2231  C CB   . SER A 1 2   ? 13.670  -21.391 36.016  1.00 0.00 ? 2   SER A CB   2  
ATOM 2232  O OG   . SER A 1 2   ? 12.277  -21.637 36.121  1.00 0.00 ? 2   SER A OG   2  
ATOM 2233  H H    . SER A 1 2   ? 12.445  -18.791 34.956  1.00 0.00 ? 2   SER A H    2  
ATOM 2234  H HA   . SER A 1 2   ? 15.017  -20.074 34.999  1.00 0.00 ? 2   SER A HA   2  
ATOM 2235  H HB2  . SER A 1 2   ? 14.160  -22.295 35.693  1.00 0.00 ? 2   SER A HB2  2  
ATOM 2236  H HB3  . SER A 1 2   ? 14.047  -21.103 36.987  1.00 0.00 ? 2   SER A HB3  2  
ATOM 2237  H HG   . SER A 1 2   ? 11.835  -21.315 35.333  1.00 0.00 ? 2   SER A HG   2  
ATOM 2238  N N    . SER A 1 3   ? 14.145  -21.765 33.108  1.00 0.00 ? 3   SER A N    2  
ATOM 2239  C CA   . SER A 1 3   ? 13.826  -22.278 31.781  1.00 0.00 ? 3   SER A CA   2  
ATOM 2240  C C    . SER A 1 3   ? 12.866  -23.460 31.873  1.00 0.00 ? 3   SER A C    2  
ATOM 2241  O O    . SER A 1 3   ? 13.135  -24.441 32.564  1.00 0.00 ? 3   SER A O    2  
ATOM 2242  C CB   . SER A 1 3   ? 15.104  -22.700 31.053  1.00 0.00 ? 3   SER A CB   2  
ATOM 2243  O OG   . SER A 1 3   ? 16.048  -21.642 31.025  1.00 0.00 ? 3   SER A OG   2  
ATOM 2244  H H    . SER A 1 3   ? 14.840  -22.208 33.639  1.00 0.00 ? 3   SER A H    2  
ATOM 2245  H HA   . SER A 1 3   ? 13.350  -21.485 31.224  1.00 0.00 ? 3   SER A HA   2  
ATOM 2246  H HB2  . SER A 1 3   ? 15.543  -23.544 31.563  1.00 0.00 ? 3   SER A HB2  2  
ATOM 2247  H HB3  . SER A 1 3   ? 14.862  -22.977 30.038  1.00 0.00 ? 3   SER A HB3  2  
ATOM 2248  H HG   . SER A 1 3   ? 16.915  -21.981 31.261  1.00 0.00 ? 3   SER A HG   2  
ATOM 2249  N N    . GLY A 1 4   ? 11.744  -23.358 31.168  1.00 0.00 ? 4   GLY A N    2  
ATOM 2250  C CA   . GLY A 1 4   ? 10.759  -24.425 31.183  1.00 0.00 ? 4   GLY A CA   2  
ATOM 2251  C C    . GLY A 1 4   ? 9.810   -24.354 30.002  1.00 0.00 ? 4   GLY A C    2  
ATOM 2252  O O    . GLY A 1 4   ? 9.789   -25.250 29.159  1.00 0.00 ? 4   GLY A O    2  
ATOM 2253  H H    . GLY A 1 4   ? 11.581  -22.552 30.634  1.00 0.00 ? 4   GLY A H    2  
ATOM 2254  H HA2  . GLY A 1 4   ? 11.272  -25.374 31.161  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 2255  H HA3  . GLY A 1 4   ? 10.185  -24.357 32.095  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 2256  N N    . SER A 1 5   ? 9.019   -23.286 29.944  1.00 0.00 ? 5   SER A N    2  
ATOM 2257  C CA   . SER A 1 5   ? 8.060   -23.105 28.861  1.00 0.00 ? 5   SER A CA   2  
ATOM 2258  C C    . SER A 1 5   ? 8.699   -22.373 27.685  1.00 0.00 ? 5   SER A C    2  
ATOM 2259  O O    . SER A 1 5   ? 9.483   -21.442 27.871  1.00 0.00 ? 5   SER A O    2  
ATOM 2260  C CB   . SER A 1 5   ? 6.840   -22.327 29.359  1.00 0.00 ? 5   SER A CB   2  
ATOM 2261  O OG   . SER A 1 5   ? 7.225   -21.103 29.962  1.00 0.00 ? 5   SER A OG   2  
ATOM 2262  H H    . SER A 1 5   ? 9.082   -22.606 30.648  1.00 0.00 ? 5   SER A H    2  
ATOM 2263  H HA   . SER A 1 5   ? 7.742   -24.083 28.532  1.00 0.00 ? 5   SER A HA   2  
ATOM 2264  H HB2  . SER A 1 5   ? 6.187   -22.114 28.525  1.00 0.00 ? 5   SER A HB2  2  
ATOM 2265  H HB3  . SER A 1 5   ? 6.310   -22.922 30.089  1.00 0.00 ? 5   SER A HB3  2  
ATOM 2266  H HG   . SER A 1 5   ? 7.911   -20.688 29.432  1.00 0.00 ? 5   SER A HG   2  
ATOM 2267  N N    . SER A 1 6   ? 8.356   -22.800 26.474  1.00 0.00 ? 6   SER A N    2  
ATOM 2268  C CA   . SER A 1 6   ? 8.899   -22.189 25.267  1.00 0.00 ? 6   SER A CA   2  
ATOM 2269  C C    . SER A 1 6   ? 8.134   -22.654 24.032  1.00 0.00 ? 6   SER A C    2  
ATOM 2270  O O    . SER A 1 6   ? 8.083   -23.846 23.730  1.00 0.00 ? 6   SER A O    2  
ATOM 2271  C CB   . SER A 1 6   ? 10.383  -22.531 25.119  1.00 0.00 ? 6   SER A CB   2  
ATOM 2272  O OG   . SER A 1 6   ? 11.042  -21.593 24.284  1.00 0.00 ? 6   SER A OG   2  
ATOM 2273  H H    . SER A 1 6   ? 7.726   -23.547 26.391  1.00 0.00 ? 6   SER A H    2  
ATOM 2274  H HA   . SER A 1 6   ? 8.792   -21.118 25.360  1.00 0.00 ? 6   SER A HA   2  
ATOM 2275  H HB2  . SER A 1 6   ? 10.851  -22.520 26.092  1.00 0.00 ? 6   SER A HB2  2  
ATOM 2276  H HB3  . SER A 1 6   ? 10.481  -23.515 24.684  1.00 0.00 ? 6   SER A HB3  2  
ATOM 2277  H HG   . SER A 1 6   ? 11.690  -22.048 23.742  1.00 0.00 ? 6   SER A HG   2  
ATOM 2278  N N    . GLY A 1 7   ? 7.538   -21.702 23.319  1.00 0.00 ? 7   GLY A N    2  
ATOM 2279  C CA   . GLY A 1 7   ? 6.783   -22.032 22.125  1.00 0.00 ? 7   GLY A CA   2  
ATOM 2280  C C    . GLY A 1 7   ? 5.805   -20.941 21.736  1.00 0.00 ? 7   GLY A C    2  
ATOM 2281  O O    . GLY A 1 7   ? 4.603   -21.064 21.967  1.00 0.00 ? 7   GLY A O    2  
ATOM 2282  H H    . GLY A 1 7   ? 7.612   -20.768 23.606  1.00 0.00 ? 7   GLY A H    2  
ATOM 2283  H HA2  . GLY A 1 7   ? 7.471   -22.192 21.309  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 2284  H HA3  . GLY A 1 7   ? 6.232   -22.945 22.302  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 2285  N N    . ASN A 1 8   ? 6.322   -19.868 21.146  1.00 0.00 ? 8   ASN A N    2  
ATOM 2286  C CA   . ASN A 1 8   ? 5.488   -18.749 20.726  1.00 0.00 ? 8   ASN A CA   2  
ATOM 2287  C C    . ASN A 1 8   ? 4.603   -19.143 19.547  1.00 0.00 ? 8   ASN A C    2  
ATOM 2288  O O    . ASN A 1 8   ? 5.079   -19.704 18.561  1.00 0.00 ? 8   ASN A O    2  
ATOM 2289  C CB   . ASN A 1 8   ? 6.358   -17.550 20.347  1.00 0.00 ? 8   ASN A CB   2  
ATOM 2290  C CG   . ASN A 1 8   ? 7.432   -17.265 21.380  1.00 0.00 ? 8   ASN A CG   2  
ATOM 2291  O OD1  . ASN A 1 8   ? 7.189   -16.574 22.369  1.00 0.00 ? 8   ASN A OD1  2  
ATOM 2292  N ND2  . ASN A 1 8   ? 8.626   -17.799 21.153  1.00 0.00 ? 8   ASN A ND2  2  
ATOM 2293  H H    . ASN A 1 8   ? 7.289   -19.829 20.988  1.00 0.00 ? 8   ASN A H    2  
ATOM 2294  H HA   . ASN A 1 8   ? 4.857   -18.476 21.558  1.00 0.00 ? 8   ASN A HA   2  
ATOM 2295  H HB2  . ASN A 1 8   ? 6.840   -17.748 19.400  1.00 0.00 ? 8   ASN A HB2  2  
ATOM 2296  H HB3  . ASN A 1 8   ? 5.734   -16.674 20.252  1.00 0.00 ? 8   ASN A HB3  2  
ATOM 2297  H HD21 . ASN A 1 8   ? 8.747   -18.339 20.344  1.00 0.00 ? 8   ASN A HD21 2  
ATOM 2298  H HD22 . ASN A 1 8   ? 9.339   -17.631 21.805  1.00 0.00 ? 8   ASN A HD22 2  
ATOM 2299  N N    . ARG A 1 9   ? 3.313   -18.842 19.657  1.00 0.00 ? 9   ARG A N    2  
ATOM 2300  C CA   . ARG A 1 9   ? 2.361   -19.165 18.601  1.00 0.00 ? 9   ARG A CA   2  
ATOM 2301  C C    . ARG A 1 9   ? 1.948   -17.908 17.838  1.00 0.00 ? 9   ARG A C    2  
ATOM 2302  O O    . ARG A 1 9   ? 1.832   -16.828 18.419  1.00 0.00 ? 9   ARG A O    2  
ATOM 2303  C CB   . ARG A 1 9   ? 1.125   -19.846 19.189  1.00 0.00 ? 9   ARG A CB   2  
ATOM 2304  C CG   . ARG A 1 9   ? 0.369   -18.983 20.187  1.00 0.00 ? 9   ARG A CG   2  
ATOM 2305  C CD   . ARG A 1 9   ? -0.697  -18.144 19.501  1.00 0.00 ? 9   ARG A CD   2  
ATOM 2306  N NE   . ARG A 1 9   ? -1.795  -18.962 18.991  1.00 0.00 ? 9   ARG A NE   2  
ATOM 2307  C CZ   . ARG A 1 9   ? -3.022  -18.498 18.783  1.00 0.00 ? 9   ARG A CZ   2  
ATOM 2308  N NH1  . ARG A 1 9   ? -3.307  -17.229 19.039  1.00 0.00 ? 9   ARG A NH1  2  
ATOM 2309  N NH2  . ARG A 1 9   ? -3.966  -19.304 18.317  1.00 0.00 ? 9   ARG A NH2  2  
ATOM 2310  H H    . ARG A 1 9   ? 2.993   -18.395 20.467  1.00 0.00 ? 9   ARG A H    2  
ATOM 2311  H HA   . ARG A 1 9   ? 2.844   -19.844 17.914  1.00 0.00 ? 9   ARG A HA   2  
ATOM 2312  H HB2  . ARG A 1 9   ? 0.451   -20.101 18.384  1.00 0.00 ? 9   ARG A HB2  2  
ATOM 2313  H HB3  . ARG A 1 9   ? 1.433   -20.752 19.689  1.00 0.00 ? 9   ARG A HB3  2  
ATOM 2314  H HG2  . ARG A 1 9   ? -0.106  -19.624 20.915  1.00 0.00 ? 9   ARG A HG2  2  
ATOM 2315  H HG3  . ARG A 1 9   ? 1.069   -18.327 20.682  1.00 0.00 ? 9   ARG A HG3  2  
ATOM 2316  H HD2  . ARG A 1 9   ? -1.091  -17.434 20.213  1.00 0.00 ? 9   ARG A HD2  2  
ATOM 2317  H HD3  . ARG A 1 9   ? -0.243  -17.612 18.678  1.00 0.00 ? 9   ARG A HD3  2  
ATOM 2318  H HE   . ARG A 1 9   ? -1.605  -19.902 18.795  1.00 0.00 ? 9   ARG A HE   2  
ATOM 2319  H HH11 . ARG A 1 9   ? -2.596  -16.619 19.390  1.00 0.00 ? 9   ARG A HH11 2  
ATOM 2320  H HH12 . ARG A 1 9   ? -4.231  -16.882 18.881  1.00 0.00 ? 9   ARG A HH12 2  
ATOM 2321  H HH21 . ARG A 1 9   ? -3.754  -20.262 18.122  1.00 0.00 ? 9   ARG A HH21 2  
ATOM 2322  H HH22 . ARG A 1 9   ? -4.890  -18.955 18.161  1.00 0.00 ? 9   ARG A HH22 2  
ATOM 2323  N N    . LEU A 1 10  ? 1.727   -18.058 16.537  1.00 0.00 ? 10  LEU A N    2  
ATOM 2324  C CA   . LEU A 1 10  ? 1.328   -16.936 15.695  1.00 0.00 ? 10  LEU A CA   2  
ATOM 2325  C C    . LEU A 1 10  ? -0.129  -17.070 15.265  1.00 0.00 ? 10  LEU A C    2  
ATOM 2326  O O    . LEU A 1 10  ? -0.648  -18.179 15.128  1.00 0.00 ? 10  LEU A O    2  
ATOM 2327  C CB   . LEU A 1 10  ? 2.230   -16.851 14.462  1.00 0.00 ? 10  LEU A CB   2  
ATOM 2328  C CG   . LEU A 1 10  ? 2.175   -18.044 13.508  1.00 0.00 ? 10  LEU A CG   2  
ATOM 2329  C CD1  . LEU A 1 10  ? 1.105   -17.831 12.448  1.00 0.00 ? 10  LEU A CD1  2  
ATOM 2330  C CD2  . LEU A 1 10  ? 3.533   -18.269 12.858  1.00 0.00 ? 10  LEU A CD2  2  
ATOM 2331  H H    . LEU A 1 10  ? 1.836   -18.944 16.132  1.00 0.00 ? 10  LEU A H    2  
ATOM 2332  H HA   . LEU A 1 10  ? 1.437   -16.031 16.275  1.00 0.00 ? 10  LEU A HA   2  
ATOM 2333  H HB2  . LEU A 1 10  ? 1.947   -15.970 13.907  1.00 0.00 ? 10  LEU A HB2  2  
ATOM 2334  H HB3  . LEU A 1 10  ? 3.249   -16.747 14.806  1.00 0.00 ? 10  LEU A HB3  2  
ATOM 2335  H HG   . LEU A 1 10  ? 1.918   -18.933 14.066  1.00 0.00 ? 10  LEU A HG   2  
ATOM 2336  H HD11 . LEU A 1 10  ? 0.622   -18.770 12.231  1.00 0.00 ? 10  LEU A HD11 2  
ATOM 2337  H HD12 . LEU A 1 10  ? 1.561   -17.443 11.549  1.00 0.00 ? 10  LEU A HD12 2  
ATOM 2338  H HD13 . LEU A 1 10  ? 0.373   -17.124 12.814  1.00 0.00 ? 10  LEU A HD13 2  
ATOM 2339  H HD21 . LEU A 1 10  ? 3.854   -19.284 13.042  1.00 0.00 ? 10  LEU A HD21 2  
ATOM 2340  H HD22 . LEU A 1 10  ? 4.252   -17.582 13.280  1.00 0.00 ? 10  LEU A HD22 2  
ATOM 2341  H HD23 . LEU A 1 10  ? 3.456   -18.103 11.795  1.00 0.00 ? 10  LEU A HD23 2  
ATOM 2342  N N    . LEU A 1 11  ? -0.785  -15.934 15.050  1.00 0.00 ? 11  LEU A N    2  
ATOM 2343  C CA   . LEU A 1 11  ? -2.182  -15.924 14.633  1.00 0.00 ? 11  LEU A CA   2  
ATOM 2344  C C    . LEU A 1 11  ? -2.379  -15.033 13.411  1.00 0.00 ? 11  LEU A C    2  
ATOM 2345  O O    . LEU A 1 11  ? -3.506  -14.808 12.968  1.00 0.00 ? 11  LEU A O    2  
ATOM 2346  C CB   . LEU A 1 11  ? -3.075  -15.443 15.778  1.00 0.00 ? 11  LEU A CB   2  
ATOM 2347  C CG   . LEU A 1 11  ? -3.001  -13.951 16.104  1.00 0.00 ? 11  LEU A CG   2  
ATOM 2348  C CD1  . LEU A 1 11  ? -4.269  -13.496 16.810  1.00 0.00 ? 11  LEU A CD1  2  
ATOM 2349  C CD2  . LEU A 1 11  ? -1.777  -13.651 16.957  1.00 0.00 ? 11  LEU A CD2  2  
ATOM 2350  H H    . LEU A 1 11  ? -0.318  -15.082 15.176  1.00 0.00 ? 11  LEU A H    2  
ATOM 2351  H HA   . LEU A 1 11  ? -2.458  -16.936 14.374  1.00 0.00 ? 11  LEU A HA   2  
ATOM 2352  H HB2  . LEU A 1 11  ? -4.097  -15.675 15.522  1.00 0.00 ? 11  LEU A HB2  2  
ATOM 2353  H HB3  . LEU A 1 11  ? -2.794  -15.992 16.666  1.00 0.00 ? 11  LEU A HB3  2  
ATOM 2354  H HG   . LEU A 1 11  ? -2.913  -13.392 15.183  1.00 0.00 ? 11  LEU A HG   2  
ATOM 2355  H HD11 . LEU A 1 11  ? -4.025  -13.157 17.805  1.00 0.00 ? 11  LEU A HD11 2  
ATOM 2356  H HD12 . LEU A 1 11  ? -4.963  -14.320 16.870  1.00 0.00 ? 11  LEU A HD12 2  
ATOM 2357  H HD13 . LEU A 1 11  ? -4.720  -12.687 16.253  1.00 0.00 ? 11  LEU A HD13 2  
ATOM 2358  H HD21 . LEU A 1 11  ? -1.320  -12.733 16.619  1.00 0.00 ? 11  LEU A HD21 2  
ATOM 2359  H HD22 . LEU A 1 11  ? -1.067  -14.461 16.866  1.00 0.00 ? 11  LEU A HD22 2  
ATOM 2360  H HD23 . LEU A 1 11  ? -2.075  -13.547 17.989  1.00 0.00 ? 11  LEU A HD23 2  
ATOM 2361  N N    . SER A 1 12  ? -1.275  -14.529 12.868  1.00 0.00 ? 12  SER A N    2  
ATOM 2362  C CA   . SER A 1 12  ? -1.326  -13.661 11.697  1.00 0.00 ? 12  SER A CA   2  
ATOM 2363  C C    . SER A 1 12  ? -0.221  -14.017 10.708  1.00 0.00 ? 12  SER A C    2  
ATOM 2364  O O    . SER A 1 12  ? 0.661   -14.822 11.007  1.00 0.00 ? 12  SER A O    2  
ATOM 2365  C CB   . SER A 1 12  ? -1.198  -12.196 12.117  1.00 0.00 ? 12  SER A CB   2  
ATOM 2366  O OG   . SER A 1 12  ? -2.468  -11.633 12.401  1.00 0.00 ? 12  SER A OG   2  
ATOM 2367  H H    . SER A 1 12  ? -0.405  -14.746 13.265  1.00 0.00 ? 12  SER A H    2  
ATOM 2368  H HA   . SER A 1 12  ? -2.283  -13.807 11.218  1.00 0.00 ? 12  SER A HA   2  
ATOM 2369  H HB2  . SER A 1 12  ? -0.584  -12.129 13.002  1.00 0.00 ? 12  SER A HB2  2  
ATOM 2370  H HB3  . SER A 1 12  ? -0.739  -11.633 11.317  1.00 0.00 ? 12  SER A HB3  2  
ATOM 2371  H HG   . SER A 1 12  ? -2.747  -11.085 11.664  1.00 0.00 ? 12  SER A HG   2  
ATOM 2372  N N    . LYS A 1 13  ? -0.275  -13.411 9.527   1.00 0.00 ? 13  LYS A N    2  
ATOM 2373  C CA   . LYS A 1 13  ? 0.721   -13.661 8.492   1.00 0.00 ? 13  LYS A CA   2  
ATOM 2374  C C    . LYS A 1 13  ? 1.948   -12.776 8.692   1.00 0.00 ? 13  LYS A C    2  
ATOM 2375  O O    . LYS A 1 13  ? 2.504   -12.243 7.731   1.00 0.00 ? 13  LYS A O    2  
ATOM 2376  C CB   . LYS A 1 13  ? 0.120   -13.413 7.106   1.00 0.00 ? 13  LYS A CB   2  
ATOM 2377  C CG   . LYS A 1 13  ? 0.815   -14.181 5.996   1.00 0.00 ? 13  LYS A CG   2  
ATOM 2378  C CD   . LYS A 1 13  ? 0.181   -15.545 5.780   1.00 0.00 ? 13  LYS A CD   2  
ATOM 2379  C CE   . LYS A 1 13  ? -0.942  -15.482 4.756   1.00 0.00 ? 13  LYS A CE   2  
ATOM 2380  N NZ   . LYS A 1 13  ? -2.068  -14.627 5.220   1.00 0.00 ? 13  LYS A NZ   2  
ATOM 2381  H H    . LYS A 1 13  ? -1.003  -12.779 9.347   1.00 0.00 ? 13  LYS A H    2  
ATOM 2382  H HA   . LYS A 1 13  ? 1.022   -14.695 8.564   1.00 0.00 ? 13  LYS A HA   2  
ATOM 2383  H HB2  . LYS A 1 13  ? -0.919  -13.703 7.121   1.00 0.00 ? 13  LYS A HB2  2  
ATOM 2384  H HB3  . LYS A 1 13  ? 0.187   -12.357 6.882   1.00 0.00 ? 13  LYS A HB3  2  
ATOM 2385  H HG2  . LYS A 1 13  ? 0.744   -13.614 5.079   1.00 0.00 ? 13  LYS A HG2  2  
ATOM 2386  H HG3  . LYS A 1 13  ? 1.855   -14.315 6.258   1.00 0.00 ? 13  LYS A HG3  2  
ATOM 2387  H HD2  . LYS A 1 13  ? 0.936   -16.232 5.427   1.00 0.00 ? 13  LYS A HD2  2  
ATOM 2388  H HD3  . LYS A 1 13  ? -0.219  -15.899 6.719   1.00 0.00 ? 13  LYS A HD3  2  
ATOM 2389  H HE2  . LYS A 1 13  ? -0.549  -15.077 3.836   1.00 0.00 ? 13  LYS A HE2  2  
ATOM 2390  H HE3  . LYS A 1 13  ? -1.307  -16.483 4.581   1.00 0.00 ? 13  LYS A HE3  2  
ATOM 2391  H HZ1  . LYS A 1 13  ? -2.862  -14.687 4.549   1.00 0.00 ? 13  LYS A HZ1  2  
ATOM 2392  H HZ2  . LYS A 1 13  ? -1.762  -13.636 5.288   1.00 0.00 ? 13  LYS A HZ2  2  
ATOM 2393  H HZ3  . LYS A 1 13  ? -2.395  -14.943 6.155   1.00 0.00 ? 13  LYS A HZ3  2  
ATOM 2394  N N    . TYR A 1 14  ? 2.364   -12.625 9.944   1.00 0.00 ? 14  TYR A N    2  
ATOM 2395  C CA   . TYR A 1 14  ? 3.524   -11.804 10.269  1.00 0.00 ? 14  TYR A CA   2  
ATOM 2396  C C    . TYR A 1 14  ? 4.779   -12.662 10.405  1.00 0.00 ? 14  TYR A C    2  
ATOM 2397  O O    . TYR A 1 14  ? 4.774   -13.684 11.091  1.00 0.00 ? 14  TYR A O    2  
ATOM 2398  C CB   . TYR A 1 14  ? 3.281   -11.030 11.566  1.00 0.00 ? 14  TYR A CB   2  
ATOM 2399  C CG   . TYR A 1 14  ? 4.160   -9.810  11.717  1.00 0.00 ? 14  TYR A CG   2  
ATOM 2400  C CD1  . TYR A 1 14  ? 5.518   -9.936  11.983  1.00 0.00 ? 14  TYR A CD1  2  
ATOM 2401  C CD2  . TYR A 1 14  ? 3.632   -8.530  11.595  1.00 0.00 ? 14  TYR A CD2  2  
ATOM 2402  C CE1  . TYR A 1 14  ? 6.324   -8.823  12.121  1.00 0.00 ? 14  TYR A CE1  2  
ATOM 2403  C CE2  . TYR A 1 14  ? 4.431   -7.412  11.731  1.00 0.00 ? 14  TYR A CE2  2  
ATOM 2404  C CZ   . TYR A 1 14  ? 5.777   -7.563  11.995  1.00 0.00 ? 14  TYR A CZ   2  
ATOM 2405  O OH   . TYR A 1 14  ? 6.577   -6.452  12.133  1.00 0.00 ? 14  TYR A OH   2  
ATOM 2406  H H    . TYR A 1 14  ? 1.880   -13.074 10.667  1.00 0.00 ? 14  TYR A H    2  
ATOM 2407  H HA   . TYR A 1 14  ? 3.669   -11.100 9.463   1.00 0.00 ? 14  TYR A HA   2  
ATOM 2408  H HB2  . TYR A 1 14  ? 2.252   -10.703 11.594  1.00 0.00 ? 14  TYR A HB2  2  
ATOM 2409  H HB3  . TYR A 1 14  ? 3.469   -11.682 12.406  1.00 0.00 ? 14  TYR A HB3  2  
ATOM 2410  H HD1  . TYR A 1 14  ? 5.943   -10.923 12.081  1.00 0.00 ? 14  TYR A HD1  2  
ATOM 2411  H HD2  . TYR A 1 14  ? 2.578   -8.414  11.388  1.00 0.00 ? 14  TYR A HD2  2  
ATOM 2412  H HE1  . TYR A 1 14  ? 7.378   -8.941  12.329  1.00 0.00 ? 14  TYR A HE1  2  
ATOM 2413  H HE2  . TYR A 1 14  ? 4.003   -6.425  11.632  1.00 0.00 ? 14  TYR A HE2  2  
ATOM 2414  H HH   . TYR A 1 14  ? 7.469   -6.663  11.848  1.00 0.00 ? 14  TYR A HH   2  
ATOM 2415  N N    . ASP A 1 15  ? 5.851   -12.238 9.744   1.00 0.00 ? 15  ASP A N    2  
ATOM 2416  C CA   . ASP A 1 15  ? 7.114   -12.966 9.791   1.00 0.00 ? 15  ASP A CA   2  
ATOM 2417  C C    . ASP A 1 15  ? 8.297   -12.009 9.675   1.00 0.00 ? 15  ASP A C    2  
ATOM 2418  O O    . ASP A 1 15  ? 8.268   -11.037 8.920   1.00 0.00 ? 15  ASP A O    2  
ATOM 2419  C CB   . ASP A 1 15  ? 7.170   -14.005 8.670   1.00 0.00 ? 15  ASP A CB   2  
ATOM 2420  C CG   . ASP A 1 15  ? 8.002   -15.216 9.044   1.00 0.00 ? 15  ASP A CG   2  
ATOM 2421  O OD1  . ASP A 1 15  ? 7.543   -16.013 9.888   1.00 0.00 ? 15  ASP A OD1  2  
ATOM 2422  O OD2  . ASP A 1 15  ? 9.114   -15.365 8.494   1.00 0.00 ? 15  ASP A OD2  2  
ATOM 2423  H H    . ASP A 1 15  ? 5.792   -11.416 9.214   1.00 0.00 ? 15  ASP A H    2  
ATOM 2424  H HA   . ASP A 1 15  ? 7.170   -13.473 10.742  1.00 0.00 ? 15  ASP A HA   2  
ATOM 2425  H HB2  . ASP A 1 15  ? 6.167   -14.337 8.444   1.00 0.00 ? 15  ASP A HB2  2  
ATOM 2426  H HB3  . ASP A 1 15  ? 7.602   -13.552 7.790   1.00 0.00 ? 15  ASP A HB3  2  
ATOM 2427  N N    . PRO A 1 16  ? 9.362   -12.289 10.440  1.00 0.00 ? 16  PRO A N    2  
ATOM 2428  C CA   . PRO A 1 16  ? 10.575  -11.465 10.440  1.00 0.00 ? 16  PRO A CA   2  
ATOM 2429  C C    . PRO A 1 16  ? 11.357  -11.583 9.137   1.00 0.00 ? 16  PRO A C    2  
ATOM 2430  O O    . PRO A 1 16  ? 12.318  -10.850 8.912   1.00 0.00 ? 16  PRO A O    2  
ATOM 2431  C CB   . PRO A 1 16  ? 11.388  -12.032 11.606  1.00 0.00 ? 16  PRO A CB   2  
ATOM 2432  C CG   . PRO A 1 16  ? 10.920  -13.440 11.746  1.00 0.00 ? 16  PRO A CG   2  
ATOM 2433  C CD   . PRO A 1 16  ? 9.466   -13.432 11.363  1.00 0.00 ? 16  PRO A CD   2  
ATOM 2434  H HA   . PRO A 1 16  ? 10.348  -10.426 10.630  1.00 0.00 ? 16  PRO A HA   2  
ATOM 2435  H HB2  . PRO A 1 16  ? 12.442  -11.989 11.369  1.00 0.00 ? 16  PRO A HB2  2  
ATOM 2436  H HB3  . PRO A 1 16  ? 11.191  -11.461 12.500  1.00 0.00 ? 16  PRO A HB3  2  
ATOM 2437  H HG2  . PRO A 1 16  ? 11.479  -14.081 11.081  1.00 0.00 ? 16  PRO A HG2  2  
ATOM 2438  H HG3  . PRO A 1 16  ? 11.036  -13.765 12.769  1.00 0.00 ? 16  PRO A HG3  2  
ATOM 2439  H HD2  . PRO A 1 16  ? 9.201   -14.354 10.866  1.00 0.00 ? 16  PRO A HD2  2  
ATOM 2440  H HD3  . PRO A 1 16  ? 8.847   -13.279 12.235  1.00 0.00 ? 16  PRO A HD3  2  
ATOM 2441  N N    . GLN A 1 17  ? 10.938  -12.511 8.283   1.00 0.00 ? 17  GLN A N    2  
ATOM 2442  C CA   . GLN A 1 17  ? 11.600  -12.724 7.002   1.00 0.00 ? 17  GLN A CA   2  
ATOM 2443  C C    . GLN A 1 17  ? 10.858  -12.007 5.879   1.00 0.00 ? 17  GLN A C    2  
ATOM 2444  O O    . GLN A 1 17  ? 11.469  -11.523 4.926   1.00 0.00 ? 17  GLN A O    2  
ATOM 2445  C CB   . GLN A 1 17  ? 11.693  -14.220 6.694   1.00 0.00 ? 17  GLN A CB   2  
ATOM 2446  C CG   . GLN A 1 17  ? 12.942  -14.880 7.254   1.00 0.00 ? 17  GLN A CG   2  
ATOM 2447  C CD   . GLN A 1 17  ? 12.866  -16.394 7.222   1.00 0.00 ? 17  GLN A CD   2  
ATOM 2448  O OE1  . GLN A 1 17  ? 12.095  -16.972 6.456   1.00 0.00 ? 17  GLN A OE1  2  
ATOM 2449  N NE2  . GLN A 1 17  ? 13.669  -17.045 8.056   1.00 0.00 ? 17  GLN A NE2  2  
ATOM 2450  H H    . GLN A 1 17  ? 10.165  -13.065 8.520   1.00 0.00 ? 17  GLN A H    2  
ATOM 2451  H HA   . GLN A 1 17  ? 12.598  -12.318 7.073   1.00 0.00 ? 17  GLN A HA   2  
ATOM 2452  H HB2  . GLN A 1 17  ? 10.830  -14.716 7.114   1.00 0.00 ? 17  GLN A HB2  2  
ATOM 2453  H HB3  . GLN A 1 17  ? 11.689  -14.356 5.622   1.00 0.00 ? 17  GLN A HB3  2  
ATOM 2454  H HG2  . GLN A 1 17  ? 13.793  -14.566 6.669   1.00 0.00 ? 17  GLN A HG2  2  
ATOM 2455  H HG3  . GLN A 1 17  ? 13.073  -14.562 8.278   1.00 0.00 ? 17  GLN A HG3  2  
ATOM 2456  H HE21 . GLN A 1 17  ? 14.255  -16.518 8.639   1.00 0.00 ? 17  GLN A HE21 2  
ATOM 2457  H HE22 . GLN A 1 17  ? 13.640  -18.024 8.057   1.00 0.00 ? 17  GLN A HE22 2  
ATOM 2458  N N    . LYS A 1 18  ? 9.536   -11.943 5.996   1.00 0.00 ? 18  LYS A N    2  
ATOM 2459  C CA   . LYS A 1 18  ? 8.709   -11.284 4.993   1.00 0.00 ? 18  LYS A CA   2  
ATOM 2460  C C    . LYS A 1 18  ? 8.942   -9.777  4.999   1.00 0.00 ? 18  LYS A C    2  
ATOM 2461  O O    . LYS A 1 18  ? 9.139   -9.166  3.949   1.00 0.00 ? 18  LYS A O    2  
ATOM 2462  C CB   . LYS A 1 18  ? 7.229   -11.583 5.245   1.00 0.00 ? 18  LYS A CB   2  
ATOM 2463  C CG   . LYS A 1 18  ? 6.831   -13.010 4.908   1.00 0.00 ? 18  LYS A CG   2  
ATOM 2464  C CD   . LYS A 1 18  ? 6.379   -13.136 3.463   1.00 0.00 ? 18  LYS A CD   2  
ATOM 2465  C CE   . LYS A 1 18  ? 5.349   -14.243 3.297   1.00 0.00 ? 18  LYS A CE   2  
ATOM 2466  N NZ   . LYS A 1 18  ? 5.987   -15.555 2.998   1.00 0.00 ? 18  LYS A NZ   2  
ATOM 2467  H H    . LYS A 1 18  ? 9.106   -12.348 6.779   1.00 0.00 ? 18  LYS A H    2  
ATOM 2468  H HA   . LYS A 1 18  ? 8.987   -11.675 4.025   1.00 0.00 ? 18  LYS A HA   2  
ATOM 2469  H HB2  . LYS A 1 18  ? 7.011   -11.407 6.288   1.00 0.00 ? 18  LYS A HB2  2  
ATOM 2470  H HB3  . LYS A 1 18  ? 6.632   -10.914 4.643   1.00 0.00 ? 18  LYS A HB3  2  
ATOM 2471  H HG2  . LYS A 1 18  ? 7.680   -13.658 5.066   1.00 0.00 ? 18  LYS A HG2  2  
ATOM 2472  H HG3  . LYS A 1 18  ? 6.021   -13.311 5.557   1.00 0.00 ? 18  LYS A HG3  2  
ATOM 2473  H HD2  . LYS A 1 18  ? 5.940   -12.202 3.149   1.00 0.00 ? 18  LYS A HD2  2  
ATOM 2474  H HD3  . LYS A 1 18  ? 7.237   -13.360 2.845   1.00 0.00 ? 18  LYS A HD3  2  
ATOM 2475  H HE2  . LYS A 1 18  ? 4.780   -14.328 4.210   1.00 0.00 ? 18  LYS A HE2  2  
ATOM 2476  H HE3  . LYS A 1 18  ? 4.687   -13.981 2.484   1.00 0.00 ? 18  LYS A HE3  2  
ATOM 2477  H HZ1  . LYS A 1 18  ? 5.883   -16.196 3.811   1.00 0.00 ? 18  LYS A HZ1  2  
ATOM 2478  H HZ2  . LYS A 1 18  ? 7.000   -15.423 2.802   1.00 0.00 ? 18  LYS A HZ2  2  
ATOM 2479  H HZ3  . LYS A 1 18  ? 5.539   -15.990 2.167   1.00 0.00 ? 18  LYS A HZ3  2  
ATOM 2480  N N    . GLU A 1 19  ? 8.920   -9.184  6.189   1.00 0.00 ? 19  GLU A N    2  
ATOM 2481  C CA   . GLU A 1 19  ? 9.130   -7.749  6.330   1.00 0.00 ? 19  GLU A CA   2  
ATOM 2482  C C    . GLU A 1 19  ? 10.268  -7.273  5.430   1.00 0.00 ? 19  GLU A C    2  
ATOM 2483  O O    . GLU A 1 19  ? 10.166  -6.233  4.781   1.00 0.00 ? 19  GLU A O    2  
ATOM 2484  C CB   . GLU A 1 19  ? 9.439   -7.397  7.787   1.00 0.00 ? 19  GLU A CB   2  
ATOM 2485  C CG   . GLU A 1 19  ? 9.471   -5.902  8.058   1.00 0.00 ? 19  GLU A CG   2  
ATOM 2486  C CD   . GLU A 1 19  ? 9.601   -5.579  9.535   1.00 0.00 ? 19  GLU A CD   2  
ATOM 2487  O OE1  . GLU A 1 19  ? 10.308  -6.327  10.244  1.00 0.00 ? 19  GLU A OE1  2  
ATOM 2488  O OE2  . GLU A 1 19  ? 8.999   -4.581  9.980   1.00 0.00 ? 19  GLU A OE2  2  
ATOM 2489  H H    . GLU A 1 19  ? 8.759   -9.726  6.990   1.00 0.00 ? 19  GLU A H    2  
ATOM 2490  H HA   . GLU A 1 19  ? 8.221   -7.249  6.034   1.00 0.00 ? 19  GLU A HA   2  
ATOM 2491  H HB2  . GLU A 1 19  ? 8.684   -7.840  8.420   1.00 0.00 ? 19  GLU A HB2  2  
ATOM 2492  H HB3  . GLU A 1 19  ? 10.402  -7.810  8.049   1.00 0.00 ? 19  GLU A HB3  2  
ATOM 2493  H HG2  . GLU A 1 19  ? 10.312  -5.473  7.536   1.00 0.00 ? 19  GLU A HG2  2  
ATOM 2494  H HG3  . GLU A 1 19  ? 8.557   -5.462  7.688   1.00 0.00 ? 19  GLU A HG3  2  
ATOM 2495  N N    . ALA A 1 20  ? 11.349  -8.043  5.396   1.00 0.00 ? 20  ALA A N    2  
ATOM 2496  C CA   . ALA A 1 20  ? 12.504  -7.704  4.576   1.00 0.00 ? 20  ALA A CA   2  
ATOM 2497  C C    . ALA A 1 20  ? 12.169  -7.796  3.091   1.00 0.00 ? 20  ALA A C    2  
ATOM 2498  O O    . ALA A 1 20  ? 12.605  -6.965  2.295   1.00 0.00 ? 20  ALA A O    2  
ATOM 2499  C CB   . ALA A 1 20  ? 13.677  -8.613  4.911   1.00 0.00 ? 20  ALA A CB   2  
ATOM 2500  H H    . ALA A 1 20  ? 11.371  -8.862  5.937   1.00 0.00 ? 20  ALA A H    2  
ATOM 2501  H HA   . ALA A 1 20  ? 12.791  -6.688  4.807   1.00 0.00 ? 20  ALA A HA   2  
ATOM 2502  H HB1  . ALA A 1 20  ? 13.343  -9.641  4.922   1.00 0.00 ? 20  ALA A HB1  2  
ATOM 2503  H HB2  . ALA A 1 20  ? 14.451  -8.493  4.167   1.00 0.00 ? 20  ALA A HB2  2  
ATOM 2504  H HB3  . ALA A 1 20  ? 14.068  -8.353  5.883   1.00 0.00 ? 20  ALA A HB3  2  
ATOM 2505  N N    . GLU A 1 21  ? 11.393  -8.812  2.726   1.00 0.00 ? 21  GLU A N    2  
ATOM 2506  C CA   . GLU A 1 21  ? 11.001  -9.012  1.336   1.00 0.00 ? 21  GLU A CA   2  
ATOM 2507  C C    . GLU A 1 21  ? 10.281  -7.782  0.791   1.00 0.00 ? 21  GLU A C    2  
ATOM 2508  O O    . GLU A 1 21  ? 10.525  -7.355  -0.338  1.00 0.00 ? 21  GLU A O    2  
ATOM 2509  C CB   . GLU A 1 21  ? 10.100  -10.243 1.209   1.00 0.00 ? 21  GLU A CB   2  
ATOM 2510  C CG   . GLU A 1 21  ? 10.756  -11.529 1.681   1.00 0.00 ? 21  GLU A CG   2  
ATOM 2511  C CD   . GLU A 1 21  ? 10.132  -12.764 1.061   1.00 0.00 ? 21  GLU A CD   2  
ATOM 2512  O OE1  . GLU A 1 21  ? 9.008   -13.126 1.466   1.00 0.00 ? 21  GLU A OE1  2  
ATOM 2513  O OE2  . GLU A 1 21  ? 10.768  -13.369 0.173   1.00 0.00 ? 21  GLU A OE2  2  
ATOM 2514  H H    . GLU A 1 21  ? 11.076  -9.442  3.408   1.00 0.00 ? 21  GLU A H    2  
ATOM 2515  H HA   . GLU A 1 21  ? 11.899  -9.174  0.759   1.00 0.00 ? 21  GLU A HA   2  
ATOM 2516  H HB2  . GLU A 1 21  ? 9.208   -10.082 1.795   1.00 0.00 ? 21  GLU A HB2  2  
ATOM 2517  H HB3  . GLU A 1 21  ? 9.823   -10.364 0.172   1.00 0.00 ? 21  GLU A HB3  2  
ATOM 2518  H HG2  . GLU A 1 21  ? 11.804  -11.502 1.416   1.00 0.00 ? 21  GLU A HG2  2  
ATOM 2519  H HG3  . GLU A 1 21  ? 10.660  -11.594 2.755   1.00 0.00 ? 21  GLU A HG3  2  
ATOM 2520  N N    . LEU A 1 22  ? 9.392   -7.218  1.601   1.00 0.00 ? 22  LEU A N    2  
ATOM 2521  C CA   . LEU A 1 22  ? 8.634   -6.037  1.201   1.00 0.00 ? 22  LEU A CA   2  
ATOM 2522  C C    . LEU A 1 22  ? 9.563   -4.852  0.953   1.00 0.00 ? 22  LEU A C    2  
ATOM 2523  O O    . LEU A 1 22  ? 9.731   -4.409  -0.182  1.00 0.00 ? 22  LEU A O    2  
ATOM 2524  C CB   . LEU A 1 22  ? 7.606   -5.678  2.276   1.00 0.00 ? 22  LEU A CB   2  
ATOM 2525  C CG   . LEU A 1 22  ? 6.514   -6.717  2.533   1.00 0.00 ? 22  LEU A CG   2  
ATOM 2526  C CD1  . LEU A 1 22  ? 5.687   -6.332  3.750   1.00 0.00 ? 22  LEU A CD1  2  
ATOM 2527  C CD2  . LEU A 1 22  ? 5.624   -6.870  1.309   1.00 0.00 ? 22  LEU A CD2  2  
ATOM 2528  H H    . LEU A 1 22  ? 9.241   -7.603  2.489   1.00 0.00 ? 22  LEU A H    2  
ATOM 2529  H HA   . LEU A 1 22  ? 8.116   -6.271  0.283   1.00 0.00 ? 22  LEU A HA   2  
ATOM 2530  H HB2  . LEU A 1 22  ? 8.138   -5.520  3.202   1.00 0.00 ? 22  LEU A HB2  2  
ATOM 2531  H HB3  . LEU A 1 22  ? 7.126   -4.757  1.978   1.00 0.00 ? 22  LEU A HB3  2  
ATOM 2532  H HG   . LEU A 1 22  ? 6.976   -7.673  2.733   1.00 0.00 ? 22  LEU A HG   2  
ATOM 2533  H HD11 . LEU A 1 22  ? 4.940   -7.088  3.932   1.00 0.00 ? 22  LEU A HD11 2  
ATOM 2534  H HD12 . LEU A 1 22  ? 5.204   -5.383  3.572   1.00 0.00 ? 22  LEU A HD12 2  
ATOM 2535  H HD13 . LEU A 1 22  ? 6.333   -6.248  4.612   1.00 0.00 ? 22  LEU A HD13 2  
ATOM 2536  H HD21 . LEU A 1 22  ? 4.974   -6.010  1.227   1.00 0.00 ? 22  LEU A HD21 2  
ATOM 2537  H HD22 . LEU A 1 22  ? 5.026   -7.765  1.408   1.00 0.00 ? 22  LEU A HD22 2  
ATOM 2538  H HD23 . LEU A 1 22  ? 6.239   -6.942  0.424   1.00 0.00 ? 22  LEU A HD23 2  
ATOM 2539  N N    . ARG A 1 23  ? 10.165  -4.345  2.024   1.00 0.00 ? 23  ARG A N    2  
ATOM 2540  C CA   . ARG A 1 23  ? 11.077  -3.212  1.923   1.00 0.00 ? 23  ARG A CA   2  
ATOM 2541  C C    . ARG A 1 23  ? 12.034  -3.389  0.748   1.00 0.00 ? 23  ARG A C    2  
ATOM 2542  O O    . ARG A 1 23  ? 12.357  -2.430  0.046   1.00 0.00 ? 23  ARG A O    2  
ATOM 2543  C CB   . ARG A 1 23  ? 11.872  -3.053  3.221   1.00 0.00 ? 23  ARG A CB   2  
ATOM 2544  C CG   . ARG A 1 23  ? 12.672  -4.287  3.603   1.00 0.00 ? 23  ARG A CG   2  
ATOM 2545  C CD   . ARG A 1 23  ? 13.797  -3.947  4.566   1.00 0.00 ? 23  ARG A CD   2  
ATOM 2546  N NE   . ARG A 1 23  ? 14.688  -5.082  4.790   1.00 0.00 ? 23  ARG A NE   2  
ATOM 2547  C CZ   . ARG A 1 23  ? 15.769  -5.027  5.561   1.00 0.00 ? 23  ARG A CZ   2  
ATOM 2548  N NH1  . ARG A 1 23  ? 16.090  -3.898  6.179   1.00 0.00 ? 23  ARG A NH1  2  
ATOM 2549  N NH2  . ARG A 1 23  ? 16.531  -6.102  5.716   1.00 0.00 ? 23  ARG A NH2  2  
ATOM 2550  H H    . ARG A 1 23  ? 9.991   -4.741  2.904   1.00 0.00 ? 23  ARG A H    2  
ATOM 2551  H HA   . ARG A 1 23  ? 10.486  -2.324  1.761   1.00 0.00 ? 23  ARG A HA   2  
ATOM 2552  H HB2  . ARG A 1 23  ? 12.558  -2.227  3.110   1.00 0.00 ? 23  ARG A HB2  2  
ATOM 2553  H HB3  . ARG A 1 23  ? 11.184  -2.834  4.025   1.00 0.00 ? 23  ARG A HB3  2  
ATOM 2554  H HG2  . ARG A 1 23  ? 12.012  -5.001  4.074   1.00 0.00 ? 23  ARG A HG2  2  
ATOM 2555  H HG3  . ARG A 1 23  ? 13.094  -4.721  2.707   1.00 0.00 ? 23  ARG A HG3  2  
ATOM 2556  H HD2  . ARG A 1 23  ? 14.368  -3.128  4.156   1.00 0.00 ? 23  ARG A HD2  2  
ATOM 2557  H HD3  . ARG A 1 23  ? 13.365  -3.647  5.510   1.00 0.00 ? 23  ARG A HD3  2  
ATOM 2558  H HE   . ARG A 1 23  ? 14.470  -5.926  4.343   1.00 0.00 ? 23  ARG A HE   2  
ATOM 2559  H HH11 . ARG A 1 23  ? 15.517  -3.086  6.065   1.00 0.00 ? 23  ARG A HH11 2  
ATOM 2560  H HH12 . ARG A 1 23  ? 16.903  -3.859  6.760   1.00 0.00 ? 23  ARG A HH12 2  
ATOM 2561  H HH21 . ARG A 1 23  ? 16.291  -6.955  5.252   1.00 0.00 ? 23  ARG A HH21 2  
ATOM 2562  H HH22 . ARG A 1 23  ? 17.343  -6.060  6.295   1.00 0.00 ? 23  ARG A HH22 2  
ATOM 2563  N N    . THR A 1 24  ? 12.486  -4.622  0.538   1.00 0.00 ? 24  THR A N    2  
ATOM 2564  C CA   . THR A 1 24  ? 13.406  -4.924  -0.550  1.00 0.00 ? 24  THR A CA   2  
ATOM 2565  C C    . THR A 1 24  ? 12.713  -4.814  -1.904  1.00 0.00 ? 24  THR A C    2  
ATOM 2566  O O    . THR A 1 24  ? 13.341  -4.481  -2.908  1.00 0.00 ? 24  THR A O    2  
ATOM 2567  C CB   . THR A 1 24  ? 14.003  -6.337  -0.406  1.00 0.00 ? 24  THR A CB   2  
ATOM 2568  O OG1  . THR A 1 24  ? 14.673  -6.459  0.854   1.00 0.00 ? 24  THR A OG1  2  
ATOM 2569  C CG2  . THR A 1 24  ? 14.979  -6.630  -1.536  1.00 0.00 ? 24  THR A CG2  2  
ATOM 2570  H H    . THR A 1 24  ? 12.192  -5.345  1.131   1.00 0.00 ? 24  THR A H    2  
ATOM 2571  H HA   . THR A 1 24  ? 14.215  -4.209  -0.512  1.00 0.00 ? 24  THR A HA   2  
ATOM 2572  H HB   . THR A 1 24  ? 13.199  -7.057  -0.449  1.00 0.00 ? 24  THR A HB   2  
ATOM 2573  H HG1  . THR A 1 24  ? 14.966  -5.591  1.146   1.00 0.00 ? 24  THR A HG1  2  
ATOM 2574  H HG21 . THR A 1 24  ? 15.117  -7.698  -1.624  1.00 0.00 ? 24  THR A HG21 2  
ATOM 2575  H HG22 . THR A 1 24  ? 15.928  -6.160  -1.322  1.00 0.00 ? 24  THR A HG22 2  
ATOM 2576  H HG23 . THR A 1 24  ? 14.584  -6.240  -2.461  1.00 0.00 ? 24  THR A HG23 2  
ATOM 2577  N N    . TRP A 1 25  ? 11.415  -5.094  -1.922  1.00 0.00 ? 25  TRP A N    2  
ATOM 2578  C CA   . TRP A 1 25  ? 10.636  -5.025  -3.153  1.00 0.00 ? 25  TRP A CA   2  
ATOM 2579  C C    . TRP A 1 25  ? 10.169  -3.599  -3.424  1.00 0.00 ? 25  TRP A C    2  
ATOM 2580  O O    . TRP A 1 25  ? 9.997   -3.201  -4.576  1.00 0.00 ? 25  TRP A O    2  
ATOM 2581  C CB   . TRP A 1 25  ? 9.430   -5.963  -3.071  1.00 0.00 ? 25  TRP A CB   2  
ATOM 2582  C CG   . TRP A 1 25  ? 8.294   -5.548  -3.956  1.00 0.00 ? 25  TRP A CG   2  
ATOM 2583  C CD1  . TRP A 1 25  ? 8.217   -5.692  -5.312  1.00 0.00 ? 25  TRP A CD1  2  
ATOM 2584  C CD2  . TRP A 1 25  ? 7.074   -4.920  -3.547  1.00 0.00 ? 25  TRP A CD2  2  
ATOM 2585  N NE1  . TRP A 1 25  ? 7.023   -5.191  -5.771  1.00 0.00 ? 25  TRP A NE1  2  
ATOM 2586  C CE2  . TRP A 1 25  ? 6.303   -4.712  -4.708  1.00 0.00 ? 25  TRP A CE2  2  
ATOM 2587  C CE3  . TRP A 1 25  ? 6.557   -4.513  -2.314  1.00 0.00 ? 25  TRP A CE3  2  
ATOM 2588  C CZ2  . TRP A 1 25  ? 5.045   -4.116  -4.669  1.00 0.00 ? 25  TRP A CZ2  2  
ATOM 2589  C CZ3  . TRP A 1 25  ? 5.308   -3.923  -2.277  1.00 0.00 ? 25  TRP A CZ3  2  
ATOM 2590  C CH2  . TRP A 1 25  ? 4.564   -3.729  -3.448  1.00 0.00 ? 25  TRP A CH2  2  
ATOM 2591  H H    . TRP A 1 25  ? 10.969  -5.353  -1.087  1.00 0.00 ? 25  TRP A H    2  
ATOM 2592  H HA   . TRP A 1 25  ? 11.272  -5.343  -3.966  1.00 0.00 ? 25  TRP A HA   2  
ATOM 2593  H HB2  . TRP A 1 25  ? 9.734   -6.957  -3.362  1.00 0.00 ? 25  TRP A HB2  2  
ATOM 2594  H HB3  . TRP A 1 25  ? 9.069   -5.984  -2.053  1.00 0.00 ? 25  TRP A HB3  2  
ATOM 2595  H HD1  . TRP A 1 25  ? 8.990   -6.136  -5.921  1.00 0.00 ? 25  TRP A HD1  2  
ATOM 2596  H HE1  . TRP A 1 25  ? 6.732   -5.181  -6.707  1.00 0.00 ? 25  TRP A HE1  2  
ATOM 2597  H HE3  . TRP A 1 25  ? 7.116   -4.654  -1.401  1.00 0.00 ? 25  TRP A HE3  2  
ATOM 2598  H HZ2  . TRP A 1 25  ? 4.458   -3.962  -5.563  1.00 0.00 ? 25  TRP A HZ2  2  
ATOM 2599  H HZ3  . TRP A 1 25  ? 4.893   -3.602  -1.333  1.00 0.00 ? 25  TRP A HZ3  2  
ATOM 2600  H HH2  . TRP A 1 25  ? 3.593   -3.263  -3.372  1.00 0.00 ? 25  TRP A HH2  2  
ATOM 2601  N N    . ILE A 1 26  ? 9.967   -2.835  -2.356  1.00 0.00 ? 26  ILE A N    2  
ATOM 2602  C CA   . ILE A 1 26  ? 9.522   -1.453  -2.480  1.00 0.00 ? 26  ILE A CA   2  
ATOM 2603  C C    . ILE A 1 26  ? 10.699  -0.517  -2.737  1.00 0.00 ? 26  ILE A C    2  
ATOM 2604  O O    . ILE A 1 26  ? 10.668  0.293   -3.663  1.00 0.00 ? 26  ILE A O    2  
ATOM 2605  C CB   . ILE A 1 26  ? 8.777   -0.985  -1.215  1.00 0.00 ? 26  ILE A CB   2  
ATOM 2606  C CG1  . ILE A 1 26  ? 7.709   -2.008  -0.819  1.00 0.00 ? 26  ILE A CG1  2  
ATOM 2607  C CG2  . ILE A 1 26  ? 8.149   0.381   -1.444  1.00 0.00 ? 26  ILE A CG2  2  
ATOM 2608  C CD1  . ILE A 1 26  ? 7.073   -1.727  0.524   1.00 0.00 ? 26  ILE A CD1  2  
ATOM 2609  H H    . ILE A 1 26  ? 10.121  -3.209  -1.463  1.00 0.00 ? 26  ILE A H    2  
ATOM 2610  H HA   . ILE A 1 26  ? 8.840   -1.396  -3.316  1.00 0.00 ? 26  ILE A HA   2  
ATOM 2611  H HB   . ILE A 1 26  ? 9.494   -0.896  -0.414  1.00 0.00 ? 26  ILE A HB   2  
ATOM 2612  H HG12 . ILE A 1 26  ? 6.927   -2.009  -1.562  1.00 0.00 ? 26  ILE A HG12 2  
ATOM 2613  H HG13 . ILE A 1 26  ? 8.160   -2.989  -0.774  1.00 0.00 ? 26  ILE A HG13 2  
ATOM 2614  H HG21 . ILE A 1 26  ? 8.571   0.826   -2.333  1.00 0.00 ? 26  ILE A HG21 2  
ATOM 2615  H HG22 . ILE A 1 26  ? 7.083   0.271   -1.568  1.00 0.00 ? 26  ILE A HG22 2  
ATOM 2616  H HG23 . ILE A 1 26  ? 8.350   1.017   -0.595  1.00 0.00 ? 26  ILE A HG23 2  
ATOM 2617  H HD11 . ILE A 1 26  ? 7.699   -2.123  1.310   1.00 0.00 ? 26  ILE A HD11 2  
ATOM 2618  H HD12 . ILE A 1 26  ? 6.961   -0.662  0.654   1.00 0.00 ? 26  ILE A HD12 2  
ATOM 2619  H HD13 . ILE A 1 26  ? 6.101   -2.198  0.567   1.00 0.00 ? 26  ILE A HD13 2  
ATOM 2620  N N    . GLU A 1 27  ? 11.734  -0.637  -1.912  1.00 0.00 ? 27  GLU A N    2  
ATOM 2621  C CA   . GLU A 1 27  ? 12.921  0.198   -2.052  1.00 0.00 ? 27  GLU A CA   2  
ATOM 2622  C C    . GLU A 1 27  ? 13.362  0.278   -3.512  1.00 0.00 ? 27  GLU A C    2  
ATOM 2623  O O    . GLU A 1 27  ? 13.711  1.348   -4.009  1.00 0.00 ? 27  GLU A O    2  
ATOM 2624  C CB   . GLU A 1 27  ? 14.063  -0.351  -1.194  1.00 0.00 ? 27  GLU A CB   2  
ATOM 2625  C CG   . GLU A 1 27  ? 14.014  0.114   0.253   1.00 0.00 ? 27  GLU A CG   2  
ATOM 2626  C CD   . GLU A 1 27  ? 15.368  0.053   0.930   1.00 0.00 ? 27  GLU A CD   2  
ATOM 2627  O OE1  . GLU A 1 27  ? 15.756  -1.042  1.387   1.00 0.00 ? 27  GLU A OE1  2  
ATOM 2628  O OE2  . GLU A 1 27  ? 16.041  1.104   1.005   1.00 0.00 ? 27  GLU A OE2  2  
ATOM 2629  H H    . GLU A 1 27  ? 11.699  -1.301  -1.193  1.00 0.00 ? 27  GLU A H    2  
ATOM 2630  H HA   . GLU A 1 27  ? 12.671  1.191   -1.711  1.00 0.00 ? 27  GLU A HA   2  
ATOM 2631  H HB2  . GLU A 1 27  ? 14.019  -1.430  -1.205  1.00 0.00 ? 27  GLU A HB2  2  
ATOM 2632  H HB3  . GLU A 1 27  ? 15.002  -0.033  -1.620  1.00 0.00 ? 27  GLU A HB3  2  
ATOM 2633  H HG2  . GLU A 1 27  ? 13.661  1.134   0.278   1.00 0.00 ? 27  GLU A HG2  2  
ATOM 2634  H HG3  . GLU A 1 27  ? 13.326  -0.517  0.797   1.00 0.00 ? 27  GLU A HG3  2  
ATOM 2635  N N    . GLY A 1 28  ? 13.343  -0.864  -4.193  1.00 0.00 ? 28  GLY A N    2  
ATOM 2636  C CA   . GLY A 1 28  ? 13.742  -0.903  -5.587  1.00 0.00 ? 28  GLY A CA   2  
ATOM 2637  C C    . GLY A 1 28  ? 12.700  -0.299  -6.506  1.00 0.00 ? 28  GLY A C    2  
ATOM 2638  O O    . GLY A 1 28  ? 13.035  0.300   -7.529  1.00 0.00 ? 28  GLY A O    2  
ATOM 2639  H H    . GLY A 1 28  ? 13.056  -1.687  -3.745  1.00 0.00 ? 28  GLY A H    2  
ATOM 2640  H HA2  . GLY A 1 28  ? 14.667  -0.356  -5.701  1.00 0.00 ? 28  GLY A HA2  2  
ATOM 2641  H HA3  . GLY A 1 28  ? 13.906  -1.931  -5.875  1.00 0.00 ? 28  GLY A HA3  2  
ATOM 2642  N N    . LEU A 1 29  ? 11.432  -0.455  -6.143  1.00 0.00 ? 29  LEU A N    2  
ATOM 2643  C CA   . LEU A 1 29  ? 10.335  0.078   -6.944  1.00 0.00 ? 29  LEU A CA   2  
ATOM 2644  C C    . LEU A 1 29  ? 10.397  1.600   -7.007  1.00 0.00 ? 29  LEU A C    2  
ATOM 2645  O O    . LEU A 1 29  ? 10.468  2.186   -8.087  1.00 0.00 ? 29  LEU A O    2  
ATOM 2646  C CB   . LEU A 1 29  ? 8.990   -0.366  -6.363  1.00 0.00 ? 29  LEU A CB   2  
ATOM 2647  C CG   . LEU A 1 29  ? 8.421   -1.673  -6.914  1.00 0.00 ? 29  LEU A CG   2  
ATOM 2648  C CD1  . LEU A 1 29  ? 7.481   -2.314  -5.904  1.00 0.00 ? 29  LEU A CD1  2  
ATOM 2649  C CD2  . LEU A 1 29  ? 7.703   -1.429  -8.233  1.00 0.00 ? 29  LEU A CD2  2  
ATOM 2650  H H    . LEU A 1 29  ? 11.226  -0.942  -5.317  1.00 0.00 ? 29  LEU A H    2  
ATOM 2651  H HA   . LEU A 1 29  ? 10.433  -0.316  -7.944  1.00 0.00 ? 29  LEU A HA   2  
ATOM 2652  H HB2  . LEU A 1 29  ? 9.113   -0.481  -5.298  1.00 0.00 ? 29  LEU A HB2  2  
ATOM 2653  H HB3  . LEU A 1 29  ? 8.272   0.418   -6.559  1.00 0.00 ? 29  LEU A HB3  2  
ATOM 2654  H HG   . LEU A 1 29  ? 9.233   -2.364  -7.098  1.00 0.00 ? 29  LEU A HG   2  
ATOM 2655  H HD11 . LEU A 1 29  ? 7.211   -1.586  -5.153  1.00 0.00 ? 29  LEU A HD11 2  
ATOM 2656  H HD12 . LEU A 1 29  ? 7.974   -3.151  -5.433  1.00 0.00 ? 29  LEU A HD12 2  
ATOM 2657  H HD13 . LEU A 1 29  ? 6.590   -2.657  -6.409  1.00 0.00 ? 29  LEU A HD13 2  
ATOM 2658  H HD21 . LEU A 1 29  ? 8.020   -2.165  -8.957  1.00 0.00 ? 29  LEU A HD21 2  
ATOM 2659  H HD22 . LEU A 1 29  ? 7.943   -0.440  -8.596  1.00 0.00 ? 29  LEU A HD22 2  
ATOM 2660  H HD23 . LEU A 1 29  ? 6.636   -1.509  -8.083  1.00 0.00 ? 29  LEU A HD23 2  
ATOM 2661  N N    . THR A 1 30  ? 10.372  2.237   -5.840  1.00 0.00 ? 30  THR A N    2  
ATOM 2662  C CA   . THR A 1 30  ? 10.426  3.692   -5.762  1.00 0.00 ? 30  THR A CA   2  
ATOM 2663  C C    . THR A 1 30  ? 11.867  4.190   -5.788  1.00 0.00 ? 30  THR A C    2  
ATOM 2664  O O    . THR A 1 30  ? 12.148  5.276   -6.293  1.00 0.00 ? 30  THR A O    2  
ATOM 2665  C CB   . THR A 1 30  ? 9.739   4.212   -4.484  1.00 0.00 ? 30  THR A CB   2  
ATOM 2666  O OG1  . THR A 1 30  ? 10.558  3.939   -3.341  1.00 0.00 ? 30  THR A OG1  2  
ATOM 2667  C CG2  . THR A 1 30  ? 8.374   3.564   -4.302  1.00 0.00 ? 30  THR A CG2  2  
ATOM 2668  H H    . THR A 1 30  ? 10.314  1.714   -5.012  1.00 0.00 ? 30  THR A H    2  
ATOM 2669  H HA   . THR A 1 30  ? 9.900   4.091   -6.617  1.00 0.00 ? 30  THR A HA   2  
ATOM 2670  H HB   . THR A 1 30  ? 9.604   5.280   -4.576  1.00 0.00 ? 30  THR A HB   2  
ATOM 2671  H HG1  . THR A 1 30  ? 10.414  3.035   -3.053  1.00 0.00 ? 30  THR A HG1  2  
ATOM 2672  H HG21 . THR A 1 30  ? 7.729   4.233   -3.752  1.00 0.00 ? 30  THR A HG21 2  
ATOM 2673  H HG22 . THR A 1 30  ? 8.484   2.639   -3.755  1.00 0.00 ? 30  THR A HG22 2  
ATOM 2674  H HG23 . THR A 1 30  ? 7.941   3.361   -5.270  1.00 0.00 ? 30  THR A HG23 2  
ATOM 2675  N N    . GLY A 1 31  ? 12.776  3.388   -5.243  1.00 0.00 ? 31  GLY A N    2  
ATOM 2676  C CA   . GLY A 1 31  ? 14.177  3.766   -5.215  1.00 0.00 ? 31  GLY A CA   2  
ATOM 2677  C C    . GLY A 1 31  ? 14.518  4.643   -4.028  1.00 0.00 ? 31  GLY A C    2  
ATOM 2678  O O    . GLY A 1 31  ? 15.586  5.257   -3.986  1.00 0.00 ? 31  GLY A O    2  
ATOM 2679  H H    . GLY A 1 31  ? 12.493  2.534   -4.855  1.00 0.00 ? 31  GLY A H    2  
ATOM 2680  H HA2  . GLY A 1 31  ? 14.779  2.871   -5.173  1.00 0.00 ? 31  GLY A HA2  2  
ATOM 2681  H HA3  . GLY A 1 31  ? 14.411  4.302   -6.124  1.00 0.00 ? 31  GLY A HA3  2  
ATOM 2682  N N    . LEU A 1 32  ? 13.610  4.704   -3.059  1.00 0.00 ? 32  LEU A N    2  
ATOM 2683  C CA   . LEU A 1 32  ? 13.819  5.516   -1.865  1.00 0.00 ? 32  LEU A CA   2  
ATOM 2684  C C    . LEU A 1 32  ? 14.337  4.663   -0.712  1.00 0.00 ? 32  LEU A C    2  
ATOM 2685  O O    . LEU A 1 32  ? 14.611  3.474   -0.880  1.00 0.00 ? 32  LEU A O    2  
ATOM 2686  C CB   . LEU A 1 32  ? 12.516  6.206   -1.458  1.00 0.00 ? 32  LEU A CB   2  
ATOM 2687  C CG   . LEU A 1 32  ? 11.901  7.144   -2.497  1.00 0.00 ? 32  LEU A CG   2  
ATOM 2688  C CD1  . LEU A 1 32  ? 10.444  7.426   -2.165  1.00 0.00 ? 32  LEU A CD1  2  
ATOM 2689  C CD2  . LEU A 1 32  ? 12.692  8.441   -2.578  1.00 0.00 ? 32  LEU A CD2  2  
ATOM 2690  H H    . LEU A 1 32  ? 12.779  4.194   -3.149  1.00 0.00 ? 32  LEU A H    2  
ATOM 2691  H HA   . LEU A 1 32  ? 14.557  6.269   -2.101  1.00 0.00 ? 32  LEU A HA   2  
ATOM 2692  H HB2  . LEU A 1 32  ? 11.791  5.438   -1.237  1.00 0.00 ? 32  LEU A HB2  2  
ATOM 2693  H HB3  . LEU A 1 32  ? 12.713  6.782   -0.565  1.00 0.00 ? 32  LEU A HB3  2  
ATOM 2694  H HG   . LEU A 1 32  ? 11.935  6.669   -3.467  1.00 0.00 ? 32  LEU A HG   2  
ATOM 2695  H HD11 . LEU A 1 32  ? 9.807   6.900   -2.861  1.00 0.00 ? 32  LEU A HD11 2  
ATOM 2696  H HD12 . LEU A 1 32  ? 10.257  8.487   -2.237  1.00 0.00 ? 32  LEU A HD12 2  
ATOM 2697  H HD13 . LEU A 1 32  ? 10.232  7.091   -1.160  1.00 0.00 ? 32  LEU A HD13 2  
ATOM 2698  H HD21 . LEU A 1 32  ? 12.472  8.939   -3.512  1.00 0.00 ? 32  LEU A HD21 2  
ATOM 2699  H HD22 . LEU A 1 32  ? 13.749  8.222   -2.527  1.00 0.00 ? 32  LEU A HD22 2  
ATOM 2700  H HD23 . LEU A 1 32  ? 12.416  9.083   -1.754  1.00 0.00 ? 32  LEU A HD23 2  
ATOM 2701  N N    . SER A 1 33  ? 14.470  5.277   0.459   1.00 0.00 ? 33  SER A N    2  
ATOM 2702  C CA   . SER A 1 33  ? 14.957  4.574   1.640   1.00 0.00 ? 33  SER A CA   2  
ATOM 2703  C C    . SER A 1 33  ? 13.963  4.694   2.792   1.00 0.00 ? 33  SER A C    2  
ATOM 2704  O O    . SER A 1 33  ? 13.512  5.790   3.127   1.00 0.00 ? 33  SER A O    2  
ATOM 2705  C CB   . SER A 1 33  ? 16.317  5.131   2.066   1.00 0.00 ? 33  SER A CB   2  
ATOM 2706  O OG   . SER A 1 33  ? 17.239  5.102   0.991   1.00 0.00 ? 33  SER A OG   2  
ATOM 2707  H H    . SER A 1 33  ? 14.235  6.226   0.530   1.00 0.00 ? 33  SER A H    2  
ATOM 2708  H HA   . SER A 1 33  ? 15.068  3.531   1.383   1.00 0.00 ? 33  SER A HA   2  
ATOM 2709  H HB2  . SER A 1 33  ? 16.198  6.152   2.396   1.00 0.00 ? 33  SER A HB2  2  
ATOM 2710  H HB3  . SER A 1 33  ? 16.709  4.534   2.878   1.00 0.00 ? 33  SER A HB3  2  
ATOM 2711  H HG   . SER A 1 33  ? 17.469  6.001   0.742   1.00 0.00 ? 33  SER A HG   2  
ATOM 2712  N N    . ILE A 1 34  ? 13.626  3.558   3.394   1.00 0.00 ? 34  ILE A N    2  
ATOM 2713  C CA   . ILE A 1 34  ? 12.687  3.534   4.509   1.00 0.00 ? 34  ILE A CA   2  
ATOM 2714  C C    . ILE A 1 34  ? 13.381  3.882   5.821   1.00 0.00 ? 34  ILE A C    2  
ATOM 2715  O O    . ILE A 1 34  ? 12.818  4.572   6.669   1.00 0.00 ? 34  ILE A O    2  
ATOM 2716  C CB   . ILE A 1 34  ? 12.012  2.157   4.647   1.00 0.00 ? 34  ILE A CB   2  
ATOM 2717  C CG1  . ILE A 1 34  ? 11.382  1.737   3.318   1.00 0.00 ? 34  ILE A CG1  2  
ATOM 2718  C CG2  . ILE A 1 34  ? 10.965  2.187   5.751   1.00 0.00 ? 34  ILE A CG2  2  
ATOM 2719  C CD1  . ILE A 1 34  ? 11.348  0.239   3.111   1.00 0.00 ? 34  ILE A CD1  2  
ATOM 2720  H H    . ILE A 1 34  ? 14.019  2.717   3.082   1.00 0.00 ? 34  ILE A H    2  
ATOM 2721  H HA   . ILE A 1 34  ? 11.920  4.270   4.313   1.00 0.00 ? 34  ILE A HA   2  
ATOM 2722  H HB   . ILE A 1 34  ? 12.768  1.437   4.921   1.00 0.00 ? 34  ILE A HB   2  
ATOM 2723  H HG12 . ILE A 1 34  ? 10.366  2.100   3.279   1.00 0.00 ? 34  ILE A HG12 2  
ATOM 2724  H HG13 . ILE A 1 34  ? 11.946  2.173   2.507   1.00 0.00 ? 34  ILE A HG13 2  
ATOM 2725  H HG21 . ILE A 1 34  ? 10.274  2.995   5.567   1.00 0.00 ? 34  ILE A HG21 2  
ATOM 2726  H HG22 . ILE A 1 34  ? 10.429  1.251   5.764   1.00 0.00 ? 34  ILE A HG22 2  
ATOM 2727  H HG23 . ILE A 1 34  ? 11.451  2.339   6.703   1.00 0.00 ? 34  ILE A HG23 2  
ATOM 2728  H HD11 . ILE A 1 34  ? 10.643  -0.001  2.329   1.00 0.00 ? 34  ILE A HD11 2  
ATOM 2729  H HD12 . ILE A 1 34  ? 12.330  -0.108  2.829   1.00 0.00 ? 34  ILE A HD12 2  
ATOM 2730  H HD13 . ILE A 1 34  ? 11.044  -0.244  4.028   1.00 0.00 ? 34  ILE A HD13 2  
ATOM 2731  N N    . GLY A 1 35  ? 14.611  3.401   5.978   1.00 0.00 ? 35  GLY A N    2  
ATOM 2732  C CA   . GLY A 1 35  ? 15.364  3.673   7.189   1.00 0.00 ? 35  GLY A CA   2  
ATOM 2733  C C    . GLY A 1 35  ? 15.553  2.436   8.045   1.00 0.00 ? 35  GLY A C    2  
ATOM 2734  O O    . GLY A 1 35  ? 15.201  1.324   7.652   1.00 0.00 ? 35  GLY A O    2  
ATOM 2735  H H    . GLY A 1 35  ? 15.010  2.857   5.268   1.00 0.00 ? 35  GLY A H    2  
ATOM 2736  H HA2  . GLY A 1 35  ? 16.334  4.062   6.917   1.00 0.00 ? 35  GLY A HA2  2  
ATOM 2737  H HA3  . GLY A 1 35  ? 14.838  4.419   7.767   1.00 0.00 ? 35  GLY A HA3  2  
ATOM 2738  N N    . PRO A 1 36  ? 16.123  2.623   9.244   1.00 0.00 ? 36  PRO A N    2  
ATOM 2739  C CA   . PRO A 1 36  ? 16.372  1.525   10.182  1.00 0.00 ? 36  PRO A CA   2  
ATOM 2740  C C    . PRO A 1 36  ? 15.084  0.963   10.772  1.00 0.00 ? 36  PRO A C    2  
ATOM 2741  O O    . PRO A 1 36  ? 15.103  -0.034  11.495  1.00 0.00 ? 36  PRO A O    2  
ATOM 2742  C CB   . PRO A 1 36  ? 17.221  2.177   11.276  1.00 0.00 ? 36  PRO A CB   2  
ATOM 2743  C CG   . PRO A 1 36  ? 16.863  3.622   11.222  1.00 0.00 ? 36  PRO A CG   2  
ATOM 2744  C CD   . PRO A 1 36  ? 16.568  3.921   9.778   1.00 0.00 ? 36  PRO A CD   2  
ATOM 2745  H HA   . PRO A 1 36  ? 16.932  0.726   9.717   1.00 0.00 ? 36  PRO A HA   2  
ATOM 2746  H HB2  . PRO A 1 36  ? 16.974  1.743   12.234  1.00 0.00 ? 36  PRO A HB2  2  
ATOM 2747  H HB3  . PRO A 1 36  ? 18.269  2.022   11.064  1.00 0.00 ? 36  PRO A HB3  2  
ATOM 2748  H HG2  . PRO A 1 36  ? 15.991  3.807   11.829  1.00 0.00 ? 36  PRO A HG2  2  
ATOM 2749  H HG3  . PRO A 1 36  ? 17.695  4.219   11.564  1.00 0.00 ? 36  PRO A HG3  2  
ATOM 2750  H HD2  . PRO A 1 36  ? 15.783  4.660   9.699   1.00 0.00 ? 36  PRO A HD2  2  
ATOM 2751  H HD3  . PRO A 1 36  ? 17.460  4.261   9.272   1.00 0.00 ? 36  PRO A HD3  2  
ATOM 2752  N N    . ASP A 1 37  ? 13.965  1.608   10.462  1.00 0.00 ? 37  ASP A N    2  
ATOM 2753  C CA   . ASP A 1 37  ? 12.666  1.172   10.960  1.00 0.00 ? 37  ASP A CA   2  
ATOM 2754  C C    . ASP A 1 37  ? 11.617  1.215   9.854   1.00 0.00 ? 37  ASP A C    2  
ATOM 2755  O O    . ASP A 1 37  ? 11.552  2.173   9.083   1.00 0.00 ? 37  ASP A O    2  
ATOM 2756  C CB   . ASP A 1 37  ? 12.226  2.049   12.134  1.00 0.00 ? 37  ASP A CB   2  
ATOM 2757  C CG   . ASP A 1 37  ? 13.310  2.198   13.183  1.00 0.00 ? 37  ASP A CG   2  
ATOM 2758  O OD1  . ASP A 1 37  ? 14.252  2.986   12.955  1.00 0.00 ? 37  ASP A OD1  2  
ATOM 2759  O OD2  . ASP A 1 37  ? 13.214  1.529   14.233  1.00 0.00 ? 37  ASP A OD2  2  
ATOM 2760  H H    . ASP A 1 37  ? 14.014  2.397   9.881   1.00 0.00 ? 37  ASP A H    2  
ATOM 2761  H HA   . ASP A 1 37  ? 12.768  0.152   11.303  1.00 0.00 ? 37  ASP A HA   2  
ATOM 2762  H HB2  . ASP A 1 37  ? 11.971  3.031   11.765  1.00 0.00 ? 37  ASP A HB2  2  
ATOM 2763  H HB3  . ASP A 1 37  ? 11.357  1.606   12.599  1.00 0.00 ? 37  ASP A HB3  2  
ATOM 2764  N N    . PHE A 1 38  ? 10.796  0.172   9.783   1.00 0.00 ? 38  PHE A N    2  
ATOM 2765  C CA   . PHE A 1 38  ? 9.750   0.090   8.769   1.00 0.00 ? 38  PHE A CA   2  
ATOM 2766  C C    . PHE A 1 38  ? 8.549   0.945   9.159   1.00 0.00 ? 38  PHE A C    2  
ATOM 2767  O O    . PHE A 1 38  ? 8.182   1.879   8.446   1.00 0.00 ? 38  PHE A O    2  
ATOM 2768  C CB   . PHE A 1 38  ? 9.315   -1.363  8.573   1.00 0.00 ? 38  PHE A CB   2  
ATOM 2769  C CG   . PHE A 1 38  ? 8.653   -1.617  7.247   1.00 0.00 ? 38  PHE A CG   2  
ATOM 2770  C CD1  . PHE A 1 38  ? 9.297   -1.291  6.065   1.00 0.00 ? 38  PHE A CD1  2  
ATOM 2771  C CD2  . PHE A 1 38  ? 7.390   -2.180  7.185   1.00 0.00 ? 38  PHE A CD2  2  
ATOM 2772  C CE1  . PHE A 1 38  ? 8.691   -1.522  4.844   1.00 0.00 ? 38  PHE A CE1  2  
ATOM 2773  C CE2  . PHE A 1 38  ? 6.778   -2.414  5.968   1.00 0.00 ? 38  PHE A CE2  2  
ATOM 2774  C CZ   . PHE A 1 38  ? 7.431   -2.086  4.796   1.00 0.00 ? 38  PHE A CZ   2  
ATOM 2775  H H    . PHE A 1 38  ? 10.897  -0.561  10.427  1.00 0.00 ? 38  PHE A H    2  
ATOM 2776  H HA   . PHE A 1 38  ? 10.158  0.464   7.843   1.00 0.00 ? 38  PHE A HA   2  
ATOM 2777  H HB2  . PHE A 1 38  ? 10.181  -2.004  8.639   1.00 0.00 ? 38  PHE A HB2  2  
ATOM 2778  H HB3  . PHE A 1 38  ? 8.615   -1.630  9.350   1.00 0.00 ? 38  PHE A HB3  2  
ATOM 2779  H HD1  . PHE A 1 38  ? 10.283  -0.852  6.100   1.00 0.00 ? 38  PHE A HD1  2  
ATOM 2780  H HD2  . PHE A 1 38  ? 6.878   -2.438  8.102   1.00 0.00 ? 38  PHE A HD2  2  
ATOM 2781  H HE1  . PHE A 1 38  ? 9.203   -1.265  3.929   1.00 0.00 ? 38  PHE A HE1  2  
ATOM 2782  H HE2  . PHE A 1 38  ? 5.793   -2.855  5.934   1.00 0.00 ? 38  PHE A HE2  2  
ATOM 2783  H HZ   . PHE A 1 38  ? 6.955   -2.267  3.844   1.00 0.00 ? 38  PHE A HZ   2  
ATOM 2784  N N    . GLN A 1 39  ? 7.939   0.618   10.293  1.00 0.00 ? 39  GLN A N    2  
ATOM 2785  C CA   . GLN A 1 39  ? 6.778   1.355   10.777  1.00 0.00 ? 39  GLN A CA   2  
ATOM 2786  C C    . GLN A 1 39  ? 6.984   2.858   10.622  1.00 0.00 ? 39  GLN A C    2  
ATOM 2787  O O    . GLN A 1 39  ? 6.153   3.552   10.035  1.00 0.00 ? 39  GLN A O    2  
ATOM 2788  C CB   . GLN A 1 39  ? 6.504   1.014   12.243  1.00 0.00 ? 39  GLN A CB   2  
ATOM 2789  C CG   . GLN A 1 39  ? 5.244   1.662   12.794  1.00 0.00 ? 39  GLN A CG   2  
ATOM 2790  C CD   . GLN A 1 39  ? 5.509   3.022   13.409  1.00 0.00 ? 39  GLN A CD   2  
ATOM 2791  O OE1  . GLN A 1 39  ? 6.032   3.123   14.519  1.00 0.00 ? 39  GLN A OE1  2  
ATOM 2792  N NE2  . GLN A 1 39  ? 5.148   4.078   12.690  1.00 0.00 ? 39  GLN A NE2  2  
ATOM 2793  H H    . GLN A 1 39  ? 8.278   -0.137  10.817  1.00 0.00 ? 39  GLN A H    2  
ATOM 2794  H HA   . GLN A 1 39  ? 5.926   1.058   10.183  1.00 0.00 ? 39  GLN A HA   2  
ATOM 2795  H HB2  . GLN A 1 39  ? 6.404   -0.057  12.338  1.00 0.00 ? 39  GLN A HB2  2  
ATOM 2796  H HB3  . GLN A 1 39  ? 7.342   1.343   12.839  1.00 0.00 ? 39  GLN A HB3  2  
ATOM 2797  H HG2  . GLN A 1 39  ? 4.534   1.780   11.988  1.00 0.00 ? 39  GLN A HG2  2  
ATOM 2798  H HG3  . GLN A 1 39  ? 4.824   1.016   13.550  1.00 0.00 ? 39  GLN A HG3  2  
ATOM 2799  H HE21 . GLN A 1 39  ? 4.735   3.922   11.815  1.00 0.00 ? 39  GLN A HE21 2  
ATOM 2800  H HE22 . GLN A 1 39  ? 5.307   4.969   13.063  1.00 0.00 ? 39  GLN A HE22 2  
ATOM 2801  N N    . LYS A 1 40  ? 8.095   3.355   11.153  1.00 0.00 ? 40  LYS A N    2  
ATOM 2802  C CA   . LYS A 1 40  ? 8.412   4.777   11.074  1.00 0.00 ? 40  LYS A CA   2  
ATOM 2803  C C    . LYS A 1 40  ? 8.687   5.193   9.632   1.00 0.00 ? 40  LYS A C    2  
ATOM 2804  O O    . LYS A 1 40  ? 7.949   5.990   9.055   1.00 0.00 ? 40  LYS A O    2  
ATOM 2805  C CB   . LYS A 1 40  ? 9.625   5.099   11.949  1.00 0.00 ? 40  LYS A CB   2  
ATOM 2806  C CG   . LYS A 1 40  ? 9.334   5.036   13.439  1.00 0.00 ? 40  LYS A CG   2  
ATOM 2807  C CD   . LYS A 1 40  ? 9.409   3.612   13.963  1.00 0.00 ? 40  LYS A CD   2  
ATOM 2808  C CE   . LYS A 1 40  ? 9.457   3.579   15.483  1.00 0.00 ? 40  LYS A CE   2  
ATOM 2809  N NZ   . LYS A 1 40  ? 10.820  3.880   16.001  1.00 0.00 ? 40  LYS A NZ   2  
ATOM 2810  H H    . LYS A 1 40  ? 8.719   2.751   11.609  1.00 0.00 ? 40  LYS A H    2  
ATOM 2811  H HA   . LYS A 1 40  ? 7.559   5.328   11.439  1.00 0.00 ? 40  LYS A HA   2  
ATOM 2812  H HB2  . LYS A 1 40  ? 10.412  4.393   11.727  1.00 0.00 ? 40  LYS A HB2  2  
ATOM 2813  H HB3  . LYS A 1 40  ? 9.970   6.095   11.713  1.00 0.00 ? 40  LYS A HB3  2  
ATOM 2814  H HG2  . LYS A 1 40  ? 10.059  5.640   13.964  1.00 0.00 ? 40  LYS A HG2  2  
ATOM 2815  H HG3  . LYS A 1 40  ? 8.341   5.425   13.619  1.00 0.00 ? 40  LYS A HG3  2  
ATOM 2816  H HD2  . LYS A 1 40  ? 8.538   3.068   13.629  1.00 0.00 ? 40  LYS A HD2  2  
ATOM 2817  H HD3  . LYS A 1 40  ? 10.301  3.141   13.573  1.00 0.00 ? 40  LYS A HD3  2  
ATOM 2818  H HE2  . LYS A 1 40  ? 8.765   4.312   15.868  1.00 0.00 ? 40  LYS A HE2  2  
ATOM 2819  H HE3  . LYS A 1 40  ? 9.162   2.595   15.817  1.00 0.00 ? 40  LYS A HE3  2  
ATOM 2820  H HZ1  . LYS A 1 40  ? 11.167  4.774   15.597  1.00 0.00 ? 40  LYS A HZ1  2  
ATOM 2821  H HZ2  . LYS A 1 40  ? 11.478  3.118   15.741  1.00 0.00 ? 40  LYS A HZ2  2  
ATOM 2822  H HZ3  . LYS A 1 40  ? 10.797  3.966   17.038  1.00 0.00 ? 40  LYS A HZ3  2  
ATOM 2823  N N    . GLY A 1 41  ? 9.754   4.647   9.056   1.00 0.00 ? 41  GLY A N    2  
ATOM 2824  C CA   . GLY A 1 41  ? 10.106  4.974   7.687   1.00 0.00 ? 41  GLY A CA   2  
ATOM 2825  C C    . GLY A 1 41  ? 8.888   5.149   6.801   1.00 0.00 ? 41  GLY A C    2  
ATOM 2826  O O    . GLY A 1 41  ? 8.921   5.906   5.830   1.00 0.00 ? 41  GLY A O    2  
ATOM 2827  H H    . GLY A 1 41  ? 10.307  4.018   9.566   1.00 0.00 ? 41  GLY A H    2  
ATOM 2828  H HA2  . GLY A 1 41  ? 10.676  5.890   7.682   1.00 0.00 ? 41  GLY A HA2  2  
ATOM 2829  H HA3  . GLY A 1 41  ? 10.717  4.180   7.286   1.00 0.00 ? 41  GLY A HA3  2  
ATOM 2830  N N    . LEU A 1 42  ? 7.811   4.447   7.134   1.00 0.00 ? 42  LEU A N    2  
ATOM 2831  C CA   . LEU A 1 42  ? 6.577   4.527   6.360   1.00 0.00 ? 42  LEU A CA   2  
ATOM 2832  C C    . LEU A 1 42  ? 5.570   5.452   7.036   1.00 0.00 ? 42  LEU A C    2  
ATOM 2833  O O    . LEU A 1 42  ? 4.788   6.131   6.369   1.00 0.00 ? 42  LEU A O    2  
ATOM 2834  C CB   . LEU A 1 42  ? 5.969   3.134   6.187   1.00 0.00 ? 42  LEU A CB   2  
ATOM 2835  C CG   . LEU A 1 42  ? 6.906   2.058   5.636   1.00 0.00 ? 42  LEU A CG   2  
ATOM 2836  C CD1  . LEU A 1 42  ? 6.202   0.710   5.593   1.00 0.00 ? 42  LEU A CD1  2  
ATOM 2837  C CD2  . LEU A 1 42  ? 7.406   2.444   4.252   1.00 0.00 ? 42  LEU A CD2  2  
ATOM 2838  H H    . LEU A 1 42  ? 7.845   3.860   7.918   1.00 0.00 ? 42  LEU A H    2  
ATOM 2839  H HA   . LEU A 1 42  ? 6.821   4.928   5.389   1.00 0.00 ? 42  LEU A HA   2  
ATOM 2840  H HB2  . LEU A 1 42  ? 5.618   2.804   7.152   1.00 0.00 ? 42  LEU A HB2  2  
ATOM 2841  H HB3  . LEU A 1 42  ? 5.130   3.222   5.512   1.00 0.00 ? 42  LEU A HB3  2  
ATOM 2842  H HG   . LEU A 1 42  ? 7.762   1.966   6.289   1.00 0.00 ? 42  LEU A HG   2  
ATOM 2843  H HD11 . LEU A 1 42  ? 6.895   -0.067  5.877   1.00 0.00 ? 42  LEU A HD11 2  
ATOM 2844  H HD12 . LEU A 1 42  ? 5.843   0.523   4.592   1.00 0.00 ? 42  LEU A HD12 2  
ATOM 2845  H HD13 . LEU A 1 42  ? 5.367   0.718   6.279   1.00 0.00 ? 42  LEU A HD13 2  
ATOM 2846  H HD21 . LEU A 1 42  ? 6.666   3.058   3.761   1.00 0.00 ? 42  LEU A HD21 2  
ATOM 2847  H HD22 . LEU A 1 42  ? 7.577   1.551   3.668   1.00 0.00 ? 42  LEU A HD22 2  
ATOM 2848  H HD23 . LEU A 1 42  ? 8.328   2.997   4.345   1.00 0.00 ? 42  LEU A HD23 2  
ATOM 2849  N N    . LYS A 1 43  ? 5.596   5.477   8.364   1.00 0.00 ? 43  LYS A N    2  
ATOM 2850  C CA   . LYS A 1 43  ? 4.688   6.323   9.132   1.00 0.00 ? 43  LYS A CA   2  
ATOM 2851  C C    . LYS A 1 43  ? 4.473   7.663   8.436   1.00 0.00 ? 43  LYS A C    2  
ATOM 2852  O O    . LYS A 1 43  ? 3.396   7.933   7.907   1.00 0.00 ? 43  LYS A O    2  
ATOM 2853  C CB   . LYS A 1 43  ? 5.239   6.549   10.541  1.00 0.00 ? 43  LYS A CB   2  
ATOM 2854  C CG   . LYS A 1 43  ? 4.337   7.402   11.417  1.00 0.00 ? 43  LYS A CG   2  
ATOM 2855  C CD   . LYS A 1 43  ? 5.125   8.115   12.502  1.00 0.00 ? 43  LYS A CD   2  
ATOM 2856  C CE   . LYS A 1 43  ? 4.254   9.097   13.271  1.00 0.00 ? 43  LYS A CE   2  
ATOM 2857  N NZ   . LYS A 1 43  ? 5.067   10.035  14.092  1.00 0.00 ? 43  LYS A NZ   2  
ATOM 2858  H H    . LYS A 1 43  ? 6.241   4.914   8.841   1.00 0.00 ? 43  LYS A H    2  
ATOM 2859  H HA   . LYS A 1 43  ? 3.739   5.812   9.203   1.00 0.00 ? 43  LYS A HA   2  
ATOM 2860  H HB2  . LYS A 1 43  ? 5.371   5.591   11.022  1.00 0.00 ? 43  LYS A HB2  2  
ATOM 2861  H HB3  . LYS A 1 43  ? 6.199   7.040   10.465  1.00 0.00 ? 43  LYS A HB3  2  
ATOM 2862  H HG2  . LYS A 1 43  ? 3.845   8.139   10.801  1.00 0.00 ? 43  LYS A HG2  2  
ATOM 2863  H HG3  . LYS A 1 43  ? 3.596   6.766   11.881  1.00 0.00 ? 43  LYS A HG3  2  
ATOM 2864  H HD2  . LYS A 1 43  ? 5.517   7.383   13.191  1.00 0.00 ? 43  LYS A HD2  2  
ATOM 2865  H HD3  . LYS A 1 43  ? 5.943   8.656   12.045  1.00 0.00 ? 43  LYS A HD3  2  
ATOM 2866  H HE2  . LYS A 1 43  ? 3.666   9.664   12.567  1.00 0.00 ? 43  LYS A HE2  2  
ATOM 2867  H HE3  . LYS A 1 43  ? 3.596   8.539   13.922  1.00 0.00 ? 43  LYS A HE3  2  
ATOM 2868  H HZ1  . LYS A 1 43  ? 4.547   10.925  14.238  1.00 0.00 ? 43  LYS A HZ1  2  
ATOM 2869  H HZ2  . LYS A 1 43  ? 5.964   10.247  13.611  1.00 0.00 ? 43  LYS A HZ2  2  
ATOM 2870  H HZ3  . LYS A 1 43  ? 5.275   9.613   15.019  1.00 0.00 ? 43  LYS A HZ3  2  
ATOM 2871  N N    . ASP A 1 44  ? 5.506   8.498   8.440   1.00 0.00 ? 44  ASP A N    2  
ATOM 2872  C CA   . ASP A 1 44  ? 5.431   9.810   7.807   1.00 0.00 ? 44  ASP A CA   2  
ATOM 2873  C C    . ASP A 1 44  ? 4.559   9.760   6.556   1.00 0.00 ? 44  ASP A C    2  
ATOM 2874  O O    . ASP A 1 44  ? 3.872   10.726  6.228   1.00 0.00 ? 44  ASP A O    2  
ATOM 2875  C CB   . ASP A 1 44  ? 6.832   10.308  7.449   1.00 0.00 ? 44  ASP A CB   2  
ATOM 2876  C CG   . ASP A 1 44  ? 6.866   11.799  7.183   1.00 0.00 ? 44  ASP A CG   2  
ATOM 2877  O OD1  . ASP A 1 44  ? 6.207   12.552  7.931   1.00 0.00 ? 44  ASP A OD1  2  
ATOM 2878  O OD2  . ASP A 1 44  ? 7.553   12.216  6.226   1.00 0.00 ? 44  ASP A OD2  2  
ATOM 2879  H H    . ASP A 1 44  ? 6.340   8.226   8.879   1.00 0.00 ? 44  ASP A H    2  
ATOM 2880  H HA   . ASP A 1 44  ? 4.986   10.494  8.513   1.00 0.00 ? 44  ASP A HA   2  
ATOM 2881  H HB2  . ASP A 1 44  ? 7.504   10.092  8.266   1.00 0.00 ? 44  ASP A HB2  2  
ATOM 2882  H HB3  . ASP A 1 44  ? 7.173   9.794   6.562   1.00 0.00 ? 44  ASP A HB3  2  
ATOM 2883  N N    . GLY A 1 45  ? 4.596   8.628   5.861   1.00 0.00 ? 45  GLY A N    2  
ATOM 2884  C CA   . GLY A 1 45  ? 3.806   8.474   4.653   1.00 0.00 ? 45  GLY A CA   2  
ATOM 2885  C C    . GLY A 1 45  ? 4.443   9.148   3.454   1.00 0.00 ? 45  GLY A C    2  
ATOM 2886  O O    . GLY A 1 45  ? 3.785   9.898   2.731   1.00 0.00 ? 45  GLY A O    2  
ATOM 2887  H H    . GLY A 1 45  ? 5.162   7.891   6.170   1.00 0.00 ? 45  GLY A H    2  
ATOM 2888  H HA2  . GLY A 1 45  ? 3.691   7.421   4.442   1.00 0.00 ? 45  GLY A HA2  2  
ATOM 2889  H HA3  . GLY A 1 45  ? 2.829   8.906   4.818   1.00 0.00 ? 45  GLY A HA3  2  
ATOM 2890  N N    . THR A 1 46  ? 5.727   8.882   3.241   1.00 0.00 ? 46  THR A N    2  
ATOM 2891  C CA   . THR A 1 46  ? 6.455   9.471   2.123   1.00 0.00 ? 46  THR A CA   2  
ATOM 2892  C C    . THR A 1 46  ? 6.671   8.452   1.011   1.00 0.00 ? 46  THR A C    2  
ATOM 2893  O O    . THR A 1 46  ? 6.363   8.715   -0.153  1.00 0.00 ? 46  THR A O    2  
ATOM 2894  C CB   . THR A 1 46  ? 7.821   10.024  2.570   1.00 0.00 ? 46  THR A CB   2  
ATOM 2895  O OG1  . THR A 1 46  ? 8.519   9.040   3.343   1.00 0.00 ? 46  THR A OG1  2  
ATOM 2896  C CG2  . THR A 1 46  ? 7.649   11.293  3.392   1.00 0.00 ? 46  THR A CG2  2  
ATOM 2897  H H    . THR A 1 46  ? 6.197   8.276   3.852   1.00 0.00 ? 46  THR A H    2  
ATOM 2898  H HA   . THR A 1 46  ? 5.867   10.291  1.738   1.00 0.00 ? 46  THR A HA   2  
ATOM 2899  H HB   . THR A 1 46  ? 8.403   10.258  1.691   1.00 0.00 ? 46  THR A HB   2  
ATOM 2900  H HG1  . THR A 1 46  ? 8.035   8.870   4.155   1.00 0.00 ? 46  THR A HG1  2  
ATOM 2901  H HG21 . THR A 1 46  ? 8.121   12.119  2.881   1.00 0.00 ? 46  THR A HG21 2  
ATOM 2902  H HG22 . THR A 1 46  ? 8.106   11.159  4.360   1.00 0.00 ? 46  THR A HG22 2  
ATOM 2903  H HG23 . THR A 1 46  ? 6.597   11.501  3.515   1.00 0.00 ? 46  THR A HG23 2  
ATOM 2904  N N    . ILE A 1 47  ? 7.201   7.289   1.374   1.00 0.00 ? 47  ILE A N    2  
ATOM 2905  C CA   . ILE A 1 47  ? 7.457   6.231   0.406   1.00 0.00 ? 47  ILE A CA   2  
ATOM 2906  C C    . ILE A 1 47  ? 6.169   5.501   0.036   1.00 0.00 ? 47  ILE A C    2  
ATOM 2907  O O    . ILE A 1 47  ? 5.809   5.412   -1.139  1.00 0.00 ? 47  ILE A O    2  
ATOM 2908  C CB   . ILE A 1 47  ? 8.475   5.209   0.945   1.00 0.00 ? 47  ILE A CB   2  
ATOM 2909  C CG1  . ILE A 1 47  ? 9.787   5.906   1.309   1.00 0.00 ? 47  ILE A CG1  2  
ATOM 2910  C CG2  . ILE A 1 47  ? 8.719   4.112   -0.081  1.00 0.00 ? 47  ILE A CG2  2  
ATOM 2911  C CD1  . ILE A 1 47  ? 10.533  5.238   2.441   1.00 0.00 ? 47  ILE A CD1  2  
ATOM 2912  H H    . ILE A 1 47  ? 7.425   7.139   2.316   1.00 0.00 ? 47  ILE A H    2  
ATOM 2913  H HA   . ILE A 1 47  ? 7.869   6.685   -0.483  1.00 0.00 ? 47  ILE A HA   2  
ATOM 2914  H HB   . ILE A 1 47  ? 8.060   4.753   1.830   1.00 0.00 ? 47  ILE A HB   2  
ATOM 2915  H HG12 . ILE A 1 47  ? 10.434  5.916   0.446   1.00 0.00 ? 47  ILE A HG12 2  
ATOM 2916  H HG13 . ILE A 1 47  ? 9.575   6.923   1.606   1.00 0.00 ? 47  ILE A HG13 2  
ATOM 2917  H HG21 . ILE A 1 47  ? 9.780   4.020   -0.265  1.00 0.00 ? 47  ILE A HG21 2  
ATOM 2918  H HG22 . ILE A 1 47  ? 8.338   3.176   0.296   1.00 0.00 ? 47  ILE A HG22 2  
ATOM 2919  H HG23 . ILE A 1 47  ? 8.215   4.363   -1.003  1.00 0.00 ? 47  ILE A HG23 2  
ATOM 2920  H HD11 . ILE A 1 47  ? 11.362  4.671   2.042   1.00 0.00 ? 47  ILE A HD11 2  
ATOM 2921  H HD12 . ILE A 1 47  ? 10.904  5.988   3.123   1.00 0.00 ? 47  ILE A HD12 2  
ATOM 2922  H HD13 . ILE A 1 47  ? 9.865   4.571   2.969   1.00 0.00 ? 47  ILE A HD13 2  
ATOM 2923  N N    . LEU A 1 48  ? 5.478   4.984   1.045   1.00 0.00 ? 48  LEU A N    2  
ATOM 2924  C CA   . LEU A 1 48  ? 4.228   4.264   0.827   1.00 0.00 ? 48  LEU A CA   2  
ATOM 2925  C C    . LEU A 1 48  ? 3.473   4.834   -0.370  1.00 0.00 ? 48  LEU A C    2  
ATOM 2926  O O    . LEU A 1 48  ? 2.952   4.088   -1.200  1.00 0.00 ? 48  LEU A O    2  
ATOM 2927  C CB   . LEU A 1 48  ? 3.351   4.334   2.078   1.00 0.00 ? 48  LEU A CB   2  
ATOM 2928  C CG   . LEU A 1 48  ? 3.773   3.441   3.245   1.00 0.00 ? 48  LEU A CG   2  
ATOM 2929  C CD1  . LEU A 1 48  ? 2.880   3.683   4.453   1.00 0.00 ? 48  LEU A CD1  2  
ATOM 2930  C CD2  . LEU A 1 48  ? 3.734   1.975   2.837   1.00 0.00 ? 48  LEU A CD2  2  
ATOM 2931  H H    . LEU A 1 48  ? 5.815   5.087   1.959   1.00 0.00 ? 48  LEU A H    2  
ATOM 2932  H HA   . LEU A 1 48  ? 4.471   3.232   0.626   1.00 0.00 ? 48  LEU A HA   2  
ATOM 2933  H HB2  . LEU A 1 48  ? 3.353   5.356   2.427   1.00 0.00 ? 48  LEU A HB2  2  
ATOM 2934  H HB3  . LEU A 1 48  ? 2.346   4.055   1.794   1.00 0.00 ? 48  LEU A HB3  2  
ATOM 2935  H HG   . LEU A 1 48  ? 4.788   3.684   3.527   1.00 0.00 ? 48  LEU A HG   2  
ATOM 2936  H HD11 . LEU A 1 48  ? 2.940   2.837   5.120   1.00 0.00 ? 48  LEU A HD11 2  
ATOM 2937  H HD12 . LEU A 1 48  ? 1.860   3.814   4.126   1.00 0.00 ? 48  LEU A HD12 2  
ATOM 2938  H HD13 . LEU A 1 48  ? 3.209   4.573   4.970   1.00 0.00 ? 48  LEU A HD13 2  
ATOM 2939  H HD21 . LEU A 1 48  ? 2.963   1.468   3.397   1.00 0.00 ? 48  LEU A HD21 2  
ATOM 2940  H HD22 . LEU A 1 48  ? 4.690   1.519   3.044   1.00 0.00 ? 48  LEU A HD22 2  
ATOM 2941  H HD23 . LEU A 1 48  ? 3.520   1.902   1.781   1.00 0.00 ? 48  LEU A HD23 2  
ATOM 2942  N N    . CYS A 1 49  ? 3.420   6.158   -0.453  1.00 0.00 ? 49  CYS A N    2  
ATOM 2943  C CA   . CYS A 1 49  ? 2.730   6.828   -1.550  1.00 0.00 ? 49  CYS A CA   2  
ATOM 2944  C C    . CYS A 1 49  ? 3.383   6.495   -2.888  1.00 0.00 ? 49  CYS A C    2  
ATOM 2945  O O    . CYS A 1 49  ? 2.748   5.927   -3.776  1.00 0.00 ? 49  CYS A O    2  
ATOM 2946  C CB   . CYS A 1 49  ? 2.732   8.342   -1.331  1.00 0.00 ? 49  CYS A CB   2  
ATOM 2947  S SG   . CYS A 1 49  ? 1.626   8.898   -0.013  1.00 0.00 ? 49  CYS A SG   2  
ATOM 2948  H H    . CYS A 1 49  ? 3.855   6.699   0.239   1.00 0.00 ? 49  CYS A H    2  
ATOM 2949  H HA   . CYS A 1 49  ? 1.711   6.475   -1.564  1.00 0.00 ? 49  CYS A HA   2  
ATOM 2950  H HB2  . CYS A 1 49  ? 3.731   8.661   -1.076  1.00 0.00 ? 49  CYS A HB2  2  
ATOM 2951  H HB3  . CYS A 1 49  ? 2.427   8.830   -2.245  1.00 0.00 ? 49  CYS A HB3  2  
ATOM 2952  H HG   . CYS A 1 49  ? 0.650   9.602   -0.568  1.00 0.00 ? 49  CYS A HG   2  
ATOM 2953  N N    . THR A 1 50  ? 4.656   6.853   -3.025  1.00 0.00 ? 50  THR A N    2  
ATOM 2954  C CA   . THR A 1 50  ? 5.395   6.595   -4.254  1.00 0.00 ? 50  THR A CA   2  
ATOM 2955  C C    . THR A 1 50  ? 5.237   5.145   -4.697  1.00 0.00 ? 50  THR A C    2  
ATOM 2956  O O    . THR A 1 50  ? 4.909   4.869   -5.851  1.00 0.00 ? 50  THR A O    2  
ATOM 2957  C CB   . THR A 1 50  ? 6.894   6.908   -4.085  1.00 0.00 ? 50  THR A CB   2  
ATOM 2958  O OG1  . THR A 1 50  ? 7.394   6.283   -2.899  1.00 0.00 ? 50  THR A OG1  2  
ATOM 2959  C CG2  . THR A 1 50  ? 7.128   8.409   -4.011  1.00 0.00 ? 50  THR A CG2  2  
ATOM 2960  H H    . THR A 1 50  ? 5.108   7.302   -2.280  1.00 0.00 ? 50  THR A H    2  
ATOM 2961  H HA   . THR A 1 50  ? 4.998   7.242   -5.023  1.00 0.00 ? 50  THR A HA   2  
ATOM 2962  H HB   . THR A 1 50  ? 7.426   6.517   -4.941  1.00 0.00 ? 50  THR A HB   2  
ATOM 2963  H HG1  . THR A 1 50  ? 6.815   6.487   -2.159  1.00 0.00 ? 50  THR A HG1  2  
ATOM 2964  H HG21 . THR A 1 50  ? 7.651   8.736   -4.897  1.00 0.00 ? 50  THR A HG21 2  
ATOM 2965  H HG22 . THR A 1 50  ? 7.721   8.638   -3.138  1.00 0.00 ? 50  THR A HG22 2  
ATOM 2966  H HG23 . THR A 1 50  ? 6.179   8.919   -3.945  1.00 0.00 ? 50  THR A HG23 2  
ATOM 2967  N N    . LEU A 1 51  ? 5.471   4.221   -3.771  1.00 0.00 ? 51  LEU A N    2  
ATOM 2968  C CA   . LEU A 1 51  ? 5.354   2.796   -4.065  1.00 0.00 ? 51  LEU A CA   2  
ATOM 2969  C C    . LEU A 1 51  ? 4.145   2.522   -4.955  1.00 0.00 ? 51  LEU A C    2  
ATOM 2970  O O    . LEU A 1 51  ? 4.254   1.842   -5.974  1.00 0.00 ? 51  LEU A O    2  
ATOM 2971  C CB   . LEU A 1 51  ? 5.239   1.995   -2.767  1.00 0.00 ? 51  LEU A CB   2  
ATOM 2972  C CG   . LEU A 1 51  ? 4.741   0.556   -2.909  1.00 0.00 ? 51  LEU A CG   2  
ATOM 2973  C CD1  . LEU A 1 51  ? 5.710   -0.264  -3.745  1.00 0.00 ? 51  LEU A CD1  2  
ATOM 2974  C CD2  . LEU A 1 51  ? 4.547   -0.078  -1.539  1.00 0.00 ? 51  LEU A CD2  2  
ATOM 2975  H H    . LEU A 1 51  ? 5.729   4.501   -2.869  1.00 0.00 ? 51  LEU A H    2  
ATOM 2976  H HA   . LEU A 1 51  ? 6.248   2.492   -4.589  1.00 0.00 ? 51  LEU A HA   2  
ATOM 2977  H HB2  . LEU A 1 51  ? 6.217   1.963   -2.311  1.00 0.00 ? 51  LEU A HB2  2  
ATOM 2978  H HB3  . LEU A 1 51  ? 4.556   2.520   -2.115  1.00 0.00 ? 51  LEU A HB3  2  
ATOM 2979  H HG   . LEU A 1 51  ? 3.785   0.561   -3.415  1.00 0.00 ? 51  LEU A HG   2  
ATOM 2980  H HD11 . LEU A 1 51  ? 6.172   -1.017  -3.126  1.00 0.00 ? 51  LEU A HD11 2  
ATOM 2981  H HD12 . LEU A 1 51  ? 6.471   0.384   -4.153  1.00 0.00 ? 51  LEU A HD12 2  
ATOM 2982  H HD13 . LEU A 1 51  ? 5.173   -0.742  -4.553  1.00 0.00 ? 51  LEU A HD13 2  
ATOM 2983  H HD21 . LEU A 1 51  ? 3.625   -0.641  -1.532  1.00 0.00 ? 51  LEU A HD21 2  
ATOM 2984  H HD22 . LEU A 1 51  ? 4.500   0.696   -0.787  1.00 0.00 ? 51  LEU A HD22 2  
ATOM 2985  H HD23 . LEU A 1 51  ? 5.374   -0.737  -1.328  1.00 0.00 ? 51  LEU A HD23 2  
ATOM 2986  N N    . MET A 1 52  ? 2.994   3.058   -4.561  1.00 0.00 ? 52  MET A N    2  
ATOM 2987  C CA   . MET A 1 52  ? 1.765   2.873   -5.325  1.00 0.00 ? 52  MET A CA   2  
ATOM 2988  C C    . MET A 1 52  ? 1.880   3.515   -6.704  1.00 0.00 ? 52  MET A C    2  
ATOM 2989  O O    . MET A 1 52  ? 1.668   2.861   -7.723  1.00 0.00 ? 52  MET A O    2  
ATOM 2990  C CB   . MET A 1 52  ? 0.576   3.469   -4.569  1.00 0.00 ? 52  MET A CB   2  
ATOM 2991  C CG   . MET A 1 52  ? -0.763  2.875   -4.978  1.00 0.00 ? 52  MET A CG   2  
ATOM 2992  S SD   . MET A 1 52  ? -0.813  1.082   -4.789  1.00 0.00 ? 52  MET A SD   2  
ATOM 2993  C CE   . MET A 1 52  ? -1.612  0.604   -6.319  1.00 0.00 ? 52  MET A CE   2  
ATOM 2994  H H    . MET A 1 52  ? 2.969   3.590   -3.739  1.00 0.00 ? 52  MET A H    2  
ATOM 2995  H HA   . MET A 1 52  ? 1.608   1.812   -5.447  1.00 0.00 ? 52  MET A HA   2  
ATOM 2996  H HB2  . MET A 1 52  ? 0.713   3.297   -3.512  1.00 0.00 ? 52  MET A HB2  2  
ATOM 2997  H HB3  . MET A 1 52  ? 0.544   4.532   -4.752  1.00 0.00 ? 52  MET A HB3  2  
ATOM 2998  H HG2  . MET A 1 52  ? -1.537  3.307   -4.362  1.00 0.00 ? 52  MET A HG2  2  
ATOM 2999  H HG3  . MET A 1 52  ? -0.948  3.120   -6.013  1.00 0.00 ? 52  MET A HG3  2  
ATOM 3000  H HE1  . MET A 1 52  ? -2.659  0.870   -6.278  1.00 0.00 ? 52  MET A HE1  2  
ATOM 3001  H HE2  . MET A 1 52  ? -1.143  1.115   -7.146  1.00 0.00 ? 52  MET A HE2  2  
ATOM 3002  H HE3  . MET A 1 52  ? -1.518  -0.465  -6.456  1.00 0.00 ? 52  MET A HE3  2  
ATOM 3003  N N    . ASN A 1 53  ? 2.216   4.801   -6.726  1.00 0.00 ? 53  ASN A N    2  
ATOM 3004  C CA   . ASN A 1 53  ? 2.358   5.532   -7.980  1.00 0.00 ? 53  ASN A CA   2  
ATOM 3005  C C    . ASN A 1 53  ? 3.141   4.714   -9.002  1.00 0.00 ? 53  ASN A C    2  
ATOM 3006  O O    . ASN A 1 53  ? 2.872   4.774   -10.200 1.00 0.00 ? 53  ASN A O    2  
ATOM 3007  C CB   . ASN A 1 53  ? 3.058   6.871   -7.738  1.00 0.00 ? 53  ASN A CB   2  
ATOM 3008  C CG   . ASN A 1 53  ? 2.078   7.993   -7.454  1.00 0.00 ? 53  ASN A CG   2  
ATOM 3009  O OD1  . ASN A 1 53  ? 1.119   8.198   -8.198  1.00 0.00 ? 53  ASN A OD1  2  
ATOM 3010  N ND2  . ASN A 1 53  ? 2.316   8.726   -6.371  1.00 0.00 ? 53  ASN A ND2  2  
ATOM 3011  H H    . ASN A 1 53  ? 2.371   5.270   -5.879  1.00 0.00 ? 53  ASN A H    2  
ATOM 3012  H HA   . ASN A 1 53  ? 1.368   5.719   -8.369  1.00 0.00 ? 53  ASN A HA   2  
ATOM 3013  H HB2  . ASN A 1 53  ? 3.722   6.775   -6.890  1.00 0.00 ? 53  ASN A HB2  2  
ATOM 3014  H HB3  . ASN A 1 53  ? 3.634   7.133   -8.612  1.00 0.00 ? 53  ASN A HB3  2  
ATOM 3015  H HD21 . ASN A 1 53  ? 3.098   8.505   -5.826  1.00 0.00 ? 53  ASN A HD21 2  
ATOM 3016  H HD22 . ASN A 1 53  ? 1.697   9.457   -6.165  1.00 0.00 ? 53  ASN A HD22 2  
ATOM 3017  N N    . LYS A 1 54  ? 4.112   3.947   -8.517  1.00 0.00 ? 54  LYS A N    2  
ATOM 3018  C CA   . LYS A 1 54  ? 4.935   3.113   -9.386  1.00 0.00 ? 54  LYS A CA   2  
ATOM 3019  C C    . LYS A 1 54  ? 4.088   2.059   -10.089 1.00 0.00 ? 54  LYS A C    2  
ATOM 3020  O O    . LYS A 1 54  ? 4.215   1.847   -11.296 1.00 0.00 ? 54  LYS A O    2  
ATOM 3021  C CB   . LYS A 1 54  ? 6.044   2.437   -8.577  1.00 0.00 ? 54  LYS A CB   2  
ATOM 3022  C CG   . LYS A 1 54  ? 6.970   3.415   -7.876  1.00 0.00 ? 54  LYS A CG   2  
ATOM 3023  C CD   . LYS A 1 54  ? 7.827   4.181   -8.871  1.00 0.00 ? 54  LYS A CD   2  
ATOM 3024  C CE   . LYS A 1 54  ? 8.178   5.567   -8.352  1.00 0.00 ? 54  LYS A CE   2  
ATOM 3025  N NZ   . LYS A 1 54  ? 7.049   6.524   -8.524  1.00 0.00 ? 54  LYS A NZ   2  
ATOM 3026  H H    . LYS A 1 54  ? 4.280   3.941   -7.550  1.00 0.00 ? 54  LYS A H    2  
ATOM 3027  H HA   . LYS A 1 54  ? 5.384   3.753   -10.131 1.00 0.00 ? 54  LYS A HA   2  
ATOM 3028  H HB2  . LYS A 1 54  ? 5.591   1.803   -7.828  1.00 0.00 ? 54  LYS A HB2  2  
ATOM 3029  H HB3  . LYS A 1 54  ? 6.637   1.825   -9.242  1.00 0.00 ? 54  LYS A HB3  2  
ATOM 3030  H HG2  . LYS A 1 54  ? 6.376   4.119   -7.312  1.00 0.00 ? 54  LYS A HG2  2  
ATOM 3031  H HG3  . LYS A 1 54  ? 7.616   2.867   -7.204  1.00 0.00 ? 54  LYS A HG3  2  
ATOM 3032  H HD2  . LYS A 1 54  ? 8.741   3.631   -9.043  1.00 0.00 ? 54  LYS A HD2  2  
ATOM 3033  H HD3  . LYS A 1 54  ? 7.285   4.279   -9.800  1.00 0.00 ? 54  LYS A HD3  2  
ATOM 3034  H HE2  . LYS A 1 54  ? 8.421   5.495   -7.303  1.00 0.00 ? 54  LYS A HE2  2  
ATOM 3035  H HE3  . LYS A 1 54  ? 9.036   5.933   -8.897  1.00 0.00 ? 54  LYS A HE3  2  
ATOM 3036  H HZ1  . LYS A 1 54  ? 7.338   7.474   -8.215  1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 3037  H HZ2  . LYS A 1 54  ? 6.234   6.220   -7.954  1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 3038  H HZ3  . LYS A 1 54  ? 6.765   6.567   -9.523  1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 3039  N N    . LEU A 1 55  ? 3.222   1.398   -9.329  1.00 0.00 ? 55  LEU A N    2  
ATOM 3040  C CA   . LEU A 1 55  ? 2.351   0.366   -9.880  1.00 0.00 ? 55  LEU A CA   2  
ATOM 3041  C C    . LEU A 1 55  ? 1.212   0.985   -10.684 1.00 0.00 ? 55  LEU A C    2  
ATOM 3042  O O    . LEU A 1 55  ? 0.919   0.551   -11.797 1.00 0.00 ? 55  LEU A O    2  
ATOM 3043  C CB   . LEU A 1 55  ? 1.783   -0.503  -8.756  1.00 0.00 ? 55  LEU A CB   2  
ATOM 3044  C CG   . LEU A 1 55  ? 2.782   -0.963  -7.694  1.00 0.00 ? 55  LEU A CG   2  
ATOM 3045  C CD1  . LEU A 1 55  ? 2.061   -1.665  -6.552  1.00 0.00 ? 55  LEU A CD1  2  
ATOM 3046  C CD2  . LEU A 1 55  ? 3.829   -1.881  -8.308  1.00 0.00 ? 55  LEU A CD2  2  
ATOM 3047  H H    . LEU A 1 55  ? 3.164   1.611   -8.374  1.00 0.00 ? 55  LEU A H    2  
ATOM 3048  H HA   . LEU A 1 55  ? 2.945   -0.252  -10.537 1.00 0.00 ? 55  LEU A HA   2  
ATOM 3049  H HB2  . LEU A 1 55  ? 1.010   0.063   -8.259  1.00 0.00 ? 55  LEU A HB2  2  
ATOM 3050  H HB3  . LEU A 1 55  ? 1.348   -1.384  -9.208  1.00 0.00 ? 55  LEU A HB3  2  
ATOM 3051  H HG   . LEU A 1 55  ? 3.289   -0.100  -7.287  1.00 0.00 ? 55  LEU A HG   2  
ATOM 3052  H HD11 . LEU A 1 55  ? 1.794   -0.941  -5.797  1.00 0.00 ? 55  LEU A HD11 2  
ATOM 3053  H HD12 . LEU A 1 55  ? 2.711   -2.412  -6.120  1.00 0.00 ? 55  LEU A HD12 2  
ATOM 3054  H HD13 . LEU A 1 55  ? 1.168   -2.141  -6.929  1.00 0.00 ? 55  LEU A HD13 2  
ATOM 3055  H HD21 . LEU A 1 55  ? 4.140   -2.611  -7.577  1.00 0.00 ? 55  LEU A HD21 2  
ATOM 3056  H HD22 . LEU A 1 55  ? 4.683   -1.294  -8.617  1.00 0.00 ? 55  LEU A HD22 2  
ATOM 3057  H HD23 . LEU A 1 55  ? 3.408   -2.384  -9.166  1.00 0.00 ? 55  LEU A HD23 2  
ATOM 3058  N N    . GLN A 1 56  ? 0.576   2.003   -10.112 1.00 0.00 ? 56  GLN A N    2  
ATOM 3059  C CA   . GLN A 1 56  ? -0.529  2.683   -10.777 1.00 0.00 ? 56  GLN A CA   2  
ATOM 3060  C C    . GLN A 1 56  ? -0.160  4.126   -11.108 1.00 0.00 ? 56  GLN A C    2  
ATOM 3061  O O    . GLN A 1 56  ? 0.242   4.904   -10.242 1.00 0.00 ? 56  GLN A O    2  
ATOM 3062  C CB   . GLN A 1 56  ? -1.779  2.653   -9.896  1.00 0.00 ? 56  GLN A CB   2  
ATOM 3063  C CG   . GLN A 1 56  ? -2.865  3.615   -10.347 1.00 0.00 ? 56  GLN A CG   2  
ATOM 3064  C CD   . GLN A 1 56  ? -4.260  3.103   -10.046 1.00 0.00 ? 56  GLN A CD   2  
ATOM 3065  O OE1  . GLN A 1 56  ? -4.959  2.613   -10.933 1.00 0.00 ? 56  GLN A OE1  2  
ATOM 3066  N NE2  . GLN A 1 56  ? -4.672  3.213   -8.788  1.00 0.00 ? 56  GLN A NE2  2  
ATOM 3067  H H    . GLN A 1 56  ? 0.857   2.304   -9.223  1.00 0.00 ? 56  GLN A H    2  
ATOM 3068  H HA   . GLN A 1 56  ? -0.736  2.158   -11.697 1.00 0.00 ? 56  GLN A HA   2  
ATOM 3069  H HB2  . GLN A 1 56  ? -2.186  1.653   -9.905  1.00 0.00 ? 56  GLN A HB2  2  
ATOM 3070  H HB3  . GLN A 1 56  ? -1.498  2.910   -8.886  1.00 0.00 ? 56  GLN A HB3  2  
ATOM 3071  H HG2  . GLN A 1 56  ? -2.727  4.558   -9.840  1.00 0.00 ? 56  GLN A HG2  2  
ATOM 3072  H HG3  . GLN A 1 56  ? -2.775  3.764   -11.414 1.00 0.00 ? 56  GLN A HG3  2  
ATOM 3073  H HE21 . GLN A 1 56  ? -4.061  3.616   -8.135  1.00 0.00 ? 56  GLN A HE21 2  
ATOM 3074  H HE22 . GLN A 1 56  ? -5.569  2.891   -8.565  1.00 0.00 ? 56  GLN A HE22 2  
ATOM 3075  N N    . PRO A 1 57  ? -0.300  4.494   -12.390 1.00 0.00 ? 57  PRO A N    2  
ATOM 3076  C CA   . PRO A 1 57  ? 0.012   5.846   -12.864 1.00 0.00 ? 57  PRO A CA   2  
ATOM 3077  C C    . PRO A 1 57  ? -0.982  6.882   -12.356 1.00 0.00 ? 57  PRO A C    2  
ATOM 3078  O O    . PRO A 1 57  ? -0.903  8.059   -12.709 1.00 0.00 ? 57  PRO A O    2  
ATOM 3079  C CB   . PRO A 1 57  ? -0.079  5.717   -14.387 1.00 0.00 ? 57  PRO A CB   2  
ATOM 3080  C CG   . PRO A 1 57  ? -1.005  4.573   -14.615 1.00 0.00 ? 57  PRO A CG   2  
ATOM 3081  C CD   . PRO A 1 57  ? -0.774  3.619   -13.476 1.00 0.00 ? 57  PRO A CD   2  
ATOM 3082  H HA   . PRO A 1 57  ? 1.014   6.142   -12.586 1.00 0.00 ? 57  PRO A HA   2  
ATOM 3083  H HB2  . PRO A 1 57  ? -0.472  6.634   -14.805 1.00 0.00 ? 57  PRO A HB2  2  
ATOM 3084  H HB3  . PRO A 1 57  ? 0.901   5.520   -14.794 1.00 0.00 ? 57  PRO A HB3  2  
ATOM 3085  H HG2  . PRO A 1 57  ? -2.027  4.921   -14.612 1.00 0.00 ? 57  PRO A HG2  2  
ATOM 3086  H HG3  . PRO A 1 57  ? -0.772  4.095   -15.556 1.00 0.00 ? 57  PRO A HG3  2  
ATOM 3087  H HD2  . PRO A 1 57  ? -1.696  3.129   -13.200 1.00 0.00 ? 57  PRO A HD2  2  
ATOM 3088  H HD3  . PRO A 1 57  ? -0.022  2.891   -13.739 1.00 0.00 ? 57  PRO A HD3  2  
ATOM 3089  N N    . GLY A 1 58  ? -1.920  6.439   -11.524 1.00 0.00 ? 58  GLY A N    2  
ATOM 3090  C CA   . GLY A 1 58  ? -2.917  7.343   -10.980 1.00 0.00 ? 58  GLY A CA   2  
ATOM 3091  C C    . GLY A 1 58  ? -3.463  6.870   -9.647  1.00 0.00 ? 58  GLY A C    2  
ATOM 3092  O O    . GLY A 1 58  ? -4.671  6.702   -9.488  1.00 0.00 ? 58  GLY A O    2  
ATOM 3093  H H    . GLY A 1 58  ? -1.934  5.491   -11.276 1.00 0.00 ? 58  GLY A H    2  
ATOM 3094  H HA2  . GLY A 1 58  ? -2.471  8.317   -10.849 1.00 0.00 ? 58  GLY A HA2  2  
ATOM 3095  H HA3  . GLY A 1 58  ? -3.734  7.423   -11.682 1.00 0.00 ? 58  GLY A HA3  2  
ATOM 3096  N N    . SER A 1 59  ? -2.568  6.653   -8.687  1.00 0.00 ? 59  SER A N    2  
ATOM 3097  C CA   . SER A 1 59  ? -2.968  6.191   -7.362  1.00 0.00 ? 59  SER A CA   2  
ATOM 3098  C C    . SER A 1 59  ? -2.979  7.346   -6.366  1.00 0.00 ? 59  SER A C    2  
ATOM 3099  O O    . SER A 1 59  ? -4.027  7.711   -5.833  1.00 0.00 ? 59  SER A O    2  
ATOM 3100  C CB   . SER A 1 59  ? -2.019  5.092   -6.876  1.00 0.00 ? 59  SER A CB   2  
ATOM 3101  O OG   . SER A 1 59  ? -0.707  5.297   -7.366  1.00 0.00 ? 59  SER A OG   2  
ATOM 3102  H H    . SER A 1 59  ? -1.619  6.805   -8.876  1.00 0.00 ? 59  SER A H    2  
ATOM 3103  H HA   . SER A 1 59  ? -3.965  5.786   -7.439  1.00 0.00 ? 59  SER A HA   2  
ATOM 3104  H HB2  . SER A 1 59  ? -1.993  5.096   -5.797  1.00 0.00 ? 59  SER A HB2  2  
ATOM 3105  H HB3  . SER A 1 59  ? -2.376  4.134   -7.225  1.00 0.00 ? 59  SER A HB3  2  
ATOM 3106  H HG   . SER A 1 59  ? -0.668  5.052   -8.293  1.00 0.00 ? 59  SER A HG   2  
ATOM 3107  N N    . VAL A 1 60  ? -1.805  7.917   -6.118  1.00 0.00 ? 60  VAL A N    2  
ATOM 3108  C CA   . VAL A 1 60  ? -1.679  9.031   -5.186  1.00 0.00 ? 60  VAL A CA   2  
ATOM 3109  C C    . VAL A 1 60  ? -1.580  10.360  -5.927  1.00 0.00 ? 60  VAL A C    2  
ATOM 3110  O O    . VAL A 1 60  ? -0.760  10.537  -6.829  1.00 0.00 ? 60  VAL A O    2  
ATOM 3111  C CB   . VAL A 1 60  ? -0.444  8.868   -4.280  1.00 0.00 ? 60  VAL A CB   2  
ATOM 3112  C CG1  . VAL A 1 60  ? -0.309  10.060  -3.343  1.00 0.00 ? 60  VAL A CG1  2  
ATOM 3113  C CG2  . VAL A 1 60  ? -0.529  7.569   -3.494  1.00 0.00 ? 60  VAL A CG2  2  
ATOM 3114  H H    . VAL A 1 60  ? -1.004  7.583   -6.573  1.00 0.00 ? 60  VAL A H    2  
ATOM 3115  H HA   . VAL A 1 60  ? -2.560  9.045   -4.560  1.00 0.00 ? 60  VAL A HA   2  
ATOM 3116  H HB   . VAL A 1 60  ? 0.434   8.830   -4.907  1.00 0.00 ? 60  VAL A HB   2  
ATOM 3117  H HG11 . VAL A 1 60  ? 0.489   9.873   -2.638  1.00 0.00 ? 60  VAL A HG11 2  
ATOM 3118  H HG12 . VAL A 1 60  ? -0.081  10.945  -3.918  1.00 0.00 ? 60  VAL A HG12 2  
ATOM 3119  H HG13 . VAL A 1 60  ? -1.236  10.205  -2.808  1.00 0.00 ? 60  VAL A HG13 2  
ATOM 3120  H HG21 . VAL A 1 60  ? -0.125  7.720   -2.504  1.00 0.00 ? 60  VAL A HG21 2  
ATOM 3121  H HG22 . VAL A 1 60  ? -1.562  7.260   -3.418  1.00 0.00 ? 60  VAL A HG22 2  
ATOM 3122  H HG23 . VAL A 1 60  ? 0.039   6.804   -4.001  1.00 0.00 ? 60  VAL A HG23 2  
ATOM 3123  N N    . PRO A 1 61  ? -2.434  11.319  -5.541  1.00 0.00 ? 61  PRO A N    2  
ATOM 3124  C CA   . PRO A 1 61  ? -2.462  12.650  -6.156  1.00 0.00 ? 61  PRO A CA   2  
ATOM 3125  C C    . PRO A 1 61  ? -1.226  13.474  -5.809  1.00 0.00 ? 61  PRO A C    2  
ATOM 3126  O O    . PRO A 1 61  ? -0.562  14.017  -6.692  1.00 0.00 ? 61  PRO A O    2  
ATOM 3127  C CB   . PRO A 1 61  ? -3.717  13.291  -5.557  1.00 0.00 ? 61  PRO A CB   2  
ATOM 3128  C CG   . PRO A 1 61  ? -3.920  12.587  -4.260  1.00 0.00 ? 61  PRO A CG   2  
ATOM 3129  C CD   . PRO A 1 61  ? -3.438  11.178  -4.473  1.00 0.00 ? 61  PRO A CD   2  
ATOM 3130  H HA   . PRO A 1 61  ? -2.563  12.588  -7.229  1.00 0.00 ? 61  PRO A HA   2  
ATOM 3131  H HB2  . PRO A 1 61  ? -3.549  14.349  -5.412  1.00 0.00 ? 61  PRO A HB2  2  
ATOM 3132  H HB3  . PRO A 1 61  ? -4.553  13.141  -6.224  1.00 0.00 ? 61  PRO A HB3  2  
ATOM 3133  H HG2  . PRO A 1 61  ? -3.341  13.069  -3.487  1.00 0.00 ? 61  PRO A HG2  2  
ATOM 3134  H HG3  . PRO A 1 61  ? -4.968  12.590  -4.003  1.00 0.00 ? 61  PRO A HG3  2  
ATOM 3135  H HD2  . PRO A 1 61  ? -2.989  10.793  -3.569  1.00 0.00 ? 61  PRO A HD2  2  
ATOM 3136  H HD3  . PRO A 1 61  ? -4.253  10.546  -4.791  1.00 0.00 ? 61  PRO A HD3  2  
ATOM 3137  N N    . LYS A 1 62  ? -0.922  13.563  -4.519  1.00 0.00 ? 62  LYS A N    2  
ATOM 3138  C CA   . LYS A 1 62  ? 0.235   14.318  -4.056  1.00 0.00 ? 62  LYS A CA   2  
ATOM 3139  C C    . LYS A 1 62  ? 0.749   13.767  -2.729  1.00 0.00 ? 62  LYS A C    2  
ATOM 3140  O O    . LYS A 1 62  ? -0.006  13.176  -1.958  1.00 0.00 ? 62  LYS A O    2  
ATOM 3141  C CB   . LYS A 1 62  ? -0.126  15.798  -3.900  1.00 0.00 ? 62  LYS A CB   2  
ATOM 3142  C CG   . LYS A 1 62  ? 1.063   16.732  -4.050  1.00 0.00 ? 62  LYS A CG   2  
ATOM 3143  C CD   . LYS A 1 62  ? 1.731   17.004  -2.712  1.00 0.00 ? 62  LYS A CD   2  
ATOM 3144  C CE   . LYS A 1 62  ? 2.410   18.365  -2.695  1.00 0.00 ? 62  LYS A CE   2  
ATOM 3145  N NZ   . LYS A 1 62  ? 1.438   19.467  -2.455  1.00 0.00 ? 62  LYS A NZ   2  
ATOM 3146  H H    . LYS A 1 62  ? -1.490  13.106  -3.862  1.00 0.00 ? 62  LYS A H    2  
ATOM 3147  H HA   . LYS A 1 62  ? 1.013   14.222  -4.797  1.00 0.00 ? 62  LYS A HA   2  
ATOM 3148  H HB2  . LYS A 1 62  ? -0.858  16.057  -4.649  1.00 0.00 ? 62  LYS A HB2  2  
ATOM 3149  H HB3  . LYS A 1 62  ? -0.555  15.950  -2.920  1.00 0.00 ? 62  LYS A HB3  2  
ATOM 3150  H HG2  . LYS A 1 62  ? 1.784   16.280  -4.715  1.00 0.00 ? 62  LYS A HG2  2  
ATOM 3151  H HG3  . LYS A 1 62  ? 0.721   17.669  -4.469  1.00 0.00 ? 62  LYS A HG3  2  
ATOM 3152  H HD2  . LYS A 1 62  ? 0.982   16.978  -1.934  1.00 0.00 ? 62  LYS A HD2  2  
ATOM 3153  H HD3  . LYS A 1 62  ? 2.471   16.239  -2.528  1.00 0.00 ? 62  LYS A HD3  2  
ATOM 3154  H HE2  . LYS A 1 62  ? 3.152   18.373  -1.911  1.00 0.00 ? 62  LYS A HE2  2  
ATOM 3155  H HE3  . LYS A 1 62  ? 2.893   18.524  -3.649  1.00 0.00 ? 62  LYS A HE3  2  
ATOM 3156  H HZ1  . LYS A 1 62  ? 0.483   19.170  -2.739  1.00 0.00 ? 62  LYS A HZ1  2  
ATOM 3157  H HZ2  . LYS A 1 62  ? 1.706   20.306  -3.006  1.00 0.00 ? 62  LYS A HZ2  2  
ATOM 3158  H HZ3  . LYS A 1 62  ? 1.426   19.718  -1.446  1.00 0.00 ? 62  LYS A HZ3  2  
ATOM 3159  N N    . ILE A 1 63  ? 2.038   13.967  -2.471  1.00 0.00 ? 63  ILE A N    2  
ATOM 3160  C CA   . ILE A 1 63  ? 2.651   13.492  -1.236  1.00 0.00 ? 63  ILE A CA   2  
ATOM 3161  C C    . ILE A 1 63  ? 3.001   14.654  -0.314  1.00 0.00 ? 63  ILE A C    2  
ATOM 3162  O O    . ILE A 1 63  ? 3.682   15.597  -0.718  1.00 0.00 ? 63  ILE A O    2  
ATOM 3163  C CB   . ILE A 1 63  ? 3.924   12.674  -1.519  1.00 0.00 ? 63  ILE A CB   2  
ATOM 3164  C CG1  . ILE A 1 63  ? 3.579   11.404  -2.299  1.00 0.00 ? 63  ILE A CG1  2  
ATOM 3165  C CG2  . ILE A 1 63  ? 4.630   12.326  -0.217  1.00 0.00 ? 63  ILE A CG2  2  
ATOM 3166  C CD1  . ILE A 1 63  ? 4.772   10.766  -2.975  1.00 0.00 ? 63  ILE A CD1  2  
ATOM 3167  H H    . ILE A 1 63  ? 2.588   14.445  -3.125  1.00 0.00 ? 63  ILE A H    2  
ATOM 3168  H HA   . ILE A 1 63  ? 1.940   12.851  -0.736  1.00 0.00 ? 63  ILE A HA   2  
ATOM 3169  H HB   . ILE A 1 63  ? 4.591   13.281  -2.111  1.00 0.00 ? 63  ILE A HB   2  
ATOM 3170  H HG12 . ILE A 1 63  ? 3.153   10.679  -1.625  1.00 0.00 ? 63  ILE A HG12 2  
ATOM 3171  H HG13 . ILE A 1 63  ? 2.854   11.647  -3.064  1.00 0.00 ? 63  ILE A HG13 2  
ATOM 3172  H HG21 . ILE A 1 63  ? 5.246   13.157  0.092   1.00 0.00 ? 63  ILE A HG21 2  
ATOM 3173  H HG22 . ILE A 1 63  ? 3.896   12.121  0.547   1.00 0.00 ? 63  ILE A HG22 2  
ATOM 3174  H HG23 . ILE A 1 63  ? 5.249   11.454  -0.365  1.00 0.00 ? 63  ILE A HG23 2  
ATOM 3175  H HD11 . ILE A 1 63  ? 5.577   11.483  -3.037  1.00 0.00 ? 63  ILE A HD11 2  
ATOM 3176  H HD12 . ILE A 1 63  ? 5.095   9.910   -2.402  1.00 0.00 ? 63  ILE A HD12 2  
ATOM 3177  H HD13 . ILE A 1 63  ? 4.496   10.450  -3.971  1.00 0.00 ? 63  ILE A HD13 2  
ATOM 3178  N N    . ASN A 1 64  ? 2.532   14.580  0.927   1.00 0.00 ? 64  ASN A N    2  
ATOM 3179  C CA   . ASN A 1 64  ? 2.797   15.626  1.909   1.00 0.00 ? 64  ASN A CA   2  
ATOM 3180  C C    . ASN A 1 64  ? 4.146   15.407  2.586   1.00 0.00 ? 64  ASN A C    2  
ATOM 3181  O O    . ASN A 1 64  ? 4.310   14.482  3.383   1.00 0.00 ? 64  ASN A O    2  
ATOM 3182  C CB   . ASN A 1 64  ? 1.686   15.661  2.959   1.00 0.00 ? 64  ASN A CB   2  
ATOM 3183  C CG   . ASN A 1 64  ? 0.330   15.973  2.357   1.00 0.00 ? 64  ASN A CG   2  
ATOM 3184  O OD1  . ASN A 1 64  ? 0.237   16.597  1.299   1.00 0.00 ? 64  ASN A OD1  2  
ATOM 3185  N ND2  . ASN A 1 64  ? -0.731  15.540  3.029   1.00 0.00 ? 64  ASN A ND2  2  
ATOM 3186  H H    . ASN A 1 64  ? 1.995   13.804  1.190   1.00 0.00 ? 64  ASN A H    2  
ATOM 3187  H HA   . ASN A 1 64  ? 2.818   16.572  1.387   1.00 0.00 ? 64  ASN A HA   2  
ATOM 3188  H HB2  . ASN A 1 64  ? 1.628   14.699  3.447   1.00 0.00 ? 64  ASN A HB2  2  
ATOM 3189  H HB3  . ASN A 1 64  ? 1.916   16.419  3.693   1.00 0.00 ? 64  ASN A HB3  2  
ATOM 3190  H HD21 . ASN A 1 64  ? -0.580  15.051  3.865   1.00 0.00 ? 64  ASN A HD21 2  
ATOM 3191  H HD22 . ASN A 1 64  ? -1.620  15.728  2.662   1.00 0.00 ? 64  ASN A HD22 2  
ATOM 3192  N N    . ARG A 1 65  ? 5.110   16.264  2.264   1.00 0.00 ? 65  ARG A N    2  
ATOM 3193  C CA   . ARG A 1 65  ? 6.446   16.164  2.841   1.00 0.00 ? 65  ARG A CA   2  
ATOM 3194  C C    . ARG A 1 65  ? 6.590   17.095  4.041   1.00 0.00 ? 65  ARG A C    2  
ATOM 3195  O O    . ARG A 1 65  ? 7.614   17.758  4.206   1.00 0.00 ? 65  ARG A O    2  
ATOM 3196  C CB   . ARG A 1 65  ? 7.504   16.502  1.790   1.00 0.00 ? 65  ARG A CB   2  
ATOM 3197  C CG   . ARG A 1 65  ? 7.470   15.588  0.576   1.00 0.00 ? 65  ARG A CG   2  
ATOM 3198  C CD   . ARG A 1 65  ? 8.833   15.499  -0.093  1.00 0.00 ? 65  ARG A CD   2  
ATOM 3199  N NE   . ARG A 1 65  ? 8.728   15.130  -1.502  1.00 0.00 ? 65  ARG A NE   2  
ATOM 3200  C CZ   . ARG A 1 65  ? 9.779   14.917  -2.286  1.00 0.00 ? 65  ARG A CZ   2  
ATOM 3201  N NH1  . ARG A 1 65  ? 11.007  15.037  -1.802  1.00 0.00 ? 65  ARG A NH1  2  
ATOM 3202  N NH2  . ARG A 1 65  ? 9.602   14.583  -3.559  1.00 0.00 ? 65  ARG A NH2  2  
ATOM 3203  H H    . ARG A 1 65  ? 4.918   16.980  1.623   1.00 0.00 ? 65  ARG A H    2  
ATOM 3204  H HA   . ARG A 1 65  ? 6.589   15.145  3.170   1.00 0.00 ? 65  ARG A HA   2  
ATOM 3205  H HB2  . ARG A 1 65  ? 7.351   17.516  1.454   1.00 0.00 ? 65  ARG A HB2  2  
ATOM 3206  H HB3  . ARG A 1 65  ? 8.481   16.424  2.243   1.00 0.00 ? 65  ARG A HB3  2  
ATOM 3207  H HG2  . ARG A 1 65  ? 7.170   14.598  0.889   1.00 0.00 ? 65  ARG A HG2  2  
ATOM 3208  H HG3  . ARG A 1 65  ? 6.755   15.976  -0.134  1.00 0.00 ? 65  ARG A HG3  2  
ATOM 3209  H HD2  . ARG A 1 65  ? 9.320   16.460  -0.018  1.00 0.00 ? 65  ARG A HD2  2  
ATOM 3210  H HD3  . ARG A 1 65  ? 9.423   14.756  0.421   1.00 0.00 ? 65  ARG A HD3  2  
ATOM 3211  H HE   . ARG A 1 65  ? 7.829   15.036  -1.881  1.00 0.00 ? 65  ARG A HE   2  
ATOM 3212  H HH11 . ARG A 1 65  ? 11.143  15.287  -0.843  1.00 0.00 ? 65  ARG A HH11 2  
ATOM 3213  H HH12 . ARG A 1 65  ? 11.796  14.874  -2.394  1.00 0.00 ? 65  ARG A HH12 2  
ATOM 3214  H HH21 . ARG A 1 65  ? 8.678   14.493  -3.928  1.00 0.00 ? 65  ARG A HH21 2  
ATOM 3215  H HH22 . ARG A 1 65  ? 10.394  14.425  -4.148  1.00 0.00 ? 65  ARG A HH22 2  
ATOM 3216  N N    . SER A 1 66  ? 5.557   17.138  4.877   1.00 0.00 ? 66  SER A N    2  
ATOM 3217  C CA   . SER A 1 66  ? 5.567   17.991  6.060   1.00 0.00 ? 66  SER A CA   2  
ATOM 3218  C C    . SER A 1 66  ? 5.651   17.153  7.333   1.00 0.00 ? 66  SER A C    2  
ATOM 3219  O O    . SER A 1 66  ? 5.130   16.040  7.392   1.00 0.00 ? 66  SER A O    2  
ATOM 3220  C CB   . SER A 1 66  ? 4.314   18.867  6.094   1.00 0.00 ? 66  SER A CB   2  
ATOM 3221  O OG   . SER A 1 66  ? 4.256   19.719  4.964   1.00 0.00 ? 66  SER A OG   2  
ATOM 3222  H H    . SER A 1 66  ? 4.769   16.586  4.692   1.00 0.00 ? 66  SER A H    2  
ATOM 3223  H HA   . SER A 1 66  ? 6.438   18.626  6.004   1.00 0.00 ? 66  SER A HA   2  
ATOM 3224  H HB2  . SER A 1 66  ? 3.438   18.237  6.101   1.00 0.00 ? 66  SER A HB2  2  
ATOM 3225  H HB3  . SER A 1 66  ? 4.326   19.475  6.988   1.00 0.00 ? 66  SER A HB3  2  
ATOM 3226  H HG   . SER A 1 66  ? 4.506   19.226  4.178   1.00 0.00 ? 66  SER A HG   2  
ATOM 3227  N N    . MET A 1 67  ? 6.311   17.698  8.350   1.00 0.00 ? 67  MET A N    2  
ATOM 3228  C CA   . MET A 1 67  ? 6.462   17.001  9.623   1.00 0.00 ? 67  MET A CA   2  
ATOM 3229  C C    . MET A 1 67  ? 5.254   17.244  10.522  1.00 0.00 ? 67  MET A C    2  
ATOM 3230  O O    . MET A 1 67  ? 5.401   17.492  11.719  1.00 0.00 ? 67  MET A O    2  
ATOM 3231  C CB   . MET A 1 67  ? 7.739   17.459  10.330  1.00 0.00 ? 67  MET A CB   2  
ATOM 3232  C CG   . MET A 1 67  ? 9.012   16.947  9.675   1.00 0.00 ? 67  MET A CG   2  
ATOM 3233  S SD   . MET A 1 67  ? 9.514   17.943  8.260   1.00 0.00 ? 67  MET A SD   2  
ATOM 3234  C CE   . MET A 1 67  ? 11.086  17.185  7.853   1.00 0.00 ? 67  MET A CE   2  
ATOM 3235  H H    . MET A 1 67  ? 6.705   18.588  8.243   1.00 0.00 ? 67  MET A H    2  
ATOM 3236  H HA   . MET A 1 67  ? 6.535   15.945  9.415   1.00 0.00 ? 67  MET A HA   2  
ATOM 3237  H HB2  . MET A 1 67  ? 7.769   18.538  10.330  1.00 0.00 ? 67  MET A HB2  2  
ATOM 3238  H HB3  . MET A 1 67  ? 7.718   17.106  11.350  1.00 0.00 ? 67  MET A HB3  2  
ATOM 3239  H HG2  . MET A 1 67  ? 9.807   16.960  10.406  1.00 0.00 ? 67  MET A HG2  2  
ATOM 3240  H HG3  . MET A 1 67  ? 8.847   15.932  9.344   1.00 0.00 ? 67  MET A HG3  2  
ATOM 3241  H HE1  . MET A 1 67  ? 11.883  17.720  8.349   1.00 0.00 ? 67  MET A HE1  2  
ATOM 3242  H HE2  . MET A 1 67  ? 11.084  16.156  8.179   1.00 0.00 ? 67  MET A HE2  2  
ATOM 3243  H HE3  . MET A 1 67  ? 11.237  17.224  6.784   1.00 0.00 ? 67  MET A HE3  2  
ATOM 3244  N N    . GLN A 1 68  ? 4.062   17.172  9.937   1.00 0.00 ? 68  GLN A N    2  
ATOM 3245  C CA   . GLN A 1 68  ? 2.830   17.386  10.688  1.00 0.00 ? 68  GLN A CA   2  
ATOM 3246  C C    . GLN A 1 68  ? 2.026   16.093  10.793  1.00 0.00 ? 68  GLN A C    2  
ATOM 3247  O O    . GLN A 1 68  ? 2.211   15.170  10.001  1.00 0.00 ? 68  GLN A O    2  
ATOM 3248  C CB   . GLN A 1 68  ? 1.985   18.472  10.022  1.00 0.00 ? 68  GLN A CB   2  
ATOM 3249  C CG   . GLN A 1 68  ? 2.675   19.826  9.958   1.00 0.00 ? 68  GLN A CG   2  
ATOM 3250  C CD   . GLN A 1 68  ? 3.019   20.370  11.330  1.00 0.00 ? 68  GLN A CD   2  
ATOM 3251  O OE1  . GLN A 1 68  ? 2.250   21.127  11.922  1.00 0.00 ? 68  GLN A OE1  2  
ATOM 3252  N NE2  . GLN A 1 68  ? 4.181   19.985  11.845  1.00 0.00 ? 68  GLN A NE2  2  
ATOM 3253  H H    . GLN A 1 68  ? 4.011   16.971  8.981   1.00 0.00 ? 68  GLN A H    2  
ATOM 3254  H HA   . GLN A 1 68  ? 3.099   17.710  11.681  1.00 0.00 ? 68  GLN A HA   2  
ATOM 3255  H HB2  . GLN A 1 68  ? 1.751   18.163  9.013   1.00 0.00 ? 68  GLN A HB2  2  
ATOM 3256  H HB3  . GLN A 1 68  ? 1.065   18.587  10.576  1.00 0.00 ? 68  GLN A HB3  2  
ATOM 3257  H HG2  . GLN A 1 68  ? 3.587   19.725  9.389   1.00 0.00 ? 68  GLN A HG2  2  
ATOM 3258  H HG3  . GLN A 1 68  ? 2.018   20.527  9.464   1.00 0.00 ? 68  GLN A HG3  2  
ATOM 3259  H HE21 . GLN A 1 68  ? 4.743   19.380  11.317  1.00 0.00 ? 68  GLN A HE21 2  
ATOM 3260  H HE22 . GLN A 1 68  ? 4.429   20.321  12.730  1.00 0.00 ? 68  GLN A HE22 2  
ATOM 3261  N N    . ASN A 1 69  ? 1.136   16.035  11.777  1.00 0.00 ? 69  ASN A N    2  
ATOM 3262  C CA   . ASN A 1 69  ? 0.304   14.856  11.987  1.00 0.00 ? 69  ASN A CA   2  
ATOM 3263  C C    . ASN A 1 69  ? -0.716  14.702  10.864  1.00 0.00 ? 69  ASN A C    2  
ATOM 3264  O O    . ASN A 1 69  ? -0.680  13.732  10.107  1.00 0.00 ? 69  ASN A O    2  
ATOM 3265  C CB   . ASN A 1 69  ? -0.414  14.946  13.335  1.00 0.00 ? 69  ASN A CB   2  
ATOM 3266  C CG   . ASN A 1 69  ? 0.459   14.490  14.488  1.00 0.00 ? 69  ASN A CG   2  
ATOM 3267  O OD1  . ASN A 1 69  ? 1.622   14.133  14.297  1.00 0.00 ? 69  ASN A OD1  2  
ATOM 3268  N ND2  . ASN A 1 69  ? -0.098  14.500  15.693  1.00 0.00 ? 69  ASN A ND2  2  
ATOM 3269  H H    . ASN A 1 69  ? 1.034   16.804  12.377  1.00 0.00 ? 69  ASN A H    2  
ATOM 3270  H HA   . ASN A 1 69  ? 0.951   13.992  11.992  1.00 0.00 ? 69  ASN A HA   2  
ATOM 3271  H HB2  . ASN A 1 69  ? -0.706  15.971  13.514  1.00 0.00 ? 69  ASN A HB2  2  
ATOM 3272  H HB3  . ASN A 1 69  ? -1.297  14.325  13.308  1.00 0.00 ? 69  ASN A HB3  2  
ATOM 3273  H HD21 . ASN A 1 69  ? -1.029  14.797  15.770  1.00 0.00 ? 69  ASN A HD21 2  
ATOM 3274  H HD22 . ASN A 1 69  ? 0.444   14.211  16.456  1.00 0.00 ? 69  ASN A HD22 2  
ATOM 3275  N N    . TRP A 1 70  ? -1.625  15.666  10.761  1.00 0.00 ? 70  TRP A N    2  
ATOM 3276  C CA   . TRP A 1 70  ? -2.655  15.638  9.730   1.00 0.00 ? 70  TRP A CA   2  
ATOM 3277  C C    . TRP A 1 70  ? -2.067  15.228  8.384   1.00 0.00 ? 70  TRP A C    2  
ATOM 3278  O O    . TRP A 1 70  ? -2.549  14.295  7.743   1.00 0.00 ? 70  TRP A O    2  
ATOM 3279  C CB   . TRP A 1 70  ? -3.325  17.008  9.611   1.00 0.00 ? 70  TRP A CB   2  
ATOM 3280  C CG   . TRP A 1 70  ? -2.358  18.150  9.696   1.00 0.00 ? 70  TRP A CG   2  
ATOM 3281  C CD1  . TRP A 1 70  ? -1.653  18.706  8.667   1.00 0.00 ? 70  TRP A CD1  2  
ATOM 3282  C CD2  . TRP A 1 70  ? -1.991  18.877  10.874  1.00 0.00 ? 70  TRP A CD2  2  
ATOM 3283  N NE1  . TRP A 1 70  ? -0.868  19.732  9.134   1.00 0.00 ? 70  TRP A NE1  2  
ATOM 3284  C CE2  . TRP A 1 70  ? -1.059  19.859  10.484  1.00 0.00 ? 70  TRP A CE2  2  
ATOM 3285  C CE3  . TRP A 1 70  ? -2.360  18.795  12.219  1.00 0.00 ? 70  TRP A CE3  2  
ATOM 3286  C CZ2  . TRP A 1 70  ? -0.491  20.748  11.392  1.00 0.00 ? 70  TRP A CZ2  2  
ATOM 3287  C CZ3  . TRP A 1 70  ? -1.795  19.679  13.119  1.00 0.00 ? 70  TRP A CZ3  2  
ATOM 3288  C CH2  . TRP A 1 70  ? -0.870  20.645  12.704  1.00 0.00 ? 70  TRP A CH2  2  
ATOM 3289  H H    . TRP A 1 70  ? -1.602  16.414  11.394  1.00 0.00 ? 70  TRP A H    2  
ATOM 3290  H HA   . TRP A 1 70  ? -3.396  14.909  10.022  1.00 0.00 ? 70  TRP A HA   2  
ATOM 3291  H HB2  . TRP A 1 70  ? -3.834  17.073  8.662   1.00 0.00 ? 70  TRP A HB2  2  
ATOM 3292  H HB3  . TRP A 1 70  ? -4.044  17.119  10.410  1.00 0.00 ? 70  TRP A HB3  2  
ATOM 3293  H HD1  . TRP A 1 70  ? -1.711  18.374  7.641   1.00 0.00 ? 70  TRP A HD1  2  
ATOM 3294  H HE1  . TRP A 1 70  ? -0.271  20.285  8.587   1.00 0.00 ? 70  TRP A HE1  2  
ATOM 3295  H HE3  . TRP A 1 70  ? -3.071  18.057  12.560  1.00 0.00 ? 70  TRP A HE3  2  
ATOM 3296  H HZ2  . TRP A 1 70  ? 0.224   21.499  11.087  1.00 0.00 ? 70  TRP A HZ2  2  
ATOM 3297  H HZ3  . TRP A 1 70  ? -2.068  19.630  14.163  1.00 0.00 ? 70  TRP A HZ3  2  
ATOM 3298  H HH2  . TRP A 1 70  ? -0.455  21.314  13.441  1.00 0.00 ? 70  TRP A HH2  2  
ATOM 3299  N N    . HIS A 1 71  ? -1.022  15.933  7.960   1.00 0.00 ? 71  HIS A N    2  
ATOM 3300  C CA   . HIS A 1 71  ? -0.368  15.642  6.689   1.00 0.00 ? 71  HIS A CA   2  
ATOM 3301  C C    . HIS A 1 71  ? 0.015   14.168  6.602   1.00 0.00 ? 71  HIS A C    2  
ATOM 3302  O O    . HIS A 1 71  ? -0.476  13.441  5.739   1.00 0.00 ? 71  HIS A O    2  
ATOM 3303  C CB   . HIS A 1 71  ? 0.876   16.515  6.520   1.00 0.00 ? 71  HIS A CB   2  
ATOM 3304  C CG   . HIS A 1 71  ? 0.586   17.862  5.932   1.00 0.00 ? 71  HIS A CG   2  
ATOM 3305  N ND1  . HIS A 1 71  ? 0.940   19.043  6.549   1.00 0.00 ? 71  HIS A ND1  2  
ATOM 3306  C CD2  . HIS A 1 71  ? -0.026  18.211  4.777   1.00 0.00 ? 71  HIS A CD2  2  
ATOM 3307  C CE1  . HIS A 1 71  ? 0.557   20.061  5.799   1.00 0.00 ? 71  HIS A CE1  2  
ATOM 3308  N NE2  . HIS A 1 71  ? -0.032  19.583  4.718   1.00 0.00 ? 71  HIS A NE2  2  
ATOM 3309  H H    . HIS A 1 71  ? -0.684  16.666  8.515   1.00 0.00 ? 71  HIS A H    2  
ATOM 3310  H HA   . HIS A 1 71  ? -1.066  15.867  5.897   1.00 0.00 ? 71  HIS A HA   2  
ATOM 3311  H HB2  . HIS A 1 71  ? 1.336   16.666  7.485   1.00 0.00 ? 71  HIS A HB2  2  
ATOM 3312  H HB3  . HIS A 1 71  ? 1.575   16.011  5.868   1.00 0.00 ? 71  HIS A HB3  2  
ATOM 3313  H HD1  . HIS A 1 71  ? 1.402   19.124  7.409   1.00 0.00 ? 71  HIS A HD1  2  
ATOM 3314  H HD2  . HIS A 1 71  ? -0.435  17.536  4.038   1.00 0.00 ? 71  HIS A HD2  2  
ATOM 3315  H HE1  . HIS A 1 71  ? 0.700   21.106  6.029   1.00 0.00 ? 71  HIS A HE1  2  
ATOM 3316  H HE2  . HIS A 1 71  ? -0.484  20.122  4.037   1.00 0.00 ? 71  HIS A HE2  2  
ATOM 3317  N N    . GLN A 1 72  ? 0.895   13.735  7.499   1.00 0.00 ? 72  GLN A N    2  
ATOM 3318  C CA   . GLN A 1 72  ? 1.345   12.348  7.521   1.00 0.00 ? 72  GLN A CA   2  
ATOM 3319  C C    . GLN A 1 72  ? 0.172   11.393  7.319   1.00 0.00 ? 72  GLN A C    2  
ATOM 3320  O O    . GLN A 1 72  ? 0.260   10.442  6.541   1.00 0.00 ? 72  GLN A O    2  
ATOM 3321  C CB   . GLN A 1 72  ? 2.048   12.038  8.844   1.00 0.00 ? 72  GLN A CB   2  
ATOM 3322  C CG   . GLN A 1 72  ? 3.449   12.617  8.937   1.00 0.00 ? 72  GLN A CG   2  
ATOM 3323  C CD   . GLN A 1 72  ? 4.147   12.252  10.233  1.00 0.00 ? 72  GLN A CD   2  
ATOM 3324  O OE1  . GLN A 1 72  ? 3.914   11.183  10.797  1.00 0.00 ? 72  GLN A OE1  2  
ATOM 3325  N NE2  . GLN A 1 72  ? 5.007   13.142  10.714  1.00 0.00 ? 72  GLN A NE2  2  
ATOM 3326  H H    . GLN A 1 72  ? 1.250   14.363  8.161   1.00 0.00 ? 72  GLN A H    2  
ATOM 3327  H HA   . GLN A 1 72  ? 2.045   12.214  6.711   1.00 0.00 ? 72  GLN A HA   2  
ATOM 3328  H HB2  . GLN A 1 72  ? 1.459   12.443  9.654   1.00 0.00 ? 72  GLN A HB2  2  
ATOM 3329  H HB3  . GLN A 1 72  ? 2.115   10.966  8.959   1.00 0.00 ? 72  GLN A HB3  2  
ATOM 3330  H HG2  . GLN A 1 72  ? 4.037   12.239  8.113   1.00 0.00 ? 72  GLN A HG2  2  
ATOM 3331  H HG3  . GLN A 1 72  ? 3.387   13.692  8.869   1.00 0.00 ? 72  GLN A HG3  2  
ATOM 3332  H HE21 . GLN A 1 72  ? 5.141   13.974  10.212  1.00 0.00 ? 72  GLN A HE21 2  
ATOM 3333  H HE22 . GLN A 1 72  ? 5.471   12.932  11.550  1.00 0.00 ? 72  GLN A HE22 2  
ATOM 3334  N N    . LEU A 1 73  ? -0.924  11.652  8.023   1.00 0.00 ? 73  LEU A N    2  
ATOM 3335  C CA   . LEU A 1 73  ? -2.114  10.815  7.922   1.00 0.00 ? 73  LEU A CA   2  
ATOM 3336  C C    . LEU A 1 73  ? -2.646  10.795  6.492   1.00 0.00 ? 73  LEU A C    2  
ATOM 3337  O O    . LEU A 1 73  ? -2.854  9.730   5.912   1.00 0.00 ? 73  LEU A O    2  
ATOM 3338  C CB   . LEU A 1 73  ? -3.200  11.319  8.874   1.00 0.00 ? 73  LEU A CB   2  
ATOM 3339  C CG   . LEU A 1 73  ? -3.140  10.782  10.305  1.00 0.00 ? 73  LEU A CG   2  
ATOM 3340  C CD1  . LEU A 1 73  ? -3.231  9.263   10.308  1.00 0.00 ? 73  LEU A CD1  2  
ATOM 3341  C CD2  . LEU A 1 73  ? -1.864  11.242  10.995  1.00 0.00 ? 73  LEU A CD2  2  
ATOM 3342  H H    . LEU A 1 73  ? -0.933  12.423  8.627   1.00 0.00 ? 73  LEU A H    2  
ATOM 3343  H HA   . LEU A 1 73  ? -1.837  9.810   8.204   1.00 0.00 ? 73  LEU A HA   2  
ATOM 3344  H HB2  . LEU A 1 73  ? -3.124  12.395  8.922   1.00 0.00 ? 73  LEU A HB2  2  
ATOM 3345  H HB3  . LEU A 1 73  ? -4.157  11.045  8.457   1.00 0.00 ? 73  LEU A HB3  2  
ATOM 3346  H HG   . LEU A 1 73  ? -3.981  11.168  10.863  1.00 0.00 ? 73  LEU A HG   2  
ATOM 3347  H HD11 . LEU A 1 73  ? -3.243  8.901   9.292   1.00 0.00 ? 73  LEU A HD11 2  
ATOM 3348  H HD12 . LEU A 1 73  ? -4.137  8.959   10.811  1.00 0.00 ? 73  LEU A HD12 2  
ATOM 3349  H HD13 . LEU A 1 73  ? -2.377  8.853   10.827  1.00 0.00 ? 73  LEU A HD13 2  
ATOM 3350  H HD21 . LEU A 1 73  ? -2.001  12.245  11.372  1.00 0.00 ? 73  LEU A HD21 2  
ATOM 3351  H HD22 . LEU A 1 73  ? -1.048  11.234  10.286  1.00 0.00 ? 73  LEU A HD22 2  
ATOM 3352  H HD23 . LEU A 1 73  ? -1.636  10.577  11.813  1.00 0.00 ? 73  LEU A HD23 2  
ATOM 3353  N N    . GLU A 1 74  ? -2.860  11.981  5.929   1.00 0.00 ? 74  GLU A N    2  
ATOM 3354  C CA   . GLU A 1 74  ? -3.366  12.099  4.567   1.00 0.00 ? 74  GLU A CA   2  
ATOM 3355  C C    . GLU A 1 74  ? -2.627  11.149  3.628   1.00 0.00 ? 74  GLU A C    2  
ATOM 3356  O O    . GLU A 1 74  ? -3.238  10.482  2.795   1.00 0.00 ? 74  GLU A O    2  
ATOM 3357  C CB   . GLU A 1 74  ? -3.224  13.539  4.069   1.00 0.00 ? 74  GLU A CB   2  
ATOM 3358  C CG   . GLU A 1 74  ? -3.935  13.801  2.753   1.00 0.00 ? 74  GLU A CG   2  
ATOM 3359  C CD   . GLU A 1 74  ? -5.406  13.435  2.802   1.00 0.00 ? 74  GLU A CD   2  
ATOM 3360  O OE1  . GLU A 1 74  ? -5.739  12.272  2.494   1.00 0.00 ? 74  GLU A OE1  2  
ATOM 3361  O OE2  . GLU A 1 74  ? -6.223  14.313  3.148   1.00 0.00 ? 74  GLU A OE2  2  
ATOM 3362  H H    . GLU A 1 74  ? -2.675  12.794  6.443   1.00 0.00 ? 74  GLU A H    2  
ATOM 3363  H HA   . GLU A 1 74  ? -4.412  11.833  4.578   1.00 0.00 ? 74  GLU A HA   2  
ATOM 3364  H HB2  . GLU A 1 74  ? -3.630  14.206  4.815   1.00 0.00 ? 74  GLU A HB2  2  
ATOM 3365  H HB3  . GLU A 1 74  ? -2.175  13.758  3.937   1.00 0.00 ? 74  GLU A HB3  2  
ATOM 3366  H HG2  . GLU A 1 74  ? -3.848  14.850  2.514   1.00 0.00 ? 74  GLU A HG2  2  
ATOM 3367  H HG3  . GLU A 1 74  ? -3.459  13.216  1.978   1.00 0.00 ? 74  GLU A HG3  2  
ATOM 3368  N N    . ASN A 1 75  ? -1.307  11.096  3.770   1.00 0.00 ? 75  ASN A N    2  
ATOM 3369  C CA   . ASN A 1 75  ? -0.483  10.229  2.934   1.00 0.00 ? 75  ASN A CA   2  
ATOM 3370  C C    . ASN A 1 75  ? -1.048  8.812   2.897   1.00 0.00 ? 75  ASN A C    2  
ATOM 3371  O O    . ASN A 1 75  ? -1.345  8.279   1.826   1.00 0.00 ? 75  ASN A O    2  
ATOM 3372  C CB   . ASN A 1 75  ? 0.956   10.202  3.454   1.00 0.00 ? 75  ASN A CB   2  
ATOM 3373  C CG   . ASN A 1 75  ? 1.662   11.531  3.270   1.00 0.00 ? 75  ASN A CG   2  
ATOM 3374  O OD1  . ASN A 1 75  ? 1.242   12.364  2.467   1.00 0.00 ? 75  ASN A OD1  2  
ATOM 3375  N ND2  . ASN A 1 75  ? 2.743   11.736  4.013   1.00 0.00 ? 75  ASN A ND2  2  
ATOM 3376  H H    . ASN A 1 75  ? -0.876  11.651  4.452   1.00 0.00 ? 75  ASN A H    2  
ATOM 3377  H HA   . ASN A 1 75  ? -0.487  10.633  1.933   1.00 0.00 ? 75  ASN A HA   2  
ATOM 3378  H HB2  . ASN A 1 75  ? 0.947   9.965   4.508   1.00 0.00 ? 75  ASN A HB2  2  
ATOM 3379  H HB3  . ASN A 1 75  ? 1.510   9.443   2.923   1.00 0.00 ? 75  ASN A HB3  2  
ATOM 3380  H HD21 . ASN A 1 75  ? 3.020   11.027  4.632   1.00 0.00 ? 75  ASN A HD21 2  
ATOM 3381  H HD22 . ASN A 1 75  ? 3.219   12.586  3.915   1.00 0.00 ? 75  ASN A HD22 2  
ATOM 3382  N N    . LEU A 1 76  ? -1.195  8.208   4.070   1.00 0.00 ? 76  LEU A N    2  
ATOM 3383  C CA   . LEU A 1 76  ? -1.726  6.853   4.172   1.00 0.00 ? 76  LEU A CA   2  
ATOM 3384  C C    . LEU A 1 76  ? -3.152  6.785   3.638   1.00 0.00 ? 76  LEU A C    2  
ATOM 3385  O O    . LEU A 1 76  ? -3.468  5.956   2.785   1.00 0.00 ? 76  LEU A O    2  
ATOM 3386  C CB   . LEU A 1 76  ? -1.691  6.379   5.626   1.00 0.00 ? 76  LEU A CB   2  
ATOM 3387  C CG   . LEU A 1 76  ? -0.305  6.282   6.267   1.00 0.00 ? 76  LEU A CG   2  
ATOM 3388  C CD1  . LEU A 1 76  ? -0.412  5.753   7.689   1.00 0.00 ? 76  LEU A CD1  2  
ATOM 3389  C CD2  . LEU A 1 76  ? 0.607   5.397   5.432   1.00 0.00 ? 76  LEU A CD2  2  
ATOM 3390  H H    . LEU A 1 76  ? -0.941  8.684   4.887   1.00 0.00 ? 76  LEU A H    2  
ATOM 3391  H HA   . LEU A 1 76  ? -1.100  6.207   3.576   1.00 0.00 ? 76  LEU A HA   2  
ATOM 3392  H HB2  . LEU A 1 76  ? -2.279  7.067   6.213   1.00 0.00 ? 76  LEU A HB2  2  
ATOM 3393  H HB3  . LEU A 1 76  ? -2.144  5.399   5.664   1.00 0.00 ? 76  LEU A HB3  2  
ATOM 3394  H HG   . LEU A 1 76  ? 0.134   7.269   6.311   1.00 0.00 ? 76  LEU A HG   2  
ATOM 3395  H HD11 . LEU A 1 76  ? -0.448  4.674   7.669   1.00 0.00 ? 76  LEU A HD11 2  
ATOM 3396  H HD12 . LEU A 1 76  ? -1.310  6.135   8.150   1.00 0.00 ? 76  LEU A HD12 2  
ATOM 3397  H HD13 . LEU A 1 76  ? 0.449   6.074   8.257   1.00 0.00 ? 76  LEU A HD13 2  
ATOM 3398  H HD21 . LEU A 1 76  ? 1.021   4.618   6.057   1.00 0.00 ? 76  LEU A HD21 2  
ATOM 3399  H HD22 . LEU A 1 76  ? 1.409   5.992   5.022   1.00 0.00 ? 76  LEU A HD22 2  
ATOM 3400  H HD23 . LEU A 1 76  ? 0.041   4.950   4.629   1.00 0.00 ? 76  LEU A HD23 2  
ATOM 3401  N N    . SER A 1 77  ? -4.012  7.665   4.144   1.00 0.00 ? 77  SER A N    2  
ATOM 3402  C CA   . SER A 1 77  ? -5.406  7.704   3.719   1.00 0.00 ? 77  SER A CA   2  
ATOM 3403  C C    . SER A 1 77  ? -5.509  7.724   2.197   1.00 0.00 ? 77  SER A C    2  
ATOM 3404  O O    . SER A 1 77  ? -6.411  7.120   1.618   1.00 0.00 ? 77  SER A O    2  
ATOM 3405  C CB   . SER A 1 77  ? -6.105  8.933   4.304   1.00 0.00 ? 77  SER A CB   2  
ATOM 3406  O OG   . SER A 1 77  ? -7.484  8.684   4.510   1.00 0.00 ? 77  SER A OG   2  
ATOM 3407  H H    . SER A 1 77  ? -3.700  8.301   4.822   1.00 0.00 ? 77  SER A H    2  
ATOM 3408  H HA   . SER A 1 77  ? -5.891  6.814   4.090   1.00 0.00 ? 77  SER A HA   2  
ATOM 3409  H HB2  . SER A 1 77  ? -5.652  9.185   5.251   1.00 0.00 ? 77  SER A HB2  2  
ATOM 3410  H HB3  . SER A 1 77  ? -5.999  9.764   3.622   1.00 0.00 ? 77  SER A HB3  2  
ATOM 3411  H HG   . SER A 1 77  ? -7.962  8.829   3.690   1.00 0.00 ? 77  SER A HG   2  
ATOM 3412  N N    . ASN A 1 78  ? -4.578  8.421   1.556   1.00 0.00 ? 78  ASN A N    2  
ATOM 3413  C CA   . ASN A 1 78  ? -4.563  8.520   0.100   1.00 0.00 ? 78  ASN A CA   2  
ATOM 3414  C C    . ASN A 1 78  ? -4.087  7.214   -0.529  1.00 0.00 ? 78  ASN A C    2  
ATOM 3415  O O    . ASN A 1 78  ? -4.656  6.745   -1.515  1.00 0.00 ? 78  ASN A O    2  
ATOM 3416  C CB   . ASN A 1 78  ? -3.659  9.672   -0.344  1.00 0.00 ? 78  ASN A CB   2  
ATOM 3417  C CG   . ASN A 1 78  ? -4.299  11.029  -0.118  1.00 0.00 ? 78  ASN A CG   2  
ATOM 3418  O OD1  . ASN A 1 78  ? -5.522  11.146  -0.046  1.00 0.00 ? 78  ASN A OD1  2  
ATOM 3419  N ND2  . ASN A 1 78  ? -3.471  12.061  -0.007  1.00 0.00 ? 78  ASN A ND2  2  
ATOM 3420  H H    . ASN A 1 78  ? -3.883  8.881   2.072   1.00 0.00 ? 78  ASN A H    2  
ATOM 3421  H HA   . ASN A 1 78  ? -5.572  8.718   -0.228  1.00 0.00 ? 78  ASN A HA   2  
ATOM 3422  H HB2  . ASN A 1 78  ? -2.736  9.633   0.215   1.00 0.00 ? 78  ASN A HB2  2  
ATOM 3423  H HB3  . ASN A 1 78  ? -3.443  9.567   -1.396  1.00 0.00 ? 78  ASN A HB3  2  
ATOM 3424  H HD21 . ASN A 1 78  ? -2.508  11.893  -0.075  1.00 0.00 ? 78  ASN A HD21 2  
ATOM 3425  H HD22 . ASN A 1 78  ? -3.858  12.950  0.140   1.00 0.00 ? 78  ASN A HD22 2  
ATOM 3426  N N    . PHE A 1 79  ? -3.042  6.631   0.049   1.00 0.00 ? 79  PHE A N    2  
ATOM 3427  C CA   . PHE A 1 79  ? -2.489  5.380   -0.456  1.00 0.00 ? 79  PHE A CA   2  
ATOM 3428  C C    . PHE A 1 79  ? -3.499  4.245   -0.318  1.00 0.00 ? 79  PHE A C    2  
ATOM 3429  O O    . PHE A 1 79  ? -3.597  3.377   -1.186  1.00 0.00 ? 79  PHE A O    2  
ATOM 3430  C CB   . PHE A 1 79  ? -1.203  5.027   0.295   1.00 0.00 ? 79  PHE A CB   2  
ATOM 3431  C CG   . PHE A 1 79  ? -0.778  3.597   0.117   1.00 0.00 ? 79  PHE A CG   2  
ATOM 3432  C CD1  . PHE A 1 79  ? -0.589  3.070   -1.151  1.00 0.00 ? 79  PHE A CD1  2  
ATOM 3433  C CD2  . PHE A 1 79  ? -0.566  2.781   1.215   1.00 0.00 ? 79  PHE A CD2  2  
ATOM 3434  C CE1  . PHE A 1 79  ? -0.200  1.755   -1.319  1.00 0.00 ? 79  PHE A CE1  2  
ATOM 3435  C CE2  . PHE A 1 79  ? -0.176  1.465   1.054   1.00 0.00 ? 79  PHE A CE2  2  
ATOM 3436  C CZ   . PHE A 1 79  ? 0.009   0.951   -0.215  1.00 0.00 ? 79  PHE A CZ   2  
ATOM 3437  H H    . PHE A 1 79  ? -2.632  7.054   0.832   1.00 0.00 ? 79  PHE A H    2  
ATOM 3438  H HA   . PHE A 1 79  ? -2.260  5.517   -1.500  1.00 0.00 ? 79  PHE A HA   2  
ATOM 3439  H HB2  . PHE A 1 79  ? -0.402  5.657   -0.062  1.00 0.00 ? 79  PHE A HB2  2  
ATOM 3440  H HB3  . PHE A 1 79  ? -1.351  5.201   1.350   1.00 0.00 ? 79  PHE A HB3  2  
ATOM 3441  H HD1  . PHE A 1 79  ? -0.751  3.697   -2.016  1.00 0.00 ? 79  PHE A HD1  2  
ATOM 3442  H HD2  . PHE A 1 79  ? -0.710  3.181   2.209   1.00 0.00 ? 79  PHE A HD2  2  
ATOM 3443  H HE1  . PHE A 1 79  ? -0.055  1.356   -2.312  1.00 0.00 ? 79  PHE A HE1  2  
ATOM 3444  H HE2  . PHE A 1 79  ? -0.013  0.840   1.920   1.00 0.00 ? 79  PHE A HE2  2  
ATOM 3445  H HZ   . PHE A 1 79  ? 0.314   -0.076  -0.343  1.00 0.00 ? 79  PHE A HZ   2  
ATOM 3446  N N    . ILE A 1 80  ? -4.249  4.258   0.779   1.00 0.00 ? 80  ILE A N    2  
ATOM 3447  C CA   . ILE A 1 80  ? -5.253  3.230   1.031   1.00 0.00 ? 80  ILE A CA   2  
ATOM 3448  C C    . ILE A 1 80  ? -6.305  3.209   -0.073  1.00 0.00 ? 80  ILE A C    2  
ATOM 3449  O O    . ILE A 1 80  ? -6.444  2.221   -0.794  1.00 0.00 ? 80  ILE A O    2  
ATOM 3450  C CB   . ILE A 1 80  ? -5.950  3.445   2.387   1.00 0.00 ? 80  ILE A CB   2  
ATOM 3451  C CG1  . ILE A 1 80  ? -4.972  3.189   3.535   1.00 0.00 ? 80  ILE A CG1  2  
ATOM 3452  C CG2  . ILE A 1 80  ? -7.165  2.538   2.507   1.00 0.00 ? 80  ILE A CG2  2  
ATOM 3453  C CD1  . ILE A 1 80  ? -5.401  3.812   4.845   1.00 0.00 ? 80  ILE A CD1  2  
ATOM 3454  H H    . ILE A 1 80  ? -4.125  4.976   1.434   1.00 0.00 ? 80  ILE A H    2  
ATOM 3455  H HA   . ILE A 1 80  ? -4.751  2.274   1.054   1.00 0.00 ? 80  ILE A HA   2  
ATOM 3456  H HB   . ILE A 1 80  ? -6.290  4.468   2.434   1.00 0.00 ? 80  ILE A HB   2  
ATOM 3457  H HG12 . ILE A 1 80  ? -4.878  2.126   3.689   1.00 0.00 ? 80  ILE A HG12 2  
ATOM 3458  H HG13 . ILE A 1 80  ? -4.007  3.598   3.273   1.00 0.00 ? 80  ILE A HG13 2  
ATOM 3459  H HG21 . ILE A 1 80  ? -7.924  2.859   1.809   1.00 0.00 ? 80  ILE A HG21 2  
ATOM 3460  H HG22 . ILE A 1 80  ? -6.879  1.521   2.283   1.00 0.00 ? 80  ILE A HG22 2  
ATOM 3461  H HG23 . ILE A 1 80  ? -7.555  2.589   3.512   1.00 0.00 ? 80  ILE A HG23 2  
ATOM 3462  H HD11 . ILE A 1 80  ? -4.887  3.325   5.661   1.00 0.00 ? 80  ILE A HD11 2  
ATOM 3463  H HD12 . ILE A 1 80  ? -5.158  4.863   4.842   1.00 0.00 ? 80  ILE A HD12 2  
ATOM 3464  H HD13 . ILE A 1 80  ? -6.468  3.689   4.969   1.00 0.00 ? 80  ILE A HD13 2  
ATOM 3465  N N    . LYS A 1 81  ? -7.044  4.305   -0.199  1.00 0.00 ? 81  LYS A N    2  
ATOM 3466  C CA   . LYS A 1 81  ? -8.084  4.415   -1.216  1.00 0.00 ? 81  LYS A CA   2  
ATOM 3467  C C    . LYS A 1 81  ? -7.544  4.025   -2.588  1.00 0.00 ? 81  LYS A C    2  
ATOM 3468  O O    . LYS A 1 81  ? -8.288  3.544   -3.444  1.00 0.00 ? 81  LYS A O    2  
ATOM 3469  C CB   . LYS A 1 81  ? -8.635  5.842   -1.260  1.00 0.00 ? 81  LYS A CB   2  
ATOM 3470  C CG   . LYS A 1 81  ? -7.621  6.872   -1.730  1.00 0.00 ? 81  LYS A CG   2  
ATOM 3471  C CD   . LYS A 1 81  ? -8.302  8.100   -2.307  1.00 0.00 ? 81  LYS A CD   2  
ATOM 3472  C CE   . LYS A 1 81  ? -7.287  9.139   -2.759  1.00 0.00 ? 81  LYS A CE   2  
ATOM 3473  N NZ   . LYS A 1 81  ? -6.587  8.726   -4.006  1.00 0.00 ? 81  LYS A NZ   2  
ATOM 3474  H H    . LYS A 1 81  ? -6.886  5.061   0.406   1.00 0.00 ? 81  LYS A H    2  
ATOM 3475  H HA   . LYS A 1 81  ? -8.881  3.738   -0.950  1.00 0.00 ? 81  LYS A HA   2  
ATOM 3476  H HB2  . LYS A 1 81  ? -9.481  5.868   -1.930  1.00 0.00 ? 81  LYS A HB2  2  
ATOM 3477  H HB3  . LYS A 1 81  ? -8.963  6.118   -0.268  1.00 0.00 ? 81  LYS A HB3  2  
ATOM 3478  H HG2  . LYS A 1 81  ? -7.011  7.172   -0.890  1.00 0.00 ? 81  LYS A HG2  2  
ATOM 3479  H HG3  . LYS A 1 81  ? -6.996  6.426   -2.490  1.00 0.00 ? 81  LYS A HG3  2  
ATOM 3480  H HD2  . LYS A 1 81  ? -8.900  7.805   -3.156  1.00 0.00 ? 81  LYS A HD2  2  
ATOM 3481  H HD3  . LYS A 1 81  ? -8.940  8.538   -1.551  1.00 0.00 ? 81  LYS A HD3  2  
ATOM 3482  H HE2  . LYS A 1 81  ? -7.802  10.072  -2.937  1.00 0.00 ? 81  LYS A HE2  2  
ATOM 3483  H HE3  . LYS A 1 81  ? -6.558  9.275   -1.974  1.00 0.00 ? 81  LYS A HE3  2  
ATOM 3484  H HZ1  . LYS A 1 81  ? -5.627  8.394   -3.783  1.00 0.00 ? 81  LYS A HZ1  2  
ATOM 3485  H HZ2  . LYS A 1 81  ? -6.520  9.530   -4.661  1.00 0.00 ? 81  LYS A HZ2  2  
ATOM 3486  H HZ3  . LYS A 1 81  ? -7.109  7.956   -4.470  1.00 0.00 ? 81  LYS A HZ3  2  
ATOM 3487  N N    . ALA A 1 82  ? -6.248  4.234   -2.791  1.00 0.00 ? 82  ALA A N    2  
ATOM 3488  C CA   . ALA A 1 82  ? -5.609  3.901   -4.059  1.00 0.00 ? 82  ALA A CA   2  
ATOM 3489  C C    . ALA A 1 82  ? -5.613  2.395   -4.296  1.00 0.00 ? 82  ALA A C    2  
ATOM 3490  O O    . ALA A 1 82  ? -5.910  1.931   -5.397  1.00 0.00 ? 82  ALA A O    2  
ATOM 3491  C CB   . ALA A 1 82  ? -4.186  4.439   -4.090  1.00 0.00 ? 82  ALA A CB   2  
ATOM 3492  H H    . ALA A 1 82  ? -5.707  4.620   -2.071  1.00 0.00 ? 82  ALA A H    2  
ATOM 3493  H HA   . ALA A 1 82  ? -6.168  4.381   -4.850  1.00 0.00 ? 82  ALA A HA   2  
ATOM 3494  H HB1  . ALA A 1 82  ? -3.510  3.646   -4.378  1.00 0.00 ? 82  ALA A HB1  2  
ATOM 3495  H HB2  . ALA A 1 82  ? -4.123  5.244   -4.806  1.00 0.00 ? 82  ALA A HB2  2  
ATOM 3496  H HB3  . ALA A 1 82  ? -3.918  4.805   -3.111  1.00 0.00 ? 82  ALA A HB3  2  
ATOM 3497  N N    . MET A 1 83  ? -5.282  1.635   -3.256  1.00 0.00 ? 83  MET A N    2  
ATOM 3498  C CA   . MET A 1 83  ? -5.248  0.181   -3.353  1.00 0.00 ? 83  MET A CA   2  
ATOM 3499  C C    . MET A 1 83  ? -6.600  -0.366  -3.798  1.00 0.00 ? 83  MET A C    2  
ATOM 3500  O O    . MET A 1 83  ? -6.679  -1.189  -4.710  1.00 0.00 ? 83  MET A O    2  
ATOM 3501  C CB   . MET A 1 83  ? -4.853  -0.432  -2.008  1.00 0.00 ? 83  MET A CB   2  
ATOM 3502  C CG   . MET A 1 83  ? -3.360  -0.369  -1.726  1.00 0.00 ? 83  MET A CG   2  
ATOM 3503  S SD   . MET A 1 83  ? -2.863  -1.455  -0.374  1.00 0.00 ? 83  MET A SD   2  
ATOM 3504  C CE   . MET A 1 83  ? -3.436  -0.516  1.040   1.00 0.00 ? 83  MET A CE   2  
ATOM 3505  H H    . MET A 1 83  ? -5.055  2.063   -2.404  1.00 0.00 ? 83  MET A H    2  
ATOM 3506  H HA   . MET A 1 83  ? -4.505  -0.085  -4.091  1.00 0.00 ? 83  MET A HA   2  
ATOM 3507  H HB2  . MET A 1 83  ? -5.369  0.097   -1.221  1.00 0.00 ? 83  MET A HB2  2  
ATOM 3508  H HB3  . MET A 1 83  ? -5.157  -1.468  -1.994  1.00 0.00 ? 83  MET A HB3  2  
ATOM 3509  H HG2  . MET A 1 83  ? -2.827  -0.662  -2.617  1.00 0.00 ? 83  MET A HG2  2  
ATOM 3510  H HG3  . MET A 1 83  ? -3.099  0.646   -1.470  1.00 0.00 ? 83  MET A HG3  2  
ATOM 3511  H HE1  . MET A 1 83  ? -4.291  0.079   0.756   1.00 0.00 ? 83  MET A HE1  2  
ATOM 3512  H HE2  . MET A 1 83  ? -3.716  -1.194  1.832   1.00 0.00 ? 83  MET A HE2  2  
ATOM 3513  H HE3  . MET A 1 83  ? -2.644  0.134   1.385   1.00 0.00 ? 83  MET A HE3  2  
ATOM 3514  N N    . VAL A 1 84  ? -7.663  0.095   -3.145  1.00 0.00 ? 84  VAL A N    2  
ATOM 3515  C CA   . VAL A 1 84  ? -9.013  -0.348  -3.473  1.00 0.00 ? 84  VAL A CA   2  
ATOM 3516  C C    . VAL A 1 84  ? -9.264  -0.278  -4.976  1.00 0.00 ? 84  VAL A C    2  
ATOM 3517  O O    . VAL A 1 84  ? -9.927  -1.145  -5.546  1.00 0.00 ? 84  VAL A O    2  
ATOM 3518  C CB   . VAL A 1 84  ? -10.075 0.499   -2.747  1.00 0.00 ? 84  VAL A CB   2  
ATOM 3519  C CG1  . VAL A 1 84  ? -11.474 0.064   -3.151  1.00 0.00 ? 84  VAL A CG1  2  
ATOM 3520  C CG2  . VAL A 1 84  ? -9.892  0.403   -1.240  1.00 0.00 ? 84  VAL A CG2  2  
ATOM 3521  H H    . VAL A 1 84  ? -7.536  0.749   -2.428  1.00 0.00 ? 84  VAL A H    2  
ATOM 3522  H HA   . VAL A 1 84  ? -9.117  -1.373  -3.148  1.00 0.00 ? 84  VAL A HA   2  
ATOM 3523  H HB   . VAL A 1 84  ? -9.944  1.531   -3.039  1.00 0.00 ? 84  VAL A HB   2  
ATOM 3524  H HG11 . VAL A 1 84  ? -11.432 -0.921  -3.590  1.00 0.00 ? 84  VAL A HG11 2  
ATOM 3525  H HG12 . VAL A 1 84  ? -12.111 0.044   -2.279  1.00 0.00 ? 84  VAL A HG12 2  
ATOM 3526  H HG13 . VAL A 1 84  ? -11.873 0.762   -3.873  1.00 0.00 ? 84  VAL A HG13 2  
ATOM 3527  H HG21 . VAL A 1 84  ? -9.311  -0.475  -1.004  1.00 0.00 ? 84  VAL A HG21 2  
ATOM 3528  H HG22 . VAL A 1 84  ? -9.375  1.282   -0.882  1.00 0.00 ? 84  VAL A HG22 2  
ATOM 3529  H HG23 . VAL A 1 84  ? -10.858 0.336   -0.763  1.00 0.00 ? 84  VAL A HG23 2  
ATOM 3530  N N    . SER A 1 85  ? -8.730  0.760   -5.612  1.00 0.00 ? 85  SER A N    2  
ATOM 3531  C CA   . SER A 1 85  ? -8.899  0.946   -7.048  1.00 0.00 ? 85  SER A CA   2  
ATOM 3532  C C    . SER A 1 85  ? -8.097  -0.093  -7.828  1.00 0.00 ? 85  SER A C    2  
ATOM 3533  O O    . SER A 1 85  ? -8.579  -0.657  -8.811  1.00 0.00 ? 85  SER A O    2  
ATOM 3534  C CB   . SER A 1 85  ? -8.465  2.354   -7.456  1.00 0.00 ? 85  SER A CB   2  
ATOM 3535  O OG   . SER A 1 85  ? -8.618  2.551   -8.851  1.00 0.00 ? 85  SER A OG   2  
ATOM 3536  H H    . SER A 1 85  ? -8.213  1.418   -5.102  1.00 0.00 ? 85  SER A H    2  
ATOM 3537  H HA   . SER A 1 85  ? -9.947  0.820   -7.278  1.00 0.00 ? 85  SER A HA   2  
ATOM 3538  H HB2  . SER A 1 85  ? -9.069  3.080   -6.934  1.00 0.00 ? 85  SER A HB2  2  
ATOM 3539  H HB3  . SER A 1 85  ? -7.425  2.497   -7.196  1.00 0.00 ? 85  SER A HB3  2  
ATOM 3540  H HG   . SER A 1 85  ? -9.461  2.976   -9.024  1.00 0.00 ? 85  SER A HG   2  
ATOM 3541  N N    . TYR A 1 86  ? -6.870  -0.339  -7.383  1.00 0.00 ? 86  TYR A N    2  
ATOM 3542  C CA   . TYR A 1 86  ? -6.000  -1.307  -8.039  1.00 0.00 ? 86  TYR A CA   2  
ATOM 3543  C C    . TYR A 1 86  ? -6.710  -2.645  -8.220  1.00 0.00 ? 86  TYR A C    2  
ATOM 3544  O O    . TYR A 1 86  ? -6.565  -3.304  -9.248  1.00 0.00 ? 86  TYR A O    2  
ATOM 3545  C CB   . TYR A 1 86  ? -4.718  -1.503  -7.227  1.00 0.00 ? 86  TYR A CB   2  
ATOM 3546  C CG   . TYR A 1 86  ? -3.556  -2.018  -8.047  1.00 0.00 ? 86  TYR A CG   2  
ATOM 3547  C CD1  . TYR A 1 86  ? -3.066  -1.294  -9.126  1.00 0.00 ? 86  TYR A CD1  2  
ATOM 3548  C CD2  . TYR A 1 86  ? -2.947  -3.229  -7.741  1.00 0.00 ? 86  TYR A CD2  2  
ATOM 3549  C CE1  . TYR A 1 86  ? -2.005  -1.760  -9.879  1.00 0.00 ? 86  TYR A CE1  2  
ATOM 3550  C CE2  . TYR A 1 86  ? -1.885  -3.703  -8.487  1.00 0.00 ? 86  TYR A CE2  2  
ATOM 3551  C CZ   . TYR A 1 86  ? -1.417  -2.965  -9.554  1.00 0.00 ? 86  TYR A CZ   2  
ATOM 3552  O OH   . TYR A 1 86  ? -0.360  -3.434  -10.299 1.00 0.00 ? 86  TYR A OH   2  
ATOM 3553  H H    . TYR A 1 86  ? -6.542  0.142   -6.595  1.00 0.00 ? 86  TYR A H    2  
ATOM 3554  H HA   . TYR A 1 86  ? -5.741  -0.916  -9.012  1.00 0.00 ? 86  TYR A HA   2  
ATOM 3555  H HB2  . TYR A 1 86  ? -4.425  -0.559  -6.795  1.00 0.00 ? 86  TYR A HB2  2  
ATOM 3556  H HB3  . TYR A 1 86  ? -4.906  -2.214  -6.435  1.00 0.00 ? 86  TYR A HB3  2  
ATOM 3557  H HD1  . TYR A 1 86  ? -3.529  -0.350  -9.378  1.00 0.00 ? 86  TYR A HD1  2  
ATOM 3558  H HD2  . TYR A 1 86  ? -3.316  -3.805  -6.905  1.00 0.00 ? 86  TYR A HD2  2  
ATOM 3559  H HE1  . TYR A 1 86  ? -1.639  -1.183  -10.714 1.00 0.00 ? 86  TYR A HE1  2  
ATOM 3560  H HE2  . TYR A 1 86  ? -1.425  -4.647  -8.233  1.00 0.00 ? 86  TYR A HE2  2  
ATOM 3561  H HH   . TYR A 1 86  ? -0.690  -3.827  -11.111 1.00 0.00 ? 86  TYR A HH   2  
ATOM 3562  N N    . GLY A 1 87  ? -7.480  -3.040  -7.210  1.00 0.00 ? 87  GLY A N    2  
ATOM 3563  C CA   . GLY A 1 87  ? -8.203  -4.297  -7.276  1.00 0.00 ? 87  GLY A CA   2  
ATOM 3564  C C    . GLY A 1 87  ? -7.932  -5.186  -6.079  1.00 0.00 ? 87  GLY A C    2  
ATOM 3565  O O    . GLY A 1 87  ? -7.837  -6.405  -6.212  1.00 0.00 ? 87  GLY A O    2  
ATOM 3566  H H    . GLY A 1 87  ? -7.558  -2.473  -6.414  1.00 0.00 ? 87  GLY A H    2  
ATOM 3567  H HA2  . GLY A 1 87  ? -9.262  -4.088  -7.323  1.00 0.00 ? 87  GLY A HA2  2  
ATOM 3568  H HA3  . GLY A 1 87  ? -7.908  -4.821  -8.173  1.00 0.00 ? 87  GLY A HA3  2  
ATOM 3569  N N    . MET A 1 88  ? -7.803  -4.573  -4.906  1.00 0.00 ? 88  MET A N    2  
ATOM 3570  C CA   . MET A 1 88  ? -7.539  -5.318  -3.680  1.00 0.00 ? 88  MET A CA   2  
ATOM 3571  C C    . MET A 1 88  ? -8.831  -5.569  -2.908  1.00 0.00 ? 88  MET A C    2  
ATOM 3572  O O    . MET A 1 88  ? -9.839  -4.902  -3.136  1.00 0.00 ? 88  MET A O    2  
ATOM 3573  C CB   . MET A 1 88  ? -6.544  -4.559  -2.801  1.00 0.00 ? 88  MET A CB   2  
ATOM 3574  C CG   . MET A 1 88  ? -5.245  -4.215  -3.511  1.00 0.00 ? 88  MET A CG   2  
ATOM 3575  S SD   . MET A 1 88  ? -3.923  -3.775  -2.366  1.00 0.00 ? 88  MET A SD   2  
ATOM 3576  C CE   . MET A 1 88  ? -3.459  -5.391  -1.748  1.00 0.00 ? 88  MET A CE   2  
ATOM 3577  H H    . MET A 1 88  ? -7.888  -3.598  -4.863  1.00 0.00 ? 88  MET A H    2  
ATOM 3578  H HA   . MET A 1 88  ? -7.108  -6.269  -3.957  1.00 0.00 ? 88  MET A HA   2  
ATOM 3579  H HB2  . MET A 1 88  ? -7.003  -3.639  -2.471  1.00 0.00 ? 88  MET A HB2  2  
ATOM 3580  H HB3  . MET A 1 88  ? -6.308  -5.164  -1.939  1.00 0.00 ? 88  MET A HB3  2  
ATOM 3581  H HG2  . MET A 1 88  ? -4.929  -5.069  -4.091  1.00 0.00 ? 88  MET A HG2  2  
ATOM 3582  H HG3  . MET A 1 88  ? -5.422  -3.379  -4.172  1.00 0.00 ? 88  MET A HG3  2  
ATOM 3583  H HE1  . MET A 1 88  ? -3.623  -6.131  -2.516  1.00 0.00 ? 88  MET A HE1  2  
ATOM 3584  H HE2  . MET A 1 88  ? -2.415  -5.384  -1.472  1.00 0.00 ? 88  MET A HE2  2  
ATOM 3585  H HE3  . MET A 1 88  ? -4.059  -5.631  -0.882  1.00 0.00 ? 88  MET A HE3  2  
ATOM 3586  N N    . ASN A 1 89  ? -8.791  -6.534  -1.995  1.00 0.00 ? 89  ASN A N    2  
ATOM 3587  C CA   . ASN A 1 89  ? -9.959  -6.872  -1.190  1.00 0.00 ? 89  ASN A CA   2  
ATOM 3588  C C    . ASN A 1 89  ? -10.093 -5.926  -0.001  1.00 0.00 ? 89  ASN A C    2  
ATOM 3589  O O    . ASN A 1 89  ? -9.131  -5.290  0.430   1.00 0.00 ? 89  ASN A O    2  
ATOM 3590  C CB   . ASN A 1 89  ? -9.863  -8.317  -0.697  1.00 0.00 ? 89  ASN A CB   2  
ATOM 3591  C CG   . ASN A 1 89  ? -10.475 -9.303  -1.674  1.00 0.00 ? 89  ASN A CG   2  
ATOM 3592  O OD1  . ASN A 1 89  ? -10.077 -9.370  -2.837  1.00 0.00 ? 89  ASN A OD1  2  
ATOM 3593  N ND2  . ASN A 1 89  ? -11.448 -10.075 -1.204  1.00 0.00 ? 89  ASN A ND2  2  
ATOM 3594  H H    . ASN A 1 89  ? -7.957  -7.030  -1.859  1.00 0.00 ? 89  ASN A H    2  
ATOM 3595  H HA   . ASN A 1 89  ? -10.832 -6.772  -1.816  1.00 0.00 ? 89  ASN A HA   2  
ATOM 3596  H HB2  . ASN A 1 89  ? -8.823  -8.575  -0.559  1.00 0.00 ? 89  ASN A HB2  2  
ATOM 3597  H HB3  . ASN A 1 89  ? -10.379 -8.406  0.246   1.00 0.00 ? 89  ASN A HB3  2  
ATOM 3598  H HD21 . ASN A 1 89  ? -11.713 -9.967  -0.267  1.00 0.00 ? 89  ASN A HD21 2  
ATOM 3599  H HD22 . ASN A 1 89  ? -11.861 -10.721 -1.814  1.00 0.00 ? 89  ASN A HD22 2  
ATOM 3600  N N    . PRO A 1 90  ? -11.315 -5.828  0.542   1.00 0.00 ? 90  PRO A N    2  
ATOM 3601  C CA   . PRO A 1 90  ? -11.605 -4.963  1.690   1.00 0.00 ? 90  PRO A CA   2  
ATOM 3602  C C    . PRO A 1 90  ? -10.965 -5.473  2.977   1.00 0.00 ? 90  PRO A C    2  
ATOM 3603  O O    . PRO A 1 90  ? -11.026 -4.815  4.016   1.00 0.00 ? 90  PRO A O    2  
ATOM 3604  C CB   . PRO A 1 90  ? -13.131 -5.012  1.795   1.00 0.00 ? 90  PRO A CB   2  
ATOM 3605  C CG   . PRO A 1 90  ? -13.512 -6.311  1.173   1.00 0.00 ? 90  PRO A CG   2  
ATOM 3606  C CD   . PRO A 1 90  ? -12.509 -6.556  0.080   1.00 0.00 ? 90  PRO A CD   2  
ATOM 3607  H HA   . PRO A 1 90  ? -11.287 -3.946  1.510   1.00 0.00 ? 90  PRO A HA   2  
ATOM 3608  H HB2  . PRO A 1 90  ? -13.424 -4.969  2.835   1.00 0.00 ? 90  PRO A HB2  2  
ATOM 3609  H HB3  . PRO A 1 90  ? -13.559 -4.177  1.260   1.00 0.00 ? 90  PRO A HB3  2  
ATOM 3610  H HG2  . PRO A 1 90  ? -13.466 -7.098  1.908   1.00 0.00 ? 90  PRO A HG2  2  
ATOM 3611  H HG3  . PRO A 1 90  ? -14.507 -6.240  0.758   1.00 0.00 ? 90  PRO A HG3  2  
ATOM 3612  H HD2  . PRO A 1 90  ? -12.304 -7.612  -0.014  1.00 0.00 ? 90  PRO A HD2  2  
ATOM 3613  H HD3  . PRO A 1 90  ? -12.865 -6.154  -0.857  1.00 0.00 ? 90  PRO A HD3  2  
ATOM 3614  N N    . VAL A 1 91  ? -10.352 -6.650  2.902   1.00 0.00 ? 91  VAL A N    2  
ATOM 3615  C CA   . VAL A 1 91  ? -9.700  -7.248  4.061   1.00 0.00 ? 91  VAL A CA   2  
ATOM 3616  C C    . VAL A 1 91  ? -8.183  -7.178  3.934   1.00 0.00 ? 91  VAL A C    2  
ATOM 3617  O O    . VAL A 1 91  ? -7.456  -7.496  4.876   1.00 0.00 ? 91  VAL A O    2  
ATOM 3618  C CB   . VAL A 1 91  ? -10.121 -8.719  4.245   1.00 0.00 ? 91  VAL A CB   2  
ATOM 3619  C CG1  . VAL A 1 91  ? -11.595 -8.811  4.605   1.00 0.00 ? 91  VAL A CG1  2  
ATOM 3620  C CG2  . VAL A 1 91  ? -9.820  -9.520  2.987   1.00 0.00 ? 91  VAL A CG2  2  
ATOM 3621  H H    . VAL A 1 91  ? -10.338 -7.128  2.046   1.00 0.00 ? 91  VAL A H    2  
ATOM 3622  H HA   . VAL A 1 91  ? -10.005 -6.696  4.937   1.00 0.00 ? 91  VAL A HA   2  
ATOM 3623  H HB   . VAL A 1 91  ? -9.547  -9.137  5.058   1.00 0.00 ? 91  VAL A HB   2  
ATOM 3624  H HG11 . VAL A 1 91  ? -11.827 -9.820  4.915   1.00 0.00 ? 91  VAL A HG11 2  
ATOM 3625  H HG12 . VAL A 1 91  ? -11.813 -8.126  5.413   1.00 0.00 ? 91  VAL A HG12 2  
ATOM 3626  H HG13 . VAL A 1 91  ? -12.194 -8.553  3.744   1.00 0.00 ? 91  VAL A HG13 2  
ATOM 3627  H HG21 . VAL A 1 91  ? -8.948  -9.111  2.500   1.00 0.00 ? 91  VAL A HG21 2  
ATOM 3628  H HG22 . VAL A 1 91  ? -9.634  -10.550 3.252   1.00 0.00 ? 91  VAL A HG22 2  
ATOM 3629  H HG23 . VAL A 1 91  ? -10.665 -9.468  2.316   1.00 0.00 ? 91  VAL A HG23 2  
ATOM 3630  N N    . ASP A 1 92  ? -7.710  -6.757  2.766   1.00 0.00 ? 92  ASP A N    2  
ATOM 3631  C CA   . ASP A 1 92  ? -6.278  -6.642  2.517   1.00 0.00 ? 92  ASP A CA   2  
ATOM 3632  C C    . ASP A 1 92  ? -5.815  -5.196  2.663   1.00 0.00 ? 92  ASP A C    2  
ATOM 3633  O O    . ASP A 1 92  ? -4.760  -4.816  2.154   1.00 0.00 ? 92  ASP A O    2  
ATOM 3634  C CB   . ASP A 1 92  ? -5.939  -7.160  1.119   1.00 0.00 ? 92  ASP A CB   2  
ATOM 3635  C CG   . ASP A 1 92  ? -5.996  -8.673  1.033   1.00 0.00 ? 92  ASP A CG   2  
ATOM 3636  O OD1  . ASP A 1 92  ? -6.957  -9.262  1.569   1.00 0.00 ? 92  ASP A OD1  2  
ATOM 3637  O OD2  . ASP A 1 92  ? -5.078  -9.266  0.428   1.00 0.00 ? 92  ASP A OD2  2  
ATOM 3638  H H    . ASP A 1 92  ? -8.340  -6.517  2.054   1.00 0.00 ? 92  ASP A H    2  
ATOM 3639  H HA   . ASP A 1 92  ? -5.765  -7.246  3.249   1.00 0.00 ? 92  ASP A HA   2  
ATOM 3640  H HB2  . ASP A 1 92  ? -6.644  -6.751  0.410   1.00 0.00 ? 92  ASP A HB2  2  
ATOM 3641  H HB3  . ASP A 1 92  ? -4.942  -6.838  0.855   1.00 0.00 ? 92  ASP A HB3  2  
ATOM 3642  N N    . LEU A 1 93  ? -6.612  -4.393  3.361   1.00 0.00 ? 93  LEU A N    2  
ATOM 3643  C CA   . LEU A 1 93  ? -6.285  -2.987  3.573   1.00 0.00 ? 93  LEU A CA   2  
ATOM 3644  C C    . LEU A 1 93  ? -5.900  -2.731  5.027   1.00 0.00 ? 93  LEU A C    2  
ATOM 3645  O O    . LEU A 1 93  ? -5.919  -3.643  5.855   1.00 0.00 ? 93  LEU A O    2  
ATOM 3646  C CB   . LEU A 1 93  ? -7.471  -2.103  3.184   1.00 0.00 ? 93  LEU A CB   2  
ATOM 3647  C CG   . LEU A 1 93  ? -7.968  -2.241  1.746   1.00 0.00 ? 93  LEU A CG   2  
ATOM 3648  C CD1  . LEU A 1 93  ? -9.241  -1.433  1.540   1.00 0.00 ? 93  LEU A CD1  2  
ATOM 3649  C CD2  . LEU A 1 93  ? -6.891  -1.802  0.764   1.00 0.00 ? 93  LEU A CD2  2  
ATOM 3650  H H    . LEU A 1 93  ? -7.439  -4.752  3.743   1.00 0.00 ? 93  LEU A H    2  
ATOM 3651  H HA   . LEU A 1 93  ? -5.443  -2.744  2.942   1.00 0.00 ? 93  LEU A HA   2  
ATOM 3652  H HB2  . LEU A 1 93  ? -8.291  -2.343  3.842   1.00 0.00 ? 93  LEU A HB2  2  
ATOM 3653  H HB3  . LEU A 1 93  ? -7.179  -1.073  3.337   1.00 0.00 ? 93  LEU A HB3  2  
ATOM 3654  H HG   . LEU A 1 93  ? -8.198  -3.280  1.549   1.00 0.00 ? 93  LEU A HG   2  
ATOM 3655  H HD11 . LEU A 1 93  ? -9.686  -1.214  2.498   1.00 0.00 ? 93  LEU A HD11 2  
ATOM 3656  H HD12 . LEU A 1 93  ? -9.935  -2.003  0.942   1.00 0.00 ? 93  LEU A HD12 2  
ATOM 3657  H HD13 . LEU A 1 93  ? -9.002  -0.510  1.033   1.00 0.00 ? 93  LEU A HD13 2  
ATOM 3658  H HD21 . LEU A 1 93  ? -7.356  -1.386  -0.117  1.00 0.00 ? 93  LEU A HD21 2  
ATOM 3659  H HD22 . LEU A 1 93  ? -6.290  -2.656  0.484   1.00 0.00 ? 93  LEU A HD22 2  
ATOM 3660  H HD23 . LEU A 1 93  ? -6.264  -1.056  1.228   1.00 0.00 ? 93  LEU A HD23 2  
ATOM 3661  N N    . PHE A 1 94  ? -5.552  -1.485  5.331   1.00 0.00 ? 94  PHE A N    2  
ATOM 3662  C CA   . PHE A 1 94  ? -5.165  -1.109  6.686   1.00 0.00 ? 94  PHE A CA   2  
ATOM 3663  C C    . PHE A 1 94  ? -5.552  0.337   6.980   1.00 0.00 ? 94  PHE A C    2  
ATOM 3664  O O    . PHE A 1 94  ? -5.713  1.146   6.067   1.00 0.00 ? 94  PHE A O    2  
ATOM 3665  C CB   . PHE A 1 94  ? -3.658  -1.294  6.877   1.00 0.00 ? 94  PHE A CB   2  
ATOM 3666  C CG   . PHE A 1 94  ? -2.827  -0.427  5.975   1.00 0.00 ? 94  PHE A CG   2  
ATOM 3667  C CD1  . PHE A 1 94  ? -2.461  0.851   6.366   1.00 0.00 ? 94  PHE A CD1  2  
ATOM 3668  C CD2  . PHE A 1 94  ? -2.414  -0.889  4.736   1.00 0.00 ? 94  PHE A CD2  2  
ATOM 3669  C CE1  . PHE A 1 94  ? -1.696  1.652   5.538   1.00 0.00 ? 94  PHE A CE1  2  
ATOM 3670  C CE2  . PHE A 1 94  ? -1.650  -0.093  3.904   1.00 0.00 ? 94  PHE A CE2  2  
ATOM 3671  C CZ   . PHE A 1 94  ? -1.291  1.179   4.305   1.00 0.00 ? 94  PHE A CZ   2  
ATOM 3672  H H    . PHE A 1 94  ? -5.556  -0.803  4.628   1.00 0.00 ? 94  PHE A H    2  
ATOM 3673  H HA   . PHE A 1 94  ? -5.689  -1.756  7.372   1.00 0.00 ? 94  PHE A HA   2  
ATOM 3674  H HB2  . PHE A 1 94  ? -3.400  -1.053  7.898   1.00 0.00 ? 94  PHE A HB2  2  
ATOM 3675  H HB3  . PHE A 1 94  ? -3.401  -2.323  6.679   1.00 0.00 ? 94  PHE A HB3  2  
ATOM 3676  H HD1  . PHE A 1 94  ? -2.777  1.221   7.330   1.00 0.00 ? 94  PHE A HD1  2  
ATOM 3677  H HD2  . PHE A 1 94  ? -2.695  -1.883  4.420   1.00 0.00 ? 94  PHE A HD2  2  
ATOM 3678  H HE1  . PHE A 1 94  ? -1.418  2.646   5.855   1.00 0.00 ? 94  PHE A HE1  2  
ATOM 3679  H HE2  . PHE A 1 94  ? -1.335  -0.464  2.940   1.00 0.00 ? 94  PHE A HE2  2  
ATOM 3680  H HZ   . PHE A 1 94  ? -0.693  1.803   3.657   1.00 0.00 ? 94  PHE A HZ   2  
ATOM 3681  N N    . GLU A 1 95  ? -5.700  0.654   8.263   1.00 0.00 ? 95  GLU A N    2  
ATOM 3682  C CA   . GLU A 1 95  ? -6.070  2.003   8.678   1.00 0.00 ? 95  GLU A CA   2  
ATOM 3683  C C    . GLU A 1 95  ? -4.834  2.886   8.821   1.00 0.00 ? 95  GLU A C    2  
ATOM 3684  O O    . GLU A 1 95  ? -3.732  2.396   9.066   1.00 0.00 ? 95  GLU A O    2  
ATOM 3685  C CB   . GLU A 1 95  ? -6.836  1.960   10.002  1.00 0.00 ? 95  GLU A CB   2  
ATOM 3686  C CG   . GLU A 1 95  ? -8.340  1.826   9.830   1.00 0.00 ? 95  GLU A CG   2  
ATOM 3687  C CD   . GLU A 1 95  ? -9.089  1.936   11.145  1.00 0.00 ? 95  GLU A CD   2  
ATOM 3688  O OE1  . GLU A 1 95  ? -9.296  0.891   11.798  1.00 0.00 ? 95  GLU A OE1  2  
ATOM 3689  O OE2  . GLU A 1 95  ? -9.469  3.064   11.519  1.00 0.00 ? 95  GLU A OE2  2  
ATOM 3690  H H    . GLU A 1 95  ? -5.558  -0.034  8.946   1.00 0.00 ? 95  GLU A H    2  
ATOM 3691  H HA   . GLU A 1 95  ? -6.710  2.420   7.915   1.00 0.00 ? 95  GLU A HA   2  
ATOM 3692  H HB2  . GLU A 1 95  ? -6.483  1.120   10.581  1.00 0.00 ? 95  GLU A HB2  2  
ATOM 3693  H HB3  . GLU A 1 95  ? -6.638  2.871   10.548  1.00 0.00 ? 95  GLU A HB3  2  
ATOM 3694  H HG2  . GLU A 1 95  ? -8.686  2.607   9.171   1.00 0.00 ? 95  GLU A HG2  2  
ATOM 3695  H HG3  . GLU A 1 95  ? -8.555  0.863   9.390   1.00 0.00 ? 95  GLU A HG3  2  
ATOM 3696  N N    . ALA A 1 96  ? -5.027  4.192   8.665   1.00 0.00 ? 96  ALA A N    2  
ATOM 3697  C CA   . ALA A 1 96  ? -3.929  5.145   8.777   1.00 0.00 ? 96  ALA A CA   2  
ATOM 3698  C C    . ALA A 1 96  ? -3.266  5.058   10.148  1.00 0.00 ? 96  ALA A C    2  
ATOM 3699  O O    . ALA A 1 96  ? -2.047  5.177   10.267  1.00 0.00 ? 96  ALA A O    2  
ATOM 3700  C CB   . ALA A 1 96  ? -4.429  6.558   8.519   1.00 0.00 ? 96  ALA A CB   2  
ATOM 3701  H H    . ALA A 1 96  ? -5.929  4.522   8.470   1.00 0.00 ? 96  ALA A H    2  
ATOM 3702  H HA   . ALA A 1 96  ? -3.198  4.903   8.020   1.00 0.00 ? 96  ALA A HA   2  
ATOM 3703  H HB1  . ALA A 1 96  ? -4.258  7.165   9.396   1.00 0.00 ? 96  ALA A HB1  2  
ATOM 3704  H HB2  . ALA A 1 96  ? -3.897  6.980   7.679   1.00 0.00 ? 96  ALA A HB2  2  
ATOM 3705  H HB3  . ALA A 1 96  ? -5.486  6.532   8.300   1.00 0.00 ? 96  ALA A HB3  2  
ATOM 3706  N N    . ASN A 1 97  ? -4.077  4.852   11.180  1.00 0.00 ? 97  ASN A N    2  
ATOM 3707  C CA   . ASN A 1 97  ? -3.568  4.751   12.544  1.00 0.00 ? 97  ASN A CA   2  
ATOM 3708  C C    . ASN A 1 97  ? -2.666  3.531   12.699  1.00 0.00 ? 97  ASN A C    2  
ATOM 3709  O O    . ASN A 1 97  ? -1.601  3.606   13.312  1.00 0.00 ? 97  ASN A O    2  
ATOM 3710  C CB   . ASN A 1 97  ? -4.728  4.671   13.539  1.00 0.00 ? 97  ASN A CB   2  
ATOM 3711  C CG   . ASN A 1 97  ? -5.883  3.840   13.015  1.00 0.00 ? 97  ASN A CG   2  
ATOM 3712  O OD1  . ASN A 1 97  ? -5.971  2.641   13.280  1.00 0.00 ? 97  ASN A OD1  2  
ATOM 3713  N ND2  . ASN A 1 97  ? -6.777  4.476   12.266  1.00 0.00 ? 97  ASN A ND2  2  
ATOM 3714  H H    . ASN A 1 97  ? -5.040  4.765   11.023  1.00 0.00 ? 97  ASN A H    2  
ATOM 3715  H HA   . ASN A 1 97  ? -2.991  5.640   12.748  1.00 0.00 ? 97  ASN A HA   2  
ATOM 3716  H HB2  . ASN A 1 97  ? -4.376  4.225   14.457  1.00 0.00 ? 97  ASN A HB2  2  
ATOM 3717  H HB3  . ASN A 1 97  ? -5.089  5.668   13.743  1.00 0.00 ? 97  ASN A HB3  2  
ATOM 3718  H HD21 . ASN A 1 97  ? -6.644  5.432   12.096  1.00 0.00 ? 97  ASN A HD21 2  
ATOM 3719  H HD22 . ASN A 1 97  ? -7.535  3.963   11.915  1.00 0.00 ? 97  ASN A HD22 2  
ATOM 3720  N N    . ASP A 1 98  ? -3.099  2.406   12.140  1.00 0.00 ? 98  ASP A N    2  
ATOM 3721  C CA   . ASP A 1 98  ? -2.331  1.168   12.214  1.00 0.00 ? 98  ASP A CA   2  
ATOM 3722  C C    . ASP A 1 98  ? -0.837  1.448   12.075  1.00 0.00 ? 98  ASP A C    2  
ATOM 3723  O O    . ASP A 1 98  ? -0.022  0.906   12.823  1.00 0.00 ? 98  ASP A O    2  
ATOM 3724  C CB   . ASP A 1 98  ? -2.783  0.196   11.123  1.00 0.00 ? 98  ASP A CB   2  
ATOM 3725  C CG   . ASP A 1 98  ? -4.169  -0.361  11.384  1.00 0.00 ? 98  ASP A CG   2  
ATOM 3726  O OD1  . ASP A 1 98  ? -4.626  -0.297  12.544  1.00 0.00 ? 98  ASP A OD1  2  
ATOM 3727  O OD2  . ASP A 1 98  ? -4.796  -0.862  10.427  1.00 0.00 ? 98  ASP A OD2  2  
ATOM 3728  H H    . ASP A 1 98  ? -3.957  2.409   11.664  1.00 0.00 ? 98  ASP A H    2  
ATOM 3729  H HA   . ASP A 1 98  ? -2.513  0.722   13.179  1.00 0.00 ? 98  ASP A HA   2  
ATOM 3730  H HB2  . ASP A 1 98  ? -2.796  0.711   10.173  1.00 0.00 ? 98  ASP A HB2  2  
ATOM 3731  H HB3  . ASP A 1 98  ? -2.086  -0.628  11.074  1.00 0.00 ? 98  ASP A HB3  2  
ATOM 3732  N N    . LEU A 1 99  ? -0.486  2.296   11.115  1.00 0.00 ? 99  LEU A N    2  
ATOM 3733  C CA   . LEU A 1 99  ? 0.910   2.648   10.878  1.00 0.00 ? 99  LEU A CA   2  
ATOM 3734  C C    . LEU A 1 99  ? 1.301   3.890   11.671  1.00 0.00 ? 99  LEU A C    2  
ATOM 3735  O O    . LEU A 1 99  ? 2.277   3.879   12.421  1.00 0.00 ? 99  LEU A O    2  
ATOM 3736  C CB   . LEU A 1 99  ? 1.151   2.884   9.387   1.00 0.00 ? 99  LEU A CB   2  
ATOM 3737  C CG   . LEU A 1 99  ? 2.612   3.018   8.955   1.00 0.00 ? 99  LEU A CG   2  
ATOM 3738  C CD1  . LEU A 1 99  ? 3.317   1.673   9.037   1.00 0.00 ? 99  LEU A CD1  2  
ATOM 3739  C CD2  . LEU A 1 99  ? 2.701   3.585   7.546   1.00 0.00 ? 99  LEU A CD2  2  
ATOM 3740  H H    . LEU A 1 99  ? -1.181  2.697   10.552  1.00 0.00 ? 99  LEU A H    2  
ATOM 3741  H HA   . LEU A 1 99  ? 1.520   1.819   11.206  1.00 0.00 ? 99  LEU A HA   2  
ATOM 3742  H HB2  . LEU A 1 99  ? 0.722   2.053   8.847   1.00 0.00 ? 99  LEU A HB2  2  
ATOM 3743  H HB3  . LEU A 1 99  ? 0.639   3.795   9.110   1.00 0.00 ? 99  LEU A HB3  2  
ATOM 3744  H HG   . LEU A 1 99  ? 3.116   3.701   9.624   1.00 0.00 ? 99  LEU A HG   2  
ATOM 3745  H HD11 . LEU A 1 99  ? 2.587   0.880   8.991   1.00 0.00 ? 99  LEU A HD11 2  
ATOM 3746  H HD12 . LEU A 1 99  ? 3.863   1.609   9.967   1.00 0.00 ? 99  LEU A HD12 2  
ATOM 3747  H HD13 . LEU A 1 99  ? 4.007   1.578   8.210   1.00 0.00 ? 99  LEU A HD13 2  
ATOM 3748  H HD21 . LEU A 1 99  ? 2.039   3.034   6.894   1.00 0.00 ? 99  LEU A HD21 2  
ATOM 3749  H HD22 . LEU A 1 99  ? 3.717   3.495   7.186   1.00 0.00 ? 99  LEU A HD22 2  
ATOM 3750  H HD23 . LEU A 1 99  ? 2.414   4.626   7.557   1.00 0.00 ? 99  LEU A HD23 2  
ATOM 3751  N N    . PHE A 1 100 ? 0.533   4.961   11.502  1.00 0.00 ? 100 PHE A N    2  
ATOM 3752  C CA   . PHE A 1 100 ? 0.798   6.212   12.202  1.00 0.00 ? 100 PHE A CA   2  
ATOM 3753  C C    . PHE A 1 100 ? 1.225   5.948   13.642  1.00 0.00 ? 100 PHE A C    2  
ATOM 3754  O O    . PHE A 1 100 ? 2.352   6.252   14.032  1.00 0.00 ? 100 PHE A O    2  
ATOM 3755  C CB   . PHE A 1 100 ? -0.444  7.106   12.181  1.00 0.00 ? 100 PHE A CB   2  
ATOM 3756  C CG   . PHE A 1 100 ? -0.159  8.535   12.545  1.00 0.00 ? 100 PHE A CG   2  
ATOM 3757  C CD1  . PHE A 1 100 ? 0.800   9.261   11.859  1.00 0.00 ? 100 PHE A CD1  2  
ATOM 3758  C CD2  . PHE A 1 100 ? -0.851  9.152   13.574  1.00 0.00 ? 100 PHE A CD2  2  
ATOM 3759  C CE1  . PHE A 1 100 ? 1.065   10.577  12.191  1.00 0.00 ? 100 PHE A CE1  2  
ATOM 3760  C CE2  . PHE A 1 100 ? -0.593  10.468  13.911  1.00 0.00 ? 100 PHE A CE2  2  
ATOM 3761  C CZ   . PHE A 1 100 ? 0.368   11.180  13.219  1.00 0.00 ? 100 PHE A CZ   2  
ATOM 3762  H H    . PHE A 1 100 ? -0.231  4.908   10.889  1.00 0.00 ? 100 PHE A H    2  
ATOM 3763  H HA   . PHE A 1 100 ? 1.602   6.715   11.688  1.00 0.00 ? 100 PHE A HA   2  
ATOM 3764  H HB2  . PHE A 1 100 ? -0.870  7.095   11.189  1.00 0.00 ? 100 PHE A HB2  2  
ATOM 3765  H HB3  . PHE A 1 100 ? -1.167  6.721   12.884  1.00 0.00 ? 100 PHE A HB3  2  
ATOM 3766  H HD1  . PHE A 1 100 ? 1.347   8.789   11.054  1.00 0.00 ? 100 PHE A HD1  2  
ATOM 3767  H HD2  . PHE A 1 100 ? -1.601  8.597   14.117  1.00 0.00 ? 100 PHE A HD2  2  
ATOM 3768  H HE1  . PHE A 1 100 ? 1.816   11.130  11.648  1.00 0.00 ? 100 PHE A HE1  2  
ATOM 3769  H HE2  . PHE A 1 100 ? -1.138  10.937  14.715  1.00 0.00 ? 100 PHE A HE2  2  
ATOM 3770  H HZ   . PHE A 1 100 ? 0.572   12.208  13.480  1.00 0.00 ? 100 PHE A HZ   2  
ATOM 3771  N N    . GLU A 1 101 ? 0.315   5.382   14.429  1.00 0.00 ? 101 GLU A N    2  
ATOM 3772  C CA   . GLU A 1 101 ? 0.597   5.078   15.828  1.00 0.00 ? 101 GLU A CA   2  
ATOM 3773  C C    . GLU A 1 101 ? 0.839   3.585   16.022  1.00 0.00 ? 101 GLU A C    2  
ATOM 3774  O O    . GLU A 1 101 ? 0.426   3.004   17.026  1.00 0.00 ? 101 GLU A O    2  
ATOM 3775  C CB   . GLU A 1 101 ? -0.562  5.538   16.715  1.00 0.00 ? 101 GLU A CB   2  
ATOM 3776  C CG   . GLU A 1 101 ? -0.801  7.038   16.676  1.00 0.00 ? 101 GLU A CG   2  
ATOM 3777  C CD   . GLU A 1 101 ? 0.040   7.791   17.688  1.00 0.00 ? 101 GLU A CD   2  
ATOM 3778  O OE1  . GLU A 1 101 ? -0.236  7.665   18.899  1.00 0.00 ? 101 GLU A OE1  2  
ATOM 3779  O OE2  . GLU A 1 101 ? 0.975   8.505   17.268  1.00 0.00 ? 101 GLU A OE2  2  
ATOM 3780  H H    . GLU A 1 101 ? -0.566  5.163   14.060  1.00 0.00 ? 101 GLU A H    2  
ATOM 3781  H HA   . GLU A 1 101 ? 1.490   5.615   16.109  1.00 0.00 ? 101 GLU A HA   2  
ATOM 3782  H HB2  . GLU A 1 101 ? -1.465  5.042   16.394  1.00 0.00 ? 101 GLU A HB2  2  
ATOM 3783  H HB3  . GLU A 1 101 ? -0.350  5.257   17.736  1.00 0.00 ? 101 GLU A HB3  2  
ATOM 3784  H HG2  . GLU A 1 101 ? -0.559  7.402   15.688  1.00 0.00 ? 101 GLU A HG2  2  
ATOM 3785  H HG3  . GLU A 1 101 ? -1.844  7.230   16.882  1.00 0.00 ? 101 GLU A HG3  2  
ATOM 3786  N N    . SER A 1 102 ? 1.512   2.969   15.055  1.00 0.00 ? 102 SER A N    2  
ATOM 3787  C CA   . SER A 1 102 ? 1.805   1.542   15.116  1.00 0.00 ? 102 SER A CA   2  
ATOM 3788  C C    . SER A 1 102 ? 0.614   0.766   15.667  1.00 0.00 ? 102 SER A C    2  
ATOM 3789  O O    . SER A 1 102 ? 0.769   -0.322  16.222  1.00 0.00 ? 102 SER A O    2  
ATOM 3790  C CB   . SER A 1 102 ? 3.038   1.292   15.988  1.00 0.00 ? 102 SER A CB   2  
ATOM 3791  O OG   . SER A 1 102 ? 2.768   1.580   17.348  1.00 0.00 ? 102 SER A OG   2  
ATOM 3792  H H    . SER A 1 102 ? 1.814   3.487   14.280  1.00 0.00 ? 102 SER A H    2  
ATOM 3793  H HA   . SER A 1 102 ? 2.009   1.202   14.113  1.00 0.00 ? 102 SER A HA   2  
ATOM 3794  H HB2  . SER A 1 102 ? 3.330   0.256   15.903  1.00 0.00 ? 102 SER A HB2  2  
ATOM 3795  H HB3  . SER A 1 102 ? 3.847   1.922   15.651  1.00 0.00 ? 102 SER A HB3  2  
ATOM 3796  H HG   . SER A 1 102 ? 3.416   1.141   17.904  1.00 0.00 ? 102 SER A HG   2  
ATOM 3797  N N    . GLY A 1 103 ? -0.579  1.332   15.508  1.00 0.00 ? 103 GLY A N    2  
ATOM 3798  C CA   . GLY A 1 103 ? -1.781  0.680   15.994  1.00 0.00 ? 103 GLY A CA   2  
ATOM 3799  C C    . GLY A 1 103 ? -1.954  -0.714  15.425  1.00 0.00 ? 103 GLY A C    2  
ATOM 3800  O O    . GLY A 1 103 ? -2.760  -1.500  15.924  1.00 0.00 ? 103 GLY A O    2  
ATOM 3801  H H    . GLY A 1 103 ? -0.643  2.201   15.058  1.00 0.00 ? 103 GLY A H    2  
ATOM 3802  H HA2  . GLY A 1 103 ? -1.733  0.616   17.070  1.00 0.00 ? 103 GLY A HA2  2  
ATOM 3803  H HA3  . GLY A 1 103 ? -2.638  1.277   15.717  1.00 0.00 ? 103 GLY A HA3  2  
ATOM 3804  N N    . ASN A 1 104 ? -1.196  -1.023  14.378  1.00 0.00 ? 104 ASN A N    2  
ATOM 3805  C CA   . ASN A 1 104 ? -1.271  -2.333  13.740  1.00 0.00 ? 104 ASN A CA   2  
ATOM 3806  C C    . ASN A 1 104 ? -0.225  -2.460  12.637  1.00 0.00 ? 104 ASN A C    2  
ATOM 3807  O O    . ASN A 1 104 ? -0.296  -1.775  11.618  1.00 0.00 ? 104 ASN A O    2  
ATOM 3808  C CB   . ASN A 1 104 ? -2.669  -2.561  13.161  1.00 0.00 ? 104 ASN A CB   2  
ATOM 3809  C CG   . ASN A 1 104 ? -3.061  -4.026  13.159  1.00 0.00 ? 104 ASN A CG   2  
ATOM 3810  O OD1  . ASN A 1 104 ? -2.290  -4.887  13.581  1.00 0.00 ? 104 ASN A OD1  2  
ATOM 3811  N ND2  . ASN A 1 104 ? -4.267  -4.315  12.681  1.00 0.00 ? 104 ASN A ND2  2  
ATOM 3812  H H    . ASN A 1 104 ? -0.573  -0.355  14.026  1.00 0.00 ? 104 ASN A H    2  
ATOM 3813  H HA   . ASN A 1 104 ? -1.077  -3.080  14.493  1.00 0.00 ? 104 ASN A HA   2  
ATOM 3814  H HB2  . ASN A 1 104 ? -3.391  -2.016  13.752  1.00 0.00 ? 104 ASN A HB2  2  
ATOM 3815  H HB3  . ASN A 1 104 ? -2.695  -2.198  12.144  1.00 0.00 ? 104 ASN A HB3  2  
ATOM 3816  H HD21 . ASN A 1 104 ? -4.827  -3.577  12.362  1.00 0.00 ? 104 ASN A HD21 2  
ATOM 3817  H HD22 . ASN A 1 104 ? -4.546  -5.254  12.669  1.00 0.00 ? 104 ASN A HD22 2  
ATOM 3818  N N    . MET A 1 105 ? 0.745   -3.344  12.849  1.00 0.00 ? 105 MET A N    2  
ATOM 3819  C CA   . MET A 1 105 ? 1.805   -3.564  11.873  1.00 0.00 ? 105 MET A CA   2  
ATOM 3820  C C    . MET A 1 105 ? 1.555   -4.841  11.076  1.00 0.00 ? 105 MET A C    2  
ATOM 3821  O O    . MET A 1 105 ? 2.206   -5.090  10.061  1.00 0.00 ? 105 MET A O    2  
ATOM 3822  C CB   . MET A 1 105 ? 3.164   -3.644  12.572  1.00 0.00 ? 105 MET A CB   2  
ATOM 3823  C CG   . MET A 1 105 ? 3.860   -2.298  12.703  1.00 0.00 ? 105 MET A CG   2  
ATOM 3824  S SD   . MET A 1 105 ? 4.927   -1.929  11.296  1.00 0.00 ? 105 MET A SD   2  
ATOM 3825  C CE   . MET A 1 105 ? 3.710   -1.634  10.016  1.00 0.00 ? 105 MET A CE   2  
ATOM 3826  H H    . MET A 1 105 ? 0.747   -3.862  13.681  1.00 0.00 ? 105 MET A H    2  
ATOM 3827  H HA   . MET A 1 105 ? 1.809   -2.724  11.193  1.00 0.00 ? 105 MET A HA   2  
ATOM 3828  H HB2  . MET A 1 105 ? 3.022   -4.049  13.562  1.00 0.00 ? 105 MET A HB2  2  
ATOM 3829  H HB3  . MET A 1 105 ? 3.807   -4.304  12.010  1.00 0.00 ? 105 MET A HB3  2  
ATOM 3830  H HG2  . MET A 1 105 ? 3.110   -1.526  12.778  1.00 0.00 ? 105 MET A HG2  2  
ATOM 3831  H HG3  . MET A 1 105 ? 4.459   -2.305  13.601  1.00 0.00 ? 105 MET A HG3  2  
ATOM 3832  H HE1  . MET A 1 105 ? 2.862   -1.118  10.438  1.00 0.00 ? 105 MET A HE1  2  
ATOM 3833  H HE2  . MET A 1 105 ? 4.149   -1.031  9.236   1.00 0.00 ? 105 MET A HE2  2  
ATOM 3834  H HE3  . MET A 1 105 ? 3.388   -2.580  9.602   1.00 0.00 ? 105 MET A HE3  2  
ATOM 3835  N N    . THR A 1 106 ? 0.606   -5.648  11.543  1.00 0.00 ? 106 THR A N    2  
ATOM 3836  C CA   . THR A 1 106 ? 0.272   -6.899  10.876  1.00 0.00 ? 106 THR A CA   2  
ATOM 3837  C C    . THR A 1 106 ? -0.717  -6.668  9.738   1.00 0.00 ? 106 THR A C    2  
ATOM 3838  O O    . THR A 1 106 ? -0.732  -7.412  8.757   1.00 0.00 ? 106 THR A O    2  
ATOM 3839  C CB   . THR A 1 106 ? -0.327  -7.919  11.862  1.00 0.00 ? 106 THR A CB   2  
ATOM 3840  O OG1  . THR A 1 106 ? -1.714  -7.635  12.077  1.00 0.00 ? 106 THR A OG1  2  
ATOM 3841  C CG2  . THR A 1 106 ? 0.414   -7.888  13.190  1.00 0.00 ? 106 THR A CG2  2  
ATOM 3842  H H    . THR A 1 106 ? 0.123   -5.394  12.357  1.00 0.00 ? 106 THR A H    2  
ATOM 3843  H HA   . THR A 1 106 ? 1.182   -7.315  10.469  1.00 0.00 ? 106 THR A HA   2  
ATOM 3844  H HB   . THR A 1 106 ? -0.233  -8.908  11.435  1.00 0.00 ? 106 THR A HB   2  
ATOM 3845  H HG1  . THR A 1 106 ? -1.908  -6.741  11.783  1.00 0.00 ? 106 THR A HG1  2  
ATOM 3846  H HG21 . THR A 1 106 ? 1.411   -8.281  13.054  1.00 0.00 ? 106 THR A HG21 2  
ATOM 3847  H HG22 . THR A 1 106 ? -0.116  -8.492  13.912  1.00 0.00 ? 106 THR A HG22 2  
ATOM 3848  H HG23 . THR A 1 106 ? 0.473   -6.871  13.544  1.00 0.00 ? 106 THR A HG23 2  
ATOM 3849  N N    . GLN A 1 107 ? -1.538  -5.632  9.875   1.00 0.00 ? 107 GLN A N    2  
ATOM 3850  C CA   . GLN A 1 107 ? -2.530  -5.304  8.858   1.00 0.00 ? 107 GLN A CA   2  
ATOM 3851  C C    . GLN A 1 107 ? -1.890  -4.540  7.702   1.00 0.00 ? 107 GLN A C    2  
ATOM 3852  O O    . GLN A 1 107 ? -2.350  -4.619  6.562   1.00 0.00 ? 107 GLN A O    2  
ATOM 3853  C CB   . GLN A 1 107 ? -3.662  -4.478  9.467   1.00 0.00 ? 107 GLN A CB   2  
ATOM 3854  C CG   . GLN A 1 107 ? -4.990  -4.639  8.745   1.00 0.00 ? 107 GLN A CG   2  
ATOM 3855  C CD   . GLN A 1 107 ? -5.539  -6.049  8.842   1.00 0.00 ? 107 GLN A CD   2  
ATOM 3856  O OE1  . GLN A 1 107 ? -6.069  -6.451  9.878   1.00 0.00 ? 107 GLN A OE1  2  
ATOM 3857  N NE2  . GLN A 1 107 ? -5.416  -6.808  7.760   1.00 0.00 ? 107 GLN A NE2  2  
ATOM 3858  H H    . GLN A 1 107 ? -1.477  -5.077  10.679  1.00 0.00 ? 107 GLN A H    2  
ATOM 3859  H HA   . GLN A 1 107 ? -2.935  -6.231  8.479   1.00 0.00 ? 107 GLN A HA   2  
ATOM 3860  H HB2  . GLN A 1 107 ? -3.798  -4.777  10.496  1.00 0.00 ? 107 GLN A HB2  2  
ATOM 3861  H HB3  . GLN A 1 107 ? -3.386  -3.434  9.437   1.00 0.00 ? 107 GLN A HB3  2  
ATOM 3862  H HG2  . GLN A 1 107 ? -5.707  -3.959  9.179   1.00 0.00 ? 107 GLN A HG2  2  
ATOM 3863  H HG3  . GLN A 1 107 ? -4.850  -4.393  7.702   1.00 0.00 ? 107 GLN A HG3  2  
ATOM 3864  H HE21 . GLN A 1 107 ? -4.982  -6.421  6.970   1.00 0.00 ? 107 GLN A HE21 2  
ATOM 3865  H HE22 . GLN A 1 107 ? -5.761  -7.723  7.795   1.00 0.00 ? 107 GLN A HE22 2  
ATOM 3866  N N    . VAL A 1 108 ? -0.829  -3.800  8.004   1.00 0.00 ? 108 VAL A N    2  
ATOM 3867  C CA   . VAL A 1 108 ? -0.126  -3.021  6.990   1.00 0.00 ? 108 VAL A CA   2  
ATOM 3868  C C    . VAL A 1 108 ? 0.871   -3.885  6.227   1.00 0.00 ? 108 VAL A C    2  
ATOM 3869  O O    . VAL A 1 108 ? 1.228   -3.580  5.090   1.00 0.00 ? 108 VAL A O    2  
ATOM 3870  C CB   . VAL A 1 108 ? 0.618   -1.827  7.616   1.00 0.00 ? 108 VAL A CB   2  
ATOM 3871  C CG1  . VAL A 1 108 ? 1.400   -1.068  6.554   1.00 0.00 ? 108 VAL A CG1  2  
ATOM 3872  C CG2  . VAL A 1 108 ? -0.357  -0.907  8.332   1.00 0.00 ? 108 VAL A CG2  2  
ATOM 3873  H H    . VAL A 1 108 ? -0.509  -3.777  8.931   1.00 0.00 ? 108 VAL A H    2  
ATOM 3874  H HA   . VAL A 1 108 ? -0.860  -2.637  6.297   1.00 0.00 ? 108 VAL A HA   2  
ATOM 3875  H HB   . VAL A 1 108 ? 1.321   -2.208  8.343   1.00 0.00 ? 108 VAL A HB   2  
ATOM 3876  H HG11 . VAL A 1 108 ? 1.975   -0.284  7.023   1.00 0.00 ? 108 VAL A HG11 2  
ATOM 3877  H HG12 . VAL A 1 108 ? 2.064   -1.748  6.041   1.00 0.00 ? 108 VAL A HG12 2  
ATOM 3878  H HG13 . VAL A 1 108 ? 0.711   -0.634  5.844   1.00 0.00 ? 108 VAL A HG13 2  
ATOM 3879  H HG21 . VAL A 1 108 ? -0.607  -1.327  9.296   1.00 0.00 ? 108 VAL A HG21 2  
ATOM 3880  H HG22 . VAL A 1 108 ? 0.097   0.064   8.470   1.00 0.00 ? 108 VAL A HG22 2  
ATOM 3881  H HG23 . VAL A 1 108 ? -1.255  -0.803  7.741   1.00 0.00 ? 108 VAL A HG23 2  
ATOM 3882  N N    . GLN A 1 109 ? 1.317   -4.965  6.861   1.00 0.00 ? 109 GLN A N    2  
ATOM 3883  C CA   . GLN A 1 109 ? 2.275   -5.873  6.241   1.00 0.00 ? 109 GLN A CA   2  
ATOM 3884  C C    . GLN A 1 109 ? 1.612   -6.693  5.138   1.00 0.00 ? 109 GLN A C    2  
ATOM 3885  O O    . GLN A 1 109 ? 2.061   -6.687  3.993   1.00 0.00 ? 109 GLN A O    2  
ATOM 3886  C CB   . GLN A 1 109 ? 2.879   -6.807  7.293   1.00 0.00 ? 109 GLN A CB   2  
ATOM 3887  C CG   . GLN A 1 109 ? 4.042   -7.635  6.774   1.00 0.00 ? 109 GLN A CG   2  
ATOM 3888  C CD   . GLN A 1 109 ? 4.856   -8.262  7.889   1.00 0.00 ? 109 GLN A CD   2  
ATOM 3889  O OE1  . GLN A 1 109 ? 4.304   -8.783  8.859   1.00 0.00 ? 109 GLN A OE1  2  
ATOM 3890  N NE2  . GLN A 1 109 ? 6.176   -8.216  7.757   1.00 0.00 ? 109 GLN A NE2  2  
ATOM 3891  H H    . GLN A 1 109 ? 0.996   -5.154  7.767   1.00 0.00 ? 109 GLN A H    2  
ATOM 3892  H HA   . GLN A 1 109 ? 3.063   -5.278  5.807   1.00 0.00 ? 109 GLN A HA   2  
ATOM 3893  H HB2  . GLN A 1 109 ? 3.230   -6.213  8.124   1.00 0.00 ? 109 GLN A HB2  2  
ATOM 3894  H HB3  . GLN A 1 109 ? 2.111   -7.482  7.641   1.00 0.00 ? 109 GLN A HB3  2  
ATOM 3895  H HG2  . GLN A 1 109 ? 3.654   -8.423  6.146   1.00 0.00 ? 109 GLN A HG2  2  
ATOM 3896  H HG3  . GLN A 1 109 ? 4.690   -6.997  6.190   1.00 0.00 ? 109 GLN A HG3  2  
ATOM 3897  H HE21 . GLN A 1 109 ? 6.546   -7.783  6.959   1.00 0.00 ? 109 GLN A HE21 2  
ATOM 3898  H HE22 . GLN A 1 109 ? 6.727   -8.612  8.463   1.00 0.00 ? 109 GLN A HE22 2  
ATOM 3899  N N    . VAL A 1 110 ? 0.542   -7.396  5.493   1.00 0.00 ? 110 VAL A N    2  
ATOM 3900  C CA   . VAL A 1 110 ? -0.183  -8.220  4.533   1.00 0.00 ? 110 VAL A CA   2  
ATOM 3901  C C    . VAL A 1 110 ? -0.600  -7.405  3.314   1.00 0.00 ? 110 VAL A C    2  
ATOM 3902  O O    . VAL A 1 110 ? -0.515  -7.877  2.180   1.00 0.00 ? 110 VAL A O    2  
ATOM 3903  C CB   . VAL A 1 110 ? -1.438  -8.850  5.168   1.00 0.00 ? 110 VAL A CB   2  
ATOM 3904  C CG1  . VAL A 1 110 ? -1.047  -9.806  6.286   1.00 0.00 ? 110 VAL A CG1  2  
ATOM 3905  C CG2  . VAL A 1 110 ? -2.374  -7.767  5.684   1.00 0.00 ? 110 VAL A CG2  2  
ATOM 3906  H H    . VAL A 1 110 ? 0.231   -7.360  6.422   1.00 0.00 ? 110 VAL A H    2  
ATOM 3907  H HA   . VAL A 1 110 ? 0.472   -9.017  4.214   1.00 0.00 ? 110 VAL A HA   2  
ATOM 3908  H HB   . VAL A 1 110 ? -1.958  -9.413  4.407   1.00 0.00 ? 110 VAL A HB   2  
ATOM 3909  H HG11 . VAL A 1 110 ? -0.850  -9.245  7.186   1.00 0.00 ? 110 VAL A HG11 2  
ATOM 3910  H HG12 . VAL A 1 110 ? -1.854  -10.502 6.462   1.00 0.00 ? 110 VAL A HG12 2  
ATOM 3911  H HG13 . VAL A 1 110 ? -0.160  -10.350 5.999   1.00 0.00 ? 110 VAL A HG13 2  
ATOM 3912  H HG21 . VAL A 1 110 ? -2.936  -8.149  6.524   1.00 0.00 ? 110 VAL A HG21 2  
ATOM 3913  H HG22 . VAL A 1 110 ? -1.796  -6.911  5.998   1.00 0.00 ? 110 VAL A HG22 2  
ATOM 3914  H HG23 . VAL A 1 110 ? -3.055  -7.475  4.899   1.00 0.00 ? 110 VAL A HG23 2  
ATOM 3915  N N    . SER A 1 111 ? -1.052  -6.178  3.555   1.00 0.00 ? 111 SER A N    2  
ATOM 3916  C CA   . SER A 1 111 ? -1.485  -5.297  2.476   1.00 0.00 ? 111 SER A CA   2  
ATOM 3917  C C    . SER A 1 111 ? -0.409  -5.188  1.399   1.00 0.00 ? 111 SER A C    2  
ATOM 3918  O O    . SER A 1 111 ? -0.703  -5.247  0.204   1.00 0.00 ? 111 SER A O    2  
ATOM 3919  C CB   . SER A 1 111 ? -1.817  -3.909  3.025   1.00 0.00 ? 111 SER A CB   2  
ATOM 3920  O OG   . SER A 1 111 ? -2.746  -3.239  2.192   1.00 0.00 ? 111 SER A OG   2  
ATOM 3921  H H    . SER A 1 111 ? -1.097  -5.859  4.480   1.00 0.00 ? 111 SER A H    2  
ATOM 3922  H HA   . SER A 1 111 ? -2.375  -5.724  2.037   1.00 0.00 ? 111 SER A HA   2  
ATOM 3923  H HB2  . SER A 1 111 ? -2.242  -4.007  4.013   1.00 0.00 ? 111 SER A HB2  2  
ATOM 3924  H HB3  . SER A 1 111 ? -0.911  -3.321  3.080   1.00 0.00 ? 111 SER A HB3  2  
ATOM 3925  H HG   . SER A 1 111 ? -2.776  -3.670  1.334   1.00 0.00 ? 111 SER A HG   2  
ATOM 3926  N N    . LEU A 1 112 ? 0.836   -5.027  1.831   1.00 0.00 ? 112 LEU A N    2  
ATOM 3927  C CA   . LEU A 1 112 ? 1.957   -4.910  0.905   1.00 0.00 ? 112 LEU A CA   2  
ATOM 3928  C C    . LEU A 1 112 ? 2.306   -6.264  0.296   1.00 0.00 ? 112 LEU A C    2  
ATOM 3929  O O    . LEU A 1 112 ? 2.613   -6.361  -0.893  1.00 0.00 ? 112 LEU A O    2  
ATOM 3930  C CB   . LEU A 1 112 ? 3.178   -4.330  1.622   1.00 0.00 ? 112 LEU A CB   2  
ATOM 3931  C CG   . LEU A 1 112 ? 2.971   -2.984  2.318   1.00 0.00 ? 112 LEU A CG   2  
ATOM 3932  C CD1  . LEU A 1 112 ? 4.218   -2.588  3.094   1.00 0.00 ? 112 LEU A CD1  2  
ATOM 3933  C CD2  . LEU A 1 112 ? 2.610   -1.910  1.304   1.00 0.00 ? 112 LEU A CD2  2  
ATOM 3934  H H    . LEU A 1 112 ? 1.008   -4.987  2.794   1.00 0.00 ? 112 LEU A H    2  
ATOM 3935  H HA   . LEU A 1 112 ? 1.663   -4.236  0.113   1.00 0.00 ? 112 LEU A HA   2  
ATOM 3936  H HB2  . LEU A 1 112 ? 3.492   -5.044  2.369   1.00 0.00 ? 112 LEU A HB2  2  
ATOM 3937  H HB3  . LEU A 1 112 ? 3.963   -4.208  0.890   1.00 0.00 ? 112 LEU A HB3  2  
ATOM 3938  H HG   . LEU A 1 112 ? 2.155   -3.072  3.021   1.00 0.00 ? 112 LEU A HG   2  
ATOM 3939  H HD11 . LEU A 1 112 ? 3.984   -1.769  3.756   1.00 0.00 ? 112 LEU A HD11 2  
ATOM 3940  H HD12 . LEU A 1 112 ? 4.991   -2.285  2.403   1.00 0.00 ? 112 LEU A HD12 2  
ATOM 3941  H HD13 . LEU A 1 112 ? 4.565   -3.432  3.673   1.00 0.00 ? 112 LEU A HD13 2  
ATOM 3942  H HD21 . LEU A 1 112 ? 1.746   -1.363  1.653   1.00 0.00 ? 112 LEU A HD21 2  
ATOM 3943  H HD22 . LEU A 1 112 ? 2.383   -2.373  0.354   1.00 0.00 ? 112 LEU A HD22 2  
ATOM 3944  H HD23 . LEU A 1 112 ? 3.441   -1.231  1.185   1.00 0.00 ? 112 LEU A HD23 2  
ATOM 3945  N N    . LEU A 1 113 ? 2.254   -7.307  1.117   1.00 0.00 ? 113 LEU A N    2  
ATOM 3946  C CA   . LEU A 1 113 ? 2.562   -8.657  0.659   1.00 0.00 ? 113 LEU A CA   2  
ATOM 3947  C C    . LEU A 1 113 ? 1.551   -9.122  -0.385  1.00 0.00 ? 113 LEU A C    2  
ATOM 3948  O O    . LEU A 1 113 ? 1.852   -9.977  -1.216  1.00 0.00 ? 113 LEU A O    2  
ATOM 3949  C CB   . LEU A 1 113 ? 2.574   -9.627  1.842   1.00 0.00 ? 113 LEU A CB   2  
ATOM 3950  C CG   . LEU A 1 113 ? 3.853   -9.648  2.680   1.00 0.00 ? 113 LEU A CG   2  
ATOM 3951  C CD1  . LEU A 1 113 ? 3.641   -10.443 3.958   1.00 0.00 ? 113 LEU A CD1  2  
ATOM 3952  C CD2  . LEU A 1 113 ? 5.009   -10.226 1.875   1.00 0.00 ? 113 LEU A CD2  2  
ATOM 3953  H H    . LEU A 1 113 ? 2.003   -7.166  2.054   1.00 0.00 ? 113 LEU A H    2  
ATOM 3954  H HA   . LEU A 1 113 ? 3.544   -8.638  0.209   1.00 0.00 ? 113 LEU A HA   2  
ATOM 3955  H HB2  . LEU A 1 113 ? 1.756   -9.363  2.494   1.00 0.00 ? 113 LEU A HB2  2  
ATOM 3956  H HB3  . LEU A 1 113 ? 2.416   -10.623 1.453   1.00 0.00 ? 113 LEU A HB3  2  
ATOM 3957  H HG   . LEU A 1 113 ? 4.111   -8.635  2.957   1.00 0.00 ? 113 LEU A HG   2  
ATOM 3958  H HD11 . LEU A 1 113 ? 2.665   -10.221 4.363   1.00 0.00 ? 113 LEU A HD11 2  
ATOM 3959  H HD12 . LEU A 1 113 ? 4.400   -10.177 4.679   1.00 0.00 ? 113 LEU A HD12 2  
ATOM 3960  H HD13 . LEU A 1 113 ? 3.708   -11.499 3.740   1.00 0.00 ? 113 LEU A HD13 2  
ATOM 3961  H HD21 . LEU A 1 113 ? 4.846   -11.282 1.721   1.00 0.00 ? 113 LEU A HD21 2  
ATOM 3962  H HD22 . LEU A 1 113 ? 5.932   -10.079 2.415   1.00 0.00 ? 113 LEU A HD22 2  
ATOM 3963  H HD23 . LEU A 1 113 ? 5.066   -9.727  0.919   1.00 0.00 ? 113 LEU A HD23 2  
ATOM 3964  N N    . ALA A 1 114 ? 0.352   -8.551  -0.335  1.00 0.00 ? 114 ALA A N    2  
ATOM 3965  C CA   . ALA A 1 114 ? -0.701  -8.903  -1.278  1.00 0.00 ? 114 ALA A CA   2  
ATOM 3966  C C    . ALA A 1 114 ? -0.668  -7.996  -2.504  1.00 0.00 ? 114 ALA A C    2  
ATOM 3967  O O    . ALA A 1 114 ? -0.869  -8.450  -3.631  1.00 0.00 ? 114 ALA A O    2  
ATOM 3968  C CB   . ALA A 1 114 ? -2.062  -8.830  -0.602  1.00 0.00 ? 114 ALA A CB   2  
ATOM 3969  H H    . ALA A 1 114 ? 0.173   -7.875  0.352   1.00 0.00 ? 114 ALA A H    2  
ATOM 3970  H HA   . ALA A 1 114 ? -0.538  -9.923  -1.595  1.00 0.00 ? 114 ALA A HA   2  
ATOM 3971  H HB1  . ALA A 1 114 ? -2.130  -9.600  0.152   1.00 0.00 ? 114 ALA A HB1  2  
ATOM 3972  H HB2  . ALA A 1 114 ? -2.182  -7.861  -0.139  1.00 0.00 ? 114 ALA A HB2  2  
ATOM 3973  H HB3  . ALA A 1 114 ? -2.838  -8.977  -1.338  1.00 0.00 ? 114 ALA A HB3  2  
ATOM 3974  N N    . LEU A 1 115 ? -0.412  -6.712  -2.277  1.00 0.00 ? 115 LEU A N    2  
ATOM 3975  C CA   . LEU A 1 115 ? -0.352  -5.740  -3.362  1.00 0.00 ? 115 LEU A CA   2  
ATOM 3976  C C    . LEU A 1 115 ? 0.847   -6.007  -4.266  1.00 0.00 ? 115 LEU A C    2  
ATOM 3977  O O    . LEU A 1 115 ? 0.780   -5.804  -5.479  1.00 0.00 ? 115 LEU A O    2  
ATOM 3978  C CB   . LEU A 1 115 ? -0.275  -4.320  -2.798  1.00 0.00 ? 115 LEU A CB   2  
ATOM 3979  C CG   . LEU A 1 115 ? 0.224   -3.241  -3.760  1.00 0.00 ? 115 LEU A CG   2  
ATOM 3980  C CD1  . LEU A 1 115 ? -0.938  -2.639  -4.536  1.00 0.00 ? 115 LEU A CD1  2  
ATOM 3981  C CD2  . LEU A 1 115 ? 0.980   -2.159  -3.003  1.00 0.00 ? 115 LEU A CD2  2  
ATOM 3982  H H    . LEU A 1 115 ? -0.260  -6.410  -1.357  1.00 0.00 ? 115 LEU A H    2  
ATOM 3983  H HA   . LEU A 1 115 ? -1.256  -5.838  -3.944  1.00 0.00 ? 115 LEU A HA   2  
ATOM 3984  H HB2  . LEU A 1 115 ? -1.264  -4.039  -2.471  1.00 0.00 ? 115 LEU A HB2  2  
ATOM 3985  H HB3  . LEU A 1 115 ? 0.391   -4.339  -1.947  1.00 0.00 ? 115 LEU A HB3  2  
ATOM 3986  H HG   . LEU A 1 115 ? 0.903   -3.690  -4.473  1.00 0.00 ? 115 LEU A HG   2  
ATOM 3987  H HD11 . LEU A 1 115 ? -0.990  -3.091  -5.515  1.00 0.00 ? 115 LEU A HD11 2  
ATOM 3988  H HD12 . LEU A 1 115 ? -0.789  -1.575  -4.637  1.00 0.00 ? 115 LEU A HD12 2  
ATOM 3989  H HD13 . LEU A 1 115 ? -1.860  -2.825  -4.004  1.00 0.00 ? 115 LEU A HD13 2  
ATOM 3990  H HD21 . LEU A 1 115 ? 1.260   -2.531  -2.028  1.00 0.00 ? 115 LEU A HD21 2  
ATOM 3991  H HD22 . LEU A 1 115 ? 0.348   -1.291  -2.890  1.00 0.00 ? 115 LEU A HD22 2  
ATOM 3992  H HD23 . LEU A 1 115 ? 1.869   -1.889  -3.555  1.00 0.00 ? 115 LEU A HD23 2  
ATOM 3993  N N    . ALA A 1 116 ? 1.942   -6.462  -3.668  1.00 0.00 ? 116 ALA A N    2  
ATOM 3994  C CA   . ALA A 1 116 ? 3.155   -6.761  -4.420  1.00 0.00 ? 116 ALA A CA   2  
ATOM 3995  C C    . ALA A 1 116 ? 2.930   -7.917  -5.388  1.00 0.00 ? 116 ALA A C    2  
ATOM 3996  O O    . ALA A 1 116 ? 3.082   -7.763  -6.599  1.00 0.00 ? 116 ALA A O    2  
ATOM 3997  C CB   . ALA A 1 116 ? 4.300   -7.079  -3.471  1.00 0.00 ? 116 ALA A CB   2  
ATOM 3998  H H    . ALA A 1 116 ? 1.935   -6.602  -2.699  1.00 0.00 ? 116 ALA A H    2  
ATOM 3999  H HA   . ALA A 1 116 ? 3.423   -5.879  -4.985  1.00 0.00 ? 116 ALA A HA   2  
ATOM 4000  H HB1  . ALA A 1 116 ? 3.900   -7.447  -2.537  1.00 0.00 ? 116 ALA A HB1  2  
ATOM 4001  H HB2  . ALA A 1 116 ? 4.935   -7.832  -3.913  1.00 0.00 ? 116 ALA A HB2  2  
ATOM 4002  H HB3  . ALA A 1 116 ? 4.875   -6.184  -3.288  1.00 0.00 ? 116 ALA A HB3  2  
ATOM 4003  N N    . GLY A 1 117 ? 2.570   -9.075  -4.845  1.00 0.00 ? 117 GLY A N    2  
ATOM 4004  C CA   . GLY A 1 117 ? 2.331   -10.242 -5.675  1.00 0.00 ? 117 GLY A CA   2  
ATOM 4005  C C    . GLY A 1 117 ? 1.472   -9.926  -6.884  1.00 0.00 ? 117 GLY A C    2  
ATOM 4006  O O    . GLY A 1 117 ? 1.718   -10.432 -7.980  1.00 0.00 ? 117 GLY A O    2  
ATOM 4007  H H    . GLY A 1 117 ? 2.465   -9.139  -3.873  1.00 0.00 ? 117 GLY A H    2  
ATOM 4008  H HA2  . GLY A 1 117 ? 3.280   -10.631 -6.013  1.00 0.00 ? 117 GLY A HA2  2  
ATOM 4009  H HA3  . GLY A 1 117 ? 1.835   -10.996 -5.082  1.00 0.00 ? 117 GLY A HA3  2  
ATOM 4010  N N    . LYS A 1 118 ? 0.458   -9.090  -6.686  1.00 0.00 ? 118 LYS A N    2  
ATOM 4011  C CA   . LYS A 1 118 ? -0.441  -8.708  -7.768  1.00 0.00 ? 118 LYS A CA   2  
ATOM 4012  C C    . LYS A 1 118 ? 0.221   -7.691  -8.693  1.00 0.00 ? 118 LYS A C    2  
ATOM 4013  O O    . LYS A 1 118 ? 0.071   -7.756  -9.912  1.00 0.00 ? 118 LYS A O    2  
ATOM 4014  C CB   . LYS A 1 118 ? -1.738  -8.128  -7.199  1.00 0.00 ? 118 LYS A CB   2  
ATOM 4015  C CG   . LYS A 1 118 ? -2.771  -7.793  -8.261  1.00 0.00 ? 118 LYS A CG   2  
ATOM 4016  C CD   . LYS A 1 118 ? -4.186  -7.932  -7.727  1.00 0.00 ? 118 LYS A CD   2  
ATOM 4017  C CE   . LYS A 1 118 ? -4.685  -6.631  -7.120  1.00 0.00 ? 118 LYS A CE   2  
ATOM 4018  N NZ   . LYS A 1 118 ? -5.099  -5.654  -8.166  1.00 0.00 ? 118 LYS A NZ   2  
ATOM 4019  H H    . LYS A 1 118 ? 0.313   -8.720  -5.791  1.00 0.00 ? 118 LYS A H    2  
ATOM 4020  H HA   . LYS A 1 118 ? -0.672  -9.596  -8.337  1.00 0.00 ? 118 LYS A HA   2  
ATOM 4021  H HB2  . LYS A 1 118 ? -2.172  -8.847  -6.519  1.00 0.00 ? 118 LYS A HB2  2  
ATOM 4022  H HB3  . LYS A 1 118 ? -1.506  -7.225  -6.654  1.00 0.00 ? 118 LYS A HB3  2  
ATOM 4023  H HG2  . LYS A 1 118 ? -2.621  -6.774  -8.588  1.00 0.00 ? 118 LYS A HG2  2  
ATOM 4024  H HG3  . LYS A 1 118 ? -2.644  -8.463  -9.099  1.00 0.00 ? 118 LYS A HG3  2  
ATOM 4025  H HD2  . LYS A 1 118 ? -4.842  -8.213  -8.538  1.00 0.00 ? 118 LYS A HD2  2  
ATOM 4026  H HD3  . LYS A 1 118 ? -4.200  -8.702  -6.967  1.00 0.00 ? 118 LYS A HD3  2  
ATOM 4027  H HE2  . LYS A 1 118 ? -5.531  -6.844  -6.485  1.00 0.00 ? 118 LYS A HE2  2  
ATOM 4028  H HE3  . LYS A 1 118 ? -3.892  -6.197  -6.529  1.00 0.00 ? 118 LYS A HE3  2  
ATOM 4029  H HZ1  . LYS A 1 118 ? -6.128  -5.506  -8.128  1.00 0.00 ? 118 LYS A HZ1  2  
ATOM 4030  H HZ2  . LYS A 1 118 ? -4.846  -6.012  -9.109  1.00 0.00 ? 118 LYS A HZ2  2  
ATOM 4031  H HZ3  . LYS A 1 118 ? -4.623  -4.743  -8.013  1.00 0.00 ? 118 LYS A HZ3  2  
ATOM 4032  N N    . ALA A 1 119 ? 0.953   -6.751  -8.103  1.00 0.00 ? 119 ALA A N    2  
ATOM 4033  C CA   . ALA A 1 119 ? 1.640   -5.723  -8.874  1.00 0.00 ? 119 ALA A CA   2  
ATOM 4034  C C    . ALA A 1 119 ? 2.670   -6.339  -9.817  1.00 0.00 ? 119 ALA A C    2  
ATOM 4035  O O    . ALA A 1 119 ? 2.908   -5.828  -10.911 1.00 0.00 ? 119 ALA A O    2  
ATOM 4036  C CB   . ALA A 1 119 ? 2.307   -4.722  -7.942  1.00 0.00 ? 119 ALA A CB   2  
ATOM 4037  H H    . ALA A 1 119 ? 1.035   -6.751  -7.127  1.00 0.00 ? 119 ALA A H    2  
ATOM 4038  H HA   . ALA A 1 119 ? 0.902   -5.195  -9.459  1.00 0.00 ? 119 ALA A HA   2  
ATOM 4039  H HB1  . ALA A 1 119 ? 3.228   -4.374  -8.389  1.00 0.00 ? 119 ALA A HB1  2  
ATOM 4040  H HB2  . ALA A 1 119 ? 1.646   -3.884  -7.781  1.00 0.00 ? 119 ALA A HB2  2  
ATOM 4041  H HB3  . ALA A 1 119 ? 2.524   -5.199  -6.998  1.00 0.00 ? 119 ALA A HB3  2  
ATOM 4042  N N    . LYS A 1 120 ? 3.278   -7.437  -9.384  1.00 0.00 ? 120 LYS A N    2  
ATOM 4043  C CA   . LYS A 1 120 ? 4.281   -8.124  -10.188 1.00 0.00 ? 120 LYS A CA   2  
ATOM 4044  C C    . LYS A 1 120 ? 3.810   -8.280  -11.630 1.00 0.00 ? 120 LYS A C    2  
ATOM 4045  O O    . LYS A 1 120 ? 4.590   -8.124  -12.570 1.00 0.00 ? 120 LYS A O    2  
ATOM 4046  C CB   . LYS A 1 120 ? 4.590   -9.500  -9.591  1.00 0.00 ? 120 LYS A CB   2  
ATOM 4047  C CG   . LYS A 1 120 ? 5.673   -9.469  -8.526  1.00 0.00 ? 120 LYS A CG   2  
ATOM 4048  C CD   . LYS A 1 120 ? 7.060   -9.386  -9.142  1.00 0.00 ? 120 LYS A CD   2  
ATOM 4049  C CE   . LYS A 1 120 ? 8.092   -8.913  -8.131  1.00 0.00 ? 120 LYS A CE   2  
ATOM 4050  N NZ   . LYS A 1 120 ? 8.533   -10.013 -7.230  1.00 0.00 ? 120 LYS A NZ   2  
ATOM 4051  H H    . LYS A 1 120 ? 3.045   -7.797  -8.501  1.00 0.00 ? 120 LYS A H    2  
ATOM 4052  H HA   . LYS A 1 120 ? 5.180   -7.526  -10.178 1.00 0.00 ? 120 LYS A HA   2  
ATOM 4053  H HB2  . LYS A 1 120 ? 3.689   -9.896  -9.147  1.00 0.00 ? 120 LYS A HB2  2  
ATOM 4054  H HB3  . LYS A 1 120 ? 4.912   -10.158 -10.384 1.00 0.00 ? 120 LYS A HB3  2  
ATOM 4055  H HG2  . LYS A 1 120 ? 5.521   -8.608  -7.893  1.00 0.00 ? 120 LYS A HG2  2  
ATOM 4056  H HG3  . LYS A 1 120 ? 5.606   -10.371 -7.933  1.00 0.00 ? 120 LYS A HG3  2  
ATOM 4057  H HD2  . LYS A 1 120 ? 7.345   -10.365 -9.499  1.00 0.00 ? 120 LYS A HD2  2  
ATOM 4058  H HD3  . LYS A 1 120 ? 7.034   -8.692  -9.971  1.00 0.00 ? 120 LYS A HD3  2  
ATOM 4059  H HE2  . LYS A 1 120 ? 8.950   -8.530  -8.664  1.00 0.00 ? 120 LYS A HE2  2  
ATOM 4060  H HE3  . LYS A 1 120 ? 7.657   -8.123  -7.536  1.00 0.00 ? 120 LYS A HE3  2  
ATOM 4061  H HZ1  . LYS A 1 120 ? 9.274   -10.577 -7.692  1.00 0.00 ? 120 LYS A HZ1  2  
ATOM 4062  H HZ2  . LYS A 1 120 ? 7.729   -10.634 -7.005  1.00 0.00 ? 120 LYS A HZ2  2  
ATOM 4063  H HZ3  . LYS A 1 120 ? 8.912   -9.620  -6.346  1.00 0.00 ? 120 LYS A HZ3  2  
ATOM 4064  N N    . THR A 1 121 ? 2.527   -8.586  -11.799 1.00 0.00 ? 121 THR A N    2  
ATOM 4065  C CA   . THR A 1 121 ? 1.951   -8.762  -13.127 1.00 0.00 ? 121 THR A CA   2  
ATOM 4066  C C    . THR A 1 121 ? 2.544   -7.769  -14.118 1.00 0.00 ? 121 THR A C    2  
ATOM 4067  O O    . THR A 1 121 ? 2.742   -8.090  -15.291 1.00 0.00 ? 121 THR A O    2  
ATOM 4068  C CB   . THR A 1 121 ? 0.420   -8.593  -13.102 1.00 0.00 ? 121 THR A CB   2  
ATOM 4069  O OG1  . THR A 1 121 ? -0.111  -8.754  -14.421 1.00 0.00 ? 121 THR A OG1  2  
ATOM 4070  C CG2  . THR A 1 121 ? 0.035   -7.226  -12.558 1.00 0.00 ? 121 THR A CG2  2  
ATOM 4071  H H    . THR A 1 121 ? 1.956   -8.698  -11.011 1.00 0.00 ? 121 THR A H    2  
ATOM 4072  H HA   . THR A 1 121 ? 2.176   -9.766  -13.457 1.00 0.00 ? 121 THR A HA   2  
ATOM 4073  H HB   . THR A 1 121 ? 0.000   -9.352  -12.457 1.00 0.00 ? 121 THR A HB   2  
ATOM 4074  H HG1  . THR A 1 121 ? -0.641  -9.555  -14.457 1.00 0.00 ? 121 THR A HG1  2  
ATOM 4075  H HG21 . THR A 1 121 ? -0.124  -6.544  -13.379 1.00 0.00 ? 121 THR A HG21 2  
ATOM 4076  H HG22 . THR A 1 121 ? 0.829   -6.852  -11.928 1.00 0.00 ? 121 THR A HG22 2  
ATOM 4077  H HG23 . THR A 1 121 ? -0.872  -7.311  -11.979 1.00 0.00 ? 121 THR A HG23 2  
ATOM 4078  N N    . LYS A 1 122 ? 2.829   -6.562  -13.643 1.00 0.00 ? 122 LYS A N    2  
ATOM 4079  C CA   . LYS A 1 122 ? 3.403   -5.521  -14.488 1.00 0.00 ? 122 LYS A CA   2  
ATOM 4080  C C    . LYS A 1 122 ? 4.720   -5.983  -15.101 1.00 0.00 ? 122 LYS A C    2  
ATOM 4081  O O    . LYS A 1 122 ? 4.886   -5.975  -16.320 1.00 0.00 ? 122 LYS A O    2  
ATOM 4082  C CB   . LYS A 1 122 ? 3.625   -4.242  -13.677 1.00 0.00 ? 122 LYS A CB   2  
ATOM 4083  C CG   . LYS A 1 122 ? 2.338   -3.600  -13.189 1.00 0.00 ? 122 LYS A CG   2  
ATOM 4084  C CD   . LYS A 1 122 ? 1.697   -2.744  -14.270 1.00 0.00 ? 122 LYS A CD   2  
ATOM 4085  C CE   . LYS A 1 122 ? 0.202   -2.588  -14.043 1.00 0.00 ? 122 LYS A CE   2  
ATOM 4086  N NZ   . LYS A 1 122 ? -0.099  -1.552  -13.016 1.00 0.00 ? 122 LYS A NZ   2  
ATOM 4087  H H    . LYS A 1 122 ? 2.649   -6.366  -12.699 1.00 0.00 ? 122 LYS A H    2  
ATOM 4088  H HA   . LYS A 1 122 ? 2.702   -5.316  -15.282 1.00 0.00 ? 122 LYS A HA   2  
ATOM 4089  H HB2  . LYS A 1 122 ? 4.233   -4.478  -12.816 1.00 0.00 ? 122 LYS A HB2  2  
ATOM 4090  H HB3  . LYS A 1 122 ? 4.148   -3.526  -14.294 1.00 0.00 ? 122 LYS A HB3  2  
ATOM 4091  H HG2  . LYS A 1 122 ? 1.645   -4.376  -12.901 1.00 0.00 ? 122 LYS A HG2  2  
ATOM 4092  H HG3  . LYS A 1 122 ? 2.559   -2.976  -12.334 1.00 0.00 ? 122 LYS A HG3  2  
ATOM 4093  H HD2  . LYS A 1 122 ? 2.155   -1.767  -14.262 1.00 0.00 ? 122 LYS A HD2  2  
ATOM 4094  H HD3  . LYS A 1 122 ? 1.860   -3.213  -15.231 1.00 0.00 ? 122 LYS A HD3  2  
ATOM 4095  H HE2  . LYS A 1 122 ? -0.263  -2.304  -14.974 1.00 0.00 ? 122 LYS A HE2  2  
ATOM 4096  H HE3  . LYS A 1 122 ? -0.200  -3.536  -13.715 1.00 0.00 ? 122 LYS A HE3  2  
ATOM 4097  H HZ1  . LYS A 1 122 ? 0.736   -0.951  -12.861 1.00 0.00 ? 122 LYS A HZ1  2  
ATOM 4098  H HZ2  . LYS A 1 122 ? -0.357  -2.006  -12.116 1.00 0.00 ? 122 LYS A HZ2  2  
ATOM 4099  H HZ3  . LYS A 1 122 ? -0.890  -0.955  -13.331 1.00 0.00 ? 122 LYS A HZ3  2  
ATOM 4100  N N    . GLY A 1 123 ? 5.656   -6.387  -14.246 1.00 0.00 ? 123 GLY A N    2  
ATOM 4101  C CA   . GLY A 1 123 ? 6.947   -6.848  -14.723 1.00 0.00 ? 123 GLY A CA   2  
ATOM 4102  C C    . GLY A 1 123 ? 7.213   -8.297  -14.367 1.00 0.00 ? 123 GLY A C    2  
ATOM 4103  O O    . GLY A 1 123 ? 8.176   -8.605  -13.664 1.00 0.00 ? 123 GLY A O    2  
ATOM 4104  H H    . GLY A 1 123 ? 5.468   -6.372  -13.284 1.00 0.00 ? 123 GLY A H    2  
ATOM 4105  H HA2  . GLY A 1 123 ? 6.981   -6.739  -15.797 1.00 0.00 ? 123 GLY A HA2  2  
ATOM 4106  H HA3  . GLY A 1 123 ? 7.720   -6.234  -14.285 1.00 0.00 ? 123 GLY A HA3  2  
ATOM 4107  N N    . LEU A 1 124 ? 6.357   -9.190  -14.851 1.00 0.00 ? 124 LEU A N    2  
ATOM 4108  C CA   . LEU A 1 124 ? 6.502   -10.616 -14.578 1.00 0.00 ? 124 LEU A CA   2  
ATOM 4109  C C    . LEU A 1 124 ? 7.928   -11.080 -14.856 1.00 0.00 ? 124 LEU A C    2  
ATOM 4110  O O    . LEU A 1 124 ? 8.340   -11.191 -16.011 1.00 0.00 ? 124 LEU A O    2  
ATOM 4111  C CB   . LEU A 1 124 ? 5.516   -11.421 -15.428 1.00 0.00 ? 124 LEU A CB   2  
ATOM 4112  C CG   . LEU A 1 124 ? 4.037   -11.246 -15.084 1.00 0.00 ? 124 LEU A CG   2  
ATOM 4113  C CD1  . LEU A 1 124 ? 3.165   -11.975 -16.094 1.00 0.00 ? 124 LEU A CD1  2  
ATOM 4114  C CD2  . LEU A 1 124 ? 3.753   -11.746 -13.675 1.00 0.00 ? 124 LEU A CD2  2  
ATOM 4115  H H    . LEU A 1 124 ? 5.608   -8.884  -15.404 1.00 0.00 ? 124 LEU A H    2  
ATOM 4116  H HA   . LEU A 1 124 ? 6.281   -10.778 -13.534 1.00 0.00 ? 124 LEU A HA   2  
ATOM 4117  H HB2  . LEU A 1 124 ? 5.653   -11.130 -16.457 1.00 0.00 ? 124 LEU A HB2  2  
ATOM 4118  H HB3  . LEU A 1 124 ? 5.762   -12.467 -15.314 1.00 0.00 ? 124 LEU A HB3  2  
ATOM 4119  H HG   . LEU A 1 124 ? 3.787   -10.195 -15.124 1.00 0.00 ? 124 LEU A HG   2  
ATOM 4120  H HD11 . LEU A 1 124 ? 3.469   -11.703 -17.094 1.00 0.00 ? 124 LEU A HD11 2  
ATOM 4121  H HD12 . LEU A 1 124 ? 2.132   -11.697 -15.945 1.00 0.00 ? 124 LEU A HD12 2  
ATOM 4122  H HD13 . LEU A 1 124 ? 3.274   -13.041 -15.962 1.00 0.00 ? 124 LEU A HD13 2  
ATOM 4123  H HD21 . LEU A 1 124 ? 4.037   -10.986 -12.961 1.00 0.00 ? 124 LEU A HD21 2  
ATOM 4124  H HD22 . LEU A 1 124 ? 4.325   -12.644 -13.490 1.00 0.00 ? 124 LEU A HD22 2  
ATOM 4125  H HD23 . LEU A 1 124 ? 2.700   -11.961 -13.574 1.00 0.00 ? 124 LEU A HD23 2  
ATOM 4126  N N    . GLN A 1 125 ? 8.676   -11.351 -13.791 1.00 0.00 ? 125 GLN A N    2  
ATOM 4127  C CA   . GLN A 1 125 ? 10.055  -11.805 -13.922 1.00 0.00 ? 125 GLN A CA   2  
ATOM 4128  C C    . GLN A 1 125 ? 10.451  -12.688 -12.744 1.00 0.00 ? 125 GLN A C    2  
ATOM 4129  O O    . GLN A 1 125 ? 10.004  -12.474 -11.616 1.00 0.00 ? 125 GLN A O    2  
ATOM 4130  C CB   . GLN A 1 125 ? 11.001  -10.606 -14.018 1.00 0.00 ? 125 GLN A CB   2  
ATOM 4131  C CG   . GLN A 1 125 ? 11.242  -10.134 -15.442 1.00 0.00 ? 125 GLN A CG   2  
ATOM 4132  C CD   . GLN A 1 125 ? 12.352  -9.105  -15.535 1.00 0.00 ? 125 GLN A CD   2  
ATOM 4133  O OE1  . GLN A 1 125 ? 12.482  -8.234  -14.675 1.00 0.00 ? 125 GLN A OE1  2  
ATOM 4134  N NE2  . GLN A 1 125 ? 13.162  -9.202  -16.584 1.00 0.00 ? 125 GLN A NE2  2  
ATOM 4135  H H    . GLN A 1 125 ? 8.291   -11.242 -12.898 1.00 0.00 ? 125 GLN A H    2  
ATOM 4136  H HA   . GLN A 1 125 ? 10.128  -12.383 -14.831 1.00 0.00 ? 125 GLN A HA   2  
ATOM 4137  H HB2  . GLN A 1 125 ? 10.582  -9.786  -13.454 1.00 0.00 ? 125 GLN A HB2  2  
ATOM 4138  H HB3  . GLN A 1 125 ? 11.953  -10.881 -13.587 1.00 0.00 ? 125 GLN A HB3  2  
ATOM 4139  H HG2  . GLN A 1 125 ? 11.510  -10.984 -16.051 1.00 0.00 ? 125 GLN A HG2  2  
ATOM 4140  H HG3  . GLN A 1 125 ? 10.331  -9.694  -15.820 1.00 0.00 ? 125 GLN A HG3  2  
ATOM 4141  H HE21 . GLN A 1 125 ? 12.998  -9.921  -17.230 1.00 0.00 ? 125 GLN A HE21 2  
ATOM 4142  H HE22 . GLN A 1 125 ? 13.887  -8.549  -16.670 1.00 0.00 ? 125 GLN A HE22 2  
ATOM 4143  N N    . SER A 1 126 ? 11.292  -13.682 -13.012 1.00 0.00 ? 126 SER A N    2  
ATOM 4144  C CA   . SER A 1 126 ? 11.745  -14.601 -11.975 1.00 0.00 ? 126 SER A CA   2  
ATOM 4145  C C    . SER A 1 126 ? 13.023  -15.317 -12.404 1.00 0.00 ? 126 SER A C    2  
ATOM 4146  O O    . SER A 1 126 ? 13.496  -15.148 -13.527 1.00 0.00 ? 126 SER A O    2  
ATOM 4147  C CB   . SER A 1 126 ? 10.654  -15.626 -11.659 1.00 0.00 ? 126 SER A CB   2  
ATOM 4148  O OG   . SER A 1 126 ? 10.808  -16.149 -10.351 1.00 0.00 ? 126 SER A OG   2  
ATOM 4149  H H    . SER A 1 126 ? 11.614  -13.801 -13.931 1.00 0.00 ? 126 SER A H    2  
ATOM 4150  H HA   . SER A 1 126 ? 11.952  -14.023 -11.087 1.00 0.00 ? 126 SER A HA   2  
ATOM 4151  H HB2  . SER A 1 126 ? 9.687   -15.152 -11.733 1.00 0.00 ? 126 SER A HB2  2  
ATOM 4152  H HB3  . SER A 1 126 ? 10.711  -16.439 -12.368 1.00 0.00 ? 126 SER A HB3  2  
ATOM 4153  H HG   . SER A 1 126 ? 10.009  -15.985 -9.845  1.00 0.00 ? 126 SER A HG   2  
ATOM 4154  N N    . GLY A 1 127 ? 13.576  -16.120 -11.500 1.00 0.00 ? 127 GLY A N    2  
ATOM 4155  C CA   . GLY A 1 127 ? 14.793  -16.850 -11.801 1.00 0.00 ? 127 GLY A CA   2  
ATOM 4156  C C    . GLY A 1 127 ? 14.535  -18.316 -12.083 1.00 0.00 ? 127 GLY A C    2  
ATOM 4157  O O    . GLY A 1 127 ? 13.427  -18.810 -11.872 1.00 0.00 ? 127 GLY A O    2  
ATOM 4158  H H    . GLY A 1 127 ? 13.154  -16.216 -10.620 1.00 0.00 ? 127 GLY A H    2  
ATOM 4159  H HA2  . GLY A 1 127 ? 15.262  -16.404 -12.666 1.00 0.00 ? 127 GLY A HA2  2  
ATOM 4160  H HA3  . GLY A 1 127 ? 15.465  -16.770 -10.959 1.00 0.00 ? 127 GLY A HA3  2  
ATOM 4161  N N    . VAL A 1 128 ? 15.559  -19.014 -12.566 1.00 0.00 ? 128 VAL A N    2  
ATOM 4162  C CA   . VAL A 1 128 ? 15.436  -20.433 -12.879 1.00 0.00 ? 128 VAL A CA   2  
ATOM 4163  C C    . VAL A 1 128 ? 14.920  -21.218 -11.678 1.00 0.00 ? 128 VAL A C    2  
ATOM 4164  O O    . VAL A 1 128 ? 15.625  -21.386 -10.683 1.00 0.00 ? 128 VAL A O    2  
ATOM 4165  C CB   . VAL A 1 128 ? 16.786  -21.026 -13.325 1.00 0.00 ? 128 VAL A CB   2  
ATOM 4166  C CG1  . VAL A 1 128 ? 16.643  -22.511 -13.623 1.00 0.00 ? 128 VAL A CG1  2  
ATOM 4167  C CG2  . VAL A 1 128 ? 17.321  -20.281 -14.538 1.00 0.00 ? 128 VAL A CG2  2  
ATOM 4168  H H    . VAL A 1 128 ? 16.416  -18.564 -12.713 1.00 0.00 ? 128 VAL A H    2  
ATOM 4169  H HA   . VAL A 1 128 ? 14.734  -20.536 -13.693 1.00 0.00 ? 128 VAL A HA   2  
ATOM 4170  H HB   . VAL A 1 128 ? 17.493  -20.911 -12.517 1.00 0.00 ? 128 VAL A HB   2  
ATOM 4171  H HG11 . VAL A 1 128 ? 17.042  -23.084 -12.798 1.00 0.00 ? 128 VAL A HG11 2  
ATOM 4172  H HG12 . VAL A 1 128 ? 15.599  -22.753 -13.758 1.00 0.00 ? 128 VAL A HG12 2  
ATOM 4173  H HG13 . VAL A 1 128 ? 17.189  -22.752 -14.522 1.00 0.00 ? 128 VAL A HG13 2  
ATOM 4174  H HG21 . VAL A 1 128 ? 18.400  -20.303 -14.526 1.00 0.00 ? 128 VAL A HG21 2  
ATOM 4175  H HG22 . VAL A 1 128 ? 16.961  -20.754 -15.440 1.00 0.00 ? 128 VAL A HG22 2  
ATOM 4176  H HG23 . VAL A 1 128 ? 16.980  -19.256 -14.510 1.00 0.00 ? 128 VAL A HG23 2  
ATOM 4177  N N    . ASP A 1 129 ? 13.685  -21.698 -11.779 1.00 0.00 ? 129 ASP A N    2  
ATOM 4178  C CA   . ASP A 1 129 ? 13.074  -22.467 -10.701 1.00 0.00 ? 129 ASP A CA   2  
ATOM 4179  C C    . ASP A 1 129 ? 11.847  -23.223 -11.203 1.00 0.00 ? 129 ASP A C    2  
ATOM 4180  O O    . ASP A 1 129 ? 11.322  -22.931 -12.278 1.00 0.00 ? 129 ASP A O    2  
ATOM 4181  C CB   . ASP A 1 129 ? 12.684  -21.546 -9.546  1.00 0.00 ? 129 ASP A CB   2  
ATOM 4182  C CG   . ASP A 1 129 ? 11.496  -20.665 -9.882  1.00 0.00 ? 129 ASP A CG   2  
ATOM 4183  O OD1  . ASP A 1 129 ? 11.409  -20.206 -11.040 1.00 0.00 ? 129 ASP A OD1  2  
ATOM 4184  O OD2  . ASP A 1 129 ? 10.656  -20.434 -8.988  1.00 0.00 ? 129 ASP A OD2  2  
ATOM 4185  H H    . ASP A 1 129 ? 13.173  -21.531 -12.598 1.00 0.00 ? 129 ASP A H    2  
ATOM 4186  H HA   . ASP A 1 129 ? 13.802  -23.182 -10.350 1.00 0.00 ? 129 ASP A HA   2  
ATOM 4187  H HB2  . ASP A 1 129 ? 12.430  -22.147 -8.685  1.00 0.00 ? 129 ASP A HB2  2  
ATOM 4188  H HB3  . ASP A 1 129 ? 13.523  -20.911 -9.301  1.00 0.00 ? 129 ASP A HB3  2  
ATOM 4189  N N    . ILE A 1 130 ? 11.395  -24.195 -10.418 1.00 0.00 ? 130 ILE A N    2  
ATOM 4190  C CA   . ILE A 1 130 ? 10.230  -24.992 -10.782 1.00 0.00 ? 130 ILE A CA   2  
ATOM 4191  C C    . ILE A 1 130 ? 9.111   -24.829 -9.758  1.00 0.00 ? 130 ILE A C    2  
ATOM 4192  O O    . ILE A 1 130 ? 8.021   -24.361 -10.085 1.00 0.00 ? 130 ILE A O    2  
ATOM 4193  C CB   . ILE A 1 130 ? 10.586  -26.486 -10.903 1.00 0.00 ? 130 ILE A CB   2  
ATOM 4194  C CG1  . ILE A 1 130 ? 11.695  -26.685 -11.938 1.00 0.00 ? 130 ILE A CG1  2  
ATOM 4195  C CG2  . ILE A 1 130 ? 9.353   -27.294 -11.277 1.00 0.00 ? 130 ILE A CG2  2  
ATOM 4196  C CD1  . ILE A 1 130 ? 12.300  -28.071 -11.915 1.00 0.00 ? 130 ILE A CD1  2  
ATOM 4197  H H    . ILE A 1 130 ? 11.856  -24.380 -9.573  1.00 0.00 ? 130 ILE A H    2  
ATOM 4198  H HA   . ILE A 1 130 ? 9.878   -24.647 -11.743 1.00 0.00 ? 130 ILE A HA   2  
ATOM 4199  H HB   . ILE A 1 130 ? 10.935  -26.829 -9.942  1.00 0.00 ? 130 ILE A HB   2  
ATOM 4200  H HG12 . ILE A 1 130 ? 11.293  -26.517 -12.925 1.00 0.00 ? 130 ILE A HG12 2  
ATOM 4201  H HG13 . ILE A 1 130 ? 12.485  -25.973 -11.750 1.00 0.00 ? 130 ILE A HG13 2  
ATOM 4202  H HG21 . ILE A 1 130 ? 8.480   -26.849 -10.824 1.00 0.00 ? 130 ILE A HG21 2  
ATOM 4203  H HG22 . ILE A 1 130 ? 9.237   -27.299 -12.351 1.00 0.00 ? 130 ILE A HG22 2  
ATOM 4204  H HG23 . ILE A 1 130 ? 9.465   -28.308 -10.923 1.00 0.00 ? 130 ILE A HG23 2  
ATOM 4205  H HD11 . ILE A 1 130 ? 11.579  -28.786 -12.283 1.00 0.00 ? 130 ILE A HD11 2  
ATOM 4206  H HD12 . ILE A 1 130 ? 13.180  -28.091 -12.541 1.00 0.00 ? 130 ILE A HD12 2  
ATOM 4207  H HD13 . ILE A 1 130 ? 12.574  -28.327 -10.902 1.00 0.00 ? 130 ILE A HD13 2  
ATOM 4208  N N    . GLY A 1 131 ? 9.390   -25.217 -8.517  1.00 0.00 ? 131 GLY A N    2  
ATOM 4209  C CA   . GLY A 1 131 ? 8.398   -25.104 -7.465  1.00 0.00 ? 131 GLY A CA   2  
ATOM 4210  C C    . GLY A 1 131 ? 8.249   -26.386 -6.669  1.00 0.00 ? 131 GLY A C    2  
ATOM 4211  O O    . GLY A 1 131 ? 7.373   -27.204 -6.954  1.00 0.00 ? 131 GLY A O    2  
ATOM 4212  H H    . GLY A 1 131 ? 10.277  -25.583 -8.315  1.00 0.00 ? 131 GLY A H    2  
ATOM 4213  H HA2  . GLY A 1 131 ? 8.688   -24.309 -6.795  1.00 0.00 ? 131 GLY A HA2  2  
ATOM 4214  H HA3  . GLY A 1 131 ? 7.445   -24.857 -7.909  1.00 0.00 ? 131 GLY A HA3  2  
ATOM 4215  N N    . VAL A 1 132 ? 9.107   -26.564 -5.670  1.00 0.00 ? 132 VAL A N    2  
ATOM 4216  C CA   . VAL A 1 132 ? 9.067   -27.756 -4.832  1.00 0.00 ? 132 VAL A CA   2  
ATOM 4217  C C    . VAL A 1 132 ? 8.670   -27.409 -3.401  1.00 0.00 ? 132 VAL A C    2  
ATOM 4218  O O    . VAL A 1 132 ? 9.367   -26.660 -2.716  1.00 0.00 ? 132 VAL A O    2  
ATOM 4219  C CB   . VAL A 1 132 ? 10.428  -28.477 -4.814  1.00 0.00 ? 132 VAL A CB   2  
ATOM 4220  C CG1  . VAL A 1 132 ? 10.390  -29.668 -3.870  1.00 0.00 ? 132 VAL A CG1  2  
ATOM 4221  C CG2  . VAL A 1 132 ? 10.818  -28.911 -6.219  1.00 0.00 ? 132 VAL A CG2  2  
ATOM 4222  H H    . VAL A 1 132 ? 9.782   -25.877 -5.492  1.00 0.00 ? 132 VAL A H    2  
ATOM 4223  H HA   . VAL A 1 132 ? 8.331   -28.430 -5.245  1.00 0.00 ? 132 VAL A HA   2  
ATOM 4224  H HB   . VAL A 1 132 ? 11.175  -27.784 -4.455  1.00 0.00 ? 132 VAL A HB   2  
ATOM 4225  H HG11 . VAL A 1 132 ? 10.345  -30.582 -4.446  1.00 0.00 ? 132 VAL A HG11 2  
ATOM 4226  H HG12 . VAL A 1 132 ? 11.279  -29.671 -3.257  1.00 0.00 ? 132 VAL A HG12 2  
ATOM 4227  H HG13 . VAL A 1 132 ? 9.516   -29.600 -3.238  1.00 0.00 ? 132 VAL A HG13 2  
ATOM 4228  H HG21 . VAL A 1 132 ? 11.358  -28.113 -6.706  1.00 0.00 ? 132 VAL A HG21 2  
ATOM 4229  H HG22 . VAL A 1 132 ? 11.445  -29.790 -6.164  1.00 0.00 ? 132 VAL A HG22 2  
ATOM 4230  H HG23 . VAL A 1 132 ? 9.928   -29.140 -6.786  1.00 0.00 ? 132 VAL A HG23 2  
ATOM 4231  N N    . LYS A 1 133 ? 7.546   -27.958 -2.954  1.00 0.00 ? 133 LYS A N    2  
ATOM 4232  C CA   . LYS A 1 133 ? 7.056   -27.709 -1.604  1.00 0.00 ? 133 LYS A CA   2  
ATOM 4233  C C    . LYS A 1 133 ? 7.277   -28.925 -0.712  1.00 0.00 ? 133 LYS A C    2  
ATOM 4234  O O    . LYS A 1 133 ? 7.060   -30.062 -1.130  1.00 0.00 ? 133 LYS A O    2  
ATOM 4235  C CB   . LYS A 1 133 ? 5.568   -27.352 -1.637  1.00 0.00 ? 133 LYS A CB   2  
ATOM 4236  C CG   . LYS A 1 133 ? 5.141   -26.419 -0.516  1.00 0.00 ? 133 LYS A CG   2  
ATOM 4237  C CD   . LYS A 1 133 ? 5.541   -24.982 -0.803  1.00 0.00 ? 133 LYS A CD   2  
ATOM 4238  C CE   . LYS A 1 133 ? 5.259   -24.076 0.386   1.00 0.00 ? 133 LYS A CE   2  
ATOM 4239  N NZ   . LYS A 1 133 ? 3.810   -24.044 0.727   1.00 0.00 ? 133 LYS A NZ   2  
ATOM 4240  H H    . LYS A 1 133 ? 7.033   -28.547 -3.548  1.00 0.00 ? 133 LYS A H    2  
ATOM 4241  H HA   . LYS A 1 133 ? 7.608   -26.875 -1.199  1.00 0.00 ? 133 LYS A HA   2  
ATOM 4242  H HB2  . LYS A 1 133 ? 5.346   -26.873 -2.580  1.00 0.00 ? 133 LYS A HB2  2  
ATOM 4243  H HB3  . LYS A 1 133 ? 4.990   -28.261 -1.560  1.00 0.00 ? 133 LYS A HB3  2  
ATOM 4244  H HG2  . LYS A 1 133 ? 4.068   -26.468 -0.409  1.00 0.00 ? 133 LYS A HG2  2  
ATOM 4245  H HG3  . LYS A 1 133 ? 5.611   -26.737 0.403   1.00 0.00 ? 133 LYS A HG3  2  
ATOM 4246  H HD2  . LYS A 1 133 ? 6.598   -24.949 -1.024  1.00 0.00 ? 133 LYS A HD2  2  
ATOM 4247  H HD3  . LYS A 1 133 ? 4.982   -24.625 -1.657  1.00 0.00 ? 133 LYS A HD3  2  
ATOM 4248  H HE2  . LYS A 1 133 ? 5.813   -24.441 1.238   1.00 0.00 ? 133 LYS A HE2  2  
ATOM 4249  H HE3  . LYS A 1 133 ? 5.587   -23.076 0.145   1.00 0.00 ? 133 LYS A HE3  2  
ATOM 4250  H HZ1  . LYS A 1 133 ? 3.542   -23.094 1.053   1.00 0.00 ? 133 LYS A HZ1  2  
ATOM 4251  H HZ2  . LYS A 1 133 ? 3.606   -24.727 1.483   1.00 0.00 ? 133 LYS A HZ2  2  
ATOM 4252  H HZ3  . LYS A 1 133 ? 3.241   -24.286 -0.109  1.00 0.00 ? 133 LYS A HZ3  2  
ATOM 4253  N N    . TYR A 1 134 ? 7.709   -28.679 0.520   1.00 0.00 ? 134 TYR A N    2  
ATOM 4254  C CA   . TYR A 1 134 ? 7.960   -29.755 1.471   1.00 0.00 ? 134 TYR A CA   2  
ATOM 4255  C C    . TYR A 1 134 ? 6.652   -30.375 1.953   1.00 0.00 ? 134 TYR A C    2  
ATOM 4256  O O    . TYR A 1 134 ? 5.909   -29.765 2.722   1.00 0.00 ? 134 TYR A O    2  
ATOM 4257  C CB   . TYR A 1 134 ? 8.759   -29.231 2.667   1.00 0.00 ? 134 TYR A CB   2  
ATOM 4258  C CG   . TYR A 1 134 ? 10.254  -29.243 2.447   1.00 0.00 ? 134 TYR A CG   2  
ATOM 4259  C CD1  . TYR A 1 134 ? 10.882  -28.213 1.757   1.00 0.00 ? 134 TYR A CD1  2  
ATOM 4260  C CD2  . TYR A 1 134 ? 11.040  -30.282 2.928   1.00 0.00 ? 134 TYR A CD2  2  
ATOM 4261  C CE1  . TYR A 1 134 ? 12.248  -28.219 1.553   1.00 0.00 ? 134 TYR A CE1  2  
ATOM 4262  C CE2  . TYR A 1 134 ? 12.407  -30.296 2.730   1.00 0.00 ? 134 TYR A CE2  2  
ATOM 4263  C CZ   . TYR A 1 134 ? 13.007  -29.262 2.042   1.00 0.00 ? 134 TYR A CZ   2  
ATOM 4264  O OH   . TYR A 1 134 ? 14.369  -29.272 1.842   1.00 0.00 ? 134 TYR A OH   2  
ATOM 4265  H H    . TYR A 1 134 ? 7.863   -27.752 0.797   1.00 0.00 ? 134 TYR A H    2  
ATOM 4266  H HA   . TYR A 1 134 ? 8.541   -30.514 0.968   1.00 0.00 ? 134 TYR A HA   2  
ATOM 4267  H HB2  . TYR A 1 134 ? 8.462   -28.215 2.872   1.00 0.00 ? 134 TYR A HB2  2  
ATOM 4268  H HB3  . TYR A 1 134 ? 8.545   -29.845 3.530   1.00 0.00 ? 134 TYR A HB3  2  
ATOM 4269  H HD1  . TYR A 1 134 ? 10.286  -27.397 1.374   1.00 0.00 ? 134 TYR A HD1  2  
ATOM 4270  H HD2  . TYR A 1 134 ? 10.566  -31.090 3.467   1.00 0.00 ? 134 TYR A HD2  2  
ATOM 4271  H HE1  . TYR A 1 134 ? 12.719  -27.410 1.014   1.00 0.00 ? 134 TYR A HE1  2  
ATOM 4272  H HE2  . TYR A 1 134 ? 13.001  -31.113 3.113   1.00 0.00 ? 134 TYR A HE2  2  
ATOM 4273  H HH   . TYR A 1 134 ? 14.607  -30.035 1.310   1.00 0.00 ? 134 TYR A HH   2  
ATOM 4274  N N    . SER A 1 135 ? 6.375   -31.591 1.493   1.00 0.00 ? 135 SER A N    2  
ATOM 4275  C CA   . SER A 1 135 ? 5.156   -32.293 1.872   1.00 0.00 ? 135 SER A CA   2  
ATOM 4276  C C    . SER A 1 135 ? 5.243   -32.797 3.310   1.00 0.00 ? 135 SER A C    2  
ATOM 4277  O O    . SER A 1 135 ? 6.333   -33.035 3.828   1.00 0.00 ? 135 SER A O    2  
ATOM 4278  C CB   . SER A 1 135 ? 4.900   -33.465 0.923   1.00 0.00 ? 135 SER A CB   2  
ATOM 4279  O OG   . SER A 1 135 ? 4.532   -33.006 -0.366  1.00 0.00 ? 135 SER A OG   2  
ATOM 4280  H H    . SER A 1 135 ? 7.006   -32.024 0.881   1.00 0.00 ? 135 SER A H    2  
ATOM 4281  H HA   . SER A 1 135 ? 4.334   -31.595 1.798   1.00 0.00 ? 135 SER A HA   2  
ATOM 4282  H HB2  . SER A 1 135 ? 5.798   -34.058 0.838   1.00 0.00 ? 135 SER A HB2  2  
ATOM 4283  H HB3  . SER A 1 135 ? 4.100   -34.076 1.317   1.00 0.00 ? 135 SER A HB3  2  
ATOM 4284  H HG   . SER A 1 135 ? 3.655   -32.618 -0.330  1.00 0.00 ? 135 SER A HG   2  
ATOM 4285  N N    . GLU A 1 136 ? 4.087   -32.957 3.945   1.00 0.00 ? 136 GLU A N    2  
ATOM 4286  C CA   . GLU A 1 136 ? 4.034   -33.432 5.324   1.00 0.00 ? 136 GLU A CA   2  
ATOM 4287  C C    . GLU A 1 136 ? 3.167   -34.684 5.434   1.00 0.00 ? 136 GLU A C    2  
ATOM 4288  O O    . GLU A 1 136 ? 2.280   -34.913 4.612   1.00 0.00 ? 136 GLU A O    2  
ATOM 4289  C CB   . GLU A 1 136 ? 3.487   -32.338 6.243   1.00 0.00 ? 136 GLU A CB   2  
ATOM 4290  C CG   . GLU A 1 136 ? 2.079   -31.892 5.888   1.00 0.00 ? 136 GLU A CG   2  
ATOM 4291  C CD   . GLU A 1 136 ? 1.451   -31.028 6.964   1.00 0.00 ? 136 GLU A CD   2  
ATOM 4292  O OE1  . GLU A 1 136 ? 1.233   -31.539 8.083   1.00 0.00 ? 136 GLU A OE1  2  
ATOM 4293  O OE2  . GLU A 1 136 ? 1.178   -29.841 6.688   1.00 0.00 ? 136 GLU A OE2  2  
ATOM 4294  H H    . GLU A 1 136 ? 3.251   -32.750 3.478   1.00 0.00 ? 136 GLU A H    2  
ATOM 4295  H HA   . GLU A 1 136 ? 5.039   -33.677 5.629   1.00 0.00 ? 136 GLU A HA   2  
ATOM 4296  H HB2  . GLU A 1 136 ? 3.481   -32.706 7.258   1.00 0.00 ? 136 GLU A HB2  2  
ATOM 4297  H HB3  . GLU A 1 136 ? 4.139   -31.478 6.186   1.00 0.00 ? 136 GLU A HB3  2  
ATOM 4298  H HG2  . GLU A 1 136 ? 2.115   -31.324 4.969   1.00 0.00 ? 136 GLU A HG2  2  
ATOM 4299  H HG3  . GLU A 1 136 ? 1.463   -32.767 5.745   1.00 0.00 ? 136 GLU A HG3  2  
ATOM 4300  N N    . LYS A 1 137 ? 3.433   -35.491 6.456   1.00 0.00 ? 137 LYS A N    2  
ATOM 4301  C CA   . LYS A 1 137 ? 2.679   -36.719 6.676   1.00 0.00 ? 137 LYS A CA   2  
ATOM 4302  C C    . LYS A 1 137 ? 2.412   -36.935 8.162   1.00 0.00 ? 137 LYS A C    2  
ATOM 4303  O O    . LYS A 1 137 ? 3.193   -36.505 9.011   1.00 0.00 ? 137 LYS A O    2  
ATOM 4304  C CB   . LYS A 1 137 ? 3.440   -37.919 6.105   1.00 0.00 ? 137 LYS A CB   2  
ATOM 4305  C CG   . LYS A 1 137 ? 2.592   -39.172 5.980   1.00 0.00 ? 137 LYS A CG   2  
ATOM 4306  C CD   . LYS A 1 137 ? 1.615   -39.071 4.821   1.00 0.00 ? 137 LYS A CD   2  
ATOM 4307  C CE   . LYS A 1 137 ? 0.389   -39.944 5.049   1.00 0.00 ? 137 LYS A CE   2  
ATOM 4308  N NZ   . LYS A 1 137 ? -0.566  -39.320 6.007   1.00 0.00 ? 137 LYS A NZ   2  
ATOM 4309  H H    . LYS A 1 137 ? 4.153   -35.254 7.078   1.00 0.00 ? 137 LYS A H    2  
ATOM 4310  H HA   . LYS A 1 137 ? 1.734   -36.625 6.162   1.00 0.00 ? 137 LYS A HA   2  
ATOM 4311  H HB2  . LYS A 1 137 ? 3.810   -37.660 5.125   1.00 0.00 ? 137 LYS A HB2  2  
ATOM 4312  H HB3  . LYS A 1 137 ? 4.278   -38.139 6.751   1.00 0.00 ? 137 LYS A HB3  2  
ATOM 4313  H HG2  . LYS A 1 137 ? 3.242   -40.021 5.816   1.00 0.00 ? 137 LYS A HG2  2  
ATOM 4314  H HG3  . LYS A 1 137 ? 2.037   -39.314 6.897   1.00 0.00 ? 137 LYS A HG3  2  
ATOM 4315  H HD2  . LYS A 1 137 ? 1.297   -38.044 4.717   1.00 0.00 ? 137 LYS A HD2  2  
ATOM 4316  H HD3  . LYS A 1 137 ? 2.110   -39.390 3.915   1.00 0.00 ? 137 LYS A HD3  2  
ATOM 4317  H HE2  . LYS A 1 137 ? -0.110  -40.095 4.103   1.00 0.00 ? 137 LYS A HE2  2  
ATOM 4318  H HE3  . LYS A 1 137 ? 0.710   -40.897 5.442   1.00 0.00 ? 137 LYS A HE3  2  
ATOM 4319  H HZ1  . LYS A 1 137 ? -1.540  -39.427 5.660   1.00 0.00 ? 137 LYS A HZ1  2  
ATOM 4320  H HZ2  . LYS A 1 137 ? -0.357  -38.307 6.111   1.00 0.00 ? 137 LYS A HZ2  2  
ATOM 4321  H HZ3  . LYS A 1 137 ? -0.487  -39.777 6.937   1.00 0.00 ? 137 LYS A HZ3  2  
ATOM 4322  N N    . GLN A 1 138 ? 1.304   -37.603 8.469   1.00 0.00 ? 138 GLN A N    2  
ATOM 4323  C CA   . GLN A 1 138 ? 0.937   -37.875 9.854   1.00 0.00 ? 138 GLN A CA   2  
ATOM 4324  C C    . GLN A 1 138 ? 0.178   -39.193 9.966   1.00 0.00 ? 138 GLN A C    2  
ATOM 4325  O O    . GLN A 1 138 ? -0.658  -39.512 9.122   1.00 0.00 ? 138 GLN A O    2  
ATOM 4326  C CB   . GLN A 1 138 ? 0.084   -36.733 10.411  1.00 0.00 ? 138 GLN A CB   2  
ATOM 4327  C CG   . GLN A 1 138 ? -0.145  -36.821 11.911  1.00 0.00 ? 138 GLN A CG   2  
ATOM 4328  C CD   . GLN A 1 138 ? -0.398  -35.467 12.543  1.00 0.00 ? 138 GLN A CD   2  
ATOM 4329  O OE1  . GLN A 1 138 ? 0.336   -35.038 13.434  1.00 0.00 ? 138 GLN A OE1  2  
ATOM 4330  N NE2  . GLN A 1 138 ? -1.440  -34.784 12.084  1.00 0.00 ? 138 GLN A NE2  2  
ATOM 4331  H H    . GLN A 1 138 ? 0.723   -37.920 7.749   1.00 0.00 ? 138 GLN A H    2  
ATOM 4332  H HA   . GLN A 1 138 ? 1.846   -37.946 10.431  1.00 0.00 ? 138 GLN A HA   2  
ATOM 4333  H HB2  . GLN A 1 138 ? 0.575   -35.795 10.197  1.00 0.00 ? 138 GLN A HB2  2  
ATOM 4334  H HB3  . GLN A 1 138 ? -0.878  -36.746 9.920   1.00 0.00 ? 138 GLN A HB3  2  
ATOM 4335  H HG2  . GLN A 1 138 ? -1.003  -37.452 12.095  1.00 0.00 ? 138 GLN A HG2  2  
ATOM 4336  H HG3  . GLN A 1 138 ? 0.728   -37.260 12.371  1.00 0.00 ? 138 GLN A HG3  2  
ATOM 4337  H HE21 . GLN A 1 138 ? -1.981  -35.189 11.373  1.00 0.00 ? 138 GLN A HE21 2  
ATOM 4338  H HE22 . GLN A 1 138 ? -1.627  -33.906 12.475  1.00 0.00 ? 138 GLN A HE22 2  
ATOM 4339  N N    . GLU A 1 139 ? 0.478   -39.955 11.014  1.00 0.00 ? 139 GLU A N    2  
ATOM 4340  C CA   . GLU A 1 139 ? -0.176  -41.240 11.235  1.00 0.00 ? 139 GLU A CA   2  
ATOM 4341  C C    . GLU A 1 139 ? 0.013   -41.706 12.676  1.00 0.00 ? 139 GLU A C    2  
ATOM 4342  O O    . GLU A 1 139 ? 1.068   -41.490 13.275  1.00 0.00 ? 139 GLU A O    2  
ATOM 4343  C CB   . GLU A 1 139 ? 0.376   -42.291 10.270  1.00 0.00 ? 139 GLU A CB   2  
ATOM 4344  C CG   . GLU A 1 139 ? -0.310  -43.642 10.384  1.00 0.00 ? 139 GLU A CG   2  
ATOM 4345  C CD   . GLU A 1 139 ? -1.721  -43.627 9.829   1.00 0.00 ? 139 GLU A CD   2  
ATOM 4346  O OE1  . GLU A 1 139 ? -1.983  -42.845 8.892   1.00 0.00 ? 139 GLU A OE1  2  
ATOM 4347  O OE2  . GLU A 1 139 ? -2.564  -44.399 10.333  1.00 0.00 ? 139 GLU A OE2  2  
ATOM 4348  H H    . GLU A 1 139 ? 1.154   -39.646 11.653  1.00 0.00 ? 139 GLU A H    2  
ATOM 4349  H HA   . GLU A 1 139 ? -1.232  -41.112 11.047  1.00 0.00 ? 139 GLU A HA   2  
ATOM 4350  H HB2  . GLU A 1 139 ? 0.256   -41.932 9.259   1.00 0.00 ? 139 GLU A HB2  2  
ATOM 4351  H HB3  . GLU A 1 139 ? 1.429   -42.427 10.471  1.00 0.00 ? 139 GLU A HB3  2  
ATOM 4352  H HG2  . GLU A 1 139 ? 0.268   -44.372 9.838   1.00 0.00 ? 139 GLU A HG2  2  
ATOM 4353  H HG3  . GLU A 1 139 ? -0.351  -43.924 11.425  1.00 0.00 ? 139 GLU A HG3  2  
ATOM 4354  N N    . ARG A 1 140 ? -1.014  -42.345 13.225  1.00 0.00 ? 140 ARG A N    2  
ATOM 4355  C CA   . ARG A 1 140 ? -0.962  -42.840 14.595  1.00 0.00 ? 140 ARG A CA   2  
ATOM 4356  C C    . ARG A 1 140 ? -1.546  -44.246 14.687  1.00 0.00 ? 140 ARG A C    2  
ATOM 4357  O O    . ARG A 1 140 ? -2.522  -44.570 14.009  1.00 0.00 ? 140 ARG A O    2  
ATOM 4358  C CB   . ARG A 1 140 ? -1.722  -41.898 15.530  1.00 0.00 ? 140 ARG A CB   2  
ATOM 4359  C CG   . ARG A 1 140 ? -0.959  -40.628 15.867  1.00 0.00 ? 140 ARG A CG   2  
ATOM 4360  C CD   . ARG A 1 140 ? -1.705  -39.783 16.890  1.00 0.00 ? 140 ARG A CD   2  
ATOM 4361  N NE   . ARG A 1 140 ? -2.910  -39.181 16.326  1.00 0.00 ? 140 ARG A NE   2  
ATOM 4362  C CZ   . ARG A 1 140 ? -3.515  -38.120 16.851  1.00 0.00 ? 140 ARG A CZ   2  
ATOM 4363  N NH1  . ARG A 1 140 ? -3.029  -37.549 17.943  1.00 0.00 ? 140 ARG A NH1  2  
ATOM 4364  N NH2  . ARG A 1 140 ? -4.607  -37.629 16.280  1.00 0.00 ? 140 ARG A NH2  2  
ATOM 4365  H H    . ARG A 1 140 ? -1.827  -42.486 12.697  1.00 0.00 ? 140 ARG A H    2  
ATOM 4366  H HA   . ARG A 1 140 ? 0.074   -42.873 14.896  1.00 0.00 ? 140 ARG A HA   2  
ATOM 4367  H HB2  . ARG A 1 140 ? -2.654  -41.617 15.060  1.00 0.00 ? 140 ARG A HB2  2  
ATOM 4368  H HB3  . ARG A 1 140 ? -1.936  -42.419 16.451  1.00 0.00 ? 140 ARG A HB3  2  
ATOM 4369  H HG2  . ARG A 1 140 ? 0.006   -40.894 16.272  1.00 0.00 ? 140 ARG A HG2  2  
ATOM 4370  H HG3  . ARG A 1 140 ? -0.825  -40.049 14.965  1.00 0.00 ? 140 ARG A HG3  2  
ATOM 4371  H HD2  . ARG A 1 140 ? -1.984  -40.413 17.721  1.00 0.00 ? 140 ARG A HD2  2  
ATOM 4372  H HD3  . ARG A 1 140 ? -1.049  -38.999 17.235  1.00 0.00 ? 140 ARG A HD3  2  
ATOM 4373  H HE   . ARG A 1 140 ? -3.287  -39.587 15.518  1.00 0.00 ? 140 ARG A HE   2  
ATOM 4374  H HH11 . ARG A 1 140 ? -2.204  -37.916 18.374  1.00 0.00 ? 140 ARG A HH11 2  
ATOM 4375  H HH12 . ARG A 1 140 ? -3.485  -36.750 18.335  1.00 0.00 ? 140 ARG A HH12 2  
ATOM 4376  H HH21 . ARG A 1 140 ? -4.977  -38.057 15.455  1.00 0.00 ? 140 ARG A HH21 2  
ATOM 4377  H HH22 . ARG A 1 140 ? -5.062  -36.832 16.675  1.00 0.00 ? 140 ARG A HH22 2  
ATOM 4378  N N    . SER A 1 141 ? -0.943  -45.078 15.531  1.00 0.00 ? 141 SER A N    2  
ATOM 4379  C CA   . SER A 1 141 ? -1.401  -46.451 15.709  1.00 0.00 ? 141 SER A CA   2  
ATOM 4380  C C    . SER A 1 141 ? -2.334  -46.561 16.912  1.00 0.00 ? 141 SER A C    2  
ATOM 4381  O O    . SER A 1 141 ? -1.939  -46.289 18.044  1.00 0.00 ? 141 SER A O    2  
ATOM 4382  C CB   . SER A 1 141 ? -0.206  -47.390 15.888  1.00 0.00 ? 141 SER A CB   2  
ATOM 4383  O OG   . SER A 1 141 ? -0.602  -48.745 15.772  1.00 0.00 ? 141 SER A OG   2  
ATOM 4384  H H    . SER A 1 141 ? -0.171  -44.761 16.044  1.00 0.00 ? 141 SER A H    2  
ATOM 4385  H HA   . SER A 1 141 ? -1.943  -46.738 14.821  1.00 0.00 ? 141 SER A HA   2  
ATOM 4386  H HB2  . SER A 1 141 ? 0.532   -47.177 15.132  1.00 0.00 ? 141 SER A HB2  2  
ATOM 4387  H HB3  . SER A 1 141 ? 0.226   -47.236 16.867  1.00 0.00 ? 141 SER A HB3  2  
ATOM 4388  H HG   . SER A 1 141 ? 0.066   -49.310 16.169  1.00 0.00 ? 141 SER A HG   2  
ATOM 4389  N N    . GLY A 1 142 ? -3.575  -46.963 16.655  1.00 0.00 ? 142 GLY A N    2  
ATOM 4390  C CA   . GLY A 1 142 ? -4.546  -47.102 17.724  1.00 0.00 ? 142 GLY A CA   2  
ATOM 4391  C C    . GLY A 1 142 ? -4.920  -48.549 17.983  1.00 0.00 ? 142 GLY A C    2  
ATOM 4392  O O    . GLY A 1 142 ? -4.841  -49.400 17.098  1.00 0.00 ? 142 GLY A O    2  
ATOM 4393  H H    . GLY A 1 142 ? -3.834  -47.167 15.731  1.00 0.00 ? 142 GLY A H    2  
ATOM 4394  H HA2  . GLY A 1 142 ? -4.132  -46.681 18.629  1.00 0.00 ? 142 GLY A HA2  2  
ATOM 4395  H HA3  . GLY A 1 142 ? -5.438  -46.554 17.459  1.00 0.00 ? 142 GLY A HA3  2  
ATOM 4396  N N    . PRO A 1 143 ? -5.336  -48.843 19.224  1.00 0.00 ? 143 PRO A N    2  
ATOM 4397  C CA   . PRO A 1 143 ? -5.731  -50.197 19.626  1.00 0.00 ? 143 PRO A CA   2  
ATOM 4398  C C    . PRO A 1 143 ? -7.039  -50.635 18.976  1.00 0.00 ? 143 PRO A C    2  
ATOM 4399  O O    . PRO A 1 143 ? -7.749  -49.826 18.381  1.00 0.00 ? 143 PRO A O    2  
ATOM 4400  C CB   . PRO A 1 143 ? -5.899  -50.081 21.143  1.00 0.00 ? 143 PRO A CB   2  
ATOM 4401  C CG   . PRO A 1 143 ? -6.209  -48.643 21.381  1.00 0.00 ? 143 PRO A CG   2  
ATOM 4402  C CD   . PRO A 1 143 ? -5.455  -47.877 20.330  1.00 0.00 ? 143 PRO A CD   2  
ATOM 4403  H HA   . PRO A 1 143 ? -4.959  -50.918 19.402  1.00 0.00 ? 143 PRO A HA   2  
ATOM 4404  H HB2  . PRO A 1 143 ? -6.710  -50.719 21.467  1.00 0.00 ? 143 PRO A HB2  2  
ATOM 4405  H HB3  . PRO A 1 143 ? -4.983  -50.374 21.634  1.00 0.00 ? 143 PRO A HB3  2  
ATOM 4406  H HG2  . PRO A 1 143 ? -7.270  -48.474 21.281  1.00 0.00 ? 143 PRO A HG2  2  
ATOM 4407  H HG3  . PRO A 1 143 ? -5.873  -48.355 22.367  1.00 0.00 ? 143 PRO A HG3  2  
ATOM 4408  H HD2  . PRO A 1 143 ? -6.015  -47.007 20.023  1.00 0.00 ? 143 PRO A HD2  2  
ATOM 4409  H HD3  . PRO A 1 143 ? -4.480  -47.591 20.696  1.00 0.00 ? 143 PRO A HD3  2  
ATOM 4410  N N    . SER A 1 144 ? -7.352  -51.922 19.097  1.00 0.00 ? 144 SER A N    2  
ATOM 4411  C CA   . SER A 1 144 ? -8.573  -52.469 18.519  1.00 0.00 ? 144 SER A CA   2  
ATOM 4412  C C    . SER A 1 144 ? -9.056  -53.680 19.313  1.00 0.00 ? 144 SER A C    2  
ATOM 4413  O O    . SER A 1 144 ? -8.350  -54.184 20.187  1.00 0.00 ? 144 SER A O    2  
ATOM 4414  C CB   . SER A 1 144 ? -8.340  -52.863 17.059  1.00 0.00 ? 144 SER A CB   2  
ATOM 4415  O OG   . SER A 1 144 ? -8.160  -51.716 16.245  1.00 0.00 ? 144 SER A OG   2  
ATOM 4416  H H    . SER A 1 144 ? -6.744  -52.518 19.585  1.00 0.00 ? 144 SER A H    2  
ATOM 4417  H HA   . SER A 1 144 ? -9.333  -51.702 18.560  1.00 0.00 ? 144 SER A HA   2  
ATOM 4418  H HB2  . SER A 1 144 ? -7.457  -53.479 16.992  1.00 0.00 ? 144 SER A HB2  2  
ATOM 4419  H HB3  . SER A 1 144 ? -9.195  -53.416 16.697  1.00 0.00 ? 144 SER A HB3  2  
ATOM 4420  H HG   . SER A 1 144 ? -8.630  -51.835 15.416  1.00 0.00 ? 144 SER A HG   2  
ATOM 4421  N N    . SER A 1 145 ? -10.262 -54.141 19.002  1.00 0.00 ? 145 SER A N    2  
ATOM 4422  C CA   . SER A 1 145 ? -10.841 -55.290 19.687  1.00 0.00 ? 145 SER A CA   2  
ATOM 4423  C C    . SER A 1 145 ? -10.705 -56.553 18.842  1.00 0.00 ? 145 SER A C    2  
ATOM 4424  O O    . SER A 1 145 ? -10.894 -56.523 17.627  1.00 0.00 ? 145 SER A O    2  
ATOM 4425  C CB   . SER A 1 145 ? -12.315 -55.032 20.005  1.00 0.00 ? 145 SER A CB   2  
ATOM 4426  O OG   . SER A 1 145 ? -12.911 -56.164 20.616  1.00 0.00 ? 145 SER A OG   2  
ATOM 4427  H H    . SER A 1 145 ? -10.776 -53.696 18.296  1.00 0.00 ? 145 SER A H    2  
ATOM 4428  H HA   . SER A 1 145 ? -10.302 -55.431 20.613  1.00 0.00 ? 145 SER A HA   2  
ATOM 4429  H HB2  . SER A 1 145 ? -12.394 -54.192 20.678  1.00 0.00 ? 145 SER A HB2  2  
ATOM 4430  H HB3  . SER A 1 145 ? -12.845 -54.811 19.090  1.00 0.00 ? 145 SER A HB3  2  
ATOM 4431  H HG   . SER A 1 145 ? -12.338 -56.925 20.508  1.00 0.00 ? 145 SER A HG   2  
ATOM 4432  N N    . GLY A 1 146 ? -10.376 -57.664 19.495  1.00 0.00 ? 146 GLY A N    2  
ATOM 4433  C CA   . GLY A 1 146 ? -10.220 -58.921 18.789  1.00 0.00 ? 146 GLY A CA   2  
ATOM 4434  C C    . GLY A 1 146 ? -8.993  -59.691 19.238  1.00 0.00 ? 146 GLY A C    2  
ATOM 4435  O O    . GLY A 1 146 ? -8.836  -59.984 20.423  1.00 0.00 ? 146 GLY A O    2  
ATOM 4436  H H    . GLY A 1 146 ? -10.238 -57.627 20.465  1.00 0.00 ? 146 GLY A H    2  
ATOM 4437  H HA2  . GLY A 1 146 ? -11.095 -59.529 18.960  1.00 0.00 ? 146 GLY A HA2  2  
ATOM 4438  H HA3  . GLY A 1 146 ? -10.136 -58.719 17.731  1.00 0.00 ? 146 GLY A HA3  2  
ATOM 4439  N N    . GLY A 1 1   ? -13.351 -18.274 -11.326 1.00 0.00 ? 1   GLY A N    3  
ATOM 4440  C CA   . GLY A 1 1   ? -11.964 -18.700 -11.326 1.00 0.00 ? 1   GLY A CA   3  
ATOM 4441  C C    . GLY A 1 1   ? -11.642 -19.625 -10.171 1.00 0.00 ? 1   GLY A C    3  
ATOM 4442  O O    . GLY A 1 1   ? -12.492 -20.396 -9.727  1.00 0.00 ? 1   GLY A O    3  
ATOM 4443  H H1   . GLY A 1 1   ? -13.667 -17.642 -10.648 1.00 0.00 ? 1   GLY A H1   3  
ATOM 4444  H HA2  . GLY A 1 1   ? -11.757 -19.213 -12.254 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 4445  H HA3  . GLY A 1 1   ? -11.331 -17.827 -11.261 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 4446  N N    . SER A 1 2   ? -10.407 -19.551 -9.682  1.00 0.00 ? 2   SER A N    3  
ATOM 4447  C CA   . SER A 1 2   ? -9.973  -20.392 -8.573  1.00 0.00 ? 2   SER A CA   3  
ATOM 4448  C C    . SER A 1 2   ? -10.819 -20.136 -7.331  1.00 0.00 ? 2   SER A C    3  
ATOM 4449  O O    . SER A 1 2   ? -10.827 -19.030 -6.789  1.00 0.00 ? 2   SER A O    3  
ATOM 4450  C CB   . SER A 1 2   ? -8.497  -20.138 -8.260  1.00 0.00 ? 2   SER A CB   3  
ATOM 4451  O OG   . SER A 1 2   ? -8.096  -20.834 -7.093  1.00 0.00 ? 2   SER A OG   3  
ATOM 4452  H H    . SER A 1 2   ? -9.774  -18.916 -10.078 1.00 0.00 ? 2   SER A H    3  
ATOM 4453  H HA   . SER A 1 2   ? -10.095 -21.423 -8.872  1.00 0.00 ? 2   SER A HA   3  
ATOM 4454  H HB2  . SER A 1 2   ? -7.892  -20.472 -9.090  1.00 0.00 ? 2   SER A HB2  3  
ATOM 4455  H HB3  . SER A 1 2   ? -8.342  -19.080 -8.106  1.00 0.00 ? 2   SER A HB3  3  
ATOM 4456  H HG   . SER A 1 2   ? -7.385  -21.443 -7.311  1.00 0.00 ? 2   SER A HG   3  
ATOM 4457  N N    . SER A 1 3   ? -11.531 -21.165 -6.884  1.00 0.00 ? 3   SER A N    3  
ATOM 4458  C CA   . SER A 1 3   ? -12.385 -21.050 -5.708  1.00 0.00 ? 3   SER A CA   3  
ATOM 4459  C C    . SER A 1 3   ? -12.037 -22.120 -4.678  1.00 0.00 ? 3   SER A C    3  
ATOM 4460  O O    . SER A 1 3   ? -12.176 -23.315 -4.935  1.00 0.00 ? 3   SER A O    3  
ATOM 4461  C CB   . SER A 1 3   ? -13.858 -21.171 -6.106  1.00 0.00 ? 3   SER A CB   3  
ATOM 4462  O OG   . SER A 1 3   ? -14.136 -22.451 -6.647  1.00 0.00 ? 3   SER A OG   3  
ATOM 4463  H H    . SER A 1 3   ? -11.483 -22.021 -7.359  1.00 0.00 ? 3   SER A H    3  
ATOM 4464  H HA   . SER A 1 3   ? -12.218 -20.078 -5.270  1.00 0.00 ? 3   SER A HA   3  
ATOM 4465  H HB2  . SER A 1 3   ? -14.477 -21.019 -5.236  1.00 0.00 ? 3   SER A HB2  3  
ATOM 4466  H HB3  . SER A 1 3   ? -14.088 -20.421 -6.849  1.00 0.00 ? 3   SER A HB3  3  
ATOM 4467  H HG   . SER A 1 3   ? -13.985 -22.438 -7.595  1.00 0.00 ? 3   SER A HG   3  
ATOM 4468  N N    . GLY A 1 4   ? -11.581 -21.681 -3.508  1.00 0.00 ? 4   GLY A N    3  
ATOM 4469  C CA   . GLY A 1 4   ? -11.219 -22.612 -2.456  1.00 0.00 ? 4   GLY A CA   3  
ATOM 4470  C C    . GLY A 1 4   ? -10.003 -22.158 -1.672  1.00 0.00 ? 4   GLY A C    3  
ATOM 4471  O O    . GLY A 1 4   ? -8.883  -22.586 -1.949  1.00 0.00 ? 4   GLY A O    3  
ATOM 4472  H H    . GLY A 1 4   ? -11.490 -20.717 -3.359  1.00 0.00 ? 4   GLY A H    3  
ATOM 4473  H HA2  . GLY A 1 4   ? -12.053 -22.715 -1.778  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 4474  H HA3  . GLY A 1 4   ? -11.008 -23.574 -2.899  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 4475  N N    . SER A 1 5   ? -10.223 -21.287 -0.693  1.00 0.00 ? 5   SER A N    3  
ATOM 4476  C CA   . SER A 1 5   ? -9.136  -20.769 0.129   1.00 0.00 ? 5   SER A CA   3  
ATOM 4477  C C    . SER A 1 5   ? -9.048  -21.525 1.451   1.00 0.00 ? 5   SER A C    3  
ATOM 4478  O O    . SER A 1 5   ? -9.557  -21.069 2.475   1.00 0.00 ? 5   SER A O    3  
ATOM 4479  C CB   . SER A 1 5   ? -9.335  -19.276 0.394   1.00 0.00 ? 5   SER A CB   3  
ATOM 4480  O OG   . SER A 1 5   ? -9.009  -18.506 -0.750  1.00 0.00 ? 5   SER A OG   3  
ATOM 4481  H H    . SER A 1 5   ? -11.140 -20.983 -0.521  1.00 0.00 ? 5   SER A H    3  
ATOM 4482  H HA   . SER A 1 5   ? -8.214  -20.910 -0.414  1.00 0.00 ? 5   SER A HA   3  
ATOM 4483  H HB2  . SER A 1 5   ? -10.366 -19.094 0.654   1.00 0.00 ? 5   SER A HB2  3  
ATOM 4484  H HB3  . SER A 1 5   ? -8.699  -18.971 1.212   1.00 0.00 ? 5   SER A HB3  3  
ATOM 4485  H HG   . SER A 1 5   ? -8.567  -17.699 -0.478  1.00 0.00 ? 5   SER A HG   3  
ATOM 4486  N N    . SER A 1 6   ? -8.398  -22.684 1.421   1.00 0.00 ? 6   SER A N    3  
ATOM 4487  C CA   . SER A 1 6   ? -8.245  -23.507 2.616   1.00 0.00 ? 6   SER A CA   3  
ATOM 4488  C C    . SER A 1 6   ? -7.554  -22.725 3.729   1.00 0.00 ? 6   SER A C    3  
ATOM 4489  O O    . SER A 1 6   ? -6.373  -22.394 3.630   1.00 0.00 ? 6   SER A O    3  
ATOM 4490  C CB   . SER A 1 6   ? -7.446  -24.770 2.292   1.00 0.00 ? 6   SER A CB   3  
ATOM 4491  O OG   . SER A 1 6   ? -6.121  -24.450 1.904   1.00 0.00 ? 6   SER A OG   3  
ATOM 4492  H H    . SER A 1 6   ? -8.014  -22.994 0.574   1.00 0.00 ? 6   SER A H    3  
ATOM 4493  H HA   . SER A 1 6   ? -9.232  -23.791 2.951   1.00 0.00 ? 6   SER A HA   3  
ATOM 4494  H HB2  . SER A 1 6   ? -7.410  -25.404 3.165   1.00 0.00 ? 6   SER A HB2  3  
ATOM 4495  H HB3  . SER A 1 6   ? -7.928  -25.300 1.482   1.00 0.00 ? 6   SER A HB3  3  
ATOM 4496  H HG   . SER A 1 6   ? -5.926  -24.862 1.060   1.00 0.00 ? 6   SER A HG   3  
ATOM 4497  N N    . GLY A 1 7   ? -8.300  -22.433 4.790   1.00 0.00 ? 7   GLY A N    3  
ATOM 4498  C CA   . GLY A 1 7   ? -7.744  -21.692 5.907   1.00 0.00 ? 7   GLY A CA   3  
ATOM 4499  C C    . GLY A 1 7   ? -7.081  -22.596 6.928   1.00 0.00 ? 7   GLY A C    3  
ATOM 4500  O O    . GLY A 1 7   ? -7.688  -23.550 7.409   1.00 0.00 ? 7   GLY A O    3  
ATOM 4501  H H    . GLY A 1 7   ? -9.237  -22.723 4.814   1.00 0.00 ? 7   GLY A H    3  
ATOM 4502  H HA2  . GLY A 1 7   ? -7.012  -20.992 5.531   1.00 0.00 ? 7   GLY A HA2  3  
ATOM 4503  H HA3  . GLY A 1 7   ? -8.538  -21.143 6.392   1.00 0.00 ? 7   GLY A HA3  3  
ATOM 4504  N N    . ASN A 1 8   ? -5.829  -22.294 7.258   1.00 0.00 ? 8   ASN A N    3  
ATOM 4505  C CA   . ASN A 1 8   ? -5.081  -23.087 8.227   1.00 0.00 ? 8   ASN A CA   3  
ATOM 4506  C C    . ASN A 1 8   ? -5.102  -22.425 9.602   1.00 0.00 ? 8   ASN A C    3  
ATOM 4507  O O    . ASN A 1 8   ? -5.570  -23.012 10.578  1.00 0.00 ? 8   ASN A O    3  
ATOM 4508  C CB   . ASN A 1 8   ? -3.637  -23.274 7.759   1.00 0.00 ? 8   ASN A CB   3  
ATOM 4509  C CG   . ASN A 1 8   ? -3.544  -23.573 6.277   1.00 0.00 ? 8   ASN A CG   3  
ATOM 4510  O OD1  . ASN A 1 8   ? -3.716  -22.686 5.440   1.00 0.00 ? 8   ASN A OD1  3  
ATOM 4511  N ND2  . ASN A 1 8   ? -3.271  -24.830 5.942   1.00 0.00 ? 8   ASN A ND2  3  
ATOM 4512  H H    . ASN A 1 8   ? -5.397  -21.520 6.840   1.00 0.00 ? 8   ASN A H    3  
ATOM 4513  H HA   . ASN A 1 8   ? -5.556  -24.054 8.300   1.00 0.00 ? 8   ASN A HA   3  
ATOM 4514  H HB2  . ASN A 1 8   ? -3.080  -22.369 7.960   1.00 0.00 ? 8   ASN A HB2  3  
ATOM 4515  H HB3  . ASN A 1 8   ? -3.192  -24.094 8.303   1.00 0.00 ? 8   ASN A HB3  3  
ATOM 4516  H HD21 . ASN A 1 8   ? -3.148  -25.484 6.661   1.00 0.00 ? 8   ASN A HD21 3  
ATOM 4517  H HD22 . ASN A 1 8   ? -3.205  -25.050 4.990   1.00 0.00 ? 8   ASN A HD22 3  
ATOM 4518  N N    . ARG A 1 9   ? -4.590  -21.202 9.671   1.00 0.00 ? 9   ARG A N    3  
ATOM 4519  C CA   . ARG A 1 9   ? -4.548  -20.461 10.926  1.00 0.00 ? 9   ARG A CA   3  
ATOM 4520  C C    . ARG A 1 9   ? -5.173  -19.078 10.763  1.00 0.00 ? 9   ARG A C    3  
ATOM 4521  O O    . ARG A 1 9   ? -4.723  -18.274 9.944   1.00 0.00 ? 9   ARG A O    3  
ATOM 4522  C CB   . ARG A 1 9   ? -3.104  -20.325 11.415  1.00 0.00 ? 9   ARG A CB   3  
ATOM 4523  C CG   . ARG A 1 9   ? -2.540  -21.605 12.008  1.00 0.00 ? 9   ARG A CG   3  
ATOM 4524  C CD   . ARG A 1 9   ? -2.942  -21.769 13.466  1.00 0.00 ? 9   ARG A CD   3  
ATOM 4525  N NE   . ARG A 1 9   ? -2.212  -22.854 14.116  1.00 0.00 ? 9   ARG A NE   3  
ATOM 4526  C CZ   . ARG A 1 9   ? -2.086  -22.969 15.433  1.00 0.00 ? 9   ARG A CZ   3  
ATOM 4527  N NH1  . ARG A 1 9   ? -2.641  -22.070 16.237  1.00 0.00 ? 9   ARG A NH1  3  
ATOM 4528  N NH2  . ARG A 1 9   ? -1.406  -23.984 15.950  1.00 0.00 ? 9   ARG A NH2  3  
ATOM 4529  H H    . ARG A 1 9   ? -4.231  -20.786 8.860   1.00 0.00 ? 9   ARG A H    3  
ATOM 4530  H HA   . ARG A 1 9   ? -5.116  -21.015 11.658  1.00 0.00 ? 9   ARG A HA   3  
ATOM 4531  H HB2  . ARG A 1 9   ? -2.480  -20.034 10.583  1.00 0.00 ? 9   ARG A HB2  3  
ATOM 4532  H HB3  . ARG A 1 9   ? -3.064  -19.555 12.172  1.00 0.00 ? 9   ARG A HB3  3  
ATOM 4533  H HG2  . ARG A 1 9   ? -2.915  -22.448 11.446  1.00 0.00 ? 9   ARG A HG2  3  
ATOM 4534  H HG3  . ARG A 1 9   ? -1.463  -21.577 11.942  1.00 0.00 ? 9   ARG A HG3  3  
ATOM 4535  H HD2  . ARG A 1 9   ? -2.738  -20.846 13.988  1.00 0.00 ? 9   ARG A HD2  3  
ATOM 4536  H HD3  . ARG A 1 9   ? -3.999  -21.982 13.511  1.00 0.00 ? 9   ARG A HD3  3  
ATOM 4537  H HE   . ARG A 1 9   ? -1.794  -23.529 13.542  1.00 0.00 ? 9   ARG A HE   3  
ATOM 4538  H HH11 . ARG A 1 9   ? -3.155  -21.305 15.849  1.00 0.00 ? 9   ARG A HH11 3  
ATOM 4539  H HH12 . ARG A 1 9   ? -2.546  -22.160 17.228  1.00 0.00 ? 9   ARG A HH12 3  
ATOM 4540  H HH21 . ARG A 1 9   ? -0.988  -24.663 15.349  1.00 0.00 ? 9   ARG A HH21 3  
ATOM 4541  H HH22 . ARG A 1 9   ? -1.313  -24.069 16.942  1.00 0.00 ? 9   ARG A HH22 3  
ATOM 4542  N N    . LEU A 1 10  ? -6.211  -18.807 11.545  1.00 0.00 ? 10  LEU A N    3  
ATOM 4543  C CA   . LEU A 1 10  ? -6.899  -17.522 11.487  1.00 0.00 ? 10  LEU A CA   3  
ATOM 4544  C C    . LEU A 1 10  ? -6.160  -16.472 12.310  1.00 0.00 ? 10  LEU A C    3  
ATOM 4545  O O    . LEU A 1 10  ? -6.695  -15.943 13.286  1.00 0.00 ? 10  LEU A O    3  
ATOM 4546  C CB   . LEU A 1 10  ? -8.335  -17.666 11.993  1.00 0.00 ? 10  LEU A CB   3  
ATOM 4547  C CG   . LEU A 1 10  ? -8.502  -18.337 13.356  1.00 0.00 ? 10  LEU A CG   3  
ATOM 4548  C CD1  . LEU A 1 10  ? -9.734  -17.801 14.068  1.00 0.00 ? 10  LEU A CD1  3  
ATOM 4549  C CD2  . LEU A 1 10  ? -8.588  -19.848 13.201  1.00 0.00 ? 10  LEU A CD2  3  
ATOM 4550  H H    . LEU A 1 10  ? -6.524  -19.487 12.176  1.00 0.00 ? 10  LEU A H    3  
ATOM 4551  H HA   . LEU A 1 10  ? -6.920  -17.204 10.455  1.00 0.00 ? 10  LEU A HA   3  
ATOM 4552  H HB2  . LEU A 1 10  ? -8.764  -16.677 12.056  1.00 0.00 ? 10  LEU A HB2  3  
ATOM 4553  H HB3  . LEU A 1 10  ? -8.884  -18.249 11.267  1.00 0.00 ? 10  LEU A HB3  3  
ATOM 4554  H HG   . LEU A 1 10  ? -7.639  -18.111 13.969  1.00 0.00 ? 10  LEU A HG   3  
ATOM 4555  H HD11 . LEU A 1 10  ? -9.431  -17.140 14.866  1.00 0.00 ? 10  LEU A HD11 3  
ATOM 4556  H HD12 . LEU A 1 10  ? -10.299 -18.625 14.480  1.00 0.00 ? 10  LEU A HD12 3  
ATOM 4557  H HD13 . LEU A 1 10  ? -10.349 -17.260 13.364  1.00 0.00 ? 10  LEU A HD13 3  
ATOM 4558  H HD21 . LEU A 1 10  ? -8.352  -20.119 12.183  1.00 0.00 ? 10  LEU A HD21 3  
ATOM 4559  H HD22 . LEU A 1 10  ? -9.590  -20.178 13.438  1.00 0.00 ? 10  LEU A HD22 3  
ATOM 4560  H HD23 . LEU A 1 10  ? -7.885  -20.320 13.871  1.00 0.00 ? 10  LEU A HD23 3  
ATOM 4561  N N    . LEU A 1 11  ? -4.929  -16.173 11.910  1.00 0.00 ? 11  LEU A N    3  
ATOM 4562  C CA   . LEU A 1 11  ? -4.117  -15.182 12.609  1.00 0.00 ? 11  LEU A CA   3  
ATOM 4563  C C    . LEU A 1 11  ? -3.208  -14.438 11.636  1.00 0.00 ? 11  LEU A C    3  
ATOM 4564  O O    . LEU A 1 11  ? -3.126  -14.785 10.458  1.00 0.00 ? 11  LEU A O    3  
ATOM 4565  C CB   . LEU A 1 11  ? -3.277  -15.858 13.694  1.00 0.00 ? 11  LEU A CB   3  
ATOM 4566  C CG   . LEU A 1 11  ? -3.924  -15.966 15.075  1.00 0.00 ? 11  LEU A CG   3  
ATOM 4567  C CD1  . LEU A 1 11  ? -3.131  -16.909 15.965  1.00 0.00 ? 11  LEU A CD1  3  
ATOM 4568  C CD2  . LEU A 1 11  ? -4.037  -14.591 15.719  1.00 0.00 ? 11  LEU A CD2  3  
ATOM 4569  H H    . LEU A 1 11  ? -4.557  -16.627 11.126  1.00 0.00 ? 11  LEU A H    3  
ATOM 4570  H HA   . LEU A 1 11  ? -4.786  -14.473 13.073  1.00 0.00 ? 11  LEU A HA   3  
ATOM 4571  H HB2  . LEU A 1 11  ? -3.046  -16.857 13.359  1.00 0.00 ? 11  LEU A HB2  3  
ATOM 4572  H HB3  . LEU A 1 11  ? -2.360  -15.295 13.800  1.00 0.00 ? 11  LEU A HB3  3  
ATOM 4573  H HG   . LEU A 1 11  ? -4.922  -16.368 14.968  1.00 0.00 ? 11  LEU A HG   3  
ATOM 4574  H HD11 . LEU A 1 11  ? -3.323  -17.929 15.669  1.00 0.00 ? 11  LEU A HD11 3  
ATOM 4575  H HD12 . LEU A 1 11  ? -3.429  -16.771 16.994  1.00 0.00 ? 11  LEU A HD12 3  
ATOM 4576  H HD13 . LEU A 1 11  ? -2.076  -16.698 15.865  1.00 0.00 ? 11  LEU A HD13 3  
ATOM 4577  H HD21 . LEU A 1 11  ? -4.733  -14.637 16.544  1.00 0.00 ? 11  LEU A HD21 3  
ATOM 4578  H HD22 . LEU A 1 11  ? -4.390  -13.879 14.988  1.00 0.00 ? 11  LEU A HD22 3  
ATOM 4579  H HD23 . LEU A 1 11  ? -3.068  -14.284 16.083  1.00 0.00 ? 11  LEU A HD23 3  
ATOM 4580  N N    . SER A 1 12  ? -2.525  -13.414 12.138  1.00 0.00 ? 12  SER A N    3  
ATOM 4581  C CA   . SER A 1 12  ? -1.623  -12.619 11.313  1.00 0.00 ? 12  SER A CA   3  
ATOM 4582  C C    . SER A 1 12  ? -0.514  -13.489 10.728  1.00 0.00 ? 12  SER A C    3  
ATOM 4583  O O    . SER A 1 12  ? -0.128  -14.501 11.314  1.00 0.00 ? 12  SER A O    3  
ATOM 4584  C CB   . SER A 1 12  ? -1.016  -11.481 12.135  1.00 0.00 ? 12  SER A CB   3  
ATOM 4585  O OG   . SER A 1 12  ? -0.327  -11.982 13.268  1.00 0.00 ? 12  SER A OG   3  
ATOM 4586  H H    . SER A 1 12  ? -2.634  -13.186 13.085  1.00 0.00 ? 12  SER A H    3  
ATOM 4587  H HA   . SER A 1 12  ? -2.200  -12.199 10.502  1.00 0.00 ? 12  SER A HA   3  
ATOM 4588  H HB2  . SER A 1 12  ? -0.321  -10.929 11.521  1.00 0.00 ? 12  SER A HB2  3  
ATOM 4589  H HB3  . SER A 1 12  ? -1.804  -10.822 12.469  1.00 0.00 ? 12  SER A HB3  3  
ATOM 4590  H HG   . SER A 1 12  ? -0.284  -11.301 13.943  1.00 0.00 ? 12  SER A HG   3  
ATOM 4591  N N    . LYS A 1 13  ? -0.005  -13.086 9.570   1.00 0.00 ? 13  LYS A N    3  
ATOM 4592  C CA   . LYS A 1 13  ? 1.061   -13.825 8.903   1.00 0.00 ? 13  LYS A CA   3  
ATOM 4593  C C    . LYS A 1 13  ? 2.402   -13.117 9.071   1.00 0.00 ? 13  LYS A C    3  
ATOM 4594  O O    . LYS A 1 13  ? 3.386   -13.465 8.418   1.00 0.00 ? 13  LYS A O    3  
ATOM 4595  C CB   . LYS A 1 13  ? 0.744   -13.992 7.416   1.00 0.00 ? 13  LYS A CB   3  
ATOM 4596  C CG   . LYS A 1 13  ? 0.861   -12.703 6.621   1.00 0.00 ? 13  LYS A CG   3  
ATOM 4597  C CD   . LYS A 1 13  ? 1.225   -12.974 5.171   1.00 0.00 ? 13  LYS A CD   3  
ATOM 4598  C CE   . LYS A 1 13  ? 0.652   -11.913 4.244   1.00 0.00 ? 13  LYS A CE   3  
ATOM 4599  N NZ   . LYS A 1 13  ? 0.678   -12.348 2.820   1.00 0.00 ? 13  LYS A NZ   3  
ATOM 4600  H H    . LYS A 1 13  ? -0.353  -12.270 9.151   1.00 0.00 ? 13  LYS A H    3  
ATOM 4601  H HA   . LYS A 1 13  ? 1.125   -14.801 9.361   1.00 0.00 ? 13  LYS A HA   3  
ATOM 4602  H HB2  . LYS A 1 13  ? 1.425   -14.714 6.993   1.00 0.00 ? 13  LYS A HB2  3  
ATOM 4603  H HB3  . LYS A 1 13  ? -0.267  -14.362 7.316   1.00 0.00 ? 13  LYS A HB3  3  
ATOM 4604  H HG2  . LYS A 1 13  ? -0.087  -12.184 6.651   1.00 0.00 ? 13  LYS A HG2  3  
ATOM 4605  H HG3  . LYS A 1 13  ? 1.627   -12.084 7.066   1.00 0.00 ? 13  LYS A HG3  3  
ATOM 4606  H HD2  . LYS A 1 13  ? 2.301   -12.976 5.074   1.00 0.00 ? 13  LYS A HD2  3  
ATOM 4607  H HD3  . LYS A 1 13  ? 0.835   -13.940 4.885   1.00 0.00 ? 13  LYS A HD3  3  
ATOM 4608  H HE2  . LYS A 1 13  ? -0.370  -11.717 4.533   1.00 0.00 ? 13  LYS A HE2  3  
ATOM 4609  H HE3  . LYS A 1 13  ? 1.235   -11.010 4.347   1.00 0.00 ? 13  LYS A HE3  3  
ATOM 4610  H HZ1  . LYS A 1 13  ? 0.154   -13.240 2.709   1.00 0.00 ? 13  LYS A HZ1  3  
ATOM 4611  H HZ2  . LYS A 1 13  ? 1.659   -12.494 2.510   1.00 0.00 ? 13  LYS A HZ2  3  
ATOM 4612  H HZ3  . LYS A 1 13  ? 0.239   -11.624 2.217   1.00 0.00 ? 13  LYS A HZ3  3  
ATOM 4613  N N    . TYR A 1 14  ? 2.434   -12.120 9.950   1.00 0.00 ? 14  TYR A N    3  
ATOM 4614  C CA   . TYR A 1 14  ? 3.654   -11.362 10.202  1.00 0.00 ? 14  TYR A CA   3  
ATOM 4615  C C    . TYR A 1 14  ? 4.864   -12.286 10.277  1.00 0.00 ? 14  TYR A C    3  
ATOM 4616  O O    . TYR A 1 14  ? 4.986   -13.094 11.199  1.00 0.00 ? 14  TYR A O    3  
ATOM 4617  C CB   . TYR A 1 14  ? 3.524   -10.566 11.502  1.00 0.00 ? 14  TYR A CB   3  
ATOM 4618  C CG   . TYR A 1 14  ? 4.546   -9.461  11.638  1.00 0.00 ? 14  TYR A CG   3  
ATOM 4619  C CD1  . TYR A 1 14  ? 5.887   -9.750  11.862  1.00 0.00 ? 14  TYR A CD1  3  
ATOM 4620  C CD2  . TYR A 1 14  ? 4.172   -8.126  11.545  1.00 0.00 ? 14  TYR A CD2  3  
ATOM 4621  C CE1  . TYR A 1 14  ? 6.824   -8.744  11.988  1.00 0.00 ? 14  TYR A CE1  3  
ATOM 4622  C CE2  . TYR A 1 14  ? 5.103   -7.112  11.668  1.00 0.00 ? 14  TYR A CE2  3  
ATOM 4623  C CZ   . TYR A 1 14  ? 6.428   -7.426  11.891  1.00 0.00 ? 14  TYR A CZ   3  
ATOM 4624  O OH   . TYR A 1 14  ? 7.359   -6.421  12.016  1.00 0.00 ? 14  TYR A OH   3  
ATOM 4625  H H    . TYR A 1 14  ? 1.617   -11.889 10.439  1.00 0.00 ? 14  TYR A H    3  
ATOM 4626  H HA   . TYR A 1 14  ? 3.791   -10.673 9.381   1.00 0.00 ? 14  TYR A HA   3  
ATOM 4627  H HB2  . TYR A 1 14  ? 2.544   -10.116 11.544  1.00 0.00 ? 14  TYR A HB2  3  
ATOM 4628  H HB3  . TYR A 1 14  ? 3.645   -11.236 12.340  1.00 0.00 ? 14  TYR A HB3  3  
ATOM 4629  H HD1  . TYR A 1 14  ? 6.195   -10.784 11.937  1.00 0.00 ? 14  TYR A HD1  3  
ATOM 4630  H HD2  . TYR A 1 14  ? 3.134   -7.883  11.371  1.00 0.00 ? 14  TYR A HD2  3  
ATOM 4631  H HE1  . TYR A 1 14  ? 7.861   -8.990  12.161  1.00 0.00 ? 14  TYR A HE1  3  
ATOM 4632  H HE2  . TYR A 1 14  ? 4.793   -6.081  11.592  1.00 0.00 ? 14  TYR A HE2  3  
ATOM 4633  H HH   . TYR A 1 14  ? 7.490   -5.999  11.163  1.00 0.00 ? 14  TYR A HH   3  
ATOM 4634  N N    . ASP A 1 15  ? 5.757   -12.162 9.302   1.00 0.00 ? 15  ASP A N    3  
ATOM 4635  C CA   . ASP A 1 15  ? 6.960   -12.985 9.256   1.00 0.00 ? 15  ASP A CA   3  
ATOM 4636  C C    . ASP A 1 15  ? 8.213   -12.121 9.367   1.00 0.00 ? 15  ASP A C    3  
ATOM 4637  O O    . ASP A 1 15  ? 8.298   -11.033 8.798   1.00 0.00 ? 15  ASP A O    3  
ATOM 4638  C CB   . ASP A 1 15  ? 6.999   -13.799 7.962   1.00 0.00 ? 15  ASP A CB   3  
ATOM 4639  C CG   . ASP A 1 15  ? 7.728   -15.117 8.130   1.00 0.00 ? 15  ASP A CG   3  
ATOM 4640  O OD1  . ASP A 1 15  ? 7.158   -16.034 8.756   1.00 0.00 ? 15  ASP A OD1  3  
ATOM 4641  O OD2  . ASP A 1 15  ? 8.869   -15.231 7.635   1.00 0.00 ? 15  ASP A OD2  3  
ATOM 4642  H H    . ASP A 1 15  ? 5.604   -11.500 8.595   1.00 0.00 ? 15  ASP A H    3  
ATOM 4643  H HA   . ASP A 1 15  ? 6.931   -13.662 10.096  1.00 0.00 ? 15  ASP A HA   3  
ATOM 4644  H HB2  . ASP A 1 15  ? 5.988   -14.006 7.645   1.00 0.00 ? 15  ASP A HB2  3  
ATOM 4645  H HB3  . ASP A 1 15  ? 7.502   -13.224 7.198   1.00 0.00 ? 15  ASP A HB3  3  
ATOM 4646  N N    . PRO A 1 16  ? 9.209   -12.616 10.117  1.00 0.00 ? 16  PRO A N    3  
ATOM 4647  C CA   . PRO A 1 16  ? 10.475  -11.905 10.320  1.00 0.00 ? 16  PRO A CA   3  
ATOM 4648  C C    . PRO A 1 16  ? 11.323  -11.856 9.053   1.00 0.00 ? 16  PRO A C    3  
ATOM 4649  O O    . PRO A 1 16  ? 12.279  -11.089 8.965   1.00 0.00 ? 16  PRO A O    3  
ATOM 4650  C CB   . PRO A 1 16  ? 11.177  -12.733 11.400  1.00 0.00 ? 16  PRO A CB   3  
ATOM 4651  C CG   . PRO A 1 16  ? 10.601  -14.100 11.264  1.00 0.00 ? 16  PRO A CG   3  
ATOM 4652  C CD   . PRO A 1 16  ? 9.176   -13.907 10.823  1.00 0.00 ? 16  PRO A CD   3  
ATOM 4653  H HA   . PRO A 1 16  ? 10.313  -10.901 10.681  1.00 0.00 ? 16  PRO A HA   3  
ATOM 4654  H HB2  . PRO A 1 16  ? 12.243  -12.732 11.222  1.00 0.00 ? 16  PRO A HB2  3  
ATOM 4655  H HB3  . PRO A 1 16  ? 10.969  -12.311 12.372  1.00 0.00 ? 16  PRO A HB3  3  
ATOM 4656  H HG2  . PRO A 1 16  ? 11.151  -14.657 10.521  1.00 0.00 ? 16  PRO A HG2  3  
ATOM 4657  H HG3  . PRO A 1 16  ? 10.633  -14.607 12.217  1.00 0.00 ? 16  PRO A HG3  3  
ATOM 4658  H HD2  . PRO A 1 16  ? 8.875   -14.704 10.158  1.00 0.00 ? 16  PRO A HD2  3  
ATOM 4659  H HD3  . PRO A 1 16  ? 8.519   -13.860 11.680  1.00 0.00 ? 16  PRO A HD3  3  
ATOM 4660  N N    . GLN A 1 17  ? 10.962  -12.680 8.073   1.00 0.00 ? 17  GLN A N    3  
ATOM 4661  C CA   . GLN A 1 17  ? 11.690  -12.730 6.810   1.00 0.00 ? 17  GLN A CA   3  
ATOM 4662  C C    . GLN A 1 17  ? 10.965  -11.931 5.732   1.00 0.00 ? 17  GLN A C    3  
ATOM 4663  O O    . GLN A 1 17  ? 11.593  -11.242 4.928   1.00 0.00 ? 17  GLN A O    3  
ATOM 4664  C CB   . GLN A 1 17  ? 11.867  -14.179 6.356   1.00 0.00 ? 17  GLN A CB   3  
ATOM 4665  C CG   . GLN A 1 17  ? 12.778  -14.993 7.260   1.00 0.00 ? 17  GLN A CG   3  
ATOM 4666  C CD   . GLN A 1 17  ? 14.248  -14.780 6.951   1.00 0.00 ? 17  GLN A CD   3  
ATOM 4667  O OE1  . GLN A 1 17  ? 14.737  -15.184 5.896   1.00 0.00 ? 17  GLN A OE1  3  
ATOM 4668  N NE2  . GLN A 1 17  ? 14.959  -14.142 7.873   1.00 0.00 ? 17  GLN A NE2  3  
ATOM 4669  H H    . GLN A 1 17  ? 10.189  -13.267 8.204   1.00 0.00 ? 17  GLN A H    3  
ATOM 4670  H HA   . GLN A 1 17  ? 12.663  -12.291 6.973   1.00 0.00 ? 17  GLN A HA   3  
ATOM 4671  H HB2  . GLN A 1 17  ? 10.898  -14.658 6.333   1.00 0.00 ? 17  GLN A HB2  3  
ATOM 4672  H HB3  . GLN A 1 17  ? 12.286  -14.183 5.361   1.00 0.00 ? 17  GLN A HB3  3  
ATOM 4673  H HG2  . GLN A 1 17  ? 12.596  -14.708 8.285   1.00 0.00 ? 17  GLN A HG2  3  
ATOM 4674  H HG3  . GLN A 1 17  ? 12.547  -16.041 7.133   1.00 0.00 ? 17  GLN A HG3  3  
ATOM 4675  H HE21 . GLN A 1 17  ? 14.503  -13.851 8.690   1.00 0.00 ? 17  GLN A HE21 3  
ATOM 4676  H HE22 . GLN A 1 17  ? 15.911  -13.992 7.701   1.00 0.00 ? 17  GLN A HE22 3  
ATOM 4677  N N    . LYS A 1 18  ? 9.640   -12.029 5.722   1.00 0.00 ? 18  LYS A N    3  
ATOM 4678  C CA   . LYS A 1 18  ? 8.828   -11.314 4.743   1.00 0.00 ? 18  LYS A CA   3  
ATOM 4679  C C    . LYS A 1 18  ? 9.106   -9.816  4.795   1.00 0.00 ? 18  LYS A C    3  
ATOM 4680  O O    . LYS A 1 18  ? 9.363   -9.187  3.768   1.00 0.00 ? 18  LYS A O    3  
ATOM 4681  C CB   . LYS A 1 18  ? 7.342   -11.577 4.995   1.00 0.00 ? 18  LYS A CB   3  
ATOM 4682  C CG   . LYS A 1 18  ? 6.922   -13.011 4.717   1.00 0.00 ? 18  LYS A CG   3  
ATOM 4683  C CD   . LYS A 1 18  ? 6.492   -13.196 3.272   1.00 0.00 ? 18  LYS A CD   3  
ATOM 4684  C CE   . LYS A 1 18  ? 5.441   -14.287 3.138   1.00 0.00 ? 18  LYS A CE   3  
ATOM 4685  N NZ   . LYS A 1 18  ? 6.056   -15.625 2.914   1.00 0.00 ? 18  LYS A NZ   3  
ATOM 4686  H H    . LYS A 1 18  ? 9.197   -12.593 6.389   1.00 0.00 ? 18  LYS A H    3  
ATOM 4687  H HA   . LYS A 1 18  ? 9.090   -11.683 3.763   1.00 0.00 ? 18  LYS A HA   3  
ATOM 4688  H HB2  . LYS A 1 18  ? 7.118   -11.352 6.026   1.00 0.00 ? 18  LYS A HB2  3  
ATOM 4689  H HB3  . LYS A 1 18  ? 6.760   -10.924 4.358   1.00 0.00 ? 18  LYS A HB3  3  
ATOM 4690  H HG2  . LYS A 1 18  ? 7.756   -13.666 4.920   1.00 0.00 ? 18  LYS A HG2  3  
ATOM 4691  H HG3  . LYS A 1 18  ? 6.094   -13.265 5.365   1.00 0.00 ? 18  LYS A HG3  3  
ATOM 4692  H HD2  . LYS A 1 18  ? 6.079   -12.268 2.906   1.00 0.00 ? 18  LYS A HD2  3  
ATOM 4693  H HD3  . LYS A 1 18  ? 7.356   -13.466 2.680   1.00 0.00 ? 18  LYS A HD3  3  
ATOM 4694  H HE2  . LYS A 1 18  ? 4.855   -14.318 4.045   1.00 0.00 ? 18  LYS A HE2  3  
ATOM 4695  H HE3  . LYS A 1 18  ? 4.799   -14.051 2.303   1.00 0.00 ? 18  LYS A HE3  3  
ATOM 4696  H HZ1  . LYS A 1 18  ? 7.021   -15.645 3.304   1.00 0.00 ? 18  LYS A HZ1  3  
ATOM 4697  H HZ2  . LYS A 1 18  ? 6.102   -15.831 1.896   1.00 0.00 ? 18  LYS A HZ2  3  
ATOM 4698  H HZ3  . LYS A 1 18  ? 5.490   -16.362 3.382   1.00 0.00 ? 18  LYS A HZ3  3  
ATOM 4699  N N    . GLU A 1 19  ? 9.055   -9.250  5.997   1.00 0.00 ? 19  GLU A N    3  
ATOM 4700  C CA   . GLU A 1 19  ? 9.302   -7.825  6.180   1.00 0.00 ? 19  GLU A CA   3  
ATOM 4701  C C    . GLU A 1 19  ? 10.422  -7.344  5.262   1.00 0.00 ? 19  GLU A C    3  
ATOM 4702  O O    . GLU A 1 19  ? 10.301  -6.310  4.607   1.00 0.00 ? 19  GLU A O    3  
ATOM 4703  C CB   . GLU A 1 19  ? 9.661   -7.530  7.639   1.00 0.00 ? 19  GLU A CB   3  
ATOM 4704  C CG   . GLU A 1 19  ? 9.815   -6.049  7.941   1.00 0.00 ? 19  GLU A CG   3  
ATOM 4705  C CD   . GLU A 1 19  ? 8.482   -5.333  8.043   1.00 0.00 ? 19  GLU A CD   3  
ATOM 4706  O OE1  . GLU A 1 19  ? 7.688   -5.418  7.084   1.00 0.00 ? 19  GLU A OE1  3  
ATOM 4707  O OE2  . GLU A 1 19  ? 8.235   -4.686  9.082   1.00 0.00 ? 19  GLU A OE2  3  
ATOM 4708  H H    . GLU A 1 19  ? 8.845   -9.803  6.778   1.00 0.00 ? 19  GLU A H    3  
ATOM 4709  H HA   . GLU A 1 19  ? 8.395   -7.295  5.930   1.00 0.00 ? 19  GLU A HA   3  
ATOM 4710  H HB2  . GLU A 1 19  ? 8.884   -7.928  8.276   1.00 0.00 ? 19  GLU A HB2  3  
ATOM 4711  H HB3  . GLU A 1 19  ? 10.592  -8.023  7.873   1.00 0.00 ? 19  GLU A HB3  3  
ATOM 4712  H HG2  . GLU A 1 19  ? 10.337  -5.938  8.879   1.00 0.00 ? 19  GLU A HG2  3  
ATOM 4713  H HG3  . GLU A 1 19  ? 10.394  -5.593  7.151   1.00 0.00 ? 19  GLU A HG3  3  
ATOM 4714  N N    . ALA A 1 20  ? 11.513  -8.102  5.223   1.00 0.00 ? 20  ALA A N    3  
ATOM 4715  C CA   . ALA A 1 20  ? 12.654  -7.755  4.385   1.00 0.00 ? 20  ALA A CA   3  
ATOM 4716  C C    . ALA A 1 20  ? 12.300  -7.857  2.905   1.00 0.00 ? 20  ALA A C    3  
ATOM 4717  O O    . ALA A 1 20  ? 12.757  -7.054  2.093   1.00 0.00 ? 20  ALA A O    3  
ATOM 4718  C CB   . ALA A 1 20  ? 13.839  -8.653  4.710   1.00 0.00 ? 20  ALA A CB   3  
ATOM 4719  H H    . ALA A 1 20  ? 11.550  -8.915  5.769   1.00 0.00 ? 20  ALA A H    3  
ATOM 4720  H HA   . ALA A 1 20  ? 12.935  -6.736  4.609   1.00 0.00 ? 20  ALA A HA   3  
ATOM 4721  H HB1  . ALA A 1 20  ? 13.504  -9.678  4.780   1.00 0.00 ? 20  ALA A HB1  3  
ATOM 4722  H HB2  . ALA A 1 20  ? 14.579  -8.569  3.929   1.00 0.00 ? 20  ALA A HB2  3  
ATOM 4723  H HB3  . ALA A 1 20  ? 14.273  -8.351  5.651   1.00 0.00 ? 20  ALA A HB3  3  
ATOM 4724  N N    . GLU A 1 21  ? 11.485  -8.849  2.564   1.00 0.00 ? 21  GLU A N    3  
ATOM 4725  C CA   . GLU A 1 21  ? 11.072  -9.056  1.181   1.00 0.00 ? 21  GLU A CA   3  
ATOM 4726  C C    . GLU A 1 21  ? 10.334  -7.833  0.645   1.00 0.00 ? 21  GLU A C    3  
ATOM 4727  O O    . GLU A 1 21  ? 10.529  -7.429  -0.503  1.00 0.00 ? 21  GLU A O    3  
ATOM 4728  C CB   . GLU A 1 21  ? 10.178  -10.292 1.071   1.00 0.00 ? 21  GLU A CB   3  
ATOM 4729  C CG   . GLU A 1 21  ? 10.853  -11.575 1.530   1.00 0.00 ? 21  GLU A CG   3  
ATOM 4730  C CD   . GLU A 1 21  ? 10.267  -12.809 0.873   1.00 0.00 ? 21  GLU A CD   3  
ATOM 4731  O OE1  . GLU A 1 21  ? 9.089   -12.759 0.461   1.00 0.00 ? 21  GLU A OE1  3  
ATOM 4732  O OE2  . GLU A 1 21  ? 10.985  -13.826 0.771   1.00 0.00 ? 21  GLU A OE2  3  
ATOM 4733  H H    . GLU A 1 21  ? 11.153  -9.457  3.258   1.00 0.00 ? 21  GLU A H    3  
ATOM 4734  H HA   . GLU A 1 21  ? 11.961  -9.213  0.589   1.00 0.00 ? 21  GLU A HA   3  
ATOM 4735  H HB2  . GLU A 1 21  ? 9.295   -10.139 1.675   1.00 0.00 ? 21  GLU A HB2  3  
ATOM 4736  H HB3  . GLU A 1 21  ? 9.880   -10.417 0.040   1.00 0.00 ? 21  GLU A HB3  3  
ATOM 4737  H HG2  . GLU A 1 21  ? 11.903  -11.520 1.285   1.00 0.00 ? 21  GLU A HG2  3  
ATOM 4738  H HG3  . GLU A 1 21  ? 10.737  -11.664 2.599   1.00 0.00 ? 21  GLU A HG3  3  
ATOM 4739  N N    . LEU A 1 22  ? 9.486   -7.246  1.483   1.00 0.00 ? 22  LEU A N    3  
ATOM 4740  C CA   . LEU A 1 22  ? 8.717   -6.069  1.094   1.00 0.00 ? 22  LEU A CA   3  
ATOM 4741  C C    . LEU A 1 22  ? 9.637   -4.881  0.833   1.00 0.00 ? 22  LEU A C    3  
ATOM 4742  O O    . LEU A 1 22  ? 9.737   -4.398  -0.296  1.00 0.00 ? 22  LEU A O    3  
ATOM 4743  C CB   . LEU A 1 22  ? 7.705   -5.714  2.185   1.00 0.00 ? 22  LEU A CB   3  
ATOM 4744  C CG   . LEU A 1 22  ? 6.605   -6.744  2.441   1.00 0.00 ? 22  LEU A CG   3  
ATOM 4745  C CD1  . LEU A 1 22  ? 5.806   -6.375  3.681   1.00 0.00 ? 22  LEU A CD1  3  
ATOM 4746  C CD2  . LEU A 1 22  ? 5.690   -6.860  1.230   1.00 0.00 ? 22  LEU A CD2  3  
ATOM 4747  H H    . LEU A 1 22  ? 9.373   -7.614  2.384   1.00 0.00 ? 22  LEU A H    3  
ATOM 4748  H HA   . LEU A 1 22  ? 8.186   -6.305  0.184   1.00 0.00 ? 22  LEU A HA   3  
ATOM 4749  H HB2  . LEU A 1 22  ? 8.248   -5.574  3.107   1.00 0.00 ? 22  LEU A HB2  3  
ATOM 4750  H HB3  . LEU A 1 22  ? 7.230   -4.784  1.904   1.00 0.00 ? 22  LEU A HB3  3  
ATOM 4751  H HG   . LEU A 1 22  ? 7.059   -7.711  2.612   1.00 0.00 ? 22  LEU A HG   3  
ATOM 4752  H HD11 . LEU A 1 22  ? 6.134   -5.415  4.048   1.00 0.00 ? 22  LEU A HD11 3  
ATOM 4753  H HD12 . LEU A 1 22  ? 5.960   -7.124  4.444   1.00 0.00 ? 22  LEU A HD12 3  
ATOM 4754  H HD13 . LEU A 1 22  ? 4.756   -6.327  3.432   1.00 0.00 ? 22  LEU A HD13 3  
ATOM 4755  H HD21 . LEU A 1 22  ? 5.037   -6.002  1.190   1.00 0.00 ? 22  LEU A HD21 3  
ATOM 4756  H HD22 . LEU A 1 22  ? 5.098   -7.759  1.311   1.00 0.00 ? 22  LEU A HD22 3  
ATOM 4757  H HD23 . LEU A 1 22  ? 6.287   -6.901  0.331   1.00 0.00 ? 22  LEU A HD23 3  
ATOM 4758  N N    . ARG A 1 23  ? 10.309  -4.416  1.880   1.00 0.00 ? 23  ARG A N    3  
ATOM 4759  C CA   . ARG A 1 23  ? 11.221  -3.285  1.763   1.00 0.00 ? 23  ARG A CA   3  
ATOM 4760  C C    . ARG A 1 23  ? 12.164  -3.468  0.578   1.00 0.00 ? 23  ARG A C    3  
ATOM 4761  O O    . ARG A 1 23  ? 12.503  -2.509  -0.116  1.00 0.00 ? 23  ARG A O    3  
ATOM 4762  C CB   . ARG A 1 23  ? 12.029  -3.119  3.051   1.00 0.00 ? 23  ARG A CB   3  
ATOM 4763  C CG   . ARG A 1 23  ? 12.835  -4.351  3.428   1.00 0.00 ? 23  ARG A CG   3  
ATOM 4764  C CD   . ARG A 1 23  ? 13.600  -4.142  4.726   1.00 0.00 ? 23  ARG A CD   3  
ATOM 4765  N NE   . ARG A 1 23  ? 14.609  -5.176  4.939   1.00 0.00 ? 23  ARG A NE   3  
ATOM 4766  C CZ   . ARG A 1 23  ? 15.300  -5.307  6.066   1.00 0.00 ? 23  ARG A CZ   3  
ATOM 4767  N NH1  . ARG A 1 23  ? 15.091  -4.474  7.076   1.00 0.00 ? 23  ARG A NH1  3  
ATOM 4768  N NH2  . ARG A 1 23  ? 16.201  -6.273  6.185   1.00 0.00 ? 23  ARG A NH2  3  
ATOM 4769  H H    . ARG A 1 23  ? 10.187  -4.843  2.754   1.00 0.00 ? 23  ARG A H    3  
ATOM 4770  H HA   . ARG A 1 23  ? 10.629  -2.396  1.602   1.00 0.00 ? 23  ARG A HA   3  
ATOM 4771  H HB2  . ARG A 1 23  ? 12.715  -2.293  2.929   1.00 0.00 ? 23  ARG A HB2  3  
ATOM 4772  H HB3  . ARG A 1 23  ? 11.352  -2.897  3.860   1.00 0.00 ? 23  ARG A HB3  3  
ATOM 4773  H HG2  . ARG A 1 23  ? 12.161  -5.187  3.551   1.00 0.00 ? 23  ARG A HG2  3  
ATOM 4774  H HG3  . ARG A 1 23  ? 13.537  -4.567  2.637   1.00 0.00 ? 23  ARG A HG3  3  
ATOM 4775  H HD2  . ARG A 1 23  ? 14.087  -3.179  4.689   1.00 0.00 ? 23  ARG A HD2  3  
ATOM 4776  H HD3  . ARG A 1 23  ? 12.900  -4.160  5.547   1.00 0.00 ? 23  ARG A HD3  3  
ATOM 4777  H HE   . ARG A 1 23  ? 14.779  -5.803  4.206   1.00 0.00 ? 23  ARG A HE   3  
ATOM 4778  H HH11 . ARG A 1 23  ? 14.412  -3.745  6.990   1.00 0.00 ? 23  ARG A HH11 3  
ATOM 4779  H HH12 . ARG A 1 23  ? 15.612  -4.576  7.924   1.00 0.00 ? 23  ARG A HH12 3  
ATOM 4780  H HH21 . ARG A 1 23  ? 16.361  -6.904  5.425   1.00 0.00 ? 23  ARG A HH21 3  
ATOM 4781  H HH22 . ARG A 1 23  ? 16.721  -6.371  7.033   1.00 0.00 ? 23  ARG A HH22 3  
ATOM 4782  N N    . THR A 1 24  ? 12.588  -4.709  0.351   1.00 0.00 ? 24  THR A N    3  
ATOM 4783  C CA   . THR A 1 24  ? 13.493  -5.018  -0.748  1.00 0.00 ? 24  THR A CA   3  
ATOM 4784  C C    . THR A 1 24  ? 12.798  -4.857  -2.096  1.00 0.00 ? 24  THR A C    3  
ATOM 4785  O O    . THR A 1 24  ? 13.435  -4.534  -3.098  1.00 0.00 ? 24  THR A O    3  
ATOM 4786  C CB   . THR A 1 24  ? 14.045  -6.452  -0.635  1.00 0.00 ? 24  THR A CB   3  
ATOM 4787  O OG1  . THR A 1 24  ? 14.755  -6.608  0.598   1.00 0.00 ? 24  THR A OG1  3  
ATOM 4788  C CG2  . THR A 1 24  ? 14.966  -6.771  -1.803  1.00 0.00 ? 24  THR A CG2  3  
ATOM 4789  H H    . THR A 1 24  ? 12.283  -5.431  0.939   1.00 0.00 ? 24  THR A H    3  
ATOM 4790  H HA   . THR A 1 24  ? 14.325  -4.331  -0.698  1.00 0.00 ? 24  THR A HA   3  
ATOM 4791  H HB   . THR A 1 24  ? 13.214  -7.143  -0.653  1.00 0.00 ? 24  THR A HB   3  
ATOM 4792  H HG1  . THR A 1 24  ? 15.671  -6.347  0.474   1.00 0.00 ? 24  THR A HG1  3  
ATOM 4793  H HG21 . THR A 1 24  ? 14.516  -7.534  -2.419  1.00 0.00 ? 24  THR A HG21 3  
ATOM 4794  H HG22 . THR A 1 24  ? 15.914  -7.125  -1.426  1.00 0.00 ? 24  THR A HG22 3  
ATOM 4795  H HG23 . THR A 1 24  ? 15.123  -5.880  -2.391  1.00 0.00 ? 24  THR A HG23 3  
ATOM 4796  N N    . TRP A 1 25  ? 11.490  -5.084  -2.111  1.00 0.00 ? 25  TRP A N    3  
ATOM 4797  C CA   . TRP A 1 25  ? 10.708  -4.963  -3.336  1.00 0.00 ? 25  TRP A CA   3  
ATOM 4798  C C    . TRP A 1 25  ? 10.275  -3.520  -3.566  1.00 0.00 ? 25  TRP A C    3  
ATOM 4799  O O    . TRP A 1 25  ? 10.177  -3.065  -4.706  1.00 0.00 ? 25  TRP A O    3  
ATOM 4800  C CB   . TRP A 1 25  ? 9.479   -5.873  -3.273  1.00 0.00 ? 25  TRP A CB   3  
ATOM 4801  C CG   . TRP A 1 25  ? 8.384   -5.456  -4.207  1.00 0.00 ? 25  TRP A CG   3  
ATOM 4802  C CD1  . TRP A 1 25  ? 8.413   -5.487  -5.572  1.00 0.00 ? 25  TRP A CD1  3  
ATOM 4803  C CD2  . TRP A 1 25  ? 7.097   -4.944  -3.842  1.00 0.00 ? 25  TRP A CD2  3  
ATOM 4804  N NE1  . TRP A 1 25  ? 7.223   -5.025  -6.078  1.00 0.00 ? 25  TRP A NE1  3  
ATOM 4805  C CE2  . TRP A 1 25  ? 6.398   -4.687  -5.039  1.00 0.00 ? 25  TRP A CE2  3  
ATOM 4806  C CE3  . TRP A 1 25  ? 6.467   -4.680  -2.624  1.00 0.00 ? 25  TRP A CE3  3  
ATOM 4807  C CZ2  . TRP A 1 25  ? 5.102   -4.178  -5.048  1.00 0.00 ? 25  TRP A CZ2  3  
ATOM 4808  C CZ3  . TRP A 1 25  ? 5.181   -4.174  -2.635  1.00 0.00 ? 25  TRP A CZ3  3  
ATOM 4809  C CH2  . TRP A 1 25  ? 4.509   -3.928  -3.840  1.00 0.00 ? 25  TRP A CH2  3  
ATOM 4810  H H    . TRP A 1 25  ? 11.038  -5.339  -1.279  1.00 0.00 ? 25  TRP A H    3  
ATOM 4811  H HA   . TRP A 1 25  ? 11.334  -5.275  -4.159  1.00 0.00 ? 25  TRP A HA   3  
ATOM 4812  H HB2  . TRP A 1 25  ? 9.771   -6.881  -3.531  1.00 0.00 ? 25  TRP A HB2  3  
ATOM 4813  H HB3  . TRP A 1 25  ? 9.085   -5.863  -2.268  1.00 0.00 ? 25  TRP A HB3  3  
ATOM 4814  H HD1  . TRP A 1 25  ? 9.257   -5.826  -6.153  1.00 0.00 ? 25  TRP A HD1  3  
ATOM 4815  H HE1  . TRP A 1 25  ? 7.000   -4.953  -7.031  1.00 0.00 ? 25  TRP A HE1  3  
ATOM 4816  H HE3  . TRP A 1 25  ? 6.968   -4.864  -1.685  1.00 0.00 ? 25  TRP A HE3  3  
ATOM 4817  H HZ2  . TRP A 1 25  ? 4.572   -3.983  -5.968  1.00 0.00 ? 25  TRP A HZ2  3  
ATOM 4818  H HZ3  . TRP A 1 25  ? 4.678   -3.963  -1.702  1.00 0.00 ? 25  TRP A HZ3  3  
ATOM 4819  H HH2  . TRP A 1 25  ? 3.506   -3.532  -3.801  1.00 0.00 ? 25  TRP A HH2  3  
ATOM 4820  N N    . ILE A 1 26  ? 10.018  -2.804  -2.476  1.00 0.00 ? 26  ILE A N    3  
ATOM 4821  C CA   . ILE A 1 26  ? 9.596   -1.411  -2.561  1.00 0.00 ? 26  ILE A CA   3  
ATOM 4822  C C    . ILE A 1 26  ? 10.790  -0.489  -2.781  1.00 0.00 ? 26  ILE A C    3  
ATOM 4823  O O    . ILE A 1 26  ? 10.813  0.298   -3.728  1.00 0.00 ? 26  ILE A O    3  
ATOM 4824  C CB   . ILE A 1 26  ? 8.850   -0.970  -1.288  1.00 0.00 ? 26  ILE A CB   3  
ATOM 4825  C CG1  . ILE A 1 26  ? 7.740   -1.967  -0.950  1.00 0.00 ? 26  ILE A CG1  3  
ATOM 4826  C CG2  . ILE A 1 26  ? 8.277   0.428   -1.466  1.00 0.00 ? 26  ILE A CG2  3  
ATOM 4827  C CD1  . ILE A 1 26  ? 7.138   -1.761  0.421   1.00 0.00 ? 26  ILE A CD1  3  
ATOM 4828  H H    . ILE A 1 26  ? 10.114  -3.221  -1.595  1.00 0.00 ? 26  ILE A H    3  
ATOM 4829  H HA   . ILE A 1 26  ? 8.922   -1.317  -3.400  1.00 0.00 ? 26  ILE A HA   3  
ATOM 4830  H HB   . ILE A 1 26  ? 9.557   -0.942  -0.474  1.00 0.00 ? 26  ILE A HB   3  
ATOM 4831  H HG12 . ILE A 1 26  ? 6.947   -1.874  -1.677  1.00 0.00 ? 26  ILE A HG12 3  
ATOM 4832  H HG13 . ILE A 1 26  ? 8.142   -2.970  -0.990  1.00 0.00 ? 26  ILE A HG13 3  
ATOM 4833  H HG21 . ILE A 1 26  ? 9.084   1.134   -1.596  1.00 0.00 ? 26  ILE A HG21 3  
ATOM 4834  H HG22 . ILE A 1 26  ? 7.642   0.446   -2.339  1.00 0.00 ? 26  ILE A HG22 3  
ATOM 4835  H HG23 . ILE A 1 26  ? 7.700   0.695   -0.594  1.00 0.00 ? 26  ILE A HG23 3  
ATOM 4836  H HD11 . ILE A 1 26  ? 7.368   -0.764  0.769   1.00 0.00 ? 26  ILE A HD11 3  
ATOM 4837  H HD12 . ILE A 1 26  ? 6.067   -1.887  0.369   1.00 0.00 ? 26  ILE A HD12 3  
ATOM 4838  H HD13 . ILE A 1 26  ? 7.552   -2.485  1.109   1.00 0.00 ? 26  ILE A HD13 3  
ATOM 4839  N N    . GLU A 1 27  ? 11.781  -0.591  -1.902  1.00 0.00 ? 27  GLU A N    3  
ATOM 4840  C CA   . GLU A 1 27  ? 12.980  0.234   -2.002  1.00 0.00 ? 27  GLU A CA   3  
ATOM 4841  C C    . GLU A 1 27  ? 13.425  0.374   -3.455  1.00 0.00 ? 27  GLU A C    3  
ATOM 4842  O O    . GLU A 1 27  ? 13.779  1.463   -3.905  1.00 0.00 ? 27  GLU A O    3  
ATOM 4843  C CB   . GLU A 1 27  ? 14.112  -0.368  -1.166  1.00 0.00 ? 27  GLU A CB   3  
ATOM 4844  C CG   . GLU A 1 27  ? 14.052  0.012   0.304   1.00 0.00 ? 27  GLU A CG   3  
ATOM 4845  C CD   . GLU A 1 27  ? 15.423  0.065   0.948   1.00 0.00 ? 27  GLU A CD   3  
ATOM 4846  O OE1  . GLU A 1 27  ? 16.178  1.018   0.658   1.00 0.00 ? 27  GLU A OE1  3  
ATOM 4847  O OE2  . GLU A 1 27  ? 15.743  -0.843  1.742   1.00 0.00 ? 27  GLU A OE2  3  
ATOM 4848  H H    . GLU A 1 27  ? 11.705  -1.237  -1.168  1.00 0.00 ? 27  GLU A H    3  
ATOM 4849  H HA   . GLU A 1 27  ? 12.741  1.213   -1.615  1.00 0.00 ? 27  GLU A HA   3  
ATOM 4850  H HB2  . GLU A 1 27  ? 14.065  -1.445  -1.242  1.00 0.00 ? 27  GLU A HB2  3  
ATOM 4851  H HB3  . GLU A 1 27  ? 15.056  -0.029  -1.566  1.00 0.00 ? 27  GLU A HB3  3  
ATOM 4852  H HG2  . GLU A 1 27  ? 13.590  0.983   0.393   1.00 0.00 ? 27  GLU A HG2  3  
ATOM 4853  H HG3  . GLU A 1 27  ? 13.454  -0.720  0.827   1.00 0.00 ? 27  GLU A HG3  3  
ATOM 4854  N N    . GLY A 1 28  ? 13.402  -0.737  -4.184  1.00 0.00 ? 28  GLY A N    3  
ATOM 4855  C CA   . GLY A 1 28  ? 13.805  -0.718  -5.578  1.00 0.00 ? 28  GLY A CA   3  
ATOM 4856  C C    . GLY A 1 28  ? 12.744  -0.120  -6.481  1.00 0.00 ? 28  GLY A C    3  
ATOM 4857  O O    . GLY A 1 28  ? 13.060  0.507   -7.493  1.00 0.00 ? 28  GLY A O    3  
ATOM 4858  H H    . GLY A 1 28  ? 13.109  -1.578  -3.772  1.00 0.00 ? 28  GLY A H    3  
ATOM 4859  H HA2  . GLY A 1 28  ? 14.710  -0.137  -5.672  1.00 0.00 ? 28  GLY A HA2  3  
ATOM 4860  H HA3  . GLY A 1 28  ? 14.004  -1.730  -5.897  1.00 0.00 ? 28  GLY A HA3  3  
ATOM 4861  N N    . LEU A 1 29  ? 11.481  -0.315  -6.115  1.00 0.00 ? 29  LEU A N    3  
ATOM 4862  C CA   . LEU A 1 29  ? 10.369  0.209   -6.901  1.00 0.00 ? 29  LEU A CA   3  
ATOM 4863  C C    . LEU A 1 29  ? 10.362  1.734   -6.885  1.00 0.00 ? 29  LEU A C    3  
ATOM 4864  O O    . LEU A 1 29  ? 10.453  2.377   -7.932  1.00 0.00 ? 29  LEU A O    3  
ATOM 4865  C CB   . LEU A 1 29  ? 9.041   -0.325  -6.359  1.00 0.00 ? 29  LEU A CB   3  
ATOM 4866  C CG   . LEU A 1 29  ? 8.530   -1.620  -6.991  1.00 0.00 ? 29  LEU A CG   3  
ATOM 4867  C CD1  . LEU A 1 29  ? 7.551   -2.319  -6.059  1.00 0.00 ? 29  LEU A CD1  3  
ATOM 4868  C CD2  . LEU A 1 29  ? 7.879   -1.336  -8.336  1.00 0.00 ? 29  LEU A CD2  3  
ATOM 4869  H H    . LEU A 1 29  ? 11.292  -0.822  -5.299  1.00 0.00 ? 29  LEU A H    3  
ATOM 4870  H HA   . LEU A 1 29  ? 10.494  -0.128  -7.918  1.00 0.00 ? 29  LEU A HA   3  
ATOM 4871  H HB2  . LEU A 1 29  ? 9.162   -0.499  -5.300  1.00 0.00 ? 29  LEU A HB2  3  
ATOM 4872  H HB3  . LEU A 1 29  ? 8.292   0.438   -6.513  1.00 0.00 ? 29  LEU A HB3  3  
ATOM 4873  H HG   . LEU A 1 29  ? 9.365   -2.286  -7.155  1.00 0.00 ? 29  LEU A HG   3  
ATOM 4874  H HD11 . LEU A 1 29  ? 7.070   -1.586  -5.429  1.00 0.00 ? 29  LEU A HD11 3  
ATOM 4875  H HD12 . LEU A 1 29  ? 8.083   -3.030  -5.445  1.00 0.00 ? 29  LEU A HD12 3  
ATOM 4876  H HD13 . LEU A 1 29  ? 6.805   -2.836  -6.644  1.00 0.00 ? 29  LEU A HD13 3  
ATOM 4877  H HD21 . LEU A 1 29  ? 6.831   -1.117  -8.190  1.00 0.00 ? 29  LEU A HD21 3  
ATOM 4878  H HD22 . LEU A 1 29  ? 7.979   -2.202  -8.974  1.00 0.00 ? 29  LEU A HD22 3  
ATOM 4879  H HD23 . LEU A 1 29  ? 8.363   -0.489  -8.799  1.00 0.00 ? 29  LEU A HD23 3  
ATOM 4880  N N    . THR A 1 30  ? 10.253  2.307   -5.691  1.00 0.00 ? 30  THR A N    3  
ATOM 4881  C CA   . THR A 1 30  ? 10.236  3.758   -5.538  1.00 0.00 ? 30  THR A CA   3  
ATOM 4882  C C    . THR A 1 30  ? 11.647  4.330   -5.563  1.00 0.00 ? 30  THR A C    3  
ATOM 4883  O O    . THR A 1 30  ? 11.853  5.485   -5.936  1.00 0.00 ? 30  THR A O    3  
ATOM 4884  C CB   . THR A 1 30  ? 9.546   4.176   -4.226  1.00 0.00 ? 30  THR A CB   3  
ATOM 4885  O OG1  . THR A 1 30  ? 10.329  3.752   -3.105  1.00 0.00 ? 30  THR A OG1  3  
ATOM 4886  C CG2  . THR A 1 30  ? 8.151   3.576   -4.132  1.00 0.00 ? 30  THR A CG2  3  
ATOM 4887  H H    . THR A 1 30  ? 10.183  1.742   -4.894  1.00 0.00 ? 30  THR A H    3  
ATOM 4888  H HA   . THR A 1 30  ? 9.674   4.173   -6.364  1.00 0.00 ? 30  THR A HA   3  
ATOM 4889  H HB   . THR A 1 30  ? 9.460   5.253   -4.210  1.00 0.00 ? 30  THR A HB   3  
ATOM 4890  H HG1  . THR A 1 30  ? 11.145  3.353   -3.417  1.00 0.00 ? 30  THR A HG1  3  
ATOM 4891  H HG21 . THR A 1 30  ? 7.618   3.757   -5.055  1.00 0.00 ? 30  THR A HG21 3  
ATOM 4892  H HG22 . THR A 1 30  ? 7.617   4.032   -3.312  1.00 0.00 ? 30  THR A HG22 3  
ATOM 4893  H HG23 . THR A 1 30  ? 8.228   2.513   -3.964  1.00 0.00 ? 30  THR A HG23 3  
ATOM 4894  N N    . GLY A 1 31  ? 12.619  3.515   -5.163  1.00 0.00 ? 31  GLY A N    3  
ATOM 4895  C CA   . GLY A 1 31  ? 14.000  3.960   -5.147  1.00 0.00 ? 31  GLY A CA   3  
ATOM 4896  C C    . GLY A 1 31  ? 14.300  4.882   -3.983  1.00 0.00 ? 31  GLY A C    3  
ATOM 4897  O O    . GLY A 1 31  ? 15.206  5.712   -4.056  1.00 0.00 ? 31  GLY A O    3  
ATOM 4898  H H    . GLY A 1 31  ? 12.396  2.605   -4.877  1.00 0.00 ? 31  GLY A H    3  
ATOM 4899  H HA2  . GLY A 1 31  ? 14.644  3.095   -5.084  1.00 0.00 ? 31  GLY A HA2  3  
ATOM 4900  H HA3  . GLY A 1 31  ? 14.208  4.483   -6.070  1.00 0.00 ? 31  GLY A HA3  3  
ATOM 4901  N N    . LEU A 1 32  ? 13.535  4.740   -2.906  1.00 0.00 ? 32  LEU A N    3  
ATOM 4902  C CA   . LEU A 1 32  ? 13.721  5.568   -1.720  1.00 0.00 ? 32  LEU A CA   3  
ATOM 4903  C C    . LEU A 1 32  ? 14.256  4.740   -0.555  1.00 0.00 ? 32  LEU A C    3  
ATOM 4904  O O    . LEU A 1 32  ? 14.486  3.539   -0.689  1.00 0.00 ? 32  LEU A O    3  
ATOM 4905  C CB   . LEU A 1 32  ? 12.401  6.232   -1.324  1.00 0.00 ? 32  LEU A CB   3  
ATOM 4906  C CG   . LEU A 1 32  ? 11.789  7.177   -2.359  1.00 0.00 ? 32  LEU A CG   3  
ATOM 4907  C CD1  . LEU A 1 32  ? 10.336  7.472   -2.019  1.00 0.00 ? 32  LEU A CD1  3  
ATOM 4908  C CD2  . LEU A 1 32  ? 12.591  8.467   -2.443  1.00 0.00 ? 32  LEU A CD2  3  
ATOM 4909  H H    . LEU A 1 32  ? 12.828  4.061   -2.907  1.00 0.00 ? 32  LEU A H    3  
ATOM 4910  H HA   . LEU A 1 32  ? 14.442  6.335   -1.961  1.00 0.00 ? 32  LEU A HA   3  
ATOM 4911  H HB2  . LEU A 1 32  ? 11.684  5.450   -1.127  1.00 0.00 ? 32  LEU A HB2  3  
ATOM 4912  H HB3  . LEU A 1 32  ? 12.574  6.797   -0.420  1.00 0.00 ? 32  LEU A HB3  3  
ATOM 4913  H HG   . LEU A 1 32  ? 11.814  6.703   -3.330  1.00 0.00 ? 32  LEU A HG   3  
ATOM 4914  H HD11 . LEU A 1 32  ? 10.143  8.526   -2.149  1.00 0.00 ? 32  LEU A HD11 3  
ATOM 4915  H HD12 . LEU A 1 32  ? 10.143  7.194   -0.994  1.00 0.00 ? 32  LEU A HD12 3  
ATOM 4916  H HD13 . LEU A 1 32  ? 9.691   6.903   -2.673  1.00 0.00 ? 32  LEU A HD13 3  
ATOM 4917  H HD21 . LEU A 1 32  ? 12.047  9.191   -3.031  1.00 0.00 ? 32  LEU A HD21 3  
ATOM 4918  H HD22 . LEU A 1 32  ? 13.545  8.268   -2.911  1.00 0.00 ? 32  LEU A HD22 3  
ATOM 4919  H HD23 . LEU A 1 32  ? 12.752  8.857   -1.449  1.00 0.00 ? 32  LEU A HD23 3  
ATOM 4920  N N    . SER A 1 33  ? 14.450  5.392   0.587   1.00 0.00 ? 33  SER A N    3  
ATOM 4921  C CA   . SER A 1 33  ? 14.960  4.716   1.775   1.00 0.00 ? 33  SER A CA   3  
ATOM 4922  C C    . SER A 1 33  ? 13.927  4.740   2.897   1.00 0.00 ? 33  SER A C    3  
ATOM 4923  O O    . SER A 1 33  ? 13.459  5.803   3.303   1.00 0.00 ? 33  SER A O    3  
ATOM 4924  C CB   . SER A 1 33  ? 16.257  5.376   2.246   1.00 0.00 ? 33  SER A CB   3  
ATOM 4925  O OG   . SER A 1 33  ? 17.179  5.506   1.179   1.00 0.00 ? 33  SER A OG   3  
ATOM 4926  H H    . SER A 1 33  ? 14.249  6.350   0.631   1.00 0.00 ? 33  SER A H    3  
ATOM 4927  H HA   . SER A 1 33  ? 15.164  3.689   1.511   1.00 0.00 ? 33  SER A HA   3  
ATOM 4928  H HB2  . SER A 1 33  ? 16.037  6.358   2.637   1.00 0.00 ? 33  SER A HB2  3  
ATOM 4929  H HB3  . SER A 1 33  ? 16.704  4.771   3.022   1.00 0.00 ? 33  SER A HB3  3  
ATOM 4930  H HG   . SER A 1 33  ? 17.749  4.733   1.151   1.00 0.00 ? 33  SER A HG   3  
ATOM 4931  N N    . ILE A 1 34  ? 13.577  3.558   3.395   1.00 0.00 ? 34  ILE A N    3  
ATOM 4932  C CA   . ILE A 1 34  ? 12.601  3.442   4.471   1.00 0.00 ? 34  ILE A CA   3  
ATOM 4933  C C    . ILE A 1 34  ? 13.219  3.810   5.817   1.00 0.00 ? 34  ILE A C    3  
ATOM 4934  O O    . ILE A 1 34  ? 12.683  4.638   6.551   1.00 0.00 ? 34  ILE A O    3  
ATOM 4935  C CB   . ILE A 1 34  ? 12.024  2.017   4.557   1.00 0.00 ? 34  ILE A CB   3  
ATOM 4936  C CG1  . ILE A 1 34  ? 11.259  1.675   3.276   1.00 0.00 ? 34  ILE A CG1  3  
ATOM 4937  C CG2  . ILE A 1 34  ? 11.118  1.884   5.772   1.00 0.00 ? 34  ILE A CG2  3  
ATOM 4938  C CD1  . ILE A 1 34  ? 11.284  0.202   2.933   1.00 0.00 ? 34  ILE A CD1  3  
ATOM 4939  H H    . ILE A 1 34  ? 13.985  2.746   3.030   1.00 0.00 ? 34  ILE A H    3  
ATOM 4940  H HA   . ILE A 1 34  ? 11.790  4.125   4.260   1.00 0.00 ? 34  ILE A HA   3  
ATOM 4941  H HB   . ILE A 1 34  ? 12.845  1.326   4.672   1.00 0.00 ? 34  ILE A HB   3  
ATOM 4942  H HG12 . ILE A 1 34  ? 10.228  1.971   3.389   1.00 0.00 ? 34  ILE A HG12 3  
ATOM 4943  H HG13 . ILE A 1 34  ? 11.696  2.216   2.450   1.00 0.00 ? 34  ILE A HG13 3  
ATOM 4944  H HG21 . ILE A 1 34  ? 11.038  2.840   6.267   1.00 0.00 ? 34  ILE A HG21 3  
ATOM 4945  H HG22 . ILE A 1 34  ? 10.138  1.559   5.457   1.00 0.00 ? 34  ILE A HG22 3  
ATOM 4946  H HG23 . ILE A 1 34  ? 11.536  1.159   6.455   1.00 0.00 ? 34  ILE A HG23 3  
ATOM 4947  H HD11 . ILE A 1 34  ? 11.525  -0.370  3.816   1.00 0.00 ? 34  ILE A HD11 3  
ATOM 4948  H HD12 . ILE A 1 34  ? 10.316  -0.098  2.562   1.00 0.00 ? 34  ILE A HD12 3  
ATOM 4949  H HD13 . ILE A 1 34  ? 12.031  0.022   2.174   1.00 0.00 ? 34  ILE A HD13 3  
ATOM 4950  N N    . GLY A 1 35  ? 14.351  3.188   6.131   1.00 0.00 ? 35  GLY A N    3  
ATOM 4951  C CA   . GLY A 1 35  ? 15.025  3.464   7.386   1.00 0.00 ? 35  GLY A CA   3  
ATOM 4952  C C    . GLY A 1 35  ? 15.078  2.252   8.294   1.00 0.00 ? 35  GLY A C    3  
ATOM 4953  O O    . GLY A 1 35  ? 14.614  1.166   7.944   1.00 0.00 ? 35  GLY A O    3  
ATOM 4954  H H    . GLY A 1 35  ? 14.732  2.536   5.505   1.00 0.00 ? 35  GLY A H    3  
ATOM 4955  H HA2  . GLY A 1 35  ? 16.033  3.788   7.177   1.00 0.00 ? 35  GLY A HA2  3  
ATOM 4956  H HA3  . GLY A 1 35  ? 14.501  4.259   7.896   1.00 0.00 ? 35  GLY A HA3  3  
ATOM 4957  N N    . PRO A 1 36  ? 15.656  2.430   9.492   1.00 0.00 ? 36  PRO A N    3  
ATOM 4958  C CA   . PRO A 1 36  ? 15.783  1.353   10.478  1.00 0.00 ? 36  PRO A CA   3  
ATOM 4959  C C    . PRO A 1 36  ? 14.439  0.954   11.076  1.00 0.00 ? 36  PRO A C    3  
ATOM 4960  O O    . PRO A 1 36  ? 14.162  -0.230  11.273  1.00 0.00 ? 36  PRO A O    3  
ATOM 4961  C CB   . PRO A 1 36  ? 16.688  1.959   11.552  1.00 0.00 ? 36  PRO A CB   3  
ATOM 4962  C CG   . PRO A 1 36  ? 16.483  3.430   11.433  1.00 0.00 ? 36  PRO A CG   3  
ATOM 4963  C CD   . PRO A 1 36  ? 16.230  3.697   9.975   1.00 0.00 ? 36  PRO A CD   3  
ATOM 4964  H HA   . PRO A 1 36  ? 16.259  0.480   10.053  1.00 0.00 ? 36  PRO A HA   3  
ATOM 4965  H HB2  . PRO A 1 36  ? 16.390  1.595   12.526  1.00 0.00 ? 36  PRO A HB2  3  
ATOM 4966  H HB3  . PRO A 1 36  ? 17.715  1.688   11.358  1.00 0.00 ? 36  PRO A HB3  3  
ATOM 4967  H HG2  . PRO A 1 36  ? 15.631  3.731   12.023  1.00 0.00 ? 36  PRO A HG2  3  
ATOM 4968  H HG3  . PRO A 1 36  ? 17.370  3.951   11.761  1.00 0.00 ? 36  PRO A HG3  3  
ATOM 4969  H HD2  . PRO A 1 36  ? 15.528  4.508   9.857   1.00 0.00 ? 36  PRO A HD2  3  
ATOM 4970  H HD3  . PRO A 1 36  ? 17.156  3.918   9.466   1.00 0.00 ? 36  PRO A HD3  3  
ATOM 4971  N N    . ASP A 1 37  ? 13.605  1.949   11.364  1.00 0.00 ? 37  ASP A N    3  
ATOM 4972  C CA   . ASP A 1 37  ? 12.289  1.701   11.940  1.00 0.00 ? 37  ASP A CA   3  
ATOM 4973  C C    . ASP A 1 37  ? 11.217  1.678   10.854  1.00 0.00 ? 37  ASP A C    3  
ATOM 4974  O O    . ASP A 1 37  ? 10.571  2.690   10.584  1.00 0.00 ? 37  ASP A O    3  
ATOM 4975  C CB   . ASP A 1 37  ? 11.955  2.770   12.981  1.00 0.00 ? 37  ASP A CB   3  
ATOM 4976  C CG   . ASP A 1 37  ? 13.043  2.920   14.026  1.00 0.00 ? 37  ASP A CG   3  
ATOM 4977  O OD1  . ASP A 1 37  ? 13.317  1.935   14.743  1.00 0.00 ? 37  ASP A OD1  3  
ATOM 4978  O OD2  . ASP A 1 37  ? 13.621  4.023   14.128  1.00 0.00 ? 37  ASP A OD2  3  
ATOM 4979  H H    . ASP A 1 37  ? 13.884  2.871   11.184  1.00 0.00 ? 37  ASP A H    3  
ATOM 4980  H HA   . ASP A 1 37  ? 12.314  0.736   12.423  1.00 0.00 ? 37  ASP A HA   3  
ATOM 4981  H HB2  . ASP A 1 37  ? 11.826  3.720   12.483  1.00 0.00 ? 37  ASP A HB2  3  
ATOM 4982  H HB3  . ASP A 1 37  ? 11.035  2.502   13.480  1.00 0.00 ? 37  ASP A HB3  3  
ATOM 4983  N N    . PHE A 1 38  ? 11.035  0.517   10.234  1.00 0.00 ? 38  PHE A N    3  
ATOM 4984  C CA   . PHE A 1 38  ? 10.043  0.362   9.176   1.00 0.00 ? 38  PHE A CA   3  
ATOM 4985  C C    . PHE A 1 38  ? 8.785   1.168   9.488   1.00 0.00 ? 38  PHE A C    3  
ATOM 4986  O O    . PHE A 1 38  ? 8.435   2.096   8.759   1.00 0.00 ? 38  PHE A O    3  
ATOM 4987  C CB   . PHE A 1 38  ? 9.685   -1.114  8.995   1.00 0.00 ? 38  PHE A CB   3  
ATOM 4988  C CG   . PHE A 1 38  ? 9.091   -1.427  7.651   1.00 0.00 ? 38  PHE A CG   3  
ATOM 4989  C CD1  . PHE A 1 38  ? 9.816   -1.207  6.491   1.00 0.00 ? 38  PHE A CD1  3  
ATOM 4990  C CD2  . PHE A 1 38  ? 7.810   -1.941  7.548   1.00 0.00 ? 38  PHE A CD2  3  
ATOM 4991  C CE1  . PHE A 1 38  ? 9.272   -1.493  5.253   1.00 0.00 ? 38  PHE A CE1  3  
ATOM 4992  C CE2  . PHE A 1 38  ? 7.259   -2.230  6.313   1.00 0.00 ? 38  PHE A CE2  3  
ATOM 4993  C CZ   . PHE A 1 38  ? 7.993   -2.006  5.165   1.00 0.00 ? 38  PHE A CZ   3  
ATOM 4994  H H    . PHE A 1 38  ? 11.583  -0.255  10.493  1.00 0.00 ? 38  PHE A H    3  
ATOM 4995  H HA   . PHE A 1 38  ? 10.477  0.733   8.260   1.00 0.00 ? 38  PHE A HA   3  
ATOM 4996  H HB2  . PHE A 1 38  ? 10.578  -1.710  9.110   1.00 0.00 ? 38  PHE A HB2  3  
ATOM 4997  H HB3  . PHE A 1 38  ? 8.968   -1.398  9.750   1.00 0.00 ? 38  PHE A HB3  3  
ATOM 4998  H HD1  . PHE A 1 38  ? 10.818  -0.807  6.559   1.00 0.00 ? 38  PHE A HD1  3  
ATOM 4999  H HD2  . PHE A 1 38  ? 7.235   -2.117  8.448   1.00 0.00 ? 38  PHE A HD2  3  
ATOM 5000  H HE1  . PHE A 1 38  ? 9.847   -1.317  4.356   1.00 0.00 ? 38  PHE A HE1  3  
ATOM 5001  H HE2  . PHE A 1 38  ? 6.260   -2.631  6.248   1.00 0.00 ? 38  PHE A HE2  3  
ATOM 5002  H HZ   . PHE A 1 38  ? 7.565   -2.230  4.198   1.00 0.00 ? 38  PHE A HZ   3  
ATOM 5003  N N    . GLN A 1 39  ? 8.112   0.805   10.575  1.00 0.00 ? 39  GLN A N    3  
ATOM 5004  C CA   . GLN A 1 39  ? 6.893   1.493   10.982  1.00 0.00 ? 39  GLN A CA   3  
ATOM 5005  C C    . GLN A 1 39  ? 7.040   3.003   10.822  1.00 0.00 ? 39  GLN A C    3  
ATOM 5006  O O    . GLN A 1 39  ? 6.141   3.675   10.317  1.00 0.00 ? 39  GLN A O    3  
ATOM 5007  C CB   . GLN A 1 39  ? 6.551   1.153   12.434  1.00 0.00 ? 39  GLN A CB   3  
ATOM 5008  C CG   . GLN A 1 39  ? 5.192   1.668   12.876  1.00 0.00 ? 39  GLN A CG   3  
ATOM 5009  C CD   . GLN A 1 39  ? 5.259   3.065   13.463  1.00 0.00 ? 39  GLN A CD   3  
ATOM 5010  O OE1  . GLN A 1 39  ? 5.698   3.253   14.597  1.00 0.00 ? 39  GLN A OE1  3  
ATOM 5011  N NE2  . GLN A 1 39  ? 4.822   4.053   12.691  1.00 0.00 ? 39  GLN A NE2  3  
ATOM 5012  H H    . GLN A 1 39  ? 8.443   0.058   11.114  1.00 0.00 ? 39  GLN A H    3  
ATOM 5013  H HA   . GLN A 1 39  ? 6.092   1.152   10.345  1.00 0.00 ? 39  GLN A HA   3  
ATOM 5014  H HB2  . GLN A 1 39  ? 6.563   0.080   12.552  1.00 0.00 ? 39  GLN A HB2  3  
ATOM 5015  H HB3  . GLN A 1 39  ? 7.303   1.585   13.079  1.00 0.00 ? 39  GLN A HB3  3  
ATOM 5016  H HG2  . GLN A 1 39  ? 4.532   1.685   12.021  1.00 0.00 ? 39  GLN A HG2  3  
ATOM 5017  H HG3  . GLN A 1 39  ? 4.792   0.999   13.623  1.00 0.00 ? 39  GLN A HG3  3  
ATOM 5018  H HE21 . GLN A 1 39  ? 4.484   3.827   11.799  1.00 0.00 ? 39  GLN A HE21 3  
ATOM 5019  H HE22 . GLN A 1 39  ? 4.853   4.965   13.045  1.00 0.00 ? 39  GLN A HE22 3  
ATOM 5020  N N    . LYS A 1 40  ? 8.180   3.530   11.256  1.00 0.00 ? 40  LYS A N    3  
ATOM 5021  C CA   . LYS A 1 40  ? 8.447   4.961   11.161  1.00 0.00 ? 40  LYS A CA   3  
ATOM 5022  C C    . LYS A 1 40  ? 8.611   5.387   9.706   1.00 0.00 ? 40  LYS A C    3  
ATOM 5023  O O    . LYS A 1 40  ? 7.777   6.111   9.163   1.00 0.00 ? 40  LYS A O    3  
ATOM 5024  C CB   . LYS A 1 40  ? 9.704   5.320   11.954  1.00 0.00 ? 40  LYS A CB   3  
ATOM 5025  C CG   . LYS A 1 40  ? 9.683   4.820   13.388  1.00 0.00 ? 40  LYS A CG   3  
ATOM 5026  C CD   . LYS A 1 40  ? 8.611   5.518   14.207  1.00 0.00 ? 40  LYS A CD   3  
ATOM 5027  C CE   . LYS A 1 40  ? 8.665   5.102   15.669  1.00 0.00 ? 40  LYS A CE   3  
ATOM 5028  N NZ   . LYS A 1 40  ? 7.814   5.973   16.526  1.00 0.00 ? 40  LYS A NZ   3  
ATOM 5029  H H    . LYS A 1 40  ? 8.859   2.943   11.650  1.00 0.00 ? 40  LYS A H    3  
ATOM 5030  H HA   . LYS A 1 40  ? 7.602   5.484   11.584  1.00 0.00 ? 40  LYS A HA   3  
ATOM 5031  H HB2  . LYS A 1 40  ? 10.562  4.892   11.458  1.00 0.00 ? 40  LYS A HB2  3  
ATOM 5032  H HB3  . LYS A 1 40  ? 9.810   6.395   11.972  1.00 0.00 ? 40  LYS A HB3  3  
ATOM 5033  H HG2  . LYS A 1 40  ? 9.485   3.758   13.387  1.00 0.00 ? 40  LYS A HG2  3  
ATOM 5034  H HG3  . LYS A 1 40  ? 10.647  5.008   13.839  1.00 0.00 ? 40  LYS A HG3  3  
ATOM 5035  H HD2  . LYS A 1 40  ? 8.761   6.586   14.143  1.00 0.00 ? 40  LYS A HD2  3  
ATOM 5036  H HD3  . LYS A 1 40  ? 7.640   5.264   13.804  1.00 0.00 ? 40  LYS A HD3  3  
ATOM 5037  H HE2  . LYS A 1 40  ? 8.321   4.082   15.751  1.00 0.00 ? 40  LYS A HE2  3  
ATOM 5038  H HE3  . LYS A 1 40  ? 9.689   5.164   16.009  1.00 0.00 ? 40  LYS A HE3  3  
ATOM 5039  H HZ1  . LYS A 1 40  ? 8.099   5.880   17.522  1.00 0.00 ? 40  LYS A HZ1  3  
ATOM 5040  H HZ2  . LYS A 1 40  ? 6.816   5.697   16.436  1.00 0.00 ? 40  LYS A HZ2  3  
ATOM 5041  H HZ3  . LYS A 1 40  ? 7.916   6.967   16.237  1.00 0.00 ? 40  LYS A HZ3  3  
ATOM 5042  N N    . GLY A 1 41  ? 9.692   4.933   9.079   1.00 0.00 ? 41  GLY A N    3  
ATOM 5043  C CA   . GLY A 1 41  ? 9.945   5.277   7.692   1.00 0.00 ? 41  GLY A CA   3  
ATOM 5044  C C    . GLY A 1 41  ? 8.670   5.370   6.876   1.00 0.00 ? 41  GLY A C    3  
ATOM 5045  O O    . GLY A 1 41  ? 8.536   6.241   6.016   1.00 0.00 ? 41  GLY A O    3  
ATOM 5046  H H    . GLY A 1 41  ? 10.322  4.359   9.561   1.00 0.00 ? 41  GLY A H    3  
ATOM 5047  H HA2  . GLY A 1 41  ? 10.453  6.229   7.655   1.00 0.00 ? 41  GLY A HA2  3  
ATOM 5048  H HA3  . GLY A 1 41  ? 10.583  4.523   7.256   1.00 0.00 ? 41  GLY A HA3  3  
ATOM 5049  N N    . LEU A 1 42  ? 7.731   4.469   7.144   1.00 0.00 ? 42  LEU A N    3  
ATOM 5050  C CA   . LEU A 1 42  ? 6.461   4.452   6.427   1.00 0.00 ? 42  LEU A CA   3  
ATOM 5051  C C    . LEU A 1 42  ? 5.431   5.336   7.123   1.00 0.00 ? 42  LEU A C    3  
ATOM 5052  O O    . LEU A 1 42  ? 4.603   5.975   6.472   1.00 0.00 ? 42  LEU A O    3  
ATOM 5053  C CB   . LEU A 1 42  ? 5.932   3.020   6.320   1.00 0.00 ? 42  LEU A CB   3  
ATOM 5054  C CG   . LEU A 1 42  ? 6.896   1.992   5.728   1.00 0.00 ? 42  LEU A CG   3  
ATOM 5055  C CD1  . LEU A 1 42  ? 6.238   0.622   5.659   1.00 0.00 ? 42  LEU A CD1  3  
ATOM 5056  C CD2  . LEU A 1 42  ? 7.363   2.432   4.348   1.00 0.00 ? 42  LEU A CD2  3  
ATOM 5057  H H    . LEU A 1 42  ? 7.895   3.801   7.840   1.00 0.00 ? 42  LEU A H    3  
ATOM 5058  H HA   . LEU A 1 42  ? 6.636   4.837   5.434   1.00 0.00 ? 42  LEU A HA   3  
ATOM 5059  H HB2  . LEU A 1 42  ? 5.667   2.691   7.313   1.00 0.00 ? 42  LEU A HB2  3  
ATOM 5060  H HB3  . LEU A 1 42  ? 5.047   3.040   5.701   1.00 0.00 ? 42  LEU A HB3  3  
ATOM 5061  H HG   . LEU A 1 42  ? 7.765   1.912   6.367   1.00 0.00 ? 42  LEU A HG   3  
ATOM 5062  H HD11 . LEU A 1 42  ? 5.212   0.731   5.342   1.00 0.00 ? 42  LEU A HD11 3  
ATOM 5063  H HD12 . LEU A 1 42  ? 6.266   0.160   6.634   1.00 0.00 ? 42  LEU A HD12 3  
ATOM 5064  H HD13 . LEU A 1 42  ? 6.771   0.003   4.952   1.00 0.00 ? 42  LEU A HD13 3  
ATOM 5065  H HD21 . LEU A 1 42  ? 8.165   3.147   4.452   1.00 0.00 ? 42  LEU A HD21 3  
ATOM 5066  H HD22 . LEU A 1 42  ? 6.540   2.888   3.817   1.00 0.00 ? 42  LEU A HD22 3  
ATOM 5067  H HD23 . LEU A 1 42  ? 7.717   1.572   3.798   1.00 0.00 ? 42  LEU A HD23 3  
ATOM 5068  N N    . LYS A 1 43  ? 5.488   5.370   8.449   1.00 0.00 ? 43  LYS A N    3  
ATOM 5069  C CA   . LYS A 1 43  ? 4.563   6.178   9.235   1.00 0.00 ? 43  LYS A CA   3  
ATOM 5070  C C    . LYS A 1 43  ? 4.208   7.467   8.501   1.00 0.00 ? 43  LYS A C    3  
ATOM 5071  O O    . LYS A 1 43  ? 3.068   7.658   8.077   1.00 0.00 ? 43  LYS A O    3  
ATOM 5072  C CB   . LYS A 1 43  ? 5.173   6.507   10.600  1.00 0.00 ? 43  LYS A CB   3  
ATOM 5073  C CG   . LYS A 1 43  ? 4.276   7.364   11.476  1.00 0.00 ? 43  LYS A CG   3  
ATOM 5074  C CD   . LYS A 1 43  ? 5.087   8.249   12.407  1.00 0.00 ? 43  LYS A CD   3  
ATOM 5075  C CE   . LYS A 1 43  ? 4.226   9.333   13.038  1.00 0.00 ? 43  LYS A CE   3  
ATOM 5076  N NZ   . LYS A 1 43  ? 4.728   9.727   14.383  1.00 0.00 ? 43  LYS A NZ   3  
ATOM 5077  H H    . LYS A 1 43  ? 6.170   4.839   8.912   1.00 0.00 ? 43  LYS A H    3  
ATOM 5078  H HA   . LYS A 1 43  ? 3.661   5.603   9.382   1.00 0.00 ? 43  LYS A HA   3  
ATOM 5079  H HB2  . LYS A 1 43  ? 5.375   5.584   11.122  1.00 0.00 ? 43  LYS A HB2  3  
ATOM 5080  H HB3  . LYS A 1 43  ? 6.103   7.036   10.447  1.00 0.00 ? 43  LYS A HB3  3  
ATOM 5081  H HG2  . LYS A 1 43  ? 3.663   7.991   10.845  1.00 0.00 ? 43  LYS A HG2  3  
ATOM 5082  H HG3  . LYS A 1 43  ? 3.643   6.719   12.068  1.00 0.00 ? 43  LYS A HG3  3  
ATOM 5083  H HD2  . LYS A 1 43  ? 5.511   7.640   13.192  1.00 0.00 ? 43  LYS A HD2  3  
ATOM 5084  H HD3  . LYS A 1 43  ? 5.882   8.717   11.844  1.00 0.00 ? 43  LYS A HD3  3  
ATOM 5085  H HE2  . LYS A 1 43  ? 4.230   10.198  12.394  1.00 0.00 ? 43  LYS A HE2  3  
ATOM 5086  H HE3  . LYS A 1 43  ? 3.216   8.961   13.134  1.00 0.00 ? 43  LYS A HE3  3  
ATOM 5087  H HZ1  . LYS A 1 43  ? 5.207   8.923   14.836  1.00 0.00 ? 43  LYS A HZ1  3  
ATOM 5088  H HZ2  . LYS A 1 43  ? 3.935   10.026  14.987  1.00 0.00 ? 43  LYS A HZ2  3  
ATOM 5089  H HZ3  . LYS A 1 43  ? 5.400   10.514  14.297  1.00 0.00 ? 43  LYS A HZ3  3  
ATOM 5090  N N    . ASP A 1 44  ? 5.191   8.349   8.354   1.00 0.00 ? 44  ASP A N    3  
ATOM 5091  C CA   . ASP A 1 44  ? 4.983   9.619   7.669   1.00 0.00 ? 44  ASP A CA   3  
ATOM 5092  C C    . ASP A 1 44  ? 4.167   9.422   6.396   1.00 0.00 ? 44  ASP A C    3  
ATOM 5093  O O    . ASP A 1 44  ? 3.320   10.247  6.054   1.00 0.00 ? 44  ASP A O    3  
ATOM 5094  C CB   . ASP A 1 44  ? 6.326   10.268  7.333   1.00 0.00 ? 44  ASP A CB   3  
ATOM 5095  C CG   . ASP A 1 44  ? 7.362   9.256   6.883   1.00 0.00 ? 44  ASP A CG   3  
ATOM 5096  O OD1  . ASP A 1 44  ? 7.225   8.725   5.762   1.00 0.00 ? 44  ASP A OD1  3  
ATOM 5097  O OD2  . ASP A 1 44  ? 8.310   8.996   7.654   1.00 0.00 ? 44  ASP A OD2  3  
ATOM 5098  H H    . ASP A 1 44  ? 6.079   8.139   8.714   1.00 0.00 ? 44  ASP A H    3  
ATOM 5099  H HA   . ASP A 1 44  ? 4.436   10.270  8.335   1.00 0.00 ? 44  ASP A HA   3  
ATOM 5100  H HB2  . ASP A 1 44  ? 6.184   10.986  6.539   1.00 0.00 ? 44  ASP A HB2  3  
ATOM 5101  H HB3  . ASP A 1 44  ? 6.703   10.777  8.209   1.00 0.00 ? 44  ASP A HB3  3  
ATOM 5102  N N    . GLY A 1 45  ? 4.429   8.323   5.694   1.00 0.00 ? 45  GLY A N    3  
ATOM 5103  C CA   . GLY A 1 45  ? 3.712   8.039   4.465   1.00 0.00 ? 45  GLY A CA   3  
ATOM 5104  C C    . GLY A 1 45  ? 4.340   8.707   3.258   1.00 0.00 ? 45  GLY A C    3  
ATOM 5105  O O    . GLY A 1 45  ? 3.637   9.203   2.377   1.00 0.00 ? 45  GLY A O    3  
ATOM 5106  H H    . GLY A 1 45  ? 5.116   7.701   6.014   1.00 0.00 ? 45  GLY A H    3  
ATOM 5107  H HA2  . GLY A 1 45  ? 3.701   6.970   4.306   1.00 0.00 ? 45  GLY A HA2  3  
ATOM 5108  H HA3  . GLY A 1 45  ? 2.695   8.387   4.566   1.00 0.00 ? 45  GLY A HA3  3  
ATOM 5109  N N    . THR A 1 46  ? 5.669   8.724   3.217   1.00 0.00 ? 46  THR A N    3  
ATOM 5110  C CA   . THR A 1 46  ? 6.392   9.339   2.113   1.00 0.00 ? 46  THR A CA   3  
ATOM 5111  C C    . THR A 1 46  ? 6.610   8.346   0.977   1.00 0.00 ? 46  THR A C    3  
ATOM 5112  O O    . THR A 1 46  ? 6.299   8.633   -0.180  1.00 0.00 ? 46  THR A O    3  
ATOM 5113  C CB   . THR A 1 46  ? 7.758   9.886   2.570   1.00 0.00 ? 46  THR A CB   3  
ATOM 5114  O OG1  . THR A 1 46  ? 8.445   8.900   3.349   1.00 0.00 ? 46  THR A OG1  3  
ATOM 5115  C CG2  . THR A 1 46  ? 7.585   11.157  3.389   1.00 0.00 ? 46  THR A CG2  3  
ATOM 5116  H H    . THR A 1 46  ? 6.174   8.312   3.950   1.00 0.00 ? 46  THR A H    3  
ATOM 5117  H HA   . THR A 1 46  ? 5.801   10.166  1.746   1.00 0.00 ? 46  THR A HA   3  
ATOM 5118  H HB   . THR A 1 46  ? 8.348   10.117  1.694   1.00 0.00 ? 46  THR A HB   3  
ATOM 5119  H HG1  . THR A 1 46  ? 9.018   9.336   3.983   1.00 0.00 ? 46  THR A HG1  3  
ATOM 5120  H HG21 . THR A 1 46  ? 7.577   12.011  2.729   1.00 0.00 ? 46  THR A HG21 3  
ATOM 5121  H HG22 . THR A 1 46  ? 8.404   11.249  4.087   1.00 0.00 ? 46  THR A HG22 3  
ATOM 5122  H HG23 . THR A 1 46  ? 6.653   11.111  3.930   1.00 0.00 ? 46  THR A HG23 3  
ATOM 5123  N N    . ILE A 1 47  ? 7.145   7.177   1.313   1.00 0.00 ? 47  ILE A N    3  
ATOM 5124  C CA   . ILE A 1 47  ? 7.402   6.142   0.321   1.00 0.00 ? 47  ILE A CA   3  
ATOM 5125  C C    . ILE A 1 47  ? 6.113   5.432   -0.080  1.00 0.00 ? 47  ILE A C    3  
ATOM 5126  O O    . ILE A 1 47  ? 5.759   5.383   -1.258  1.00 0.00 ? 47  ILE A O    3  
ATOM 5127  C CB   . ILE A 1 47  ? 8.408   5.098   0.844   1.00 0.00 ? 47  ILE A CB   3  
ATOM 5128  C CG1  . ILE A 1 47  ? 9.698   5.784   1.297   1.00 0.00 ? 47  ILE A CG1  3  
ATOM 5129  C CG2  . ILE A 1 47  ? 8.701   4.061   -0.230  1.00 0.00 ? 47  ILE A CG2  3  
ATOM 5130  C CD1  . ILE A 1 47  ? 10.405  5.059   2.422   1.00 0.00 ? 47  ILE A CD1  3  
ATOM 5131  H H    . ILE A 1 47  ? 7.372   7.008   2.252   1.00 0.00 ? 47  ILE A H    3  
ATOM 5132  H HA   . ILE A 1 47  ? 7.827   6.615   -0.552  1.00 0.00 ? 47  ILE A HA   3  
ATOM 5133  H HB   . ILE A 1 47  ? 7.962   4.592   1.687   1.00 0.00 ? 47  ILE A HB   3  
ATOM 5134  H HG12 . ILE A 1 47  ? 10.379  5.844   0.463   1.00 0.00 ? 47  ILE A HG12 3  
ATOM 5135  H HG13 . ILE A 1 47  ? 9.465   6.782   1.640   1.00 0.00 ? 47  ILE A HG13 3  
ATOM 5136  H HG21 . ILE A 1 47  ? 8.316   3.101   0.082   1.00 0.00 ? 47  ILE A HG21 3  
ATOM 5137  H HG22 . ILE A 1 47  ? 8.226   4.356   -1.154  1.00 0.00 ? 47  ILE A HG22 3  
ATOM 5138  H HG23 . ILE A 1 47  ? 9.768   3.989   -0.379  1.00 0.00 ? 47  ILE A HG23 3  
ATOM 5139  H HD11 . ILE A 1 47  ? 11.446  5.344   2.435   1.00 0.00 ? 47  ILE A HD11 3  
ATOM 5140  H HD12 . ILE A 1 47  ? 9.946   5.319   3.363   1.00 0.00 ? 47  ILE A HD12 3  
ATOM 5141  H HD13 . ILE A 1 47  ? 10.328  3.992   2.266   1.00 0.00 ? 47  ILE A HD13 3  
ATOM 5142  N N    . LEU A 1 48  ? 5.414   4.885   0.908   1.00 0.00 ? 48  LEU A N    3  
ATOM 5143  C CA   . LEU A 1 48  ? 4.161   4.180   0.660   1.00 0.00 ? 48  LEU A CA   3  
ATOM 5144  C C    . LEU A 1 48  ? 3.416   4.793   -0.521  1.00 0.00 ? 48  LEU A C    3  
ATOM 5145  O O    . LEU A 1 48  ? 2.836   4.080   -1.341  1.00 0.00 ? 48  LEU A O    3  
ATOM 5146  C CB   . LEU A 1 48  ? 3.279   4.213   1.908   1.00 0.00 ? 48  LEU A CB   3  
ATOM 5147  C CG   . LEU A 1 48  ? 3.621   3.197   2.999   1.00 0.00 ? 48  LEU A CG   3  
ATOM 5148  C CD1  . LEU A 1 48  ? 2.656   3.324   4.168   1.00 0.00 ? 48  LEU A CD1  3  
ATOM 5149  C CD2  . LEU A 1 48  ? 3.599   1.783   2.438   1.00 0.00 ? 48  LEU A CD2  3  
ATOM 5150  H H    . LEU A 1 48  ? 5.746   4.956   1.827   1.00 0.00 ? 48  LEU A H    3  
ATOM 5151  H HA   . LEU A 1 48  ? 4.400   3.153   0.425   1.00 0.00 ? 48  LEU A HA   3  
ATOM 5152  H HB2  . LEU A 1 48  ? 3.352   5.198   2.340   1.00 0.00 ? 48  LEU A HB2  3  
ATOM 5153  H HB3  . LEU A 1 48  ? 2.259   4.032   1.596   1.00 0.00 ? 48  LEU A HB3  3  
ATOM 5154  H HG   . LEU A 1 48  ? 4.618   3.397   3.368   1.00 0.00 ? 48  LEU A HG   3  
ATOM 5155  H HD11 . LEU A 1 48  ? 2.382   4.360   4.299   1.00 0.00 ? 48  LEU A HD11 3  
ATOM 5156  H HD12 . LEU A 1 48  ? 3.130   2.961   5.067   1.00 0.00 ? 48  LEU A HD12 3  
ATOM 5157  H HD13 . LEU A 1 48  ? 1.770   2.739   3.967   1.00 0.00 ? 48  LEU A HD13 3  
ATOM 5158  H HD21 . LEU A 1 48  ? 2.915   1.178   3.014   1.00 0.00 ? 48  LEU A HD21 3  
ATOM 5159  H HD22 . LEU A 1 48  ? 4.592   1.358   2.496   1.00 0.00 ? 48  LEU A HD22 3  
ATOM 5160  H HD23 . LEU A 1 48  ? 3.277   1.809   1.408   1.00 0.00 ? 48  LEU A HD23 3  
ATOM 5161  N N    . CYS A 1 49  ? 3.437   6.119   -0.603  1.00 0.00 ? 49  CYS A N    3  
ATOM 5162  C CA   . CYS A 1 49  ? 2.764   6.829   -1.684  1.00 0.00 ? 49  CYS A CA   3  
ATOM 5163  C C    . CYS A 1 49  ? 3.394   6.491   -3.032  1.00 0.00 ? 49  CYS A C    3  
ATOM 5164  O O    . CYS A 1 49  ? 2.736   5.946   -3.918  1.00 0.00 ? 49  CYS A O    3  
ATOM 5165  C CB   . CYS A 1 49  ? 2.822   8.338   -1.445  1.00 0.00 ? 49  CYS A CB   3  
ATOM 5166  S SG   . CYS A 1 49  ? 1.734   8.919   -0.122  1.00 0.00 ? 49  CYS A SG   3  
ATOM 5167  H H    . CYS A 1 49  ? 3.915   6.633   0.081   1.00 0.00 ? 49  CYS A H    3  
ATOM 5168  H HA   . CYS A 1 49  ? 1.732   6.514   -1.694  1.00 0.00 ? 49  CYS A HA   3  
ATOM 5169  H HB2  . CYS A 1 49  ? 3.833   8.616   -1.183  1.00 0.00 ? 49  CYS A HB2  3  
ATOM 5170  H HB3  . CYS A 1 49  ? 2.539   8.851   -2.352  1.00 0.00 ? 49  CYS A HB3  3  
ATOM 5171  H HG   . CYS A 1 49  ? 2.319   9.951   0.465   1.00 0.00 ? 49  CYS A HG   3  
ATOM 5172  N N    . THR A 1 50  ? 4.674   6.819   -3.179  1.00 0.00 ? 50  THR A N    3  
ATOM 5173  C CA   . THR A 1 50  ? 5.392   6.553   -4.419  1.00 0.00 ? 50  THR A CA   3  
ATOM 5174  C C    . THR A 1 50  ? 5.213   5.104   -4.859  1.00 0.00 ? 50  THR A C    3  
ATOM 5175  O O    . THR A 1 50  ? 4.903   4.831   -6.019  1.00 0.00 ? 50  THR A O    3  
ATOM 5176  C CB   . THR A 1 50  ? 6.896   6.850   -4.271  1.00 0.00 ? 50  THR A CB   3  
ATOM 5177  O OG1  . THR A 1 50  ? 7.397   6.254   -3.070  1.00 0.00 ? 50  THR A OG1  3  
ATOM 5178  C CG2  . THR A 1 50  ? 7.152   8.350   -4.244  1.00 0.00 ? 50  THR A CG2  3  
ATOM 5179  H H    . THR A 1 50  ? 5.144   7.251   -2.436  1.00 0.00 ? 50  THR A H    3  
ATOM 5180  H HA   . THR A 1 50  ? 4.992   7.203   -5.183  1.00 0.00 ? 50  THR A HA   3  
ATOM 5181  H HB   . THR A 1 50  ? 7.417   6.427   -5.118  1.00 0.00 ? 50  THR A HB   3  
ATOM 5182  H HG1  . THR A 1 50  ? 6.903   6.587   -2.317  1.00 0.00 ? 50  THR A HG1  3  
ATOM 5183  H HG21 . THR A 1 50  ? 7.971   8.563   -3.574  1.00 0.00 ? 50  THR A HG21 3  
ATOM 5184  H HG22 . THR A 1 50  ? 6.264   8.860   -3.901  1.00 0.00 ? 50  THR A HG22 3  
ATOM 5185  H HG23 . THR A 1 50  ? 7.401   8.690   -5.238  1.00 0.00 ? 50  THR A HG23 3  
ATOM 5186  N N    . LEU A 1 51  ? 5.408   4.180   -3.926  1.00 0.00 ? 51  LEU A N    3  
ATOM 5187  C CA   . LEU A 1 51  ? 5.268   2.757   -4.216  1.00 0.00 ? 51  LEU A CA   3  
ATOM 5188  C C    . LEU A 1 51  ? 4.027   2.495   -5.065  1.00 0.00 ? 51  LEU A C    3  
ATOM 5189  O O    . LEU A 1 51  ? 4.089   1.789   -6.070  1.00 0.00 ? 51  LEU A O    3  
ATOM 5190  C CB   . LEU A 1 51  ? 5.189   1.955   -2.916  1.00 0.00 ? 51  LEU A CB   3  
ATOM 5191  C CG   . LEU A 1 51  ? 4.699   0.514   -3.046  1.00 0.00 ? 51  LEU A CG   3  
ATOM 5192  C CD1  . LEU A 1 51  ? 5.686   -0.317  -3.851  1.00 0.00 ? 51  LEU A CD1  3  
ATOM 5193  C CD2  . LEU A 1 51  ? 4.480   -0.101  -1.671  1.00 0.00 ? 51  LEU A CD2  3  
ATOM 5194  H H    . LEU A 1 51  ? 5.654   4.459   -3.019  1.00 0.00 ? 51  LEU A H    3  
ATOM 5195  H HA   . LEU A 1 51  ? 6.141   2.444   -4.770  1.00 0.00 ? 51  LEU A HA   3  
ATOM 5196  H HB2  . LEU A 1 51  ? 6.176   1.931   -2.482  1.00 0.00 ? 51  LEU A HB2  3  
ATOM 5197  H HB3  . LEU A 1 51  ? 4.516   2.476   -2.249  1.00 0.00 ? 51  LEU A HB3  3  
ATOM 5198  H HG   . LEU A 1 51  ? 3.752   0.506   -3.570  1.00 0.00 ? 51  LEU A HG   3  
ATOM 5199  H HD11 . LEU A 1 51  ? 5.243   -0.583  -4.799  1.00 0.00 ? 51  LEU A HD11 3  
ATOM 5200  H HD12 . LEU A 1 51  ? 5.933   -1.214  -3.304  1.00 0.00 ? 51  LEU A HD12 3  
ATOM 5201  H HD13 . LEU A 1 51  ? 6.584   0.259   -4.022  1.00 0.00 ? 51  LEU A HD13 3  
ATOM 5202  H HD21 . LEU A 1 51  ? 3.524   -0.603  -1.649  1.00 0.00 ? 51  LEU A HD21 3  
ATOM 5203  H HD22 . LEU A 1 51  ? 4.494   0.678   -0.922  1.00 0.00 ? 51  LEU A HD22 3  
ATOM 5204  H HD23 . LEU A 1 51  ? 5.266   -0.814  -1.466  1.00 0.00 ? 51  LEU A HD23 3  
ATOM 5205  N N    . MET A 1 52  ? 2.902   3.071   -4.653  1.00 0.00 ? 52  MET A N    3  
ATOM 5206  C CA   . MET A 1 52  ? 1.649   2.903   -5.377  1.00 0.00 ? 52  MET A CA   3  
ATOM 5207  C C    . MET A 1 52  ? 1.717   3.573   -6.746  1.00 0.00 ? 52  MET A C    3  
ATOM 5208  O O    . MET A 1 52  ? 1.281   3.006   -7.747  1.00 0.00 ? 52  MET A O    3  
ATOM 5209  C CB   . MET A 1 52  ? 0.486   3.483   -4.569  1.00 0.00 ? 52  MET A CB   3  
ATOM 5210  C CG   . MET A 1 52  ? -0.880  3.046   -5.071  1.00 0.00 ? 52  MET A CG   3  
ATOM 5211  S SD   . MET A 1 52  ? -1.216  1.305   -4.744  1.00 0.00 ? 52  MET A SD   3  
ATOM 5212  C CE   . MET A 1 52  ? -1.555  0.710   -6.399  1.00 0.00 ? 52  MET A CE   3  
ATOM 5213  H H    . MET A 1 52  ? 2.916   3.624   -3.843  1.00 0.00 ? 52  MET A H    3  
ATOM 5214  H HA   . MET A 1 52  ? 1.486   1.844   -5.516  1.00 0.00 ? 52  MET A HA   3  
ATOM 5215  H HB2  . MET A 1 52  ? 0.586   3.169   -3.541  1.00 0.00 ? 52  MET A HB2  3  
ATOM 5216  H HB3  . MET A 1 52  ? 0.534   4.561   -4.615  1.00 0.00 ? 52  MET A HB3  3  
ATOM 5217  H HG2  . MET A 1 52  ? -1.637  3.641   -4.581  1.00 0.00 ? 52  MET A HG2  3  
ATOM 5218  H HG3  . MET A 1 52  ? -0.928  3.214   -6.136  1.00 0.00 ? 52  MET A HG3  3  
ATOM 5219  H HE1  . MET A 1 52  ? -1.440  1.519   -7.104  1.00 0.00 ? 52  MET A HE1  3  
ATOM 5220  H HE2  . MET A 1 52  ? -0.864  -0.083  -6.644  1.00 0.00 ? 52  MET A HE2  3  
ATOM 5221  H HE3  . MET A 1 52  ? -2.567  0.333   -6.445  1.00 0.00 ? 52  MET A HE3  3  
ATOM 5222  N N    . ASN A 1 53  ? 2.266   4.783   -6.780  1.00 0.00 ? 53  ASN A N    3  
ATOM 5223  C CA   . ASN A 1 53  ? 2.390   5.531   -8.026  1.00 0.00 ? 53  ASN A CA   3  
ATOM 5224  C C    . ASN A 1 53  ? 3.134   4.715   -9.079  1.00 0.00 ? 53  ASN A C    3  
ATOM 5225  O O    . ASN A 1 53  ? 2.785   4.737   -10.259 1.00 0.00 ? 53  ASN A O    3  
ATOM 5226  C CB   . ASN A 1 53  ? 3.119   6.854   -7.781  1.00 0.00 ? 53  ASN A CB   3  
ATOM 5227  C CG   . ASN A 1 53  ? 2.171   7.971   -7.389  1.00 0.00 ? 53  ASN A CG   3  
ATOM 5228  O OD1  . ASN A 1 53  ? 1.087   8.109   -7.957  1.00 0.00 ? 53  ASN A OD1  3  
ATOM 5229  N ND2  . ASN A 1 53  ? 2.577   8.777   -6.415  1.00 0.00 ? 53  ASN A ND2  3  
ATOM 5230  H H    . ASN A 1 53  ? 2.595   5.182   -5.948  1.00 0.00 ? 53  ASN A H    3  
ATOM 5231  H HA   . ASN A 1 53  ? 1.394   5.740   -8.388  1.00 0.00 ? 53  ASN A HA   3  
ATOM 5232  H HB2  . ASN A 1 53  ? 3.836   6.720   -6.984  1.00 0.00 ? 53  ASN A HB2  3  
ATOM 5233  H HB3  . ASN A 1 53  ? 3.637   7.145   -8.682  1.00 0.00 ? 53  ASN A HB3  3  
ATOM 5234  H HD21 . ASN A 1 53  ? 3.453   8.607   -6.008  1.00 0.00 ? 53  ASN A HD21 3  
ATOM 5235  H HD22 . ASN A 1 53  ? 1.985   9.507   -6.142  1.00 0.00 ? 53  ASN A HD22 3  
ATOM 5236  N N    . LYS A 1 54  ? 4.161   3.993   -8.642  1.00 0.00 ? 54  LYS A N    3  
ATOM 5237  C CA   . LYS A 1 54  ? 4.954   3.168   -9.545  1.00 0.00 ? 54  LYS A CA   3  
ATOM 5238  C C    . LYS A 1 54  ? 4.089   2.103   -10.211 1.00 0.00 ? 54  LYS A C    3  
ATOM 5239  O O    . LYS A 1 54  ? 4.197   1.864   -11.415 1.00 0.00 ? 54  LYS A O    3  
ATOM 5240  C CB   . LYS A 1 54  ? 6.103   2.502   -8.783  1.00 0.00 ? 54  LYS A CB   3  
ATOM 5241  C CG   . LYS A 1 54  ? 6.942   3.478   -7.975  1.00 0.00 ? 54  LYS A CG   3  
ATOM 5242  C CD   . LYS A 1 54  ? 8.049   4.092   -8.815  1.00 0.00 ? 54  LYS A CD   3  
ATOM 5243  C CE   . LYS A 1 54  ? 7.618   5.417   -9.422  1.00 0.00 ? 54  LYS A CE   3  
ATOM 5244  N NZ   . LYS A 1 54  ? 7.065   5.245   -10.794 1.00 0.00 ? 54  LYS A NZ   3  
ATOM 5245  H H    . LYS A 1 54  ? 4.391   4.016   -7.689  1.00 0.00 ? 54  LYS A H    3  
ATOM 5246  H HA   . LYS A 1 54  ? 5.365   3.811   -10.308 1.00 0.00 ? 54  LYS A HA   3  
ATOM 5247  H HB2  . LYS A 1 54  ? 5.694   1.767   -8.108  1.00 0.00 ? 54  LYS A HB2  3  
ATOM 5248  H HB3  . LYS A 1 54  ? 6.750   2.007   -9.493  1.00 0.00 ? 54  LYS A HB3  3  
ATOM 5249  H HG2  . LYS A 1 54  ? 6.305   4.268   -7.607  1.00 0.00 ? 54  LYS A HG2  3  
ATOM 5250  H HG3  . LYS A 1 54  ? 7.384   2.952   -7.141  1.00 0.00 ? 54  LYS A HG3  3  
ATOM 5251  H HD2  . LYS A 1 54  ? 8.913   4.259   -8.190  1.00 0.00 ? 54  LYS A HD2  3  
ATOM 5252  H HD3  . LYS A 1 54  ? 8.306   3.407   -9.611  1.00 0.00 ? 54  LYS A HD3  3  
ATOM 5253  H HE2  . LYS A 1 54  ? 6.861   5.859   -8.792  1.00 0.00 ? 54  LYS A HE2  3  
ATOM 5254  H HE3  . LYS A 1 54  ? 8.475   6.073   -9.469  1.00 0.00 ? 54  LYS A HE3  3  
ATOM 5255  H HZ1  . LYS A 1 54  ? 6.071   5.548   -10.819 1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 5256  H HZ2  . LYS A 1 54  ? 7.118   4.247   -11.079 1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 5257  H HZ3  . LYS A 1 54  ? 7.607   5.817   -11.473 1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 5258  N N    . LEU A 1 55  ? 3.229   1.467   -9.422  1.00 0.00 ? 55  LEU A N    3  
ATOM 5259  C CA   . LEU A 1 55  ? 2.343   0.428   -9.937  1.00 0.00 ? 55  LEU A CA   3  
ATOM 5260  C C    . LEU A 1 55  ? 1.225   1.034   -10.778 1.00 0.00 ? 55  LEU A C    3  
ATOM 5261  O O    . LEU A 1 55  ? 0.997   0.621   -11.914 1.00 0.00 ? 55  LEU A O    3  
ATOM 5262  C CB   . LEU A 1 55  ? 1.749   -0.379  -8.782  1.00 0.00 ? 55  LEU A CB   3  
ATOM 5263  C CG   . LEU A 1 55  ? 2.735   -0.844  -7.709  1.00 0.00 ? 55  LEU A CG   3  
ATOM 5264  C CD1  . LEU A 1 55  ? 2.003   -1.560  -6.585  1.00 0.00 ? 55  LEU A CD1  3  
ATOM 5265  C CD2  . LEU A 1 55  ? 3.796   -1.749  -8.317  1.00 0.00 ? 55  LEU A CD2  3  
ATOM 5266  H H    . LEU A 1 55  ? 3.189   1.702   -8.472  1.00 0.00 ? 55  LEU A H    3  
ATOM 5267  H HA   . LEU A 1 55  ? 2.931   -0.229  -10.560 1.00 0.00 ? 55  LEU A HA   3  
ATOM 5268  H HB2  . LEU A 1 55  ? 1.002   0.234   -8.301  1.00 0.00 ? 55  LEU A HB2  3  
ATOM 5269  H HB3  . LEU A 1 55  ? 1.277   -1.256  -9.201  1.00 0.00 ? 55  LEU A HB3  3  
ATOM 5270  H HG   . LEU A 1 55  ? 3.231   0.019   -7.288  1.00 0.00 ? 55  LEU A HG   3  
ATOM 5271  H HD11 . LEU A 1 55  ? 1.830   -0.871  -5.772  1.00 0.00 ? 55  LEU A HD11 3  
ATOM 5272  H HD12 . LEU A 1 55  ? 2.602   -2.387  -6.235  1.00 0.00 ? 55  LEU A HD12 3  
ATOM 5273  H HD13 . LEU A 1 55  ? 1.056   -1.931  -6.951  1.00 0.00 ? 55  LEU A HD13 3  
ATOM 5274  H HD21 . LEU A 1 55  ? 3.395   -2.234  -9.195  1.00 0.00 ? 55  LEU A HD21 3  
ATOM 5275  H HD22 . LEU A 1 55  ? 4.088   -2.497  -7.595  1.00 0.00 ? 55  LEU A HD22 3  
ATOM 5276  H HD23 . LEU A 1 55  ? 4.657   -1.158  -8.594  1.00 0.00 ? 55  LEU A HD23 3  
ATOM 5277  N N    . GLN A 1 56  ? 0.532   2.018   -10.212 1.00 0.00 ? 56  GLN A N    3  
ATOM 5278  C CA   . GLN A 1 56  ? -0.561  2.681   -10.912 1.00 0.00 ? 56  GLN A CA   3  
ATOM 5279  C C    . GLN A 1 56  ? -0.198  4.124   -11.247 1.00 0.00 ? 56  GLN A C    3  
ATOM 5280  O O    . GLN A 1 56  ? 0.186   4.910   -10.381 1.00 0.00 ? 56  GLN A O    3  
ATOM 5281  C CB   . GLN A 1 56  ? -1.833  2.648   -10.061 1.00 0.00 ? 56  GLN A CB   3  
ATOM 5282  C CG   . GLN A 1 56  ? -2.916  3.597   -10.549 1.00 0.00 ? 56  GLN A CG   3  
ATOM 5283  C CD   . GLN A 1 56  ? -4.314  3.070   -10.291 1.00 0.00 ? 56  GLN A CD   3  
ATOM 5284  O OE1  . GLN A 1 56  ? -5.104  2.892   -11.218 1.00 0.00 ? 56  GLN A OE1  3  
ATOM 5285  N NE2  . GLN A 1 56  ? -4.627  2.817   -9.026  1.00 0.00 ? 56  GLN A NE2  3  
ATOM 5286  H H    . GLN A 1 56  ? 0.761   2.303   -9.304  1.00 0.00 ? 56  GLN A H    3  
ATOM 5287  H HA   . GLN A 1 56  ? -0.741  2.146   -11.831 1.00 0.00 ? 56  GLN A HA   3  
ATOM 5288  H HB2  . GLN A 1 56  ? -2.233  1.645   -10.072 1.00 0.00 ? 56  GLN A HB2  3  
ATOM 5289  H HB3  . GLN A 1 56  ? -1.581  2.916   -9.047  1.00 0.00 ? 56  GLN A HB3  3  
ATOM 5290  H HG2  . GLN A 1 56  ? -2.804  4.542   -10.039 1.00 0.00 ? 56  GLN A HG2  3  
ATOM 5291  H HG3  . GLN A 1 56  ? -2.794  3.746   -11.612 1.00 0.00 ? 56  GLN A HG3  3  
ATOM 5292  H HE21 . GLN A 1 56  ? -3.946  2.983   -8.339  1.00 0.00 ? 56  GLN A HE21 3  
ATOM 5293  H HE22 . GLN A 1 56  ? -5.523  2.477   -8.829  1.00 0.00 ? 56  GLN A HE22 3  
ATOM 5294  N N    . PRO A 1 57  ? -0.320  4.482   -12.534 1.00 0.00 ? 57  PRO A N    3  
ATOM 5295  C CA   . PRO A 1 57  ? -0.008  5.831   -13.013 1.00 0.00 ? 57  PRO A CA   3  
ATOM 5296  C C    . PRO A 1 57  ? -1.018  6.866   -12.528 1.00 0.00 ? 57  PRO A C    3  
ATOM 5297  O O    . PRO A 1 57  ? -0.946  8.038   -12.896 1.00 0.00 ? 57  PRO A O    3  
ATOM 5298  C CB   . PRO A 1 57  ? -0.074  5.692   -14.536 1.00 0.00 ? 57  PRO A CB   3  
ATOM 5299  C CG   . PRO A 1 57  ? -0.990  4.540   -14.770 1.00 0.00 ? 57  PRO A CG   3  
ATOM 5300  C CD   . PRO A 1 57  ? -0.771  3.596   -13.620 1.00 0.00 ? 57  PRO A CD   3  
ATOM 5301  H HA   . PRO A 1 57  ? 0.986   6.137   -12.721 1.00 0.00 ? 57  PRO A HA   3  
ATOM 5302  H HB2  . PRO A 1 57  ? -0.467  6.602   -14.966 1.00 0.00 ? 57  PRO A HB2  3  
ATOM 5303  H HB3  . PRO A 1 57  ? 0.913   5.498   -14.927 1.00 0.00 ? 57  PRO A HB3  3  
ATOM 5304  H HG2  . PRO A 1 57  ? -2.013  4.880   -14.786 1.00 0.00 ? 57  PRO A HG2  3  
ATOM 5305  H HG3  . PRO A 1 57  ? -0.739  4.057   -15.704 1.00 0.00 ? 57  PRO A HG3  3  
ATOM 5306  H HD2  . PRO A 1 57  ? -1.694  3.102   -13.357 1.00 0.00 ? 57  PRO A HD2  3  
ATOM 5307  H HD3  . PRO A 1 57  ? -0.009  2.870   -13.866 1.00 0.00 ? 57  PRO A HD3  3  
ATOM 5308  N N    . GLY A 1 58  ? -1.960  6.424   -11.700 1.00 0.00 ? 58  GLY A N    3  
ATOM 5309  C CA   . GLY A 1 58  ? -2.971  7.325   -11.179 1.00 0.00 ? 58  GLY A CA   3  
ATOM 5310  C C    . GLY A 1 58  ? -3.490  6.891   -9.823  1.00 0.00 ? 58  GLY A C    3  
ATOM 5311  O O    . GLY A 1 58  ? -4.695  6.719   -9.639  1.00 0.00 ? 58  GLY A O    3  
ATOM 5312  H H    . GLY A 1 58  ? -1.969  5.479   -11.442 1.00 0.00 ? 58  GLY A H    3  
ATOM 5313  H HA2  . GLY A 1 58  ? -2.546  8.314   -11.091 1.00 0.00 ? 58  GLY A HA2  3  
ATOM 5314  H HA3  . GLY A 1 58  ? -3.798  7.361   -11.874 1.00 0.00 ? 58  GLY A HA3  3  
ATOM 5315  N N    . SER A 1 59  ? -2.580  6.712   -8.872  1.00 0.00 ? 59  SER A N    3  
ATOM 5316  C CA   . SER A 1 59  ? -2.952  6.290   -7.527  1.00 0.00 ? 59  SER A CA   3  
ATOM 5317  C C    . SER A 1 59  ? -2.868  7.457   -6.547  1.00 0.00 ? 59  SER A C    3  
ATOM 5318  O O    . SER A 1 59  ? -3.882  7.920   -6.027  1.00 0.00 ? 59  SER A O    3  
ATOM 5319  C CB   . SER A 1 59  ? -2.046  5.150   -7.057  1.00 0.00 ? 59  SER A CB   3  
ATOM 5320  O OG   . SER A 1 59  ? -0.715  5.338   -7.508  1.00 0.00 ? 59  SER A OG   3  
ATOM 5321  H H    . SER A 1 59  ? -1.634  6.866   -9.081  1.00 0.00 ? 59  SER A H    3  
ATOM 5322  H HA   . SER A 1 59  ? -3.972  5.937   -7.561  1.00 0.00 ? 59  SER A HA   3  
ATOM 5323  H HB2  . SER A 1 59  ? -2.045  5.114   -5.979  1.00 0.00 ? 59  SER A HB2  3  
ATOM 5324  H HB3  . SER A 1 59  ? -2.417  4.214   -7.449  1.00 0.00 ? 59  SER A HB3  3  
ATOM 5325  H HG   . SER A 1 59  ? -0.650  5.082   -8.431  1.00 0.00 ? 59  SER A HG   3  
ATOM 5326  N N    . VAL A 1 60  ? -1.649  7.928   -6.302  1.00 0.00 ? 60  VAL A N    3  
ATOM 5327  C CA   . VAL A 1 60  ? -1.430  9.042   -5.387  1.00 0.00 ? 60  VAL A CA   3  
ATOM 5328  C C    . VAL A 1 60  ? -1.237  10.349  -6.148  1.00 0.00 ? 60  VAL A C    3  
ATOM 5329  O O    . VAL A 1 60  ? -0.365  10.471  -7.009  1.00 0.00 ? 60  VAL A O    3  
ATOM 5330  C CB   . VAL A 1 60  ? -0.203  8.798   -4.488  1.00 0.00 ? 60  VAL A CB   3  
ATOM 5331  C CG1  . VAL A 1 60  ? 0.086   10.022  -3.634  1.00 0.00 ? 60  VAL A CG1  3  
ATOM 5332  C CG2  . VAL A 1 60  ? -0.417  7.568   -3.619  1.00 0.00 ? 60  VAL A CG2  3  
ATOM 5333  H H    . VAL A 1 60  ? -0.879  7.518   -6.747  1.00 0.00 ? 60  VAL A H    3  
ATOM 5334  H HA   . VAL A 1 60  ? -2.301  9.131   -4.754  1.00 0.00 ? 60  VAL A HA   3  
ATOM 5335  H HB   . VAL A 1 60  ? 0.652   8.619   -5.123  1.00 0.00 ? 60  VAL A HB   3  
ATOM 5336  H HG11 . VAL A 1 60  ? 0.936   10.551  -4.039  1.00 0.00 ? 60  VAL A HG11 3  
ATOM 5337  H HG12 . VAL A 1 60  ? -0.777  10.673  -3.633  1.00 0.00 ? 60  VAL A HG12 3  
ATOM 5338  H HG13 . VAL A 1 60  ? 0.304   9.712   -2.622  1.00 0.00 ? 60  VAL A HG13 3  
ATOM 5339  H HG21 . VAL A 1 60  ? -0.592  7.877   -2.598  1.00 0.00 ? 60  VAL A HG21 3  
ATOM 5340  H HG22 . VAL A 1 60  ? -1.274  7.016   -3.978  1.00 0.00 ? 60  VAL A HG22 3  
ATOM 5341  H HG23 . VAL A 1 60  ? 0.459   6.940   -3.660  1.00 0.00 ? 60  VAL A HG23 3  
ATOM 5342  N N    . PRO A 1 61  ? -2.066  11.351  -5.824  1.00 0.00 ? 61  PRO A N    3  
ATOM 5343  C CA   . PRO A 1 61  ? -2.006  12.668  -6.466  1.00 0.00 ? 61  PRO A CA   3  
ATOM 5344  C C    . PRO A 1 61  ? -0.756  13.447  -6.072  1.00 0.00 ? 61  PRO A C    3  
ATOM 5345  O O    . PRO A 1 61  ? -0.038  13.964  -6.929  1.00 0.00 ? 61  PRO A O    3  
ATOM 5346  C CB   . PRO A 1 61  ? -3.261  13.374  -5.945  1.00 0.00 ? 61  PRO A CB   3  
ATOM 5347  C CG   . PRO A 1 61  ? -3.559  12.708  -4.647  1.00 0.00 ? 61  PRO A CG   3  
ATOM 5348  C CD   . PRO A 1 61  ? -3.129  11.276  -4.807  1.00 0.00 ? 61  PRO A CD   3  
ATOM 5349  H HA   . PRO A 1 61  ? -2.055  12.588  -7.541  1.00 0.00 ? 61  PRO A HA   3  
ATOM 5350  H HB2  . PRO A 1 61  ? -3.056  14.427  -5.812  1.00 0.00 ? 61  PRO A HB2  3  
ATOM 5351  H HB3  . PRO A 1 61  ? -4.069  13.245  -6.650  1.00 0.00 ? 61  PRO A HB3  3  
ATOM 5352  H HG2  . PRO A 1 61  ? -3.001  13.181  -3.854  1.00 0.00 ? 61  PRO A HG2  3  
ATOM 5353  H HG3  . PRO A 1 61  ? -4.619  12.760  -4.444  1.00 0.00 ? 61  PRO A HG3  3  
ATOM 5354  H HD2  . PRO A 1 61  ? -2.744  10.892  -3.875  1.00 0.00 ? 61  PRO A HD2  3  
ATOM 5355  H HD3  . PRO A 1 61  ? -3.954  10.671  -5.155  1.00 0.00 ? 61  PRO A HD3  3  
ATOM 5356  N N    . LYS A 1 62  ? -0.499  13.527  -4.771  1.00 0.00 ? 62  LYS A N    3  
ATOM 5357  C CA   . LYS A 1 62  ? 0.667   14.242  -4.263  1.00 0.00 ? 62  LYS A CA   3  
ATOM 5358  C C    . LYS A 1 62  ? 1.087   13.698  -2.901  1.00 0.00 ? 62  LYS A C    3  
ATOM 5359  O O    . LYS A 1 62  ? 0.321   12.996  -2.240  1.00 0.00 ? 62  LYS A O    3  
ATOM 5360  C CB   . LYS A 1 62  ? 0.366   15.739  -4.156  1.00 0.00 ? 62  LYS A CB   3  
ATOM 5361  C CG   . LYS A 1 62  ? 1.588   16.620  -4.348  1.00 0.00 ? 62  LYS A CG   3  
ATOM 5362  C CD   . LYS A 1 62  ? 1.221   18.094  -4.337  1.00 0.00 ? 62  LYS A CD   3  
ATOM 5363  C CE   . LYS A 1 62  ? 2.186   18.915  -5.178  1.00 0.00 ? 62  LYS A CE   3  
ATOM 5364  N NZ   . LYS A 1 62  ? 3.417   19.273  -4.418  1.00 0.00 ? 62  LYS A NZ   3  
ATOM 5365  H H    . LYS A 1 62  ? -1.108  13.095  -4.136  1.00 0.00 ? 62  LYS A H    3  
ATOM 5366  H HA   . LYS A 1 62  ? 1.476   14.094  -4.962  1.00 0.00 ? 62  LYS A HA   3  
ATOM 5367  H HB2  . LYS A 1 62  ? -0.363  16.002  -4.908  1.00 0.00 ? 62  LYS A HB2  3  
ATOM 5368  H HB3  . LYS A 1 62  ? -0.048  15.942  -3.179  1.00 0.00 ? 62  LYS A HB3  3  
ATOM 5369  H HG2  . LYS A 1 62  ? 2.288   16.428  -3.549  1.00 0.00 ? 62  LYS A HG2  3  
ATOM 5370  H HG3  . LYS A 1 62  ? 2.049   16.379  -5.296  1.00 0.00 ? 62  LYS A HG3  3  
ATOM 5371  H HD2  . LYS A 1 62  ? 0.225   18.210  -4.737  1.00 0.00 ? 62  LYS A HD2  3  
ATOM 5372  H HD3  . LYS A 1 62  ? 1.246   18.455  -3.319  1.00 0.00 ? 62  LYS A HD3  3  
ATOM 5373  H HE2  . LYS A 1 62  ? 2.465   18.340  -6.047  1.00 0.00 ? 62  LYS A HE2  3  
ATOM 5374  H HE3  . LYS A 1 62  ? 1.689   19.822  -5.489  1.00 0.00 ? 62  LYS A HE3  3  
ATOM 5375  H HZ1  . LYS A 1 62  ? 3.705   18.479  -3.811  1.00 0.00 ? 62  LYS A HZ1  3  
ATOM 5376  H HZ2  . LYS A 1 62  ? 3.238   20.104  -3.819  1.00 0.00 ? 62  LYS A HZ2  3  
ATOM 5377  H HZ3  . LYS A 1 62  ? 4.191   19.492  -5.076  1.00 0.00 ? 62  LYS A HZ3  3  
ATOM 5378  N N    . ILE A 1 63  ? 2.305   14.029  -2.488  1.00 0.00 ? 63  ILE A N    3  
ATOM 5379  C CA   . ILE A 1 63  ? 2.826   13.576  -1.204  1.00 0.00 ? 63  ILE A CA   3  
ATOM 5380  C C    . ILE A 1 63  ? 3.226   14.757  -0.325  1.00 0.00 ? 63  ILE A C    3  
ATOM 5381  O O    . ILE A 1 63  ? 3.968   15.638  -0.754  1.00 0.00 ? 63  ILE A O    3  
ATOM 5382  C CB   . ILE A 1 63  ? 4.043   12.648  -1.385  1.00 0.00 ? 63  ILE A CB   3  
ATOM 5383  C CG1  . ILE A 1 63  ? 3.656   11.419  -2.209  1.00 0.00 ? 63  ILE A CG1  3  
ATOM 5384  C CG2  . ILE A 1 63  ? 4.596   12.233  -0.030  1.00 0.00 ? 63  ILE A CG2  3  
ATOM 5385  C CD1  . ILE A 1 63  ? 4.837   10.727  -2.851  1.00 0.00 ? 63  ILE A CD1  3  
ATOM 5386  H H    . ILE A 1 63  ? 2.868   14.591  -3.060  1.00 0.00 ? 63  ILE A H    3  
ATOM 5387  H HA   . ILE A 1 63  ? 2.044   13.018  -0.706  1.00 0.00 ? 63  ILE A HA   3  
ATOM 5388  H HB   . ILE A 1 63  ? 4.810   13.197  -1.907  1.00 0.00 ? 63  ILE A HB   3  
ATOM 5389  H HG12 . ILE A 1 63  ? 3.161   10.705  -1.568  1.00 0.00 ? 63  ILE A HG12 3  
ATOM 5390  H HG13 . ILE A 1 63  ? 2.979   11.720  -2.994  1.00 0.00 ? 63  ILE A HG13 3  
ATOM 5391  H HG21 . ILE A 1 63  ? 5.635   11.953  -0.136  1.00 0.00 ? 63  ILE A HG21 3  
ATOM 5392  H HG22 . ILE A 1 63  ? 4.516   13.059  0.660   1.00 0.00 ? 63  ILE A HG22 3  
ATOM 5393  H HG23 . ILE A 1 63  ? 4.034   11.392  0.347   1.00 0.00 ? 63  ILE A HG23 3  
ATOM 5394  H HD11 . ILE A 1 63  ? 4.483   9.999   -3.566  1.00 0.00 ? 63  ILE A HD11 3  
ATOM 5395  H HD12 . ILE A 1 63  ? 5.453   11.457  -3.353  1.00 0.00 ? 63  ILE A HD12 3  
ATOM 5396  H HD13 . ILE A 1 63  ? 5.420   10.228  -2.089  1.00 0.00 ? 63  ILE A HD13 3  
ATOM 5397  N N    . ASN A 1 64  ? 2.729   14.765  0.908   1.00 0.00 ? 64  ASN A N    3  
ATOM 5398  C CA   . ASN A 1 64  ? 3.037   15.836  1.848   1.00 0.00 ? 64  ASN A CA   3  
ATOM 5399  C C    . ASN A 1 64  ? 4.442   15.675  2.416   1.00 0.00 ? 64  ASN A C    3  
ATOM 5400  O O    . ASN A 1 64  ? 4.725   14.721  3.141   1.00 0.00 ? 64  ASN A O    3  
ATOM 5401  C CB   . ASN A 1 64  ? 2.013   15.853  2.986   1.00 0.00 ? 64  ASN A CB   3  
ATOM 5402  C CG   . ASN A 1 64  ? 0.592   16.021  2.483   1.00 0.00 ? 64  ASN A CG   3  
ATOM 5403  O OD1  . ASN A 1 64  ? 0.313   16.889  1.656   1.00 0.00 ? 64  ASN A OD1  3  
ATOM 5404  N ND2  . ASN A 1 64  ? -0.314  15.189  2.984   1.00 0.00 ? 64  ASN A ND2  3  
ATOM 5405  H H    . ASN A 1 64  ? 2.142   14.033  1.192   1.00 0.00 ? 64  ASN A H    3  
ATOM 5406  H HA   . ASN A 1 64  ? 2.981   16.772  1.313   1.00 0.00 ? 64  ASN A HA   3  
ATOM 5407  H HB2  . ASN A 1 64  ? 2.074   14.921  3.530   1.00 0.00 ? 64  ASN A HB2  3  
ATOM 5408  H HB3  . ASN A 1 64  ? 2.239   16.671  3.653   1.00 0.00 ? 64  ASN A HB3  3  
ATOM 5409  H HD21 . ASN A 1 64  ? -0.020  14.524  3.640   1.00 0.00 ? 64  ASN A HD21 3  
ATOM 5410  H HD22 . ASN A 1 64  ? -1.241  15.276  2.676   1.00 0.00 ? 64  ASN A HD22 3  
ATOM 5411  N N    . ARG A 1 65  ? 5.321   16.614  2.081   1.00 0.00 ? 65  ARG A N    3  
ATOM 5412  C CA   . ARG A 1 65  ? 6.698   16.578  2.558   1.00 0.00 ? 65  ARG A CA   3  
ATOM 5413  C C    . ARG A 1 65  ? 6.859   17.409  3.826   1.00 0.00 ? 65  ARG A C    3  
ATOM 5414  O O    . ARG A 1 65  ? 7.856   18.109  4.000   1.00 0.00 ? 65  ARG A O    3  
ATOM 5415  C CB   . ARG A 1 65  ? 7.649   17.091  1.475   1.00 0.00 ? 65  ARG A CB   3  
ATOM 5416  C CG   . ARG A 1 65  ? 8.130   16.008  0.523   1.00 0.00 ? 65  ARG A CG   3  
ATOM 5417  C CD   . ARG A 1 65  ? 7.059   15.639  -0.491  1.00 0.00 ? 65  ARG A CD   3  
ATOM 5418  N NE   . ARG A 1 65  ? 7.617   14.954  -1.653  1.00 0.00 ? 65  ARG A NE   3  
ATOM 5419  C CZ   . ARG A 1 65  ? 6.932   14.723  -2.768  1.00 0.00 ? 65  ARG A CZ   3  
ATOM 5420  N NH1  . ARG A 1 65  ? 5.672   15.121  -2.872  1.00 0.00 ? 65  ARG A NH1  3  
ATOM 5421  N NH2  . ARG A 1 65  ? 7.510   14.093  -3.783  1.00 0.00 ? 65  ARG A NH2  3  
ATOM 5422  H H    . ARG A 1 65  ? 5.037   17.351  1.500   1.00 0.00 ? 65  ARG A H    3  
ATOM 5423  H HA   . ARG A 1 65  ? 6.945   15.550  2.782   1.00 0.00 ? 65  ARG A HA   3  
ATOM 5424  H HB2  . ARG A 1 65  ? 7.141   17.848  0.895   1.00 0.00 ? 65  ARG A HB2  3  
ATOM 5425  H HB3  . ARG A 1 65  ? 8.512   17.531  1.949   1.00 0.00 ? 65  ARG A HB3  3  
ATOM 5426  H HG2  . ARG A 1 65  ? 9.001   16.367  -0.005  1.00 0.00 ? 65  ARG A HG2  3  
ATOM 5427  H HG3  . ARG A 1 65  ? 8.390   15.129  1.095   1.00 0.00 ? 65  ARG A HG3  3  
ATOM 5428  H HD2  . ARG A 1 65  ? 6.339   14.992  -0.014  1.00 0.00 ? 65  ARG A HD2  3  
ATOM 5429  H HD3  . ARG A 1 65  ? 6.567   16.543  -0.818  1.00 0.00 ? 65  ARG A HD3  3  
ATOM 5430  H HE   . ARG A 1 65  ? 8.546   14.651  -1.598  1.00 0.00 ? 65  ARG A HE   3  
ATOM 5431  H HH11 . ARG A 1 65  ? 5.235   15.598  -2.108  1.00 0.00 ? 65  ARG A HH11 3  
ATOM 5432  H HH12 . ARG A 1 65  ? 5.160   14.948  -3.714  1.00 0.00 ? 65  ARG A HH12 3  
ATOM 5433  H HH21 . ARG A 1 65  ? 8.459   13.791  -3.710  1.00 0.00 ? 65  ARG A HH21 3  
ATOM 5434  H HH22 . ARG A 1 65  ? 6.994   13.920  -4.622  1.00 0.00 ? 65  ARG A HH22 3  
ATOM 5435  N N    . SER A 1 66  ? 5.868   17.330  4.710   1.00 0.00 ? 66  SER A N    3  
ATOM 5436  C CA   . SER A 1 66  ? 5.896   18.079  5.960   1.00 0.00 ? 66  SER A CA   3  
ATOM 5437  C C    . SER A 1 66  ? 5.916   17.134  7.159   1.00 0.00 ? 66  SER A C    3  
ATOM 5438  O O    . SER A 1 66  ? 5.802   15.919  7.006   1.00 0.00 ? 66  SER A O    3  
ATOM 5439  C CB   . SER A 1 66  ? 4.686   19.009  6.049   1.00 0.00 ? 66  SER A CB   3  
ATOM 5440  O OG   . SER A 1 66  ? 4.793   20.077  5.123   1.00 0.00 ? 66  SER A OG   3  
ATOM 5441  H H    . SER A 1 66  ? 5.099   16.754  4.514   1.00 0.00 ? 66  SER A H    3  
ATOM 5442  H HA   . SER A 1 66  ? 6.798   18.673  5.970   1.00 0.00 ? 66  SER A HA   3  
ATOM 5443  H HB2  . SER A 1 66  ? 3.788   18.450  5.832   1.00 0.00 ? 66  SER A HB2  3  
ATOM 5444  H HB3  . SER A 1 66  ? 4.622   19.419  7.047   1.00 0.00 ? 66  SER A HB3  3  
ATOM 5445  H HG   . SER A 1 66  ? 5.362   20.760  5.486   1.00 0.00 ? 66  SER A HG   3  
ATOM 5446  N N    . MET A 1 67  ? 6.061   17.705  8.350   1.00 0.00 ? 67  MET A N    3  
ATOM 5447  C CA   . MET A 1 67  ? 6.094   16.915  9.576   1.00 0.00 ? 67  MET A CA   3  
ATOM 5448  C C    . MET A 1 67  ? 4.883   17.220  10.452  1.00 0.00 ? 67  MET A C    3  
ATOM 5449  O O    . MET A 1 67  ? 5.004   17.347  11.669  1.00 0.00 ? 67  MET A O    3  
ATOM 5450  C CB   . MET A 1 67  ? 7.383   17.193  10.352  1.00 0.00 ? 67  MET A CB   3  
ATOM 5451  C CG   . MET A 1 67  ? 7.864   16.008  11.173  1.00 0.00 ? 67  MET A CG   3  
ATOM 5452  S SD   . MET A 1 67  ? 7.151   15.975  12.830  1.00 0.00 ? 67  MET A SD   3  
ATOM 5453  C CE   . MET A 1 67  ? 8.354   16.946  13.735  1.00 0.00 ? 67  MET A CE   3  
ATOM 5454  H H    . MET A 1 67  ? 6.147   18.679  8.408   1.00 0.00 ? 67  MET A H    3  
ATOM 5455  H HA   . MET A 1 67  ? 6.069   15.872  9.298   1.00 0.00 ? 67  MET A HA   3  
ATOM 5456  H HB2  . MET A 1 67  ? 8.161   17.458  9.651   1.00 0.00 ? 67  MET A HB2  3  
ATOM 5457  H HB3  . MET A 1 67  ? 7.214   18.022  11.022  1.00 0.00 ? 67  MET A HB3  3  
ATOM 5458  H HG2  . MET A 1 67  ? 7.591   15.097  10.662  1.00 0.00 ? 67  MET A HG2  3  
ATOM 5459  H HG3  . MET A 1 67  ? 8.939   16.062  11.260  1.00 0.00 ? 67  MET A HG3  3  
ATOM 5460  H HE1  . MET A 1 67  ? 9.288   16.406  13.786  1.00 0.00 ? 67  MET A HE1  3  
ATOM 5461  H HE2  . MET A 1 67  ? 8.508   17.888  13.230  1.00 0.00 ? 67  MET A HE2  3  
ATOM 5462  H HE3  . MET A 1 67  ? 7.989   17.128  14.736  1.00 0.00 ? 67  MET A HE3  3  
ATOM 5463  N N    . GLN A 1 68  ? 3.717   17.335  9.823   1.00 0.00 ? 68  GLN A N    3  
ATOM 5464  C CA   . GLN A 1 68  ? 2.486   17.627  10.547  1.00 0.00 ? 68  GLN A CA   3  
ATOM 5465  C C    . GLN A 1 68  ? 1.612   16.381  10.657  1.00 0.00 ? 68  GLN A C    3  
ATOM 5466  O O    . GLN A 1 68  ? 1.400   15.672  9.674   1.00 0.00 ? 68  GLN A O    3  
ATOM 5467  C CB   . GLN A 1 68  ? 1.712   18.747  9.850   1.00 0.00 ? 68  GLN A CB   3  
ATOM 5468  C CG   . GLN A 1 68  ? 2.534   20.006  9.628   1.00 0.00 ? 68  GLN A CG   3  
ATOM 5469  C CD   . GLN A 1 68  ? 3.303   20.427  10.866  1.00 0.00 ? 68  GLN A CD   3  
ATOM 5470  O OE1  . GLN A 1 68  ? 4.233   19.744  11.294  1.00 0.00 ? 68  GLN A OE1  3  
ATOM 5471  N NE2  . GLN A 1 68  ? 2.917   21.557  11.447  1.00 0.00 ? 68  GLN A NE2  3  
ATOM 5472  H H    . GLN A 1 68  ? 3.685   17.223  8.850   1.00 0.00 ? 68  GLN A H    3  
ATOM 5473  H HA   . GLN A 1 68  ? 2.754   17.951  11.541  1.00 0.00 ? 68  GLN A HA   3  
ATOM 5474  H HB2  . GLN A 1 68  ? 1.373   18.390  8.889   1.00 0.00 ? 68  GLN A HB2  3  
ATOM 5475  H HB3  . GLN A 1 68  ? 0.854   19.005  10.452  1.00 0.00 ? 68  GLN A HB3  3  
ATOM 5476  H HG2  . GLN A 1 68  ? 3.238   19.826  8.830   1.00 0.00 ? 68  GLN A HG2  3  
ATOM 5477  H HG3  . GLN A 1 68  ? 1.869   20.810  9.345   1.00 0.00 ? 68  GLN A HG3  3  
ATOM 5478  H HE21 . GLN A 1 68  ? 2.168   22.049  11.050  1.00 0.00 ? 68  GLN A HE21 3  
ATOM 5479  H HE22 . GLN A 1 68  ? 3.396   21.851  12.248  1.00 0.00 ? 68  GLN A HE22 3  
ATOM 5480  N N    . ASN A 1 69  ? 1.108   16.122  11.859  1.00 0.00 ? 69  ASN A N    3  
ATOM 5481  C CA   . ASN A 1 69  ? 0.257   14.961  12.097  1.00 0.00 ? 69  ASN A CA   3  
ATOM 5482  C C    . ASN A 1 69  ? -0.722  14.758  10.944  1.00 0.00 ? 69  ASN A C    3  
ATOM 5483  O O    . ASN A 1 69  ? -0.660  13.754  10.234  1.00 0.00 ? 69  ASN A O    3  
ATOM 5484  C CB   . ASN A 1 69  ? -0.511  15.127  13.410  1.00 0.00 ? 69  ASN A CB   3  
ATOM 5485  C CG   . ASN A 1 69  ? -1.740  14.241  13.476  1.00 0.00 ? 69  ASN A CG   3  
ATOM 5486  O OD1  . ASN A 1 69  ? -1.664  13.036  13.240  1.00 0.00 ? 69  ASN A OD1  3  
ATOM 5487  N ND2  . ASN A 1 69  ? -2.883  14.838  13.797  1.00 0.00 ? 69  ASN A ND2  3  
ATOM 5488  H H    . ASN A 1 69  ? 1.312   16.725  12.604  1.00 0.00 ? 69  ASN A H    3  
ATOM 5489  H HA   . ASN A 1 69  ? 0.895   14.093  12.170  1.00 0.00 ? 69  ASN A HA   3  
ATOM 5490  H HB2  . ASN A 1 69  ? 0.139   14.870  14.234  1.00 0.00 ? 69  ASN A HB2  3  
ATOM 5491  H HB3  . ASN A 1 69  ? -0.825  16.155  13.510  1.00 0.00 ? 69  ASN A HB3  3  
ATOM 5492  H HD21 . ASN A 1 69  ? -2.868  15.803  13.971  1.00 0.00 ? 69  ASN A HD21 3  
ATOM 5493  H HD22 . ASN A 1 69  ? -3.692  14.289  13.848  1.00 0.00 ? 69  ASN A HD22 3  
ATOM 5494  N N    . TRP A 1 70  ? -1.622  15.717  10.764  1.00 0.00 ? 70  TRP A N    3  
ATOM 5495  C CA   . TRP A 1 70  ? -2.613  15.645  9.697   1.00 0.00 ? 70  TRP A CA   3  
ATOM 5496  C C    . TRP A 1 70  ? -1.956  15.291  8.367   1.00 0.00 ? 70  TRP A C    3  
ATOM 5497  O O    . TRP A 1 70  ? -2.408  14.388  7.661   1.00 0.00 ? 70  TRP A O    3  
ATOM 5498  C CB   . TRP A 1 70  ? -3.358  16.975  9.574   1.00 0.00 ? 70  TRP A CB   3  
ATOM 5499  C CG   . TRP A 1 70  ? -2.464  18.170  9.697   1.00 0.00 ? 70  TRP A CG   3  
ATOM 5500  C CD1  . TRP A 1 70  ? -1.674  18.707  8.721   1.00 0.00 ? 70  TRP A CD1  3  
ATOM 5501  C CD2  . TRP A 1 70  ? -2.268  18.977  10.864  1.00 0.00 ? 70  TRP A CD2  3  
ATOM 5502  N NE1  . TRP A 1 70  ? -0.998  19.799  9.212   1.00 0.00 ? 70  TRP A NE1  3  
ATOM 5503  C CE2  . TRP A 1 70  ? -1.346  19.985  10.523  1.00 0.00 ? 70  TRP A CE2  3  
ATOM 5504  C CE3  . TRP A 1 70  ? -2.783  18.946  12.162  1.00 0.00 ? 70  TRP A CE3  3  
ATOM 5505  C CZ2  . TRP A 1 70  ? -0.929  20.951  11.435  1.00 0.00 ? 70  TRP A CZ2  3  
ATOM 5506  C CZ3  . TRP A 1 70  ? -2.368  19.905  13.067  1.00 0.00 ? 70  TRP A CZ3  3  
ATOM 5507  C CH2  . TRP A 1 70  ? -1.449  20.897  12.700  1.00 0.00 ? 70  TRP A CH2  3  
ATOM 5508  H H    . TRP A 1 70  ? -1.620  16.494  11.363  1.00 0.00 ? 70  TRP A H    3  
ATOM 5509  H HA   . TRP A 1 70  ? -3.319  14.869  9.954   1.00 0.00 ? 70  TRP A HA   3  
ATOM 5510  H HB2  . TRP A 1 70  ? -3.844  17.020  8.610   1.00 0.00 ? 70  TRP A HB2  3  
ATOM 5511  H HB3  . TRP A 1 70  ? -4.105  17.033  10.352  1.00 0.00 ? 70  TRP A HB3  3  
ATOM 5512  H HD1  . TRP A 1 70  ? -1.599  18.319  7.717   1.00 0.00 ? 70  TRP A HD1  3  
ATOM 5513  H HE1  . TRP A 1 70  ? -0.370  20.354  8.703   1.00 0.00 ? 70  TRP A HE1  3  
ATOM 5514  H HE3  . TRP A 1 70  ? -3.492  18.190  12.464  1.00 0.00 ? 70  TRP A HE3  3  
ATOM 5515  H HZ2  . TRP A 1 70  ? -0.222  21.722  11.168  1.00 0.00 ? 70  TRP A HZ2  3  
ATOM 5516  H HZ3  . TRP A 1 70  ? -2.755  19.897  14.075  1.00 0.00 ? 70  TRP A HZ3  3  
ATOM 5517  H HH2  . TRP A 1 70  ? -1.153  21.626  13.438  1.00 0.00 ? 70  TRP A HH2  3  
ATOM 5518  N N    . HIS A 1 71  ? -0.888  16.006  8.030   1.00 0.00 ? 71  HIS A N    3  
ATOM 5519  C CA   . HIS A 1 71  ? -0.168  15.766  6.784   1.00 0.00 ? 71  HIS A CA   3  
ATOM 5520  C C    . HIS A 1 71  ? 0.231   14.299  6.662   1.00 0.00 ? 71  HIS A C    3  
ATOM 5521  O O    . HIS A 1 71  ? -0.149  13.621  5.706   1.00 0.00 ? 71  HIS A O    3  
ATOM 5522  C CB   . HIS A 1 71  ? 1.075   16.652  6.711   1.00 0.00 ? 71  HIS A CB   3  
ATOM 5523  C CG   . HIS A 1 71  ? 0.797   18.034  6.202   1.00 0.00 ? 71  HIS A CG   3  
ATOM 5524  N ND1  . HIS A 1 71  ? 1.563   19.128  6.540   1.00 0.00 ? 71  HIS A ND1  3  
ATOM 5525  C CD2  . HIS A 1 71  ? -0.169  18.494  5.374   1.00 0.00 ? 71  HIS A CD2  3  
ATOM 5526  C CE1  . HIS A 1 71  ? 1.080   20.203  5.944   1.00 0.00 ? 71  HIS A CE1  3  
ATOM 5527  N NE2  . HIS A 1 71  ? 0.028   19.846  5.230   1.00 0.00 ? 71  HIS A NE2  3  
ATOM 5528  H H    . HIS A 1 71  ? -0.576  16.712  8.635   1.00 0.00 ? 71  HIS A H    3  
ATOM 5529  H HA   . HIS A 1 71  ? -0.827  16.017  5.968   1.00 0.00 ? 71  HIS A HA   3  
ATOM 5530  H HB2  . HIS A 1 71  ? 1.505   16.742  7.697   1.00 0.00 ? 71  HIS A HB2  3  
ATOM 5531  H HB3  . HIS A 1 71  ? 1.797   16.194  6.049   1.00 0.00 ? 71  HIS A HB3  3  
ATOM 5532  H HD1  . HIS A 1 71  ? 2.346   19.119  7.131   1.00 0.00 ? 71  HIS A HD1  3  
ATOM 5533  H HD2  . HIS A 1 71  ? -0.953  17.908  4.912   1.00 0.00 ? 71  HIS A HD2  3  
ATOM 5534  H HE1  . HIS A 1 71  ? 1.476   21.204  6.026   1.00 0.00 ? 71  HIS A HE1  3  
ATOM 5535  H HE2  . HIS A 1 71  ? -0.570  20.461  4.758   1.00 0.00 ? 71  HIS A HE2  3  
ATOM 5536  N N    . GLN A 1 72  ? 0.997   13.814  7.634   1.00 0.00 ? 72  GLN A N    3  
ATOM 5537  C CA   . GLN A 1 72  ? 1.447   12.428  7.633   1.00 0.00 ? 72  GLN A CA   3  
ATOM 5538  C C    . GLN A 1 72  ? 0.282   11.477  7.377   1.00 0.00 ? 72  GLN A C    3  
ATOM 5539  O O    . GLN A 1 72  ? 0.407   10.515  6.618   1.00 0.00 ? 72  GLN A O    3  
ATOM 5540  C CB   . GLN A 1 72  ? 2.117   12.086  8.965   1.00 0.00 ? 72  GLN A CB   3  
ATOM 5541  C CG   . GLN A 1 72  ? 3.589   12.462  9.019   1.00 0.00 ? 72  GLN A CG   3  
ATOM 5542  C CD   . GLN A 1 72  ? 3.813   13.872  9.529   1.00 0.00 ? 72  GLN A CD   3  
ATOM 5543  O OE1  . GLN A 1 72  ? 3.500   14.848  8.847   1.00 0.00 ? 72  GLN A OE1  3  
ATOM 5544  N NE2  . GLN A 1 72  ? 4.357   13.987  10.734  1.00 0.00 ? 72  GLN A NE2  3  
ATOM 5545  H H    . GLN A 1 72  ? 1.265   14.404  8.368   1.00 0.00 ? 72  GLN A H    3  
ATOM 5546  H HA   . GLN A 1 72  ? 2.169   12.315  6.838   1.00 0.00 ? 72  GLN A HA   3  
ATOM 5547  H HB2  . GLN A 1 72  ? 1.604   12.610  9.757   1.00 0.00 ? 72  GLN A HB2  3  
ATOM 5548  H HB3  . GLN A 1 72  ? 2.032   11.022  9.134   1.00 0.00 ? 72  GLN A HB3  3  
ATOM 5549  H HG2  . GLN A 1 72  ? 4.099   11.773  9.677   1.00 0.00 ? 72  GLN A HG2  3  
ATOM 5550  H HG3  . GLN A 1 72  ? 4.004   12.383  8.026   1.00 0.00 ? 72  GLN A HG3  3  
ATOM 5551  H HE21 . GLN A 1 72  ? 4.581   13.165  11.220  1.00 0.00 ? 72  GLN A HE21 3  
ATOM 5552  H HE22 . GLN A 1 72  ? 4.513   14.886  11.088  1.00 0.00 ? 72  GLN A HE22 3  
ATOM 5553  N N    . LEU A 1 73  ? -0.850  11.752  8.016   1.00 0.00 ? 73  LEU A N    3  
ATOM 5554  C CA   . LEU A 1 73  ? -2.038  10.921  7.857   1.00 0.00 ? 73  LEU A CA   3  
ATOM 5555  C C    . LEU A 1 73  ? -2.528  10.939  6.412   1.00 0.00 ? 73  LEU A C    3  
ATOM 5556  O O    . LEU A 1 73  ? -2.708  9.890   5.796   1.00 0.00 ? 73  LEU A O    3  
ATOM 5557  C CB   . LEU A 1 73  ? -3.150  11.404  8.790   1.00 0.00 ? 73  LEU A CB   3  
ATOM 5558  C CG   . LEU A 1 73  ? -3.130  10.835  10.210  1.00 0.00 ? 73  LEU A CG   3  
ATOM 5559  C CD1  . LEU A 1 73  ? -3.457  9.350   10.193  1.00 0.00 ? 73  LEU A CD1  3  
ATOM 5560  C CD2  . LEU A 1 73  ? -1.778  11.078  10.863  1.00 0.00 ? 73  LEU A CD2  3  
ATOM 5561  H H    . LEU A 1 73  ? -0.889  12.533  8.607   1.00 0.00 ? 73  LEU A H    3  
ATOM 5562  H HA   . LEU A 1 73  ? -1.772  9.909   8.122   1.00 0.00 ? 73  LEU A HA   3  
ATOM 5563  H HB2  . LEU A 1 73  ? -3.077  12.478  8.864   1.00 0.00 ? 73  LEU A HB2  3  
ATOM 5564  H HB3  . LEU A 1 73  ? -4.097  11.140  8.340   1.00 0.00 ? 73  LEU A HB3  3  
ATOM 5565  H HG   . LEU A 1 73  ? -3.884  11.335  10.802  1.00 0.00 ? 73  LEU A HG   3  
ATOM 5566  H HD11 . LEU A 1 73  ? -2.943  8.877   9.371   1.00 0.00 ? 73  LEU A HD11 3  
ATOM 5567  H HD12 . LEU A 1 73  ? -4.523  9.217   10.076  1.00 0.00 ? 73  LEU A HD12 3  
ATOM 5568  H HD13 . LEU A 1 73  ? -3.139  8.902   11.123  1.00 0.00 ? 73  LEU A HD13 3  
ATOM 5569  H HD21 . LEU A 1 73  ? -1.732  12.093  11.230  1.00 0.00 ? 73  LEU A HD21 3  
ATOM 5570  H HD22 . LEU A 1 73  ? -0.993  10.923  10.135  1.00 0.00 ? 73  LEU A HD22 3  
ATOM 5571  H HD23 . LEU A 1 73  ? -1.646  10.392  11.685  1.00 0.00 ? 73  LEU A HD23 3  
ATOM 5572  N N    . GLU A 1 74  ? -2.739  12.139  5.880   1.00 0.00 ? 74  GLU A N    3  
ATOM 5573  C CA   . GLU A 1 74  ? -3.206  12.292  4.507   1.00 0.00 ? 74  GLU A CA   3  
ATOM 5574  C C    . GLU A 1 74  ? -2.481  11.326  3.574   1.00 0.00 ? 74  GLU A C    3  
ATOM 5575  O O    . GLU A 1 74  ? -3.096  10.705  2.708   1.00 0.00 ? 74  GLU A O    3  
ATOM 5576  C CB   . GLU A 1 74  ? -2.996  13.731  4.031   1.00 0.00 ? 74  GLU A CB   3  
ATOM 5577  C CG   . GLU A 1 74  ? -3.836  14.101  2.820   1.00 0.00 ? 74  GLU A CG   3  
ATOM 5578  C CD   . GLU A 1 74  ? -5.323  13.955  3.077   1.00 0.00 ? 74  GLU A CD   3  
ATOM 5579  O OE1  . GLU A 1 74  ? -5.758  14.223  4.216   1.00 0.00 ? 74  GLU A OE1  3  
ATOM 5580  O OE2  . GLU A 1 74  ? -6.053  13.572  2.138   1.00 0.00 ? 74  GLU A OE2  3  
ATOM 5581  H H    . GLU A 1 74  ? -2.577  12.939  6.423   1.00 0.00 ? 74  GLU A H    3  
ATOM 5582  H HA   . GLU A 1 74  ? -4.261  12.067  4.488   1.00 0.00 ? 74  GLU A HA   3  
ATOM 5583  H HB2  . GLU A 1 74  ? -3.247  14.405  4.837   1.00 0.00 ? 74  GLU A HB2  3  
ATOM 5584  H HB3  . GLU A 1 74  ? -1.955  13.864  3.774   1.00 0.00 ? 74  GLU A HB3  3  
ATOM 5585  H HG2  . GLU A 1 74  ? -3.632  15.127  2.556   1.00 0.00 ? 74  GLU A HG2  3  
ATOM 5586  H HG3  . GLU A 1 74  ? -3.563  13.457  1.997   1.00 0.00 ? 74  GLU A HG3  3  
ATOM 5587  N N    . ASN A 1 75  ? -1.171  11.206  3.760   1.00 0.00 ? 75  ASN A N    3  
ATOM 5588  C CA   . ASN A 1 75  ? -0.361  10.316  2.934   1.00 0.00 ? 75  ASN A CA   3  
ATOM 5589  C C    . ASN A 1 75  ? -0.948  8.908   2.913   1.00 0.00 ? 75  ASN A C    3  
ATOM 5590  O O    . ASN A 1 75  ? -1.252  8.365   1.851   1.00 0.00 ? 75  ASN A O    3  
ATOM 5591  C CB   . ASN A 1 75  ? 1.078   10.273  3.453   1.00 0.00 ? 75  ASN A CB   3  
ATOM 5592  C CG   . ASN A 1 75  ? 1.889   11.474  3.007   1.00 0.00 ? 75  ASN A CG   3  
ATOM 5593  O OD1  . ASN A 1 75  ? 1.664   12.024  1.929   1.00 0.00 ? 75  ASN A OD1  3  
ATOM 5594  N ND2  . ASN A 1 75  ? 2.840   11.888  3.839   1.00 0.00 ? 75  ASN A ND2  3  
ATOM 5595  H H    . ASN A 1 75  ? -0.737  11.727  4.466   1.00 0.00 ? 75  ASN A H    3  
ATOM 5596  H HA   . ASN A 1 75  ? -0.359  10.708  1.928   1.00 0.00 ? 75  ASN A HA   3  
ATOM 5597  H HB2  . ASN A 1 75  ? 1.063   10.254  4.534   1.00 0.00 ? 75  ASN A HB2  3  
ATOM 5598  H HB3  . ASN A 1 75  ? 1.560   9.379   3.087   1.00 0.00 ? 75  ASN A HB3  3  
ATOM 5599  H HD21 . ASN A 1 75  ? 2.962   11.401  4.680   1.00 0.00 ? 75  ASN A HD21 3  
ATOM 5600  H HD22 . ASN A 1 75  ? 3.379   12.663  3.575   1.00 0.00 ? 75  ASN A HD22 3  
ATOM 5601  N N    . LEU A 1 76  ? -1.105  8.321   4.096   1.00 0.00 ? 76  LEU A N    3  
ATOM 5602  C CA   . LEU A 1 76  ? -1.657  6.977   4.214   1.00 0.00 ? 76  LEU A CA   3  
ATOM 5603  C C    . LEU A 1 76  ? -3.066  6.912   3.635   1.00 0.00 ? 76  LEU A C    3  
ATOM 5604  O O    . LEU A 1 76  ? -3.373  6.045   2.817   1.00 0.00 ? 76  LEU A O    3  
ATOM 5605  C CB   . LEU A 1 76  ? -1.677  6.540   5.680   1.00 0.00 ? 76  LEU A CB   3  
ATOM 5606  C CG   . LEU A 1 76  ? -0.311  6.352   6.343   1.00 0.00 ? 76  LEU A CG   3  
ATOM 5607  C CD1  . LEU A 1 76  ? -0.476  5.877   7.778   1.00 0.00 ? 76  LEU A CD1  3  
ATOM 5608  C CD2  . LEU A 1 76  ? 0.536   5.370   5.548   1.00 0.00 ? 76  LEU A CD2  3  
ATOM 5609  H H    . LEU A 1 76  ? -0.844  8.804   4.907   1.00 0.00 ? 76  LEU A H    3  
ATOM 5610  H HA   . LEU A 1 76  ? -1.020  6.307   3.657   1.00 0.00 ? 76  LEU A HA   3  
ATOM 5611  H HB2  . LEU A 1 76  ? -2.216  7.289   6.241   1.00 0.00 ? 76  LEU A HB2  3  
ATOM 5612  H HB3  . LEU A 1 76  ? -2.205  5.600   5.737   1.00 0.00 ? 76  LEU A HB3  3  
ATOM 5613  H HG   . LEU A 1 76  ? 0.205   7.302   6.363   1.00 0.00 ? 76  LEU A HG   3  
ATOM 5614  H HD11 . LEU A 1 76  ? 0.279   6.337   8.398   1.00 0.00 ? 76  LEU A HD11 3  
ATOM 5615  H HD12 . LEU A 1 76  ? -0.369  4.803   7.816   1.00 0.00 ? 76  LEU A HD12 3  
ATOM 5616  H HD13 . LEU A 1 76  ? -1.455  6.155   8.139   1.00 0.00 ? 76  LEU A HD13 3  
ATOM 5617  H HD21 . LEU A 1 76  ? 0.883   4.583   6.202   1.00 0.00 ? 76  LEU A HD21 3  
ATOM 5618  H HD22 . LEU A 1 76  ? 1.385   5.887   5.125   1.00 0.00 ? 76  LEU A HD22 3  
ATOM 5619  H HD23 . LEU A 1 76  ? -0.058  4.943   4.754   1.00 0.00 ? 76  LEU A HD23 3  
ATOM 5620  N N    . SER A 1 77  ? -3.919  7.839   4.061   1.00 0.00 ? 77  SER A N    3  
ATOM 5621  C CA   . SER A 1 77  ? -5.297  7.887   3.585   1.00 0.00 ? 77  SER A CA   3  
ATOM 5622  C C    . SER A 1 77  ? -5.350  7.776   2.064   1.00 0.00 ? 77  SER A C    3  
ATOM 5623  O O    . SER A 1 77  ? -6.183  7.059   1.512   1.00 0.00 ? 77  SER A O    3  
ATOM 5624  C CB   . SER A 1 77  ? -5.970  9.184   4.037   1.00 0.00 ? 77  SER A CB   3  
ATOM 5625  O OG   . SER A 1 77  ? -6.252  9.155   5.426   1.00 0.00 ? 77  SER A OG   3  
ATOM 5626  H H    . SER A 1 77  ? -3.615  8.504   4.713   1.00 0.00 ? 77  SER A H    3  
ATOM 5627  H HA   . SER A 1 77  ? -5.825  7.048   4.014   1.00 0.00 ? 77  SER A HA   3  
ATOM 5628  H HB2  . SER A 1 77  ? -5.315  10.017  3.834   1.00 0.00 ? 77  SER A HB2  3  
ATOM 5629  H HB3  . SER A 1 77  ? -6.896  9.314   3.497   1.00 0.00 ? 77  SER A HB3  3  
ATOM 5630  H HG   . SER A 1 77  ? -5.590  9.665   5.898   1.00 0.00 ? 77  SER A HG   3  
ATOM 5631  N N    . ASN A 1 78  ? -4.454  8.494   1.394   1.00 0.00 ? 78  ASN A N    3  
ATOM 5632  C CA   . ASN A 1 78  ? -4.399  8.477   -0.064  1.00 0.00 ? 78  ASN A CA   3  
ATOM 5633  C C    . ASN A 1 78  ? -3.942  7.115   -0.575  1.00 0.00 ? 78  ASN A C    3  
ATOM 5634  O O    . ASN A 1 78  ? -4.593  6.509   -1.427  1.00 0.00 ? 78  ASN A O    3  
ATOM 5635  C CB   . ASN A 1 78  ? -3.454  9.568   -0.571  1.00 0.00 ? 78  ASN A CB   3  
ATOM 5636  C CG   . ASN A 1 78  ? -4.127  10.926  -0.650  1.00 0.00 ? 78  ASN A CG   3  
ATOM 5637  O OD1  . ASN A 1 78  ? -5.314  11.025  -0.959  1.00 0.00 ? 78  ASN A OD1  3  
ATOM 5638  N ND2  . ASN A 1 78  ? -3.368  11.979  -0.370  1.00 0.00 ? 78  ASN A ND2  3  
ATOM 5639  H H    . ASN A 1 78  ? -3.815  9.047   1.890   1.00 0.00 ? 78  ASN A H    3  
ATOM 5640  H HA   . ASN A 1 78  ? -5.393  8.674   -0.435  1.00 0.00 ? 78  ASN A HA   3  
ATOM 5641  H HB2  . ASN A 1 78  ? -2.610  9.645   0.099   1.00 0.00 ? 78  ASN A HB2  3  
ATOM 5642  H HB3  . ASN A 1 78  ? -3.102  9.303   -1.557  1.00 0.00 ? 78  ASN A HB3  3  
ATOM 5643  H HD21 . ASN A 1 78  ? -2.429  11.824  -0.133  1.00 0.00 ? 78  ASN A HD21 3  
ATOM 5644  H HD22 . ASN A 1 78  ? -3.777  12.868  -0.413  1.00 0.00 ? 78  ASN A HD22 3  
ATOM 5645  N N    . PHE A 1 79  ? -2.819  6.638   -0.051  1.00 0.00 ? 79  PHE A N    3  
ATOM 5646  C CA   . PHE A 1 79  ? -2.273  5.347   -0.455  1.00 0.00 ? 79  PHE A CA   3  
ATOM 5647  C C    . PHE A 1 79  ? -3.321  4.246   -0.313  1.00 0.00 ? 79  PHE A C    3  
ATOM 5648  O O    . PHE A 1 79  ? -3.593  3.509   -1.261  1.00 0.00 ? 79  PHE A O    3  
ATOM 5649  C CB   . PHE A 1 79  ? -1.042  5.004   0.385   1.00 0.00 ? 79  PHE A CB   3  
ATOM 5650  C CG   . PHE A 1 79  ? -0.572  3.589   0.212   1.00 0.00 ? 79  PHE A CG   3  
ATOM 5651  C CD1  . PHE A 1 79  ? -0.300  3.085   -1.051  1.00 0.00 ? 79  PHE A CD1  3  
ATOM 5652  C CD2  . PHE A 1 79  ? -0.402  2.761   1.310   1.00 0.00 ? 79  PHE A CD2  3  
ATOM 5653  C CE1  . PHE A 1 79  ? 0.131   1.782   -1.214  1.00 0.00 ? 79  PHE A CE1  3  
ATOM 5654  C CE2  . PHE A 1 79  ? 0.030   1.457   1.153   1.00 0.00 ? 79  PHE A CE2  3  
ATOM 5655  C CZ   . PHE A 1 79  ? 0.298   0.968   -0.111  1.00 0.00 ? 79  PHE A CZ   3  
ATOM 5656  H H    . PHE A 1 79  ? -2.344  7.168   0.624   1.00 0.00 ? 79  PHE A H    3  
ATOM 5657  H HA   . PHE A 1 79  ? -1.983  5.420   -1.491  1.00 0.00 ? 79  PHE A HA   3  
ATOM 5658  H HB2  . PHE A 1 79  ? -0.230  5.660   0.105   1.00 0.00 ? 79  PHE A HB2  3  
ATOM 5659  H HB3  . PHE A 1 79  ? -1.273  5.152   1.429   1.00 0.00 ? 79  PHE A HB3  3  
ATOM 5660  H HD1  . PHE A 1 79  ? -0.428  3.721   -1.915  1.00 0.00 ? 79  PHE A HD1  3  
ATOM 5661  H HD2  . PHE A 1 79  ? -0.611  3.144   2.299   1.00 0.00 ? 79  PHE A HD2  3  
ATOM 5662  H HE1  . PHE A 1 79  ? 0.341   1.402   -2.203  1.00 0.00 ? 79  PHE A HE1  3  
ATOM 5663  H HE2  . PHE A 1 79  ? 0.159   0.823   2.018   1.00 0.00 ? 79  PHE A HE2  3  
ATOM 5664  H HZ   . PHE A 1 79  ? 0.635   -0.050  -0.235  1.00 0.00 ? 79  PHE A HZ   3  
ATOM 5665  N N    . ILE A 1 80  ? -3.905  4.143   0.876   1.00 0.00 ? 80  ILE A N    3  
ATOM 5666  C CA   . ILE A 1 80  ? -4.922  3.133   1.142   1.00 0.00 ? 80  ILE A CA   3  
ATOM 5667  C C    . ILE A 1 80  ? -6.019  3.166   0.083   1.00 0.00 ? 80  ILE A C    3  
ATOM 5668  O O    . ILE A 1 80  ? -6.282  2.167   -0.587  1.00 0.00 ? 80  ILE A O    3  
ATOM 5669  C CB   . ILE A 1 80  ? -5.558  3.327   2.530   1.00 0.00 ? 80  ILE A CB   3  
ATOM 5670  C CG1  . ILE A 1 80  ? -4.497  3.196   3.624   1.00 0.00 ? 80  ILE A CG1  3  
ATOM 5671  C CG2  . ILE A 1 80  ? -6.677  2.319   2.746   1.00 0.00 ? 80  ILE A CG2  3  
ATOM 5672  C CD1  . ILE A 1 80  ? -4.875  3.881   4.918   1.00 0.00 ? 80  ILE A CD1  3  
ATOM 5673  H H    . ILE A 1 80  ? -3.646  4.760   1.591   1.00 0.00 ? 80  ILE A H    3  
ATOM 5674  H HA   . ILE A 1 80  ? -4.444  2.164   1.119   1.00 0.00 ? 80  ILE A HA   3  
ATOM 5675  H HB   . ILE A 1 80  ? -5.986  4.317   2.571   1.00 0.00 ? 80  ILE A HB   3  
ATOM 5676  H HG12 . ILE A 1 80  ? -4.337  2.151   3.838   1.00 0.00 ? 80  ILE A HG12 3  
ATOM 5677  H HG13 . ILE A 1 80  ? -3.573  3.632   3.274   1.00 0.00 ? 80  ILE A HG13 3  
ATOM 5678  H HG21 . ILE A 1 80  ? -7.311  2.652   3.554   1.00 0.00 ? 80  ILE A HG21 3  
ATOM 5679  H HG22 . ILE A 1 80  ? -7.262  2.232   1.843   1.00 0.00 ? 80  ILE A HG22 3  
ATOM 5680  H HG23 . ILE A 1 80  ? -6.252  1.358   2.994   1.00 0.00 ? 80  ILE A HG23 3  
ATOM 5681  H HD11 . ILE A 1 80  ? -4.762  4.950   4.807   1.00 0.00 ? 80  ILE A HD11 3  
ATOM 5682  H HD12 . ILE A 1 80  ? -5.901  3.650   5.164   1.00 0.00 ? 80  ILE A HD12 3  
ATOM 5683  H HD13 . ILE A 1 80  ? -4.229  3.534   5.712   1.00 0.00 ? 80  ILE A HD13 3  
ATOM 5684  N N    . LYS A 1 81  ? -6.655  4.324   -0.065  1.00 0.00 ? 81  LYS A N    3  
ATOM 5685  C CA   . LYS A 1 81  ? -7.722  4.491   -1.045  1.00 0.00 ? 81  LYS A CA   3  
ATOM 5686  C C    . LYS A 1 81  ? -7.268  4.035   -2.428  1.00 0.00 ? 81  LYS A C    3  
ATOM 5687  O O    . LYS A 1 81  ? -8.045  3.462   -3.189  1.00 0.00 ? 81  LYS A O    3  
ATOM 5688  C CB   . LYS A 1 81  ? -8.169  5.953   -1.098  1.00 0.00 ? 81  LYS A CB   3  
ATOM 5689  C CG   . LYS A 1 81  ? -9.012  6.377   0.092   1.00 0.00 ? 81  LYS A CG   3  
ATOM 5690  C CD   . LYS A 1 81  ? -9.233  7.881   0.113   1.00 0.00 ? 81  LYS A CD   3  
ATOM 5691  C CE   . LYS A 1 81  ? -10.061 8.305   1.316   1.00 0.00 ? 81  LYS A CE   3  
ATOM 5692  N NZ   . LYS A 1 81  ? -10.067 9.784   1.490   1.00 0.00 ? 81  LYS A NZ   3  
ATOM 5693  H H    . LYS A 1 81  ? -6.400  5.085   0.498   1.00 0.00 ? 81  LYS A H    3  
ATOM 5694  H HA   . LYS A 1 81  ? -8.557  3.881   -0.734  1.00 0.00 ? 81  LYS A HA   3  
ATOM 5695  H HB2  . LYS A 1 81  ? -7.292  6.584   -1.135  1.00 0.00 ? 81  LYS A HB2  3  
ATOM 5696  H HB3  . LYS A 1 81  ? -8.751  6.107   -1.997  1.00 0.00 ? 81  LYS A HB3  3  
ATOM 5697  H HG2  . LYS A 1 81  ? -9.970  5.884   0.037   1.00 0.00 ? 81  LYS A HG2  3  
ATOM 5698  H HG3  . LYS A 1 81  ? -8.506  6.085   1.001   1.00 0.00 ? 81  LYS A HG3  3  
ATOM 5699  H HD2  . LYS A 1 81  ? -8.275  8.376   0.156   1.00 0.00 ? 81  LYS A HD2  3  
ATOM 5700  H HD3  . LYS A 1 81  ? -9.750  8.171   -0.790  1.00 0.00 ? 81  LYS A HD3  3  
ATOM 5701  H HE2  . LYS A 1 81  ? -11.075 7.963   1.178   1.00 0.00 ? 81  LYS A HE2  3  
ATOM 5702  H HE3  . LYS A 1 81  ? -9.644  7.849   2.202   1.00 0.00 ? 81  LYS A HE3  3  
ATOM 5703  H HZ1  . LYS A 1 81  ? -9.128  10.112  1.791   1.00 0.00 ? 81  LYS A HZ1  3  
ATOM 5704  H HZ2  . LYS A 1 81  ? -10.765 10.056  2.211   1.00 0.00 ? 81  LYS A HZ2  3  
ATOM 5705  H HZ3  . LYS A 1 81  ? -10.314 10.248  0.593   1.00 0.00 ? 81  LYS A HZ3  3  
ATOM 5706  N N    . ALA A 1 82  ? -6.003  4.294   -2.745  1.00 0.00 ? 82  ALA A N    3  
ATOM 5707  C CA   . ALA A 1 82  ? -5.445  3.908   -4.035  1.00 0.00 ? 82  ALA A CA   3  
ATOM 5708  C C    . ALA A 1 82  ? -5.473  2.394   -4.213  1.00 0.00 ? 82  ALA A C    3  
ATOM 5709  O O    . ALA A 1 82  ? -5.789  1.893   -5.292  1.00 0.00 ? 82  ALA A O    3  
ATOM 5710  C CB   . ALA A 1 82  ? -4.023  4.432   -4.172  1.00 0.00 ? 82  ALA A CB   3  
ATOM 5711  H H    . ALA A 1 82  ? -5.432  4.755   -2.095  1.00 0.00 ? 82  ALA A H    3  
ATOM 5712  H HA   . ALA A 1 82  ? -6.047  4.363   -4.809  1.00 0.00 ? 82  ALA A HA   3  
ATOM 5713  H HB1  . ALA A 1 82  ? -3.402  3.991   -3.404  1.00 0.00 ? 82  ALA A HB1  3  
ATOM 5714  H HB2  . ALA A 1 82  ? -3.635  4.169   -5.144  1.00 0.00 ? 82  ALA A HB2  3  
ATOM 5715  H HB3  . ALA A 1 82  ? -4.022  5.506   -4.062  1.00 0.00 ? 82  ALA A HB3  3  
ATOM 5716  N N    . MET A 1 83  ? -5.140  1.671   -3.149  1.00 0.00 ? 83  MET A N    3  
ATOM 5717  C CA   . MET A 1 83  ? -5.128  0.213   -3.190  1.00 0.00 ? 83  MET A CA   3  
ATOM 5718  C C    . MET A 1 83  ? -6.491  -0.331  -3.607  1.00 0.00 ? 83  MET A C    3  
ATOM 5719  O O    . MET A 1 83  ? -6.582  -1.222  -4.451  1.00 0.00 ? 83  MET A O    3  
ATOM 5720  C CB   . MET A 1 83  ? -4.736  -0.353  -1.824  1.00 0.00 ? 83  MET A CB   3  
ATOM 5721  C CG   . MET A 1 83  ? -3.306  -0.032  -1.419  1.00 0.00 ? 83  MET A CG   3  
ATOM 5722  S SD   . MET A 1 83  ? -2.650  -1.190  -0.203  1.00 0.00 ? 83  MET A SD   3  
ATOM 5723  C CE   . MET A 1 83  ? -3.389  -0.557  1.300   1.00 0.00 ? 83  MET A CE   3  
ATOM 5724  H H    . MET A 1 83  ? -4.897  2.127   -2.317  1.00 0.00 ? 83  MET A H    3  
ATOM 5725  H HA   . MET A 1 83  ? -4.393  -0.092  -3.920  1.00 0.00 ? 83  MET A HA   3  
ATOM 5726  H HB2  . MET A 1 83  ? -5.399  0.054   -1.075  1.00 0.00 ? 83  MET A HB2  3  
ATOM 5727  H HB3  . MET A 1 83  ? -4.847  -1.427  -1.847  1.00 0.00 ? 83  MET A HB3  3  
ATOM 5728  H HG2  . MET A 1 83  ? -2.681  -0.064  -2.300  1.00 0.00 ? 83  MET A HG2  3  
ATOM 5729  H HG3  . MET A 1 83  ? -3.282  0.963   -1.000  1.00 0.00 ? 83  MET A HG3  3  
ATOM 5730  H HE1  . MET A 1 83  ? -3.008  0.434   1.498   1.00 0.00 ? 83  MET A HE1  3  
ATOM 5731  H HE2  . MET A 1 83  ? -4.462  -0.513  1.183   1.00 0.00 ? 83  MET A HE2  3  
ATOM 5732  H HE3  . MET A 1 83  ? -3.143  -1.209  2.125   1.00 0.00 ? 83  MET A HE3  3  
ATOM 5733  N N    . VAL A 1 84  ? -7.547  0.212   -3.011  1.00 0.00 ? 84  VAL A N    3  
ATOM 5734  C CA   . VAL A 1 84  ? -8.905  -0.218  -3.321  1.00 0.00 ? 84  VAL A CA   3  
ATOM 5735  C C    . VAL A 1 84  ? -9.172  -0.156  -4.820  1.00 0.00 ? 84  VAL A C    3  
ATOM 5736  O O    . VAL A 1 84  ? -9.767  -1.069  -5.393  1.00 0.00 ? 84  VAL A O    3  
ATOM 5737  C CB   . VAL A 1 84  ? -9.949  0.647   -2.589  1.00 0.00 ? 84  VAL A CB   3  
ATOM 5738  C CG1  . VAL A 1 84  ? -11.358 0.210   -2.959  1.00 0.00 ? 84  VAL A CG1  3  
ATOM 5739  C CG2  . VAL A 1 84  ? -9.737  0.578   -1.085  1.00 0.00 ? 84  VAL A CG2  3  
ATOM 5740  H H    . VAL A 1 84  ? -7.410  0.921   -2.347  1.00 0.00 ? 84  VAL A H    3  
ATOM 5741  H HA   . VAL A 1 84  ? -9.017  -1.239  -2.987  1.00 0.00 ? 84  VAL A HA   3  
ATOM 5742  H HB   . VAL A 1 84  ? -9.820  1.672   -2.903  1.00 0.00 ? 84  VAL A HB   3  
ATOM 5743  H HG11 . VAL A 1 84  ? -12.024 1.059   -2.903  1.00 0.00 ? 84  VAL A HG11 3  
ATOM 5744  H HG12 . VAL A 1 84  ? -11.361 -0.186  -3.963  1.00 0.00 ? 84  VAL A HG12 3  
ATOM 5745  H HG13 . VAL A 1 84  ? -11.690 -0.553  -2.269  1.00 0.00 ? 84  VAL A HG13 3  
ATOM 5746  H HG21 . VAL A 1 84  ? -8.707  0.326   -0.878  1.00 0.00 ? 84  VAL A HG21 3  
ATOM 5747  H HG22 . VAL A 1 84  ? -9.970  1.536   -0.643  1.00 0.00 ? 84  VAL A HG22 3  
ATOM 5748  H HG23 . VAL A 1 84  ? -10.384 -0.178  -0.664  1.00 0.00 ? 84  VAL A HG23 3  
ATOM 5749  N N    . SER A 1 85  ? -8.726  0.925   -5.452  1.00 0.00 ? 85  SER A N    3  
ATOM 5750  C CA   . SER A 1 85  ? -8.919  1.108   -6.885  1.00 0.00 ? 85  SER A CA   3  
ATOM 5751  C C    . SER A 1 85  ? -8.116  0.080   -7.677  1.00 0.00 ? 85  SER A C    3  
ATOM 5752  O O    . SER A 1 85  ? -8.598  -0.472  -8.666  1.00 0.00 ? 85  SER A O    3  
ATOM 5753  C CB   . SER A 1 85  ? -8.510  2.522   -7.301  1.00 0.00 ? 85  SER A CB   3  
ATOM 5754  O OG   . SER A 1 85  ? -8.809  2.760   -8.666  1.00 0.00 ? 85  SER A OG   3  
ATOM 5755  H H    . SER A 1 85  ? -8.258  1.618   -4.940  1.00 0.00 ? 85  SER A H    3  
ATOM 5756  H HA   . SER A 1 85  ? -9.969  0.969   -7.099  1.00 0.00 ? 85  SER A HA   3  
ATOM 5757  H HB2  . SER A 1 85  ? -9.044  3.241   -6.698  1.00 0.00 ? 85  SER A HB2  3  
ATOM 5758  H HB3  . SER A 1 85  ? -7.447  2.645   -7.151  1.00 0.00 ? 85  SER A HB3  3  
ATOM 5759  H HG   . SER A 1 85  ? -8.502  2.019   -9.194  1.00 0.00 ? 85  SER A HG   3  
ATOM 5760  N N    . TYR A 1 86  ? -6.889  -0.171  -7.233  1.00 0.00 ? 86  TYR A N    3  
ATOM 5761  C CA   . TYR A 1 86  ? -6.016  -1.129  -7.901  1.00 0.00 ? 86  TYR A CA   3  
ATOM 5762  C C    . TYR A 1 86  ? -6.738  -2.454  -8.132  1.00 0.00 ? 86  TYR A C    3  
ATOM 5763  O O    . TYR A 1 86  ? -6.739  -2.988  -9.241  1.00 0.00 ? 86  TYR A O    3  
ATOM 5764  C CB   . TYR A 1 86  ? -4.752  -1.363  -7.073  1.00 0.00 ? 86  TYR A CB   3  
ATOM 5765  C CG   . TYR A 1 86  ? -3.594  -1.909  -7.876  1.00 0.00 ? 86  TYR A CG   3  
ATOM 5766  C CD1  . TYR A 1 86  ? -3.101  -1.221  -8.979  1.00 0.00 ? 86  TYR A CD1  3  
ATOM 5767  C CD2  . TYR A 1 86  ? -2.994  -3.115  -7.535  1.00 0.00 ? 86  TYR A CD2  3  
ATOM 5768  C CE1  . TYR A 1 86  ? -2.043  -1.718  -9.716  1.00 0.00 ? 86  TYR A CE1  3  
ATOM 5769  C CE2  . TYR A 1 86  ? -1.935  -3.618  -8.265  1.00 0.00 ? 86  TYR A CE2  3  
ATOM 5770  C CZ   . TYR A 1 86  ? -1.464  -2.916  -9.356  1.00 0.00 ? 86  TYR A CZ   3  
ATOM 5771  O OH   . TYR A 1 86  ? -0.410  -3.414  -10.087 1.00 0.00 ? 86  TYR A OH   3  
ATOM 5772  H H    . TYR A 1 86  ? -6.561  0.301   -6.441  1.00 0.00 ? 86  TYR A H    3  
ATOM 5773  H HA   . TYR A 1 86  ? -5.737  -0.714  -8.858  1.00 0.00 ? 86  TYR A HA   3  
ATOM 5774  H HB2  . TYR A 1 86  ? -4.439  -0.428  -6.636  1.00 0.00 ? 86  TYR A HB2  3  
ATOM 5775  H HB3  . TYR A 1 86  ? -4.971  -2.067  -6.285  1.00 0.00 ? 86  TYR A HB3  3  
ATOM 5776  H HD1  . TYR A 1 86  ? -3.558  -0.283  -9.258  1.00 0.00 ? 86  TYR A HD1  3  
ATOM 5777  H HD2  . TYR A 1 86  ? -3.366  -3.662  -6.681  1.00 0.00 ? 86  TYR A HD2  3  
ATOM 5778  H HE1  . TYR A 1 86  ? -1.674  -1.168  -10.569 1.00 0.00 ? 86  TYR A HE1  3  
ATOM 5779  H HE2  . TYR A 1 86  ? -1.480  -4.556  -7.984  1.00 0.00 ? 86  TYR A HE2  3  
ATOM 5780  H HH   . TYR A 1 86  ? 0.394   -2.946  -9.850  1.00 0.00 ? 86  TYR A HH   3  
ATOM 5781  N N    . GLY A 1 87  ? -7.352  -2.978  -7.076  1.00 0.00 ? 87  GLY A N    3  
ATOM 5782  C CA   . GLY A 1 87  ? -8.070  -4.235  -7.182  1.00 0.00 ? 87  GLY A CA   3  
ATOM 5783  C C    . GLY A 1 87  ? -7.814  -5.150  -6.002  1.00 0.00 ? 87  GLY A C    3  
ATOM 5784  O O    . GLY A 1 87  ? -7.698  -6.365  -6.164  1.00 0.00 ? 87  GLY A O    3  
ATOM 5785  H H    . GLY A 1 87  ? -7.317  -2.508  -6.217  1.00 0.00 ? 87  GLY A H    3  
ATOM 5786  H HA2  . GLY A 1 87  ? -9.128  -4.028  -7.243  1.00 0.00 ? 87  GLY A HA2  3  
ATOM 5787  H HA3  . GLY A 1 87  ? -7.759  -4.738  -8.087  1.00 0.00 ? 87  GLY A HA3  3  
ATOM 5788  N N    . MET A 1 88  ? -7.724  -4.568  -4.812  1.00 0.00 ? 88  MET A N    3  
ATOM 5789  C CA   . MET A 1 88  ? -7.480  -5.341  -3.599  1.00 0.00 ? 88  MET A CA   3  
ATOM 5790  C C    . MET A 1 88  ? -8.793  -5.712  -2.917  1.00 0.00 ? 88  MET A C    3  
ATOM 5791  O O    . MET A 1 88  ? -9.870  -5.331  -3.375  1.00 0.00 ? 88  MET A O    3  
ATOM 5792  C CB   . MET A 1 88  ? -6.597  -4.548  -2.632  1.00 0.00 ? 88  MET A CB   3  
ATOM 5793  C CG   . MET A 1 88  ? -5.221  -4.224  -3.194  1.00 0.00 ? 88  MET A CG   3  
ATOM 5794  S SD   . MET A 1 88  ? -3.972  -4.046  -1.907  1.00 0.00 ? 88  MET A SD   3  
ATOM 5795  C CE   . MET A 1 88  ? -3.490  -5.754  -1.664  1.00 0.00 ? 88  MET A CE   3  
ATOM 5796  H H    . MET A 1 88  ? -7.825  -3.595  -4.746  1.00 0.00 ? 88  MET A H    3  
ATOM 5797  H HA   . MET A 1 88  ? -6.966  -6.247  -3.882  1.00 0.00 ? 88  MET A HA   3  
ATOM 5798  H HB2  . MET A 1 88  ? -7.091  -3.619  -2.392  1.00 0.00 ? 88  MET A HB2  3  
ATOM 5799  H HB3  . MET A 1 88  ? -6.466  -5.123  -1.729  1.00 0.00 ? 88  MET A HB3  3  
ATOM 5800  H HG2  . MET A 1 88  ? -4.922  -5.020  -3.859  1.00 0.00 ? 88  MET A HG2  3  
ATOM 5801  H HG3  . MET A 1 88  ? -5.283  -3.299  -3.748  1.00 0.00 ? 88  MET A HG3  3  
ATOM 5802  H HE1  . MET A 1 88  ? -2.597  -5.793  -1.058  1.00 0.00 ? 88  MET A HE1  3  
ATOM 5803  H HE2  . MET A 1 88  ? -4.287  -6.285  -1.165  1.00 0.00 ? 88  MET A HE2  3  
ATOM 5804  H HE3  . MET A 1 88  ? -3.296  -6.212  -2.623  1.00 0.00 ? 88  MET A HE3  3  
ATOM 5805  N N    . ASN A 1 89  ? -8.696  -6.459  -1.822  1.00 0.00 ? 89  ASN A N    3  
ATOM 5806  C CA   . ASN A 1 89  ? -9.876  -6.882  -1.078  1.00 0.00 ? 89  ASN A CA   3  
ATOM 5807  C C    . ASN A 1 89  ? -10.181 -5.911  0.058   1.00 0.00 ? 89  ASN A C    3  
ATOM 5808  O O    . ASN A 1 89  ? -9.330  -5.131  0.486   1.00 0.00 ? 89  ASN A O    3  
ATOM 5809  C CB   . ASN A 1 89  ? -9.674  -8.292  -0.519  1.00 0.00 ? 89  ASN A CB   3  
ATOM 5810  C CG   . ASN A 1 89  ? -10.144 -9.368  -1.478  1.00 0.00 ? 89  ASN A CG   3  
ATOM 5811  O OD1  . ASN A 1 89  ? -10.193 -9.157  -2.690  1.00 0.00 ? 89  ASN A OD1  3  
ATOM 5812  N ND2  . ASN A 1 89  ? -10.494 -10.530 -0.938  1.00 0.00 ? 89  ASN A ND2  3  
ATOM 5813  H H    . ASN A 1 89  ? -7.809  -6.731  -1.507  1.00 0.00 ? 89  ASN A H    3  
ATOM 5814  H HA   . ASN A 1 89  ? -10.711 -6.893  -1.762  1.00 0.00 ? 89  ASN A HA   3  
ATOM 5815  H HB2  . ASN A 1 89  ? -8.622  -8.447  -0.323  1.00 0.00 ? 89  ASN A HB2  3  
ATOM 5816  H HB3  . ASN A 1 89  ? -10.226 -8.391  0.404   1.00 0.00 ? 89  ASN A HB3  3  
ATOM 5817  H HD21 . ASN A 1 89  ? -10.430 -10.626 0.035   1.00 0.00 ? 89  ASN A HD21 3  
ATOM 5818  H HD22 . ASN A 1 89  ? -10.802 -11.243 -1.535  1.00 0.00 ? 89  ASN A HD22 3  
ATOM 5819  N N    . PRO A 1 90  ? -11.424 -5.959  0.560   1.00 0.00 ? 90  PRO A N    3  
ATOM 5820  C CA   . PRO A 1 90  ? -11.869 -5.092  1.654   1.00 0.00 ? 90  PRO A CA   3  
ATOM 5821  C C    . PRO A 1 90  ? -11.215 -5.451  2.983   1.00 0.00 ? 90  PRO A C    3  
ATOM 5822  O O    . PRO A 1 90  ? -11.406 -4.765  3.987   1.00 0.00 ? 90  PRO A O    3  
ATOM 5823  C CB   . PRO A 1 90  ? -13.378 -5.345  1.716   1.00 0.00 ? 90  PRO A CB   3  
ATOM 5824  C CG   . PRO A 1 90  ? -13.556 -6.710  1.147   1.00 0.00 ? 90  PRO A CG   3  
ATOM 5825  C CD   . PRO A 1 90  ? -12.489 -6.864  0.098   1.00 0.00 ? 90  PRO A CD   3  
ATOM 5826  H HA   . PRO A 1 90  ? -11.687 -4.050  1.434   1.00 0.00 ? 90  PRO A HA   3  
ATOM 5827  H HB2  . PRO A 1 90  ? -13.712 -5.297  2.743   1.00 0.00 ? 90  PRO A HB2  3  
ATOM 5828  H HB3  . PRO A 1 90  ? -13.896 -4.602  1.128   1.00 0.00 ? 90  PRO A HB3  3  
ATOM 5829  H HG2  . PRO A 1 90  ? -13.430 -7.451  1.922   1.00 0.00 ? 90  PRO A HG2  3  
ATOM 5830  H HG3  . PRO A 1 90  ? -14.536 -6.796  0.700   1.00 0.00 ? 90  PRO A HG3  3  
ATOM 5831  H HD2  . PRO A 1 90  ? -12.139 -7.885  0.063   1.00 0.00 ? 90  PRO A HD2  3  
ATOM 5832  H HD3  . PRO A 1 90  ? -12.863 -6.558  -0.868  1.00 0.00 ? 90  PRO A HD3  3  
ATOM 5833  N N    . VAL A 1 91  ? -10.439 -6.530  2.982   1.00 0.00 ? 91  VAL A N    3  
ATOM 5834  C CA   . VAL A 1 91  ? -9.753  -6.980  4.188   1.00 0.00 ? 91  VAL A CA   3  
ATOM 5835  C C    . VAL A 1 91  ? -8.240  -6.957  4.000   1.00 0.00 ? 91  VAL A C    3  
ATOM 5836  O O    . VAL A 1 91  ? -7.484  -6.958  4.972   1.00 0.00 ? 91  VAL A O    3  
ATOM 5837  C CB   . VAL A 1 91  ? -10.189 -8.403  4.584   1.00 0.00 ? 91  VAL A CB   3  
ATOM 5838  C CG1  . VAL A 1 91  ? -10.321 -9.284  3.350   1.00 0.00 ? 91  VAL A CG1  3  
ATOM 5839  C CG2  . VAL A 1 91  ? -9.205  -9.004  5.576   1.00 0.00 ? 91  VAL A CG2  3  
ATOM 5840  H H    . VAL A 1 91  ? -10.324 -7.036  2.151   1.00 0.00 ? 91  VAL A H    3  
ATOM 5841  H HA   . VAL A 1 91  ? -10.017 -6.309  4.992   1.00 0.00 ? 91  VAL A HA   3  
ATOM 5842  H HB   . VAL A 1 91  ? -11.156 -8.342  5.060   1.00 0.00 ? 91  VAL A HB   3  
ATOM 5843  H HG11 . VAL A 1 91  ? -10.497 -10.305 3.655   1.00 0.00 ? 91  VAL A HG11 3  
ATOM 5844  H HG12 . VAL A 1 91  ? -11.149 -8.939  2.748   1.00 0.00 ? 91  VAL A HG12 3  
ATOM 5845  H HG13 . VAL A 1 91  ? -9.410  -9.233  2.773   1.00 0.00 ? 91  VAL A HG13 3  
ATOM 5846  H HG21 . VAL A 1 91  ? -9.099  -8.343  6.422   1.00 0.00 ? 91  VAL A HG21 3  
ATOM 5847  H HG22 . VAL A 1 91  ? -9.573  -9.963  5.912   1.00 0.00 ? 91  VAL A HG22 3  
ATOM 5848  H HG23 . VAL A 1 91  ? -8.246  -9.136  5.098   1.00 0.00 ? 91  VAL A HG23 3  
ATOM 5849  N N    . ASP A 1 92  ? -7.806  -6.936  2.746   1.00 0.00 ? 92  ASP A N    3  
ATOM 5850  C CA   . ASP A 1 92  ? -6.382  -6.911  2.430   1.00 0.00 ? 92  ASP A CA   3  
ATOM 5851  C C    . ASP A 1 92  ? -5.834  -5.489  2.502   1.00 0.00 ? 92  ASP A C    3  
ATOM 5852  O O    . ASP A 1 92  ? -4.790  -5.185  1.924   1.00 0.00 ? 92  ASP A O    3  
ATOM 5853  C CB   . ASP A 1 92  ? -6.136  -7.496  1.038   1.00 0.00 ? 92  ASP A CB   3  
ATOM 5854  C CG   . ASP A 1 92  ? -6.271  -9.006  1.012   1.00 0.00 ? 92  ASP A CG   3  
ATOM 5855  O OD1  . ASP A 1 92  ? -5.951  -9.648  2.035   1.00 0.00 ? 92  ASP A OD1  3  
ATOM 5856  O OD2  . ASP A 1 92  ? -6.697  -9.546  -0.031  1.00 0.00 ? 92  ASP A OD2  3  
ATOM 5857  H H    . ASP A 1 92  ? -8.457  -6.937  2.014   1.00 0.00 ? 92  ASP A H    3  
ATOM 5858  H HA   . ASP A 1 92  ? -5.870  -7.519  3.161   1.00 0.00 ? 92  ASP A HA   3  
ATOM 5859  H HB2  . ASP A 1 92  ? -6.853  -7.078  0.347   1.00 0.00 ? 92  ASP A HB2  3  
ATOM 5860  H HB3  . ASP A 1 92  ? -5.139  -7.237  0.717   1.00 0.00 ? 92  ASP A HB3  3  
ATOM 5861  N N    . LEU A 1 93  ? -6.545  -4.623  3.214   1.00 0.00 ? 93  LEU A N    3  
ATOM 5862  C CA   . LEU A 1 93  ? -6.131  -3.232  3.361   1.00 0.00 ? 93  LEU A CA   3  
ATOM 5863  C C    . LEU A 1 93  ? -5.782  -2.918  4.813   1.00 0.00 ? 93  LEU A C    3  
ATOM 5864  O O    . LEU A 1 93  ? -5.825  -3.795  5.676   1.00 0.00 ? 93  LEU A O    3  
ATOM 5865  C CB   . LEU A 1 93  ? -7.239  -2.295  2.878   1.00 0.00 ? 93  LEU A CB   3  
ATOM 5866  C CG   . LEU A 1 93  ? -7.767  -2.554  1.466   1.00 0.00 ? 93  LEU A CG   3  
ATOM 5867  C CD1  . LEU A 1 93  ? -9.076  -1.812  1.242   1.00 0.00 ? 93  LEU A CD1  3  
ATOM 5868  C CD2  . LEU A 1 93  ? -6.734  -2.142  0.426   1.00 0.00 ? 93  LEU A CD2  3  
ATOM 5869  H H    . LEU A 1 93  ? -7.368  -4.924  3.652   1.00 0.00 ? 93  LEU A H    3  
ATOM 5870  H HA   . LEU A 1 93  ? -5.252  -3.082  2.753   1.00 0.00 ? 93  LEU A HA   3  
ATOM 5871  H HB2  . LEU A 1 93  ? -8.069  -2.382  3.562   1.00 0.00 ? 93  LEU A HB2  3  
ATOM 5872  H HB3  . LEU A 1 93  ? -6.855  -1.285  2.908   1.00 0.00 ? 93  LEU A HB3  3  
ATOM 5873  H HG   . LEU A 1 93  ? -7.959  -3.612  1.348   1.00 0.00 ? 93  LEU A HG   3  
ATOM 5874  H HD11 . LEU A 1 93  ? -9.264  -1.154  2.077   1.00 0.00 ? 93  LEU A HD11 3  
ATOM 5875  H HD12 . LEU A 1 93  ? -9.884  -2.524  1.156   1.00 0.00 ? 93  LEU A HD12 3  
ATOM 5876  H HD13 . LEU A 1 93  ? -9.010  -1.233  0.332   1.00 0.00 ? 93  LEU A HD13 3  
ATOM 5877  H HD21 . LEU A 1 93  ? -6.443  -1.116  0.595   1.00 0.00 ? 93  LEU A HD21 3  
ATOM 5878  H HD22 . LEU A 1 93  ? -7.161  -2.238  -0.561  1.00 0.00 ? 93  LEU A HD22 3  
ATOM 5879  H HD23 . LEU A 1 93  ? -5.868  -2.781  0.508   1.00 0.00 ? 93  LEU A HD23 3  
ATOM 5880  N N    . PHE A 1 94  ? -5.439  -1.661  5.075   1.00 0.00 ? 94  PHE A N    3  
ATOM 5881  C CA   . PHE A 1 94  ? -5.085  -1.231  6.423   1.00 0.00 ? 94  PHE A CA   3  
ATOM 5882  C C    . PHE A 1 94  ? -5.424  0.242   6.631   1.00 0.00 ? 94  PHE A C    3  
ATOM 5883  O O    . PHE A 1 94  ? -5.363  1.040   5.697   1.00 0.00 ? 94  PHE A O    3  
ATOM 5884  C CB   . PHE A 1 94  ? -3.595  -1.465  6.681   1.00 0.00 ? 94  PHE A CB   3  
ATOM 5885  C CG   . PHE A 1 94  ? -2.699  -0.585  5.855   1.00 0.00 ? 94  PHE A CG   3  
ATOM 5886  C CD1  . PHE A 1 94  ? -2.412  -0.906  4.539   1.00 0.00 ? 94  PHE A CD1  3  
ATOM 5887  C CD2  . PHE A 1 94  ? -2.146  0.565   6.397   1.00 0.00 ? 94  PHE A CD2  3  
ATOM 5888  C CE1  . PHE A 1 94  ? -1.587  -0.099  3.778   1.00 0.00 ? 94  PHE A CE1  3  
ATOM 5889  C CE2  . PHE A 1 94  ? -1.321  1.376   5.640   1.00 0.00 ? 94  PHE A CE2  3  
ATOM 5890  C CZ   . PHE A 1 94  ? -1.042  1.044   4.329   1.00 0.00 ? 94  PHE A CZ   3  
ATOM 5891  H H    . PHE A 1 94  ? -5.424  -1.007  4.346   1.00 0.00 ? 94  PHE A H    3  
ATOM 5892  H HA   . PHE A 1 94  ? -5.659  -1.822  7.120   1.00 0.00 ? 94  PHE A HA   3  
ATOM 5893  H HB2  . PHE A 1 94  ? -3.382  -1.272  7.721   1.00 0.00 ? 94  PHE A HB2  3  
ATOM 5894  H HB3  . PHE A 1 94  ? -3.354  -2.492  6.452   1.00 0.00 ? 94  PHE A HB3  3  
ATOM 5895  H HD1  . PHE A 1 94  ? -2.838  -1.800  4.106   1.00 0.00 ? 94  PHE A HD1  3  
ATOM 5896  H HD2  . PHE A 1 94  ? -2.363  0.825   7.422   1.00 0.00 ? 94  PHE A HD2  3  
ATOM 5897  H HE1  . PHE A 1 94  ? -1.371  -0.361  2.753   1.00 0.00 ? 94  PHE A HE1  3  
ATOM 5898  H HE2  . PHE A 1 94  ? -0.897  2.269   6.075   1.00 0.00 ? 94  PHE A HE2  3  
ATOM 5899  H HZ   . PHE A 1 94  ? -0.397  1.676   3.737   1.00 0.00 ? 94  PHE A HZ   3  
ATOM 5900  N N    . GLU A 1 95  ? -5.781  0.593   7.863   1.00 0.00 ? 95  GLU A N    3  
ATOM 5901  C CA   . GLU A 1 95  ? -6.131  1.970   8.192   1.00 0.00 ? 95  GLU A CA   3  
ATOM 5902  C C    . GLU A 1 95  ? -4.897  2.866   8.163   1.00 0.00 ? 95  GLU A C    3  
ATOM 5903  O O    . GLU A 1 95  ? -3.807  2.429   7.795   1.00 0.00 ? 95  GLU A O    3  
ATOM 5904  C CB   . GLU A 1 95  ? -6.791  2.036   9.571   1.00 0.00 ? 95  GLU A CB   3  
ATOM 5905  C CG   . GLU A 1 95  ? -8.247  1.600   9.570   1.00 0.00 ? 95  GLU A CG   3  
ATOM 5906  C CD   . GLU A 1 95  ? -8.802  1.418   10.970  1.00 0.00 ? 95  GLU A CD   3  
ATOM 5907  O OE1  . GLU A 1 95  ? -8.632  0.317   11.535  1.00 0.00 ? 95  GLU A OE1  3  
ATOM 5908  O OE2  . GLU A 1 95  ? -9.405  2.374   11.499  1.00 0.00 ? 95  GLU A OE2  3  
ATOM 5909  H H    . GLU A 1 95  ? -5.810  -0.089  8.565   1.00 0.00 ? 95  GLU A H    3  
ATOM 5910  H HA   . GLU A 1 95  ? -6.833  2.320   7.451   1.00 0.00 ? 95  GLU A HA   3  
ATOM 5911  H HB2  . GLU A 1 95  ? -6.245  1.396   10.248  1.00 0.00 ? 95  GLU A HB2  3  
ATOM 5912  H HB3  . GLU A 1 95  ? -6.742  3.052   9.932   1.00 0.00 ? 95  GLU A HB3  3  
ATOM 5913  H HG2  . GLU A 1 95  ? -8.834  2.351   9.062   1.00 0.00 ? 95  GLU A HG2  3  
ATOM 5914  H HG3  . GLU A 1 95  ? -8.329  0.662   9.040   1.00 0.00 ? 95  GLU A HG3  3  
ATOM 5915  N N    . ALA A 1 96  ? -5.078  4.124   8.554   1.00 0.00 ? 96  ALA A N    3  
ATOM 5916  C CA   . ALA A 1 96  ? -3.980  5.082   8.574   1.00 0.00 ? 96  ALA A CA   3  
ATOM 5917  C C    . ALA A 1 96  ? -3.373  5.193   9.970   1.00 0.00 ? 96  ALA A C    3  
ATOM 5918  O O    . ALA A 1 96  ? -2.280  5.731   10.140  1.00 0.00 ? 96  ALA A O    3  
ATOM 5919  C CB   . ALA A 1 96  ? -4.459  6.445   8.097   1.00 0.00 ? 96  ALA A CB   3  
ATOM 5920  H H    . ALA A 1 96  ? -5.970  4.414   8.836   1.00 0.00 ? 96  ALA A H    3  
ATOM 5921  H HA   . ALA A 1 96  ? -3.220  4.736   7.888   1.00 0.00 ? 96  ALA A HA   3  
ATOM 5922  H HB1  . ALA A 1 96  ? -5.510  6.390   7.852   1.00 0.00 ? 96  ALA A HB1  3  
ATOM 5923  H HB2  . ALA A 1 96  ? -4.309  7.174   8.880   1.00 0.00 ? 96  ALA A HB2  3  
ATOM 5924  H HB3  . ALA A 1 96  ? -3.900  6.737   7.220   1.00 0.00 ? 96  ALA A HB3  3  
ATOM 5925  N N    . ASN A 1 97  ? -4.090  4.678   10.964  1.00 0.00 ? 97  ASN A N    3  
ATOM 5926  C CA   . ASN A 1 97  ? -3.622  4.721   12.344  1.00 0.00 ? 97  ASN A CA   3  
ATOM 5927  C C    . ASN A 1 97  ? -2.697  3.545   12.641  1.00 0.00 ? 97  ASN A C    3  
ATOM 5928  O O    . ASN A 1 97  ? -1.675  3.698   13.311  1.00 0.00 ? 97  ASN A O    3  
ATOM 5929  C CB   . ASN A 1 97  ? -4.810  4.704   13.308  1.00 0.00 ? 97  ASN A CB   3  
ATOM 5930  C CG   . ASN A 1 97  ? -5.784  5.837   13.045  1.00 0.00 ? 97  ASN A CG   3  
ATOM 5931  O OD1  . ASN A 1 97  ? -5.668  6.918   13.621  1.00 0.00 ? 97  ASN A OD1  3  
ATOM 5932  N ND2  . ASN A 1 97  ? -6.751  5.593   12.167  1.00 0.00 ? 97  ASN A ND2  3  
ATOM 5933  H H    . ASN A 1 97  ? -4.954  4.262   10.765  1.00 0.00 ? 97  ASN A H    3  
ATOM 5934  H HA   . ASN A 1 97  ? -3.072  5.640   12.480  1.00 0.00 ? 97  ASN A HA   3  
ATOM 5935  H HB2  . ASN A 1 97  ? -5.340  3.768   13.202  1.00 0.00 ? 97  ASN A HB2  3  
ATOM 5936  H HB3  . ASN A 1 97  ? -4.447  4.795   14.320  1.00 0.00 ? 97  ASN A HB3  3  
ATOM 5937  H HD21 . ASN A 1 97  ? -6.782  4.708   11.746  1.00 0.00 ? 97  ASN A HD21 3  
ATOM 5938  H HD22 . ASN A 1 97  ? -7.394  6.308   11.977  1.00 0.00 ? 97  ASN A HD22 3  
ATOM 5939  N N    . ASP A 1 98  ? -3.061  2.371   12.136  1.00 0.00 ? 98  ASP A N    3  
ATOM 5940  C CA   . ASP A 1 98  ? -2.263  1.168   12.346  1.00 0.00 ? 98  ASP A CA   3  
ATOM 5941  C C    . ASP A 1 98  ? -0.773  1.479   12.236  1.00 0.00 ? 98  ASP A C    3  
ATOM 5942  O O    . ASP A 1 98  ? 0.030   1.014   13.046  1.00 0.00 ? 98  ASP A O    3  
ATOM 5943  C CB   . ASP A 1 98  ? -2.648  0.092   11.329  1.00 0.00 ? 98  ASP A CB   3  
ATOM 5944  C CG   . ASP A 1 98  ? -2.664  0.616   9.907   1.00 0.00 ? 98  ASP A CG   3  
ATOM 5945  O OD1  . ASP A 1 98  ? -1.620  1.131   9.454   1.00 0.00 ? 98  ASP A OD1  3  
ATOM 5946  O OD2  . ASP A 1 98  ? -3.720  0.514   9.248   1.00 0.00 ? 98  ASP A OD2  3  
ATOM 5947  H H    . ASP A 1 98  ? -3.886  2.311   11.610  1.00 0.00 ? 98  ASP A H    3  
ATOM 5948  H HA   . ASP A 1 98  ? -2.469  0.802   13.340  1.00 0.00 ? 98  ASP A HA   3  
ATOM 5949  H HB2  . ASP A 1 98  ? -1.936  -0.719  11.386  1.00 0.00 ? 98  ASP A HB2  3  
ATOM 5950  H HB3  . ASP A 1 98  ? -3.633  -0.282  11.568  1.00 0.00 ? 98  ASP A HB3  3  
ATOM 5951  N N    . LEU A 1 99  ? -0.411  2.265   11.228  1.00 0.00 ? 99  LEU A N    3  
ATOM 5952  C CA   . LEU A 1 99  ? 0.983   2.638   11.012  1.00 0.00 ? 99  LEU A CA   3  
ATOM 5953  C C    . LEU A 1 99  ? 1.337   3.900   11.791  1.00 0.00 ? 99  LEU A C    3  
ATOM 5954  O O    . LEU A 1 99  ? 2.294   3.916   12.565  1.00 0.00 ? 99  LEU A O    3  
ATOM 5955  C CB   . LEU A 1 99  ? 1.248   2.855   9.520   1.00 0.00 ? 99  LEU A CB   3  
ATOM 5956  C CG   . LEU A 1 99  ? 2.713   3.014   9.114   1.00 0.00 ? 99  LEU A CG   3  
ATOM 5957  C CD1  . LEU A 1 99  ? 3.436   1.678   9.187   1.00 0.00 ? 99  LEU A CD1  3  
ATOM 5958  C CD2  . LEU A 1 99  ? 2.818   3.604   7.716   1.00 0.00 ? 99  LEU A CD2  3  
ATOM 5959  H H    . LEU A 1 99  ? -1.096  2.605   10.616  1.00 0.00 ? 99  LEU A H    3  
ATOM 5960  H HA   . LEU A 1 99  ? 1.601   1.826   11.364  1.00 0.00 ? 99  LEU A HA   3  
ATOM 5961  H HB2  . LEU A 1 99  ? 0.847   2.006   8.987   1.00 0.00 ? 99  LEU A HB2  3  
ATOM 5962  H HB3  . LEU A 1 99  ? 0.720   3.749   9.219   1.00 0.00 ? 99  LEU A HB3  3  
ATOM 5963  H HG   . LEU A 1 99  ? 3.198   3.693   9.803   1.00 0.00 ? 99  LEU A HG   3  
ATOM 5964  H HD11 . LEU A 1 99  ? 2.712   0.877   9.194   1.00 0.00 ? 99  LEU A HD11 3  
ATOM 5965  H HD12 . LEU A 1 99  ? 4.026   1.637   10.090  1.00 0.00 ? 99  LEU A HD12 3  
ATOM 5966  H HD13 . LEU A 1 99  ? 4.083   1.571   8.328   1.00 0.00 ? 99  LEU A HD13 3  
ATOM 5967  H HD21 . LEU A 1 99  ? 3.837   3.523   7.367   1.00 0.00 ? 99  LEU A HD21 3  
ATOM 5968  H HD22 . LEU A 1 99  ? 2.529   4.646   7.742   1.00 0.00 ? 99  LEU A HD22 3  
ATOM 5969  H HD23 . LEU A 1 99  ? 2.164   3.065   7.048   1.00 0.00 ? 99  LEU A HD23 3  
ATOM 5970  N N    . PHE A 1 100 ? 0.558   4.956   11.583  1.00 0.00 ? 100 PHE A N    3  
ATOM 5971  C CA   . PHE A 1 100 ? 0.789   6.223   12.267  1.00 0.00 ? 100 PHE A CA   3  
ATOM 5972  C C    . PHE A 1 100 ? 1.177   5.991   13.725  1.00 0.00 ? 100 PHE A C    3  
ATOM 5973  O O    . PHE A 1 100 ? 2.278   6.342   14.147  1.00 0.00 ? 100 PHE A O    3  
ATOM 5974  C CB   . PHE A 1 100 ? -0.462  7.102   12.195  1.00 0.00 ? 100 PHE A CB   3  
ATOM 5975  C CG   . PHE A 1 100 ? -0.216  8.529   12.593  1.00 0.00 ? 100 PHE A CG   3  
ATOM 5976  C CD1  . PHE A 1 100 ? 0.795   9.264   11.996  1.00 0.00 ? 100 PHE A CD1  3  
ATOM 5977  C CD2  . PHE A 1 100 ? -0.997  9.135   13.564  1.00 0.00 ? 100 PHE A CD2  3  
ATOM 5978  C CE1  . PHE A 1 100 ? 1.023   10.578  12.360  1.00 0.00 ? 100 PHE A CE1  3  
ATOM 5979  C CE2  . PHE A 1 100 ? -0.772  10.448  13.932  1.00 0.00 ? 100 PHE A CE2  3  
ATOM 5980  C CZ   . PHE A 1 100 ? 0.239   11.170  13.330  1.00 0.00 ? 100 PHE A CZ   3  
ATOM 5981  H H    . PHE A 1 100 ? -0.189  4.881   10.953  1.00 0.00 ? 100 PHE A H    3  
ATOM 5982  H HA   . PHE A 1 100 ? 1.602   6.726   11.766  1.00 0.00 ? 100 PHE A HA   3  
ATOM 5983  H HB2  . PHE A 1 100 ? -0.835  7.100   11.182  1.00 0.00 ? 100 PHE A HB2  3  
ATOM 5984  H HB3  . PHE A 1 100 ? -1.216  6.697   12.853  1.00 0.00 ? 100 PHE A HB3  3  
ATOM 5985  H HD1  . PHE A 1 100 ? 1.410   8.802   11.236  1.00 0.00 ? 100 PHE A HD1  3  
ATOM 5986  H HD2  . PHE A 1 100 ? -1.787  8.571   14.037  1.00 0.00 ? 100 PHE A HD2  3  
ATOM 5987  H HE1  . PHE A 1 100 ? 1.815   11.139  11.887  1.00 0.00 ? 100 PHE A HE1  3  
ATOM 5988  H HE2  . PHE A 1 100 ? -1.387  10.908  14.691  1.00 0.00 ? 100 PHE A HE2  3  
ATOM 5989  H HZ   . PHE A 1 100 ? 0.415   12.196  13.615  1.00 0.00 ? 100 PHE A HZ   3  
ATOM 5990  N N    . GLU A 1 101 ? 0.264   5.398   14.487  1.00 0.00 ? 101 GLU A N    3  
ATOM 5991  C CA   . GLU A 1 101 ? 0.510   5.120   15.897  1.00 0.00 ? 101 GLU A CA   3  
ATOM 5992  C C    . GLU A 1 101 ? 0.801   3.639   16.117  1.00 0.00 ? 101 GLU A C    3  
ATOM 5993  O O    . GLU A 1 101 ? 0.400   3.060   17.128  1.00 0.00 ? 101 GLU A O    3  
ATOM 5994  C CB   . GLU A 1 101 ? -0.693  5.547   16.741  1.00 0.00 ? 101 GLU A CB   3  
ATOM 5995  C CG   . GLU A 1 101 ? -1.012  7.029   16.643  1.00 0.00 ? 101 GLU A CG   3  
ATOM 5996  C CD   . GLU A 1 101 ? -0.281  7.853   17.686  1.00 0.00 ? 101 GLU A CD   3  
ATOM 5997  O OE1  . GLU A 1 101 ? 0.968   7.864   17.665  1.00 0.00 ? 101 GLU A OE1  3  
ATOM 5998  O OE2  . GLU A 1 101 ? -0.958  8.486   18.523  1.00 0.00 ? 101 GLU A OE2  3  
ATOM 5999  H H    . GLU A 1 101 ? -0.596  5.141   14.092  1.00 0.00 ? 101 GLU A H    3  
ATOM 6000  H HA   . GLU A 1 101 ? 1.373   5.694   16.202  1.00 0.00 ? 101 GLU A HA   3  
ATOM 6001  H HB2  . GLU A 1 101 ? -1.560  4.990   16.417  1.00 0.00 ? 101 GLU A HB2  3  
ATOM 6002  H HB3  . GLU A 1 101 ? -0.492  5.311   17.776  1.00 0.00 ? 101 GLU A HB3  3  
ATOM 6003  H HG2  . GLU A 1 101 ? -0.725  7.381   15.663  1.00 0.00 ? 101 GLU A HG2  3  
ATOM 6004  H HG3  . GLU A 1 101 ? -2.074  7.165   16.777  1.00 0.00 ? 101 GLU A HG3  3  
ATOM 6005  N N    . SER A 1 102 ? 1.502   3.032   15.165  1.00 0.00 ? 102 SER A N    3  
ATOM 6006  C CA   . SER A 1 102 ? 1.843   1.617   15.252  1.00 0.00 ? 102 SER A CA   3  
ATOM 6007  C C    . SER A 1 102 ? 0.667   0.806   15.788  1.00 0.00 ? 102 SER A C    3  
ATOM 6008  O O    . SER A 1 102 ? 0.851   -0.244  16.402  1.00 0.00 ? 102 SER A O    3  
ATOM 6009  C CB   . SER A 1 102 ? 3.065   1.420   16.151  1.00 0.00 ? 102 SER A CB   3  
ATOM 6010  O OG   . SER A 1 102 ? 2.765   1.744   17.498  1.00 0.00 ? 102 SER A OG   3  
ATOM 6011  H H    . SER A 1 102 ? 1.794   3.547   14.384  1.00 0.00 ? 102 SER A H    3  
ATOM 6012  H HA   . SER A 1 102 ? 2.080   1.271   14.257  1.00 0.00 ? 102 SER A HA   3  
ATOM 6013  H HB2  . SER A 1 102 ? 3.381   0.389   16.104  1.00 0.00 ? 102 SER A HB2  3  
ATOM 6014  H HB3  . SER A 1 102 ? 3.868   2.058   15.809  1.00 0.00 ? 102 SER A HB3  3  
ATOM 6015  H HG   . SER A 1 102 ? 3.525   2.171   17.901  1.00 0.00 ? 102 SER A HG   3  
ATOM 6016  N N    . GLY A 1 103 ? -0.544  1.303   15.551  1.00 0.00 ? 103 GLY A N    3  
ATOM 6017  C CA   . GLY A 1 103 ? -1.732  0.614   16.016  1.00 0.00 ? 103 GLY A CA   3  
ATOM 6018  C C    . GLY A 1 103 ? -1.815  -0.810  15.502  1.00 0.00 ? 103 GLY A C    3  
ATOM 6019  O O    . GLY A 1 103 ? -2.566  -1.627  16.035  1.00 0.00 ? 103 GLY A O    3  
ATOM 6020  H H    . GLY A 1 103 ? -0.629  2.145   15.056  1.00 0.00 ? 103 GLY A H    3  
ATOM 6021  H HA2  . GLY A 1 103 ? -1.726  0.595   17.096  1.00 0.00 ? 103 GLY A HA2  3  
ATOM 6022  H HA3  . GLY A 1 103 ? -2.603  1.156   15.682  1.00 0.00 ? 103 GLY A HA3  3  
ATOM 6023  N N    . ASN A 1 104 ? -1.043  -1.109  14.462  1.00 0.00 ? 104 ASN A N    3  
ATOM 6024  C CA   . ASN A 1 104 ? -1.035  -2.443  13.873  1.00 0.00 ? 104 ASN A CA   3  
ATOM 6025  C C    . ASN A 1 104 ? 0.014   -2.544  12.771  1.00 0.00 ? 104 ASN A C    3  
ATOM 6026  O O    . ASN A 1 104 ? -0.101  -1.898  11.729  1.00 0.00 ? 104 ASN A O    3  
ATOM 6027  C CB   . ASN A 1 104 ? -2.417  -2.783  13.312  1.00 0.00 ? 104 ASN A CB   3  
ATOM 6028  C CG   . ASN A 1 104 ? -2.671  -4.277  13.269  1.00 0.00 ? 104 ASN A CG   3  
ATOM 6029  O OD1  . ASN A 1 104 ? -1.736  -5.078  13.286  1.00 0.00 ? 104 ASN A OD1  3  
ATOM 6030  N ND2  . ASN A 1 104 ? -3.942  -4.660  13.214  1.00 0.00 ? 104 ASN A ND2  3  
ATOM 6031  H H    . ASN A 1 104 ? -0.466  -0.415  14.081  1.00 0.00 ? 104 ASN A H    3  
ATOM 6032  H HA   . ASN A 1 104 ? -0.790  -3.147  14.654  1.00 0.00 ? 104 ASN A HA   3  
ATOM 6033  H HB2  . ASN A 1 104 ? -3.174  -2.326  13.932  1.00 0.00 ? 104 ASN A HB2  3  
ATOM 6034  H HB3  . ASN A 1 104 ? -2.497  -2.394  12.307  1.00 0.00 ? 104 ASN A HB3  3  
ATOM 6035  H HD21 . ASN A 1 104 ? -4.634  -3.967  13.204  1.00 0.00 ? 104 ASN A HD21 3  
ATOM 6036  H HD22 . ASN A 1 104 ? -4.135  -5.620  13.186  1.00 0.00 ? 104 ASN A HD22 3  
ATOM 6037  N N    . MET A 1 105 ? 1.037   -3.359  13.008  1.00 0.00 ? 105 MET A N    3  
ATOM 6038  C CA   . MET A 1 105 ? 2.106   -3.547  12.033  1.00 0.00 ? 105 MET A CA   3  
ATOM 6039  C C    . MET A 1 105 ? 1.911   -4.845  11.256  1.00 0.00 ? 105 MET A C    3  
ATOM 6040  O O    . MET A 1 105 ? 2.715   -5.189  10.389  1.00 0.00 ? 105 MET A O    3  
ATOM 6041  C CB   . MET A 1 105 ? 3.466   -3.557  12.732  1.00 0.00 ? 105 MET A CB   3  
ATOM 6042  C CG   . MET A 1 105 ? 4.108   -2.182  12.833  1.00 0.00 ? 105 MET A CG   3  
ATOM 6043  S SD   . MET A 1 105 ? 5.174   -1.810  11.426  1.00 0.00 ? 105 MET A SD   3  
ATOM 6044  C CE   . MET A 1 105 ? 3.955   -1.520  10.145  1.00 0.00 ? 105 MET A CE   3  
ATOM 6045  H H    . MET A 1 105 ? 1.073   -3.848  13.856  1.00 0.00 ? 105 MET A H    3  
ATOM 6046  H HA   . MET A 1 105 ? 2.072   -2.719  11.342  1.00 0.00 ? 105 MET A HA   3  
ATOM 6047  H HB2  . MET A 1 105 ? 3.341   -3.945  13.732  1.00 0.00 ? 105 MET A HB2  3  
ATOM 6048  H HB3  . MET A 1 105 ? 4.135   -4.203  12.185  1.00 0.00 ? 105 MET A HB3  3  
ATOM 6049  H HG2  . MET A 1 105 ? 3.328   -1.438  12.880  1.00 0.00 ? 105 MET A HG2  3  
ATOM 6050  H HG3  . MET A 1 105 ? 4.698   -2.141  13.735  1.00 0.00 ? 105 MET A HG3  3  
ATOM 6051  H HE1  . MET A 1 105 ? 3.728   -2.451  9.647   1.00 0.00 ? 105 MET A HE1  3  
ATOM 6052  H HE2  . MET A 1 105 ? 3.055   -1.120  10.589  1.00 0.00 ? 105 MET A HE2  3  
ATOM 6053  H HE3  . MET A 1 105 ? 4.349   -0.814  9.428   1.00 0.00 ? 105 MET A HE3  3  
ATOM 6054  N N    . THR A 1 106 ? 0.839   -5.564  11.573  1.00 0.00 ? 106 THR A N    3  
ATOM 6055  C CA   . THR A 1 106 ? 0.539   -6.826  10.906  1.00 0.00 ? 106 THR A CA   3  
ATOM 6056  C C    . THR A 1 106 ? -0.439  -6.620  9.755   1.00 0.00 ? 106 THR A C    3  
ATOM 6057  O O    . THR A 1 106 ? -0.372  -7.314  8.741   1.00 0.00 ? 106 THR A O    3  
ATOM 6058  C CB   . THR A 1 106 ? -0.049  -7.855  11.888  1.00 0.00 ? 106 THR A CB   3  
ATOM 6059  O OG1  . THR A 1 106 ? -1.465  -7.669  12.003  1.00 0.00 ? 106 THR A OG1  3  
ATOM 6060  C CG2  . THR A 1 106 ? 0.597   -7.727  13.259  1.00 0.00 ? 106 THR A CG2  3  
ATOM 6061  H H    . THR A 1 106 ? 0.235   -5.239  12.272  1.00 0.00 ? 106 THR A H    3  
ATOM 6062  H HA   . THR A 1 106 ? 1.465   -7.223  10.513  1.00 0.00 ? 106 THR A HA   3  
ATOM 6063  H HB   . THR A 1 106 ? 0.146   -8.847  11.506  1.00 0.00 ? 106 THR A HB   3  
ATOM 6064  H HG1  . THR A 1 106 ? -1.674  -6.736  11.909  1.00 0.00 ? 106 THR A HG1  3  
ATOM 6065  H HG21 . THR A 1 106 ? 1.632   -8.032  13.199  1.00 0.00 ? 106 THR A HG21 3  
ATOM 6066  H HG22 . THR A 1 106 ? 0.075   -8.357  13.964  1.00 0.00 ? 106 THR A HG22 3  
ATOM 6067  H HG23 . THR A 1 106 ? 0.544   -6.699  13.587  1.00 0.00 ? 106 THR A HG23 3  
ATOM 6068  N N    . GLN A 1 107 ? -1.346  -5.663  9.920   1.00 0.00 ? 107 GLN A N    3  
ATOM 6069  C CA   . GLN A 1 107 ? -2.338  -5.368  8.893   1.00 0.00 ? 107 GLN A CA   3  
ATOM 6070  C C    . GLN A 1 107 ? -1.705  -4.623  7.722   1.00 0.00 ? 107 GLN A C    3  
ATOM 6071  O O    . GLN A 1 107 ? -2.080  -4.829  6.567   1.00 0.00 ? 107 GLN A O    3  
ATOM 6072  C CB   . GLN A 1 107 ? -3.481  -4.538  9.483   1.00 0.00 ? 107 GLN A CB   3  
ATOM 6073  C CG   . GLN A 1 107 ? -4.693  -4.437  8.570   1.00 0.00 ? 107 GLN A CG   3  
ATOM 6074  C CD   . GLN A 1 107 ? -5.332  -5.785  8.299   1.00 0.00 ? 107 GLN A CD   3  
ATOM 6075  O OE1  . GLN A 1 107 ? -5.860  -6.429  9.206   1.00 0.00 ? 107 GLN A OE1  3  
ATOM 6076  N NE2  . GLN A 1 107 ? -5.289  -6.219  7.045   1.00 0.00 ? 107 GLN A NE2  3  
ATOM 6077  H H    . GLN A 1 107 ? -1.348  -5.145  10.751  1.00 0.00 ? 107 GLN A H    3  
ATOM 6078  H HA   . GLN A 1 107 ? -2.735  -6.306  8.536   1.00 0.00 ? 107 GLN A HA   3  
ATOM 6079  H HB2  . GLN A 1 107 ? -3.793  -4.987  10.413  1.00 0.00 ? 107 GLN A HB2  3  
ATOM 6080  H HB3  . GLN A 1 107 ? -3.120  -3.538  9.677   1.00 0.00 ? 107 GLN A HB3  3  
ATOM 6081  H HG2  . GLN A 1 107 ? -5.426  -3.796  9.037   1.00 0.00 ? 107 GLN A HG2  3  
ATOM 6082  H HG3  . GLN A 1 107 ? -4.385  -4.005  7.630   1.00 0.00 ? 107 GLN A HG3  3  
ATOM 6083  H HE21 . GLN A 1 107 ? -4.851  -5.653  6.374   1.00 0.00 ? 107 GLN A HE21 3  
ATOM 6084  H HE22 . GLN A 1 107 ? -5.694  -7.087  6.842   1.00 0.00 ? 107 GLN A HE22 3  
ATOM 6085  N N    . VAL A 1 108 ? -0.745  -3.757  8.028   1.00 0.00 ? 108 VAL A N    3  
ATOM 6086  C CA   . VAL A 1 108 ? -0.059  -2.982  6.999   1.00 0.00 ? 108 VAL A CA   3  
ATOM 6087  C C    . VAL A 1 108 ? 0.994   -3.824  6.288   1.00 0.00 ? 108 VAL A C    3  
ATOM 6088  O O    . VAL A 1 108 ? 1.367   -3.537  5.151   1.00 0.00 ? 108 VAL A O    3  
ATOM 6089  C CB   . VAL A 1 108 ? 0.617   -1.734  7.597   1.00 0.00 ? 108 VAL A CB   3  
ATOM 6090  C CG1  . VAL A 1 108 ? 1.372   -0.969  6.519   1.00 0.00 ? 108 VAL A CG1  3  
ATOM 6091  C CG2  . VAL A 1 108 ? -0.414  -0.842  8.272   1.00 0.00 ? 108 VAL A CG2  3  
ATOM 6092  H H    . VAL A 1 108 ? -0.490  -3.637  8.966   1.00 0.00 ? 108 VAL A H    3  
ATOM 6093  H HA   . VAL A 1 108 ? -0.795  -2.658  6.280   1.00 0.00 ? 108 VAL A HA   3  
ATOM 6094  H HB   . VAL A 1 108 ? 1.328   -2.056  8.343   1.00 0.00 ? 108 VAL A HB   3  
ATOM 6095  H HG11 . VAL A 1 108 ? 1.821   -0.088  6.953   1.00 0.00 ? 108 VAL A HG11 3  
ATOM 6096  H HG12 . VAL A 1 108 ? 2.143   -1.600  6.103   1.00 0.00 ? 108 VAL A HG12 3  
ATOM 6097  H HG13 . VAL A 1 108 ? 0.685   -0.675  5.739   1.00 0.00 ? 108 VAL A HG13 3  
ATOM 6098  H HG21 . VAL A 1 108 ? -1.399  -1.092  7.907   1.00 0.00 ? 108 VAL A HG21 3  
ATOM 6099  H HG22 . VAL A 1 108 ? -0.377  -0.993  9.341   1.00 0.00 ? 108 VAL A HG22 3  
ATOM 6100  H HG23 . VAL A 1 108 ? -0.198  0.192   8.048   1.00 0.00 ? 108 VAL A HG23 3  
ATOM 6101  N N    . GLN A 1 109 ? 1.466   -4.867  6.964   1.00 0.00 ? 109 GLN A N    3  
ATOM 6102  C CA   . GLN A 1 109 ? 2.477   -5.751  6.395   1.00 0.00 ? 109 GLN A CA   3  
ATOM 6103  C C    . GLN A 1 109 ? 1.872   -6.647  5.320   1.00 0.00 ? 109 GLN A C    3  
ATOM 6104  O O    . GLN A 1 109 ? 2.367   -6.705  4.193   1.00 0.00 ? 109 GLN A O    3  
ATOM 6105  C CB   . GLN A 1 109 ? 3.112   -6.608  7.492   1.00 0.00 ? 109 GLN A CB   3  
ATOM 6106  C CG   . GLN A 1 109 ? 4.230   -7.507  6.990   1.00 0.00 ? 109 GLN A CG   3  
ATOM 6107  C CD   . GLN A 1 109 ? 5.251   -7.821  8.065   1.00 0.00 ? 109 GLN A CD   3  
ATOM 6108  O OE1  . GLN A 1 109 ? 5.264   -7.199  9.127   1.00 0.00 ? 109 GLN A OE1  3  
ATOM 6109  N NE2  . GLN A 1 109 ? 6.117   -8.792  7.794   1.00 0.00 ? 109 GLN A NE2  3  
ATOM 6110  H H    . GLN A 1 109 ? 1.130   -5.044  7.866   1.00 0.00 ? 109 GLN A H    3  
ATOM 6111  H HA   . GLN A 1 109 ? 3.240   -5.135  5.944   1.00 0.00 ? 109 GLN A HA   3  
ATOM 6112  H HB2  . GLN A 1 109 ? 3.516   -5.956  8.252   1.00 0.00 ? 109 GLN A HB2  3  
ATOM 6113  H HB3  . GLN A 1 109 ? 2.348   -7.231  7.932   1.00 0.00 ? 109 GLN A HB3  3  
ATOM 6114  H HG2  . GLN A 1 109 ? 3.800   -8.434  6.642   1.00 0.00 ? 109 GLN A HG2  3  
ATOM 6115  H HG3  . GLN A 1 109 ? 4.731   -7.013  6.171   1.00 0.00 ? 109 GLN A HG3  3  
ATOM 6116  H HE21 . GLN A 1 109 ? 6.049   -9.243  6.926   1.00 0.00 ? 109 GLN A HE21 3  
ATOM 6117  H HE22 . GLN A 1 109 ? 6.789   -9.015  8.470   1.00 0.00 ? 109 GLN A HE22 3  
ATOM 6118  N N    . VAL A 1 110 ? 0.798   -7.347  5.675   1.00 0.00 ? 110 VAL A N    3  
ATOM 6119  C CA   . VAL A 1 110 ? 0.124   -8.241  4.740   1.00 0.00 ? 110 VAL A CA   3  
ATOM 6120  C C    . VAL A 1 110 ? -0.359  -7.484  3.507   1.00 0.00 ? 110 VAL A C    3  
ATOM 6121  O O    . VAL A 1 110 ? -0.257  -7.977  2.384   1.00 0.00 ? 110 VAL A O    3  
ATOM 6122  C CB   . VAL A 1 110 ? -1.077  -8.943  5.400   1.00 0.00 ? 110 VAL A CB   3  
ATOM 6123  C CG1  . VAL A 1 110 ? -0.611  -9.836  6.541   1.00 0.00 ? 110 VAL A CG1  3  
ATOM 6124  C CG2  . VAL A 1 110 ? -2.087  -7.918  5.894   1.00 0.00 ? 110 VAL A CG2  3  
ATOM 6125  H H    . VAL A 1 110 ? 0.450   -7.259  6.587   1.00 0.00 ? 110 VAL A H    3  
ATOM 6126  H HA   . VAL A 1 110 ? 0.832   -8.997  4.432   1.00 0.00 ? 110 VAL A HA   3  
ATOM 6127  H HB   . VAL A 1 110 ? -1.557  -9.564  4.659   1.00 0.00 ? 110 VAL A HB   3  
ATOM 6128  H HG11 . VAL A 1 110 ? -0.519  -9.248  7.443   1.00 0.00 ? 110 VAL A HG11 3  
ATOM 6129  H HG12 . VAL A 1 110 ? -1.332  -10.625 6.696   1.00 0.00 ? 110 VAL A HG12 3  
ATOM 6130  H HG13 . VAL A 1 110 ? 0.348   -10.267 6.293   1.00 0.00 ? 110 VAL A HG13 3  
ATOM 6131  H HG21 . VAL A 1 110 ? -2.932  -8.429  6.330   1.00 0.00 ? 110 VAL A HG21 3  
ATOM 6132  H HG22 . VAL A 1 110 ? -1.625  -7.284  6.637   1.00 0.00 ? 110 VAL A HG22 3  
ATOM 6133  H HG23 . VAL A 1 110 ? -2.421  -7.313  5.063   1.00 0.00 ? 110 VAL A HG23 3  
ATOM 6134  N N    . SER A 1 111 ? -0.884  -6.283  3.726   1.00 0.00 ? 111 SER A N    3  
ATOM 6135  C CA   . SER A 1 111 ? -1.386  -5.459  2.631   1.00 0.00 ? 111 SER A CA   3  
ATOM 6136  C C    . SER A 1 111 ? -0.366  -5.376  1.500   1.00 0.00 ? 111 SER A C    3  
ATOM 6137  O O    . SER A 1 111 ? -0.706  -5.540  0.328   1.00 0.00 ? 111 SER A O    3  
ATOM 6138  C CB   . SER A 1 111 ? -1.719  -4.053  3.137   1.00 0.00 ? 111 SER A CB   3  
ATOM 6139  O OG   . SER A 1 111 ? -2.654  -3.414  2.284   1.00 0.00 ? 111 SER A OG   3  
ATOM 6140  H H    . SER A 1 111 ? -0.937  -5.944  4.643   1.00 0.00 ? 111 SER A H    3  
ATOM 6141  H HA   . SER A 1 111 ? -2.287  -5.920  2.255   1.00 0.00 ? 111 SER A HA   3  
ATOM 6142  H HB2  . SER A 1 111 ? -2.142  -4.120  4.128   1.00 0.00 ? 111 SER A HB2  3  
ATOM 6143  H HB3  . SER A 1 111 ? -0.816  -3.462  3.169   1.00 0.00 ? 111 SER A HB3  3  
ATOM 6144  H HG   . SER A 1 111 ? -2.892  -4.007  1.567   1.00 0.00 ? 111 SER A HG   3  
ATOM 6145  N N    . LEU A 1 112 ? 0.887   -5.120  1.860   1.00 0.00 ? 112 LEU A N    3  
ATOM 6146  C CA   . LEU A 1 112 ? 1.960   -5.016  0.877   1.00 0.00 ? 112 LEU A CA   3  
ATOM 6147  C C    . LEU A 1 112 ? 2.251   -6.373  0.243   1.00 0.00 ? 112 LEU A C    3  
ATOM 6148  O O    . LEU A 1 112 ? 2.409   -6.480  -0.975  1.00 0.00 ? 112 LEU A O    3  
ATOM 6149  C CB   . LEU A 1 112 ? 3.227   -4.463  1.532   1.00 0.00 ? 112 LEU A CB   3  
ATOM 6150  C CG   . LEU A 1 112 ? 3.084   -3.113  2.236   1.00 0.00 ? 112 LEU A CG   3  
ATOM 6151  C CD1  . LEU A 1 112 ? 4.379   -2.739  2.941   1.00 0.00 ? 112 LEU A CD1  3  
ATOM 6152  C CD2  . LEU A 1 112 ? 2.684   -2.033  1.242   1.00 0.00 ? 112 LEU A CD2  3  
ATOM 6153  H H    . LEU A 1 112 ? 1.098   -4.999  2.810   1.00 0.00 ? 112 LEU A H    3  
ATOM 6154  H HA   . LEU A 1 112 ? 1.636   -4.334  0.105   1.00 0.00 ? 112 LEU A HA   3  
ATOM 6155  H HB2  . LEU A 1 112 ? 3.562   -5.183  2.262   1.00 0.00 ? 112 LEU A HB2  3  
ATOM 6156  H HB3  . LEU A 1 112 ? 3.977   -4.358  0.760   1.00 0.00 ? 112 LEU A HB3  3  
ATOM 6157  H HG   . LEU A 1 112 ? 2.306   -3.185  2.984   1.00 0.00 ? 112 LEU A HG   3  
ATOM 6158  H HD11 . LEU A 1 112 ? 4.463   -3.299  3.859   1.00 0.00 ? 112 LEU A HD11 3  
ATOM 6159  H HD12 . LEU A 1 112 ? 4.376   -1.683  3.162   1.00 0.00 ? 112 LEU A HD12 3  
ATOM 6160  H HD13 . LEU A 1 112 ? 5.217   -2.971  2.299   1.00 0.00 ? 112 LEU A HD13 3  
ATOM 6161  H HD21 . LEU A 1 112 ? 2.709   -2.437  0.241   1.00 0.00 ? 112 LEU A HD21 3  
ATOM 6162  H HD22 . LEU A 1 112 ? 3.376   -1.206  1.312   1.00 0.00 ? 112 LEU A HD22 3  
ATOM 6163  H HD23 . LEU A 1 112 ? 1.686   -1.688  1.467   1.00 0.00 ? 112 LEU A HD23 3  
ATOM 6164  N N    . LEU A 1 113 ? 2.319   -7.406  1.074   1.00 0.00 ? 113 LEU A N    3  
ATOM 6165  C CA   . LEU A 1 113 ? 2.590   -8.757  0.595   1.00 0.00 ? 113 LEU A CA   3  
ATOM 6166  C C    . LEU A 1 113 ? 1.517   -9.210  -0.390  1.00 0.00 ? 113 LEU A C    3  
ATOM 6167  O O    . LEU A 1 113 ? 1.778   -10.024 -1.276  1.00 0.00 ? 113 LEU A O    3  
ATOM 6168  C CB   . LEU A 1 113 ? 2.662   -9.732  1.772   1.00 0.00 ? 113 LEU A CB   3  
ATOM 6169  C CG   . LEU A 1 113 ? 3.964   -9.719  2.575   1.00 0.00 ? 113 LEU A CG   3  
ATOM 6170  C CD1  . LEU A 1 113 ? 3.809   -10.528 3.853   1.00 0.00 ? 113 LEU A CD1  3  
ATOM 6171  C CD2  . LEU A 1 113 ? 5.113   -10.260 1.736   1.00 0.00 ? 113 LEU A CD2  3  
ATOM 6172  H H    . LEU A 1 113 ? 2.185   -7.258  2.033   1.00 0.00 ? 113 LEU A H    3  
ATOM 6173  H HA   . LEU A 1 113 ? 3.544   -8.745  0.090   1.00 0.00 ? 113 LEU A HA   3  
ATOM 6174  H HB2  . LEU A 1 113 ? 1.855   -9.494  2.448   1.00 0.00 ? 113 LEU A HB2  3  
ATOM 6175  H HB3  . LEU A 1 113 ? 2.521   -10.730 1.383   1.00 0.00 ? 113 LEU A HB3  3  
ATOM 6176  H HG   . LEU A 1 113 ? 4.200   -8.701  2.851   1.00 0.00 ? 113 LEU A HG   3  
ATOM 6177  H HD11 . LEU A 1 113 ? 3.130   -11.350 3.680   1.00 0.00 ? 113 LEU A HD11 3  
ATOM 6178  H HD12 . LEU A 1 113 ? 3.416   -9.894  4.635   1.00 0.00 ? 113 LEU A HD12 3  
ATOM 6179  H HD13 . LEU A 1 113 ? 4.772   -10.914 4.153   1.00 0.00 ? 113 LEU A HD13 3  
ATOM 6180  H HD21 . LEU A 1 113 ? 4.954   -11.310 1.543   1.00 0.00 ? 113 LEU A HD21 3  
ATOM 6181  H HD22 . LEU A 1 113 ? 6.042   -10.128 2.271   1.00 0.00 ? 113 LEU A HD22 3  
ATOM 6182  H HD23 . LEU A 1 113 ? 5.157   -9.725  0.799   1.00 0.00 ? 113 LEU A HD23 3  
ATOM 6183  N N    . ALA A 1 114 ? 0.311   -8.675  -0.231  1.00 0.00 ? 114 ALA A N    3  
ATOM 6184  C CA   . ALA A 1 114 ? -0.799  -9.021  -1.110  1.00 0.00 ? 114 ALA A CA   3  
ATOM 6185  C C    . ALA A 1 114 ? -0.850  -8.096  -2.322  1.00 0.00 ? 114 ALA A C    3  
ATOM 6186  O O    . ALA A 1 114 ? -1.214  -8.516  -3.421  1.00 0.00 ? 114 ALA A O    3  
ATOM 6187  C CB   . ALA A 1 114 ? -2.114  -8.964  -0.346  1.00 0.00 ? 114 ALA A CB   3  
ATOM 6188  H H    . ALA A 1 114 ? 0.165   -8.031  0.493   1.00 0.00 ? 114 ALA A H    3  
ATOM 6189  H HA   . ALA A 1 114 ? -0.652  -10.036 -1.450  1.00 0.00 ? 114 ALA A HA   3  
ATOM 6190  H HB1  . ALA A 1 114 ? -1.926  -8.639  0.668   1.00 0.00 ? 114 ALA A HB1  3  
ATOM 6191  H HB2  . ALA A 1 114 ? -2.782  -8.268  -0.830  1.00 0.00 ? 114 ALA A HB2  3  
ATOM 6192  H HB3  . ALA A 1 114 ? -2.564  -9.945  -0.331  1.00 0.00 ? 114 ALA A HB3  3  
ATOM 6193  N N    . LEU A 1 115 ? -0.483  -6.837  -2.114  1.00 0.00 ? 115 LEU A N    3  
ATOM 6194  C CA   . LEU A 1 115 ? -0.486  -5.851  -3.190  1.00 0.00 ? 115 LEU A CA   3  
ATOM 6195  C C    . LEU A 1 115 ? 0.653   -6.112  -4.171  1.00 0.00 ? 115 LEU A C    3  
ATOM 6196  O O    . LEU A 1 115 ? 0.512   -5.891  -5.373  1.00 0.00 ? 115 LEU A O    3  
ATOM 6197  C CB   . LEU A 1 115 ? -0.367  -4.439  -2.616  1.00 0.00 ? 115 LEU A CB   3  
ATOM 6198  C CG   . LEU A 1 115 ? 0.115   -3.359  -3.585  1.00 0.00 ? 115 LEU A CG   3  
ATOM 6199  C CD1  . LEU A 1 115 ? -1.059  -2.769  -4.353  1.00 0.00 ? 115 LEU A CD1  3  
ATOM 6200  C CD2  . LEU A 1 115 ? 0.867   -2.268  -2.837  1.00 0.00 ? 115 LEU A CD2  3  
ATOM 6201  H H    . LEU A 1 115 ? -0.202  -6.561  -1.217  1.00 0.00 ? 115 LEU A H    3  
ATOM 6202  H HA   . LEU A 1 115 ? -1.425  -5.939  -3.716  1.00 0.00 ? 115 LEU A HA   3  
ATOM 6203  H HB2  . LEU A 1 115 ? -1.340  -4.147  -2.252  1.00 0.00 ? 115 LEU A HB2  3  
ATOM 6204  H HB3  . LEU A 1 115 ? 0.328   -4.476  -1.789  1.00 0.00 ? 115 LEU A HB3  3  
ATOM 6205  H HG   . LEU A 1 115 ? 0.792   -3.802  -4.301  1.00 0.00 ? 115 LEU A HG   3  
ATOM 6206  H HD11 . LEU A 1 115 ? -0.969  -1.694  -4.378  1.00 0.00 ? 115 LEU A HD11 3  
ATOM 6207  H HD12 . LEU A 1 115 ? -1.982  -3.042  -3.864  1.00 0.00 ? 115 LEU A HD12 3  
ATOM 6208  H HD13 . LEU A 1 115 ? -1.057  -3.155  -5.362  1.00 0.00 ? 115 LEU A HD13 3  
ATOM 6209  H HD21 . LEU A 1 115 ? 1.728   -1.965  -3.414  1.00 0.00 ? 115 LEU A HD21 3  
ATOM 6210  H HD22 . LEU A 1 115 ? 1.191   -2.647  -1.878  1.00 0.00 ? 115 LEU A HD22 3  
ATOM 6211  H HD23 . LEU A 1 115 ? 0.216   -1.419  -2.688  1.00 0.00 ? 115 LEU A HD23 3  
ATOM 6212  N N    . ALA A 1 116 ? 1.780   -6.585  -3.649  1.00 0.00 ? 116 ALA A N    3  
ATOM 6213  C CA   . ALA A 1 116 ? 2.942   -6.879  -4.478  1.00 0.00 ? 116 ALA A CA   3  
ATOM 6214  C C    . ALA A 1 116 ? 2.657   -8.037  -5.430  1.00 0.00 ? 116 ALA A C    3  
ATOM 6215  O O    . ALA A 1 116 ? 2.729   -7.884  -6.648  1.00 0.00 ? 116 ALA A O    3  
ATOM 6216  C CB   . ALA A 1 116 ? 4.146   -7.195  -3.605  1.00 0.00 ? 116 ALA A CB   3  
ATOM 6217  H H    . ALA A 1 116 ? 1.830   -6.740  -2.683  1.00 0.00 ? 116 ALA A H    3  
ATOM 6218  H HA   . ALA A 1 116 ? 3.169   -5.998  -5.060  1.00 0.00 ? 116 ALA A HA   3  
ATOM 6219  H HB1  . ALA A 1 116 ? 3.810   -7.505  -2.626  1.00 0.00 ? 116 ALA A HB1  3  
ATOM 6220  H HB2  . ALA A 1 116 ? 4.721   -7.990  -4.058  1.00 0.00 ? 116 ALA A HB2  3  
ATOM 6221  H HB3  . ALA A 1 116 ? 4.764   -6.314  -3.512  1.00 0.00 ? 116 ALA A HB3  3  
ATOM 6222  N N    . GLY A 1 117 ? 2.335   -9.197  -4.864  1.00 0.00 ? 117 GLY A N    3  
ATOM 6223  C CA   . GLY A 1 117 ? 2.046   -10.364 -5.677  1.00 0.00 ? 117 GLY A CA   3  
ATOM 6224  C C    . GLY A 1 117 ? 1.189   -10.032 -6.882  1.00 0.00 ? 117 GLY A C    3  
ATOM 6225  O O    . GLY A 1 117 ? 1.366   -10.606 -7.957  1.00 0.00 ? 117 GLY A O    3  
ATOM 6226  H H    . GLY A 1 117 ? 2.293   -9.260  -3.886  1.00 0.00 ? 117 GLY A H    3  
ATOM 6227  H HA2  . GLY A 1 117 ? 2.976   -10.791 -6.016  1.00 0.00 ? 117 GLY A HA2  3  
ATOM 6228  H HA3  . GLY A 1 117 ? 1.527   -11.091 -5.070  1.00 0.00 ? 117 GLY A HA3  3  
ATOM 6229  N N    . LYS A 1 118 ? 0.253   -9.105  -6.705  1.00 0.00 ? 118 LYS A N    3  
ATOM 6230  C CA   . LYS A 1 118 ? -0.636  -8.698  -7.785  1.00 0.00 ? 118 LYS A CA   3  
ATOM 6231  C C    . LYS A 1 118 ? 0.073   -7.748  -8.746  1.00 0.00 ? 118 LYS A C    3  
ATOM 6232  O O    . LYS A 1 118 ? -0.040  -7.884  -9.963  1.00 0.00 ? 118 LYS A O    3  
ATOM 6233  C CB   . LYS A 1 118 ? -1.887  -8.026  -7.217  1.00 0.00 ? 118 LYS A CB   3  
ATOM 6234  C CG   . LYS A 1 118 ? -2.770  -7.387  -8.277  1.00 0.00 ? 118 LYS A CG   3  
ATOM 6235  C CD   . LYS A 1 118 ? -4.231  -7.389  -7.862  1.00 0.00 ? 118 LYS A CD   3  
ATOM 6236  C CE   . LYS A 1 118 ? -4.481  -6.438  -6.700  1.00 0.00 ? 118 LYS A CE   3  
ATOM 6237  N NZ   . LYS A 1 118 ? -4.318  -7.116  -5.384  1.00 0.00 ? 118 LYS A NZ   3  
ATOM 6238  H H    . LYS A 1 118 ? 0.160   -8.683  -5.824  1.00 0.00 ? 118 LYS A H    3  
ATOM 6239  H HA   . LYS A 1 118 ? -0.929  -9.585  -8.326  1.00 0.00 ? 118 LYS A HA   3  
ATOM 6240  H HB2  . LYS A 1 118 ? -2.473  -8.765  -6.690  1.00 0.00 ? 118 LYS A HB2  3  
ATOM 6241  H HB3  . LYS A 1 118 ? -1.584  -7.257  -6.521  1.00 0.00 ? 118 LYS A HB3  3  
ATOM 6242  H HG2  . LYS A 1 118 ? -2.451  -6.367  -8.431  1.00 0.00 ? 118 LYS A HG2  3  
ATOM 6243  H HG3  . LYS A 1 118 ? -2.666  -7.940  -9.199  1.00 0.00 ? 118 LYS A HG3  3  
ATOM 6244  H HD2  . LYS A 1 118 ? -4.835  -7.080  -8.701  1.00 0.00 ? 118 LYS A HD2  3  
ATOM 6245  H HD3  . LYS A 1 118 ? -4.510  -8.390  -7.563  1.00 0.00 ? 118 LYS A HD3  3  
ATOM 6246  H HE2  . LYS A 1 118 ? -3.780  -5.620  -6.764  1.00 0.00 ? 118 LYS A HE2  3  
ATOM 6247  H HE3  . LYS A 1 118 ? -5.488  -6.056  -6.776  1.00 0.00 ? 118 LYS A HE3  3  
ATOM 6248  H HZ1  . LYS A 1 118 ? -5.025  -6.761  -4.710  1.00 0.00 ? 118 LYS A HZ1  3  
ATOM 6249  H HZ2  . LYS A 1 118 ? -3.369  -6.930  -5.003  1.00 0.00 ? 118 LYS A HZ2  3  
ATOM 6250  H HZ3  . LYS A 1 118 ? -4.442  -8.142  -5.493  1.00 0.00 ? 118 LYS A HZ3  3  
ATOM 6251  N N    . ALA A 1 119 ? 0.805   -6.789  -8.188  1.00 0.00 ? 119 ALA A N    3  
ATOM 6252  C CA   . ALA A 1 119 ? 1.536   -5.820  -8.996  1.00 0.00 ? 119 ALA A CA   3  
ATOM 6253  C C    . ALA A 1 119 ? 2.538   -6.513  -9.912  1.00 0.00 ? 119 ALA A C    3  
ATOM 6254  O O    . ALA A 1 119 ? 2.854   -6.016  -10.993 1.00 0.00 ? 119 ALA A O    3  
ATOM 6255  C CB   . ALA A 1 119 ? 2.244   -4.815  -8.100  1.00 0.00 ? 119 ALA A CB   3  
ATOM 6256  H H    . ALA A 1 119 ? 0.856   -6.733  -7.211  1.00 0.00 ? 119 ALA A H    3  
ATOM 6257  H HA   . ALA A 1 119 ? 0.820   -5.283  -9.601  1.00 0.00 ? 119 ALA A HA   3  
ATOM 6258  H HB1  . ALA A 1 119 ? 1.645   -3.919  -8.021  1.00 0.00 ? 119 ALA A HB1  3  
ATOM 6259  H HB2  . ALA A 1 119 ? 2.383   -5.242  -7.118  1.00 0.00 ? 119 ALA A HB2  3  
ATOM 6260  H HB3  . ALA A 1 119 ? 3.206   -4.568  -8.525  1.00 0.00 ? 119 ALA A HB3  3  
ATOM 6261  N N    . LYS A 1 120 ? 3.036   -7.664  -9.474  1.00 0.00 ? 120 LYS A N    3  
ATOM 6262  C CA   . LYS A 1 120 ? 4.003   -8.427  -10.254 1.00 0.00 ? 120 LYS A CA   3  
ATOM 6263  C C    . LYS A 1 120 ? 3.546   -8.563  -11.703 1.00 0.00 ? 120 LYS A C    3  
ATOM 6264  O O    . LYS A 1 120 ? 4.364   -8.632  -12.621 1.00 0.00 ? 120 LYS A O    3  
ATOM 6265  C CB   . LYS A 1 120 ? 4.205   -9.814  -9.640  1.00 0.00 ? 120 LYS A CB   3  
ATOM 6266  C CG   . LYS A 1 120 ? 5.233   -9.839  -8.522  1.00 0.00 ? 120 LYS A CG   3  
ATOM 6267  C CD   . LYS A 1 120 ? 5.291   -11.200 -7.848  1.00 0.00 ? 120 LYS A CD   3  
ATOM 6268  C CE   . LYS A 1 120 ? 6.304   -12.113 -8.522  1.00 0.00 ? 120 LYS A CE   3  
ATOM 6269  N NZ   . LYS A 1 120 ? 5.723   -12.809 -9.704  1.00 0.00 ? 120 LYS A NZ   3  
ATOM 6270  H H    . LYS A 1 120 ? 2.745   -8.010  -8.603  1.00 0.00 ? 120 LYS A H    3  
ATOM 6271  H HA   . LYS A 1 120 ? 4.941   -7.893  -10.234 1.00 0.00 ? 120 LYS A HA   3  
ATOM 6272  H HB2  . LYS A 1 120 ? 3.263   -10.159 -9.242  1.00 0.00 ? 120 LYS A HB2  3  
ATOM 6273  H HB3  . LYS A 1 120 ? 4.529   -10.494 -10.415 1.00 0.00 ? 120 LYS A HB3  3  
ATOM 6274  H HG2  . LYS A 1 120 ? 6.205   -9.613  -8.934  1.00 0.00 ? 120 LYS A HG2  3  
ATOM 6275  H HG3  . LYS A 1 120 ? 4.969   -9.094  -7.785  1.00 0.00 ? 120 LYS A HG3  3  
ATOM 6276  H HD2  . LYS A 1 120 ? 5.574   -11.068 -6.815  1.00 0.00 ? 120 LYS A HD2  3  
ATOM 6277  H HD3  . LYS A 1 120 ? 4.314   -11.660 -7.901  1.00 0.00 ? 120 LYS A HD3  3  
ATOM 6278  H HE2  . LYS A 1 120 ? 7.146   -11.520 -8.843  1.00 0.00 ? 120 LYS A HE2  3  
ATOM 6279  H HE3  . LYS A 1 120 ? 6.635   -12.851 -7.807  1.00 0.00 ? 120 LYS A HE3  3  
ATOM 6280  H HZ1  . LYS A 1 120 ? 6.399   -13.508 -10.074 1.00 0.00 ? 120 LYS A HZ1  3  
ATOM 6281  H HZ2  . LYS A 1 120 ? 5.509   -12.121 -10.454 1.00 0.00 ? 120 LYS A HZ2  3  
ATOM 6282  H HZ3  . LYS A 1 120 ? 4.846   -13.298 -9.435  1.00 0.00 ? 120 LYS A HZ3  3  
ATOM 6283  N N    . THR A 1 121 ? 2.232   -8.602  -11.904 1.00 0.00 ? 121 THR A N    3  
ATOM 6284  C CA   . THR A 1 121 ? 1.666   -8.729  -13.240 1.00 0.00 ? 121 THR A CA   3  
ATOM 6285  C C    . THR A 1 121 ? 2.417   -7.859  -14.241 1.00 0.00 ? 121 THR A C    3  
ATOM 6286  O O    . THR A 1 121 ? 2.450   -8.154  -15.436 1.00 0.00 ? 121 THR A O    3  
ATOM 6287  C CB   . THR A 1 121 ? 0.175   -8.341  -13.258 1.00 0.00 ? 121 THR A CB   3  
ATOM 6288  O OG1  . THR A 1 121 ? -0.392  -8.634  -14.541 1.00 0.00 ? 121 THR A OG1  3  
ATOM 6289  C CG2  . THR A 1 121 ? -0.004  -6.864  -12.945 1.00 0.00 ? 121 THR A CG2  3  
ATOM 6290  H H    . THR A 1 121 ? 1.630   -8.543  -11.133 1.00 0.00 ? 121 THR A H    3  
ATOM 6291  H HA   . THR A 1 121 ? 1.751   -9.763  -13.542 1.00 0.00 ? 121 THR A HA   3  
ATOM 6292  H HB   . THR A 1 121 ? -0.341  -8.920  -12.506 1.00 0.00 ? 121 THR A HB   3  
ATOM 6293  H HG1  . THR A 1 121 ? -0.769  -9.517  -14.531 1.00 0.00 ? 121 THR A HG1  3  
ATOM 6294  H HG21 . THR A 1 121 ? -1.027  -6.576  -13.137 1.00 0.00 ? 121 THR A HG21 3  
ATOM 6295  H HG22 . THR A 1 121 ? 0.657   -6.281  -13.567 1.00 0.00 ? 121 THR A HG22 3  
ATOM 6296  H HG23 . THR A 1 121 ? 0.229   -6.687  -11.905 1.00 0.00 ? 121 THR A HG23 3  
ATOM 6297  N N    . LYS A 1 122 ? 3.022   -6.784  -13.746 1.00 0.00 ? 122 LYS A N    3  
ATOM 6298  C CA   . LYS A 1 122 ? 3.775   -5.870  -14.597 1.00 0.00 ? 122 LYS A CA   3  
ATOM 6299  C C    . LYS A 1 122 ? 4.832   -6.622  -15.400 1.00 0.00 ? 122 LYS A C    3  
ATOM 6300  O O    . LYS A 1 122 ? 4.923   -6.472  -16.618 1.00 0.00 ? 122 LYS A O    3  
ATOM 6301  C CB   . LYS A 1 122 ? 4.441   -4.784  -13.749 1.00 0.00 ? 122 LYS A CB   3  
ATOM 6302  C CG   . LYS A 1 122 ? 3.573   -3.555  -13.543 1.00 0.00 ? 122 LYS A CG   3  
ATOM 6303  C CD   . LYS A 1 122 ? 2.388   -3.855  -12.640 1.00 0.00 ? 122 LYS A CD   3  
ATOM 6304  C CE   . LYS A 1 122 ? 1.191   -2.982  -12.983 1.00 0.00 ? 122 LYS A CE   3  
ATOM 6305  N NZ   . LYS A 1 122 ? 0.616   -3.326  -14.313 1.00 0.00 ? 122 LYS A NZ   3  
ATOM 6306  H H    . LYS A 1 122 ? 2.959   -6.601  -12.785 1.00 0.00 ? 122 LYS A H    3  
ATOM 6307  H HA   . LYS A 1 122 ? 3.083   -5.406  -15.282 1.00 0.00 ? 122 LYS A HA   3  
ATOM 6308  H HB2  . LYS A 1 122 ? 4.681   -5.197  -12.781 1.00 0.00 ? 122 LYS A HB2  3  
ATOM 6309  H HB3  . LYS A 1 122 ? 5.356   -4.475  -14.235 1.00 0.00 ? 122 LYS A HB3  3  
ATOM 6310  H HG2  . LYS A 1 122 ? 4.168   -2.776  -13.091 1.00 0.00 ? 122 LYS A HG2  3  
ATOM 6311  H HG3  . LYS A 1 122 ? 3.205   -3.220  -14.503 1.00 0.00 ? 122 LYS A HG3  3  
ATOM 6312  H HD2  . LYS A 1 122 ? 2.109   -4.891  -12.758 1.00 0.00 ? 122 LYS A HD2  3  
ATOM 6313  H HD3  . LYS A 1 122 ? 2.674   -3.672  -11.614 1.00 0.00 ? 122 LYS A HD3  3  
ATOM 6314  H HE2  . LYS A 1 122 ? 0.433   -3.120  -12.226 1.00 0.00 ? 122 LYS A HE2  3  
ATOM 6315  H HE3  . LYS A 1 122 ? 1.507   -1.949  -12.992 1.00 0.00 ? 122 LYS A HE3  3  
ATOM 6316  H HZ1  . LYS A 1 122 ? 0.193   -4.276  -14.284 1.00 0.00 ? 122 LYS A HZ1  3  
ATOM 6317  H HZ2  . LYS A 1 122 ? 1.361   -3.313  -15.037 1.00 0.00 ? 122 LYS A HZ2  3  
ATOM 6318  H HZ3  . LYS A 1 122 ? -0.119  -2.639  -14.573 1.00 0.00 ? 122 LYS A HZ3  3  
ATOM 6319  N N    . GLY A 1 123 ? 5.629   -7.432  -14.710 1.00 0.00 ? 123 GLY A N    3  
ATOM 6320  C CA   . GLY A 1 123 ? 6.668   -8.196  -15.376 1.00 0.00 ? 123 GLY A CA   3  
ATOM 6321  C C    . GLY A 1 123 ? 6.528   -9.687  -15.146 1.00 0.00 ? 123 GLY A C    3  
ATOM 6322  O O    . GLY A 1 123 ? 7.371   -10.304 -14.493 1.00 0.00 ? 123 GLY A O    3  
ATOM 6323  H H    . GLY A 1 123 ? 5.511   -7.512  -13.741 1.00 0.00 ? 123 GLY A H    3  
ATOM 6324  H HA2  . GLY A 1 123 ? 6.619   -7.999  -16.437 1.00 0.00 ? 123 GLY A HA2  3  
ATOM 6325  H HA3  . GLY A 1 123 ? 7.630   -7.874  -15.004 1.00 0.00 ? 123 GLY A HA3  3  
ATOM 6326  N N    . LEU A 1 124 ? 5.462   -10.270 -15.683 1.00 0.00 ? 124 LEU A N    3  
ATOM 6327  C CA   . LEU A 1 124 ? 5.213   -11.700 -15.531 1.00 0.00 ? 124 LEU A CA   3  
ATOM 6328  C C    . LEU A 1 124 ? 5.742   -12.474 -16.734 1.00 0.00 ? 124 LEU A C    3  
ATOM 6329  O O    . LEU A 1 124 ? 6.036   -11.893 -17.778 1.00 0.00 ? 124 LEU A O    3  
ATOM 6330  C CB   . LEU A 1 124 ? 3.716   -11.962 -15.360 1.00 0.00 ? 124 LEU A CB   3  
ATOM 6331  C CG   . LEU A 1 124 ? 2.811   -11.435 -16.473 1.00 0.00 ? 124 LEU A CG   3  
ATOM 6332  C CD1  . LEU A 1 124 ? 2.725   -12.441 -17.612 1.00 0.00 ? 124 LEU A CD1  3  
ATOM 6333  C CD2  . LEU A 1 124 ? 1.424   -11.122 -15.931 1.00 0.00 ? 124 LEU A CD2  3  
ATOM 6334  H H    . LEU A 1 124 ? 4.826   -9.727  -16.193 1.00 0.00 ? 124 LEU A H    3  
ATOM 6335  H HA   . LEU A 1 124 ? 5.733   -12.034 -14.646 1.00 0.00 ? 124 LEU A HA   3  
ATOM 6336  H HB2  . LEU A 1 124 ? 3.573   -13.029 -15.293 1.00 0.00 ? 124 LEU A HB2  3  
ATOM 6337  H HB3  . LEU A 1 124 ? 3.404   -11.500 -14.433 1.00 0.00 ? 124 LEU A HB3  3  
ATOM 6338  H HG   . LEU A 1 124 ? 3.230   -10.520 -16.867 1.00 0.00 ? 124 LEU A HG   3  
ATOM 6339  H HD11 . LEU A 1 124 ? 1.909   -13.122 -17.429 1.00 0.00 ? 124 LEU A HD11 3  
ATOM 6340  H HD12 . LEU A 1 124 ? 3.649   -12.994 -17.673 1.00 0.00 ? 124 LEU A HD12 3  
ATOM 6341  H HD13 . LEU A 1 124 ? 2.557   -11.917 -18.542 1.00 0.00 ? 124 LEU A HD13 3  
ATOM 6342  H HD21 . LEU A 1 124 ? 1.239   -11.720 -15.050 1.00 0.00 ? 124 LEU A HD21 3  
ATOM 6343  H HD22 . LEU A 1 124 ? 0.683   -11.351 -16.682 1.00 0.00 ? 124 LEU A HD22 3  
ATOM 6344  H HD23 . LEU A 1 124 ? 1.366   -10.076 -15.674 1.00 0.00 ? 124 LEU A HD23 3  
ATOM 6345  N N    . GLN A 1 125 ? 5.858   -13.789 -16.580 1.00 0.00 ? 125 GLN A N    3  
ATOM 6346  C CA   . GLN A 1 125 ? 6.349   -14.644 -17.655 1.00 0.00 ? 125 GLN A CA   3  
ATOM 6347  C C    . GLN A 1 125 ? 5.224   -15.497 -18.229 1.00 0.00 ? 125 GLN A C    3  
ATOM 6348  O O    . GLN A 1 125 ? 5.126   -16.691 -17.939 1.00 0.00 ? 125 GLN A O    3  
ATOM 6349  C CB   . GLN A 1 125 ? 7.478   -15.542 -17.146 1.00 0.00 ? 125 GLN A CB   3  
ATOM 6350  C CG   . GLN A 1 125 ? 7.162   -16.223 -15.823 1.00 0.00 ? 125 GLN A CG   3  
ATOM 6351  C CD   . GLN A 1 125 ? 7.938   -17.512 -15.632 1.00 0.00 ? 125 GLN A CD   3  
ATOM 6352  O OE1  . GLN A 1 125 ? 7.423   -18.603 -15.882 1.00 0.00 ? 125 GLN A OE1  3  
ATOM 6353  N NE2  . GLN A 1 125 ? 9.183   -17.394 -15.187 1.00 0.00 ? 125 GLN A NE2  3  
ATOM 6354  H H    . GLN A 1 125 ? 5.607   -14.195 -15.724 1.00 0.00 ? 125 GLN A H    3  
ATOM 6355  H HA   . GLN A 1 125 ? 6.734   -14.006 -18.435 1.00 0.00 ? 125 GLN A HA   3  
ATOM 6356  H HB2  . GLN A 1 125 ? 7.675   -16.306 -17.882 1.00 0.00 ? 125 GLN A HB2  3  
ATOM 6357  H HB3  . GLN A 1 125 ? 8.367   -14.943 -17.013 1.00 0.00 ? 125 GLN A HB3  3  
ATOM 6358  H HG2  . GLN A 1 125 ? 7.412   -15.549 -15.017 1.00 0.00 ? 125 GLN A HG2  3  
ATOM 6359  H HG3  . GLN A 1 125 ? 6.107   -16.448 -15.792 1.00 0.00 ? 125 GLN A HG3  3  
ATOM 6360  H HE21 . GLN A 1 125 ? 9.527   -16.492 -15.009 1.00 0.00 ? 125 GLN A HE21 3  
ATOM 6361  H HE22 . GLN A 1 125 ? 9.707   -18.210 -15.054 1.00 0.00 ? 125 GLN A HE22 3  
ATOM 6362  N N    . SER A 1 126 ? 4.376   -14.880 -19.045 1.00 0.00 ? 126 SER A N    3  
ATOM 6363  C CA   . SER A 1 126 ? 3.255   -15.582 -19.658 1.00 0.00 ? 126 SER A CA   3  
ATOM 6364  C C    . SER A 1 126 ? 3.573   -15.962 -21.101 1.00 0.00 ? 126 SER A C    3  
ATOM 6365  O O    . SER A 1 126 ? 4.313   -15.261 -21.789 1.00 0.00 ? 126 SER A O    3  
ATOM 6366  C CB   . SER A 1 126 ? 1.995   -14.714 -19.613 1.00 0.00 ? 126 SER A CB   3  
ATOM 6367  O OG   . SER A 1 126 ? 1.006   -15.207 -20.499 1.00 0.00 ? 126 SER A OG   3  
ATOM 6368  H H    . SER A 1 126 ? 4.507   -13.928 -19.238 1.00 0.00 ? 126 SER A H    3  
ATOM 6369  H HA   . SER A 1 126 ? 3.079   -16.485 -19.090 1.00 0.00 ? 126 SER A HA   3  
ATOM 6370  H HB2  . SER A 1 126 ? 1.596   -14.714 -18.611 1.00 0.00 ? 126 SER A HB2  3  
ATOM 6371  H HB3  . SER A 1 126 ? 2.248   -13.703 -19.900 1.00 0.00 ? 126 SER A HB3  3  
ATOM 6372  H HG   . SER A 1 126 ? 0.282   -14.577 -20.552 1.00 0.00 ? 126 SER A HG   3  
ATOM 6373  N N    . GLY A 1 127 ? 3.010   -17.079 -21.551 1.00 0.00 ? 127 GLY A N    3  
ATOM 6374  C CA   . GLY A 1 127 ? 3.246   -17.534 -22.909 1.00 0.00 ? 127 GLY A CA   3  
ATOM 6375  C C    . GLY A 1 127 ? 2.000   -17.460 -23.769 1.00 0.00 ? 127 GLY A C    3  
ATOM 6376  O O    . GLY A 1 127 ? 2.063   -17.068 -24.933 1.00 0.00 ? 127 GLY A O    3  
ATOM 6377  H H    . GLY A 1 127 ? 2.429   -17.598 -20.956 1.00 0.00 ? 127 GLY A H    3  
ATOM 6378  H HA2  . GLY A 1 127 ? 4.015   -16.920 -23.354 1.00 0.00 ? 127 GLY A HA2  3  
ATOM 6379  H HA3  . GLY A 1 127 ? 3.589   -18.557 -22.879 1.00 0.00 ? 127 GLY A HA3  3  
ATOM 6380  N N    . VAL A 1 128 ? 0.863   -17.842 -23.195 1.00 0.00 ? 128 VAL A N    3  
ATOM 6381  C CA   . VAL A 1 128 ? -0.404  -17.819 -23.918 1.00 0.00 ? 128 VAL A CA   3  
ATOM 6382  C C    . VAL A 1 128 ? -1.470  -17.063 -23.133 1.00 0.00 ? 128 VAL A C    3  
ATOM 6383  O O    . VAL A 1 128 ? -1.676  -17.314 -21.946 1.00 0.00 ? 128 VAL A O    3  
ATOM 6384  C CB   . VAL A 1 128 ? -0.909  -19.244 -24.208 1.00 0.00 ? 128 VAL A CB   3  
ATOM 6385  C CG1  . VAL A 1 128 ? -2.252  -19.198 -24.923 1.00 0.00 ? 128 VAL A CG1  3  
ATOM 6386  C CG2  . VAL A 1 128 ? 0.114   -20.016 -25.028 1.00 0.00 ? 128 VAL A CG2  3  
ATOM 6387  H H    . VAL A 1 128 ? 0.876   -18.145 -22.264 1.00 0.00 ? 128 VAL A H    3  
ATOM 6388  H HA   . VAL A 1 128 ? -0.240  -17.317 -24.861 1.00 0.00 ? 128 VAL A HA   3  
ATOM 6389  H HB   . VAL A 1 128 ? -1.045  -19.756 -23.267 1.00 0.00 ? 128 VAL A HB   3  
ATOM 6390  H HG11 . VAL A 1 128 ? -2.956  -19.835 -24.406 1.00 0.00 ? 128 VAL A HG11 3  
ATOM 6391  H HG12 . VAL A 1 128 ? -2.622  -18.184 -24.931 1.00 0.00 ? 128 VAL A HG12 3  
ATOM 6392  H HG13 . VAL A 1 128 ? -2.131  -19.547 -25.938 1.00 0.00 ? 128 VAL A HG13 3  
ATOM 6393  H HG21 . VAL A 1 128 ? 0.181   -19.585 -26.016 1.00 0.00 ? 128 VAL A HG21 3  
ATOM 6394  H HG22 . VAL A 1 128 ? 1.079   -19.961 -24.545 1.00 0.00 ? 128 VAL A HG22 3  
ATOM 6395  H HG23 . VAL A 1 128 ? -0.191  -21.048 -25.105 1.00 0.00 ? 128 VAL A HG23 3  
ATOM 6396  N N    . ASP A 1 129 ? -2.144  -16.136 -23.805 1.00 0.00 ? 129 ASP A N    3  
ATOM 6397  C CA   . ASP A 1 129 ? -3.191  -15.343 -23.171 1.00 0.00 ? 129 ASP A CA   3  
ATOM 6398  C C    . ASP A 1 129 ? -4.573  -15.819 -23.609 1.00 0.00 ? 129 ASP A C    3  
ATOM 6399  O O    . ASP A 1 129 ? -4.773  -16.197 -24.763 1.00 0.00 ? 129 ASP A O    3  
ATOM 6400  C CB   . ASP A 1 129 ? -3.017  -13.863 -23.513 1.00 0.00 ? 129 ASP A CB   3  
ATOM 6401  C CG   . ASP A 1 129 ? -1.704  -13.301 -23.002 1.00 0.00 ? 129 ASP A CG   3  
ATOM 6402  O OD1  . ASP A 1 129 ? -0.674  -13.487 -23.684 1.00 0.00 ? 129 ASP A OD1  3  
ATOM 6403  O OD2  . ASP A 1 129 ? -1.706  -12.676 -21.922 1.00 0.00 ? 129 ASP A OD2  3  
ATOM 6404  H H    . ASP A 1 129 ? -1.932  -15.981 -24.749 1.00 0.00 ? 129 ASP A H    3  
ATOM 6405  H HA   . ASP A 1 129 ? -3.103  -15.469 -22.102 1.00 0.00 ? 129 ASP A HA   3  
ATOM 6406  H HB2  . ASP A 1 129 ? -3.045  -13.741 -24.586 1.00 0.00 ? 129 ASP A HB2  3  
ATOM 6407  H HB3  . ASP A 1 129 ? -3.824  -13.300 -23.069 1.00 0.00 ? 129 ASP A HB3  3  
ATOM 6408  N N    . ILE A 1 130 ? -5.521  -15.799 -22.679 1.00 0.00 ? 130 ILE A N    3  
ATOM 6409  C CA   . ILE A 1 130 ? -6.884  -16.228 -22.968 1.00 0.00 ? 130 ILE A CA   3  
ATOM 6410  C C    . ILE A 1 130 ? -7.479  -15.428 -24.122 1.00 0.00 ? 130 ILE A C    3  
ATOM 6411  O O    . ILE A 1 130 ? -8.071  -15.991 -25.042 1.00 0.00 ? 130 ILE A O    3  
ATOM 6412  C CB   . ILE A 1 130 ? -7.794  -16.084 -21.735 1.00 0.00 ? 130 ILE A CB   3  
ATOM 6413  C CG1  . ILE A 1 130 ? -7.249  -16.914 -20.571 1.00 0.00 ? 130 ILE A CG1  3  
ATOM 6414  C CG2  . ILE A 1 130 ? -9.216  -16.506 -22.073 1.00 0.00 ? 130 ILE A CG2  3  
ATOM 6415  C CD1  . ILE A 1 130 ? -7.671  -16.400 -19.212 1.00 0.00 ? 130 ILE A CD1  3  
ATOM 6416  H H    . ILE A 1 130 ? -5.300  -15.487 -21.776 1.00 0.00 ? 130 ILE A H    3  
ATOM 6417  H HA   . ILE A 1 130 ? -6.852  -17.272 -23.246 1.00 0.00 ? 130 ILE A HA   3  
ATOM 6418  H HB   . ILE A 1 130 ? -7.813  -15.043 -21.448 1.00 0.00 ? 130 ILE A HB   3  
ATOM 6419  H HG12 . ILE A 1 130 ? -7.601  -17.928 -20.665 1.00 0.00 ? 130 ILE A HG12 3  
ATOM 6420  H HG13 . ILE A 1 130 ? -6.169  -16.906 -20.609 1.00 0.00 ? 130 ILE A HG13 3  
ATOM 6421  H HG21 . ILE A 1 130 ? -9.336  -17.560 -21.870 1.00 0.00 ? 130 ILE A HG21 3  
ATOM 6422  H HG22 . ILE A 1 130 ? -9.912  -15.943 -21.469 1.00 0.00 ? 130 ILE A HG22 3  
ATOM 6423  H HG23 . ILE A 1 130 ? -9.409  -16.317 -23.118 1.00 0.00 ? 130 ILE A HG23 3  
ATOM 6424  H HD11 . ILE A 1 130 ? -6.834  -16.451 -18.532 1.00 0.00 ? 130 ILE A HD11 3  
ATOM 6425  H HD12 . ILE A 1 130 ? -8.001  -15.376 -19.300 1.00 0.00 ? 130 ILE A HD12 3  
ATOM 6426  H HD13 . ILE A 1 130 ? -8.480  -17.007 -18.833 1.00 0.00 ? 130 ILE A HD13 3  
ATOM 6427  N N    . GLY A 1 131 ? -7.317  -14.110 -24.066 1.00 0.00 ? 131 GLY A N    3  
ATOM 6428  C CA   . GLY A 1 131 ? -7.842  -13.252 -25.114 1.00 0.00 ? 131 GLY A CA   3  
ATOM 6429  C C    . GLY A 1 131 ? -8.605  -12.065 -24.563 1.00 0.00 ? 131 GLY A C    3  
ATOM 6430  O O    . GLY A 1 131 ? -9.767  -12.190 -24.175 1.00 0.00 ? 131 GLY A O    3  
ATOM 6431  H H    . GLY A 1 131 ? -6.836  -13.715 -23.308 1.00 0.00 ? 131 GLY A H    3  
ATOM 6432  H HA2  . GLY A 1 131 ? -7.020  -12.892 -25.714 1.00 0.00 ? 131 GLY A HA2  3  
ATOM 6433  H HA3  . GLY A 1 131 ? -8.504  -13.832 -25.739 1.00 0.00 ? 131 GLY A HA3  3  
ATOM 6434  N N    . VAL A 1 132 ? -7.951  -10.909 -24.525 1.00 0.00 ? 132 VAL A N    3  
ATOM 6435  C CA   . VAL A 1 132 ? -8.576  -9.693  -24.017 1.00 0.00 ? 132 VAL A CA   3  
ATOM 6436  C C    . VAL A 1 132 ? -8.194  -8.483  -24.862 1.00 0.00 ? 132 VAL A C    3  
ATOM 6437  O O    . VAL A 1 132 ? -7.019  -8.267  -25.160 1.00 0.00 ? 132 VAL A O    3  
ATOM 6438  C CB   . VAL A 1 132 ? -8.178  -9.429  -22.552 1.00 0.00 ? 132 VAL A CB   3  
ATOM 6439  C CG1  . VAL A 1 132 ? -6.664  -9.413  -22.404 1.00 0.00 ? 132 VAL A CG1  3  
ATOM 6440  C CG2  . VAL A 1 132 ? -8.784  -8.121  -22.063 1.00 0.00 ? 132 VAL A CG2  3  
ATOM 6441  H H    . VAL A 1 132 ? -7.027  -10.871 -24.848 1.00 0.00 ? 132 VAL A H    3  
ATOM 6442  H HA   . VAL A 1 132 ? -9.647  -9.825  -24.059 1.00 0.00 ? 132 VAL A HA   3  
ATOM 6443  H HB   . VAL A 1 132 ? -8.569  -10.231 -21.943 1.00 0.00 ? 132 VAL A HB   3  
ATOM 6444  H HG11 . VAL A 1 132 ? -6.407  -9.324  -21.358 1.00 0.00 ? 132 VAL A HG11 3  
ATOM 6445  H HG12 . VAL A 1 132 ? -6.254  -10.330 -22.800 1.00 0.00 ? 132 VAL A HG12 3  
ATOM 6446  H HG13 . VAL A 1 132 ? -6.259  -8.572  -22.947 1.00 0.00 ? 132 VAL A HG13 3  
ATOM 6447  H HG21 . VAL A 1 132 ? -8.857  -8.139  -20.986 1.00 0.00 ? 132 VAL A HG21 3  
ATOM 6448  H HG22 . VAL A 1 132 ? -8.155  -7.297  -22.369 1.00 0.00 ? 132 VAL A HG22 3  
ATOM 6449  H HG23 . VAL A 1 132 ? -9.768  -7.998  -22.491 1.00 0.00 ? 132 VAL A HG23 3  
ATOM 6450  N N    . LYS A 1 133 ? -9.193  -7.696  -25.245 1.00 0.00 ? 133 LYS A N    3  
ATOM 6451  C CA   . LYS A 1 133 ? -8.963  -6.507  -26.054 1.00 0.00 ? 133 LYS A CA   3  
ATOM 6452  C C    . LYS A 1 133 ? -8.573  -5.319  -25.180 1.00 0.00 ? 133 LYS A C    3  
ATOM 6453  O O    . LYS A 1 133 ? -9.193  -5.067  -24.146 1.00 0.00 ? 133 LYS A O    3  
ATOM 6454  C CB   . LYS A 1 133 ? -10.216 -6.165  -26.865 1.00 0.00 ? 133 LYS A CB   3  
ATOM 6455  C CG   . LYS A 1 133 ? -11.458 -5.975  -26.012 1.00 0.00 ? 133 LYS A CG   3  
ATOM 6456  C CD   . LYS A 1 133 ? -12.604 -5.387  -26.819 1.00 0.00 ? 133 LYS A CD   3  
ATOM 6457  C CE   . LYS A 1 133 ? -12.430 -3.890  -27.027 1.00 0.00 ? 133 LYS A CE   3  
ATOM 6458  N NZ   . LYS A 1 133 ? -13.490 -3.326  -27.908 1.00 0.00 ? 133 LYS A NZ   3  
ATOM 6459  H H    . LYS A 1 133 ? -10.108 -7.922  -24.975 1.00 0.00 ? 133 LYS A H    3  
ATOM 6460  H HA   . LYS A 1 133 ? -8.152  -6.719  -26.734 1.00 0.00 ? 133 LYS A HA   3  
ATOM 6461  H HB2  . LYS A 1 133 ? -10.038 -5.253  -27.414 1.00 0.00 ? 133 LYS A HB2  3  
ATOM 6462  H HB3  . LYS A 1 133 ? -10.406 -6.965  -27.566 1.00 0.00 ? 133 LYS A HB3  3  
ATOM 6463  H HG2  . LYS A 1 133 ? -11.764 -6.932  -25.618 1.00 0.00 ? 133 LYS A HG2  3  
ATOM 6464  H HG3  . LYS A 1 133 ? -11.225 -5.305  -25.197 1.00 0.00 ? 133 LYS A HG3  3  
ATOM 6465  H HD2  . LYS A 1 133 ? -12.639 -5.872  -27.784 1.00 0.00 ? 133 LYS A HD2  3  
ATOM 6466  H HD3  . LYS A 1 133 ? -13.531 -5.563  -26.292 1.00 0.00 ? 133 LYS A HD3  3  
ATOM 6467  H HE2  . LYS A 1 133 ? -12.472 -3.400  -26.067 1.00 0.00 ? 133 LYS A HE2  3  
ATOM 6468  H HE3  . LYS A 1 133 ? -11.465 -3.714  -27.480 1.00 0.00 ? 133 LYS A HE3  3  
ATOM 6469  H HZ1  . LYS A 1 133 ? -13.849 -2.436  -27.507 1.00 0.00 ? 133 LYS A HZ1  3  
ATOM 6470  H HZ2  . LYS A 1 133 ? -14.278 -3.997  -27.993 1.00 0.00 ? 133 LYS A HZ2  3  
ATOM 6471  H HZ3  . LYS A 1 133 ? -13.104 -3.136  -28.854 1.00 0.00 ? 133 LYS A HZ3  3  
ATOM 6472  N N    . TYR A 1 134 ? -7.542  -4.595  -25.599 1.00 0.00 ? 134 TYR A N    3  
ATOM 6473  C CA   . TYR A 1 134 ? -7.069  -3.435  -24.853 1.00 0.00 ? 134 TYR A CA   3  
ATOM 6474  C C    . TYR A 1 134 ? -7.557  -2.139  -25.493 1.00 0.00 ? 134 TYR A C    3  
ATOM 6475  O O    . TYR A 1 134 ? -6.937  -1.619  -26.421 1.00 0.00 ? 134 TYR A O    3  
ATOM 6476  C CB   . TYR A 1 134 ? -5.541  -3.437  -24.781 1.00 0.00 ? 134 TYR A CB   3  
ATOM 6477  C CG   . TYR A 1 134 ? -4.874  -3.804  -26.087 1.00 0.00 ? 134 TYR A CG   3  
ATOM 6478  C CD1  . TYR A 1 134 ? -4.735  -5.133  -26.470 1.00 0.00 ? 134 TYR A CD1  3  
ATOM 6479  C CD2  . TYR A 1 134 ? -4.383  -2.823  -26.939 1.00 0.00 ? 134 TYR A CD2  3  
ATOM 6480  C CE1  . TYR A 1 134 ? -4.125  -5.473  -27.662 1.00 0.00 ? 134 TYR A CE1  3  
ATOM 6481  C CE2  . TYR A 1 134 ? -3.774  -3.153  -28.134 1.00 0.00 ? 134 TYR A CE2  3  
ATOM 6482  C CZ   . TYR A 1 134 ? -3.647  -4.480  -28.490 1.00 0.00 ? 134 TYR A CZ   3  
ATOM 6483  O OH   . TYR A 1 134 ? -3.040  -4.814  -29.680 1.00 0.00 ? 134 TYR A OH   3  
ATOM 6484  H H    . TYR A 1 134 ? -7.087  -4.846  -26.430 1.00 0.00 ? 134 TYR A H    3  
ATOM 6485  H HA   . TYR A 1 134 ? -7.466  -3.500  -23.851 1.00 0.00 ? 134 TYR A HA   3  
ATOM 6486  H HB2  . TYR A 1 134 ? -5.199  -2.453  -24.500 1.00 0.00 ? 134 TYR A HB2  3  
ATOM 6487  H HB3  . TYR A 1 134 ? -5.224  -4.150  -24.034 1.00 0.00 ? 134 TYR A HB3  3  
ATOM 6488  H HD1  . TYR A 1 134 ? -5.111  -5.908  -25.819 1.00 0.00 ? 134 TYR A HD1  3  
ATOM 6489  H HD2  . TYR A 1 134 ? -4.484  -1.784  -26.657 1.00 0.00 ? 134 TYR A HD2  3  
ATOM 6490  H HE1  . TYR A 1 134 ? -4.027  -6.512  -27.942 1.00 0.00 ? 134 TYR A HE1  3  
ATOM 6491  H HE2  . TYR A 1 134 ? -3.398  -2.376  -28.784 1.00 0.00 ? 134 TYR A HE2  3  
ATOM 6492  H HH   . TYR A 1 134 ? -2.132  -5.076  -29.513 1.00 0.00 ? 134 TYR A HH   3  
ATOM 6493  N N    . SER A 1 135 ? -8.672  -1.621  -24.988 1.00 0.00 ? 135 SER A N    3  
ATOM 6494  C CA   . SER A 1 135 ? -9.247  -0.387  -25.511 1.00 0.00 ? 135 SER A CA   3  
ATOM 6495  C C    . SER A 1 135 ? -9.176  0.728   -24.473 1.00 0.00 ? 135 SER A C    3  
ATOM 6496  O O    . SER A 1 135 ? -9.977  0.772   -23.539 1.00 0.00 ? 135 SER A O    3  
ATOM 6497  C CB   . SER A 1 135 ? -10.700 -0.615  -25.933 1.00 0.00 ? 135 SER A CB   3  
ATOM 6498  O OG   . SER A 1 135 ? -11.119 0.366   -26.867 1.00 0.00 ? 135 SER A OG   3  
ATOM 6499  H H    . SER A 1 135 ? -9.120  -2.081  -24.248 1.00 0.00 ? 135 SER A H    3  
ATOM 6500  H HA   . SER A 1 135 ? -8.672  -0.094  -26.376 1.00 0.00 ? 135 SER A HA   3  
ATOM 6501  H HB2  . SER A 1 135 ? -10.792 -1.590  -26.388 1.00 0.00 ? 135 SER A HB2  3  
ATOM 6502  H HB3  . SER A 1 135 ? -11.337 -0.562  -25.063 1.00 0.00 ? 135 SER A HB3  3  
ATOM 6503  H HG   . SER A 1 135 ? -12.078 0.419   -26.866 1.00 0.00 ? 135 SER A HG   3  
ATOM 6504  N N    . GLU A 1 136 ? -8.213  1.628   -24.643 1.00 0.00 ? 136 GLU A N    3  
ATOM 6505  C CA   . GLU A 1 136 ? -8.036  2.742   -23.720 1.00 0.00 ? 136 GLU A CA   3  
ATOM 6506  C C    . GLU A 1 136 ? -9.164  3.758   -23.873 1.00 0.00 ? 136 GLU A C    3  
ATOM 6507  O O    . GLU A 1 136 ? -9.455  4.221   -24.976 1.00 0.00 ? 136 GLU A O    3  
ATOM 6508  C CB   . GLU A 1 136 ? -6.687  3.423   -23.959 1.00 0.00 ? 136 GLU A CB   3  
ATOM 6509  C CG   . GLU A 1 136 ? -5.529  2.745   -23.247 1.00 0.00 ? 136 GLU A CG   3  
ATOM 6510  C CD   . GLU A 1 136 ? -4.192  3.030   -23.904 1.00 0.00 ? 136 GLU A CD   3  
ATOM 6511  O OE1  . GLU A 1 136 ? -3.928  2.462   -24.984 1.00 0.00 ? 136 GLU A OE1  3  
ATOM 6512  O OE2  . GLU A 1 136 ? -3.410  3.823   -23.337 1.00 0.00 ? 136 GLU A OE2  3  
ATOM 6513  H H    . GLU A 1 136 ? -7.605  1.539   -25.408 1.00 0.00 ? 136 GLU A H    3  
ATOM 6514  H HA   . GLU A 1 136 ? -8.057  2.348   -22.715 1.00 0.00 ? 136 GLU A HA   3  
ATOM 6515  H HB2  . GLU A 1 136 ? -6.480  3.425   -25.019 1.00 0.00 ? 136 GLU A HB2  3  
ATOM 6516  H HB3  . GLU A 1 136 ? -6.747  4.444   -23.612 1.00 0.00 ? 136 GLU A HB3  3  
ATOM 6517  H HG2  . GLU A 1 136 ? -5.493  3.097   -22.227 1.00 0.00 ? 136 GLU A HG2  3  
ATOM 6518  H HG3  . GLU A 1 136 ? -5.695  1.678   -23.252 1.00 0.00 ? 136 GLU A HG3  3  
ATOM 6519  N N    . LYS A 1 137 ? -9.799  4.102   -22.756 1.00 0.00 ? 137 LYS A N    3  
ATOM 6520  C CA   . LYS A 1 137 ? -10.895 5.063   -22.763 1.00 0.00 ? 137 LYS A CA   3  
ATOM 6521  C C    . LYS A 1 137 ? -10.374 6.483   -22.563 1.00 0.00 ? 137 LYS A C    3  
ATOM 6522  O O    . LYS A 1 137 ? -10.205 6.936   -21.431 1.00 0.00 ? 137 LYS A O    3  
ATOM 6523  C CB   . LYS A 1 137 ? -11.908 4.720   -21.669 1.00 0.00 ? 137 LYS A CB   3  
ATOM 6524  C CG   . LYS A 1 137 ? -12.993 3.759   -22.124 1.00 0.00 ? 137 LYS A CG   3  
ATOM 6525  C CD   . LYS A 1 137 ? -12.567 2.312   -21.943 1.00 0.00 ? 137 LYS A CD   3  
ATOM 6526  C CE   . LYS A 1 137 ? -13.625 1.350   -22.461 1.00 0.00 ? 137 LYS A CE   3  
ATOM 6527  N NZ   . LYS A 1 137 ? -13.198 -0.070  -22.329 1.00 0.00 ? 137 LYS A NZ   3  
ATOM 6528  H H    . LYS A 1 137 ? -9.521  3.699   -21.907 1.00 0.00 ? 137 LYS A H    3  
ATOM 6529  H HA   . LYS A 1 137 ? -11.382 5.004   -23.725 1.00 0.00 ? 137 LYS A HA   3  
ATOM 6530  H HB2  . LYS A 1 137 ? -11.384 4.272   -20.838 1.00 0.00 ? 137 LYS A HB2  3  
ATOM 6531  H HB3  . LYS A 1 137 ? -12.382 5.632   -21.335 1.00 0.00 ? 137 LYS A HB3  3  
ATOM 6532  H HG2  . LYS A 1 137 ? -13.885 3.936   -21.542 1.00 0.00 ? 137 LYS A HG2  3  
ATOM 6533  H HG3  . LYS A 1 137 ? -13.201 3.935   -23.170 1.00 0.00 ? 137 LYS A HG3  3  
ATOM 6534  H HD2  . LYS A 1 137 ? -11.649 2.145   -22.485 1.00 0.00 ? 137 LYS A HD2  3  
ATOM 6535  H HD3  . LYS A 1 137 ? -12.405 2.121   -20.891 1.00 0.00 ? 137 LYS A HD3  3  
ATOM 6536  H HE2  . LYS A 1 137 ? -14.534 1.498   -21.899 1.00 0.00 ? 137 LYS A HE2  3  
ATOM 6537  H HE3  . LYS A 1 137 ? -13.809 1.566   -23.504 1.00 0.00 ? 137 LYS A HE3  3  
ATOM 6538  H HZ1  . LYS A 1 137 ? -12.408 -0.267  -22.977 1.00 0.00 ? 137 LYS A HZ1  3  
ATOM 6539  H HZ2  . LYS A 1 137 ? -13.988 -0.704  -22.561 1.00 0.00 ? 137 LYS A HZ2  3  
ATOM 6540  H HZ3  . LYS A 1 137 ? -12.889 -0.260  -21.354 1.00 0.00 ? 137 LYS A HZ3  3  
ATOM 6541  N N    . GLN A 1 138 ? -10.125 7.179   -23.667 1.00 0.00 ? 138 GLN A N    3  
ATOM 6542  C CA   . GLN A 1 138 ? -9.625  8.547   -23.611 1.00 0.00 ? 138 GLN A CA   3  
ATOM 6543  C C    . GLN A 1 138 ? -10.733 9.544   -23.935 1.00 0.00 ? 138 GLN A C    3  
ATOM 6544  O O    . GLN A 1 138 ? -11.291 9.531   -25.032 1.00 0.00 ? 138 GLN A O    3  
ATOM 6545  C CB   . GLN A 1 138 ? -8.459  8.727   -24.584 1.00 0.00 ? 138 GLN A CB   3  
ATOM 6546  C CG   . GLN A 1 138 ? -8.867  8.641   -26.046 1.00 0.00 ? 138 GLN A CG   3  
ATOM 6547  C CD   . GLN A 1 138 ? -7.717  8.249   -26.952 1.00 0.00 ? 138 GLN A CD   3  
ATOM 6548  O OE1  . GLN A 1 138 ? -6.557  8.550   -26.667 1.00 0.00 ? 138 GLN A OE1  3  
ATOM 6549  N NE2  . GLN A 1 138 ? -8.032  7.574   -28.051 1.00 0.00 ? 138 GLN A NE2  3  
ATOM 6550  H H    . GLN A 1 138 ? -10.280 6.761   -24.540 1.00 0.00 ? 138 GLN A H    3  
ATOM 6551  H HA   . GLN A 1 138 ? -9.276  8.731   -22.606 1.00 0.00 ? 138 GLN A HA   3  
ATOM 6552  H HB2  . GLN A 1 138 ? -8.010  9.694   -24.415 1.00 0.00 ? 138 GLN A HB2  3  
ATOM 6553  H HB3  . GLN A 1 138 ? -7.724  7.960   -24.393 1.00 0.00 ? 138 GLN A HB3  3  
ATOM 6554  H HG2  . GLN A 1 138 ? -9.651  7.903   -26.145 1.00 0.00 ? 138 GLN A HG2  3  
ATOM 6555  H HG3  . GLN A 1 138 ? -9.242  9.604   -26.359 1.00 0.00 ? 138 GLN A HG3  3  
ATOM 6556  H HE21 . GLN A 1 138 ? -8.978  7.371   -28.215 1.00 0.00 ? 138 GLN A HE21 3  
ATOM 6557  H HE22 . GLN A 1 138 ? -7.308  7.309   -28.655 1.00 0.00 ? 138 GLN A HE22 3  
ATOM 6558  N N    . GLU A 1 139 ? -11.045 10.408  -22.974 1.00 0.00 ? 139 GLU A N    3  
ATOM 6559  C CA   . GLU A 1 139 ? -12.086 11.412  -23.158 1.00 0.00 ? 139 GLU A CA   3  
ATOM 6560  C C    . GLU A 1 139 ? -12.099 12.402  -21.997 1.00 0.00 ? 139 GLU A C    3  
ATOM 6561  O O    . GLU A 1 139 ? -11.727 12.063  -20.874 1.00 0.00 ? 139 GLU A O    3  
ATOM 6562  C CB   . GLU A 1 139 ? -13.456 10.741  -23.285 1.00 0.00 ? 139 GLU A CB   3  
ATOM 6563  C CG   . GLU A 1 139 ? -14.567 11.696  -23.688 1.00 0.00 ? 139 GLU A CG   3  
ATOM 6564  C CD   . GLU A 1 139 ? -15.939 11.054  -23.626 1.00 0.00 ? 139 GLU A CD   3  
ATOM 6565  O OE1  . GLU A 1 139 ? -16.110 9.963   -24.209 1.00 0.00 ? 139 GLU A OE1  3  
ATOM 6566  O OE2  . GLU A 1 139 ? -16.841 11.641  -22.994 1.00 0.00 ? 139 GLU A OE2  3  
ATOM 6567  H H    . GLU A 1 139 ? -10.564 10.369  -22.121 1.00 0.00 ? 139 GLU A H    3  
ATOM 6568  H HA   . GLU A 1 139 ? -11.873 11.947  -24.070 1.00 0.00 ? 139 GLU A HA   3  
ATOM 6569  H HB2  . GLU A 1 139 ? -13.393 9.959   -24.028 1.00 0.00 ? 139 GLU A HB2  3  
ATOM 6570  H HB3  . GLU A 1 139 ? -13.716 10.300  -22.334 1.00 0.00 ? 139 GLU A HB3  3  
ATOM 6571  H HG2  . GLU A 1 139 ? -14.553 12.545  -23.022 1.00 0.00 ? 139 GLU A HG2  3  
ATOM 6572  H HG3  . GLU A 1 139 ? -14.387 12.029  -24.699 1.00 0.00 ? 139 GLU A HG3  3  
ATOM 6573  N N    . ARG A 1 140 ? -12.530 13.628  -22.277 1.00 0.00 ? 140 ARG A N    3  
ATOM 6574  C CA   . ARG A 1 140 ? -12.590 14.668  -21.257 1.00 0.00 ? 140 ARG A CA   3  
ATOM 6575  C C    . ARG A 1 140 ? -13.982 14.741  -20.637 1.00 0.00 ? 140 ARG A C    3  
ATOM 6576  O O    . ARG A 1 140 ? -14.905 14.054  -21.074 1.00 0.00 ? 140 ARG A O    3  
ATOM 6577  C CB   . ARG A 1 140 ? -12.217 16.024  -21.861 1.00 0.00 ? 140 ARG A CB   3  
ATOM 6578  C CG   . ARG A 1 140 ? -13.294 16.609  -22.760 1.00 0.00 ? 140 ARG A CG   3  
ATOM 6579  C CD   . ARG A 1 140 ? -12.697 17.497  -23.840 1.00 0.00 ? 140 ARG A CD   3  
ATOM 6580  N NE   . ARG A 1 140 ? -13.715 18.010  -24.752 1.00 0.00 ? 140 ARG A NE   3  
ATOM 6581  C CZ   . ARG A 1 140 ? -13.555 19.101  -25.493 1.00 0.00 ? 140 ARG A CZ   3  
ATOM 6582  N NH1  . ARG A 1 140 ? -12.424 19.789  -25.429 1.00 0.00 ? 140 ARG A NH1  3  
ATOM 6583  N NH2  . ARG A 1 140 ? -14.528 19.506  -26.298 1.00 0.00 ? 140 ARG A NH2  3  
ATOM 6584  H H    . ARG A 1 140 ? -12.815 13.837  -23.192 1.00 0.00 ? 140 ARG A H    3  
ATOM 6585  H HA   . ARG A 1 140 ? -11.877 14.418  -20.487 1.00 0.00 ? 140 ARG A HA   3  
ATOM 6586  H HB2  . ARG A 1 140 ? -12.031 16.723  -21.058 1.00 0.00 ? 140 ARG A HB2  3  
ATOM 6587  H HB3  . ARG A 1 140 ? -11.315 15.909  -22.443 1.00 0.00 ? 140 ARG A HB3  3  
ATOM 6588  H HG2  . ARG A 1 140 ? -13.833 15.800  -23.232 1.00 0.00 ? 140 ARG A HG2  3  
ATOM 6589  H HG3  . ARG A 1 140 ? -13.973 17.194  -22.158 1.00 0.00 ? 140 ARG A HG3  3  
ATOM 6590  H HD2  . ARG A 1 140 ? -12.197 18.329  -23.367 1.00 0.00 ? 140 ARG A HD2  3  
ATOM 6591  H HD3  . ARG A 1 140 ? -11.978 16.920  -24.404 1.00 0.00 ? 140 ARG A HD3  3  
ATOM 6592  H HE   . ARG A 1 140 ? -14.558 17.517  -24.813 1.00 0.00 ? 140 ARG A HE   3  
ATOM 6593  H HH11 . ARG A 1 140 ? -11.688 19.487  -24.824 1.00 0.00 ? 140 ARG A HH11 3  
ATOM 6594  H HH12 . ARG A 1 140 ? -12.306 20.611  -25.988 1.00 0.00 ? 140 ARG A HH12 3  
ATOM 6595  H HH21 . ARG A 1 140 ? -15.382 18.989  -26.349 1.00 0.00 ? 140 ARG A HH21 3  
ATOM 6596  H HH22 . ARG A 1 140 ? -14.407 20.327  -26.855 1.00 0.00 ? 140 ARG A HH22 3  
ATOM 6597  N N    . SER A 1 141 ? -14.125 15.581  -19.616 1.00 0.00 ? 141 SER A N    3  
ATOM 6598  C CA   . SER A 1 141 ? -15.404 15.740  -18.932 1.00 0.00 ? 141 SER A CA   3  
ATOM 6599  C C    . SER A 1 141 ? -15.849 17.199  -18.946 1.00 0.00 ? 141 SER A C    3  
ATOM 6600  O O    . SER A 1 141 ? -16.979 17.512  -19.315 1.00 0.00 ? 141 SER A O    3  
ATOM 6601  C CB   . SER A 1 141 ? -15.300 15.241  -17.489 1.00 0.00 ? 141 SER A CB   3  
ATOM 6602  O OG   . SER A 1 141 ? -16.576 15.187  -16.875 1.00 0.00 ? 141 SER A OG   3  
ATOM 6603  H H    . SER A 1 141 ? -13.353 16.101  -19.313 1.00 0.00 ? 141 SER A H    3  
ATOM 6604  H HA   . SER A 1 141 ? -16.138 15.147  -19.457 1.00 0.00 ? 141 SER A HA   3  
ATOM 6605  H HB2  . SER A 1 141 ? -14.869 14.251  -17.483 1.00 0.00 ? 141 SER A HB2  3  
ATOM 6606  H HB3  . SER A 1 141 ? -14.669 15.912  -16.924 1.00 0.00 ? 141 SER A HB3  3  
ATOM 6607  H HG   . SER A 1 141 ? -16.480 14.914  -15.960 1.00 0.00 ? 141 SER A HG   3  
ATOM 6608  N N    . GLY A 1 142 ? -14.948 18.091  -18.540 1.00 0.00 ? 142 GLY A N    3  
ATOM 6609  C CA   . GLY A 1 142 ? -15.265 19.506  -18.514 1.00 0.00 ? 142 GLY A CA   3  
ATOM 6610  C C    . GLY A 1 142 ? -14.181 20.356  -19.147 1.00 0.00 ? 142 GLY A C    3  
ATOM 6611  O O    . GLY A 1 142 ? -12.992 20.043  -19.068 1.00 0.00 ? 142 GLY A O    3  
ATOM 6612  H H    . GLY A 1 142 ? -14.062 17.784  -18.257 1.00 0.00 ? 142 GLY A H    3  
ATOM 6613  H HA2  . GLY A 1 142 ? -16.190 19.667  -19.047 1.00 0.00 ? 142 GLY A HA2  3  
ATOM 6614  H HA3  . GLY A 1 142 ? -15.394 19.815  -17.487 1.00 0.00 ? 142 GLY A HA3  3  
ATOM 6615  N N    . PRO A 1 143 ? -14.589 21.456  -19.795 1.00 0.00 ? 143 PRO A N    3  
ATOM 6616  C CA   . PRO A 1 143 ? -13.659 22.376  -20.458 1.00 0.00 ? 143 PRO A CA   3  
ATOM 6617  C C    . PRO A 1 143 ? -12.808 23.157  -19.463 1.00 0.00 ? 143 PRO A C    3  
ATOM 6618  O O    . PRO A 1 143 ? -11.936 23.933  -19.852 1.00 0.00 ? 143 PRO A O    3  
ATOM 6619  C CB   . PRO A 1 143 ? -14.583 23.321  -21.229 1.00 0.00 ? 143 PRO A CB   3  
ATOM 6620  C CG   . PRO A 1 143 ? -15.871 23.284  -20.482 1.00 0.00 ? 143 PRO A CG   3  
ATOM 6621  C CD   . PRO A 1 143 ? -15.989 21.891  -19.929 1.00 0.00 ? 143 PRO A CD   3  
ATOM 6622  H HA   . PRO A 1 143 ? -13.013 21.855  -21.151 1.00 0.00 ? 143 PRO A HA   3  
ATOM 6623  H HB2  . PRO A 1 143 ? -14.159 24.315  -21.238 1.00 0.00 ? 143 PRO A HB2  3  
ATOM 6624  H HB3  . PRO A 1 143 ? -14.703 22.965  -22.241 1.00 0.00 ? 143 PRO A HB3  3  
ATOM 6625  H HG2  . PRO A 1 143 ? -15.852 24.005  -19.680 1.00 0.00 ? 143 PRO A HG2  3  
ATOM 6626  H HG3  . PRO A 1 143 ? -16.691 23.490  -21.154 1.00 0.00 ? 143 PRO A HG3  3  
ATOM 6627  H HD2  . PRO A 1 143 ? -16.482 21.906  -18.969 1.00 0.00 ? 143 PRO A HD2  3  
ATOM 6628  H HD3  . PRO A 1 143 ? -16.524 21.255  -20.619 1.00 0.00 ? 143 PRO A HD3  3  
ATOM 6629  N N    . SER A 1 144 ? -13.066 22.946  -18.176 1.00 0.00 ? 144 SER A N    3  
ATOM 6630  C CA   . SER A 1 144 ? -12.325 23.634  -17.125 1.00 0.00 ? 144 SER A CA   3  
ATOM 6631  C C    . SER A 1 144 ? -11.458 22.653  -16.341 1.00 0.00 ? 144 SER A C    3  
ATOM 6632  O O    . SER A 1 144 ? -11.953 21.664  -15.801 1.00 0.00 ? 144 SER A O    3  
ATOM 6633  C CB   . SER A 1 144 ? -13.290 24.350  -16.178 1.00 0.00 ? 144 SER A CB   3  
ATOM 6634  O OG   . SER A 1 144 ? -12.590 25.193  -15.279 1.00 0.00 ? 144 SER A OG   3  
ATOM 6635  H H    . SER A 1 144 ? -13.774 22.314  -17.928 1.00 0.00 ? 144 SER A H    3  
ATOM 6636  H HA   . SER A 1 144 ? -11.686 24.365  -17.594 1.00 0.00 ? 144 SER A HA   3  
ATOM 6637  H HB2  . SER A 1 144 ? -13.977 24.950  -16.753 1.00 0.00 ? 144 SER A HB2  3  
ATOM 6638  H HB3  . SER A 1 144 ? -13.842 23.616  -15.608 1.00 0.00 ? 144 SER A HB3  3  
ATOM 6639  H HG   . SER A 1 144 ? -12.170 25.904  -15.769 1.00 0.00 ? 144 SER A HG   3  
ATOM 6640  N N    . SER A 1 145 ? -10.161 22.935  -16.283 1.00 0.00 ? 145 SER A N    3  
ATOM 6641  C CA   . SER A 1 145 ? -9.223  22.078  -15.569 1.00 0.00 ? 145 SER A CA   3  
ATOM 6642  C C    . SER A 1 145 ? -9.007  22.577  -14.144 1.00 0.00 ? 145 SER A C    3  
ATOM 6643  O O    . SER A 1 145 ? -9.223  21.845  -13.178 1.00 0.00 ? 145 SER A O    3  
ATOM 6644  C CB   . SER A 1 145 ? -7.885  22.021  -16.309 1.00 0.00 ? 145 SER A CB   3  
ATOM 6645  O OG   . SER A 1 145 ? -6.917  21.306  -15.561 1.00 0.00 ? 145 SER A OG   3  
ATOM 6646  H H    . SER A 1 145 ? -9.826  23.739  -16.734 1.00 0.00 ? 145 SER A H    3  
ATOM 6647  H HA   . SER A 1 145 ? -9.645  21.085  -15.530 1.00 0.00 ? 145 SER A HA   3  
ATOM 6648  H HB2  . SER A 1 145 ? -8.024  21.527  -17.260 1.00 0.00 ? 145 SER A HB2  3  
ATOM 6649  H HB3  . SER A 1 145 ? -7.525  23.026  -16.474 1.00 0.00 ? 145 SER A HB3  3  
ATOM 6650  H HG   . SER A 1 145 ? -6.652  20.522  -16.045 1.00 0.00 ? 145 SER A HG   3  
ATOM 6651  N N    . GLY A 1 146 ? -8.578  23.830  -14.021 1.00 0.00 ? 146 GLY A N    3  
ATOM 6652  C CA   . GLY A 1 146 ? -8.341  24.407  -12.710 1.00 0.00 ? 146 GLY A CA   3  
ATOM 6653  C C    . GLY A 1 146 ? -7.195  25.400  -12.714 1.00 0.00 ? 146 GLY A C    3  
ATOM 6654  O O    . GLY A 1 146 ? -7.396  26.591  -12.477 1.00 0.00 ? 146 GLY A O    3  
ATOM 6655  H H    . GLY A 1 146 ? -8.424  24.367  -14.826 1.00 0.00 ? 146 GLY A H    3  
ATOM 6656  H HA2  . GLY A 1 146 ? -9.238  24.910  -12.382 1.00 0.00 ? 146 GLY A HA2  3  
ATOM 6657  H HA3  . GLY A 1 146 ? -8.110  23.612  -12.016 1.00 0.00 ? 146 GLY A HA3  3  
ATOM 6658  N N    . GLY A 1 1   ? 10.567  -12.686 -24.527 1.00 0.00 ? 1   GLY A N    4  
ATOM 6659  C CA   . GLY A 1 1   ? 9.958   -12.126 -23.335 1.00 0.00 ? 1   GLY A CA   4  
ATOM 6660  C C    . GLY A 1 1   ? 8.555   -12.651 -23.099 1.00 0.00 ? 1   GLY A C    4  
ATOM 6661  O O    . GLY A 1 1   ? 7.737   -12.686 -24.017 1.00 0.00 ? 1   GLY A O    4  
ATOM 6662  H H1   . GLY A 1 1   ? 11.526  -12.886 -24.537 1.00 0.00 ? 1   GLY A H1   4  
ATOM 6663  H HA2  . GLY A 1 1   ? 10.572  -12.372 -22.481 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 6664  H HA3  . GLY A 1 1   ? 9.915   -11.052 -23.437 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 6665  N N    . SER A 1 2   ? 8.278   -13.060 -21.866 1.00 0.00 ? 2   SER A N    4  
ATOM 6666  C CA   . SER A 1 2   ? 6.966   -13.592 -21.514 1.00 0.00 ? 2   SER A CA   4  
ATOM 6667  C C    . SER A 1 2   ? 6.554   -13.138 -20.116 1.00 0.00 ? 2   SER A C    4  
ATOM 6668  O O    . SER A 1 2   ? 7.241   -13.416 -19.134 1.00 0.00 ? 2   SER A O    4  
ATOM 6669  C CB   . SER A 1 2   ? 6.975   -15.120 -21.585 1.00 0.00 ? 2   SER A CB   4  
ATOM 6670  O OG   . SER A 1 2   ? 6.844   -15.569 -22.923 1.00 0.00 ? 2   SER A OG   4  
ATOM 6671  H H    . SER A 1 2   ? 8.973   -13.007 -21.177 1.00 0.00 ? 2   SER A H    4  
ATOM 6672  H HA   . SER A 1 2   ? 6.252   -13.211 -22.228 1.00 0.00 ? 2   SER A HA   4  
ATOM 6673  H HB2  . SER A 1 2   ? 7.905   -15.491 -21.183 1.00 0.00 ? 2   SER A HB2  4  
ATOM 6674  H HB3  . SER A 1 2   ? 6.150   -15.509 -21.004 1.00 0.00 ? 2   SER A HB3  4  
ATOM 6675  H HG   . SER A 1 2   ? 7.591   -15.258 -23.439 1.00 0.00 ? 2   SER A HG   4  
ATOM 6676  N N    . SER A 1 3   ? 5.426   -12.439 -20.036 1.00 0.00 ? 3   SER A N    4  
ATOM 6677  C CA   . SER A 1 3   ? 4.923   -11.943 -18.762 1.00 0.00 ? 3   SER A CA   4  
ATOM 6678  C C    . SER A 1 3   ? 3.509   -12.452 -18.500 1.00 0.00 ? 3   SER A C    4  
ATOM 6679  O O    . SER A 1 3   ? 2.599   -12.228 -19.296 1.00 0.00 ? 3   SER A O    4  
ATOM 6680  C CB   . SER A 1 3   ? 4.936   -10.413 -18.744 1.00 0.00 ? 3   SER A CB   4  
ATOM 6681  O OG   . SER A 1 3   ? 4.969   -9.918  -17.416 1.00 0.00 ? 3   SER A OG   4  
ATOM 6682  H H    . SER A 1 3   ? 4.923   -12.250 -20.856 1.00 0.00 ? 3   SER A H    4  
ATOM 6683  H HA   . SER A 1 3   ? 5.576   -12.309 -17.983 1.00 0.00 ? 3   SER A HA   4  
ATOM 6684  H HB2  . SER A 1 3   ? 5.810   -10.057 -19.269 1.00 0.00 ? 3   SER A HB2  4  
ATOM 6685  H HB3  . SER A 1 3   ? 4.047   -10.043 -19.232 1.00 0.00 ? 3   SER A HB3  4  
ATOM 6686  H HG   . SER A 1 3   ? 5.339   -10.587 -16.834 1.00 0.00 ? 3   SER A HG   4  
ATOM 6687  N N    . GLY A 1 4   ? 3.334   -13.142 -17.377 1.00 0.00 ? 4   GLY A N    4  
ATOM 6688  C CA   . GLY A 1 4   ? 2.029   -13.674 -17.028 1.00 0.00 ? 4   GLY A CA   4  
ATOM 6689  C C    . GLY A 1 4   ? 1.763   -13.628 -15.537 1.00 0.00 ? 4   GLY A C    4  
ATOM 6690  O O    . GLY A 1 4   ? 2.694   -13.629 -14.733 1.00 0.00 ? 4   GLY A O    4  
ATOM 6691  H H    . GLY A 1 4   ? 4.096   -13.290 -16.779 1.00 0.00 ? 4   GLY A H    4  
ATOM 6692  H HA2  . GLY A 1 4   ? 1.270   -13.099 -17.537 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 6693  H HA3  . GLY A 1 4   ? 1.972   -14.700 -17.361 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 6694  N N    . SER A 1 5   ? 0.487   -13.584 -15.167 1.00 0.00 ? 5   SER A N    4  
ATOM 6695  C CA   . SER A 1 5   ? 0.100   -13.531 -13.762 1.00 0.00 ? 5   SER A CA   4  
ATOM 6696  C C    . SER A 1 5   ? 0.189   -14.913 -13.121 1.00 0.00 ? 5   SER A C    4  
ATOM 6697  O O    . SER A 1 5   ? -0.522  -15.838 -13.515 1.00 0.00 ? 5   SER A O    4  
ATOM 6698  C CB   . SER A 1 5   ? -1.320  -12.981 -13.621 1.00 0.00 ? 5   SER A CB   4  
ATOM 6699  O OG   . SER A 1 5   ? -1.396  -11.642 -14.079 1.00 0.00 ? 5   SER A OG   4  
ATOM 6700  H H    . SER A 1 5   ? -0.211  -13.585 -15.855 1.00 0.00 ? 5   SER A H    4  
ATOM 6701  H HA   . SER A 1 5   ? 0.785   -12.869 -13.254 1.00 0.00 ? 5   SER A HA   4  
ATOM 6702  H HB2  . SER A 1 5   ? -1.997  -13.587 -14.205 1.00 0.00 ? 5   SER A HB2  4  
ATOM 6703  H HB3  . SER A 1 5   ? -1.615  -13.012 -12.582 1.00 0.00 ? 5   SER A HB3  4  
ATOM 6704  H HG   . SER A 1 5   ? -0.520  -11.251 -14.072 1.00 0.00 ? 5   SER A HG   4  
ATOM 6705  N N    . SER A 1 6   ? 1.066   -15.045 -12.132 1.00 0.00 ? 6   SER A N    4  
ATOM 6706  C CA   . SER A 1 6   ? 1.251   -16.315 -11.439 1.00 0.00 ? 6   SER A CA   4  
ATOM 6707  C C    . SER A 1 6   ? 1.086   -16.140 -9.932  1.00 0.00 ? 6   SER A C    4  
ATOM 6708  O O    . SER A 1 6   ? 1.035   -15.019 -9.428  1.00 0.00 ? 6   SER A O    4  
ATOM 6709  C CB   . SER A 1 6   ? 2.634   -16.893 -11.748 1.00 0.00 ? 6   SER A CB   4  
ATOM 6710  O OG   . SER A 1 6   ? 2.629   -17.595 -12.978 1.00 0.00 ? 6   SER A OG   4  
ATOM 6711  H H    . SER A 1 6   ? 1.604   -14.271 -11.864 1.00 0.00 ? 6   SER A H    4  
ATOM 6712  H HA   . SER A 1 6   ? 0.497   -17.000 -11.795 1.00 0.00 ? 6   SER A HA   4  
ATOM 6713  H HB2  . SER A 1 6   ? 3.351   -16.089 -11.809 1.00 0.00 ? 6   SER A HB2  4  
ATOM 6714  H HB3  . SER A 1 6   ? 2.921   -17.573 -10.960 1.00 0.00 ? 6   SER A HB3  4  
ATOM 6715  H HG   . SER A 1 6   ? 2.245   -18.466 -12.849 1.00 0.00 ? 6   SER A HG   4  
ATOM 6716  N N    . GLY A 1 7   ? 1.004   -17.259 -9.219  1.00 0.00 ? 7   GLY A N    4  
ATOM 6717  C CA   . GLY A 1 7   ? 0.845   -17.210 -7.776  1.00 0.00 ? 7   GLY A CA   4  
ATOM 6718  C C    . GLY A 1 7   ? -0.600  -17.034 -7.358  1.00 0.00 ? 7   GLY A C    4  
ATOM 6719  O O    . GLY A 1 7   ? -1.127  -15.922 -7.370  1.00 0.00 ? 7   GLY A O    4  
ATOM 6720  H H    . GLY A 1 7   ? 1.050   -18.126 -9.675  1.00 0.00 ? 7   GLY A H    4  
ATOM 6721  H HA2  . GLY A 1 7   ? 1.223   -18.127 -7.352  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 6722  H HA3  . GLY A 1 7   ? 1.422   -16.382 -7.391  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 6723  N N    . ASN A 1 8   ? -1.247  -18.135 -6.989  1.00 0.00 ? 8   ASN A N    4  
ATOM 6724  C CA   . ASN A 1 8   ? -2.643  -18.098 -6.567  1.00 0.00 ? 8   ASN A CA   4  
ATOM 6725  C C    . ASN A 1 8   ? -2.826  -18.815 -5.233  1.00 0.00 ? 8   ASN A C    4  
ATOM 6726  O O    . ASN A 1 8   ? -3.139  -20.005 -5.193  1.00 0.00 ? 8   ASN A O    4  
ATOM 6727  C CB   . ASN A 1 8   ? -3.535  -18.740 -7.630  1.00 0.00 ? 8   ASN A CB   4  
ATOM 6728  C CG   . ASN A 1 8   ? -2.882  -19.940 -8.288  1.00 0.00 ? 8   ASN A CG   4  
ATOM 6729  O OD1  . ASN A 1 8   ? -3.153  -21.084 -7.927  1.00 0.00 ? 8   ASN A OD1  4  
ATOM 6730  N ND2  . ASN A 1 8   ? -2.013  -19.681 -9.259  1.00 0.00 ? 8   ASN A ND2  4  
ATOM 6731  H H    . ASN A 1 8   ? -0.774  -18.993 -6.999  1.00 0.00 ? 8   ASN A H    4  
ATOM 6732  H HA   . ASN A 1 8   ? -2.925  -17.063 -6.448  1.00 0.00 ? 8   ASN A HA   4  
ATOM 6733  H HB2  . ASN A 1 8   ? -4.457  -19.064 -7.170  1.00 0.00 ? 8   ASN A HB2  4  
ATOM 6734  H HB3  . ASN A 1 8   ? -3.757  -18.009 -8.394  1.00 0.00 ? 8   ASN A HB3  4  
ATOM 6735  H HD21 . ASN A 1 8   ? -1.845  -18.744 -9.493  1.00 0.00 ? 8   ASN A HD21 4  
ATOM 6736  H HD22 . ASN A 1 8   ? -1.576  -20.438 -9.701  1.00 0.00 ? 8   ASN A HD22 4  
ATOM 6737  N N    . ARG A 1 9   ? -2.630  -18.081 -4.141  1.00 0.00 ? 9   ARG A N    4  
ATOM 6738  C CA   . ARG A 1 9   ? -2.775  -18.646 -2.805  1.00 0.00 ? 9   ARG A CA   4  
ATOM 6739  C C    . ARG A 1 9   ? -3.532  -17.690 -1.889  1.00 0.00 ? 9   ARG A C    4  
ATOM 6740  O O    . ARG A 1 9   ? -3.857  -16.568 -2.278  1.00 0.00 ? 9   ARG A O    4  
ATOM 6741  C CB   . ARG A 1 9   ? -1.400  -18.960 -2.210  1.00 0.00 ? 9   ARG A CB   4  
ATOM 6742  C CG   . ARG A 1 9   ? -0.758  -20.210 -2.786  1.00 0.00 ? 9   ARG A CG   4  
ATOM 6743  C CD   . ARG A 1 9   ? -1.349  -21.472 -2.176  1.00 0.00 ? 9   ARG A CD   4  
ATOM 6744  N NE   . ARG A 1 9   ? -1.241  -22.618 -3.074  1.00 0.00 ? 9   ARG A NE   4  
ATOM 6745  C CZ   . ARG A 1 9   ? -1.960  -23.727 -2.942  1.00 0.00 ? 9   ARG A CZ   4  
ATOM 6746  N NH1  . ARG A 1 9   ? -2.836  -23.839 -1.952  1.00 0.00 ? 9   ARG A NH1  4  
ATOM 6747  N NH2  . ARG A 1 9   ? -1.804  -24.727 -3.799  1.00 0.00 ? 9   ARG A NH2  4  
ATOM 6748  H H    . ARG A 1 9   ? -2.383  -17.138 -4.237  1.00 0.00 ? 9   ARG A H    4  
ATOM 6749  H HA   . ARG A 1 9   ? -3.337  -19.564 -2.891  1.00 0.00 ? 9   ARG A HA   4  
ATOM 6750  H HB2  . ARG A 1 9   ? -0.742  -18.125 -2.397  1.00 0.00 ? 9   ARG A HB2  4  
ATOM 6751  H HB3  . ARG A 1 9   ? -1.505  -19.093 -1.144  1.00 0.00 ? 9   ARG A HB3  4  
ATOM 6752  H HG2  . ARG A 1 9   ? -0.922  -20.230 -3.853  1.00 0.00 ? 9   ARG A HG2  4  
ATOM 6753  H HG3  . ARG A 1 9   ? 0.303   -20.186 -2.583  1.00 0.00 ? 9   ARG A HG3  4  
ATOM 6754  H HD2  . ARG A 1 9   ? -0.823  -21.694 -1.259  1.00 0.00 ? 9   ARG A HD2  4  
ATOM 6755  H HD3  . ARG A 1 9   ? -2.392  -21.295 -1.957  1.00 0.00 ? 9   ARG A HD3  4  
ATOM 6756  H HE   . ARG A 1 9   ? -0.599  -22.557 -3.812  1.00 0.00 ? 9   ARG A HE   4  
ATOM 6757  H HH11 . ARG A 1 9   ? -2.956  -23.086 -1.305  1.00 0.00 ? 9   ARG A HH11 4  
ATOM 6758  H HH12 . ARG A 1 9   ? -3.377  -24.675 -1.856  1.00 0.00 ? 9   ARG A HH12 4  
ATOM 6759  H HH21 . ARG A 1 9   ? -1.145  -24.647 -4.547  1.00 0.00 ? 9   ARG A HH21 4  
ATOM 6760  H HH22 . ARG A 1 9   ? -2.346  -25.561 -3.699  1.00 0.00 ? 9   ARG A HH22 4  
ATOM 6761  N N    . LEU A 1 10  ? -3.809  -18.140 -0.670  1.00 0.00 ? 10  LEU A N    4  
ATOM 6762  C CA   . LEU A 1 10  ? -4.528  -17.325 0.302   1.00 0.00 ? 10  LEU A CA   4  
ATOM 6763  C C    . LEU A 1 10  ? -3.720  -17.171 1.587   1.00 0.00 ? 10  LEU A C    4  
ATOM 6764  O O    . LEU A 1 10  ? -4.283  -17.080 2.680   1.00 0.00 ? 10  LEU A O    4  
ATOM 6765  C CB   . LEU A 1 10  ? -5.889  -17.949 0.614   1.00 0.00 ? 10  LEU A CB   4  
ATOM 6766  C CG   . LEU A 1 10  ? -5.860  -19.306 1.320   1.00 0.00 ? 10  LEU A CG   4  
ATOM 6767  C CD1  . LEU A 1 10  ? -7.086  -19.475 2.202   1.00 0.00 ? 10  LEU A CD1  4  
ATOM 6768  C CD2  . LEU A 1 10  ? -5.772  -20.435 0.303   1.00 0.00 ? 10  LEU A CD2  4  
ATOM 6769  H H    . LEU A 1 10  ? -3.523  -19.043 -0.417  1.00 0.00 ? 10  LEU A H    4  
ATOM 6770  H HA   . LEU A 1 10  ? -4.680  -16.349 -0.132  1.00 0.00 ? 10  LEU A HA   4  
ATOM 6771  H HB2  . LEU A 1 10  ? -6.432  -17.261 1.243   1.00 0.00 ? 10  LEU A HB2  4  
ATOM 6772  H HB3  . LEU A 1 10  ? -6.417  -18.073 -0.321  1.00 0.00 ? 10  LEU A HB3  4  
ATOM 6773  H HG   . LEU A 1 10  ? -4.984  -19.356 1.953   1.00 0.00 ? 10  LEU A HG   4  
ATOM 6774  H HD11 . LEU A 1 10  ? -7.927  -19.775 1.596   1.00 0.00 ? 10  LEU A HD11 4  
ATOM 6775  H HD12 . LEU A 1 10  ? -7.311  -18.538 2.690   1.00 0.00 ? 10  LEU A HD12 4  
ATOM 6776  H HD13 . LEU A 1 10  ? -6.891  -20.231 2.949   1.00 0.00 ? 10  LEU A HD13 4  
ATOM 6777  H HD21 . LEU A 1 10  ? -4.951  -21.088 0.562   1.00 0.00 ? 10  LEU A HD21 4  
ATOM 6778  H HD22 . LEU A 1 10  ? -5.606  -20.021 -0.681  1.00 0.00 ? 10  LEU A HD22 4  
ATOM 6779  H HD23 . LEU A 1 10  ? -6.694  -20.996 0.308   1.00 0.00 ? 10  LEU A HD23 4  
ATOM 6780  N N    . LEU A 1 11  ? -2.399  -17.141 1.449   1.00 0.00 ? 11  LEU A N    4  
ATOM 6781  C CA   . LEU A 1 11  ? -1.513  -16.995 2.599   1.00 0.00 ? 11  LEU A CA   4  
ATOM 6782  C C    . LEU A 1 11  ? -1.331  -15.525 2.963   1.00 0.00 ? 11  LEU A C    4  
ATOM 6783  O O    . LEU A 1 11  ? -0.856  -14.729 2.153   1.00 0.00 ? 11  LEU A O    4  
ATOM 6784  C CB   . LEU A 1 11  ? -0.153  -17.632 2.304   1.00 0.00 ? 11  LEU A CB   4  
ATOM 6785  C CG   . LEU A 1 11  ? -0.008  -19.106 2.681   1.00 0.00 ? 11  LEU A CG   4  
ATOM 6786  C CD1  . LEU A 1 11  ? -0.118  -19.286 4.188   1.00 0.00 ? 11  LEU A CD1  4  
ATOM 6787  C CD2  . LEU A 1 11  ? -1.053  -19.946 1.964   1.00 0.00 ? 11  LEU A CD2  4  
ATOM 6788  H H    . LEU A 1 11  ? -2.010  -17.218 0.553   1.00 0.00 ? 11  LEU A H    4  
ATOM 6789  H HA   . LEU A 1 11  ? -1.967  -17.506 3.435   1.00 0.00 ? 11  LEU A HA   4  
ATOM 6790  H HB2  . LEU A 1 11  ? 0.031   -17.541 1.245   1.00 0.00 ? 11  LEU A HB2  4  
ATOM 6791  H HB3  . LEU A 1 11  ? 0.596   -17.074 2.847   1.00 0.00 ? 11  LEU A HB3  4  
ATOM 6792  H HG   . LEU A 1 11  ? 0.970   -19.455 2.376   1.00 0.00 ? 11  LEU A HG   4  
ATOM 6793  H HD11 . LEU A 1 11  ? 0.829   -19.622 4.580   1.00 0.00 ? 11  LEU A HD11 4  
ATOM 6794  H HD12 . LEU A 1 11  ? -0.880  -20.019 4.407   1.00 0.00 ? 11  LEU A HD12 4  
ATOM 6795  H HD13 . LEU A 1 11  ? -0.384  -18.343 4.644   1.00 0.00 ? 11  LEU A HD13 4  
ATOM 6796  H HD21 . LEU A 1 11  ? -1.905  -20.091 2.613   1.00 0.00 ? 11  LEU A HD21 4  
ATOM 6797  H HD22 . LEU A 1 11  ? -0.630  -20.906 1.706   1.00 0.00 ? 11  LEU A HD22 4  
ATOM 6798  H HD23 . LEU A 1 11  ? -1.369  -19.438 1.065   1.00 0.00 ? 11  LEU A HD23 4  
ATOM 6799  N N    . SER A 1 12  ? -1.708  -15.172 4.188   1.00 0.00 ? 12  SER A N    4  
ATOM 6800  C CA   . SER A 1 12  ? -1.588  -13.798 4.659   1.00 0.00 ? 12  SER A CA   4  
ATOM 6801  C C    . SER A 1 12  ? -1.352  -13.759 6.166   1.00 0.00 ? 12  SER A C    4  
ATOM 6802  O O    . SER A 1 12  ? -2.193  -14.201 6.949   1.00 0.00 ? 12  SER A O    4  
ATOM 6803  C CB   . SER A 1 12  ? -2.847  -13.004 4.307   1.00 0.00 ? 12  SER A CB   4  
ATOM 6804  O OG   . SER A 1 12  ? -2.571  -11.615 4.235   1.00 0.00 ? 12  SER A OG   4  
ATOM 6805  H H    . SER A 1 12  ? -2.079  -15.853 4.787   1.00 0.00 ? 12  SER A H    4  
ATOM 6806  H HA   . SER A 1 12  ? -0.740  -13.350 4.162   1.00 0.00 ? 12  SER A HA   4  
ATOM 6807  H HB2  . SER A 1 12  ? -3.222  -13.333 3.350   1.00 0.00 ? 12  SER A HB2  4  
ATOM 6808  H HB3  . SER A 1 12  ? -3.598  -13.170 5.065   1.00 0.00 ? 12  SER A HB3  4  
ATOM 6809  H HG   . SER A 1 12  ? -3.165  -11.139 4.819   1.00 0.00 ? 12  SER A HG   4  
ATOM 6810  N N    . LYS A 1 13  ? -0.203  -13.225 6.565   1.00 0.00 ? 13  LYS A N    4  
ATOM 6811  C CA   . LYS A 1 13  ? 0.145   -13.126 7.978   1.00 0.00 ? 13  LYS A CA   4  
ATOM 6812  C C    . LYS A 1 13  ? 1.461   -12.378 8.162   1.00 0.00 ? 13  LYS A C    4  
ATOM 6813  O O    . LYS A 1 13  ? 2.044   -11.881 7.198   1.00 0.00 ? 13  LYS A O    4  
ATOM 6814  C CB   . LYS A 1 13  ? 0.247   -14.521 8.598   1.00 0.00 ? 13  LYS A CB   4  
ATOM 6815  C CG   . LYS A 1 13  ? 1.464   -15.304 8.137   1.00 0.00 ? 13  LYS A CG   4  
ATOM 6816  C CD   . LYS A 1 13  ? 1.174   -16.088 6.867   1.00 0.00 ? 13  LYS A CD   4  
ATOM 6817  C CE   . LYS A 1 13  ? 2.185   -17.205 6.659   1.00 0.00 ? 13  LYS A CE   4  
ATOM 6818  N NZ   . LYS A 1 13  ? 2.044   -18.279 7.680   1.00 0.00 ? 13  LYS A NZ   4  
ATOM 6819  H H    . LYS A 1 13  ? 0.427   -12.889 5.894   1.00 0.00 ? 13  LYS A H    4  
ATOM 6820  H HA   . LYS A 1 13  ? -0.640  -12.576 8.475   1.00 0.00 ? 13  LYS A HA   4  
ATOM 6821  H HB2  . LYS A 1 13  ? 0.295   -14.421 9.672   1.00 0.00 ? 13  LYS A HB2  4  
ATOM 6822  H HB3  . LYS A 1 13  ? -0.638  -15.084 8.337   1.00 0.00 ? 13  LYS A HB3  4  
ATOM 6823  H HG2  . LYS A 1 13  ? 2.273   -14.615 7.945   1.00 0.00 ? 13  LYS A HG2  4  
ATOM 6824  H HG3  . LYS A 1 13  ? 1.753   -15.994 8.917   1.00 0.00 ? 13  LYS A HG3  4  
ATOM 6825  H HD2  . LYS A 1 13  ? 0.187   -16.521 6.939   1.00 0.00 ? 13  LYS A HD2  4  
ATOM 6826  H HD3  . LYS A 1 13  ? 1.214   -15.415 6.022   1.00 0.00 ? 13  LYS A HD3  4  
ATOM 6827  H HE2  . LYS A 1 13  ? 2.034   -17.629 5.678   1.00 0.00 ? 13  LYS A HE2  4  
ATOM 6828  H HE3  . LYS A 1 13  ? 3.179   -16.788 6.722   1.00 0.00 ? 13  LYS A HE3  4  
ATOM 6829  H HZ1  . LYS A 1 13  ? 2.821   -18.222 8.369   1.00 0.00 ? 13  LYS A HZ1  4  
ATOM 6830  H HZ2  . LYS A 1 13  ? 2.069   -19.212 7.223   1.00 0.00 ? 13  LYS A HZ2  4  
ATOM 6831  H HZ3  . LYS A 1 13  ? 1.140   -18.176 8.184   1.00 0.00 ? 13  LYS A HZ3  4  
ATOM 6832  N N    . TYR A 1 14  ? 1.926   -12.304 9.405   1.00 0.00 ? 14  TYR A N    4  
ATOM 6833  C CA   . TYR A 1 14  ? 3.173   -11.617 9.714   1.00 0.00 ? 14  TYR A CA   4  
ATOM 6834  C C    . TYR A 1 14  ? 4.350   -12.589 9.698   1.00 0.00 ? 14  TYR A C    4  
ATOM 6835  O O    . TYR A 1 14  ? 4.186   -13.783 9.946   1.00 0.00 ? 14  TYR A O    4  
ATOM 6836  C CB   . TYR A 1 14  ? 3.079   -10.937 11.082  1.00 0.00 ? 14  TYR A CB   4  
ATOM 6837  C CG   . TYR A 1 14  ? 4.165   -9.913  11.326  1.00 0.00 ? 14  TYR A CG   4  
ATOM 6838  C CD1  . TYR A 1 14  ? 5.466   -10.306 11.614  1.00 0.00 ? 14  TYR A CD1  4  
ATOM 6839  C CD2  . TYR A 1 14  ? 3.889   -8.553  11.267  1.00 0.00 ? 14  TYR A CD2  4  
ATOM 6840  C CE1  . TYR A 1 14  ? 6.461   -9.374  11.838  1.00 0.00 ? 14  TYR A CE1  4  
ATOM 6841  C CE2  . TYR A 1 14  ? 4.878   -7.613  11.488  1.00 0.00 ? 14  TYR A CE2  4  
ATOM 6842  C CZ   . TYR A 1 14  ? 6.161   -8.029  11.773  1.00 0.00 ? 14  TYR A CZ   4  
ATOM 6843  O OH   . TYR A 1 14  ? 7.150   -7.098  11.994  1.00 0.00 ? 14  TYR A OH   4  
ATOM 6844  H H    . TYR A 1 14  ? 1.416   -12.720 10.131  1.00 0.00 ? 14  TYR A H    4  
ATOM 6845  H HA   . TYR A 1 14  ? 3.333   -10.862 8.960   1.00 0.00 ? 14  TYR A HA   4  
ATOM 6846  H HB2  . TYR A 1 14  ? 2.127   -10.435 11.162  1.00 0.00 ? 14  TYR A HB2  4  
ATOM 6847  H HB3  . TYR A 1 14  ? 3.151   -11.688 11.856  1.00 0.00 ? 14  TYR A HB3  4  
ATOM 6848  H HD1  . TYR A 1 14  ? 5.697   -11.361 11.663  1.00 0.00 ? 14  TYR A HD1  4  
ATOM 6849  H HD2  . TYR A 1 14  ? 2.882   -8.230  11.043  1.00 0.00 ? 14  TYR A HD2  4  
ATOM 6850  H HE1  . TYR A 1 14  ? 7.465   -9.700  12.061  1.00 0.00 ? 14  TYR A HE1  4  
ATOM 6851  H HE2  . TYR A 1 14  ? 4.645   -6.560  11.437  1.00 0.00 ? 14  TYR A HE2  4  
ATOM 6852  H HH   . TYR A 1 14  ? 6.757   -6.225  12.068  1.00 0.00 ? 14  TYR A HH   4  
ATOM 6853  N N    . ASP A 1 15  ? 5.535   -12.065 9.404   1.00 0.00 ? 15  ASP A N    4  
ATOM 6854  C CA   . ASP A 1 15  ? 6.741   -12.885 9.355   1.00 0.00 ? 15  ASP A CA   4  
ATOM 6855  C C    . ASP A 1 15  ? 7.992   -12.011 9.359   1.00 0.00 ? 15  ASP A C    4  
ATOM 6856  O O    . ASP A 1 15  ? 8.066   -10.986 8.681   1.00 0.00 ? 15  ASP A O    4  
ATOM 6857  C CB   . ASP A 1 15  ? 6.729   -13.774 8.111   1.00 0.00 ? 15  ASP A CB   4  
ATOM 6858  C CG   . ASP A 1 15  ? 7.471   -15.079 8.325   1.00 0.00 ? 15  ASP A CG   4  
ATOM 6859  O OD1  . ASP A 1 15  ? 6.868   -16.017 8.886   1.00 0.00 ? 15  ASP A OD1  4  
ATOM 6860  O OD2  . ASP A 1 15  ? 8.653   -15.161 7.931   1.00 0.00 ? 15  ASP A OD2  4  
ATOM 6861  H H    . ASP A 1 15  ? 5.601   -11.105 9.215   1.00 0.00 ? 15  ASP A H    4  
ATOM 6862  H HA   . ASP A 1 15  ? 6.751   -13.512 10.233  1.00 0.00 ? 15  ASP A HA   4  
ATOM 6863  H HB2  . ASP A 1 15  ? 5.707   -14.002 7.848   1.00 0.00 ? 15  ASP A HB2  4  
ATOM 6864  H HB3  . ASP A 1 15  ? 7.196   -13.245 7.294   1.00 0.00 ? 15  ASP A HB3  4  
ATOM 6865  N N    . PRO A 1 16  ? 8.999   -12.424 10.144  1.00 0.00 ? 16  PRO A N    4  
ATOM 6866  C CA   . PRO A 1 16  ? 10.265  -11.694 10.255  1.00 0.00 ? 16  PRO A CA   4  
ATOM 6867  C C    . PRO A 1 16  ? 11.095  -11.772 8.980   1.00 0.00 ? 16  PRO A C    4  
ATOM 6868  O O    . PRO A 1 16  ? 12.084  -11.056 8.827   1.00 0.00 ? 16  PRO A O    4  
ATOM 6869  C CB   . PRO A 1 16  ? 10.983  -12.403 11.406  1.00 0.00 ? 16  PRO A CB   4  
ATOM 6870  C CG   . PRO A 1 16  ? 10.411  -13.779 11.418  1.00 0.00 ? 16  PRO A CG   4  
ATOM 6871  C CD   . PRO A 1 16  ? 8.980   -13.636 10.979  1.00 0.00 ? 16  PRO A CD   4  
ATOM 6872  H HA   . PRO A 1 16  ? 10.103  -10.658 10.515  1.00 0.00 ? 16  PRO A HA   4  
ATOM 6873  H HB2  . PRO A 1 16  ? 12.047  -12.419 11.215  1.00 0.00 ? 16  PRO A HB2  4  
ATOM 6874  H HB3  . PRO A 1 16  ? 10.785  -11.885 12.332  1.00 0.00 ? 16  PRO A HB3  4  
ATOM 6875  H HG2  . PRO A 1 16  ? 10.953  -14.409 10.730  1.00 0.00 ? 16  PRO A HG2  4  
ATOM 6876  H HG3  . PRO A 1 16  ? 10.457  -14.186 12.418  1.00 0.00 ? 16  PRO A HG3  4  
ATOM 6877  H HD2  . PRO A 1 16  ? 8.674   -14.497 10.404  1.00 0.00 ? 16  PRO A HD2  4  
ATOM 6878  H HD3  . PRO A 1 16  ? 8.334   -13.504 11.835  1.00 0.00 ? 16  PRO A HD3  4  
ATOM 6879  N N    . GLN A 1 17  ? 10.686  -12.647 8.066   1.00 0.00 ? 17  GLN A N    4  
ATOM 6880  C CA   . GLN A 1 17  ? 11.393  -12.819 6.802   1.00 0.00 ? 17  GLN A CA   4  
ATOM 6881  C C    . GLN A 1 17  ? 10.767  -11.962 5.707   1.00 0.00 ? 17  GLN A C    4  
ATOM 6882  O O    . GLN A 1 17  ? 11.471  -11.380 4.880   1.00 0.00 ? 17  GLN A O    4  
ATOM 6883  C CB   . GLN A 1 17  ? 11.384  -14.290 6.384   1.00 0.00 ? 17  GLN A CB   4  
ATOM 6884  C CG   . GLN A 1 17  ? 12.246  -15.180 7.266   1.00 0.00 ? 17  GLN A CG   4  
ATOM 6885  C CD   . GLN A 1 17  ? 12.428  -16.570 6.691   1.00 0.00 ? 17  GLN A CD   4  
ATOM 6886  O OE1  . GLN A 1 17  ? 13.481  -16.896 6.144   1.00 0.00 ? 17  GLN A OE1  4  
ATOM 6887  N NE2  . GLN A 1 17  ? 11.398  -17.401 6.813   1.00 0.00 ? 17  GLN A NE2  4  
ATOM 6888  H H    . GLN A 1 17  ? 9.890   -13.189 8.245   1.00 0.00 ? 17  GLN A H    4  
ATOM 6889  H HA   . GLN A 1 17  ? 12.415  -12.502 6.949   1.00 0.00 ? 17  GLN A HA   4  
ATOM 6890  H HB2  . GLN A 1 17  ? 10.368  -14.656 6.423   1.00 0.00 ? 17  GLN A HB2  4  
ATOM 6891  H HB3  . GLN A 1 17  ? 11.746  -14.366 5.370   1.00 0.00 ? 17  GLN A HB3  4  
ATOM 6892  H HG2  . GLN A 1 17  ? 13.218  -14.722 7.375   1.00 0.00 ? 17  GLN A HG2  4  
ATOM 6893  H HG3  . GLN A 1 17  ? 11.778  -15.263 8.235   1.00 0.00 ? 17  GLN A HG3  4  
ATOM 6894  H HE21 . GLN A 1 17  ? 10.590  -17.072 7.260   1.00 0.00 ? 17  GLN A HE21 4  
ATOM 6895  H HE22 . GLN A 1 17  ? 11.488  -18.306 6.450   1.00 0.00 ? 17  GLN A HE22 4  
ATOM 6896  N N    . LYS A 1 18  ? 9.440   -11.889 5.705   1.00 0.00 ? 18  LYS A N    4  
ATOM 6897  C CA   . LYS A 1 18  ? 8.718   -11.103 4.712   1.00 0.00 ? 18  LYS A CA   4  
ATOM 6898  C C    . LYS A 1 18  ? 9.042   -9.619  4.852   1.00 0.00 ? 18  LYS A C    4  
ATOM 6899  O O    . LYS A 1 18  ? 9.264   -8.927  3.859   1.00 0.00 ? 18  LYS A O    4  
ATOM 6900  C CB   . LYS A 1 18  ? 7.210   -11.323 4.857   1.00 0.00 ? 18  LYS A CB   4  
ATOM 6901  C CG   . LYS A 1 18  ? 6.787   -12.769 4.675   1.00 0.00 ? 18  LYS A CG   4  
ATOM 6902  C CD   . LYS A 1 18  ? 6.747   -13.159 3.206   1.00 0.00 ? 18  LYS A CD   4  
ATOM 6903  C CE   . LYS A 1 18  ? 5.695   -14.225 2.940   1.00 0.00 ? 18  LYS A CE   4  
ATOM 6904  N NZ   . LYS A 1 18  ? 5.761   -14.733 1.542   1.00 0.00 ? 18  LYS A NZ   4  
ATOM 6905  H H    . LYS A 1 18  ? 8.935   -12.376 6.390   1.00 0.00 ? 18  LYS A H    4  
ATOM 6906  H HA   . LYS A 1 18  ? 9.030   -11.436 3.734   1.00 0.00 ? 18  LYS A HA   4  
ATOM 6907  H HB2  . LYS A 1 18  ? 6.904   -11.001 5.841   1.00 0.00 ? 18  LYS A HB2  4  
ATOM 6908  H HB3  . LYS A 1 18  ? 6.700   -10.724 4.116   1.00 0.00 ? 18  LYS A HB3  4  
ATOM 6909  H HG2  . LYS A 1 18  ? 7.491   -13.409 5.186   1.00 0.00 ? 18  LYS A HG2  4  
ATOM 6910  H HG3  . LYS A 1 18  ? 5.802   -12.903 5.099   1.00 0.00 ? 18  LYS A HG3  4  
ATOM 6911  H HD2  . LYS A 1 18  ? 6.512   -12.285 2.617   1.00 0.00 ? 18  LYS A HD2  4  
ATOM 6912  H HD3  . LYS A 1 18  ? 7.716   -13.540 2.918   1.00 0.00 ? 18  LYS A HD3  4  
ATOM 6913  H HE2  . LYS A 1 18  ? 5.856   -15.048 3.620   1.00 0.00 ? 18  LYS A HE2  4  
ATOM 6914  H HE3  . LYS A 1 18  ? 4.718   -13.800 3.115   1.00 0.00 ? 18  LYS A HE3  4  
ATOM 6915  H HZ1  . LYS A 1 18  ? 5.272   -14.076 0.901   1.00 0.00 ? 18  LYS A HZ1  4  
ATOM 6916  H HZ2  . LYS A 1 18  ? 5.305   -15.665 1.478   1.00 0.00 ? 18  LYS A HZ2  4  
ATOM 6917  H HZ3  . LYS A 1 18  ? 6.752   -14.822 1.240   1.00 0.00 ? 18  LYS A HZ3  4  
ATOM 6918  N N    . GLU A 1 19  ? 9.069   -9.139  6.091   1.00 0.00 ? 19  GLU A N    4  
ATOM 6919  C CA   . GLU A 1 19  ? 9.367   -7.736  6.359   1.00 0.00 ? 19  GLU A CA   4  
ATOM 6920  C C    . GLU A 1 19  ? 10.506  -7.242  5.470   1.00 0.00 ? 19  GLU A C    4  
ATOM 6921  O O    . GLU A 1 19  ? 10.527  -6.083  5.059   1.00 0.00 ? 19  GLU A O    4  
ATOM 6922  C CB   . GLU A 1 19  ? 9.735   -7.542  7.832   1.00 0.00 ? 19  GLU A CB   4  
ATOM 6923  C CG   . GLU A 1 19  ? 10.242  -6.146  8.154   1.00 0.00 ? 19  GLU A CG   4  
ATOM 6924  C CD   . GLU A 1 19  ? 11.704  -5.960  7.797   1.00 0.00 ? 19  GLU A CD   4  
ATOM 6925  O OE1  . GLU A 1 19  ? 12.468  -6.942  7.893   1.00 0.00 ? 19  GLU A OE1  4  
ATOM 6926  O OE2  . GLU A 1 19  ? 12.082  -4.831  7.421   1.00 0.00 ? 19  GLU A OE2  4  
ATOM 6927  H H    . GLU A 1 19  ? 8.884   -9.740  6.842   1.00 0.00 ? 19  GLU A H    4  
ATOM 6928  H HA   . GLU A 1 19  ? 8.480   -7.161  6.140   1.00 0.00 ? 19  GLU A HA   4  
ATOM 6929  H HB2  . GLU A 1 19  ? 8.861   -7.735  8.437   1.00 0.00 ? 19  GLU A HB2  4  
ATOM 6930  H HB3  . GLU A 1 19  ? 10.505  -8.251  8.094   1.00 0.00 ? 19  GLU A HB3  4  
ATOM 6931  H HG2  . GLU A 1 19  ? 9.657   -5.428  7.599   1.00 0.00 ? 19  GLU A HG2  4  
ATOM 6932  H HG3  . GLU A 1 19  ? 10.119  -5.968  9.213   1.00 0.00 ? 19  GLU A HG3  4  
ATOM 6933  N N    . ALA A 1 20  ? 11.449  -8.131  5.180   1.00 0.00 ? 20  ALA A N    4  
ATOM 6934  C CA   . ALA A 1 20  ? 12.590  -7.787  4.340   1.00 0.00 ? 20  ALA A CA   4  
ATOM 6935  C C    . ALA A 1 20  ? 12.217  -7.831  2.862   1.00 0.00 ? 20  ALA A C    4  
ATOM 6936  O O    . ALA A 1 20  ? 12.613  -6.963  2.086   1.00 0.00 ? 20  ALA A O    4  
ATOM 6937  C CB   . ALA A 1 20  ? 13.754  -8.725  4.619   1.00 0.00 ? 20  ALA A CB   4  
ATOM 6938  H H    . ALA A 1 20  ? 11.376  -9.040  5.538   1.00 0.00 ? 20  ALA A H    4  
ATOM 6939  H HA   . ALA A 1 20  ? 12.900  -6.784  4.592   1.00 0.00 ? 20  ALA A HA   4  
ATOM 6940  H HB1  . ALA A 1 20  ? 13.971  -8.722  5.679   1.00 0.00 ? 20  ALA A HB1  4  
ATOM 6941  H HB2  . ALA A 1 20  ? 13.493  -9.727  4.309   1.00 0.00 ? 20  ALA A HB2  4  
ATOM 6942  H HB3  . ALA A 1 20  ? 14.624  -8.393  4.072   1.00 0.00 ? 20  ALA A HB3  4  
ATOM 6943  N N    . GLU A 1 21  ? 11.452  -8.850  2.480   1.00 0.00 ? 21  GLU A N    4  
ATOM 6944  C CA   . GLU A 1 21  ? 11.026  -9.007  1.094   1.00 0.00 ? 21  GLU A CA   4  
ATOM 6945  C C    . GLU A 1 21  ? 10.281  -7.767  0.610   1.00 0.00 ? 21  GLU A C    4  
ATOM 6946  O O    . GLU A 1 21  ? 10.515  -7.280  -0.497  1.00 0.00 ? 21  GLU A O    4  
ATOM 6947  C CB   . GLU A 1 21  ? 10.134  -10.241 0.947   1.00 0.00 ? 21  GLU A CB   4  
ATOM 6948  C CG   . GLU A 1 21  ? 10.815  -11.537 1.357   1.00 0.00 ? 21  GLU A CG   4  
ATOM 6949  C CD   . GLU A 1 21  ? 10.157  -12.759 0.747   1.00 0.00 ? 21  GLU A CD   4  
ATOM 6950  O OE1  . GLU A 1 21  ? 8.956   -12.978 1.008   1.00 0.00 ? 21  GLU A OE1  4  
ATOM 6951  O OE2  . GLU A 1 21  ? 10.844  -13.498 0.011   1.00 0.00 ? 21  GLU A OE2  4  
ATOM 6952  H H    . GLU A 1 21  ? 11.167  -9.511  3.145   1.00 0.00 ? 21  GLU A H    4  
ATOM 6953  H HA   . GLU A 1 21  ? 11.910  -9.139  0.488   1.00 0.00 ? 21  GLU A HA   4  
ATOM 6954  H HB2  . GLU A 1 21  ? 9.255   -10.110 1.562   1.00 0.00 ? 21  GLU A HB2  4  
ATOM 6955  H HB3  . GLU A 1 21  ? 9.830   -10.330 -0.085  1.00 0.00 ? 21  GLU A HB3  4  
ATOM 6956  H HG2  . GLU A 1 21  ? 11.845  -11.504 1.036   1.00 0.00 ? 21  GLU A HG2  4  
ATOM 6957  H HG3  . GLU A 1 21  ? 10.776  -11.623 2.433   1.00 0.00 ? 21  GLU A HG3  4  
ATOM 6958  N N    . LEU A 1 22  ? 9.382   -7.260  1.446   1.00 0.00 ? 22  LEU A N    4  
ATOM 6959  C CA   . LEU A 1 22  ? 8.600   -6.077  1.105   1.00 0.00 ? 22  LEU A CA   4  
ATOM 6960  C C    . LEU A 1 22  ? 9.508   -4.875  0.868   1.00 0.00 ? 22  LEU A C    4  
ATOM 6961  O O    . LEU A 1 22  ? 9.621   -4.380  -0.254  1.00 0.00 ? 22  LEU A O    4  
ATOM 6962  C CB   . LEU A 1 22  ? 7.600   -5.763  2.218   1.00 0.00 ? 22  LEU A CB   4  
ATOM 6963  C CG   . LEU A 1 22  ? 6.547   -6.838  2.497   1.00 0.00 ? 22  LEU A CG   4  
ATOM 6964  C CD1  . LEU A 1 22  ? 5.773   -6.509  3.764   1.00 0.00 ? 22  LEU A CD1  4  
ATOM 6965  C CD2  . LEU A 1 22  ? 5.604   -6.980  1.313   1.00 0.00 ? 22  LEU A CD2  4  
ATOM 6966  H H    . LEU A 1 22  ? 9.239   -7.691  2.314   1.00 0.00 ? 22  LEU A H    4  
ATOM 6967  H HA   . LEU A 1 22  ? 8.058   -6.288  0.194   1.00 0.00 ? 22  LEU A HA   4  
ATOM 6968  H HB2  . LEU A 1 22  ? 8.157   -5.602  3.127   1.00 0.00 ? 22  LEU A HB2  4  
ATOM 6969  H HB3  . LEU A 1 22  ? 7.082   -4.853  1.950   1.00 0.00 ? 22  LEU A HB3  4  
ATOM 6970  H HG   . LEU A 1 22  ? 7.044   -7.787  2.648   1.00 0.00 ? 22  LEU A HG   4  
ATOM 6971  H HD11 . LEU A 1 22  ? 6.206   -5.640  4.236   1.00 0.00 ? 22  LEU A HD11 4  
ATOM 6972  H HD12 . LEU A 1 22  ? 5.818   -7.347  4.442   1.00 0.00 ? 22  LEU A HD12 4  
ATOM 6973  H HD13 . LEU A 1 22  ? 4.742   -6.305  3.511   1.00 0.00 ? 22  LEU A HD13 4  
ATOM 6974  H HD21 . LEU A 1 22  ? 5.109   -7.939  1.362   1.00 0.00 ? 22  LEU A HD21 4  
ATOM 6975  H HD22 . LEU A 1 22  ? 6.166   -6.911  0.394   1.00 0.00 ? 22  LEU A HD22 4  
ATOM 6976  H HD23 . LEU A 1 22  ? 4.866   -6.193  1.344   1.00 0.00 ? 22  LEU A HD23 4  
ATOM 6977  N N    . ARG A 1 23  ? 10.155  -4.410  1.931   1.00 0.00 ? 23  ARG A N    4  
ATOM 6978  C CA   . ARG A 1 23  ? 11.055  -3.265  1.839   1.00 0.00 ? 23  ARG A CA   4  
ATOM 6979  C C    . ARG A 1 23  ? 12.003  -3.414  0.652   1.00 0.00 ? 23  ARG A C    4  
ATOM 6980  O O    . ARG A 1 23  ? 12.320  -2.439  -0.029  1.00 0.00 ? 23  ARG A O    4  
ATOM 6981  C CB   . ARG A 1 23  ? 11.858  -3.116  3.132   1.00 0.00 ? 23  ARG A CB   4  
ATOM 6982  C CG   . ARG A 1 23  ? 12.723  -4.323  3.456   1.00 0.00 ? 23  ARG A CG   4  
ATOM 6983  C CD   . ARG A 1 23  ? 13.822  -3.972  4.446   1.00 0.00 ? 23  ARG A CD   4  
ATOM 6984  N NE   . ARG A 1 23  ? 14.932  -4.919  4.390   1.00 0.00 ? 23  ARG A NE   4  
ATOM 6985  C CZ   . ARG A 1 23  ? 16.148  -4.653  4.855   1.00 0.00 ? 23  ARG A CZ   4  
ATOM 6986  N NH1  . ARG A 1 23  ? 16.408  -3.476  5.408   1.00 0.00 ? 23  ARG A NH1  4  
ATOM 6987  N NH2  . ARG A 1 23  ? 17.108  -5.566  4.767   1.00 0.00 ? 23  ARG A NH2  4  
ATOM 6988  H H    . ARG A 1 23  ? 10.025  -4.846  2.800   1.00 0.00 ? 23  ARG A H    4  
ATOM 6989  H HA   . ARG A 1 23  ? 10.453  -2.382  1.694   1.00 0.00 ? 23  ARG A HA   4  
ATOM 6990  H HB2  . ARG A 1 23  ? 12.501  -2.253  3.045   1.00 0.00 ? 23  ARG A HB2  4  
ATOM 6991  H HB3  . ARG A 1 23  ? 11.172  -2.961  3.951   1.00 0.00 ? 23  ARG A HB3  4  
ATOM 6992  H HG2  . ARG A 1 23  ? 12.101  -5.095  3.884   1.00 0.00 ? 23  ARG A HG2  4  
ATOM 6993  H HG3  . ARG A 1 23  ? 13.174  -4.685  2.544   1.00 0.00 ? 23  ARG A HG3  4  
ATOM 6994  H HD2  . ARG A 1 23  ? 14.192  -2.983  4.217   1.00 0.00 ? 23  ARG A HD2  4  
ATOM 6995  H HD3  . ARG A 1 23  ? 13.405  -3.978  5.442   1.00 0.00 ? 23  ARG A HD3  4  
ATOM 6996  H HE   . ARG A 1 23  ? 14.763  -5.793  3.985   1.00 0.00 ? 23  ARG A HE   4  
ATOM 6997  H HH11 . ARG A 1 23  ? 15.687  -2.787  5.477   1.00 0.00 ? 23  ARG A HH11 4  
ATOM 6998  H HH12 . ARG A 1 23  ? 17.324  -3.280  5.760   1.00 0.00 ? 23  ARG A HH12 4  
ATOM 6999  H HH21 . ARG A 1 23  ? 16.915  -6.454  4.351   1.00 0.00 ? 23  ARG A HH21 4  
ATOM 7000  H HH22 . ARG A 1 23  ? 18.021  -5.366  5.118   1.00 0.00 ? 23  ARG A HH22 4  
ATOM 7001  N N    . THR A 1 24  ? 12.455  -4.642  0.413   1.00 0.00 ? 24  THR A N    4  
ATOM 7002  C CA   . THR A 1 24  ? 13.368  -4.918  -0.689  1.00 0.00 ? 24  THR A CA   4  
ATOM 7003  C C    . THR A 1 24  ? 12.663  -4.785  -2.035  1.00 0.00 ? 24  THR A C    4  
ATOM 7004  O O    . THR A 1 24  ? 13.285  -4.445  -3.041  1.00 0.00 ? 24  THR A O    4  
ATOM 7005  C CB   . THR A 1 24  ? 13.972  -6.331  -0.577  1.00 0.00 ? 24  THR A CB   4  
ATOM 7006  O OG1  . THR A 1 24  ? 14.750  -6.437  0.621   1.00 0.00 ? 24  THR A OG1  4  
ATOM 7007  C CG2  . THR A 1 24  ? 14.844  -6.643  -1.783  1.00 0.00 ? 24  THR A CG2  4  
ATOM 7008  H H    . THR A 1 24  ? 12.165  -5.378  0.991   1.00 0.00 ? 24  THR A H    4  
ATOM 7009  H HA   . THR A 1 24  ? 14.173  -4.199  -0.643  1.00 0.00 ? 24  THR A HA   4  
ATOM 7010  H HB   . THR A 1 24  ? 13.165  -7.049  -0.539  1.00 0.00 ? 24  THR A HB   4  
ATOM 7011  H HG1  . THR A 1 24  ? 14.169  -6.391  1.385   1.00 0.00 ? 24  THR A HG1  4  
ATOM 7012  H HG21 . THR A 1 24  ? 14.388  -7.430  -2.364  1.00 0.00 ? 24  THR A HG21 4  
ATOM 7013  H HG22 . THR A 1 24  ? 15.821  -6.962  -1.449  1.00 0.00 ? 24  THR A HG22 4  
ATOM 7014  H HG23 . THR A 1 24  ? 14.945  -5.758  -2.393  1.00 0.00 ? 24  THR A HG23 4  
ATOM 7015  N N    . TRP A 1 25  ? 11.362  -5.054  -2.044  1.00 0.00 ? 25  TRP A N    4  
ATOM 7016  C CA   . TRP A 1 25  ? 10.573  -4.963  -3.267  1.00 0.00 ? 25  TRP A CA   4  
ATOM 7017  C C    . TRP A 1 25  ? 10.120  -3.529  -3.517  1.00 0.00 ? 25  TRP A C    4  
ATOM 7018  O O    . TRP A 1 25  ? 9.999   -3.098  -4.664  1.00 0.00 ? 25  TRP A O    4  
ATOM 7019  C CB   . TRP A 1 25  ? 9.357   -5.888  -3.184  1.00 0.00 ? 25  TRP A CB   4  
ATOM 7020  C CG   . TRP A 1 25  ? 8.233   -5.473  -4.084  1.00 0.00 ? 25  TRP A CG   4  
ATOM 7021  C CD1  . TRP A 1 25  ? 8.192   -5.574  -5.445  1.00 0.00 ? 25  TRP A CD1  4  
ATOM 7022  C CD2  . TRP A 1 25  ? 6.988   -4.889  -3.686  1.00 0.00 ? 25  TRP A CD2  4  
ATOM 7023  N NE1  . TRP A 1 25  ? 6.996   -5.089  -5.917  1.00 0.00 ? 25  TRP A NE1  4  
ATOM 7024  C CE2  . TRP A 1 25  ? 6.239   -4.663  -4.858  1.00 0.00 ? 25  TRP A CE2  4  
ATOM 7025  C CE3  . TRP A 1 25  ? 6.430   -4.538  -2.453  1.00 0.00 ? 25  TRP A CE3  4  
ATOM 7026  C CZ2  . TRP A 1 25  ? 4.966   -4.101  -4.831  1.00 0.00 ? 25  TRP A CZ2  4  
ATOM 7027  C CZ3  . TRP A 1 25  ? 5.167   -3.980  -2.428  1.00 0.00 ? 25  TRP A CZ3  4  
ATOM 7028  C CH2  . TRP A 1 25  ? 4.445   -3.767  -3.610  1.00 0.00 ? 25  TRP A CH2  4  
ATOM 7029  H H    . TRP A 1 25  ? 10.922  -5.320  -1.210  1.00 0.00 ? 25  TRP A H    4  
ATOM 7030  H HA   . TRP A 1 25  ? 11.199  -5.279  -4.089  1.00 0.00 ? 25  TRP A HA   4  
ATOM 7031  H HB2  . TRP A 1 25  ? 9.654   -6.889  -3.461  1.00 0.00 ? 25  TRP A HB2  4  
ATOM 7032  H HB3  . TRP A 1 25  ? 8.989   -5.894  -2.169  1.00 0.00 ? 25  TRP A HB3  4  
ATOM 7033  H HD1  . TRP A 1 25  ? 8.991   -5.977  -6.048  1.00 0.00 ? 25  TRP A HD1  4  
ATOM 7034  H HE1  . TRP A 1 25  ? 6.729   -5.055  -6.860  1.00 0.00 ? 25  TRP A HE1  4  
ATOM 7035  H HE3  . TRP A 1 25  ? 6.971   -4.694  -1.531  1.00 0.00 ? 25  TRP A HE3  4  
ATOM 7036  H HZ2  . TRP A 1 25  ? 4.398   -3.932  -5.733  1.00 0.00 ? 25  TRP A HZ2  4  
ATOM 7037  H HZ3  . TRP A 1 25  ? 4.720   -3.701  -1.484  1.00 0.00 ? 25  TRP A HZ3  4  
ATOM 7038  H HH2  . TRP A 1 25  ? 3.462   -3.328  -3.544  1.00 0.00 ? 25  TRP A HH2  4  
ATOM 7039  N N    . ILE A 1 26  ? 9.872   -2.795  -2.438  1.00 0.00 ? 26  ILE A N    4  
ATOM 7040  C CA   . ILE A 1 26  ? 9.433   -1.409  -2.542  1.00 0.00 ? 26  ILE A CA   4  
ATOM 7041  C C    . ILE A 1 26  ? 10.613  -0.476  -2.795  1.00 0.00 ? 26  ILE A C    4  
ATOM 7042  O O    . ILE A 1 26  ? 10.603  0.311   -3.741  1.00 0.00 ? 26  ILE A O    4  
ATOM 7043  C CB   . ILE A 1 26  ? 8.697   -0.954  -1.268  1.00 0.00 ? 26  ILE A CB   4  
ATOM 7044  C CG1  . ILE A 1 26  ? 7.573   -1.933  -0.925  1.00 0.00 ? 26  ILE A CG1  4  
ATOM 7045  C CG2  . ILE A 1 26  ? 8.145   0.453   -1.449  1.00 0.00 ? 26  ILE A CG2  4  
ATOM 7046  C CD1  . ILE A 1 26  ? 6.983   -1.718  0.451   1.00 0.00 ? 26  ILE A CD1  4  
ATOM 7047  H H    . ILE A 1 26  ? 9.986   -3.194  -1.551  1.00 0.00 ? 26  ILE A H    4  
ATOM 7048  H HA   . ILE A 1 26  ? 8.747   -1.338  -3.375  1.00 0.00 ? 26  ILE A HA   4  
ATOM 7049  H HB   . ILE A 1 26  ? 9.408   -0.934  -0.457  1.00 0.00 ? 26  ILE A HB   4  
ATOM 7050  H HG12 . ILE A 1 26  ? 6.779   -1.826  -1.647  1.00 0.00 ? 26  ILE A HG12 4  
ATOM 7051  H HG13 . ILE A 1 26  ? 7.959   -2.941  -0.968  1.00 0.00 ? 26  ILE A HG13 4  
ATOM 7052  H HG21 . ILE A 1 26  ? 7.901   0.870   -0.483  1.00 0.00 ? 26  ILE A HG21 4  
ATOM 7053  H HG22 . ILE A 1 26  ? 8.889   1.071   -1.929  1.00 0.00 ? 26  ILE A HG22 4  
ATOM 7054  H HG23 . ILE A 1 26  ? 7.257   0.415   -2.061  1.00 0.00 ? 26  ILE A HG23 4  
ATOM 7055  H HD11 . ILE A 1 26  ? 6.031   -2.224  0.518   1.00 0.00 ? 26  ILE A HD11 4  
ATOM 7056  H HD12 . ILE A 1 26  ? 7.655   -2.113  1.197   1.00 0.00 ? 26  ILE A HD12 4  
ATOM 7057  H HD13 . ILE A 1 26  ? 6.839   -0.660  0.619   1.00 0.00 ? 26  ILE A HD13 4  
ATOM 7058  N N    . GLU A 1 27  ? 11.629  -0.573  -1.942  1.00 0.00 ? 27  GLU A N    4  
ATOM 7059  C CA   . GLU A 1 27  ? 12.817  0.263   -2.074  1.00 0.00 ? 27  GLU A CA   4  
ATOM 7060  C C    . GLU A 1 27  ? 13.290  0.312   -3.525  1.00 0.00 ? 27  GLU A C    4  
ATOM 7061  O O    . GLU A 1 27  ? 13.657  1.370   -4.033  1.00 0.00 ? 27  GLU A O    4  
ATOM 7062  C CB   . GLU A 1 27  ? 13.940  -0.265  -1.178  1.00 0.00 ? 27  GLU A CB   4  
ATOM 7063  C CG   . GLU A 1 27  ? 13.837  0.200   0.264   1.00 0.00 ? 27  GLU A CG   4  
ATOM 7064  C CD   . GLU A 1 27  ? 15.109  -0.053  1.051   1.00 0.00 ? 27  GLU A CD   4  
ATOM 7065  O OE1  . GLU A 1 27  ? 16.204  0.080   0.466   1.00 0.00 ? 27  GLU A OE1  4  
ATOM 7066  O OE2  . GLU A 1 27  ? 15.009  -0.385  2.250   1.00 0.00 ? 27  GLU A OE2  4  
ATOM 7067  H H    . GLU A 1 27  ? 11.577  -1.219  -1.208  1.00 0.00 ? 27  GLU A H    4  
ATOM 7068  H HA   . GLU A 1 27  ? 12.558  1.262   -1.759  1.00 0.00 ? 27  GLU A HA   4  
ATOM 7069  H HB2  . GLU A 1 27  ? 13.916  -1.345  -1.190  1.00 0.00 ? 27  GLU A HB2  4  
ATOM 7070  H HB3  . GLU A 1 27  ? 14.887  0.069   -1.575  1.00 0.00 ? 27  GLU A HB3  4  
ATOM 7071  H HG2  . GLU A 1 27  ? 13.633  1.260   0.273   1.00 0.00 ? 27  GLU A HG2  4  
ATOM 7072  H HG3  . GLU A 1 27  ? 13.025  -0.326  0.743   1.00 0.00 ? 27  GLU A HG3  4  
ATOM 7073  N N    . GLY A 1 28  ? 13.275  -0.842  -4.185  1.00 0.00 ? 28  GLY A N    4  
ATOM 7074  C CA   . GLY A 1 28  ? 13.704  -0.910  -5.570  1.00 0.00 ? 28  GLY A CA   4  
ATOM 7075  C C    . GLY A 1 28  ? 12.684  -0.320  -6.522  1.00 0.00 ? 28  GLY A C    4  
ATOM 7076  O O    . GLY A 1 28  ? 13.040  0.208   -7.576  1.00 0.00 ? 28  GLY A O    4  
ATOM 7077  H H    . GLY A 1 28  ? 12.971  -1.654  -3.728  1.00 0.00 ? 28  GLY A H    4  
ATOM 7078  H HA2  . GLY A 1 28  ? 14.633  -0.369  -5.674  1.00 0.00 ? 28  GLY A HA2  4  
ATOM 7079  H HA3  . GLY A 1 28  ? 13.870  -1.943  -5.833  1.00 0.00 ? 28  GLY A HA3  4  
ATOM 7080  N N    . LEU A 1 29  ? 11.411  -0.409  -6.153  1.00 0.00 ? 29  LEU A N    4  
ATOM 7081  C CA   . LEU A 1 29  ? 10.334  0.120   -6.983  1.00 0.00 ? 29  LEU A CA   4  
ATOM 7082  C C    . LEU A 1 29  ? 10.414  1.640   -7.075  1.00 0.00 ? 29  LEU A C    4  
ATOM 7083  O O    . LEU A 1 29  ? 10.588  2.199   -8.158  1.00 0.00 ? 29  LEU A O    4  
ATOM 7084  C CB   . LEU A 1 29  ? 8.976   -0.299  -6.418  1.00 0.00 ? 29  LEU A CB   4  
ATOM 7085  C CG   . LEU A 1 29  ? 8.398   -1.608  -6.959  1.00 0.00 ? 29  LEU A CG   4  
ATOM 7086  C CD1  . LEU A 1 29  ? 7.420   -2.210  -5.963  1.00 0.00 ? 29  LEU A CD1  4  
ATOM 7087  C CD2  . LEU A 1 29  ? 7.721   -1.377  -8.302  1.00 0.00 ? 29  LEU A CD2  4  
ATOM 7088  H H    . LEU A 1 29  ? 11.189  -0.840  -5.301  1.00 0.00 ? 29  LEU A H    4  
ATOM 7089  H HA   . LEU A 1 29  ? 10.446  -0.296  -7.974  1.00 0.00 ? 29  LEU A HA   4  
ATOM 7090  H HB2  . LEU A 1 29  ? 9.080   -0.401  -5.349  1.00 0.00 ? 29  LEU A HB2  4  
ATOM 7091  H HB3  . LEU A 1 29  ? 8.271   0.490   -6.636  1.00 0.00 ? 29  LEU A HB3  4  
ATOM 7092  H HG   . LEU A 1 29  ? 9.202   -2.315  -7.106  1.00 0.00 ? 29  LEU A HG   4  
ATOM 7093  H HD11 . LEU A 1 29  ? 6.593   -2.656  -6.495  1.00 0.00 ? 29  LEU A HD11 4  
ATOM 7094  H HD12 . LEU A 1 29  ? 7.050   -1.436  -5.307  1.00 0.00 ? 29  LEU A HD12 4  
ATOM 7095  H HD13 . LEU A 1 29  ? 7.923   -2.967  -5.378  1.00 0.00 ? 29  LEU A HD13 4  
ATOM 7096  H HD21 . LEU A 1 29  ? 6.797   -1.935  -8.339  1.00 0.00 ? 29  LEU A HD21 4  
ATOM 7097  H HD22 . LEU A 1 29  ? 8.374   -1.708  -9.096  1.00 0.00 ? 29  LEU A HD22 4  
ATOM 7098  H HD23 . LEU A 1 29  ? 7.511   -0.325  -8.423  1.00 0.00 ? 29  LEU A HD23 4  
ATOM 7099  N N    . THR A 1 30  ? 10.285  2.304   -5.931  1.00 0.00 ? 30  THR A N    4  
ATOM 7100  C CA   . THR A 1 30  ? 10.343  3.759   -5.882  1.00 0.00 ? 30  THR A CA   4  
ATOM 7101  C C    . THR A 1 30  ? 11.786  4.253   -5.881  1.00 0.00 ? 30  THR A C    4  
ATOM 7102  O O    . THR A 1 30  ? 12.077  5.351   -6.353  1.00 0.00 ? 30  THR A O    4  
ATOM 7103  C CB   . THR A 1 30  ? 9.625   4.308   -4.635  1.00 0.00 ? 30  THR A CB   4  
ATOM 7104  O OG1  . THR A 1 30  ? 10.318  3.900   -3.450  1.00 0.00 ? 30  THR A OG1  4  
ATOM 7105  C CG2  . THR A 1 30  ? 8.185   3.819   -4.580  1.00 0.00 ? 30  THR A CG2  4  
ATOM 7106  H H    . THR A 1 30  ? 10.148  1.802   -5.100  1.00 0.00 ? 30  THR A H    4  
ATOM 7107  H HA   . THR A 1 30  ? 9.842   4.143   -6.759  1.00 0.00 ? 30  THR A HA   4  
ATOM 7108  H HB   . THR A 1 30  ? 9.620   5.388   -4.686  1.00 0.00 ? 30  THR A HB   4  
ATOM 7109  H HG1  . THR A 1 30  ? 11.127  3.444   -3.694  1.00 0.00 ? 30  THR A HG1  4  
ATOM 7110  H HG21 . THR A 1 30  ? 8.109   3.006   -3.874  1.00 0.00 ? 30  THR A HG21 4  
ATOM 7111  H HG22 . THR A 1 30  ? 7.885   3.475   -5.559  1.00 0.00 ? 30  THR A HG22 4  
ATOM 7112  H HG23 . THR A 1 30  ? 7.542   4.628   -4.269  1.00 0.00 ? 30  THR A HG23 4  
ATOM 7113  N N    . GLY A 1 31  ? 12.687  3.434   -5.348  1.00 0.00 ? 31  GLY A N    4  
ATOM 7114  C CA   . GLY A 1 31  ? 14.088  3.804   -5.296  1.00 0.00 ? 31  GLY A CA   4  
ATOM 7115  C C    . GLY A 1 31  ? 14.405  4.712   -4.125  1.00 0.00 ? 31  GLY A C    4  
ATOM 7116  O O    . GLY A 1 31  ? 15.374  5.473   -4.164  1.00 0.00 ? 31  GLY A O    4  
ATOM 7117  H H    . GLY A 1 31  ? 12.397  2.570   -4.985  1.00 0.00 ? 31  GLY A H    4  
ATOM 7118  H HA2  . GLY A 1 31  ? 14.684  2.907   -5.214  1.00 0.00 ? 31  GLY A HA2  4  
ATOM 7119  H HA3  . GLY A 1 31  ? 14.348  4.314   -6.212  1.00 0.00 ? 31  GLY A HA3  4  
ATOM 7120  N N    . LEU A 1 32  ? 13.589  4.636   -3.080  1.00 0.00 ? 32  LEU A N    4  
ATOM 7121  C CA   . LEU A 1 32  ? 13.785  5.459   -1.892  1.00 0.00 ? 32  LEU A CA   4  
ATOM 7122  C C    . LEU A 1 32  ? 14.274  4.615   -0.719  1.00 0.00 ? 32  LEU A C    4  
ATOM 7123  O O    . LEU A 1 32  ? 14.346  3.389   -0.812  1.00 0.00 ? 32  LEU A O    4  
ATOM 7124  C CB   . LEU A 1 32  ? 12.483  6.168   -1.517  1.00 0.00 ? 32  LEU A CB   4  
ATOM 7125  C CG   . LEU A 1 32  ? 11.886  7.085   -2.586  1.00 0.00 ? 32  LEU A CG   4  
ATOM 7126  C CD1  . LEU A 1 32  ? 10.445  7.433   -2.247  1.00 0.00 ? 32  LEU A CD1  4  
ATOM 7127  C CD2  . LEU A 1 32  ? 12.721  8.349   -2.730  1.00 0.00 ? 32  LEU A CD2  4  
ATOM 7128  H H    . LEU A 1 32  ? 12.834  4.011   -3.108  1.00 0.00 ? 32  LEU A H    4  
ATOM 7129  H HA   . LEU A 1 32  ? 14.535  6.200   -2.124  1.00 0.00 ? 32  LEU A HA   4  
ATOM 7130  H HB2  . LEU A 1 32  ? 11.749  5.411   -1.285  1.00 0.00 ? 32  LEU A HB2  4  
ATOM 7131  H HB3  . LEU A 1 32  ? 12.673  6.764   -0.636  1.00 0.00 ? 32  LEU A HB3  4  
ATOM 7132  H HG   . LEU A 1 32  ? 11.890  6.570   -3.537  1.00 0.00 ? 32  LEU A HG   4  
ATOM 7133  H HD11 . LEU A 1 32  ? 10.248  7.183   -1.216  1.00 0.00 ? 32  LEU A HD11 4  
ATOM 7134  H HD12 . LEU A 1 32  ? 9.780   6.871   -2.887  1.00 0.00 ? 32  LEU A HD12 4  
ATOM 7135  H HD13 . LEU A 1 32  ? 10.283  8.489   -2.400  1.00 0.00 ? 32  LEU A HD13 4  
ATOM 7136  H HD21 . LEU A 1 32  ? 13.751  8.128   -2.493  1.00 0.00 ? 32  LEU A HD21 4  
ATOM 7137  H HD22 . LEU A 1 32  ? 12.350  9.105   -2.053  1.00 0.00 ? 32  LEU A HD22 4  
ATOM 7138  H HD23 . LEU A 1 32  ? 12.655  8.710   -3.745  1.00 0.00 ? 32  LEU A HD23 4  
ATOM 7139  N N    . SER A 1 33  ? 14.605  5.278   0.383   1.00 0.00 ? 33  SER A N    4  
ATOM 7140  C CA   . SER A 1 33  ? 15.088  4.589   1.574   1.00 0.00 ? 33  SER A CA   4  
ATOM 7141  C C    . SER A 1 33  ? 14.064  4.672   2.702   1.00 0.00 ? 33  SER A C    4  
ATOM 7142  O O    . SER A 1 33  ? 13.602  5.756   3.056   1.00 0.00 ? 33  SER A O    4  
ATOM 7143  C CB   . SER A 1 33  ? 16.418  5.190   2.033   1.00 0.00 ? 33  SER A CB   4  
ATOM 7144  O OG   . SER A 1 33  ? 16.320  6.596   2.178   1.00 0.00 ? 33  SER A OG   4  
ATOM 7145  H H    . SER A 1 33  ? 14.525  6.255   0.395   1.00 0.00 ? 33  SER A H    4  
ATOM 7146  H HA   . SER A 1 33  ? 15.240  3.551   1.317   1.00 0.00 ? 33  SER A HA   4  
ATOM 7147  H HB2  . SER A 1 33  ? 16.696  4.760   2.983   1.00 0.00 ? 33  SER A HB2  4  
ATOM 7148  H HB3  . SER A 1 33  ? 17.181  4.968   1.300   1.00 0.00 ? 33  SER A HB3  4  
ATOM 7149  H HG   . SER A 1 33  ? 15.755  6.802   2.927   1.00 0.00 ? 33  SER A HG   4  
ATOM 7150  N N    . ILE A 1 34  ? 13.716  3.518   3.261   1.00 0.00 ? 34  ILE A N    4  
ATOM 7151  C CA   . ILE A 1 34  ? 12.748  3.459   4.350   1.00 0.00 ? 34  ILE A CA   4  
ATOM 7152  C C    . ILE A 1 34  ? 13.381  3.877   5.673   1.00 0.00 ? 34  ILE A C    4  
ATOM 7153  O O    . ILE A 1 34  ? 12.745  4.529   6.499   1.00 0.00 ? 34  ILE A O    4  
ATOM 7154  C CB   . ILE A 1 34  ? 12.157  2.045   4.501   1.00 0.00 ? 34  ILE A CB   4  
ATOM 7155  C CG1  . ILE A 1 34  ? 11.389  1.652   3.238   1.00 0.00 ? 34  ILE A CG1  4  
ATOM 7156  C CG2  . ILE A 1 34  ? 11.250  1.978   5.721   1.00 0.00 ? 34  ILE A CG2  4  
ATOM 7157  C CD1  . ILE A 1 34  ? 11.397  0.164   2.964   1.00 0.00 ? 34  ILE A CD1  4  
ATOM 7158  H H    . ILE A 1 34  ? 14.120  2.687   2.935   1.00 0.00 ? 34  ILE A H    4  
ATOM 7159  H HA   . ILE A 1 34  ? 11.943  4.141   4.116   1.00 0.00 ? 34  ILE A HA   4  
ATOM 7160  H HB   . ILE A 1 34  ? 12.971  1.353   4.649   1.00 0.00 ? 34  ILE A HB   4  
ATOM 7161  H HG12 . ILE A 1 34  ? 10.362  1.964   3.336   1.00 0.00 ? 34  ILE A HG12 4  
ATOM 7162  H HG13 . ILE A 1 34  ? 11.832  2.148   2.387   1.00 0.00 ? 34  ILE A HG13 4  
ATOM 7163  H HG21 . ILE A 1 34  ? 11.776  2.364   6.582   1.00 0.00 ? 34  ILE A HG21 4  
ATOM 7164  H HG22 . ILE A 1 34  ? 10.365  2.571   5.545   1.00 0.00 ? 34  ILE A HG22 4  
ATOM 7165  H HG23 . ILE A 1 34  ? 10.965  0.952   5.903   1.00 0.00 ? 34  ILE A HG23 4  
ATOM 7166  H HD11 . ILE A 1 34  ? 10.891  -0.353  3.767   1.00 0.00 ? 34  ILE A HD11 4  
ATOM 7167  H HD12 . ILE A 1 34  ? 10.891  -0.034  2.032   1.00 0.00 ? 34  ILE A HD12 4  
ATOM 7168  H HD13 . ILE A 1 34  ? 12.417  -0.185  2.901   1.00 0.00 ? 34  ILE A HD13 4  
ATOM 7169  N N    . GLY A 1 35  ? 14.642  3.498   5.865   1.00 0.00 ? 35  GLY A N    4  
ATOM 7170  C CA   . GLY A 1 35  ? 15.342  3.844   7.088   1.00 0.00 ? 35  GLY A CA   4  
ATOM 7171  C C    . GLY A 1 35  ? 15.598  2.639   7.971   1.00 0.00 ? 35  GLY A C    4  
ATOM 7172  O O    . GLY A 1 35  ? 15.282  1.503   7.613   1.00 0.00 ? 35  GLY A O    4  
ATOM 7173  H H    . GLY A 1 35  ? 15.098  2.979   5.171   1.00 0.00 ? 35  GLY A H    4  
ATOM 7174  H HA2  . GLY A 1 35  ? 16.287  4.299   6.832   1.00 0.00 ? 35  GLY A HA2  4  
ATOM 7175  H HA3  . GLY A 1 35  ? 14.748  4.559   7.640   1.00 0.00 ? 35  GLY A HA3  4  
ATOM 7176  N N    . PRO A 1 36  ? 16.187  2.879   9.151   1.00 0.00 ? 36  PRO A N    4  
ATOM 7177  C CA   . PRO A 1 36  ? 16.501  1.816   10.111  1.00 0.00 ? 36  PRO A CA   4  
ATOM 7178  C C    . PRO A 1 36  ? 15.249  1.221   10.745  1.00 0.00 ? 36  PRO A C    4  
ATOM 7179  O O    . PRO A 1 36  ? 15.333  0.313   11.573  1.00 0.00 ? 36  PRO A O    4  
ATOM 7180  C CB   . PRO A 1 36  ? 17.349  2.529   11.166  1.00 0.00 ? 36  PRO A CB   4  
ATOM 7181  C CG   . PRO A 1 36  ? 16.933  3.958   11.083  1.00 0.00 ? 36  PRO A CG   4  
ATOM 7182  C CD   . PRO A 1 36  ? 16.593  4.207   9.640   1.00 0.00 ? 36  PRO A CD   4  
ATOM 7183  H HA   . PRO A 1 36  ? 17.081  1.027   9.653   1.00 0.00 ? 36  PRO A HA   4  
ATOM 7184  H HB2  . PRO A 1 36  ? 17.140  2.112   12.141  1.00 0.00 ? 36  PRO A HB2  4  
ATOM 7185  H HB3  . PRO A 1 36  ? 18.396  2.409   10.933  1.00 0.00 ? 36  PRO A HB3  4  
ATOM 7186  H HG2  . PRO A 1 36  ? 16.068  4.125   11.707  1.00 0.00 ? 36  PRO A HG2  4  
ATOM 7187  H HG3  . PRO A 1 36  ? 17.748  4.595   11.392  1.00 0.00 ? 36  PRO A HG3  4  
ATOM 7188  H HD2  . PRO A 1 36  ? 15.778  4.912   9.562   1.00 0.00 ? 36  PRO A HD2  4  
ATOM 7189  H HD3  . PRO A 1 36  ? 17.459  4.566   9.105   1.00 0.00 ? 36  PRO A HD3  4  
ATOM 7190  N N    . ASP A 1 37  ? 14.090  1.736   10.353  1.00 0.00 ? 37  ASP A N    4  
ATOM 7191  C CA   . ASP A 1 37  ? 12.820  1.254   10.882  1.00 0.00 ? 37  ASP A CA   4  
ATOM 7192  C C    . ASP A 1 37  ? 11.745  1.248   9.799   1.00 0.00 ? 37  ASP A C    4  
ATOM 7193  O O    . ASP A 1 37  ? 11.640  2.187   9.010   1.00 0.00 ? 37  ASP A O    4  
ATOM 7194  C CB   . ASP A 1 37  ? 12.370  2.123   12.059  1.00 0.00 ? 37  ASP A CB   4  
ATOM 7195  C CG   . ASP A 1 37  ? 11.305  1.451   12.902  1.00 0.00 ? 37  ASP A CG   4  
ATOM 7196  O OD1  . ASP A 1 37  ? 10.212  1.176   12.367  1.00 0.00 ? 37  ASP A OD1  4  
ATOM 7197  O OD2  . ASP A 1 37  ? 11.566  1.200   14.098  1.00 0.00 ? 37  ASP A OD2  4  
ATOM 7198  H H    . ASP A 1 37  ? 14.088  2.458   9.689   1.00 0.00 ? 37  ASP A H    4  
ATOM 7199  H HA   . ASP A 1 37  ? 12.968  0.243   11.230  1.00 0.00 ? 37  ASP A HA   4  
ATOM 7200  H HB2  . ASP A 1 37  ? 13.223  2.334   12.688  1.00 0.00 ? 37  ASP A HB2  4  
ATOM 7201  H HB3  . ASP A 1 37  ? 11.970  3.052   11.679  1.00 0.00 ? 37  ASP A HB3  4  
ATOM 7202  N N    . PHE A 1 38  ? 10.951  0.183   9.766   1.00 0.00 ? 38  PHE A N    4  
ATOM 7203  C CA   . PHE A 1 38  ? 9.887   0.054   8.778   1.00 0.00 ? 38  PHE A CA   4  
ATOM 7204  C C    . PHE A 1 38  ? 8.677   0.897   9.168   1.00 0.00 ? 38  PHE A C    4  
ATOM 7205  O O    . PHE A 1 38  ? 8.321   1.848   8.472   1.00 0.00 ? 38  PHE A O    4  
ATOM 7206  C CB   . PHE A 1 38  ? 9.473   -1.412  8.632   1.00 0.00 ? 38  PHE A CB   4  
ATOM 7207  C CG   . PHE A 1 38  ? 8.801   -1.718  7.324   1.00 0.00 ? 38  PHE A CG   4  
ATOM 7208  C CD1  . PHE A 1 38  ? 9.504   -1.638  6.133   1.00 0.00 ? 38  PHE A CD1  4  
ATOM 7209  C CD2  . PHE A 1 38  ? 7.465   -2.085  7.286   1.00 0.00 ? 38  PHE A CD2  4  
ATOM 7210  C CE1  . PHE A 1 38  ? 8.886   -1.918  4.928   1.00 0.00 ? 38  PHE A CE1  4  
ATOM 7211  C CE2  . PHE A 1 38  ? 6.842   -2.366  6.084   1.00 0.00 ? 38  PHE A CE2  4  
ATOM 7212  C CZ   . PHE A 1 38  ? 7.555   -2.283  4.904   1.00 0.00 ? 38  PHE A CZ   4  
ATOM 7213  H H    . PHE A 1 38  ? 11.085  -0.533  10.422  1.00 0.00 ? 38  PHE A H    4  
ATOM 7214  H HA   . PHE A 1 38  ? 10.268  0.408   7.833   1.00 0.00 ? 38  PHE A HA   4  
ATOM 7215  H HB2  . PHE A 1 38  ? 10.352  -2.036  8.706   1.00 0.00 ? 38  PHE A HB2  4  
ATOM 7216  H HB3  . PHE A 1 38  ? 8.789   -1.666  9.426   1.00 0.00 ? 38  PHE A HB3  4  
ATOM 7217  H HD1  . PHE A 1 38  ? 10.545  -1.353  6.150   1.00 0.00 ? 38  PHE A HD1  4  
ATOM 7218  H HD2  . PHE A 1 38  ? 6.907   -2.150  8.210   1.00 0.00 ? 38  PHE A HD2  4  
ATOM 7219  H HE1  . PHE A 1 38  ? 9.445   -1.852  4.007   1.00 0.00 ? 38  PHE A HE1  4  
ATOM 7220  H HE2  . PHE A 1 38  ? 5.801   -2.651  6.070   1.00 0.00 ? 38  PHE A HE2  4  
ATOM 7221  H HZ   . PHE A 1 38  ? 7.070   -2.502  3.964   1.00 0.00 ? 38  PHE A HZ   4  
ATOM 7222  N N    . GLN A 1 39  ? 8.051   0.543   10.285  1.00 0.00 ? 39  GLN A N    4  
ATOM 7223  C CA   . GLN A 1 39  ? 6.881   1.268   10.767  1.00 0.00 ? 39  GLN A CA   4  
ATOM 7224  C C    . GLN A 1 39  ? 7.075   2.774   10.624  1.00 0.00 ? 39  GLN A C    4  
ATOM 7225  O O    . GLN A 1 39  ? 6.196   3.480   10.129  1.00 0.00 ? 39  GLN A O    4  
ATOM 7226  C CB   . GLN A 1 39  ? 6.603   0.914   12.229  1.00 0.00 ? 39  GLN A CB   4  
ATOM 7227  C CG   . GLN A 1 39  ? 5.335   1.548   12.778  1.00 0.00 ? 39  GLN A CG   4  
ATOM 7228  C CD   . GLN A 1 39  ? 5.584   2.907   13.403  1.00 0.00 ? 39  GLN A CD   4  
ATOM 7229  O OE1  . GLN A 1 39  ? 6.289   3.020   14.408  1.00 0.00 ? 39  GLN A OE1  4  
ATOM 7230  N NE2  . GLN A 1 39  ? 5.007   3.946   12.814  1.00 0.00 ? 39  GLN A NE2  4  
ATOM 7231  H H    . GLN A 1 39  ? 8.383   -0.222  10.797  1.00 0.00 ? 39  GLN A H    4  
ATOM 7232  H HA   . GLN A 1 39  ? 6.035   0.968   10.167  1.00 0.00 ? 39  GLN A HA   4  
ATOM 7233  H HB2  . GLN A 1 39  ? 6.512   -0.158  12.317  1.00 0.00 ? 39  GLN A HB2  4  
ATOM 7234  H HB3  . GLN A 1 39  ? 7.435   1.248   12.832  1.00 0.00 ? 39  GLN A HB3  4  
ATOM 7235  H HG2  . GLN A 1 39  ? 4.628   1.667   11.970  1.00 0.00 ? 39  GLN A HG2  4  
ATOM 7236  H HG3  . GLN A 1 39  ? 4.916   0.893   13.528  1.00 0.00 ? 39  GLN A HG3  4  
ATOM 7237  H HE21 . GLN A 1 39  ? 4.458   3.780   12.017  1.00 0.00 ? 39  GLN A HE21 4  
ATOM 7238  H HE22 . GLN A 1 39  ? 5.150   4.835   13.197  1.00 0.00 ? 39  GLN A HE22 4  
ATOM 7239  N N    . LYS A 1 40  ? 8.232   3.260   11.060  1.00 0.00 ? 40  LYS A N    4  
ATOM 7240  C CA   . LYS A 1 40  ? 8.544   4.682   10.981  1.00 0.00 ? 40  LYS A CA   4  
ATOM 7241  C C    . LYS A 1 40  ? 8.758   5.111   9.533   1.00 0.00 ? 40  LYS A C    4  
ATOM 7242  O O    . LYS A 1 40  ? 8.069   5.998   9.030   1.00 0.00 ? 40  LYS A O    4  
ATOM 7243  C CB   . LYS A 1 40  ? 9.791   4.999   11.808  1.00 0.00 ? 40  LYS A CB   4  
ATOM 7244  C CG   . LYS A 1 40  ? 9.697   4.540   13.252  1.00 0.00 ? 40  LYS A CG   4  
ATOM 7245  C CD   . LYS A 1 40  ? 10.985  4.817   14.011  1.00 0.00 ? 40  LYS A CD   4  
ATOM 7246  C CE   . LYS A 1 40  ? 10.816  4.572   15.503  1.00 0.00 ? 40  LYS A CE   4  
ATOM 7247  N NZ   . LYS A 1 40  ? 11.725  5.430   16.311  1.00 0.00 ? 40  LYS A NZ   4  
ATOM 7248  H H    . LYS A 1 40  ? 8.893   2.647   11.446  1.00 0.00 ? 40  LYS A H    4  
ATOM 7249  H HA   . LYS A 1 40  ? 7.706   5.229   11.385  1.00 0.00 ? 40  LYS A HA   4  
ATOM 7250  H HB2  . LYS A 1 40  ? 10.643  4.515   11.352  1.00 0.00 ? 40  LYS A HB2  4  
ATOM 7251  H HB3  . LYS A 1 40  ? 9.951   6.068   11.802  1.00 0.00 ? 40  LYS A HB3  4  
ATOM 7252  H HG2  . LYS A 1 40  ? 8.888   5.067   13.736  1.00 0.00 ? 40  LYS A HG2  4  
ATOM 7253  H HG3  . LYS A 1 40  ? 9.500   3.478   13.271  1.00 0.00 ? 40  LYS A HG3  4  
ATOM 7254  H HD2  . LYS A 1 40  ? 11.759  4.165   13.636  1.00 0.00 ? 40  LYS A HD2  4  
ATOM 7255  H HD3  . LYS A 1 40  ? 11.270  5.848   13.854  1.00 0.00 ? 40  LYS A HD3  4  
ATOM 7256  H HE2  . LYS A 1 40  ? 9.794   4.786   15.776  1.00 0.00 ? 40  LYS A HE2  4  
ATOM 7257  H HE3  . LYS A 1 40  ? 11.035  3.535   15.711  1.00 0.00 ? 40  LYS A HE3  4  
ATOM 7258  H HZ1  . LYS A 1 40  ? 12.472  4.850   16.744  1.00 0.00 ? 40  LYS A HZ1  4  
ATOM 7259  H HZ2  . LYS A 1 40  ? 11.191  5.905   17.067  1.00 0.00 ? 40  LYS A HZ2  4  
ATOM 7260  H HZ3  . LYS A 1 40  ? 12.167  6.152   15.708  1.00 0.00 ? 40  LYS A HZ3  4  
ATOM 7261  N N    . GLY A 1 41  ? 9.716   4.475   8.867   1.00 0.00 ? 41  GLY A N    4  
ATOM 7262  C CA   . GLY A 1 41  ? 10.002  4.804   7.482   1.00 0.00 ? 41  GLY A CA   4  
ATOM 7263  C C    . GLY A 1 41  ? 8.744   5.007   6.663   1.00 0.00 ? 41  GLY A C    4  
ATOM 7264  O O    . GLY A 1 41  ? 8.729   5.797   5.718   1.00 0.00 ? 41  GLY A O    4  
ATOM 7265  H H    . GLY A 1 41  ? 10.234  3.776   9.319   1.00 0.00 ? 41  GLY A H    4  
ATOM 7266  H HA2  . GLY A 1 41  ? 10.588  5.711   7.453   1.00 0.00 ? 41  GLY A HA2  4  
ATOM 7267  H HA3  . GLY A 1 41  ? 10.577  4.002   7.045   1.00 0.00 ? 41  GLY A HA3  4  
ATOM 7268  N N    . LEU A 1 42  ? 7.683   4.292   7.023   1.00 0.00 ? 42  LEU A N    4  
ATOM 7269  C CA   . LEU A 1 42  ? 6.413   4.395   6.313   1.00 0.00 ? 42  LEU A CA   4  
ATOM 7270  C C    . LEU A 1 42  ? 5.430   5.273   7.081   1.00 0.00 ? 42  LEU A C    4  
ATOM 7271  O O    . LEU A 1 42  ? 4.564   5.918   6.490   1.00 0.00 ? 42  LEU A O    4  
ATOM 7272  C CB   . LEU A 1 42  ? 5.812   3.005   6.097   1.00 0.00 ? 42  LEU A CB   4  
ATOM 7273  C CG   . LEU A 1 42  ? 6.754   1.950   5.515   1.00 0.00 ? 42  LEU A CG   4  
ATOM 7274  C CD1  . LEU A 1 42  ? 6.029   0.624   5.348   1.00 0.00 ? 42  LEU A CD1  4  
ATOM 7275  C CD2  . LEU A 1 42  ? 7.324   2.421   4.185   1.00 0.00 ? 42  LEU A CD2  4  
ATOM 7276  H H    . LEU A 1 42  ? 7.755   3.680   7.784   1.00 0.00 ? 42  LEU A H    4  
ATOM 7277  H HA   . LEU A 1 42  ? 6.607   4.848   5.353   1.00 0.00 ? 42  LEU A HA   4  
ATOM 7278  H HB2  . LEU A 1 42  ? 5.462   2.645   7.052   1.00 0.00 ? 42  LEU A HB2  4  
ATOM 7279  H HB3  . LEU A 1 42  ? 4.973   3.110   5.423   1.00 0.00 ? 42  LEU A HB3  4  
ATOM 7280  H HG   . LEU A 1 42  ? 7.577   1.797   6.198   1.00 0.00 ? 42  LEU A HG   4  
ATOM 7281  H HD11 . LEU A 1 42  ? 5.165   0.762   4.717   1.00 0.00 ? 42  LEU A HD11 4  
ATOM 7282  H HD12 . LEU A 1 42  ? 5.714   0.261   6.315   1.00 0.00 ? 42  LEU A HD12 4  
ATOM 7283  H HD13 . LEU A 1 42  ? 6.696   -0.096  4.894   1.00 0.00 ? 42  LEU A HD13 4  
ATOM 7284  H HD21 . LEU A 1 42  ? 8.222   2.994   4.362   1.00 0.00 ? 42  LEU A HD21 4  
ATOM 7285  H HD22 . LEU A 1 42  ? 6.596   3.037   3.679   1.00 0.00 ? 42  LEU A HD22 4  
ATOM 7286  H HD23 . LEU A 1 42  ? 7.560   1.563   3.572   1.00 0.00 ? 42  LEU A HD23 4  
ATOM 7287  N N    . LYS A 1 43  ? 5.571   5.296   8.401   1.00 0.00 ? 43  LYS A N    4  
ATOM 7288  C CA   . LYS A 1 43  ? 4.699   6.097   9.252   1.00 0.00 ? 43  LYS A CA   4  
ATOM 7289  C C    . LYS A 1 43  ? 4.334   7.412   8.572   1.00 0.00 ? 43  LYS A C    4  
ATOM 7290  O O    . LYS A 1 43  ? 3.202   7.599   8.128   1.00 0.00 ? 43  LYS A O    4  
ATOM 7291  C CB   . LYS A 1 43  ? 5.378   6.377   10.594  1.00 0.00 ? 43  LYS A CB   4  
ATOM 7292  C CG   . LYS A 1 43  ? 4.761   7.535   11.358  1.00 0.00 ? 43  LYS A CG   4  
ATOM 7293  C CD   . LYS A 1 43  ? 5.594   7.910   12.573  1.00 0.00 ? 43  LYS A CD   4  
ATOM 7294  C CE   . LYS A 1 43  ? 5.234   9.294   13.090  1.00 0.00 ? 43  LYS A CE   4  
ATOM 7295  N NZ   . LYS A 1 43  ? 6.059   10.356  12.451  1.00 0.00 ? 43  LYS A NZ   4  
ATOM 7296  H H    . LYS A 1 43  ? 6.281   4.760   8.815   1.00 0.00 ? 43  LYS A H    4  
ATOM 7297  H HA   . LYS A 1 43  ? 3.795   5.533   9.425   1.00 0.00 ? 43  LYS A HA   4  
ATOM 7298  H HB2  . LYS A 1 43  ? 5.311   5.491   11.209  1.00 0.00 ? 43  LYS A HB2  4  
ATOM 7299  H HB3  . LYS A 1 43  ? 6.419   6.604   10.417  1.00 0.00 ? 43  LYS A HB3  4  
ATOM 7300  H HG2  . LYS A 1 43  ? 4.693   8.391   10.704  1.00 0.00 ? 43  LYS A HG2  4  
ATOM 7301  H HG3  . LYS A 1 43  ? 3.770   7.252   11.686  1.00 0.00 ? 43  LYS A HG3  4  
ATOM 7302  H HD2  . LYS A 1 43  ? 5.416   7.188   13.356  1.00 0.00 ? 43  LYS A HD2  4  
ATOM 7303  H HD3  . LYS A 1 43  ? 6.639   7.897   12.299  1.00 0.00 ? 43  LYS A HD3  4  
ATOM 7304  H HE2  . LYS A 1 43  ? 4.193   9.483   12.880  1.00 0.00 ? 43  LYS A HE2  4  
ATOM 7305  H HE3  . LYS A 1 43  ? 5.396   9.318   14.158  1.00 0.00 ? 43  LYS A HE3  4  
ATOM 7306  H HZ1  . LYS A 1 43  ? 5.692   10.569  11.501  1.00 0.00 ? 43  LYS A HZ1  4  
ATOM 7307  H HZ2  . LYS A 1 43  ? 7.046   10.040  12.365  1.00 0.00 ? 43  LYS A HZ2  4  
ATOM 7308  H HZ3  . LYS A 1 43  ? 6.031   11.224  13.024  1.00 0.00 ? 43  LYS A HZ3  4  
ATOM 7309  N N    . ASP A 1 44  ? 5.301   8.319   8.491   1.00 0.00 ? 44  ASP A N    4  
ATOM 7310  C CA   . ASP A 1 44  ? 5.082   9.616   7.860   1.00 0.00 ? 44  ASP A CA   4  
ATOM 7311  C C    . ASP A 1 44  ? 4.232   9.474   6.602   1.00 0.00 ? 44  ASP A C    4  
ATOM 7312  O O    . ASP A 1 44  ? 3.474   10.374  6.247   1.00 0.00 ? 44  ASP A O    4  
ATOM 7313  C CB   . ASP A 1 44  ? 6.420   10.272  7.516   1.00 0.00 ? 44  ASP A CB   4  
ATOM 7314  C CG   . ASP A 1 44  ? 7.422   9.282   6.954   1.00 0.00 ? 44  ASP A CG   4  
ATOM 7315  O OD1  . ASP A 1 44  ? 7.089   8.596   5.965   1.00 0.00 ? 44  ASP A OD1  4  
ATOM 7316  O OD2  . ASP A 1 44  ? 8.540   9.194   7.504   1.00 0.00 ? 44  ASP A OD2  4  
ATOM 7317  H H    . ASP A 1 44  ? 6.184   8.112   8.863   1.00 0.00 ? 44  ASP A H    4  
ATOM 7318  H HA   . ASP A 1 44  ? 4.556   10.243  8.566   1.00 0.00 ? 44  ASP A HA   4  
ATOM 7319  H HB2  . ASP A 1 44  ? 6.255   11.045  6.779   1.00 0.00 ? 44  ASP A HB2  4  
ATOM 7320  H HB3  . ASP A 1 44  ? 6.839   10.714  8.408   1.00 0.00 ? 44  ASP A HB3  4  
ATOM 7321  N N    . GLY A 1 45  ? 4.365   8.333   5.931   1.00 0.00 ? 45  GLY A N    4  
ATOM 7322  C CA   . GLY A 1 45  ? 3.604   8.093   4.719   1.00 0.00 ? 45  GLY A CA   4  
ATOM 7323  C C    . GLY A 1 45  ? 4.181   8.817   3.519   1.00 0.00 ? 45  GLY A C    4  
ATOM 7324  O O    . GLY A 1 45  ? 3.445   9.394   2.718   1.00 0.00 ? 45  GLY A O    4  
ATOM 7325  H H    . GLY A 1 45  ? 4.985   7.650   6.261   1.00 0.00 ? 45  GLY A H    4  
ATOM 7326  H HA2  . GLY A 1 45  ? 3.595   7.033   4.517   1.00 0.00 ? 45  GLY A HA2  4  
ATOM 7327  H HA3  . GLY A 1 45  ? 2.589   8.428   4.873   1.00 0.00 ? 45  GLY A HA3  4  
ATOM 7328  N N    . THR A 1 46  ? 5.504   8.790   3.393   1.00 0.00 ? 46  THR A N    4  
ATOM 7329  C CA   . THR A 1 46  ? 6.181   9.451   2.284   1.00 0.00 ? 46  THR A CA   4  
ATOM 7330  C C    . THR A 1 46  ? 6.443   8.477   1.141   1.00 0.00 ? 46  THR A C    4  
ATOM 7331  O O    . THR A 1 46  ? 6.164   8.780   -0.020  1.00 0.00 ? 46  THR A O    4  
ATOM 7332  C CB   . THR A 1 46  ? 7.518   10.072  2.732   1.00 0.00 ? 46  THR A CB   4  
ATOM 7333  O OG1  . THR A 1 46  ? 8.400   9.047   3.204   1.00 0.00 ? 46  THR A OG1  4  
ATOM 7334  C CG2  . THR A 1 46  ? 7.297   11.103  3.827   1.00 0.00 ? 46  THR A CG2  4  
ATOM 7335  H H    . THR A 1 46  ? 6.037   8.313   4.063   1.00 0.00 ? 46  THR A H    4  
ATOM 7336  H HA   . THR A 1 46  ? 5.540   10.245  1.929   1.00 0.00 ? 46  THR A HA   4  
ATOM 7337  H HB   . THR A 1 46  ? 7.971   10.562  1.882   1.00 0.00 ? 46  THR A HB   4  
ATOM 7338  H HG1  . THR A 1 46  ? 9.232   9.095   2.727   1.00 0.00 ? 46  THR A HG1  4  
ATOM 7339  H HG21 . THR A 1 46  ? 6.350   11.599  3.669   1.00 0.00 ? 46  THR A HG21 4  
ATOM 7340  H HG22 . THR A 1 46  ? 8.094   11.830  3.803   1.00 0.00 ? 46  THR A HG22 4  
ATOM 7341  H HG23 . THR A 1 46  ? 7.287   10.610  4.788   1.00 0.00 ? 46  THR A HG23 4  
ATOM 7342  N N    . ILE A 1 47  ? 6.979   7.309   1.476   1.00 0.00 ? 47  ILE A N    4  
ATOM 7343  C CA   . ILE A 1 47  ? 7.276   6.291   0.475   1.00 0.00 ? 47  ILE A CA   4  
ATOM 7344  C C    . ILE A 1 47  ? 6.013   5.545   0.057   1.00 0.00 ? 47  ILE A C    4  
ATOM 7345  O O    . ILE A 1 47  ? 5.688   5.468   -1.128  1.00 0.00 ? 47  ILE A O    4  
ATOM 7346  C CB   . ILE A 1 47  ? 8.309   5.274   0.998   1.00 0.00 ? 47  ILE A CB   4  
ATOM 7347  C CG1  . ILE A 1 47  ? 9.653   5.961   1.245   1.00 0.00 ? 47  ILE A CG1  4  
ATOM 7348  C CG2  . ILE A 1 47  ? 8.467   4.127   0.011   1.00 0.00 ? 47  ILE A CG2  4  
ATOM 7349  C CD1  . ILE A 1 47  ? 10.458  5.331   2.360   1.00 0.00 ? 47  ILE A CD1  4  
ATOM 7350  H H    . ILE A 1 47  ? 7.178   7.127   2.417   1.00 0.00 ? 47  ILE A H    4  
ATOM 7351  H HA   . ILE A 1 47  ? 7.693   6.785   -0.389  1.00 0.00 ? 47  ILE A HA   4  
ATOM 7352  H HB   . ILE A 1 47  ? 7.943   4.868   1.928   1.00 0.00 ? 47  ILE A HB   4  
ATOM 7353  H HG12 . ILE A 1 47  ? 10.244  5.916   0.344   1.00 0.00 ? 47  ILE A HG12 4  
ATOM 7354  H HG13 . ILE A 1 47  ? 9.478   6.995   1.505   1.00 0.00 ? 47  ILE A HG13 4  
ATOM 7355  H HG21 . ILE A 1 47  ? 7.969   4.377   -0.914  1.00 0.00 ? 47  ILE A HG21 4  
ATOM 7356  H HG22 . ILE A 1 47  ? 9.516   3.959   -0.180  1.00 0.00 ? 47  ILE A HG22 4  
ATOM 7357  H HG23 . ILE A 1 47  ? 8.028   3.231   0.425   1.00 0.00 ? 47  ILE A HG23 4  
ATOM 7358  H HD11 . ILE A 1 47  ? 9.827   4.658   2.924   1.00 0.00 ? 47  ILE A HD11 4  
ATOM 7359  H HD12 . ILE A 1 47  ? 11.286  4.781   1.941   1.00 0.00 ? 47  ILE A HD12 4  
ATOM 7360  H HD13 . ILE A 1 47  ? 10.832  6.104   3.015   1.00 0.00 ? 47  ILE A HD13 4  
ATOM 7361  N N    . LEU A 1 48  ? 5.300   5.002   1.038   1.00 0.00 ? 48  LEU A N    4  
ATOM 7362  C CA   . LEU A 1 48  ? 4.070   4.264   0.773   1.00 0.00 ? 48  LEU A CA   4  
ATOM 7363  C C    . LEU A 1 48  ? 3.334   4.848   -0.429  1.00 0.00 ? 48  LEU A C    4  
ATOM 7364  O O    . LEU A 1 48  ? 2.786   4.113   -1.251  1.00 0.00 ? 48  LEU A O    4  
ATOM 7365  C CB   . LEU A 1 48  ? 3.162   4.289   2.004   1.00 0.00 ? 48  LEU A CB   4  
ATOM 7366  C CG   . LEU A 1 48  ? 3.533   3.325   3.130   1.00 0.00 ? 48  LEU A CG   4  
ATOM 7367  C CD1  . LEU A 1 48  ? 2.515   3.404   4.257   1.00 0.00 ? 48  LEU A CD1  4  
ATOM 7368  C CD2  . LEU A 1 48  ? 3.637   1.901   2.602   1.00 0.00 ? 48  LEU A CD2  4  
ATOM 7369  H H    . LEU A 1 48  ? 5.609   5.097   1.963   1.00 0.00 ? 48  LEU A H    4  
ATOM 7370  H HA   . LEU A 1 48  ? 4.338   3.241   0.554   1.00 0.00 ? 48  LEU A HA   4  
ATOM 7371  H HB2  . LEU A 1 48  ? 3.179   5.290   2.406   1.00 0.00 ? 48  LEU A HB2  4  
ATOM 7372  H HB3  . LEU A 1 48  ? 2.159   4.049   1.678   1.00 0.00 ? 48  LEU A HB3  4  
ATOM 7373  H HG   . LEU A 1 48  ? 4.497   3.603   3.533   1.00 0.00 ? 48  LEU A HG   4  
ATOM 7374  H HD11 . LEU A 1 48  ? 2.324   2.413   4.641   1.00 0.00 ? 48  LEU A HD11 4  
ATOM 7375  H HD12 . LEU A 1 48  ? 1.596   3.828   3.882   1.00 0.00 ? 48  LEU A HD12 4  
ATOM 7376  H HD13 . LEU A 1 48  ? 2.902   4.029   5.049   1.00 0.00 ? 48  LEU A HD13 4  
ATOM 7377  H HD21 . LEU A 1 48  ? 2.900   1.751   1.827   1.00 0.00 ? 48  LEU A HD21 4  
ATOM 7378  H HD22 . LEU A 1 48  ? 3.458   1.204   3.408   1.00 0.00 ? 48  LEU A HD22 4  
ATOM 7379  H HD23 . LEU A 1 48  ? 4.624   1.739   2.198   1.00 0.00 ? 48  LEU A HD23 4  
ATOM 7380  N N    . CYS A 1 49  ? 3.327   6.173   -0.525  1.00 0.00 ? 49  CYS A N    4  
ATOM 7381  C CA   . CYS A 1 49  ? 2.660   6.856   -1.627  1.00 0.00 ? 49  CYS A CA   4  
ATOM 7382  C C    . CYS A 1 49  ? 3.353   6.556   -2.952  1.00 0.00 ? 49  CYS A C    4  
ATOM 7383  O O    . CYS A 1 49  ? 2.750   5.997   -3.870  1.00 0.00 ? 49  CYS A O    4  
ATOM 7384  C CB   . CYS A 1 49  ? 2.636   8.365   -1.380  1.00 0.00 ? 49  CYS A CB   4  
ATOM 7385  S SG   . CYS A 1 49  ? 1.348   8.905   -0.232  1.00 0.00 ? 49  CYS A SG   4  
ATOM 7386  H H    . CYS A 1 49  ? 3.783   6.705   0.161   1.00 0.00 ? 49  CYS A H    4  
ATOM 7387  H HA   . CYS A 1 49  ? 1.645   6.492   -1.676  1.00 0.00 ? 49  CYS A HA   4  
ATOM 7388  H HB2  . CYS A 1 49  ? 3.588   8.671   -0.971  1.00 0.00 ? 49  CYS A HB2  4  
ATOM 7389  H HB3  . CYS A 1 49  ? 2.476   8.874   -2.319  1.00 0.00 ? 49  CYS A HB3  4  
ATOM 7390  H HG   . CYS A 1 49  ? 1.940   9.466   0.812   1.00 0.00 ? 49  CYS A HG   4  
ATOM 7391  N N    . THR A 1 50  ? 4.624   6.934   -3.048  1.00 0.00 ? 50  THR A N    4  
ATOM 7392  C CA   . THR A 1 50  ? 5.399   6.709   -4.262  1.00 0.00 ? 50  THR A CA   4  
ATOM 7393  C C    . THR A 1 50  ? 5.254   5.271   -4.748  1.00 0.00 ? 50  THR A C    4  
ATOM 7394  O O    . THR A 1 50  ? 5.068   5.024   -5.941  1.00 0.00 ? 50  THR A O    4  
ATOM 7395  C CB   . THR A 1 50  ? 6.892   7.014   -4.040  1.00 0.00 ? 50  THR A CB   4  
ATOM 7396  O OG1  . THR A 1 50  ? 7.355   6.361   -2.853  1.00 0.00 ? 50  THR A OG1  4  
ATOM 7397  C CG2  . THR A 1 50  ? 7.127   8.513   -3.923  1.00 0.00 ? 50  THR A CG2  4  
ATOM 7398  H H    . THR A 1 50  ? 5.049   7.375   -2.284  1.00 0.00 ? 50  THR A H    4  
ATOM 7399  H HA   . THR A 1 50  ? 5.026   7.377   -5.025  1.00 0.00 ? 50  THR A HA   4  
ATOM 7400  H HB   . THR A 1 50  ? 7.450   6.643   -4.887  1.00 0.00 ? 50  THR A HB   4  
ATOM 7401  H HG1  . THR A 1 50  ? 6.746   6.538   -2.132  1.00 0.00 ? 50  THR A HG1  4  
ATOM 7402  H HG21 . THR A 1 50  ? 8.149   8.696   -3.631  1.00 0.00 ? 50  THR A HG21 4  
ATOM 7403  H HG22 . THR A 1 50  ? 6.460   8.925   -3.180  1.00 0.00 ? 50  THR A HG22 4  
ATOM 7404  H HG23 . THR A 1 50  ? 6.935   8.982   -4.877  1.00 0.00 ? 50  THR A HG23 4  
ATOM 7405  N N    . LEU A 1 51  ? 5.337   4.326   -3.819  1.00 0.00 ? 51  LEU A N    4  
ATOM 7406  C CA   . LEU A 1 51  ? 5.213   2.912   -4.153  1.00 0.00 ? 51  LEU A CA   4  
ATOM 7407  C C    . LEU A 1 51  ? 4.027   2.673   -5.082  1.00 0.00 ? 51  LEU A C    4  
ATOM 7408  O O    . LEU A 1 51  ? 4.159   2.024   -6.118  1.00 0.00 ? 51  LEU A O    4  
ATOM 7409  C CB   . LEU A 1 51  ? 5.056   2.079   -2.880  1.00 0.00 ? 51  LEU A CB   4  
ATOM 7410  C CG   . LEU A 1 51  ? 4.586   0.636   -3.076  1.00 0.00 ? 51  LEU A CG   4  
ATOM 7411  C CD1  . LEU A 1 51  ? 5.599   -0.148  -3.896  1.00 0.00 ? 51  LEU A CD1  4  
ATOM 7412  C CD2  . LEU A 1 51  ? 4.352   -0.036  -1.730  1.00 0.00 ? 51  LEU A CD2  4  
ATOM 7413  H H    . LEU A 1 51  ? 5.485   4.584   -2.886  1.00 0.00 ? 51  LEU A H    4  
ATOM 7414  H HA   . LEU A 1 51  ? 6.118   2.611   -4.660  1.00 0.00 ? 51  LEU A HA   4  
ATOM 7415  H HB2  . LEU A 1 51  ? 6.013   2.050   -2.382  1.00 0.00 ? 51  LEU A HB2  4  
ATOM 7416  H HB3  . LEU A 1 51  ? 4.336   2.578   -2.245  1.00 0.00 ? 51  LEU A HB3  4  
ATOM 7417  H HG   . LEU A 1 51  ? 3.650   0.639   -3.617  1.00 0.00 ? 51  LEU A HG   4  
ATOM 7418  H HD11 . LEU A 1 51  ? 5.081   -0.755  -4.622  1.00 0.00 ? 51  LEU A HD11 4  
ATOM 7419  H HD12 . LEU A 1 51  ? 6.177   -0.783  -3.241  1.00 0.00 ? 51  LEU A HD12 4  
ATOM 7420  H HD13 . LEU A 1 51  ? 6.260   0.539   -4.404  1.00 0.00 ? 51  LEU A HD13 4  
ATOM 7421  H HD21 . LEU A 1 51  ? 4.949   0.454   -0.975  1.00 0.00 ? 51  LEU A HD21 4  
ATOM 7422  H HD22 . LEU A 1 51  ? 4.636   -1.077  -1.794  1.00 0.00 ? 51  LEU A HD22 4  
ATOM 7423  H HD23 . LEU A 1 51  ? 3.307   0.039   -1.468  1.00 0.00 ? 51  LEU A HD23 4  
ATOM 7424  N N    . MET A 1 52  ? 2.869   3.204   -4.702  1.00 0.00 ? 52  MET A N    4  
ATOM 7425  C CA   . MET A 1 52  ? 1.660   3.052   -5.503  1.00 0.00 ? 52  MET A CA   4  
ATOM 7426  C C    . MET A 1 52  ? 1.815   3.736   -6.856  1.00 0.00 ? 52  MET A C    4  
ATOM 7427  O O    . MET A 1 52  ? 1.596   3.124   -7.901  1.00 0.00 ? 52  MET A O    4  
ATOM 7428  C CB   . MET A 1 52  ? 0.454   3.630   -4.759  1.00 0.00 ? 52  MET A CB   4  
ATOM 7429  C CG   . MET A 1 52  ? -0.883  3.214   -5.353  1.00 0.00 ? 52  MET A CG   4  
ATOM 7430  S SD   . MET A 1 52  ? -1.244  1.467   -5.094  1.00 0.00 ? 52  MET A SD   4  
ATOM 7431  C CE   . MET A 1 52  ? -1.997  1.041   -6.662  1.00 0.00 ? 52  MET A CE   4  
ATOM 7432  H H    . MET A 1 52  ? 2.826   3.711   -3.864  1.00 0.00 ? 52  MET A H    4  
ATOM 7433  H HA   . MET A 1 52  ? 1.500   1.995   -5.662  1.00 0.00 ? 52  MET A HA   4  
ATOM 7434  H HB2  . MET A 1 52  ? 0.486   3.298   -3.732  1.00 0.00 ? 52  MET A HB2  4  
ATOM 7435  H HB3  . MET A 1 52  ? 0.514   4.708   -4.784  1.00 0.00 ? 52  MET A HB3  4  
ATOM 7436  H HG2  . MET A 1 52  ? -1.663  3.800   -4.893  1.00 0.00 ? 52  MET A HG2  4  
ATOM 7437  H HG3  . MET A 1 52  ? -0.865  3.411   -6.415  1.00 0.00 ? 52  MET A HG3  4  
ATOM 7438  H HE1  . MET A 1 52  ? -1.227  0.877   -7.400  1.00 0.00 ? 52  MET A HE1  4  
ATOM 7439  H HE2  . MET A 1 52  ? -2.583  0.142   -6.547  1.00 0.00 ? 52  MET A HE2  4  
ATOM 7440  H HE3  . MET A 1 52  ? -2.639  1.849   -6.984  1.00 0.00 ? 52  MET A HE3  4  
ATOM 7441  N N    . ASN A 1 53  ? 2.192   5.011   -6.830  1.00 0.00 ? 53  ASN A N    4  
ATOM 7442  C CA   . ASN A 1 53  ? 2.375   5.779   -8.056  1.00 0.00 ? 53  ASN A CA   4  
ATOM 7443  C C    . ASN A 1 53  ? 3.125   4.961   -9.104  1.00 0.00 ? 53  ASN A C    4  
ATOM 7444  O O    . ASN A 1 53  ? 2.948   5.160   -10.305 1.00 0.00 ? 53  ASN A O    4  
ATOM 7445  C CB   . ASN A 1 53  ? 3.136   7.074   -7.763  1.00 0.00 ? 53  ASN A CB   4  
ATOM 7446  C CG   . ASN A 1 53  ? 2.219   8.191   -7.302  1.00 0.00 ? 53  ASN A CG   4  
ATOM 7447  O OD1  . ASN A 1 53  ? 1.150   8.407   -7.872  1.00 0.00 ? 53  ASN A OD1  4  
ATOM 7448  N ND2  . ASN A 1 53  ? 2.636   8.908   -6.265  1.00 0.00 ? 53  ASN A ND2  4  
ATOM 7449  H H    . ASN A 1 53  ? 2.351   5.444   -5.966  1.00 0.00 ? 53  ASN A H    4  
ATOM 7450  H HA   . ASN A 1 53  ? 1.397   6.026   -8.441  1.00 0.00 ? 53  ASN A HA   4  
ATOM 7451  H HB2  . ASN A 1 53  ? 3.863   6.888   -6.987  1.00 0.00 ? 53  ASN A HB2  4  
ATOM 7452  H HB3  . ASN A 1 53  ? 3.645   7.396   -8.658  1.00 0.00 ? 53  ASN A HB3  4  
ATOM 7453  H HD21 . ASN A 1 53  ? 3.499   8.679   -5.860  1.00 0.00 ? 53  ASN A HD21 4  
ATOM 7454  H HD22 . ASN A 1 53  ? 2.063   9.635   -5.946  1.00 0.00 ? 53  ASN A HD22 4  
ATOM 7455  N N    . LYS A 1 54  ? 3.963   4.041   -8.640  1.00 0.00 ? 54  LYS A N    4  
ATOM 7456  C CA   . LYS A 1 54  ? 4.740   3.191   -9.534  1.00 0.00 ? 54  LYS A CA   4  
ATOM 7457  C C    . LYS A 1 54  ? 3.882   2.058   -10.088 1.00 0.00 ? 54  LYS A C    4  
ATOM 7458  O O    . LYS A 1 54  ? 3.980   1.710   -11.265 1.00 0.00 ? 54  LYS A O    4  
ATOM 7459  C CB   . LYS A 1 54  ? 5.952   2.616   -8.800  1.00 0.00 ? 54  LYS A CB   4  
ATOM 7460  C CG   . LYS A 1 54  ? 6.893   3.676   -8.255  1.00 0.00 ? 54  LYS A CG   4  
ATOM 7461  C CD   . LYS A 1 54  ? 7.683   4.346   -9.367  1.00 0.00 ? 54  LYS A CD   4  
ATOM 7462  C CE   . LYS A 1 54  ? 8.286   5.664   -8.906  1.00 0.00 ? 54  LYS A CE   4  
ATOM 7463  N NZ   . LYS A 1 54  ? 9.208   6.238   -9.924  1.00 0.00 ? 54  LYS A NZ   4  
ATOM 7464  H H    . LYS A 1 54  ? 4.061   3.930   -7.670  1.00 0.00 ? 54  LYS A H    4  
ATOM 7465  H HA   . LYS A 1 54  ? 5.082   3.801   -10.356 1.00 0.00 ? 54  LYS A HA   4  
ATOM 7466  H HB2  . LYS A 1 54  ? 5.605   2.013   -7.974  1.00 0.00 ? 54  LYS A HB2  4  
ATOM 7467  H HB3  . LYS A 1 54  ? 6.507   1.988   -9.483  1.00 0.00 ? 54  LYS A HB3  4  
ATOM 7468  H HG2  . LYS A 1 54  ? 6.314   4.426   -7.736  1.00 0.00 ? 54  LYS A HG2  4  
ATOM 7469  H HG3  . LYS A 1 54  ? 7.583   3.212   -7.565  1.00 0.00 ? 54  LYS A HG3  4  
ATOM 7470  H HD2  . LYS A 1 54  ? 8.480   3.688   -9.677  1.00 0.00 ? 54  LYS A HD2  4  
ATOM 7471  H HD3  . LYS A 1 54  ? 7.023   4.535   -10.202 1.00 0.00 ? 54  LYS A HD3  4  
ATOM 7472  H HE2  . LYS A 1 54  ? 7.486   6.366   -8.721  1.00 0.00 ? 54  LYS A HE2  4  
ATOM 7473  H HE3  . LYS A 1 54  ? 8.833   5.494   -7.991  1.00 0.00 ? 54  LYS A HE3  4  
ATOM 7474  H HZ1  . LYS A 1 54  ? 9.750   5.479   -10.384 1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 7475  H HZ2  . LYS A 1 54  ? 9.873   6.898   -9.473  1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 7476  H HZ3  . LYS A 1 54  ? 8.666   6.751   -10.649 1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 7477  N N    . LEU A 1 55  ? 3.041   1.485   -9.233  1.00 0.00 ? 55  LEU A N    4  
ATOM 7478  C CA   . LEU A 1 55  ? 2.165   0.392   -9.637  1.00 0.00 ? 55  LEU A CA   4  
ATOM 7479  C C    . LEU A 1 55  ? 0.969   0.915   -10.427 1.00 0.00 ? 55  LEU A C    4  
ATOM 7480  O O    . LEU A 1 55  ? 0.728   0.493   -11.557 1.00 0.00 ? 55  LEU A O    4  
ATOM 7481  C CB   . LEU A 1 55  ? 1.681   -0.381  -8.409  1.00 0.00 ? 55  LEU A CB   4  
ATOM 7482  C CG   . LEU A 1 55  ? 2.756   -0.768  -7.393  1.00 0.00 ? 55  LEU A CG   4  
ATOM 7483  C CD1  . LEU A 1 55  ? 2.143   -1.546  -6.238  1.00 0.00 ? 55  LEU A CD1  4  
ATOM 7484  C CD2  . LEU A 1 55  ? 3.853   -1.582  -8.064  1.00 0.00 ? 55  LEU A CD2  4  
ATOM 7485  H H    . LEU A 1 55  ? 3.009   1.807   -8.308  1.00 0.00 ? 55  LEU A H    4  
ATOM 7486  H HA   . LEU A 1 55  ? 2.734   -0.273  -10.269 1.00 0.00 ? 55  LEU A HA   4  
ATOM 7487  H HB2  . LEU A 1 55  ? 0.952   0.231   -7.900  1.00 0.00 ? 55  LEU A HB2  4  
ATOM 7488  H HB3  . LEU A 1 55  ? 1.208   -1.288  -8.756  1.00 0.00 ? 55  LEU A HB3  4  
ATOM 7489  H HG   . LEU A 1 55  ? 3.203   0.130   -6.990  1.00 0.00 ? 55  LEU A HG   4  
ATOM 7490  H HD11 . LEU A 1 55  ? 2.466   -2.575  -6.286  1.00 0.00 ? 55  LEU A HD11 4  
ATOM 7491  H HD12 . LEU A 1 55  ? 1.066   -1.503  -6.306  1.00 0.00 ? 55  LEU A HD12 4  
ATOM 7492  H HD13 . LEU A 1 55  ? 2.463   -1.111  -5.303  1.00 0.00 ? 55  LEU A HD13 4  
ATOM 7493  H HD21 . LEU A 1 55  ? 4.712   -0.951  -8.240  1.00 0.00 ? 55  LEU A HD21 4  
ATOM 7494  H HD22 . LEU A 1 55  ? 3.491   -1.969  -9.005  1.00 0.00 ? 55  LEU A HD22 4  
ATOM 7495  H HD23 . LEU A 1 55  ? 4.136   -2.403  -7.421  1.00 0.00 ? 55  LEU A HD23 4  
ATOM 7496  N N    . GLN A 1 56  ? 0.227   1.838   -9.824  1.00 0.00 ? 56  GLN A N    4  
ATOM 7497  C CA   . GLN A 1 56  ? -0.943  2.420   -10.472 1.00 0.00 ? 56  GLN A CA   4  
ATOM 7498  C C    . GLN A 1 56  ? -0.623  3.803   -11.030 1.00 0.00 ? 56  GLN A C    4  
ATOM 7499  O O    . GLN A 1 56  ? -0.339  4.747   -10.292 1.00 0.00 ? 56  GLN A O    4  
ATOM 7500  C CB   . GLN A 1 56  ? -2.107  2.512   -9.484  1.00 0.00 ? 56  GLN A CB   4  
ATOM 7501  C CG   . GLN A 1 56  ? -3.294  3.300   -10.014 1.00 0.00 ? 56  GLN A CG   4  
ATOM 7502  C CD   . GLN A 1 56  ? -4.612  2.833   -9.432  1.00 0.00 ? 56  GLN A CD   4  
ATOM 7503  O OE1  . GLN A 1 56  ? -5.465  2.301   -10.143 1.00 0.00 ? 56  GLN A OE1  4  
ATOM 7504  N NE2  . GLN A 1 56  ? -4.787  3.027   -8.130  1.00 0.00 ? 56  GLN A NE2  4  
ATOM 7505  H H    . GLN A 1 56  ? 0.471   2.133   -8.923  1.00 0.00 ? 56  GLN A H    4  
ATOM 7506  H HA   . GLN A 1 56  ? -1.225  1.773   -11.289 1.00 0.00 ? 56  GLN A HA   4  
ATOM 7507  H HB2  . GLN A 1 56  ? -2.442  1.513   -9.247  1.00 0.00 ? 56  GLN A HB2  4  
ATOM 7508  H HB3  . GLN A 1 56  ? -1.759  2.990   -8.580  1.00 0.00 ? 56  GLN A HB3  4  
ATOM 7509  H HG2  . GLN A 1 56  ? -3.157  4.342   -9.765  1.00 0.00 ? 56  GLN A HG2  4  
ATOM 7510  H HG3  . GLN A 1 56  ? -3.331  3.191   -11.088 1.00 0.00 ? 56  GLN A HG3  4  
ATOM 7511  H HE21 . GLN A 1 56  ? -4.065  3.459   -7.626  1.00 0.00 ? 56  GLN A HE21 4  
ATOM 7512  H HE22 . GLN A 1 56  ? -5.631  2.735   -7.727  1.00 0.00 ? 56  GLN A HE22 4  
ATOM 7513  N N    . PRO A 1 57  ? -0.672  3.929   -12.365 1.00 0.00 ? 57  PRO A N    4  
ATOM 7514  C CA   . PRO A 1 57  ? -0.391  5.193   -13.052 1.00 0.00 ? 57  PRO A CA   4  
ATOM 7515  C C    . PRO A 1 57  ? -1.480  6.234   -12.816 1.00 0.00 ? 57  PRO A C    4  
ATOM 7516  O O    . PRO A 1 57  ? -2.346  6.443   -13.663 1.00 0.00 ? 57  PRO A O    4  
ATOM 7517  C CB   . PRO A 1 57  ? -0.345  4.792   -14.528 1.00 0.00 ? 57  PRO A CB   4  
ATOM 7518  C CG   . PRO A 1 57  ? -1.187  3.566   -14.614 1.00 0.00 ? 57  PRO A CG   4  
ATOM 7519  C CD   . PRO A 1 57  ? -1.004  2.847   -13.306 1.00 0.00 ? 57  PRO A CD   4  
ATOM 7520  H HA   . PRO A 1 57  ? 0.565   5.600   -12.758 1.00 0.00 ? 57  PRO A HA   4  
ATOM 7521  H HB2  . PRO A 1 57  ? -0.748  5.592   -15.134 1.00 0.00 ? 57  PRO A HB2  4  
ATOM 7522  H HB3  . PRO A 1 57  ? 0.674   4.591   -14.819 1.00 0.00 ? 57  PRO A HB3  4  
ATOM 7523  H HG2  . PRO A 1 57  ? -2.222  3.839   -14.751 1.00 0.00 ? 57  PRO A HG2  4  
ATOM 7524  H HG3  . PRO A 1 57  ? -0.850  2.946   -15.432 1.00 0.00 ? 57  PRO A HG3  4  
ATOM 7525  H HD2  . PRO A 1 57  ? -1.920  2.352   -13.017 1.00 0.00 ? 57  PRO A HD2  4  
ATOM 7526  H HD3  . PRO A 1 57  ? -0.195  2.135   -13.376 1.00 0.00 ? 57  PRO A HD3  4  
ATOM 7527  N N    . GLY A 1 58  ? -1.428  6.887   -11.659 1.00 0.00 ? 58  GLY A N    4  
ATOM 7528  C CA   . GLY A 1 58  ? -2.414  7.900   -11.333 1.00 0.00 ? 58  GLY A CA   4  
ATOM 7529  C C    . GLY A 1 58  ? -3.086  7.647   -9.998  1.00 0.00 ? 58  GLY A C    4  
ATOM 7530  O O    . GLY A 1 58  ? -4.275  7.919   -9.833  1.00 0.00 ? 58  GLY A O    4  
ATOM 7531  H H    . GLY A 1 58  ? -0.712  6.679   -11.020 1.00 0.00 ? 58  GLY A H    4  
ATOM 7532  H HA2  . GLY A 1 58  ? -1.928  8.864   -11.303 1.00 0.00 ? 58  GLY A HA2  4  
ATOM 7533  H HA3  . GLY A 1 58  ? -3.169  7.912   -12.106 1.00 0.00 ? 58  GLY A HA3  4  
ATOM 7534  N N    . SER A 1 59  ? -2.323  7.123   -9.044  1.00 0.00 ? 59  SER A N    4  
ATOM 7535  C CA   . SER A 1 59  ? -2.853  6.827   -7.718  1.00 0.00 ? 59  SER A CA   4  
ATOM 7536  C C    . SER A 1 59  ? -2.780  8.056   -6.817  1.00 0.00 ? 59  SER A C    4  
ATOM 7537  O O    . SER A 1 59  ? -3.792  8.701   -6.543  1.00 0.00 ? 59  SER A O    4  
ATOM 7538  C CB   . SER A 1 59  ? -2.082  5.668   -7.084  1.00 0.00 ? 59  SER A CB   4  
ATOM 7539  O OG   . SER A 1 59  ? -0.738  5.646   -7.530  1.00 0.00 ? 59  SER A OG   4  
ATOM 7540  H H    . SER A 1 59  ? -1.383  6.927   -9.237  1.00 0.00 ? 59  SER A H    4  
ATOM 7541  H HA   . SER A 1 59  ? -3.889  6.539   -7.831  1.00 0.00 ? 59  SER A HA   4  
ATOM 7542  H HB2  . SER A 1 59  ? -2.090  5.779   -6.010  1.00 0.00 ? 59  SER A HB2  4  
ATOM 7543  H HB3  . SER A 1 59  ? -2.555  4.735   -7.352  1.00 0.00 ? 59  SER A HB3  4  
ATOM 7544  H HG   . SER A 1 59  ? -0.655  5.038   -8.269  1.00 0.00 ? 59  SER A HG   4  
ATOM 7545  N N    . VAL A 1 60  ? -1.573  8.375   -6.359  1.00 0.00 ? 60  VAL A N    4  
ATOM 7546  C CA   . VAL A 1 60  ? -1.365  9.527   -5.490  1.00 0.00 ? 60  VAL A CA   4  
ATOM 7547  C C    . VAL A 1 60  ? -0.832  10.719  -6.277  1.00 0.00 ? 60  VAL A C    4  
ATOM 7548  O O    . VAL A 1 60  ? 0.215   10.652  -6.919  1.00 0.00 ? 60  VAL A O    4  
ATOM 7549  C CB   . VAL A 1 60  ? -0.384  9.199   -4.349  1.00 0.00 ? 60  VAL A CB   4  
ATOM 7550  C CG1  . VAL A 1 60  ? -0.311  10.351  -3.359  1.00 0.00 ? 60  VAL A CG1  4  
ATOM 7551  C CG2  . VAL A 1 60  ? -0.792  7.910   -3.651  1.00 0.00 ? 60  VAL A CG2  4  
ATOM 7552  H H    . VAL A 1 60  ? -0.805  7.822   -6.613  1.00 0.00 ? 60  VAL A H    4  
ATOM 7553  H HA   . VAL A 1 60  ? -2.317  9.792   -5.054  1.00 0.00 ? 60  VAL A HA   4  
ATOM 7554  H HB   . VAL A 1 60  ? 0.598   9.057   -4.775  1.00 0.00 ? 60  VAL A HB   4  
ATOM 7555  H HG11 . VAL A 1 60  ? -0.933  10.130  -2.504  1.00 0.00 ? 60  VAL A HG11 4  
ATOM 7556  H HG12 . VAL A 1 60  ? 0.711   10.487  -3.038  1.00 0.00 ? 60  VAL A HG12 4  
ATOM 7557  H HG13 . VAL A 1 60  ? -0.663  11.256  -3.834  1.00 0.00 ? 60  VAL A HG13 4  
ATOM 7558  H HG21 . VAL A 1 60  ? -1.765  8.039   -3.199  1.00 0.00 ? 60  VAL A HG21 4  
ATOM 7559  H HG22 . VAL A 1 60  ? -0.834  7.106   -4.372  1.00 0.00 ? 60  VAL A HG22 4  
ATOM 7560  H HG23 . VAL A 1 60  ? -0.069  7.670   -2.886  1.00 0.00 ? 60  VAL A HG23 4  
ATOM 7561  N N    . PRO A 1 61  ? -1.569  11.838  -6.225  1.00 0.00 ? 61  PRO A N    4  
ATOM 7562  C CA   . PRO A 1 61  ? -1.190  13.070  -6.926  1.00 0.00 ? 61  PRO A CA   4  
ATOM 7563  C C    . PRO A 1 61  ? 0.038   13.732  -6.310  1.00 0.00 ? 61  PRO A C    4  
ATOM 7564  O O    . PRO A 1 61  ? 0.991   14.072  -7.013  1.00 0.00 ? 61  PRO A O    4  
ATOM 7565  C CB   . PRO A 1 61  ? -2.420  13.965  -6.761  1.00 0.00 ? 61  PRO A CB   4  
ATOM 7566  C CG   . PRO A 1 61  ? -3.084  13.471  -5.522  1.00 0.00 ? 61  PRO A CG   4  
ATOM 7567  C CD   . PRO A 1 61  ? -2.829  11.990  -5.478  1.00 0.00 ? 61  PRO A CD   4  
ATOM 7568  H HA   . PRO A 1 61  ? -1.012  12.889  -7.976  1.00 0.00 ? 61  PRO A HA   4  
ATOM 7569  H HB2  . PRO A 1 61  ? -2.108  14.995  -6.659  1.00 0.00 ? 61  PRO A HB2  4  
ATOM 7570  H HB3  . PRO A 1 61  ? -3.063  13.862  -7.622  1.00 0.00 ? 61  PRO A HB3  4  
ATOM 7571  H HG2  . PRO A 1 61  ? -2.655  13.953  -4.658  1.00 0.00 ? 61  PRO A HG2  4  
ATOM 7572  H HG3  . PRO A 1 61  ? -4.146  13.666  -5.574  1.00 0.00 ? 61  PRO A HG3  4  
ATOM 7573  H HD2  . PRO A 1 61  ? -2.714  11.658  -4.456  1.00 0.00 ? 61  PRO A HD2  4  
ATOM 7574  H HD3  . PRO A 1 61  ? -3.631  11.453  -5.962  1.00 0.00 ? 61  PRO A HD3  4  
ATOM 7575  N N    . LYS A 1 62  ? 0.011   13.912  -4.994  1.00 0.00 ? 62  LYS A N    4  
ATOM 7576  C CA   . LYS A 1 62  ? 1.122   14.532  -4.283  1.00 0.00 ? 62  LYS A CA   4  
ATOM 7577  C C    . LYS A 1 62  ? 1.284   13.926  -2.892  1.00 0.00 ? 62  LYS A C    4  
ATOM 7578  O O    . LYS A 1 62  ? 0.385   13.250  -2.392  1.00 0.00 ? 62  LYS A O    4  
ATOM 7579  C CB   . LYS A 1 62  ? 0.903   16.043  -4.171  1.00 0.00 ? 62  LYS A CB   4  
ATOM 7580  C CG   . LYS A 1 62  ? 2.189   16.832  -3.998  1.00 0.00 ? 62  LYS A CG   4  
ATOM 7581  C CD   . LYS A 1 62  ? 2.006   18.289  -4.390  1.00 0.00 ? 62  LYS A CD   4  
ATOM 7582  C CE   . LYS A 1 62  ? 2.142   18.482  -5.893  1.00 0.00 ? 62  LYS A CE   4  
ATOM 7583  N NZ   . LYS A 1 62  ? 2.578   19.864  -6.237  1.00 0.00 ? 62  LYS A NZ   4  
ATOM 7584  H H    . LYS A 1 62  ? -0.778  13.619  -4.489  1.00 0.00 ? 62  LYS A H    4  
ATOM 7585  H HA   . LYS A 1 62  ? 2.022   14.349  -4.850  1.00 0.00 ? 62  LYS A HA   4  
ATOM 7586  H HB2  . LYS A 1 62  ? 0.410   16.390  -5.066  1.00 0.00 ? 62  LYS A HB2  4  
ATOM 7587  H HB3  . LYS A 1 62  ? 0.266   16.239  -3.320  1.00 0.00 ? 62  LYS A HB3  4  
ATOM 7588  H HG2  . LYS A 1 62  ? 2.492   16.786  -2.962  1.00 0.00 ? 62  LYS A HG2  4  
ATOM 7589  H HG3  . LYS A 1 62  ? 2.956   16.394  -4.620  1.00 0.00 ? 62  LYS A HG3  4  
ATOM 7590  H HD2  . LYS A 1 62  ? 1.022   18.614  -4.085  1.00 0.00 ? 62  LYS A HD2  4  
ATOM 7591  H HD3  . LYS A 1 62  ? 2.755   18.885  -3.889  1.00 0.00 ? 62  LYS A HD3  4  
ATOM 7592  H HE2  . LYS A 1 62  ? 2.871   17.780  -6.269  1.00 0.00 ? 62  LYS A HE2  4  
ATOM 7593  H HE3  . LYS A 1 62  ? 1.186   18.290  -6.355  1.00 0.00 ? 62  LYS A HE3  4  
ATOM 7594  H HZ1  . LYS A 1 62  ? 3.014   19.877  -7.181  1.00 0.00 ? 62  LYS A HZ1  4  
ATOM 7595  H HZ2  . LYS A 1 62  ? 3.275   20.202  -5.541  1.00 0.00 ? 62  LYS A HZ2  4  
ATOM 7596  H HZ3  . LYS A 1 62  ? 1.762   20.508  -6.235  1.00 0.00 ? 62  LYS A HZ3  4  
ATOM 7597  N N    . ILE A 1 63  ? 2.433   14.175  -2.274  1.00 0.00 ? 63  ILE A N    4  
ATOM 7598  C CA   . ILE A 1 63  ? 2.710   13.657  -0.940  1.00 0.00 ? 63  ILE A CA   4  
ATOM 7599  C C    . ILE A 1 63  ? 3.041   14.784  0.030   1.00 0.00 ? 63  ILE A C    4  
ATOM 7600  O O    . ILE A 1 63  ? 3.790   15.703  -0.301  1.00 0.00 ? 63  ILE A O    4  
ATOM 7601  C CB   . ILE A 1 63  ? 3.876   12.651  -0.959  1.00 0.00 ? 63  ILE A CB   4  
ATOM 7602  C CG1  . ILE A 1 63  ? 3.523   11.441  -1.826  1.00 0.00 ? 63  ILE A CG1  4  
ATOM 7603  C CG2  . ILE A 1 63  ? 4.220   12.212  0.457   1.00 0.00 ? 63  ILE A CG2  4  
ATOM 7604  C CD1  . ILE A 1 63  ? 4.730   10.732  -2.397  1.00 0.00 ? 63  ILE A CD1  4  
ATOM 7605  H H    . ILE A 1 63  ? 3.110   14.721  -2.725  1.00 0.00 ? 63  ILE A H    4  
ATOM 7606  H HA   . ILE A 1 63  ? 1.825   13.144  -0.591  1.00 0.00 ? 63  ILE A HA   4  
ATOM 7607  H HB   . ILE A 1 63  ? 4.741   13.144  -1.377  1.00 0.00 ? 63  ILE A HB   4  
ATOM 7608  H HG12 . ILE A 1 63  ? 2.971   10.730  -1.232  1.00 0.00 ? 63  ILE A HG12 4  
ATOM 7609  H HG13 . ILE A 1 63  ? 2.907   11.768  -2.652  1.00 0.00 ? 63  ILE A HG13 4  
ATOM 7610  H HG21 . ILE A 1 63  ? 3.492   11.491  0.797   1.00 0.00 ? 63  ILE A HG21 4  
ATOM 7611  H HG22 . ILE A 1 63  ? 5.202   11.763  0.466   1.00 0.00 ? 63  ILE A HG22 4  
ATOM 7612  H HG23 . ILE A 1 63  ? 4.210   13.070  1.112   1.00 0.00 ? 63  ILE A HG23 4  
ATOM 7613  H HD11 . ILE A 1 63  ? 5.296   10.281  -1.596  1.00 0.00 ? 63  ILE A HD11 4  
ATOM 7614  H HD12 . ILE A 1 63  ? 4.407   9.968   -3.087  1.00 0.00 ? 63  ILE A HD12 4  
ATOM 7615  H HD13 . ILE A 1 63  ? 5.353   11.446  -2.918  1.00 0.00 ? 63  ILE A HD13 4  
ATOM 7616  N N    . ASN A 1 64  ? 2.479   14.708  1.233   1.00 0.00 ? 64  ASN A N    4  
ATOM 7617  C CA   . ASN A 1 64  ? 2.716   15.723  2.253   1.00 0.00 ? 64  ASN A CA   4  
ATOM 7618  C C    . ASN A 1 64  ? 4.207   15.868  2.540   1.00 0.00 ? 64  ASN A C    4  
ATOM 7619  O O    . ASN A 1 64  ? 4.792   16.927  2.314   1.00 0.00 ? 64  ASN A O    4  
ATOM 7620  C CB   . ASN A 1 64  ? 1.970   15.364  3.540   1.00 0.00 ? 64  ASN A CB   4  
ATOM 7621  C CG   . ASN A 1 64  ? 0.572   15.953  3.582   1.00 0.00 ? 64  ASN A CG   4  
ATOM 7622  O OD1  . ASN A 1 64  ? 0.402   17.172  3.611   1.00 0.00 ? 64  ASN A OD1  4  
ATOM 7623  N ND2  . ASN A 1 64  ? -0.435  15.088  3.585   1.00 0.00 ? 64  ASN A ND2  4  
ATOM 7624  H H    . ASN A 1 64  ? 1.890   13.952  1.438   1.00 0.00 ? 64  ASN A H    4  
ATOM 7625  H HA   . ASN A 1 64  ? 2.339   16.662  1.879   1.00 0.00 ? 64  ASN A HA   4  
ATOM 7626  H HB2  . ASN A 1 64  ? 1.889   14.289  3.614   1.00 0.00 ? 64  ASN A HB2  4  
ATOM 7627  H HB3  . ASN A 1 64  ? 2.525   15.739  4.387   1.00 0.00 ? 64  ASN A HB3  4  
ATOM 7628  H HD21 . ASN A 1 64  ? -0.223  14.131  3.561   1.00 0.00 ? 64  ASN A HD21 4  
ATOM 7629  H HD22 . ASN A 1 64  ? -1.348  15.441  3.611   1.00 0.00 ? 64  ASN A HD22 4  
ATOM 7630  N N    . ARG A 1 65  ? 4.815   14.796  3.038   1.00 0.00 ? 65  ARG A N    4  
ATOM 7631  C CA   . ARG A 1 65  ? 6.238   14.804  3.356   1.00 0.00 ? 65  ARG A CA   4  
ATOM 7632  C C    . ARG A 1 65  ? 6.578   15.958  4.297   1.00 0.00 ? 65  ARG A C    4  
ATOM 7633  O O    . ARG A 1 65  ? 7.715   16.428  4.333   1.00 0.00 ? 65  ARG A O    4  
ATOM 7634  C CB   . ARG A 1 65  ? 7.068   14.915  2.076   1.00 0.00 ? 65  ARG A CB   4  
ATOM 7635  C CG   . ARG A 1 65  ? 6.821   13.784  1.091   1.00 0.00 ? 65  ARG A CG   4  
ATOM 7636  C CD   . ARG A 1 65  ? 8.061   13.487  0.262   1.00 0.00 ? 65  ARG A CD   4  
ATOM 7637  N NE   . ARG A 1 65  ? 9.212   13.159  1.098   1.00 0.00 ? 65  ARG A NE   4  
ATOM 7638  C CZ   . ARG A 1 65  ? 10.394  12.796  0.612   1.00 0.00 ? 65  ARG A CZ   4  
ATOM 7639  N NH1  . ARG A 1 65  ? 10.579  12.715  -0.698  1.00 0.00 ? 65  ARG A NH1  4  
ATOM 7640  N NH2  . ARG A 1 65  ? 11.394  12.514  1.437   1.00 0.00 ? 65  ARG A NH2  4  
ATOM 7641  H H    . ARG A 1 65  ? 4.296   13.981  3.196   1.00 0.00 ? 65  ARG A H    4  
ATOM 7642  H HA   . ARG A 1 65  ? 6.474   13.873  3.848   1.00 0.00 ? 65  ARG A HA   4  
ATOM 7643  H HB2  . ARG A 1 65  ? 6.831   15.847  1.587   1.00 0.00 ? 65  ARG A HB2  4  
ATOM 7644  H HB3  . ARG A 1 65  ? 8.115   14.911  2.340   1.00 0.00 ? 65  ARG A HB3  4  
ATOM 7645  H HG2  . ARG A 1 65  ? 6.545   12.895  1.638   1.00 0.00 ? 65  ARG A HG2  4  
ATOM 7646  H HG3  . ARG A 1 65  ? 6.015   14.066  0.429   1.00 0.00 ? 65  ARG A HG3  4  
ATOM 7647  H HD2  . ARG A 1 65  ? 7.851   12.650  -0.388  1.00 0.00 ? 65  ARG A HD2  4  
ATOM 7648  H HD3  . ARG A 1 65  ? 8.296   14.356  -0.335  1.00 0.00 ? 65  ARG A HD3  4  
ATOM 7649  H HE   . ARG A 1 65  ? 9.097   13.213  2.069   1.00 0.00 ? 65  ARG A HE   4  
ATOM 7650  H HH11 . ARG A 1 65  ? 9.828   12.927  -1.322  1.00 0.00 ? 65  ARG A HH11 4  
ATOM 7651  H HH12 . ARG A 1 65  ? 11.470  12.442  -1.061  1.00 0.00 ? 65  ARG A HH12 4  
ATOM 7652  H HH21 . ARG A 1 65  ? 11.258  12.575  2.426   1.00 0.00 ? 65  ARG A HH21 4  
ATOM 7653  H HH22 . ARG A 1 65  ? 12.282  12.240  1.071   1.00 0.00 ? 65  ARG A HH22 4  
ATOM 7654  N N    . SER A 1 66  ? 5.584   16.406  5.057   1.00 0.00 ? 66  SER A N    4  
ATOM 7655  C CA   . SER A 1 66  ? 5.777   17.507  5.994   1.00 0.00 ? 66  SER A CA   4  
ATOM 7656  C C    . SER A 1 66  ? 5.774   17.001  7.434   1.00 0.00 ? 66  SER A C    4  
ATOM 7657  O O    . SER A 1 66  ? 5.358   15.875  7.706   1.00 0.00 ? 66  SER A O    4  
ATOM 7658  C CB   . SER A 1 66  ? 4.683   18.560  5.809   1.00 0.00 ? 66  SER A CB   4  
ATOM 7659  O OG   . SER A 1 66  ? 5.160   19.854  6.134   1.00 0.00 ? 66  SER A OG   4  
ATOM 7660  H H    . SER A 1 66  ? 4.700   15.990  4.983   1.00 0.00 ? 66  SER A H    4  
ATOM 7661  H HA   . SER A 1 66  ? 6.736   17.956  5.786   1.00 0.00 ? 66  SER A HA   4  
ATOM 7662  H HB2  . SER A 1 66  ? 4.355   18.558  4.781   1.00 0.00 ? 66  SER A HB2  4  
ATOM 7663  H HB3  . SER A 1 66  ? 3.848   18.324  6.453   1.00 0.00 ? 66  SER A HB3  4  
ATOM 7664  H HG   . SER A 1 66  ? 4.983   20.038  7.061   1.00 0.00 ? 66  SER A HG   4  
ATOM 7665  N N    . MET A 1 67  ? 6.241   17.842  8.351   1.00 0.00 ? 67  MET A N    4  
ATOM 7666  C CA   . MET A 1 67  ? 6.290   17.481  9.763   1.00 0.00 ? 67  MET A CA   4  
ATOM 7667  C C    . MET A 1 67  ? 4.887   17.407  10.355  1.00 0.00 ? 67  MET A C    4  
ATOM 7668  O O    . MET A 1 67  ? 4.631   16.625  11.270  1.00 0.00 ? 67  MET A O    4  
ATOM 7669  C CB   . MET A 1 67  ? 7.132   18.495  10.541  1.00 0.00 ? 67  MET A CB   4  
ATOM 7670  C CG   . MET A 1 67  ? 7.021   18.345  12.050  1.00 0.00 ? 67  MET A CG   4  
ATOM 7671  S SD   . MET A 1 67  ? 8.184   19.398  12.939  1.00 0.00 ? 67  MET A SD   4  
ATOM 7672  C CE   . MET A 1 67  ? 9.457   18.212  13.365  1.00 0.00 ? 67  MET A CE   4  
ATOM 7673  H H    . MET A 1 67  ? 6.558   18.726  8.073   1.00 0.00 ? 67  MET A H    4  
ATOM 7674  H HA   . MET A 1 67  ? 6.753   16.509  9.840   1.00 0.00 ? 67  MET A HA   4  
ATOM 7675  H HB2  . MET A 1 67  ? 8.168   18.374  10.264  1.00 0.00 ? 67  MET A HB2  4  
ATOM 7676  H HB3  . MET A 1 67  ? 6.810   19.490  10.276  1.00 0.00 ? 67  MET A HB3  4  
ATOM 7677  H HG2  . MET A 1 67  ? 6.018   18.606  12.352  1.00 0.00 ? 67  MET A HG2  4  
ATOM 7678  H HG3  . MET A 1 67  ? 7.217   17.316  12.311  1.00 0.00 ? 67  MET A HG3  4  
ATOM 7679  H HE1  . MET A 1 67  ? 10.355  18.432  12.807  1.00 0.00 ? 67  MET A HE1  4  
ATOM 7680  H HE2  . MET A 1 67  ? 9.666   18.274  14.423  1.00 0.00 ? 67  MET A HE2  4  
ATOM 7681  H HE3  . MET A 1 67  ? 9.117   17.217  13.122  1.00 0.00 ? 67  MET A HE3  4  
ATOM 7682  N N    . GLN A 1 68  ? 3.982   18.224  9.826   1.00 0.00 ? 68  GLN A N    4  
ATOM 7683  C CA   . GLN A 1 68  ? 2.605   18.250  10.304  1.00 0.00 ? 68  GLN A CA   4  
ATOM 7684  C C    . GLN A 1 68  ? 2.054   16.835  10.455  1.00 0.00 ? 68  GLN A C    4  
ATOM 7685  O O    . GLN A 1 68  ? 2.016   16.068  9.494   1.00 0.00 ? 68  GLN A O    4  
ATOM 7686  C CB   . GLN A 1 68  ? 1.725   19.053  9.345   1.00 0.00 ? 68  GLN A CB   4  
ATOM 7687  C CG   . GLN A 1 68  ? 1.971   20.552  9.404   1.00 0.00 ? 68  GLN A CG   4  
ATOM 7688  C CD   . GLN A 1 68  ? 3.160   20.982  8.568   1.00 0.00 ? 68  GLN A CD   4  
ATOM 7689  O OE1  . GLN A 1 68  ? 3.038   21.208  7.363   1.00 0.00 ? 68  GLN A OE1  4  
ATOM 7690  N NE2  . GLN A 1 68  ? 4.320   21.099  9.204   1.00 0.00 ? 68  GLN A NE2  4  
ATOM 7691  H H    . GLN A 1 68  ? 4.247   18.824  9.099   1.00 0.00 ? 68  GLN A H    4  
ATOM 7692  H HA   . GLN A 1 68  ? 2.598   18.730  11.271  1.00 0.00 ? 68  GLN A HA   4  
ATOM 7693  H HB2  . GLN A 1 68  ? 1.915   18.719  8.336   1.00 0.00 ? 68  GLN A HB2  4  
ATOM 7694  H HB3  . GLN A 1 68  ? 0.688   18.871  9.588   1.00 0.00 ? 68  GLN A HB3  4  
ATOM 7695  H HG2  . GLN A 1 68  ? 1.092   21.063  9.041   1.00 0.00 ? 68  GLN A HG2  4  
ATOM 7696  H HG3  . GLN A 1 68  ? 2.150   20.833  10.432  1.00 0.00 ? 68  GLN A HG3  4  
ATOM 7697  H HE21 . GLN A 1 68  ? 4.343   20.902  10.165  1.00 0.00 ? 68  GLN A HE21 4  
ATOM 7698  H HE22 . GLN A 1 68  ? 5.104   21.374  8.688   1.00 0.00 ? 68  GLN A HE22 4  
ATOM 7699  N N    . ASN A 1 69  ? 1.628   16.498  11.668  1.00 0.00 ? 69  ASN A N    4  
ATOM 7700  C CA   . ASN A 1 69  ? 1.080   15.175  11.944  1.00 0.00 ? 69  ASN A CA   4  
ATOM 7701  C C    . ASN A 1 69  ? -0.098  14.871  11.023  1.00 0.00 ? 69  ASN A C    4  
ATOM 7702  O O    . ASN A 1 69  ? -0.092  13.873  10.302  1.00 0.00 ? 69  ASN A O    4  
ATOM 7703  C CB   . ASN A 1 69  ? 0.636   15.080  13.405  1.00 0.00 ? 69  ASN A CB   4  
ATOM 7704  C CG   . ASN A 1 69  ? 1.772   15.351  14.374  1.00 0.00 ? 69  ASN A CG   4  
ATOM 7705  O OD1  . ASN A 1 69  ? 2.762   15.991  14.021  1.00 0.00 ? 69  ASN A OD1  4  
ATOM 7706  N ND2  . ASN A 1 69  ? 1.633   14.862  15.601  1.00 0.00 ? 69  ASN A ND2  4  
ATOM 7707  H H    . ASN A 1 69  ? 1.684   17.153  12.394  1.00 0.00 ? 69  ASN A H    4  
ATOM 7708  H HA   . ASN A 1 69  ? 1.859   14.449  11.766  1.00 0.00 ? 69  ASN A HA   4  
ATOM 7709  H HB2  . ASN A 1 69  ? -0.146  15.803  13.586  1.00 0.00 ? 69  ASN A HB2  4  
ATOM 7710  H HB3  . ASN A 1 69  ? 0.254   14.088  13.596  1.00 0.00 ? 69  ASN A HB3  4  
ATOM 7711  H HD21 . ASN A 1 69  ? 0.817   14.362  15.810  1.00 0.00 ? 69  ASN A HD21 4  
ATOM 7712  H HD22 . ASN A 1 69  ? 2.351   15.024  16.246  1.00 0.00 ? 69  ASN A HD22 4  
ATOM 7713  N N    . TRP A 1 70  ? -1.104  15.737  11.052  1.00 0.00 ? 70  TRP A N    4  
ATOM 7714  C CA   . TRP A 1 70  ? -2.288  15.561  10.219  1.00 0.00 ? 70  TRP A CA   4  
ATOM 7715  C C    . TRP A 1 70  ? -1.899  15.319  8.765   1.00 0.00 ? 70  TRP A C    4  
ATOM 7716  O O    . TRP A 1 70  ? -2.557  14.559  8.055   1.00 0.00 ? 70  TRP A O    4  
ATOM 7717  C CB   . TRP A 1 70  ? -3.195  16.788  10.321  1.00 0.00 ? 70  TRP A CB   4  
ATOM 7718  C CG   . TRP A 1 70  ? -2.445  18.085  10.294  1.00 0.00 ? 70  TRP A CG   4  
ATOM 7719  C CD1  . TRP A 1 70  ? -2.148  18.838  9.194   1.00 0.00 ? 70  TRP A CD1  4  
ATOM 7720  C CD2  . TRP A 1 70  ? -1.895  18.781  11.419  1.00 0.00 ? 70  TRP A CD2  4  
ATOM 7721  N NE1  . TRP A 1 70  ? -1.447  19.959  9.567   1.00 0.00 ? 70  TRP A NE1  4  
ATOM 7722  C CE2  . TRP A 1 70  ? -1.280  19.947  10.926  1.00 0.00 ? 70  TRP A CE2  4  
ATOM 7723  C CE3  . TRP A 1 70  ? -1.865  18.532  12.793  1.00 0.00 ? 70  TRP A CE3  4  
ATOM 7724  C CZ2  . TRP A 1 70  ? -0.641  20.861  11.761  1.00 0.00 ? 70  TRP A CZ2  4  
ATOM 7725  C CZ3  . TRP A 1 70  ? -1.231  19.439  13.621  1.00 0.00 ? 70  TRP A CZ3  4  
ATOM 7726  C CH2  . TRP A 1 70  ? -0.626  20.593  13.103  1.00 0.00 ? 70  TRP A CH2  4  
ATOM 7727  H H    . TRP A 1 70  ? -1.050  16.513  11.648  1.00 0.00 ? 70  TRP A H    4  
ATOM 7728  H HA   . TRP A 1 70  ? -2.824  14.697  10.584  1.00 0.00 ? 70  TRP A HA   4  
ATOM 7729  H HB2  . TRP A 1 70  ? -3.887  16.786  9.492   1.00 0.00 ? 70  TRP A HB2  4  
ATOM 7730  H HB3  . TRP A 1 70  ? -3.749  16.742  11.247  1.00 0.00 ? 70  TRP A HB3  4  
ATOM 7731  H HD1  . TRP A 1 70  ? -2.428  18.576  8.185   1.00 0.00 ? 70  TRP A HD1  4  
ATOM 7732  H HE1  . TRP A 1 70  ? -1.121  20.655  8.957   1.00 0.00 ? 70  TRP A HE1  4  
ATOM 7733  H HE3  . TRP A 1 70  ? -2.325  17.648  13.211  1.00 0.00 ? 70  TRP A HE3  4  
ATOM 7734  H HZ2  . TRP A 1 70  ? -0.172  21.755  11.377  1.00 0.00 ? 70  TRP A HZ2  4  
ATOM 7735  H HZ3  . TRP A 1 70  ? -1.197  19.263  14.685  1.00 0.00 ? 70  TRP A HZ3  4  
ATOM 7736  H HH2  . TRP A 1 70  ? -0.142  21.273  13.786  1.00 0.00 ? 70  TRP A HH2  4  
ATOM 7737  N N    . HIS A 1 71  ? -0.827  15.972  8.327   1.00 0.00 ? 71  HIS A N    4  
ATOM 7738  C CA   . HIS A 1 71  ? -0.350  15.827  6.956   1.00 0.00 ? 71  HIS A CA   4  
ATOM 7739  C C    . HIS A 1 71  ? 0.130   14.402  6.696   1.00 0.00 ? 71  HIS A C    4  
ATOM 7740  O O    . HIS A 1 71  ? -0.182  13.812  5.662   1.00 0.00 ? 71  HIS A O    4  
ATOM 7741  C CB   . HIS A 1 71  ? 0.781   16.818  6.679   1.00 0.00 ? 71  HIS A CB   4  
ATOM 7742  C CG   . HIS A 1 71  ? 0.301   18.165  6.235   1.00 0.00 ? 71  HIS A CG   4  
ATOM 7743  N ND1  . HIS A 1 71  ? 1.124   19.268  6.157   1.00 0.00 ? 71  HIS A ND1  4  
ATOM 7744  C CD2  . HIS A 1 71  ? -0.925  18.583  5.841   1.00 0.00 ? 71  HIS A CD2  4  
ATOM 7745  C CE1  . HIS A 1 71  ? 0.424   20.308  5.735   1.00 0.00 ? 71  HIS A CE1  4  
ATOM 7746  N NE2  . HIS A 1 71  ? -0.822  19.917  5.537   1.00 0.00 ? 71  HIS A NE2  4  
ATOM 7747  H H    . HIS A 1 71  ? -0.345  16.564  8.941   1.00 0.00 ? 71  HIS A H    4  
ATOM 7748  H HA   . HIS A 1 71  ? -1.175  16.041  6.293   1.00 0.00 ? 71  HIS A HA   4  
ATOM 7749  H HB2  . HIS A 1 71  ? 1.360   16.953  7.581   1.00 0.00 ? 71  HIS A HB2  4  
ATOM 7750  H HB3  . HIS A 1 71  ? 1.418   16.419  5.904   1.00 0.00 ? 71  HIS A HB3  4  
ATOM 7751  H HD1  . HIS A 1 71  ? 2.078   19.288  6.378   1.00 0.00 ? 71  HIS A HD1  4  
ATOM 7752  H HD2  . HIS A 1 71  ? -1.819  17.978  5.778   1.00 0.00 ? 71  HIS A HD2  4  
ATOM 7753  H HE1  . HIS A 1 71  ? 0.806   21.305  5.580   1.00 0.00 ? 71  HIS A HE1  4  
ATOM 7754  H HE2  . HIS A 1 71  ? -1.568  20.510  5.306   1.00 0.00 ? 71  HIS A HE2  4  
ATOM 7755  N N    . GLN A 1 72  ? 0.891   13.859  7.639   1.00 0.00 ? 72  GLN A N    4  
ATOM 7756  C CA   . GLN A 1 72  ? 1.416   12.504  7.511   1.00 0.00 ? 72  GLN A CA   4  
ATOM 7757  C C    . GLN A 1 72  ? 0.283   11.491  7.385   1.00 0.00 ? 72  GLN A C    4  
ATOM 7758  O O    . GLN A 1 72  ? 0.403   10.494  6.671   1.00 0.00 ? 72  GLN A O    4  
ATOM 7759  C CB   . GLN A 1 72  ? 2.295   12.158  8.713   1.00 0.00 ? 72  GLN A CB   4  
ATOM 7760  C CG   . GLN A 1 72  ? 3.668   12.810  8.673   1.00 0.00 ? 72  GLN A CG   4  
ATOM 7761  C CD   . GLN A 1 72  ? 4.383   12.746  10.007  1.00 0.00 ? 72  GLN A CD   4  
ATOM 7762  O OE1  . GLN A 1 72  ? 4.637   11.665  10.538  1.00 0.00 ? 72  GLN A OE1  4  
ATOM 7763  N NE2  . GLN A 1 72  ? 4.714   13.910  10.557  1.00 0.00 ? 72  GLN A NE2  4  
ATOM 7764  H H    . GLN A 1 72  ? 1.106   14.380  8.440   1.00 0.00 ? 72  GLN A H    4  
ATOM 7765  H HA   . GLN A 1 72  ? 2.017   12.465  6.614   1.00 0.00 ? 72  GLN A HA   4  
ATOM 7766  H HB2  . GLN A 1 72  ? 1.794   12.479  9.615   1.00 0.00 ? 72  GLN A HB2  4  
ATOM 7767  H HB3  . GLN A 1 72  ? 2.430   11.087  8.749   1.00 0.00 ? 72  GLN A HB3  4  
ATOM 7768  H HG2  . GLN A 1 72  ? 4.270   12.302  7.934   1.00 0.00 ? 72  GLN A HG2  4  
ATOM 7769  H HG3  . GLN A 1 72  ? 3.551   13.845  8.391   1.00 0.00 ? 72  GLN A HG3  4  
ATOM 7770  H HE21 . GLN A 1 72  ? 4.478   14.731  10.077  1.00 0.00 ? 72  GLN A HE21 4  
ATOM 7771  H HE22 . GLN A 1 72  ? 5.176   13.898  11.420  1.00 0.00 ? 72  GLN A HE22 4  
ATOM 7772  N N    . LEU A 1 73  ? -0.817  11.751  8.083   1.00 0.00 ? 73  LEU A N    4  
ATOM 7773  C CA   . LEU A 1 73  ? -1.973  10.862  8.050   1.00 0.00 ? 73  LEU A CA   4  
ATOM 7774  C C    . LEU A 1 73  ? -2.594  10.827  6.657   1.00 0.00 ? 73  LEU A C    4  
ATOM 7775  O O    . LEU A 1 73  ? -2.738  9.762   6.058   1.00 0.00 ? 73  LEU A O    4  
ATOM 7776  C CB   . LEU A 1 73  ? -3.016  11.311  9.075   1.00 0.00 ? 73  LEU A CB   4  
ATOM 7777  C CG   . LEU A 1 73  ? -2.878  10.718  10.477  1.00 0.00 ? 73  LEU A CG   4  
ATOM 7778  C CD1  . LEU A 1 73  ? -3.120  9.216   10.447  1.00 0.00 ? 73  LEU A CD1  4  
ATOM 7779  C CD2  . LEU A 1 73  ? -1.505  11.027  11.055  1.00 0.00 ? 73  LEU A CD2  4  
ATOM 7780  H H    . LEU A 1 73  ? -0.853  12.561  8.633   1.00 0.00 ? 73  LEU A H    4  
ATOM 7781  H HA   . LEU A 1 73  ? -1.633  9.869   8.305   1.00 0.00 ? 73  LEU A HA   4  
ATOM 7782  H HB2  . LEU A 1 73  ? -2.952  12.385  9.163   1.00 0.00 ? 73  LEU A HB2  4  
ATOM 7783  H HB3  . LEU A 1 73  ? -3.990  11.040  8.694   1.00 0.00 ? 73  LEU A HB3  4  
ATOM 7784  H HG   . LEU A 1 73  ? -3.623  11.162  11.124  1.00 0.00 ? 73  LEU A HG   4  
ATOM 7785  H HD11 . LEU A 1 73  ? -2.173  8.699   10.409  1.00 0.00 ? 73  LEU A HD11 4  
ATOM 7786  H HD12 . LEU A 1 73  ? -3.704  8.963   9.575   1.00 0.00 ? 73  LEU A HD12 4  
ATOM 7787  H HD13 . LEU A 1 73  ? -3.657  8.920   11.337  1.00 0.00 ? 73  LEU A HD13 4  
ATOM 7788  H HD21 . LEU A 1 73  ? -1.619  11.529  12.005  1.00 0.00 ? 73  LEU A HD21 4  
ATOM 7789  H HD22 . LEU A 1 73  ? -0.964  11.667  10.374  1.00 0.00 ? 73  LEU A HD22 4  
ATOM 7790  H HD23 . LEU A 1 73  ? -0.958  10.107  11.197  1.00 0.00 ? 73  LEU A HD23 4  
ATOM 7791  N N    . GLU A 1 74  ? -2.956  12.000  6.147   1.00 0.00 ? 74  GLU A N    4  
ATOM 7792  C CA   . GLU A 1 74  ? -3.560  12.103  4.824   1.00 0.00 ? 74  GLU A CA   4  
ATOM 7793  C C    . GLU A 1 74  ? -2.855  11.183  3.831   1.00 0.00 ? 74  GLU A C    4  
ATOM 7794  O O    . GLU A 1 74  ? -3.497  10.529  3.010   1.00 0.00 ? 74  GLU A O    4  
ATOM 7795  C CB   . GLU A 1 74  ? -3.506  13.548  4.325   1.00 0.00 ? 74  GLU A CB   4  
ATOM 7796  C CG   . GLU A 1 74  ? -4.562  13.872  3.281   1.00 0.00 ? 74  GLU A CG   4  
ATOM 7797  C CD   . GLU A 1 74  ? -5.973  13.722  3.813   1.00 0.00 ? 74  GLU A CD   4  
ATOM 7798  O OE1  . GLU A 1 74  ? -6.298  14.377  4.825   1.00 0.00 ? 74  GLU A OE1  4  
ATOM 7799  O OE2  . GLU A 1 74  ? -6.753  12.950  3.218   1.00 0.00 ? 74  GLU A OE2  4  
ATOM 7800  H H    . GLU A 1 74  ? -2.816  12.815  6.674   1.00 0.00 ? 74  GLU A H    4  
ATOM 7801  H HA   . GLU A 1 74  ? -4.593  11.798  4.906   1.00 0.00 ? 74  GLU A HA   4  
ATOM 7802  H HB2  . GLU A 1 74  ? -3.645  14.212  5.165   1.00 0.00 ? 74  GLU A HB2  4  
ATOM 7803  H HB3  . GLU A 1 74  ? -2.533  13.730  3.891   1.00 0.00 ? 74  GLU A HB3  4  
ATOM 7804  H HG2  . GLU A 1 74  ? -4.424  14.890  2.951   1.00 0.00 ? 74  GLU A HG2  4  
ATOM 7805  H HG3  . GLU A 1 74  ? -4.436  13.203  2.442   1.00 0.00 ? 74  GLU A HG3  4  
ATOM 7806  N N    . ASN A 1 75  ? -1.529  11.139  3.914   1.00 0.00 ? 75  ASN A N    4  
ATOM 7807  C CA   . ASN A 1 75  ? -0.735  10.301  3.021   1.00 0.00 ? 75  ASN A CA   4  
ATOM 7808  C C    . ASN A 1 75  ? -1.281  8.877   2.985   1.00 0.00 ? 75  ASN A C    4  
ATOM 7809  O O    . ASN A 1 75  ? -1.678  8.380   1.930   1.00 0.00 ? 75  ASN A O    4  
ATOM 7810  C CB   . ASN A 1 75  ? 0.728   10.287  3.469   1.00 0.00 ? 75  ASN A CB   4  
ATOM 7811  C CG   . ASN A 1 75  ? 1.434   11.597  3.177   1.00 0.00 ? 75  ASN A CG   4  
ATOM 7812  O OD1  . ASN A 1 75  ? 1.006   12.368  2.319   1.00 0.00 ? 75  ASN A OD1  4  
ATOM 7813  N ND2  . ASN A 1 75  ? 2.523   11.854  3.893   1.00 0.00 ? 75  ASN A ND2  4  
ATOM 7814  H H    . ASN A 1 75  ? -1.073  11.683  4.589   1.00 0.00 ? 75  ASN A H    4  
ATOM 7815  H HA   . ASN A 1 75  ? -0.795  10.723  2.030   1.00 0.00 ? 75  ASN A HA   4  
ATOM 7816  H HB2  . ASN A 1 75  ? 0.770   10.108  4.534   1.00 0.00 ? 75  ASN A HB2  4  
ATOM 7817  H HB3  . ASN A 1 75  ? 1.249   9.495   2.954   1.00 0.00 ? 75  ASN A HB3  4  
ATOM 7818  H HD21 . ASN A 1 75  ? 2.806   11.194  4.560   1.00 0.00 ? 75  ASN A HD21 4  
ATOM 7819  H HD22 . ASN A 1 75  ? 2.999   12.694  3.725   1.00 0.00 ? 75  ASN A HD22 4  
ATOM 7820  N N    . LEU A 1 76  ? -1.298  8.226   4.142   1.00 0.00 ? 76  LEU A N    4  
ATOM 7821  C CA   . LEU A 1 76  ? -1.796  6.858   4.244   1.00 0.00 ? 76  LEU A CA   4  
ATOM 7822  C C    . LEU A 1 76  ? -3.207  6.750   3.676   1.00 0.00 ? 76  LEU A C    4  
ATOM 7823  O O    . LEU A 1 76  ? -3.486  5.893   2.837   1.00 0.00 ? 76  LEU A O    4  
ATOM 7824  C CB   . LEU A 1 76  ? -1.783  6.396   5.702   1.00 0.00 ? 76  LEU A CB   4  
ATOM 7825  C CG   . LEU A 1 76  ? -0.403  6.208   6.334   1.00 0.00 ? 76  LEU A CG   4  
ATOM 7826  C CD1  . LEU A 1 76  ? -0.536  5.786   7.789   1.00 0.00 ? 76  LEU A CD1  4  
ATOM 7827  C CD2  . LEU A 1 76  ? 0.408   5.187   5.551   1.00 0.00 ? 76  LEU A CD2  4  
ATOM 7828  H H    . LEU A 1 76  ? -0.969  8.674   4.949   1.00 0.00 ? 76  LEU A H    4  
ATOM 7829  H HA   . LEU A 1 76  ? -1.139  6.223   3.667   1.00 0.00 ? 76  LEU A HA   4  
ATOM 7830  H HB2  . LEU A 1 76  ? -2.317  7.129   6.285   1.00 0.00 ? 76  LEU A HB2  4  
ATOM 7831  H HB3  . LEU A 1 76  ? -2.303  5.450   5.752   1.00 0.00 ? 76  LEU A HB3  4  
ATOM 7832  H HG   . LEU A 1 76  ? 0.129   7.150   6.308   1.00 0.00 ? 76  LEU A HG   4  
ATOM 7833  H HD11 . LEU A 1 76  ? 0.287   6.190   8.357   1.00 0.00 ? 76  LEU A HD11 4  
ATOM 7834  H HD12 . LEU A 1 76  ? -0.522  4.707   7.853   1.00 0.00 ? 76  LEU A HD12 4  
ATOM 7835  H HD13 . LEU A 1 76  ? -1.468  6.158   8.188   1.00 0.00 ? 76  LEU A HD13 4  
ATOM 7836  H HD21 . LEU A 1 76  ? -0.177  4.825   4.719   1.00 0.00 ? 76  LEU A HD21 4  
ATOM 7837  H HD22 . LEU A 1 76  ? 0.664   4.359   6.198   1.00 0.00 ? 76  LEU A HD22 4  
ATOM 7838  H HD23 . LEU A 1 76  ? 1.311   5.649   5.183   1.00 0.00 ? 76  LEU A HD23 4  
ATOM 7839  N N    . SER A 1 77  ? -4.095  7.624   4.139   1.00 0.00 ? 77  SER A N    4  
ATOM 7840  C CA   . SER A 1 77  ? -5.478  7.625   3.679   1.00 0.00 ? 77  SER A CA   4  
ATOM 7841  C C    . SER A 1 77  ? -5.544  7.630   2.155   1.00 0.00 ? 77  SER A C    4  
ATOM 7842  O O    . SER A 1 77  ? -6.455  7.055   1.560   1.00 0.00 ? 77  SER A O    4  
ATOM 7843  C CB   . SER A 1 77  ? -6.223  8.840   4.236   1.00 0.00 ? 77  SER A CB   4  
ATOM 7844  O OG   . SER A 1 77  ? -6.338  8.764   5.647   1.00 0.00 ? 77  SER A OG   4  
ATOM 7845  H H    . SER A 1 77  ? -3.813  8.282   4.808   1.00 0.00 ? 77  SER A H    4  
ATOM 7846  H HA   . SER A 1 77  ? -5.950  6.726   4.045   1.00 0.00 ? 77  SER A HA   4  
ATOM 7847  H HB2  . SER A 1 77  ? -5.683  9.738   3.979   1.00 0.00 ? 77  SER A HB2  4  
ATOM 7848  H HB3  . SER A 1 77  ? -7.214  8.880   3.807   1.00 0.00 ? 77  SER A HB3  4  
ATOM 7849  H HG   . SER A 1 77  ? -6.646  9.607   5.989   1.00 0.00 ? 77  SER A HG   4  
ATOM 7850  N N    . ASN A 1 78  ? -4.570  8.284   1.529   1.00 0.00 ? 78  ASN A N    4  
ATOM 7851  C CA   . ASN A 1 78  ? -4.518  8.365   0.073   1.00 0.00 ? 78  ASN A CA   4  
ATOM 7852  C C    . ASN A 1 78  ? -4.072  7.037   -0.530  1.00 0.00 ? 78  ASN A C    4  
ATOM 7853  O O    . ASN A 1 78  ? -4.736  6.488   -1.410  1.00 0.00 ? 78  ASN A O    4  
ATOM 7854  C CB   . ASN A 1 78  ? -3.564  9.481   -0.361  1.00 0.00 ? 78  ASN A CB   4  
ATOM 7855  C CG   . ASN A 1 78  ? -4.251  10.831  -0.437  1.00 0.00 ? 78  ASN A CG   4  
ATOM 7856  O OD1  . ASN A 1 78  ? -5.252  10.992  -1.136  1.00 0.00 ? 78  ASN A OD1  4  
ATOM 7857  N ND2  . ASN A 1 78  ? -3.714  11.809  0.283   1.00 0.00 ? 78  ASN A ND2  4  
ATOM 7858  H H    . ASN A 1 78  ? -3.872  8.723   2.058   1.00 0.00 ? 78  ASN A H    4  
ATOM 7859  H HA   . ASN A 1 78  ? -5.511  8.594   -0.283  1.00 0.00 ? 78  ASN A HA   4  
ATOM 7860  H HB2  . ASN A 1 78  ? -2.753  9.550   0.350   1.00 0.00 ? 78  ASN A HB2  4  
ATOM 7861  H HB3  . ASN A 1 78  ? -3.164  9.245   -1.336  1.00 0.00 ? 78  ASN A HB3  4  
ATOM 7862  H HD21 . ASN A 1 78  ? -2.916  11.607  0.816   1.00 0.00 ? 78  ASN A HD21 4  
ATOM 7863  H HD22 . ASN A 1 78  ? -4.137  12.692  0.253   1.00 0.00 ? 78  ASN A HD22 4  
ATOM 7864  N N    . PHE A 1 79  ? -2.944  6.524   -0.049  1.00 0.00 ? 79  PHE A N    4  
ATOM 7865  C CA   . PHE A 1 79  ? -2.408  5.259   -0.540  1.00 0.00 ? 79  PHE A CA   4  
ATOM 7866  C C    . PHE A 1 79  ? -3.453  4.151   -0.441  1.00 0.00 ? 79  PHE A C    4  
ATOM 7867  O O    . PHE A 1 79  ? -3.563  3.306   -1.329  1.00 0.00 ? 79  PHE A O    4  
ATOM 7868  C CB   . PHE A 1 79  ? -1.158  4.869   0.249   1.00 0.00 ? 79  PHE A CB   4  
ATOM 7869  C CG   . PHE A 1 79  ? -0.742  3.441   0.046   1.00 0.00 ? 79  PHE A CG   4  
ATOM 7870  C CD1  . PHE A 1 79  ? -0.655  2.905   -1.229  1.00 0.00 ? 79  PHE A CD1  4  
ATOM 7871  C CD2  . PHE A 1 79  ? -0.437  2.633   1.130   1.00 0.00 ? 79  PHE A CD2  4  
ATOM 7872  C CE1  . PHE A 1 79  ? -0.273  1.590   -1.419  1.00 0.00 ? 79  PHE A CE1  4  
ATOM 7873  C CE2  . PHE A 1 79  ? -0.054  1.317   0.946   1.00 0.00 ? 79  PHE A CE2  4  
ATOM 7874  C CZ   . PHE A 1 79  ? 0.030   0.796   -0.330  1.00 0.00 ? 79  PHE A CZ   4  
ATOM 7875  H H    . PHE A 1 79  ? -2.459  7.007   0.653   1.00 0.00 ? 79  PHE A H    4  
ATOM 7876  H HA   . PHE A 1 79  ? -2.142  5.393   -1.578  1.00 0.00 ? 79  PHE A HA   4  
ATOM 7877  H HB2  . PHE A 1 79  ? -0.337  5.500   -0.056  1.00 0.00 ? 79  PHE A HB2  4  
ATOM 7878  H HB3  . PHE A 1 79  ? -1.346  5.015   1.303   1.00 0.00 ? 79  PHE A HB3  4  
ATOM 7879  H HD1  . PHE A 1 79  ? -0.889  3.526   -2.082  1.00 0.00 ? 79  PHE A HD1  4  
ATOM 7880  H HD2  . PHE A 1 79  ? -0.502  3.039   2.129   1.00 0.00 ? 79  PHE A HD2  4  
ATOM 7881  H HE1  . PHE A 1 79  ? -0.208  1.186   -2.418  1.00 0.00 ? 79  PHE A HE1  4  
ATOM 7882  H HE2  . PHE A 1 79  ? 0.181   0.699   1.800   1.00 0.00 ? 79  PHE A HE2  4  
ATOM 7883  H HZ   . PHE A 1 79  ? 0.327   -0.231  -0.476  1.00 0.00 ? 79  PHE A HZ   4  
ATOM 7884  N N    . ILE A 1 80  ? -4.216  4.161   0.647   1.00 0.00 ? 80  ILE A N    4  
ATOM 7885  C CA   . ILE A 1 80  ? -5.251  3.159   0.863   1.00 0.00 ? 80  ILE A CA   4  
ATOM 7886  C C    . ILE A 1 80  ? -6.313  3.219   -0.230  1.00 0.00 ? 80  ILE A C    4  
ATOM 7887  O O    . ILE A 1 80  ? -6.444  2.296   -1.034  1.00 0.00 ? 80  ILE A O    4  
ATOM 7888  C CB   . ILE A 1 80  ? -5.932  3.339   2.233   1.00 0.00 ? 80  ILE A CB   4  
ATOM 7889  C CG1  . ILE A 1 80  ? -4.916  3.146   3.361   1.00 0.00 ? 80  ILE A CG1  4  
ATOM 7890  C CG2  . ILE A 1 80  ? -7.088  2.360   2.383   1.00 0.00 ? 80  ILE A CG2  4  
ATOM 7891  C CD1  . ILE A 1 80  ? -5.271  3.892   4.628   1.00 0.00 ? 80  ILE A CD1  4  
ATOM 7892  H H    . ILE A 1 80  ? -4.080  4.861   1.320   1.00 0.00 ? 80  ILE A H    4  
ATOM 7893  H HA   . ILE A 1 80  ? -4.782  2.186   0.842   1.00 0.00 ? 80  ILE A HA   4  
ATOM 7894  H HB   . ILE A 1 80  ? -6.330  4.340   2.284   1.00 0.00 ? 80  ILE A HB   4  
ATOM 7895  H HG12 . ILE A 1 80  ? -4.849  2.097   3.602   1.00 0.00 ? 80  ILE A HG12 4  
ATOM 7896  H HG13 . ILE A 1 80  ? -3.950  3.497   3.029   1.00 0.00 ? 80  ILE A HG13 4  
ATOM 7897  H HG21 . ILE A 1 80  ? -6.700  1.370   2.563   1.00 0.00 ? 80  ILE A HG21 4  
ATOM 7898  H HG22 . ILE A 1 80  ? -7.707  2.660   3.214   1.00 0.00 ? 80  ILE A HG22 4  
ATOM 7899  H HG23 . ILE A 1 80  ? -7.676  2.358   1.478   1.00 0.00 ? 80  ILE A HG23 4  
ATOM 7900  H HD11 . ILE A 1 80  ? -5.131  4.952   4.473   1.00 0.00 ? 80  ILE A HD11 4  
ATOM 7901  H HD12 . ILE A 1 80  ? -6.301  3.698   4.884   1.00 0.00 ? 80  ILE A HD12 4  
ATOM 7902  H HD13 . ILE A 1 80  ? -4.631  3.560   5.433   1.00 0.00 ? 80  ILE A HD13 4  
ATOM 7903  N N    . LYS A 1 81  ? -7.066  4.313   -0.256  1.00 0.00 ? 81  LYS A N    4  
ATOM 7904  C CA   . LYS A 1 81  ? -8.114  4.498   -1.253  1.00 0.00 ? 81  LYS A CA   4  
ATOM 7905  C C    . LYS A 1 81  ? -7.599  4.173   -2.651  1.00 0.00 ? 81  LYS A C    4  
ATOM 7906  O O    . LYS A 1 81  ? -8.366  3.787   -3.532  1.00 0.00 ? 81  LYS A O    4  
ATOM 7907  C CB   . LYS A 1 81  ? -8.637  5.935   -1.212  1.00 0.00 ? 81  LYS A CB   4  
ATOM 7908  C CG   . LYS A 1 81  ? -7.635  6.962   -1.707  1.00 0.00 ? 81  LYS A CG   4  
ATOM 7909  C CD   . LYS A 1 81  ? -8.327  8.192   -2.269  1.00 0.00 ? 81  LYS A CD   4  
ATOM 7910  C CE   . LYS A 1 81  ? -7.486  9.445   -2.073  1.00 0.00 ? 81  LYS A CE   4  
ATOM 7911  N NZ   . LYS A 1 81  ? -7.625  9.995   -0.697  1.00 0.00 ? 81  LYS A NZ   4  
ATOM 7912  H H    . LYS A 1 81  ? -6.913  5.015   0.412   1.00 0.00 ? 81  LYS A H    4  
ATOM 7913  H HA   . LYS A 1 81  ? -8.921  3.822   -1.014  1.00 0.00 ? 81  LYS A HA   4  
ATOM 7914  H HB2  . LYS A 1 81  ? -9.522  6.000   -1.828  1.00 0.00 ? 81  LYS A HB2  4  
ATOM 7915  H HB3  . LYS A 1 81  ? -8.901  6.181   -0.193  1.00 0.00 ? 81  LYS A HB3  4  
ATOM 7916  H HG2  . LYS A 1 81  ? -7.005  7.263   -0.883  1.00 0.00 ? 81  LYS A HG2  4  
ATOM 7917  H HG3  . LYS A 1 81  ? -7.028  6.515   -2.482  1.00 0.00 ? 81  LYS A HG3  4  
ATOM 7918  H HD2  . LYS A 1 81  ? -8.497  8.048   -3.326  1.00 0.00 ? 81  LYS A HD2  4  
ATOM 7919  H HD3  . LYS A 1 81  ? -9.275  8.324   -1.765  1.00 0.00 ? 81  LYS A HD3  4  
ATOM 7920  H HE2  . LYS A 1 81  ? -6.451  9.198   -2.251  1.00 0.00 ? 81  LYS A HE2  4  
ATOM 7921  H HE3  . LYS A 1 81  ? -7.805  10.191  -2.785  1.00 0.00 ? 81  LYS A HE3  4  
ATOM 7922  H HZ1  . LYS A 1 81  ? -6.939  10.764  -0.550  1.00 0.00 ? 81  LYS A HZ1  4  
ATOM 7923  H HZ2  . LYS A 1 81  ? -7.448  9.250   0.006   1.00 0.00 ? 81  LYS A HZ2  4  
ATOM 7924  H HZ3  . LYS A 1 81  ? -8.584  10.371  -0.557  1.00 0.00 ? 81  LYS A HZ3  4  
ATOM 7925  N N    . ALA A 1 82  ? -6.293  4.331   -2.847  1.00 0.00 ? 82  ALA A N    4  
ATOM 7926  C CA   . ALA A 1 82  ? -5.675  4.051   -4.137  1.00 0.00 ? 82  ALA A CA   4  
ATOM 7927  C C    . ALA A 1 82  ? -5.600  2.550   -4.395  1.00 0.00 ? 82  ALA A C    4  
ATOM 7928  O O    . ALA A 1 82  ? -5.728  2.100   -5.534  1.00 0.00 ? 82  ALA A O    4  
ATOM 7929  C CB   . ALA A 1 82  ? -4.286  4.670   -4.202  1.00 0.00 ? 82  ALA A CB   4  
ATOM 7930  H H    . ALA A 1 82  ? -5.733  4.641   -2.106  1.00 0.00 ? 82  ALA A H    4  
ATOM 7931  H HA   . ALA A 1 82  ? -6.282  4.508   -4.905  1.00 0.00 ? 82  ALA A HA   4  
ATOM 7932  H HB1  . ALA A 1 82  ? -4.201  5.267   -5.099  1.00 0.00 ? 82  ALA A HB1  4  
ATOM 7933  H HB2  . ALA A 1 82  ? -4.130  5.296   -3.336  1.00 0.00 ? 82  ALA A HB2  4  
ATOM 7934  H HB3  . ALA A 1 82  ? -3.544  3.886   -4.220  1.00 0.00 ? 82  ALA A HB3  4  
ATOM 7935  N N    . MET A 1 83  ? -5.390  1.781   -3.332  1.00 0.00 ? 83  MET A N    4  
ATOM 7936  C CA   . MET A 1 83  ? -5.298  0.329   -3.445  1.00 0.00 ? 83  MET A CA   4  
ATOM 7937  C C    . MET A 1 83  ? -6.627  -0.265  -3.902  1.00 0.00 ? 83  MET A C    4  
ATOM 7938  O O    . MET A 1 83  ? -6.662  -1.135  -4.773  1.00 0.00 ? 83  MET A O    4  
ATOM 7939  C CB   . MET A 1 83  ? -4.885  -0.283  -2.106  1.00 0.00 ? 83  MET A CB   4  
ATOM 7940  C CG   . MET A 1 83  ? -3.416  -0.083  -1.773  1.00 0.00 ? 83  MET A CG   4  
ATOM 7941  S SD   . MET A 1 83  ? -2.803  -1.289  -0.581  1.00 0.00 ? 83  MET A SD   4  
ATOM 7942  C CE   . MET A 1 83  ? -3.253  -0.497  0.962   1.00 0.00 ? 83  MET A CE   4  
ATOM 7943  H H    . MET A 1 83  ? -5.295  2.198   -2.451  1.00 0.00 ? 83  MET A H    4  
ATOM 7944  H HA   . MET A 1 83  ? -4.543  0.103   -4.183  1.00 0.00 ? 83  MET A HA   4  
ATOM 7945  H HB2  . MET A 1 83  ? -5.474  0.168   -1.321  1.00 0.00 ? 83  MET A HB2  4  
ATOM 7946  H HB3  . MET A 1 83  ? -5.085  -1.343  -2.131  1.00 0.00 ? 83  MET A HB3  4  
ATOM 7947  H HG2  . MET A 1 83  ? -2.839  -0.172  -2.682  1.00 0.00 ? 83  MET A HG2  4  
ATOM 7948  H HG3  . MET A 1 83  ? -3.286  0.908   -1.363  1.00 0.00 ? 83  MET A HG3  4  
ATOM 7949  H HE1  . MET A 1 83  ? -2.722  -0.968  1.776   1.00 0.00 ? 83  MET A HE1  4  
ATOM 7950  H HE2  . MET A 1 83  ? -2.991  0.550   0.919   1.00 0.00 ? 83  MET A HE2  4  
ATOM 7951  H HE3  . MET A 1 83  ? -4.317  -0.596  1.121   1.00 0.00 ? 83  MET A HE3  4  
ATOM 7952  N N    . VAL A 1 84  ? -7.718  0.209   -3.308  1.00 0.00 ? 84  VAL A N    4  
ATOM 7953  C CA   . VAL A 1 84  ? -9.048  -0.275  -3.655  1.00 0.00 ? 84  VAL A CA   4  
ATOM 7954  C C    . VAL A 1 84  ? -9.257  -0.275  -5.165  1.00 0.00 ? 84  VAL A C    4  
ATOM 7955  O O    . VAL A 1 84  ? -9.792  -1.230  -5.728  1.00 0.00 ? 84  VAL A O    4  
ATOM 7956  C CB   . VAL A 1 84  ? -10.146 0.579   -2.995  1.00 0.00 ? 84  VAL A CB   4  
ATOM 7957  C CG1  . VAL A 1 84  ? -11.516 0.201   -3.537  1.00 0.00 ? 84  VAL A CG1  4  
ATOM 7958  C CG2  . VAL A 1 84  ? -10.102 0.429   -1.482  1.00 0.00 ? 84  VAL A CG2  4  
ATOM 7959  H H    . VAL A 1 84  ? -7.625  0.902   -2.622  1.00 0.00 ? 84  VAL A H    4  
ATOM 7960  H HA   . VAL A 1 84  ? -9.141  -1.288  -3.288  1.00 0.00 ? 84  VAL A HA   4  
ATOM 7961  H HB   . VAL A 1 84  ? -9.961  1.616   -3.238  1.00 0.00 ? 84  VAL A HB   4  
ATOM 7962  H HG11 . VAL A 1 84  ? -11.904 1.013   -4.135  1.00 0.00 ? 84  VAL A HG11 4  
ATOM 7963  H HG12 . VAL A 1 84  ? -11.430 -0.687  -4.145  1.00 0.00 ? 84  VAL A HG12 4  
ATOM 7964  H HG13 . VAL A 1 84  ? -12.188 0.010   -2.714  1.00 0.00 ? 84  VAL A HG13 4  
ATOM 7965  H HG21 . VAL A 1 84  ? -10.258 -0.607  -1.220  1.00 0.00 ? 84  VAL A HG21 4  
ATOM 7966  H HG22 . VAL A 1 84  ? -9.138  0.751   -1.115  1.00 0.00 ? 84  VAL A HG22 4  
ATOM 7967  H HG23 . VAL A 1 84  ? -10.877 1.034   -1.036  1.00 0.00 ? 84  VAL A HG23 4  
ATOM 7968  N N    . SER A 1 85  ? -8.833  0.804   -5.815  1.00 0.00 ? 85  SER A N    4  
ATOM 7969  C CA   . SER A 1 85  ? -8.977  0.930   -7.261  1.00 0.00 ? 85  SER A CA   4  
ATOM 7970  C C    . SER A 1 85  ? -8.119  -0.104  -7.984  1.00 0.00 ? 85  SER A C    4  
ATOM 7971  O O    . SER A 1 85  ? -8.505  -0.622  -9.033  1.00 0.00 ? 85  SER A O    4  
ATOM 7972  C CB   . SER A 1 85  ? -8.585  2.339   -7.711  1.00 0.00 ? 85  SER A CB   4  
ATOM 7973  O OG   . SER A 1 85  ? -9.055  2.603   -9.022  1.00 0.00 ? 85  SER A OG   4  
ATOM 7974  H H    . SER A 1 85  ? -8.415  1.532   -5.309  1.00 0.00 ? 85  SER A H    4  
ATOM 7975  H HA   . SER A 1 85  ? -10.013 0.757   -7.507  1.00 0.00 ? 85  SER A HA   4  
ATOM 7976  H HB2  . SER A 1 85  ? -9.015  3.063   -7.036  1.00 0.00 ? 85  SER A HB2  4  
ATOM 7977  H HB3  . SER A 1 85  ? -7.509  2.431   -7.702  1.00 0.00 ? 85  SER A HB3  4  
ATOM 7978  H HG   . SER A 1 85  ? -8.523  2.118   -9.657  1.00 0.00 ? 85  SER A HG   4  
ATOM 7979  N N    . TYR A 1 86  ? -6.955  -0.399  -7.418  1.00 0.00 ? 86  TYR A N    4  
ATOM 7980  C CA   . TYR A 1 86  ? -6.041  -1.369  -8.010  1.00 0.00 ? 86  TYR A CA   4  
ATOM 7981  C C    . TYR A 1 86  ? -6.732  -2.712  -8.217  1.00 0.00 ? 86  TYR A C    4  
ATOM 7982  O O    . TYR A 1 86  ? -6.579  -3.348  -9.259  1.00 0.00 ? 86  TYR A O    4  
ATOM 7983  C CB   . TYR A 1 86  ? -4.809  -1.548  -7.119  1.00 0.00 ? 86  TYR A CB   4  
ATOM 7984  C CG   . TYR A 1 86  ? -3.556  -1.905  -7.886  1.00 0.00 ? 86  TYR A CG   4  
ATOM 7985  C CD1  . TYR A 1 86  ? -3.091  -1.092  -8.914  1.00 0.00 ? 86  TYR A CD1  4  
ATOM 7986  C CD2  . TYR A 1 86  ? -2.836  -3.054  -7.584  1.00 0.00 ? 86  TYR A CD2  4  
ATOM 7987  C CE1  . TYR A 1 86  ? -1.947  -1.414  -9.617  1.00 0.00 ? 86  TYR A CE1  4  
ATOM 7988  C CE2  . TYR A 1 86  ? -1.690  -3.383  -8.282  1.00 0.00 ? 86  TYR A CE2  4  
ATOM 7989  C CZ   . TYR A 1 86  ? -1.249  -2.560  -9.297  1.00 0.00 ? 86  TYR A CZ   4  
ATOM 7990  O OH   . TYR A 1 86  ? -0.108  -2.884  -9.995  1.00 0.00 ? 86  TYR A OH   4  
ATOM 7991  H H    . TYR A 1 86  ? -6.702  0.048   -6.583  1.00 0.00 ? 86  TYR A H    4  
ATOM 7992  H HA   . TYR A 1 86  ? -5.726  -0.986  -8.969  1.00 0.00 ? 86  TYR A HA   4  
ATOM 7993  H HB2  . TYR A 1 86  ? -4.622  -0.629  -6.587  1.00 0.00 ? 86  TYR A HB2  4  
ATOM 7994  H HB3  . TYR A 1 86  ? -5.000  -2.339  -6.409  1.00 0.00 ? 86  TYR A HB3  4  
ATOM 7995  H HD1  . TYR A 1 86  ? -3.639  -0.195  -9.162  1.00 0.00 ? 86  TYR A HD1  4  
ATOM 7996  H HD2  . TYR A 1 86  ? -3.184  -3.697  -6.788  1.00 0.00 ? 86  TYR A HD2  4  
ATOM 7997  H HE1  . TYR A 1 86  ? -1.601  -0.769  -10.412 1.00 0.00 ? 86  TYR A HE1  4  
ATOM 7998  H HE2  . TYR A 1 86  ? -1.143  -4.281  -8.032  1.00 0.00 ? 86  TYR A HE2  4  
ATOM 7999  H HH   . TYR A 1 86  ? 0.118   -3.802  -9.828  1.00 0.00 ? 86  TYR A HH   4  
ATOM 8000  N N    . GLY A 1 87  ? -7.496  -3.139  -7.217  1.00 0.00 ? 87  GLY A N    4  
ATOM 8001  C CA   . GLY A 1 87  ? -8.201  -4.404  -7.308  1.00 0.00 ? 87  GLY A CA   4  
ATOM 8002  C C    . GLY A 1 87  ? -7.888  -5.327  -6.146  1.00 0.00 ? 87  GLY A C    4  
ATOM 8003  O O    . GLY A 1 87  ? -7.811  -6.544  -6.316  1.00 0.00 ? 87  GLY A O    4  
ATOM 8004  H H    . GLY A 1 87  ? -7.581  -2.590  -6.408  1.00 0.00 ? 87  GLY A H    4  
ATOM 8005  H HA2  . GLY A 1 87  ? -9.263  -4.211  -7.325  1.00 0.00 ? 87  GLY A HA2  4  
ATOM 8006  H HA3  . GLY A 1 87  ? -7.919  -4.895  -8.228  1.00 0.00 ? 87  GLY A HA3  4  
ATOM 8007  N N    . MET A 1 88  ? -7.708  -4.749  -4.964  1.00 0.00 ? 88  MET A N    4  
ATOM 8008  C CA   . MET A 1 88  ? -7.403  -5.528  -3.771  1.00 0.00 ? 88  MET A CA   4  
ATOM 8009  C C    . MET A 1 88  ? -8.666  -5.802  -2.962  1.00 0.00 ? 88  MET A C    4  
ATOM 8010  O O    . MET A 1 88  ? -9.720  -5.228  -3.226  1.00 0.00 ? 88  MET A O    4  
ATOM 8011  C CB   . MET A 1 88  ? -6.377  -4.793  -2.905  1.00 0.00 ? 88  MET A CB   4  
ATOM 8012  C CG   . MET A 1 88  ? -5.009  -4.670  -3.554  1.00 0.00 ? 88  MET A CG   4  
ATOM 8013  S SD   . MET A 1 88  ? -3.932  -6.065  -3.173  1.00 0.00 ? 88  MET A SD   4  
ATOM 8014  C CE   . MET A 1 88  ? -3.544  -5.736  -1.456  1.00 0.00 ? 88  MET A CE   4  
ATOM 8015  H H    . MET A 1 88  ? -7.783  -3.774  -4.892  1.00 0.00 ? 88  MET A H    4  
ATOM 8016  H HA   . MET A 1 88  ? -6.981  -6.470  -4.089  1.00 0.00 ? 88  MET A HA   4  
ATOM 8017  H HB2  . MET A 1 88  ? -6.745  -3.799  -2.698  1.00 0.00 ? 88  MET A HB2  4  
ATOM 8018  H HB3  . MET A 1 88  ? -6.262  -5.326  -1.972  1.00 0.00 ? 88  MET A HB3  4  
ATOM 8019  H HG2  . MET A 1 88  ? -5.136  -4.614  -4.624  1.00 0.00 ? 88  MET A HG2  4  
ATOM 8020  H HG3  . MET A 1 88  ? -4.539  -3.763  -3.201  1.00 0.00 ? 88  MET A HG3  4  
ATOM 8021  H HE1  . MET A 1 88  ? -4.135  -4.902  -1.107  1.00 0.00 ? 88  MET A HE1  4  
ATOM 8022  H HE2  . MET A 1 88  ? -3.770  -6.610  -0.863  1.00 0.00 ? 88  MET A HE2  4  
ATOM 8023  H HE3  . MET A 1 88  ? -2.494  -5.498  -1.364  1.00 0.00 ? 88  MET A HE3  4  
ATOM 8024  N N    . ASN A 1 89  ? -8.551  -6.686  -1.975  1.00 0.00 ? 89  ASN A N    4  
ATOM 8025  C CA   . ASN A 1 89  ? -9.685  -7.037  -1.128  1.00 0.00 ? 89  ASN A CA   4  
ATOM 8026  C C    . ASN A 1 89  ? -9.977  -5.928  -0.121  1.00 0.00 ? 89  ASN A C    4  
ATOM 8027  O O    . ASN A 1 89  ? -9.112  -5.118  0.215   1.00 0.00 ? 89  ASN A O    4  
ATOM 8028  C CB   . ASN A 1 89  ? -9.412  -8.351  -0.393  1.00 0.00 ? 89  ASN A CB   4  
ATOM 8029  C CG   . ASN A 1 89  ? -9.845  -9.563  -1.194  1.00 0.00 ? 89  ASN A CG   4  
ATOM 8030  O OD1  . ASN A 1 89  ? -10.100 -9.468  -2.395  1.00 0.00 ? 89  ASN A OD1  4  
ATOM 8031  N ND2  . ASN A 1 89  ? -9.929  -10.711 -0.532  1.00 0.00 ? 89  ASN A ND2  4  
ATOM 8032  H H    . ASN A 1 89  ? -7.684  -7.112  -1.812  1.00 0.00 ? 89  ASN A H    4  
ATOM 8033  H HA   . ASN A 1 89  ? -10.548 -7.165  -1.765  1.00 0.00 ? 89  ASN A HA   4  
ATOM 8034  H HB2  . ASN A 1 89  ? -8.353  -8.433  -0.196  1.00 0.00 ? 89  ASN A HB2  4  
ATOM 8035  H HB3  . ASN A 1 89  ? -9.948  -8.350  0.544   1.00 0.00 ? 89  ASN A HB3  4  
ATOM 8036  H HD21 . ASN A 1 89  ? -9.711  -10.711 0.424   1.00 0.00 ? 89  ASN A HD21 4  
ATOM 8037  H HD22 . ASN A 1 89  ? -10.207 -11.511 -1.025  1.00 0.00 ? 89  ASN A HD22 4  
ATOM 8038  N N    . PRO A 1 90  ? -11.223 -5.890  0.373   1.00 0.00 ? 90  PRO A N    4  
ATOM 8039  C CA   . PRO A 1 90  ? -11.657 -4.887  1.350   1.00 0.00 ? 90  PRO A CA   4  
ATOM 8040  C C    . PRO A 1 90  ? -11.015 -5.094  2.718   1.00 0.00 ? 90  PRO A C    4  
ATOM 8041  O O    . PRO A 1 90  ? -11.055 -4.209  3.573   1.00 0.00 ? 90  PRO A O    4  
ATOM 8042  C CB   . PRO A 1 90  ? -13.170 -5.102  1.431   1.00 0.00 ? 90  PRO A CB   4  
ATOM 8043  C CG   . PRO A 1 90  ? -13.373 -6.523  1.031   1.00 0.00 ? 90  PRO A CG   4  
ATOM 8044  C CD   . PRO A 1 90  ? -12.305 -6.825  0.017   1.00 0.00 ? 90  PRO A CD   4  
ATOM 8045  H HA   . PRO A 1 90  ? -11.453 -3.884  1.005   1.00 0.00 ? 90  PRO A HA   4  
ATOM 8046  H HB2  . PRO A 1 90  ? -13.508 -4.923  2.441   1.00 0.00 ? 90  PRO A HB2  4  
ATOM 8047  H HB3  . PRO A 1 90  ? -13.671 -4.426  0.753   1.00 0.00 ? 90  PRO A HB3  4  
ATOM 8048  H HG2  . PRO A 1 90  ? -13.265 -7.165  1.892   1.00 0.00 ? 90  PRO A HG2  4  
ATOM 8049  H HG3  . PRO A 1 90  ? -14.351 -6.644  0.591   1.00 0.00 ? 90  PRO A HG3  4  
ATOM 8050  H HD2  . PRO A 1 90  ? -11.975 -7.849  0.109   1.00 0.00 ? 90  PRO A HD2  4  
ATOM 8051  H HD3  . PRO A 1 90  ? -12.666 -6.631  -0.982  1.00 0.00 ? 90  PRO A HD3  4  
ATOM 8052  N N    . VAL A 1 91  ? -10.424 -6.267  2.917   1.00 0.00 ? 91  VAL A N    4  
ATOM 8053  C CA   . VAL A 1 91  ? -9.773  -6.590  4.181   1.00 0.00 ? 91  VAL A CA   4  
ATOM 8054  C C    . VAL A 1 91  ? -8.273  -6.327  4.109   1.00 0.00 ? 91  VAL A C    4  
ATOM 8055  O O    . VAL A 1 91  ? -7.686  -5.758  5.029   1.00 0.00 ? 91  VAL A O    4  
ATOM 8056  C CB   . VAL A 1 91  ? -10.008 -8.061  4.574   1.00 0.00 ? 91  VAL A CB   4  
ATOM 8057  C CG1  . VAL A 1 91  ? -11.494 -8.342  4.727   1.00 0.00 ? 91  VAL A CG1  4  
ATOM 8058  C CG2  . VAL A 1 91  ? -9.383  -8.992  3.547   1.00 0.00 ? 91  VAL A CG2  4  
ATOM 8059  H H    . VAL A 1 91  ? -10.426 -6.932  2.198   1.00 0.00 ? 91  VAL A H    4  
ATOM 8060  H HA   . VAL A 1 91  ? -10.203 -5.961  4.948   1.00 0.00 ? 91  VAL A HA   4  
ATOM 8061  H HB   . VAL A 1 91  ? -9.531  -8.237  5.527   1.00 0.00 ? 91  VAL A HB   4  
ATOM 8062  H HG11 . VAL A 1 91  ? -12.024 -7.411  4.866   1.00 0.00 ? 91  VAL A HG11 4  
ATOM 8063  H HG12 . VAL A 1 91  ? -11.861 -8.837  3.840   1.00 0.00 ? 91  VAL A HG12 4  
ATOM 8064  H HG13 . VAL A 1 91  ? -11.654 -8.977  5.587   1.00 0.00 ? 91  VAL A HG13 4  
ATOM 8065  H HG21 . VAL A 1 91  ? -8.315  -9.028  3.697   1.00 0.00 ? 91  VAL A HG21 4  
ATOM 8066  H HG22 . VAL A 1 91  ? -9.796  -9.985  3.662   1.00 0.00 ? 91  VAL A HG22 4  
ATOM 8067  H HG23 . VAL A 1 91  ? -9.596  -8.628  2.553   1.00 0.00 ? 91  VAL A HG23 4  
ATOM 8068  N N    . ASP A 1 92  ? -7.657  -6.747  3.009   1.00 0.00 ? 92  ASP A N    4  
ATOM 8069  C CA   . ASP A 1 92  ? -6.225  -6.557  2.815   1.00 0.00 ? 92  ASP A CA   4  
ATOM 8070  C C    . ASP A 1 92  ? -5.821  -5.119  3.125   1.00 0.00 ? 92  ASP A C    4  
ATOM 8071  O O    . ASP A 1 92  ? -4.651  -4.832  3.381   1.00 0.00 ? 92  ASP A O    4  
ATOM 8072  C CB   . ASP A 1 92  ? -5.831  -6.912  1.381   1.00 0.00 ? 92  ASP A CB   4  
ATOM 8073  C CG   . ASP A 1 92  ? -5.947  -8.398  1.100   1.00 0.00 ? 92  ASP A CG   4  
ATOM 8074  O OD1  . ASP A 1 92  ? -6.560  -9.111  1.922   1.00 0.00 ? 92  ASP A OD1  4  
ATOM 8075  O OD2  . ASP A 1 92  ? -5.426  -8.846  0.057   1.00 0.00 ? 92  ASP A OD2  4  
ATOM 8076  H H    . ASP A 1 92  ? -8.179  -7.195  2.310   1.00 0.00 ? 92  ASP A H    4  
ATOM 8077  H HA   . ASP A 1 92  ? -5.707  -7.216  3.494   1.00 0.00 ? 92  ASP A HA   4  
ATOM 8078  H HB2  . ASP A 1 92  ? -6.478  -6.384  0.695   1.00 0.00 ? 92  ASP A HB2  4  
ATOM 8079  H HB3  . ASP A 1 92  ? -4.808  -6.610  1.210   1.00 0.00 ? 92  ASP A HB3  4  
ATOM 8080  N N    . LEU A 1 93  ? -6.797  -4.217  3.099   1.00 0.00 ? 93  LEU A N    4  
ATOM 8081  C CA   . LEU A 1 93  ? -6.544  -2.807  3.376   1.00 0.00 ? 93  LEU A CA   4  
ATOM 8082  C C    . LEU A 1 93  ? -6.241  -2.589  4.855   1.00 0.00 ? 93  LEU A C    4  
ATOM 8083  O O    . LEU A 1 93  ? -6.601  -3.408  5.701   1.00 0.00 ? 93  LEU A O    4  
ATOM 8084  C CB   . LEU A 1 93  ? -7.747  -1.961  2.960   1.00 0.00 ? 93  LEU A CB   4  
ATOM 8085  C CG   . LEU A 1 93  ? -8.281  -2.203  1.547   1.00 0.00 ? 93  LEU A CG   4  
ATOM 8086  C CD1  . LEU A 1 93  ? -9.500  -1.333  1.281   1.00 0.00 ? 93  LEU A CD1  4  
ATOM 8087  C CD2  . LEU A 1 93  ? -7.197  -1.935  0.514   1.00 0.00 ? 93  LEU A CD2  4  
ATOM 8088  H H    . LEU A 1 93  ? -7.709  -4.505  2.889   1.00 0.00 ? 93  LEU A H    4  
ATOM 8089  H HA   . LEU A 1 93  ? -5.683  -2.505  2.797   1.00 0.00 ? 93  LEU A HA   4  
ATOM 8090  H HB2  . LEU A 1 93  ? -8.549  -2.161  3.655   1.00 0.00 ? 93  LEU A HB2  4  
ATOM 8091  H HB3  . LEU A 1 93  ? -7.461  -0.921  3.033   1.00 0.00 ? 93  LEU A HB3  4  
ATOM 8092  H HG   . LEU A 1 93  ? -8.584  -3.236  1.456   1.00 0.00 ? 93  LEU A HG   4  
ATOM 8093  H HD11 . LEU A 1 93  ? -9.222  -0.509  0.640   1.00 0.00 ? 93  LEU A HD11 4  
ATOM 8094  H HD12 . LEU A 1 93  ? -9.879  -0.948  2.217   1.00 0.00 ? 93  LEU A HD12 4  
ATOM 8095  H HD13 . LEU A 1 93  ? -10.266 -1.923  0.800   1.00 0.00 ? 93  LEU A HD13 4  
ATOM 8096  H HD21 . LEU A 1 93  ? -6.731  -2.868  0.232   1.00 0.00 ? 93  LEU A HD21 4  
ATOM 8097  H HD22 . LEU A 1 93  ? -6.453  -1.275  0.936   1.00 0.00 ? 93  LEU A HD22 4  
ATOM 8098  H HD23 . LEU A 1 93  ? -7.637  -1.473  -0.357  1.00 0.00 ? 93  LEU A HD23 4  
ATOM 8099  N N    . PHE A 1 94  ? -5.579  -1.478  5.160   1.00 0.00 ? 94  PHE A N    4  
ATOM 8100  C CA   . PHE A 1 94  ? -5.229  -1.150  6.538   1.00 0.00 ? 94  PHE A CA   4  
ATOM 8101  C C    . PHE A 1 94  ? -5.627  0.284   6.873   1.00 0.00 ? 94  PHE A C    4  
ATOM 8102  O O    . PHE A 1 94  ? -6.039  1.046   5.999   1.00 0.00 ? 94  PHE A O    4  
ATOM 8103  C CB   . PHE A 1 94  ? -3.728  -1.341  6.764   1.00 0.00 ? 94  PHE A CB   4  
ATOM 8104  C CG   . PHE A 1 94  ? -2.875  -0.434  5.925   1.00 0.00 ? 94  PHE A CG   4  
ATOM 8105  C CD1  . PHE A 1 94  ? -2.566  0.846   6.359   1.00 0.00 ? 94  PHE A CD1  4  
ATOM 8106  C CD2  . PHE A 1 94  ? -2.381  -0.860  4.703   1.00 0.00 ? 94  PHE A CD2  4  
ATOM 8107  C CE1  . PHE A 1 94  ? -1.780  1.683   5.590   1.00 0.00 ? 94  PHE A CE1  4  
ATOM 8108  C CE2  . PHE A 1 94  ? -1.596  -0.027  3.929   1.00 0.00 ? 94  PHE A CE2  4  
ATOM 8109  C CZ   . PHE A 1 94  ? -1.295  1.246   4.373   1.00 0.00 ? 94  PHE A CZ   4  
ATOM 8110  H H    . PHE A 1 94  ? -5.319  -0.863  4.442   1.00 0.00 ? 94  PHE A H    4  
ATOM 8111  H HA   . PHE A 1 94  ? -5.771  -1.822  7.185   1.00 0.00 ? 94  PHE A HA   4  
ATOM 8112  H HB2  . PHE A 1 94  ? -3.500  -1.146  7.801   1.00 0.00 ? 94  PHE A HB2  4  
ATOM 8113  H HB3  . PHE A 1 94  ? -3.463  -2.361  6.528   1.00 0.00 ? 94  PHE A HB3  4  
ATOM 8114  H HD1  . PHE A 1 94  ? -2.945  1.187   7.312   1.00 0.00 ? 94  PHE A HD1  4  
ATOM 8115  H HD2  . PHE A 1 94  ? -2.616  -1.855  4.354   1.00 0.00 ? 94  PHE A HD2  4  
ATOM 8116  H HE1  . PHE A 1 94  ? -1.548  2.677   5.940   1.00 0.00 ? 94  PHE A HE1  4  
ATOM 8117  H HE2  . PHE A 1 94  ? -1.218  -0.371  2.978   1.00 0.00 ? 94  PHE A HE2  4  
ATOM 8118  H HZ   . PHE A 1 94  ? -0.681  1.899   3.770   1.00 0.00 ? 94  PHE A HZ   4  
ATOM 8119  N N    . GLU A 1 95  ? -5.500  0.645   8.147   1.00 0.00 ? 95  GLU A N    4  
ATOM 8120  C CA   . GLU A 1 95  ? -5.847  1.987   8.598   1.00 0.00 ? 95  GLU A CA   4  
ATOM 8121  C C    . GLU A 1 95  ? -4.599  2.853   8.743   1.00 0.00 ? 95  GLU A C    4  
ATOM 8122  O O    . GLU A 1 95  ? -3.523  2.358   9.079   1.00 0.00 ? 95  GLU A O    4  
ATOM 8123  C CB   . GLU A 1 95  ? -6.594  1.923   9.933   1.00 0.00 ? 95  GLU A CB   4  
ATOM 8124  C CG   . GLU A 1 95  ? -8.038  1.470   9.801   1.00 0.00 ? 95  GLU A CG   4  
ATOM 8125  C CD   . GLU A 1 95  ? -8.165  0.099   9.167   1.00 0.00 ? 95  GLU A CD   4  
ATOM 8126  O OE1  . GLU A 1 95  ? -8.118  0.016   7.921   1.00 0.00 ? 95  GLU A OE1  4  
ATOM 8127  O OE2  . GLU A 1 95  ? -8.312  -0.890  9.914   1.00 0.00 ? 95  GLU A OE2  4  
ATOM 8128  H H    . GLU A 1 95  ? -5.166  -0.008  8.798   1.00 0.00 ? 95  GLU A H    4  
ATOM 8129  H HA   . GLU A 1 95  ? -6.494  2.429   7.856   1.00 0.00 ? 95  GLU A HA   4  
ATOM 8130  H HB2  . GLU A 1 95  ? -6.080  1.233   10.586  1.00 0.00 ? 95  GLU A HB2  4  
ATOM 8131  H HB3  . GLU A 1 95  ? -6.586  2.904   10.383  1.00 0.00 ? 95  GLU A HB3  4  
ATOM 8132  H HG2  . GLU A 1 95  ? -8.483  1.437   10.785  1.00 0.00 ? 95  GLU A HG2  4  
ATOM 8133  H HG3  . GLU A 1 95  ? -8.571  2.184   9.191   1.00 0.00 ? 95  GLU A HG3  4  
ATOM 8134  N N    . ALA A 1 96  ? -4.751  4.147   8.486   1.00 0.00 ? 96  ALA A N    4  
ATOM 8135  C CA   . ALA A 1 96  ? -3.638  5.083   8.588   1.00 0.00 ? 96  ALA A CA   4  
ATOM 8136  C C    . ALA A 1 96  ? -3.049  5.084   9.995   1.00 0.00 ? 96  ALA A C    4  
ATOM 8137  O O    . ALA A 1 96  ? -1.846  5.263   10.174  1.00 0.00 ? 96  ALA A O    4  
ATOM 8138  C CB   . ALA A 1 96  ? -4.088  6.483   8.201   1.00 0.00 ? 96  ALA A CB   4  
ATOM 8139  H H    . ALA A 1 96  ? -5.634  4.482   8.222   1.00 0.00 ? 96  ALA A H    4  
ATOM 8140  H HA   . ALA A 1 96  ? -2.875  4.770   7.890   1.00 0.00 ? 96  ALA A HA   4  
ATOM 8141  H HB1  . ALA A 1 96  ? -4.056  6.586   7.126   1.00 0.00 ? 96  ALA A HB1  4  
ATOM 8142  H HB2  . ALA A 1 96  ? -5.097  6.646   8.549   1.00 0.00 ? 96  ALA A HB2  4  
ATOM 8143  H HB3  . ALA A 1 96  ? -3.429  7.210   8.652   1.00 0.00 ? 96  ALA A HB3  4  
ATOM 8144  N N    . ASN A 1 97  ? -3.907  4.884   10.990  1.00 0.00 ? 97  ASN A N    4  
ATOM 8145  C CA   . ASN A 1 97  ? -3.471  4.863   12.382  1.00 0.00 ? 97  ASN A CA   4  
ATOM 8146  C C    . ASN A 1 97  ? -2.620  3.630   12.667  1.00 0.00 ? 97  ASN A C    4  
ATOM 8147  O O    . ASN A 1 97  ? -1.562  3.724   13.291  1.00 0.00 ? 97  ASN A O    4  
ATOM 8148  C CB   . ASN A 1 97  ? -4.682  4.889   13.317  1.00 0.00 ? 97  ASN A CB   4  
ATOM 8149  C CG   . ASN A 1 97  ? -5.805  3.992   12.834  1.00 0.00 ? 97  ASN A CG   4  
ATOM 8150  O OD1  . ASN A 1 97  ? -6.625  4.396   12.010  1.00 0.00 ? 97  ASN A OD1  4  
ATOM 8151  N ND2  . ASN A 1 97  ? -5.847  2.768   13.347  1.00 0.00 ? 97  ASN A ND2  4  
ATOM 8152  H H    . ASN A 1 97  ? -4.856  4.747   10.785  1.00 0.00 ? 97  ASN A H    4  
ATOM 8153  H HA   . ASN A 1 97  ? -2.874  5.746   12.555  1.00 0.00 ? 97  ASN A HA   4  
ATOM 8154  H HB2  . ASN A 1 97  ? -4.378  4.555   14.299  1.00 0.00 ? 97  ASN A HB2  4  
ATOM 8155  H HB3  . ASN A 1 97  ? -5.056  5.899   13.385  1.00 0.00 ? 97  ASN A HB3  4  
ATOM 8156  H HD21 . ASN A 1 97  ? -5.160  2.515   13.999  1.00 0.00 ? 97  ASN A HD21 4  
ATOM 8157  H HD22 . ASN A 1 97  ? -6.563  2.168   13.051  1.00 0.00 ? 97  ASN A HD22 4  
ATOM 8158  N N    . ASP A 1 98  ? -3.088  2.476   12.205  1.00 0.00 ? 98  ASP A N    4  
ATOM 8159  C CA   . ASP A 1 98  ? -2.368  1.223   12.410  1.00 0.00 ? 98  ASP A CA   4  
ATOM 8160  C C    . ASP A 1 98  ? -0.868  1.422   12.225  1.00 0.00 ? 98  ASP A C    4  
ATOM 8161  O O    . ASP A 1 98  ? -0.060  0.861   12.968  1.00 0.00 ? 98  ASP A O    4  
ATOM 8162  C CB   . ASP A 1 98  ? -2.877  0.155   11.440  1.00 0.00 ? 98  ASP A CB   4  
ATOM 8163  C CG   . ASP A 1 98  ? -4.144  -0.518  11.932  1.00 0.00 ? 98  ASP A CG   4  
ATOM 8164  O OD1  . ASP A 1 98  ? -4.759  0.002   12.887  1.00 0.00 ? 98  ASP A OD1  4  
ATOM 8165  O OD2  . ASP A 1 98  ? -4.520  -1.564  11.363  1.00 0.00 ? 98  ASP A OD2  4  
ATOM 8166  H H    . ASP A 1 98  ? -3.937  2.465   11.716  1.00 0.00 ? 98  ASP A H    4  
ATOM 8167  H HA   . ASP A 1 98  ? -2.555  0.895   13.421  1.00 0.00 ? 98  ASP A HA   4  
ATOM 8168  H HB2  . ASP A 1 98  ? -3.084  0.615   10.485  1.00 0.00 ? 98  ASP A HB2  4  
ATOM 8169  H HB3  . ASP A 1 98  ? -2.116  -0.601  11.315  1.00 0.00 ? 98  ASP A HB3  4  
ATOM 8170  N N    . LEU A 1 99  ? -0.500  2.223   11.231  1.00 0.00 ? 99  LEU A N    4  
ATOM 8171  C CA   . LEU A 1 99  ? 0.905   2.495   10.949  1.00 0.00 ? 99  LEU A CA   4  
ATOM 8172  C C    . LEU A 1 99  ? 1.385   3.727   11.709  1.00 0.00 ? 99  LEU A C    4  
ATOM 8173  O O    . LEU A 1 99  ? 2.428   3.697   12.363  1.00 0.00 ? 99  LEU A O    4  
ATOM 8174  C CB   . LEU A 1 99  ? 1.113   2.697   9.446   1.00 0.00 ? 99  LEU A CB   4  
ATOM 8175  C CG   . LEU A 1 99  ? 2.565   2.781   8.975   1.00 0.00 ? 99  LEU A CG   4  
ATOM 8176  C CD1  . LEU A 1 99  ? 3.280   1.459   9.211   1.00 0.00 ? 99  LEU A CD1  4  
ATOM 8177  C CD2  . LEU A 1 99  ? 2.627   3.167   7.505   1.00 0.00 ? 99  LEU A CD2  4  
ATOM 8178  H H    . LEU A 1 99  ? -1.189  2.641   10.674  1.00 0.00 ? 99  LEU A H    4  
ATOM 8179  H HA   . LEU A 1 99  ? 1.479   1.640   11.271  1.00 0.00 ? 99  LEU A HA   4  
ATOM 8180  H HB2  . LEU A 1 99  ? 0.646   1.871   8.934   1.00 0.00 ? 99  LEU A HB2  4  
ATOM 8181  H HB3  . LEU A 1 99  ? 0.620   3.617   9.166   1.00 0.00 ? 99  LEU A HB3  4  
ATOM 8182  H HG   . LEU A 1 99  ? 3.079   3.543   9.544   1.00 0.00 ? 99  LEU A HG   4  
ATOM 8183  H HD11 . LEU A 1 99  ? 2.558   0.657   9.223   1.00 0.00 ? 99  LEU A HD11 4  
ATOM 8184  H HD12 . LEU A 1 99  ? 3.795   1.493   10.160  1.00 0.00 ? 99  LEU A HD12 4  
ATOM 8185  H HD13 . LEU A 1 99  ? 3.995   1.290   8.419   1.00 0.00 ? 99  LEU A HD13 4  
ATOM 8186  H HD21 . LEU A 1 99  ? 1.712   2.868   7.015   1.00 0.00 ? 99  LEU A HD21 4  
ATOM 8187  H HD22 . LEU A 1 99  ? 3.464   2.669   7.037   1.00 0.00 ? 99  LEU A HD22 4  
ATOM 8188  H HD23 . LEU A 1 99  ? 2.750   4.236   7.418   1.00 0.00 ? 99  LEU A HD23 4  
ATOM 8189  N N    . PHE A 1 100 ? 0.616   4.807   11.622  1.00 0.00 ? 100 PHE A N    4  
ATOM 8190  C CA   . PHE A 1 100 ? 0.962   6.049   12.304  1.00 0.00 ? 100 PHE A CA   4  
ATOM 8191  C C    . PHE A 1 100 ? 1.318   5.787   13.765  1.00 0.00 ? 100 PHE A C    4  
ATOM 8192  O O    . PHE A 1 100 ? 2.441   6.044   14.197  1.00 0.00 ? 100 PHE A O    4  
ATOM 8193  C CB   . PHE A 1 100 ? -0.199  7.042   12.220  1.00 0.00 ? 100 PHE A CB   4  
ATOM 8194  C CG   . PHE A 1 100 ? 0.205   8.460   12.506  1.00 0.00 ? 100 PHE A CG   4  
ATOM 8195  C CD1  . PHE A 1 100 ? 1.268   9.041   11.834  1.00 0.00 ? 100 PHE A CD1  4  
ATOM 8196  C CD2  . PHE A 1 100 ? -0.480  9.213   13.447  1.00 0.00 ? 100 PHE A CD2  4  
ATOM 8197  C CE1  . PHE A 1 100 ? 1.642   10.346  12.094  1.00 0.00 ? 100 PHE A CE1  4  
ATOM 8198  C CE2  . PHE A 1 100 ? -0.111  10.519  13.711  1.00 0.00 ? 100 PHE A CE2  4  
ATOM 8199  C CZ   . PHE A 1 100 ? 0.951   11.085  13.034  1.00 0.00 ? 100 PHE A CZ   4  
ATOM 8200  H H    . PHE A 1 100 ? -0.203  4.768   11.086  1.00 0.00 ? 100 PHE A H    4  
ATOM 8201  H HA   . PHE A 1 100 ? 1.822   6.470   11.808  1.00 0.00 ? 100 PHE A HA   4  
ATOM 8202  H HB2  . PHE A 1 100 ? -0.619  7.010   11.227  1.00 0.00 ? 100 PHE A HB2  4  
ATOM 8203  H HB3  . PHE A 1 100 ? -0.956  6.760   12.937  1.00 0.00 ? 100 PHE A HB3  4  
ATOM 8204  H HD1  . PHE A 1 100 ? 1.809   8.463   11.098  1.00 0.00 ? 100 PHE A HD1  4  
ATOM 8205  H HD2  . PHE A 1 100 ? -1.310  8.771   13.978  1.00 0.00 ? 100 PHE A HD2  4  
ATOM 8206  H HE1  . PHE A 1 100 ? 2.472   10.786  11.562  1.00 0.00 ? 100 PHE A HE1  4  
ATOM 8207  H HE2  . PHE A 1 100 ? -0.652  11.095  14.447  1.00 0.00 ? 100 PHE A HE2  4  
ATOM 8208  H HZ   . PHE A 1 100 ? 1.241   12.106  13.238  1.00 0.00 ? 100 PHE A HZ   4  
ATOM 8209  N N    . GLU A 1 101 ? 0.351   5.272   14.520  1.00 0.00 ? 101 GLU A N    4  
ATOM 8210  C CA   . GLU A 1 101 ? 0.563   4.976   15.932  1.00 0.00 ? 101 GLU A CA   4  
ATOM 8211  C C    . GLU A 1 101 ? 0.793   3.482   16.147  1.00 0.00 ? 101 GLU A C    4  
ATOM 8212  O O    . GLU A 1 101 ? 0.339   2.911   17.138  1.00 0.00 ? 101 GLU A O    4  
ATOM 8213  C CB   . GLU A 1 101 ? -0.638  5.443   16.758  1.00 0.00 ? 101 GLU A CB   4  
ATOM 8214  C CG   . GLU A 1 101 ? -0.816  6.951   16.776  1.00 0.00 ? 101 GLU A CG   4  
ATOM 8215  C CD   . GLU A 1 101 ? 0.028   7.625   17.841  1.00 0.00 ? 101 GLU A CD   4  
ATOM 8216  O OE1  . GLU A 1 101 ? 0.107   7.087   18.965  1.00 0.00 ? 101 GLU A OE1  4  
ATOM 8217  O OE2  . GLU A 1 101 ? 0.609   8.691   17.550  1.00 0.00 ? 101 GLU A OE2  4  
ATOM 8218  H H    . GLU A 1 101 ? -0.523  5.089   14.118  1.00 0.00 ? 101 GLU A H    4  
ATOM 8219  H HA   . GLU A 1 101 ? 1.441   5.513   16.255  1.00 0.00 ? 101 GLU A HA   4  
ATOM 8220  H HB2  . GLU A 1 101 ? -1.534  5.000   16.350  1.00 0.00 ? 101 GLU A HB2  4  
ATOM 8221  H HB3  . GLU A 1 101 ? -0.512  5.103   17.776  1.00 0.00 ? 101 GLU A HB3  4  
ATOM 8222  H HG2  . GLU A 1 101 ? -0.532  7.346   15.812  1.00 0.00 ? 101 GLU A HG2  4  
ATOM 8223  H HG3  . GLU A 1 101 ? -1.855  7.177   16.965  1.00 0.00 ? 101 GLU A HG3  4  
ATOM 8224  N N    . SER A 1 102 ? 1.498   2.859   15.210  1.00 0.00 ? 102 SER A N    4  
ATOM 8225  C CA   . SER A 1 102 ? 1.785   1.431   15.293  1.00 0.00 ? 102 SER A CA   4  
ATOM 8226  C C    . SER A 1 102 ? 0.568   0.661   15.796  1.00 0.00 ? 102 SER A C    4  
ATOM 8227  O O    . SER A 1 102 ? 0.696   -0.423  16.363  1.00 0.00 ? 102 SER A O    4  
ATOM 8228  C CB   . SER A 1 102 ? 2.978   1.182   16.218  1.00 0.00 ? 102 SER A CB   4  
ATOM 8229  O OG   . SER A 1 102 ? 2.670   1.540   17.554  1.00 0.00 ? 102 SER A OG   4  
ATOM 8230  H H    . SER A 1 102 ? 1.833   3.370   14.443  1.00 0.00 ? 102 SER A H    4  
ATOM 8231  H HA   . SER A 1 102 ? 2.032   1.084   14.300  1.00 0.00 ? 102 SER A HA   4  
ATOM 8232  H HB2  . SER A 1 102 ? 3.240   0.135   16.190  1.00 0.00 ? 102 SER A HB2  4  
ATOM 8233  H HB3  . SER A 1 102 ? 3.819   1.773   15.884  1.00 0.00 ? 102 SER A HB3  4  
ATOM 8234  H HG   . SER A 1 102 ? 2.366   2.450   17.581  1.00 0.00 ? 102 SER A HG   4  
ATOM 8235  N N    . GLY A 1 103 ? -0.615  1.230   15.583  1.00 0.00 ? 103 GLY A N    4  
ATOM 8236  C CA   . GLY A 1 103 ? -1.838  0.584   16.020  1.00 0.00 ? 103 GLY A CA   4  
ATOM 8237  C C    . GLY A 1 103 ? -1.974  -0.826  15.481  1.00 0.00 ? 103 GLY A C    4  
ATOM 8238  O O    . GLY A 1 103 ? -2.754  -1.623  16.002  1.00 0.00 ? 103 GLY A O    4  
ATOM 8239  H H    . GLY A 1 103 ? -0.656  2.097   15.126  1.00 0.00 ? 103 GLY A H    4  
ATOM 8240  H HA2  . GLY A 1 103 ? -1.849  0.549   17.099  1.00 0.00 ? 103 GLY A HA2  4  
ATOM 8241  H HA3  . GLY A 1 103 ? -2.681  1.170   15.681  1.00 0.00 ? 103 GLY A HA3  4  
ATOM 8242  N N    . ASN A 1 104 ? -1.216  -1.133  14.435  1.00 0.00 ? 104 ASN A N    4  
ATOM 8243  C CA   . ASN A 1 104 ? -1.256  -2.457  13.824  1.00 0.00 ? 104 ASN A CA   4  
ATOM 8244  C C    . ASN A 1 104 ? -0.207  -2.581  12.723  1.00 0.00 ? 104 ASN A C    4  
ATOM 8245  O O    . ASN A 1 104 ? -0.284  -1.900  11.700  1.00 0.00 ? 104 ASN A O    4  
ATOM 8246  C CB   . ASN A 1 104 ? -2.648  -2.734  13.251  1.00 0.00 ? 104 ASN A CB   4  
ATOM 8247  C CG   . ASN A 1 104 ? -3.008  -4.207  13.294  1.00 0.00 ? 104 ASN A CG   4  
ATOM 8248  O OD1  . ASN A 1 104 ? -2.241  -5.030  13.794  1.00 0.00 ? 104 ASN A OD1  4  
ATOM 8249  N ND2  . ASN A 1 104 ? -4.179  -4.545  12.767  1.00 0.00 ? 104 ASN A ND2  4  
ATOM 8250  H H    . ASN A 1 104 ? -0.614  -0.454  14.064  1.00 0.00 ? 104 ASN A H    4  
ATOM 8251  H HA   . ASN A 1 104 ? -1.042  -3.184  14.593  1.00 0.00 ? 104 ASN A HA   4  
ATOM 8252  H HB2  . ASN A 1 104 ? -3.382  -2.187  13.825  1.00 0.00 ? 104 ASN A HB2  4  
ATOM 8253  H HB3  . ASN A 1 104 ? -2.681  -2.403  12.225  1.00 0.00 ? 104 ASN A HB3  4  
ATOM 8254  H HD21 . ASN A 1 104 ? -4.738  -3.835  12.387  1.00 0.00 ? 104 ASN A HD21 4  
ATOM 8255  H HD22 . ASN A 1 104 ? -4.438  -5.490  12.782  1.00 0.00 ? 104 ASN A HD22 4  
ATOM 8256  N N    . MET A 1 105 ? 0.771   -3.454  12.940  1.00 0.00 ? 105 MET A N    4  
ATOM 8257  C CA   . MET A 1 105 ? 1.834   -3.667  11.966  1.00 0.00 ? 105 MET A CA   4  
ATOM 8258  C C    . MET A 1 105 ? 1.579   -4.931  11.150  1.00 0.00 ? 105 MET A C    4  
ATOM 8259  O O    . MET A 1 105 ? 2.254   -5.186  10.153  1.00 0.00 ? 105 MET A O    4  
ATOM 8260  C CB   . MET A 1 105 ? 3.188   -3.767  12.671  1.00 0.00 ? 105 MET A CB   4  
ATOM 8261  C CG   . MET A 1 105 ? 3.899   -2.431  12.814  1.00 0.00 ? 105 MET A CG   4  
ATOM 8262  S SD   . MET A 1 105 ? 5.000   -2.077  11.432  1.00 0.00 ? 105 MET A SD   4  
ATOM 8263  C CE   . MET A 1 105 ? 3.817   -1.864  10.103  1.00 0.00 ? 105 MET A CE   4  
ATOM 8264  H H    . MET A 1 105 ? 0.778   -3.966  13.775  1.00 0.00 ? 105 MET A H    4  
ATOM 8265  H HA   . MET A 1 105 ? 1.847   -2.819  11.299  1.00 0.00 ? 105 MET A HA   4  
ATOM 8266  H HB2  . MET A 1 105 ? 3.038   -4.179  13.658  1.00 0.00 ? 105 MET A HB2  4  
ATOM 8267  H HB3  . MET A 1 105 ? 3.827   -4.430  12.106  1.00 0.00 ? 105 MET A HB3  4  
ATOM 8268  H HG2  . MET A 1 105 ? 3.157   -1.648  12.874  1.00 0.00 ? 105 MET A HG2  4  
ATOM 8269  H HG3  . MET A 1 105 ? 4.479   -2.444  13.725  1.00 0.00 ? 105 MET A HG3  4  
ATOM 8270  H HE1  . MET A 1 105 ? 4.285   -1.336  9.286   1.00 0.00 ? 105 MET A HE1  4  
ATOM 8271  H HE2  . MET A 1 105 ? 3.483   -2.832  9.760   1.00 0.00 ? 105 MET A HE2  4  
ATOM 8272  H HE3  . MET A 1 105 ? 2.972   -1.296  10.461  1.00 0.00 ? 105 MET A HE3  4  
ATOM 8273  N N    . THR A 1 106 ? 0.598   -5.719  11.581  1.00 0.00 ? 106 THR A N    4  
ATOM 8274  C CA   . THR A 1 106 ? 0.254   -6.957  10.892  1.00 0.00 ? 106 THR A CA   4  
ATOM 8275  C C    . THR A 1 106 ? -0.708  -6.694  9.738   1.00 0.00 ? 106 THR A C    4  
ATOM 8276  O O    . THR A 1 106 ? -0.615  -7.326  8.687   1.00 0.00 ? 106 THR A O    4  
ATOM 8277  C CB   . THR A 1 106 ? -0.382  -7.977  11.854  1.00 0.00 ? 106 THR A CB   4  
ATOM 8278  O OG1  . THR A 1 106 ? -1.747  -7.627  12.108  1.00 0.00 ? 106 THR A OG1  4  
ATOM 8279  C CG2  . THR A 1 106 ? 0.384   -8.034  13.167  1.00 0.00 ? 106 THR A CG2  4  
ATOM 8280  H H    . THR A 1 106 ? 0.096   -5.462  12.382  1.00 0.00 ? 106 THR A H    4  
ATOM 8281  H HA   . THR A 1 106 ? 1.165   -7.384  10.498  1.00 0.00 ? 106 THR A HA   4  
ATOM 8282  H HB   . THR A 1 106 ? -0.349  -8.954  11.392  1.00 0.00 ? 106 THR A HB   4  
ATOM 8283  H HG1  . THR A 1 106 ? -2.227  -7.587  11.277  1.00 0.00 ? 106 THR A HG1  4  
ATOM 8284  H HG21 . THR A 1 106 ? -0.124  -8.697  13.852  1.00 0.00 ? 106 THR A HG21 4  
ATOM 8285  H HG22 . THR A 1 106 ? 0.437   -7.045  13.596  1.00 0.00 ? 106 THR A HG22 4  
ATOM 8286  H HG23 . THR A 1 106 ? 1.383   -8.401  12.984  1.00 0.00 ? 106 THR A HG23 4  
ATOM 8287  N N    . GLN A 1 107 ? -1.630  -5.759  9.943   1.00 0.00 ? 107 GLN A N    4  
ATOM 8288  C CA   . GLN A 1 107 ? -2.609  -5.415  8.920   1.00 0.00 ? 107 GLN A CA   4  
ATOM 8289  C C    . GLN A 1 107 ? -1.940  -4.715  7.742   1.00 0.00 ? 107 GLN A C    4  
ATOM 8290  O O    . GLN A 1 107 ? -2.252  -4.992  6.583   1.00 0.00 ? 107 GLN A O    4  
ATOM 8291  C CB   . GLN A 1 107 ? -3.700  -4.518  9.509   1.00 0.00 ? 107 GLN A CB   4  
ATOM 8292  C CG   . GLN A 1 107 ? -5.059  -4.705  8.855   1.00 0.00 ? 107 GLN A CG   4  
ATOM 8293  C CD   . GLN A 1 107 ? -4.956  -5.084  7.391   1.00 0.00 ? 107 GLN A CD   4  
ATOM 8294  O OE1  . GLN A 1 107 ? -4.537  -4.279  6.558   1.00 0.00 ? 107 GLN A OE1  4  
ATOM 8295  N NE2  . GLN A 1 107 ? -5.338  -6.314  7.069   1.00 0.00 ? 107 GLN A NE2  4  
ATOM 8296  H H    . GLN A 1 107 ? -1.652  -5.291  10.804  1.00 0.00 ? 107 GLN A H    4  
ATOM 8297  H HA   . GLN A 1 107 ? -3.059  -6.331  8.570   1.00 0.00 ? 107 GLN A HA   4  
ATOM 8298  H HB2  . GLN A 1 107 ? -3.797  -4.734  10.562  1.00 0.00 ? 107 GLN A HB2  4  
ATOM 8299  H HB3  . GLN A 1 107 ? -3.405  -3.486  9.388   1.00 0.00 ? 107 GLN A HB3  4  
ATOM 8300  H HG2  . GLN A 1 107 ? -5.591  -5.487  9.376   1.00 0.00 ? 107 GLN A HG2  4  
ATOM 8301  H HG3  . GLN A 1 107 ? -5.612  -3.780  8.935   1.00 0.00 ? 107 GLN A HG3  4  
ATOM 8302  H HE21 . GLN A 1 107 ? -5.661  -6.900  7.785   1.00 0.00 ? 107 GLN A HE21 4  
ATOM 8303  H HE22 . GLN A 1 107 ? -5.282  -6.585  6.130   1.00 0.00 ? 107 GLN A HE22 4  
ATOM 8304  N N    . VAL A 1 108 ? -1.019  -3.805  8.044   1.00 0.00 ? 108 VAL A N    4  
ATOM 8305  C CA   . VAL A 1 108 ? -0.305  -3.066  7.010   1.00 0.00 ? 108 VAL A CA   4  
ATOM 8306  C C    . VAL A 1 108 ? 0.659   -3.973  6.253   1.00 0.00 ? 108 VAL A C    4  
ATOM 8307  O O    . VAL A 1 108 ? 0.871   -3.803  5.053   1.00 0.00 ? 108 VAL A O    4  
ATOM 8308  C CB   . VAL A 1 108 ? 0.481   -1.883  7.606   1.00 0.00 ? 108 VAL A CB   4  
ATOM 8309  C CG1  . VAL A 1 108 ? 1.292   -1.183  6.527   1.00 0.00 ? 108 VAL A CG1  4  
ATOM 8310  C CG2  . VAL A 1 108 ? -0.464  -0.909  8.292   1.00 0.00 ? 108 VAL A CG2  4  
ATOM 8311  H H    . VAL A 1 108 ? -0.814  -3.628  8.986   1.00 0.00 ? 108 VAL A H    4  
ATOM 8312  H HA   . VAL A 1 108 ? -1.035  -2.674  6.316   1.00 0.00 ? 108 VAL A HA   4  
ATOM 8313  H HB   . VAL A 1 108 ? 1.166   -2.270  8.346   1.00 0.00 ? 108 VAL A HB   4  
ATOM 8314  H HG11 . VAL A 1 108 ? 2.060   -0.581  6.989   1.00 0.00 ? 108 VAL A HG11 4  
ATOM 8315  H HG12 . VAL A 1 108 ? 1.747   -1.920  5.883   1.00 0.00 ? 108 VAL A HG12 4  
ATOM 8316  H HG13 . VAL A 1 108 ? 0.640   -0.548  5.943   1.00 0.00 ? 108 VAL A HG13 4  
ATOM 8317  H HG21 . VAL A 1 108 ? -0.629  -1.225  9.311   1.00 0.00 ? 108 VAL A HG21 4  
ATOM 8318  H HG22 . VAL A 1 108 ? -0.027  0.080   8.288   1.00 0.00 ? 108 VAL A HG22 4  
ATOM 8319  H HG23 . VAL A 1 108 ? -1.406  -0.887  7.764   1.00 0.00 ? 108 VAL A HG23 4  
ATOM 8320  N N    . GLN A 1 109 ? 1.239   -4.935  6.963   1.00 0.00 ? 109 GLN A N    4  
ATOM 8321  C CA   . GLN A 1 109 ? 2.181   -5.869  6.357   1.00 0.00 ? 109 GLN A CA   4  
ATOM 8322  C C    . GLN A 1 109 ? 1.498   -6.714  5.287   1.00 0.00 ? 109 GLN A C    4  
ATOM 8323  O O    . GLN A 1 109 ? 1.938   -6.753  4.138   1.00 0.00 ? 109 GLN A O    4  
ATOM 8324  C CB   . GLN A 1 109 ? 2.792   -6.776  7.426   1.00 0.00 ? 109 GLN A CB   4  
ATOM 8325  C CG   . GLN A 1 109 ? 3.903   -7.671  6.903   1.00 0.00 ? 109 GLN A CG   4  
ATOM 8326  C CD   . GLN A 1 109 ? 5.272   -7.032  7.024   1.00 0.00 ? 109 GLN A CD   4  
ATOM 8327  O OE1  . GLN A 1 109 ? 5.436   -5.836  6.786   1.00 0.00 ? 109 GLN A OE1  4  
ATOM 8328  N NE2  . GLN A 1 109 ? 6.267   -7.830  7.398   1.00 0.00 ? 109 GLN A NE2  4  
ATOM 8329  H H    . GLN A 1 109 ? 1.028   -5.019  7.915   1.00 0.00 ? 109 GLN A H    4  
ATOM 8330  H HA   . GLN A 1 109 ? 2.968   -5.292  5.895   1.00 0.00 ? 109 GLN A HA   4  
ATOM 8331  H HB2  . GLN A 1 109 ? 3.196   -6.160  8.216   1.00 0.00 ? 109 GLN A HB2  4  
ATOM 8332  H HB3  . GLN A 1 109 ? 2.014   -7.405  7.835   1.00 0.00 ? 109 GLN A HB3  4  
ATOM 8333  H HG2  . GLN A 1 109 ? 3.902   -8.593  7.466   1.00 0.00 ? 109 GLN A HG2  4  
ATOM 8334  H HG3  . GLN A 1 109 ? 3.714   -7.887  5.862   1.00 0.00 ? 109 GLN A HG3  4  
ATOM 8335  H HE21 . GLN A 1 109 ? 6.063   -8.773  7.569   1.00 0.00 ? 109 GLN A HE21 4  
ATOM 8336  H HE22 . GLN A 1 109 ? 7.163   -7.445  7.483   1.00 0.00 ? 109 GLN A HE22 4  
ATOM 8337  N N    . VAL A 1 110 ? 0.420   -7.389  5.671   1.00 0.00 ? 110 VAL A N    4  
ATOM 8338  C CA   . VAL A 1 110 ? -0.325  -8.233  4.744   1.00 0.00 ? 110 VAL A CA   4  
ATOM 8339  C C    . VAL A 1 110 ? -0.832  -7.427  3.553   1.00 0.00 ? 110 VAL A C    4  
ATOM 8340  O O    . VAL A 1 110 ? -1.082  -7.975  2.481   1.00 0.00 ? 110 VAL A O    4  
ATOM 8341  C CB   . VAL A 1 110 ? -1.520  -8.910  5.439   1.00 0.00 ? 110 VAL A CB   4  
ATOM 8342  C CG1  . VAL A 1 110 ? -1.039  -9.879  6.507   1.00 0.00 ? 110 VAL A CG1  4  
ATOM 8343  C CG2  . VAL A 1 110 ? -2.452  -7.866  6.035   1.00 0.00 ? 110 VAL A CG2  4  
ATOM 8344  H H    . VAL A 1 110 ? 0.117   -7.317  6.600   1.00 0.00 ? 110 VAL A H    4  
ATOM 8345  H HA   . VAL A 1 110 ? 0.341   -9.005  4.386   1.00 0.00 ? 110 VAL A HA   4  
ATOM 8346  H HB   . VAL A 1 110 ? -2.071  -9.472  4.697   1.00 0.00 ? 110 VAL A HB   4  
ATOM 8347  H HG11 . VAL A 1 110 ? -0.841  -9.337  7.421   1.00 0.00 ? 110 VAL A HG11 4  
ATOM 8348  H HG12 . VAL A 1 110 ? -1.799  -10.624 6.688   1.00 0.00 ? 110 VAL A HG12 4  
ATOM 8349  H HG13 . VAL A 1 110 ? -0.132  -10.362 6.174   1.00 0.00 ? 110 VAL A HG13 4  
ATOM 8350  H HG21 . VAL A 1 110 ? -3.473  -8.206  5.952   1.00 0.00 ? 110 VAL A HG21 4  
ATOM 8351  H HG22 . VAL A 1 110 ? -2.206  -7.715  7.075   1.00 0.00 ? 110 VAL A HG22 4  
ATOM 8352  H HG23 . VAL A 1 110 ? -2.338  -6.935  5.500   1.00 0.00 ? 110 VAL A HG23 4  
ATOM 8353  N N    . SER A 1 111 ? -0.981  -6.121  3.750   1.00 0.00 ? 111 SER A N    4  
ATOM 8354  C CA   . SER A 1 111 ? -1.463  -5.239  2.694   1.00 0.00 ? 111 SER A CA   4  
ATOM 8355  C C    . SER A 1 111 ? -0.421  -5.096  1.589   1.00 0.00 ? 111 SER A C    4  
ATOM 8356  O O    . SER A 1 111 ? -0.760  -4.977  0.411   1.00 0.00 ? 111 SER A O    4  
ATOM 8357  C CB   . SER A 1 111 ? -1.806  -3.862  3.267   1.00 0.00 ? 111 SER A CB   4  
ATOM 8358  O OG   . SER A 1 111 ? -2.696  -3.162  2.414   1.00 0.00 ? 111 SER A OG   4  
ATOM 8359  H H    . SER A 1 111 ? -0.765  -5.742  4.628   1.00 0.00 ? 111 SER A H    4  
ATOM 8360  H HA   . SER A 1 111 ? -2.356  -5.678  2.276   1.00 0.00 ? 111 SER A HA   4  
ATOM 8361  H HB2  . SER A 1 111 ? -2.273  -3.984  4.232   1.00 0.00 ? 111 SER A HB2  4  
ATOM 8362  H HB3  . SER A 1 111 ? -0.900  -3.284  3.375   1.00 0.00 ? 111 SER A HB3  4  
ATOM 8363  H HG   . SER A 1 111 ? -3.322  -3.779  2.029   1.00 0.00 ? 111 SER A HG   4  
ATOM 8364  N N    . LEU A 1 112 ? 0.850   -5.110  1.977   1.00 0.00 ? 112 LEU A N    4  
ATOM 8365  C CA   . LEU A 1 112 ? 1.944   -4.982  1.020   1.00 0.00 ? 112 LEU A CA   4  
ATOM 8366  C C    . LEU A 1 112 ? 2.269   -6.329  0.382   1.00 0.00 ? 112 LEU A C    4  
ATOM 8367  O O    . LEU A 1 112 ? 2.496   -6.418  -0.825  1.00 0.00 ? 112 LEU A O    4  
ATOM 8368  C CB   . LEU A 1 112 ? 3.187   -4.417  1.709   1.00 0.00 ? 112 LEU A CB   4  
ATOM 8369  C CG   . LEU A 1 112 ? 3.002   -3.090  2.445   1.00 0.00 ? 112 LEU A CG   4  
ATOM 8370  C CD1  . LEU A 1 112 ? 4.258   -2.733  3.226   1.00 0.00 ? 112 LEU A CD1  4  
ATOM 8371  C CD2  . LEU A 1 112 ? 2.647   -1.981  1.465   1.00 0.00 ? 112 LEU A CD2  4  
ATOM 8372  H H    . LEU A 1 112 ? 1.058   -5.208  2.929   1.00 0.00 ? 112 LEU A H    4  
ATOM 8373  H HA   . LEU A 1 112 ? 1.628   -4.298  0.246   1.00 0.00 ? 112 LEU A HA   4  
ATOM 8374  H HB2  . LEU A 1 112 ? 3.529   -5.148  2.426   1.00 0.00 ? 112 LEU A HB2  4  
ATOM 8375  H HB3  . LEU A 1 112 ? 3.946   -4.275  0.953   1.00 0.00 ? 112 LEU A HB3  4  
ATOM 8376  H HG   . LEU A 1 112 ? 2.188   -3.188  3.150   1.00 0.00 ? 112 LEU A HG   4  
ATOM 8377  H HD11 . LEU A 1 112 ? 3.981   -2.274  4.163   1.00 0.00 ? 112 LEU A HD11 4  
ATOM 8378  H HD12 . LEU A 1 112 ? 4.855   -2.042  2.649   1.00 0.00 ? 112 LEU A HD12 4  
ATOM 8379  H HD13 . LEU A 1 112 ? 4.829   -3.630  3.417   1.00 0.00 ? 112 LEU A HD13 4  
ATOM 8380  H HD21 . LEU A 1 112 ? 3.535   -1.414  1.227   1.00 0.00 ? 112 LEU A HD21 4  
ATOM 8381  H HD22 . LEU A 1 112 ? 1.911   -1.328  1.913   1.00 0.00 ? 112 LEU A HD22 4  
ATOM 8382  H HD23 . LEU A 1 112 ? 2.243   -2.415  0.562   1.00 0.00 ? 112 LEU A HD23 4  
ATOM 8383  N N    . LEU A 1 113 ? 2.288   -7.375  1.200   1.00 0.00 ? 113 LEU A N    4  
ATOM 8384  C CA   . LEU A 1 113 ? 2.583   -8.720  0.716   1.00 0.00 ? 113 LEU A CA   4  
ATOM 8385  C C    . LEU A 1 113 ? 1.543   -9.171  -0.305  1.00 0.00 ? 113 LEU A C    4  
ATOM 8386  O O    . LEU A 1 113 ? 1.823   -10.010 -1.161  1.00 0.00 ? 113 LEU A O    4  
ATOM 8387  C CB   . LEU A 1 113 ? 2.629   -9.705  1.885   1.00 0.00 ? 113 LEU A CB   4  
ATOM 8388  C CG   . LEU A 1 113 ? 3.932   -9.738  2.685   1.00 0.00 ? 113 LEU A CG   4  
ATOM 8389  C CD1  . LEU A 1 113 ? 3.752   -10.540 3.965   1.00 0.00 ? 113 LEU A CD1  4  
ATOM 8390  C CD2  . LEU A 1 113 ? 5.060   -10.318 1.844   1.00 0.00 ? 113 LEU A CD2  4  
ATOM 8391  H H    . LEU A 1 113 ? 2.098   -7.243  2.152   1.00 0.00 ? 113 LEU A H    4  
ATOM 8392  H HA   . LEU A 1 113 ? 3.551   -8.694  0.239   1.00 0.00 ? 113 LEU A HA   4  
ATOM 8393  H HB2  . LEU A 1 113 ? 1.830   -9.449  2.564   1.00 0.00 ? 113 LEU A HB2  4  
ATOM 8394  H HB3  . LEU A 1 113 ? 2.458   -10.696 1.488   1.00 0.00 ? 113 LEU A HB3  4  
ATOM 8395  H HG   . LEU A 1 113 ? 4.203   -8.728  2.959   1.00 0.00 ? 113 LEU A HG   4  
ATOM 8396  H HD11 . LEU A 1 113 ? 3.640   -9.865  4.799   1.00 0.00 ? 113 LEU A HD11 4  
ATOM 8397  H HD12 . LEU A 1 113 ? 4.617   -11.166 4.121   1.00 0.00 ? 113 LEU A HD12 4  
ATOM 8398  H HD13 . LEU A 1 113 ? 2.870   -11.158 3.881   1.00 0.00 ? 113 LEU A HD13 4  
ATOM 8399  H HD21 . LEU A 1 113 ? 4.938   -11.389 1.770   1.00 0.00 ? 113 LEU A HD21 4  
ATOM 8400  H HD22 . LEU A 1 113 ? 6.007   -10.095 2.310   1.00 0.00 ? 113 LEU A HD22 4  
ATOM 8401  H HD23 . LEU A 1 113 ? 5.032   -9.883  0.856   1.00 0.00 ? 113 LEU A HD23 4  
ATOM 8402  N N    . ALA A 1 114 ? 0.343   -8.608  -0.208  1.00 0.00 ? 114 ALA A N    4  
ATOM 8403  C CA   . ALA A 1 114 ? -0.736  -8.950  -1.125  1.00 0.00 ? 114 ALA A CA   4  
ATOM 8404  C C    . ALA A 1 114 ? -0.708  -8.059  -2.363  1.00 0.00 ? 114 ALA A C    4  
ATOM 8405  O O    . ALA A 1 114 ? -0.942  -8.524  -3.480  1.00 0.00 ? 114 ALA A O    4  
ATOM 8406  C CB   . ALA A 1 114 ? -2.081  -8.838  -0.422  1.00 0.00 ? 114 ALA A CB   4  
ATOM 8407  H H    . ALA A 1 114 ? 0.181   -7.947  0.495   1.00 0.00 ? 114 ALA A H    4  
ATOM 8408  H HA   . ALA A 1 114 ? -0.603  -9.978  -1.431  1.00 0.00 ? 114 ALA A HA   4  
ATOM 8409  H HB1  . ALA A 1 114 ? -1.964  -8.265  0.487   1.00 0.00 ? 114 ALA A HB1  4  
ATOM 8410  H HB2  . ALA A 1 114 ? -2.787  -8.341  -1.073  1.00 0.00 ? 114 ALA A HB2  4  
ATOM 8411  H HB3  . ALA A 1 114 ? -2.446  -9.825  -0.182  1.00 0.00 ? 114 ALA A HB3  4  
ATOM 8412  N N    . LEU A 1 115 ? -0.422  -6.778  -2.157  1.00 0.00 ? 115 LEU A N    4  
ATOM 8413  C CA   . LEU A 1 115 ? -0.364  -5.821  -3.257  1.00 0.00 ? 115 LEU A CA   4  
ATOM 8414  C C    . LEU A 1 115 ? 0.811   -6.126  -4.182  1.00 0.00 ? 115 LEU A C    4  
ATOM 8415  O O    . LEU A 1 115 ? 0.736   -5.904  -5.390  1.00 0.00 ? 115 LEU A O    4  
ATOM 8416  C CB   . LEU A 1 115 ? -0.243  -4.397  -2.714  1.00 0.00 ? 115 LEU A CB   4  
ATOM 8417  C CG   . LEU A 1 115 ? 0.298   -3.350  -3.689  1.00 0.00 ? 115 LEU A CG   4  
ATOM 8418  C CD1  . LEU A 1 115 ? -0.835  -2.731  -4.491  1.00 0.00 ? 115 LEU A CD1  4  
ATOM 8419  C CD2  . LEU A 1 115 ? 1.075   -2.276  -2.940  1.00 0.00 ? 115 LEU A CD2  4  
ATOM 8420  H H    . LEU A 1 115 ? -0.245  -6.468  -1.245  1.00 0.00 ? 115 LEU A H    4  
ATOM 8421  H HA   . LEU A 1 115 ? -1.281  -5.907  -3.820  1.00 0.00 ? 115 LEU A HA   4  
ATOM 8422  H HB2  . LEU A 1 115 ? -1.225  -4.079  -2.400  1.00 0.00 ? 115 LEU A HB2  4  
ATOM 8423  H HB3  . LEU A 1 115 ? 0.415   -4.425  -1.857  1.00 0.00 ? 115 LEU A HB3  4  
ATOM 8424  H HG   . LEU A 1 115 ? 0.974   -3.830  -4.383  1.00 0.00 ? 115 LEU A HG   4  
ATOM 8425  H HD11 . LEU A 1 115 ? -0.965  -3.278  -5.412  1.00 0.00 ? 115 LEU A HD11 4  
ATOM 8426  H HD12 . LEU A 1 115 ? -0.598  -1.701  -4.713  1.00 0.00 ? 115 LEU A HD12 4  
ATOM 8427  H HD13 . LEU A 1 115 ? -1.748  -2.772  -3.914  1.00 0.00 ? 115 LEU A HD13 4  
ATOM 8428  H HD21 . LEU A 1 115 ? 1.459   -2.687  -2.019  1.00 0.00 ? 115 LEU A HD21 4  
ATOM 8429  H HD22 . LEU A 1 115 ? 0.418   -1.447  -2.720  1.00 0.00 ? 115 LEU A HD22 4  
ATOM 8430  H HD23 . LEU A 1 115 ? 1.895   -1.934  -3.553  1.00 0.00 ? 115 LEU A HD23 4  
ATOM 8431  N N    . ALA A 1 116 ? 1.894   -6.638  -3.606  1.00 0.00 ? 116 ALA A N    4  
ATOM 8432  C CA   . ALA A 1 116 ? 3.082   -6.978  -4.380  1.00 0.00 ? 116 ALA A CA   4  
ATOM 8433  C C    . ALA A 1 116 ? 2.824   -8.178  -5.284  1.00 0.00 ? 116 ALA A C    4  
ATOM 8434  O O    . ALA A 1 116 ? 3.176   -8.166  -6.462  1.00 0.00 ? 116 ALA A O    4  
ATOM 8435  C CB   . ALA A 1 116 ? 4.254   -7.255  -3.451  1.00 0.00 ? 116 ALA A CB   4  
ATOM 8436  H H    . ALA A 1 116 ? 1.892   -6.792  -2.639  1.00 0.00 ? 116 ALA A H    4  
ATOM 8437  H HA   . ALA A 1 116 ? 3.335   -6.125  -4.994  1.00 0.00 ? 116 ALA A HA   4  
ATOM 8438  H HB1  . ALA A 1 116 ? 4.873   -8.032  -3.876  1.00 0.00 ? 116 ALA A HB1  4  
ATOM 8439  H HB2  . ALA A 1 116 ? 4.839   -6.356  -3.329  1.00 0.00 ? 116 ALA A HB2  4  
ATOM 8440  H HB3  . ALA A 1 116 ? 3.883   -7.577  -2.490  1.00 0.00 ? 116 ALA A HB3  4  
ATOM 8441  N N    . GLY A 1 117 ? 2.208   -9.214  -4.723  1.00 0.00 ? 117 GLY A N    4  
ATOM 8442  C CA   . GLY A 1 117 ? 1.915   -10.409 -5.493  1.00 0.00 ? 117 GLY A CA   4  
ATOM 8443  C C    . GLY A 1 117 ? 1.133   -10.106 -6.757  1.00 0.00 ? 117 GLY A C    4  
ATOM 8444  O O    . GLY A 1 117 ? 1.073   -10.929 -7.670  1.00 0.00 ? 117 GLY A O    4  
ATOM 8445  H H    . GLY A 1 117 ? 1.951   -9.167  -3.778  1.00 0.00 ? 117 GLY A H    4  
ATOM 8446  H HA2  . GLY A 1 117 ? 2.845   -10.887 -5.762  1.00 0.00 ? 117 GLY A HA2  4  
ATOM 8447  H HA3  . GLY A 1 117 ? 1.338   -11.085 -4.881  1.00 0.00 ? 117 GLY A HA3  4  
ATOM 8448  N N    . LYS A 1 118 ? 0.533   -8.923  -6.810  1.00 0.00 ? 118 LYS A N    4  
ATOM 8449  C CA   . LYS A 1 118 ? -0.249  -8.513  -7.970  1.00 0.00 ? 118 LYS A CA   4  
ATOM 8450  C C    . LYS A 1 118 ? 0.535   -7.532  -8.836  1.00 0.00 ? 118 LYS A C    4  
ATOM 8451  O O    . LYS A 1 118 ? 0.431   -7.552  -10.062 1.00 0.00 ? 118 LYS A O    4  
ATOM 8452  C CB   . LYS A 1 118 ? -1.566  -7.874  -7.523  1.00 0.00 ? 118 LYS A CB   4  
ATOM 8453  C CG   . LYS A 1 118 ? -2.368  -7.271  -8.665  1.00 0.00 ? 118 LYS A CG   4  
ATOM 8454  C CD   . LYS A 1 118 ? -3.301  -6.178  -8.173  1.00 0.00 ? 118 LYS A CD   4  
ATOM 8455  C CE   . LYS A 1 118 ? -4.588  -6.756  -7.606  1.00 0.00 ? 118 LYS A CE   4  
ATOM 8456  N NZ   . LYS A 1 118 ? -5.318  -7.576  -8.612  1.00 0.00 ? 118 LYS A NZ   4  
ATOM 8457  H H    . LYS A 1 118 ? 0.618   -8.309  -6.050  1.00 0.00 ? 118 LYS A H    4  
ATOM 8458  H HA   . LYS A 1 118 ? -0.466  -9.395  -8.553  1.00 0.00 ? 118 LYS A HA   4  
ATOM 8459  H HB2  . LYS A 1 118 ? -2.173  -8.628  -7.043  1.00 0.00 ? 118 LYS A HB2  4  
ATOM 8460  H HB3  . LYS A 1 118 ? -1.350  -7.091  -6.810  1.00 0.00 ? 118 LYS A HB3  4  
ATOM 8461  H HG2  . LYS A 1 118 ? -1.686  -6.850  -9.388  1.00 0.00 ? 118 LYS A HG2  4  
ATOM 8462  H HG3  . LYS A 1 118 ? -2.955  -8.050  -9.130  1.00 0.00 ? 118 LYS A HG3  4  
ATOM 8463  H HD2  . LYS A 1 118 ? -2.803  -5.611  -7.400  1.00 0.00 ? 118 LYS A HD2  4  
ATOM 8464  H HD3  . LYS A 1 118 ? -3.543  -5.525  -9.000  1.00 0.00 ? 118 LYS A HD3  4  
ATOM 8465  H HE2  . LYS A 1 118 ? -4.345  -7.375  -6.757  1.00 0.00 ? 118 LYS A HE2  4  
ATOM 8466  H HE3  . LYS A 1 118 ? -5.224  -5.942  -7.288  1.00 0.00 ? 118 LYS A HE3  4  
ATOM 8467  H HZ1  . LYS A 1 118 ? -5.114  -7.229  -9.571  1.00 0.00 ? 118 LYS A HZ1  4  
ATOM 8468  H HZ2  . LYS A 1 118 ? -6.343  -7.518  -8.446  1.00 0.00 ? 118 LYS A HZ2  4  
ATOM 8469  H HZ3  . LYS A 1 118 ? -5.023  -8.572  -8.544  1.00 0.00 ? 118 LYS A HZ3  4  
ATOM 8470  N N    . ALA A 1 119 ? 1.320   -6.677  -8.190  1.00 0.00 ? 119 ALA A N    4  
ATOM 8471  C CA   . ALA A 1 119 ? 2.125   -5.691  -8.902  1.00 0.00 ? 119 ALA A CA   4  
ATOM 8472  C C    . ALA A 1 119 ? 3.327   -6.346  -9.574  1.00 0.00 ? 119 ALA A C    4  
ATOM 8473  O O    . ALA A 1 119 ? 3.914   -5.787  -10.501 1.00 0.00 ? 119 ALA A O    4  
ATOM 8474  C CB   . ALA A 1 119 ? 2.582   -4.596  -7.950  1.00 0.00 ? 119 ALA A CB   4  
ATOM 8475  H H    . ALA A 1 119 ? 1.361   -6.709  -7.212  1.00 0.00 ? 119 ALA A H    4  
ATOM 8476  H HA   . ALA A 1 119 ? 1.504   -5.238  -9.661  1.00 0.00 ? 119 ALA A HA   4  
ATOM 8477  H HB1  . ALA A 1 119 ? 3.124   -5.039  -7.127  1.00 0.00 ? 119 ALA A HB1  4  
ATOM 8478  H HB2  . ALA A 1 119 ? 3.225   -3.907  -8.476  1.00 0.00 ? 119 ALA A HB2  4  
ATOM 8479  H HB3  . ALA A 1 119 ? 1.721   -4.066  -7.570  1.00 0.00 ? 119 ALA A HB3  4  
ATOM 8480  N N    . LYS A 1 120 ? 3.689   -7.533  -9.101  1.00 0.00 ? 120 LYS A N    4  
ATOM 8481  C CA   . LYS A 1 120 ? 4.821   -8.266  -9.657  1.00 0.00 ? 120 LYS A CA   4  
ATOM 8482  C C    . LYS A 1 120 ? 4.640   -8.495  -11.154 1.00 0.00 ? 120 LYS A C    4  
ATOM 8483  O O    . LYS A 1 120 ? 5.611   -8.694  -11.884 1.00 0.00 ? 120 LYS A O    4  
ATOM 8484  C CB   . LYS A 1 120 ? 4.987   -9.608  -8.941  1.00 0.00 ? 120 LYS A CB   4  
ATOM 8485  C CG   . LYS A 1 120 ? 3.821   -10.559 -9.154  1.00 0.00 ? 120 LYS A CG   4  
ATOM 8486  C CD   . LYS A 1 120 ? 4.248   -12.009 -8.996  1.00 0.00 ? 120 LYS A CD   4  
ATOM 8487  C CE   . LYS A 1 120 ? 4.392   -12.391 -7.531  1.00 0.00 ? 120 LYS A CE   4  
ATOM 8488  N NZ   . LYS A 1 120 ? 5.182   -13.642 -7.359  1.00 0.00 ? 120 LYS A NZ   4  
ATOM 8489  H H    . LYS A 1 120 ? 3.181   -7.928  -8.361  1.00 0.00 ? 120 LYS A H    4  
ATOM 8490  H HA   . LYS A 1 120 ? 5.709   -7.672  -9.499  1.00 0.00 ? 120 LYS A HA   4  
ATOM 8491  H HB2  . LYS A 1 120 ? 5.885   -10.087 -9.302  1.00 0.00 ? 120 LYS A HB2  4  
ATOM 8492  H HB3  . LYS A 1 120 ? 5.087   -9.427  -7.880  1.00 0.00 ? 120 LYS A HB3  4  
ATOM 8493  H HG2  . LYS A 1 120 ? 3.053   -10.340 -8.428  1.00 0.00 ? 120 LYS A HG2  4  
ATOM 8494  H HG3  . LYS A 1 120 ? 3.429   -10.415 -10.151 1.00 0.00 ? 120 LYS A HG3  4  
ATOM 8495  H HD2  . LYS A 1 120 ? 3.505   -12.646 -9.452  1.00 0.00 ? 120 LYS A HD2  4  
ATOM 8496  H HD3  . LYS A 1 120 ? 5.199   -12.151 -9.491  1.00 0.00 ? 120 LYS A HD3  4  
ATOM 8497  H HE2  . LYS A 1 120 ? 4.888   -11.587 -7.009  1.00 0.00 ? 120 LYS A HE2  4  
ATOM 8498  H HE3  . LYS A 1 120 ? 3.407   -12.538 -7.113  1.00 0.00 ? 120 LYS A HE3  4  
ATOM 8499  H HZ1  . LYS A 1 120 ? 6.197   -13.440 -7.468  1.00 0.00 ? 120 LYS A HZ1  4  
ATOM 8500  H HZ2  . LYS A 1 120 ? 4.902   -14.343 -8.073  1.00 0.00 ? 120 LYS A HZ2  4  
ATOM 8501  H HZ3  . LYS A 1 120 ? 5.018   -14.041 -6.413  1.00 0.00 ? 120 LYS A HZ3  4  
ATOM 8502  N N    . THR A 1 121 ? 3.390   -8.463  -11.605 1.00 0.00 ? 121 THR A N    4  
ATOM 8503  C CA   . THR A 1 121 ? 3.082   -8.667  -13.015 1.00 0.00 ? 121 THR A CA   4  
ATOM 8504  C C    . THR A 1 121 ? 3.893   -7.724  -13.897 1.00 0.00 ? 121 THR A C    4  
ATOM 8505  O O    . THR A 1 121 ? 4.132   -8.008  -15.071 1.00 0.00 ? 121 THR A O    4  
ATOM 8506  C CB   . THR A 1 121 ? 1.583   -8.454  -13.299 1.00 0.00 ? 121 THR A CB   4  
ATOM 8507  O OG1  . THR A 1 121 ? 1.296   -8.755  -14.669 1.00 0.00 ? 121 THR A OG1  4  
ATOM 8508  C CG2  . THR A 1 121 ? 1.172   -7.022  -12.992 1.00 0.00 ? 121 THR A CG2  4  
ATOM 8509  H H    . THR A 1 121 ? 2.659   -8.300  -10.973 1.00 0.00 ? 121 THR A H    4  
ATOM 8510  H HA   . THR A 1 121 ? 3.333   -9.687  -13.268 1.00 0.00 ? 121 THR A HA   4  
ATOM 8511  H HB   . THR A 1 121 ? 1.014   -9.120  -12.666 1.00 0.00 ? 121 THR A HB   4  
ATOM 8512  H HG1  . THR A 1 121 ? 2.037   -8.486  -15.218 1.00 0.00 ? 121 THR A HG1  4  
ATOM 8513  H HG21 . THR A 1 121 ? 1.718   -6.668  -12.130 1.00 0.00 ? 121 THR A HG21 4  
ATOM 8514  H HG22 . THR A 1 121 ? 0.113   -6.988  -12.785 1.00 0.00 ? 121 THR A HG22 4  
ATOM 8515  H HG23 . THR A 1 121 ? 1.394   -6.394  -13.841 1.00 0.00 ? 121 THR A HG23 4  
ATOM 8516  N N    . LYS A 1 122 ? 4.316   -6.602  -13.324 1.00 0.00 ? 122 LYS A N    4  
ATOM 8517  C CA   . LYS A 1 122 ? 5.103   -5.618  -14.056 1.00 0.00 ? 122 LYS A CA   4  
ATOM 8518  C C    . LYS A 1 122 ? 6.386   -6.240  -14.597 1.00 0.00 ? 122 LYS A C    4  
ATOM 8519  O O    . LYS A 1 122 ? 6.729   -6.065  -15.766 1.00 0.00 ? 122 LYS A O    4  
ATOM 8520  C CB   . LYS A 1 122 ? 5.440   -4.429  -13.154 1.00 0.00 ? 122 LYS A CB   4  
ATOM 8521  C CG   . LYS A 1 122 ? 4.405   -3.320  -13.196 1.00 0.00 ? 122 LYS A CG   4  
ATOM 8522  C CD   . LYS A 1 122 ? 3.130   -3.718  -12.472 1.00 0.00 ? 122 LYS A CD   4  
ATOM 8523  C CE   . LYS A 1 122 ? 1.993   -2.752  -12.772 1.00 0.00 ? 122 LYS A CE   4  
ATOM 8524  N NZ   . LYS A 1 122 ? 1.220   -3.161  -13.977 1.00 0.00 ? 122 LYS A NZ   4  
ATOM 8525  H H    . LYS A 1 122 ? 4.094   -6.433  -12.384 1.00 0.00 ? 122 LYS A H    4  
ATOM 8526  H HA   . LYS A 1 122 ? 4.508   -5.270  -14.887 1.00 0.00 ? 122 LYS A HA   4  
ATOM 8527  H HB2  . LYS A 1 122 ? 5.521   -4.779  -12.134 1.00 0.00 ? 122 LYS A HB2  4  
ATOM 8528  H HB3  . LYS A 1 122 ? 6.391   -4.019  -13.460 1.00 0.00 ? 122 LYS A HB3  4  
ATOM 8529  H HG2  . LYS A 1 122 ? 4.814   -2.439  -12.724 1.00 0.00 ? 122 LYS A HG2  4  
ATOM 8530  H HG3  . LYS A 1 122 ? 4.169   -3.099  -14.227 1.00 0.00 ? 122 LYS A HG3  4  
ATOM 8531  H HD2  . LYS A 1 122 ? 2.839   -4.708  -12.793 1.00 0.00 ? 122 LYS A HD2  4  
ATOM 8532  H HD3  . LYS A 1 122 ? 3.316   -3.722  -11.407 1.00 0.00 ? 122 LYS A HD3  4  
ATOM 8533  H HE2  . LYS A 1 122 ? 1.330   -2.723  -11.921 1.00 0.00 ? 122 LYS A HE2  4  
ATOM 8534  H HE3  . LYS A 1 122 ? 2.409   -1.769  -12.938 1.00 0.00 ? 122 LYS A HE3  4  
ATOM 8535  H HZ1  . LYS A 1 122 ? 0.260   -2.761  -13.938 1.00 0.00 ? 122 LYS A HZ1  4  
ATOM 8536  H HZ2  . LYS A 1 122 ? 1.148   -4.199  -14.020 1.00 0.00 ? 122 LYS A HZ2  4  
ATOM 8537  H HZ3  . LYS A 1 122 ? 1.692   -2.821  -14.838 1.00 0.00 ? 122 LYS A HZ3  4  
ATOM 8538  N N    . GLY A 1 123 ? 7.093   -6.969  -13.738 1.00 0.00 ? 123 GLY A N    4  
ATOM 8539  C CA   . GLY A 1 123 ? 8.330   -7.607  -14.148 1.00 0.00 ? 123 GLY A CA   4  
ATOM 8540  C C    . GLY A 1 123 ? 8.657   -8.828  -13.312 1.00 0.00 ? 123 GLY A C    4  
ATOM 8541  O O    . GLY A 1 123 ? 9.560   -8.793  -12.475 1.00 0.00 ? 123 GLY A O    4  
ATOM 8542  H H    . GLY A 1 123 ? 6.772   -7.073  -12.818 1.00 0.00 ? 123 GLY A H    4  
ATOM 8543  H HA2  . GLY A 1 123 ? 8.243   -7.904  -15.182 1.00 0.00 ? 123 GLY A HA2  4  
ATOM 8544  H HA3  . GLY A 1 123 ? 9.137   -6.895  -14.055 1.00 0.00 ? 123 GLY A HA3  4  
ATOM 8545  N N    . LEU A 1 124 ? 7.922   -9.912  -13.537 1.00 0.00 ? 124 LEU A N    4  
ATOM 8546  C CA   . LEU A 1 124 ? 8.138   -11.150 -12.797 1.00 0.00 ? 124 LEU A CA   4  
ATOM 8547  C C    . LEU A 1 124 ? 8.827   -12.193 -13.671 1.00 0.00 ? 124 LEU A C    4  
ATOM 8548  O O    . LEU A 1 124 ? 9.020   -11.984 -14.867 1.00 0.00 ? 124 LEU A O    4  
ATOM 8549  C CB   . LEU A 1 124 ? 6.806   -11.698 -12.283 1.00 0.00 ? 124 LEU A CB   4  
ATOM 8550  C CG   . LEU A 1 124 ? 5.716   -11.911 -13.334 1.00 0.00 ? 124 LEU A CG   4  
ATOM 8551  C CD1  . LEU A 1 124 ? 5.908   -13.244 -14.039 1.00 0.00 ? 124 LEU A CD1  4  
ATOM 8552  C CD2  . LEU A 1 124 ? 4.337   -11.836 -12.695 1.00 0.00 ? 124 LEU A CD2  4  
ATOM 8553  H H    . LEU A 1 124 ? 7.218   -9.879  -14.217 1.00 0.00 ? 124 LEU A H    4  
ATOM 8554  H HA   . LEU A 1 124 ? 8.775   -10.925 -11.954 1.00 0.00 ? 124 LEU A HA   4  
ATOM 8555  H HB2  . LEU A 1 124 ? 7.000   -12.649 -11.810 1.00 0.00 ? 124 LEU A HB2  4  
ATOM 8556  H HB3  . LEU A 1 124 ? 6.426   -11.003 -11.546 1.00 0.00 ? 124 LEU A HB3  4  
ATOM 8557  H HG   . LEU A 1 124 ? 5.784   -11.128 -14.077 1.00 0.00 ? 124 LEU A HG   4  
ATOM 8558  H HD11 . LEU A 1 124 ? 6.654   -13.823 -13.516 1.00 0.00 ? 124 LEU A HD11 4  
ATOM 8559  H HD12 . LEU A 1 124 ? 6.232   -13.071 -15.055 1.00 0.00 ? 124 LEU A HD12 4  
ATOM 8560  H HD13 . LEU A 1 124 ? 4.972   -13.783 -14.049 1.00 0.00 ? 124 LEU A HD13 4  
ATOM 8561  H HD21 . LEU A 1 124 ? 4.291   -10.980 -12.038 1.00 0.00 ? 124 LEU A HD21 4  
ATOM 8562  H HD22 . LEU A 1 124 ? 4.155   -12.736 -12.127 1.00 0.00 ? 124 LEU A HD22 4  
ATOM 8563  H HD23 . LEU A 1 124 ? 3.588   -11.739 -13.467 1.00 0.00 ? 124 LEU A HD23 4  
ATOM 8564  N N    . GLN A 1 125 ? 9.192   -13.318 -13.063 1.00 0.00 ? 125 GLN A N    4  
ATOM 8565  C CA   . GLN A 1 125 ? 9.858   -14.395 -13.786 1.00 0.00 ? 125 GLN A CA   4  
ATOM 8566  C C    . GLN A 1 125 ? 9.104   -14.737 -15.068 1.00 0.00 ? 125 GLN A C    4  
ATOM 8567  O O    . GLN A 1 125 ? 7.877   -14.833 -15.070 1.00 0.00 ? 125 GLN A O    4  
ATOM 8568  C CB   . GLN A 1 125 ? 9.974   -15.636 -12.901 1.00 0.00 ? 125 GLN A CB   4  
ATOM 8569  C CG   . GLN A 1 125 ? 8.638   -16.290 -12.592 1.00 0.00 ? 125 GLN A CG   4  
ATOM 8570  C CD   . GLN A 1 125 ? 7.795   -15.471 -11.634 1.00 0.00 ? 125 GLN A CD   4  
ATOM 8571  O OE1  . GLN A 1 125 ? 8.314   -14.644 -10.883 1.00 0.00 ? 125 GLN A OE1  4  
ATOM 8572  N NE2  . GLN A 1 125 ? 6.486   -15.697 -11.653 1.00 0.00 ? 125 GLN A NE2  4  
ATOM 8573  H H    . GLN A 1 125 ? 9.010   -13.426 -12.106 1.00 0.00 ? 125 GLN A H    4  
ATOM 8574  H HA   . GLN A 1 125 ? 10.849  -14.055 -14.047 1.00 0.00 ? 125 GLN A HA   4  
ATOM 8575  H HB2  . GLN A 1 125 ? 10.598  -16.362 -13.400 1.00 0.00 ? 125 GLN A HB2  4  
ATOM 8576  H HB3  . GLN A 1 125 ? 10.437  -15.356 -11.967 1.00 0.00 ? 125 GLN A HB3  4  
ATOM 8577  H HG2  . GLN A 1 125 ? 8.088   -16.413 -13.514 1.00 0.00 ? 125 GLN A HG2  4  
ATOM 8578  H HG3  . GLN A 1 125 ? 8.819   -17.260 -12.151 1.00 0.00 ? 125 GLN A HG3  4  
ATOM 8579  H HE21 . GLN A 1 125 ? 6.144   -16.372 -12.276 1.00 0.00 ? 125 GLN A HE21 4  
ATOM 8580  H HE22 . GLN A 1 125 ? 5.919   -15.182 -11.043 1.00 0.00 ? 125 GLN A HE22 4  
ATOM 8581  N N    . SER A 1 126 ? 9.847   -14.920 -16.154 1.00 0.00 ? 126 SER A N    4  
ATOM 8582  C CA   . SER A 1 126 ? 9.248   -15.248 -17.443 1.00 0.00 ? 126 SER A CA   4  
ATOM 8583  C C    . SER A 1 126 ? 8.081   -16.215 -17.269 1.00 0.00 ? 126 SER A C    4  
ATOM 8584  O O    . SER A 1 126 ? 8.101   -17.077 -16.392 1.00 0.00 ? 126 SER A O    4  
ATOM 8585  C CB   . SER A 1 126 ? 10.297  -15.858 -18.376 1.00 0.00 ? 126 SER A CB   4  
ATOM 8586  O OG   . SER A 1 126 ? 9.953   -15.649 -19.735 1.00 0.00 ? 126 SER A OG   4  
ATOM 8587  H H    . SER A 1 126 ? 10.821  -14.830 -16.089 1.00 0.00 ? 126 SER A H    4  
ATOM 8588  H HA   . SER A 1 126 ? 8.879   -14.332 -17.880 1.00 0.00 ? 126 SER A HA   4  
ATOM 8589  H HB2  . SER A 1 126 ? 11.255  -15.398 -18.185 1.00 0.00 ? 126 SER A HB2  4  
ATOM 8590  H HB3  . SER A 1 126 ? 10.363  -16.920 -18.193 1.00 0.00 ? 126 SER A HB3  4  
ATOM 8591  H HG   . SER A 1 126 ? 9.557   -14.780 -19.835 1.00 0.00 ? 126 SER A HG   4  
ATOM 8592  N N    . GLY A 1 127 ? 7.065   -16.065 -18.114 1.00 0.00 ? 127 GLY A N    4  
ATOM 8593  C CA   . GLY A 1 127 ? 5.903   -16.931 -18.039 1.00 0.00 ? 127 GLY A CA   4  
ATOM 8594  C C    . GLY A 1 127 ? 5.209   -17.089 -19.377 1.00 0.00 ? 127 GLY A C    4  
ATOM 8595  O O    . GLY A 1 127 ? 5.619   -17.905 -20.203 1.00 0.00 ? 127 GLY A O    4  
ATOM 8596  H H    . GLY A 1 127 ? 7.105   -15.359 -18.793 1.00 0.00 ? 127 GLY A H    4  
ATOM 8597  H HA2  . GLY A 1 127 ? 6.215   -17.903 -17.688 1.00 0.00 ? 127 GLY A HA2  4  
ATOM 8598  H HA3  . GLY A 1 127 ? 5.203   -16.512 -17.330 1.00 0.00 ? 127 GLY A HA3  4  
ATOM 8599  N N    . VAL A 1 128 ? 4.156   -16.308 -19.592 1.00 0.00 ? 128 VAL A N    4  
ATOM 8600  C CA   . VAL A 1 128 ? 3.404   -16.366 -20.839 1.00 0.00 ? 128 VAL A CA   4  
ATOM 8601  C C    . VAL A 1 128 ? 3.897   -15.316 -21.828 1.00 0.00 ? 128 VAL A C    4  
ATOM 8602  O O    . VAL A 1 128 ? 4.276   -14.211 -21.438 1.00 0.00 ? 128 VAL A O    4  
ATOM 8603  C CB   . VAL A 1 128 ? 1.896   -16.158 -20.596 1.00 0.00 ? 128 VAL A CB   4  
ATOM 8604  C CG1  . VAL A 1 128 ? 1.627   -14.749 -20.089 1.00 0.00 ? 128 VAL A CG1  4  
ATOM 8605  C CG2  . VAL A 1 128 ? 1.109   -16.438 -21.868 1.00 0.00 ? 128 VAL A CG2  4  
ATOM 8606  H H    . VAL A 1 128 ? 3.878   -15.678 -18.895 1.00 0.00 ? 128 VAL A H    4  
ATOM 8607  H HA   . VAL A 1 128 ? 3.546   -17.347 -21.270 1.00 0.00 ? 128 VAL A HA   4  
ATOM 8608  H HB   . VAL A 1 128 ? 1.575   -16.858 -19.838 1.00 0.00 ? 128 VAL A HB   4  
ATOM 8609  H HG11 . VAL A 1 128 ? 2.374   -14.481 -19.358 1.00 0.00 ? 128 VAL A HG11 4  
ATOM 8610  H HG12 . VAL A 1 128 ? 1.664   -14.056 -20.917 1.00 0.00 ? 128 VAL A HG12 4  
ATOM 8611  H HG13 . VAL A 1 128 ? 0.648   -14.713 -19.633 1.00 0.00 ? 128 VAL A HG13 4  
ATOM 8612  H HG21 . VAL A 1 128 ? 0.499   -17.316 -21.726 1.00 0.00 ? 128 VAL A HG21 4  
ATOM 8613  H HG22 . VAL A 1 128 ? 0.475   -15.591 -22.092 1.00 0.00 ? 128 VAL A HG22 4  
ATOM 8614  H HG23 . VAL A 1 128 ? 1.793   -16.601 -22.687 1.00 0.00 ? 128 VAL A HG23 4  
ATOM 8615  N N    . ASP A 1 129 ? 3.889   -15.667 -23.109 1.00 0.00 ? 129 ASP A N    4  
ATOM 8616  C CA   . ASP A 1 129 ? 4.335   -14.754 -24.155 1.00 0.00 ? 129 ASP A CA   4  
ATOM 8617  C C    . ASP A 1 129 ? 3.219   -13.790 -24.546 1.00 0.00 ? 129 ASP A C    4  
ATOM 8618  O O    . ASP A 1 129 ? 2.205   -14.197 -25.112 1.00 0.00 ? 129 ASP A O    4  
ATOM 8619  C CB   . ASP A 1 129 ? 4.802   -15.539 -25.382 1.00 0.00 ? 129 ASP A CB   4  
ATOM 8620  C CG   . ASP A 1 129 ? 3.835   -16.643 -25.765 1.00 0.00 ? 129 ASP A CG   4  
ATOM 8621  O OD1  . ASP A 1 129 ? 3.714   -17.618 -24.994 1.00 0.00 ? 129 ASP A OD1  4  
ATOM 8622  O OD2  . ASP A 1 129 ? 3.201   -16.533 -26.835 1.00 0.00 ? 129 ASP A OD2  4  
ATOM 8623  H H    . ASP A 1 129 ? 3.576   -16.562 -23.357 1.00 0.00 ? 129 ASP A H    4  
ATOM 8624  H HA   . ASP A 1 129 ? 5.166   -14.184 -23.766 1.00 0.00 ? 129 ASP A HA   4  
ATOM 8625  H HB2  . ASP A 1 129 ? 4.896   -14.863 -26.219 1.00 0.00 ? 129 ASP A HB2  4  
ATOM 8626  H HB3  . ASP A 1 129 ? 5.764   -15.983 -25.173 1.00 0.00 ? 129 ASP A HB3  4  
ATOM 8627  N N    . ILE A 1 130 ? 3.415   -12.512 -24.240 1.00 0.00 ? 130 ILE A N    4  
ATOM 8628  C CA   . ILE A 1 130 ? 2.425   -11.491 -24.559 1.00 0.00 ? 130 ILE A CA   4  
ATOM 8629  C C    . ILE A 1 130 ? 2.953   -10.527 -25.617 1.00 0.00 ? 130 ILE A C    4  
ATOM 8630  O O    . ILE A 1 130 ? 2.348   -10.360 -26.676 1.00 0.00 ? 130 ILE A O    4  
ATOM 8631  C CB   . ILE A 1 130 ? 2.018   -10.690 -23.308 1.00 0.00 ? 130 ILE A CB   4  
ATOM 8632  C CG1  . ILE A 1 130 ? 1.482   -11.630 -22.227 1.00 0.00 ? 130 ILE A CG1  4  
ATOM 8633  C CG2  . ILE A 1 130 ? 0.979   -9.638  -23.667 1.00 0.00 ? 130 ILE A CG2  4  
ATOM 8634  C CD1  . ILE A 1 130 ? 0.068   -12.102 -22.484 1.00 0.00 ? 130 ILE A CD1  4  
ATOM 8635  H H    . ILE A 1 130 ? 4.244   -12.250 -23.789 1.00 0.00 ? 130 ILE A H    4  
ATOM 8636  H HA   . ILE A 1 130 ? 1.547   -11.987 -24.945 1.00 0.00 ? 130 ILE A HA   4  
ATOM 8637  H HB   . ILE A 1 130 ? 2.894   -10.182 -22.932 1.00 0.00 ? 130 ILE A HB   4  
ATOM 8638  H HG12 . ILE A 1 130 ? 2.116   -12.500 -22.168 1.00 0.00 ? 130 ILE A HG12 4  
ATOM 8639  H HG13 . ILE A 1 130 ? 1.493   -11.116 -21.276 1.00 0.00 ? 130 ILE A HG13 4  
ATOM 8640  H HG21 . ILE A 1 130 ? 0.486   -9.298  -22.768 1.00 0.00 ? 130 ILE A HG21 4  
ATOM 8641  H HG22 . ILE A 1 130 ? 1.464   -8.802  -24.148 1.00 0.00 ? 130 ILE A HG22 4  
ATOM 8642  H HG23 . ILE A 1 130 ? 0.249   -10.067 -24.337 1.00 0.00 ? 130 ILE A HG23 4  
ATOM 8643  H HD11 . ILE A 1 130 ? -0.631  -11.399 -22.053 1.00 0.00 ? 130 ILE A HD11 4  
ATOM 8644  H HD12 . ILE A 1 130 ? -0.100  -12.174 -23.548 1.00 0.00 ? 130 ILE A HD12 4  
ATOM 8645  H HD13 . ILE A 1 130 ? -0.075  -13.073 -22.030 1.00 0.00 ? 130 ILE A HD13 4  
ATOM 8646  N N    . GLY A 1 131 ? 4.084   -9.894  -25.322 1.00 0.00 ? 131 GLY A N    4  
ATOM 8647  C CA   . GLY A 1 131 ? 4.674   -8.955  -26.258 1.00 0.00 ? 131 GLY A CA   4  
ATOM 8648  C C    . GLY A 1 131 ? 5.461   -7.861  -25.564 1.00 0.00 ? 131 GLY A C    4  
ATOM 8649  O O    . GLY A 1 131 ? 4.924   -6.796  -25.263 1.00 0.00 ? 131 GLY A O    4  
ATOM 8650  H H    . GLY A 1 131 ? 4.522   -10.066 -24.462 1.00 0.00 ? 131 GLY A H    4  
ATOM 8651  H HA2  . GLY A 1 131 ? 5.335   -9.494  -26.923 1.00 0.00 ? 131 GLY A HA2  4  
ATOM 8652  H HA3  . GLY A 1 131 ? 3.886   -8.501  -26.841 1.00 0.00 ? 131 GLY A HA3  4  
ATOM 8653  N N    . VAL A 1 132 ? 6.738   -8.126  -25.307 1.00 0.00 ? 132 VAL A N    4  
ATOM 8654  C CA   . VAL A 1 132 ? 7.601   -7.155  -24.643 1.00 0.00 ? 132 VAL A CA   4  
ATOM 8655  C C    . VAL A 1 132 ? 8.928   -7.005  -25.379 1.00 0.00 ? 132 VAL A C    4  
ATOM 8656  O O    . VAL A 1 132 ? 9.525   -7.991  -25.812 1.00 0.00 ? 132 VAL A O    4  
ATOM 8657  C CB   . VAL A 1 132 ? 7.879   -7.559  -23.183 1.00 0.00 ? 132 VAL A CB   4  
ATOM 8658  C CG1  . VAL A 1 132 ? 8.792   -6.543  -22.513 1.00 0.00 ? 132 VAL A CG1  4  
ATOM 8659  C CG2  . VAL A 1 132 ? 6.575   -7.704  -22.413 1.00 0.00 ? 132 VAL A CG2  4  
ATOM 8660  H H    . VAL A 1 132 ? 7.110   -8.994  -25.570 1.00 0.00 ? 132 VAL A H    4  
ATOM 8661  H HA   . VAL A 1 132 ? 7.092   -6.203  -24.640 1.00 0.00 ? 132 VAL A HA   4  
ATOM 8662  H HB   . VAL A 1 132 ? 8.381   -8.515  -23.184 1.00 0.00 ? 132 VAL A HB   4  
ATOM 8663  H HG11 . VAL A 1 132 ? 9.555   -7.062  -21.950 1.00 0.00 ? 132 VAL A HG11 4  
ATOM 8664  H HG12 . VAL A 1 132 ? 9.258   -5.925  -23.266 1.00 0.00 ? 132 VAL A HG12 4  
ATOM 8665  H HG13 . VAL A 1 132 ? 8.212   -5.923  -21.845 1.00 0.00 ? 132 VAL A HG13 4  
ATOM 8666  H HG21 . VAL A 1 132 ? 6.458   -8.729  -22.094 1.00 0.00 ? 132 VAL A HG21 4  
ATOM 8667  H HG22 . VAL A 1 132 ? 6.593   -7.058  -21.548 1.00 0.00 ? 132 VAL A HG22 4  
ATOM 8668  H HG23 . VAL A 1 132 ? 5.748   -7.429  -23.050 1.00 0.00 ? 132 VAL A HG23 4  
ATOM 8669  N N    . LYS A 1 133 ? 9.385   -5.765  -25.516 1.00 0.00 ? 133 LYS A N    4  
ATOM 8670  C CA   . LYS A 1 133 ? 10.643  -5.484  -26.198 1.00 0.00 ? 133 LYS A CA   4  
ATOM 8671  C C    . LYS A 1 133 ? 11.826  -6.019  -25.399 1.00 0.00 ? 133 LYS A C    4  
ATOM 8672  O O    . LYS A 1 133 ? 12.568  -6.881  -25.872 1.00 0.00 ? 133 LYS A O    4  
ATOM 8673  C CB   . LYS A 1 133 ? 10.801  -3.978  -26.418 1.00 0.00 ? 133 LYS A CB   4  
ATOM 8674  C CG   . LYS A 1 133 ? 11.733  -3.626  -27.565 1.00 0.00 ? 133 LYS A CG   4  
ATOM 8675  C CD   . LYS A 1 133 ? 12.105  -2.153  -27.549 1.00 0.00 ? 133 LYS A CD   4  
ATOM 8676  C CE   . LYS A 1 133 ? 12.763  -1.730  -28.853 1.00 0.00 ? 133 LYS A CE   4  
ATOM 8677  N NZ   . LYS A 1 133 ? 12.621  -0.268  -29.097 1.00 0.00 ? 133 LYS A NZ   4  
ATOM 8678  H H    . LYS A 1 133 ? 8.863   -5.021  -25.149 1.00 0.00 ? 133 LYS A H    4  
ATOM 8679  H HA   . LYS A 1 133 ? 10.618  -5.980  -27.157 1.00 0.00 ? 133 LYS A HA   4  
ATOM 8680  H HB2  . LYS A 1 133 ? 9.830   -3.553  -26.627 1.00 0.00 ? 133 LYS A HB2  4  
ATOM 8681  H HB3  . LYS A 1 133 ? 11.193  -3.534  -25.515 1.00 0.00 ? 133 LYS A HB3  4  
ATOM 8682  H HG2  . LYS A 1 133 ? 12.634  -4.215  -27.479 1.00 0.00 ? 133 LYS A HG2  4  
ATOM 8683  H HG3  . LYS A 1 133 ? 11.240  -3.853  -28.500 1.00 0.00 ? 133 LYS A HG3  4  
ATOM 8684  H HD2  . LYS A 1 133 ? 11.211  -1.566  -27.403 1.00 0.00 ? 133 LYS A HD2  4  
ATOM 8685  H HD3  . LYS A 1 133 ? 12.793  -1.974  -26.734 1.00 0.00 ? 133 LYS A HD3  4  
ATOM 8686  H HE2  . LYS A 1 133 ? 13.813  -1.979  -28.810 1.00 0.00 ? 133 LYS A HE2  4  
ATOM 8687  H HE3  . LYS A 1 133 ? 12.299  -2.269  -29.666 1.00 0.00 ? 133 LYS A HE3  4  
ATOM 8688  H HZ1  . LYS A 1 133 ? 13.559  0.175   -29.171 1.00 0.00 ? 133 LYS A HZ1  4  
ATOM 8689  H HZ2  . LYS A 1 133 ? 12.101  0.176   -28.314 1.00 0.00 ? 133 LYS A HZ2  4  
ATOM 8690  H HZ3  . LYS A 1 133 ? 12.100  -0.102  -29.982 1.00 0.00 ? 133 LYS A HZ3  4  
ATOM 8691  N N    . TYR A 1 134 ? 11.996  -5.505  -24.186 1.00 0.00 ? 134 TYR A N    4  
ATOM 8692  C CA   . TYR A 1 134 ? 13.090  -5.931  -23.322 1.00 0.00 ? 134 TYR A CA   4  
ATOM 8693  C C    . TYR A 1 134 ? 12.742  -5.709  -21.853 1.00 0.00 ? 134 TYR A C    4  
ATOM 8694  O O    . TYR A 1 134 ? 12.139  -4.699  -21.492 1.00 0.00 ? 134 TYR A O    4  
ATOM 8695  C CB   . TYR A 1 134 ? 14.370  -5.173  -23.674 1.00 0.00 ? 134 TYR A CB   4  
ATOM 8696  C CG   . TYR A 1 134 ? 15.612  -5.751  -23.033 1.00 0.00 ? 134 TYR A CG   4  
ATOM 8697  C CD1  . TYR A 1 134 ? 16.109  -6.988  -23.424 1.00 0.00 ? 134 TYR A CD1  4  
ATOM 8698  C CD2  . TYR A 1 134 ? 16.288  -5.061  -22.034 1.00 0.00 ? 134 TYR A CD2  4  
ATOM 8699  C CE1  . TYR A 1 134 ? 17.243  -7.519  -22.841 1.00 0.00 ? 134 TYR A CE1  4  
ATOM 8700  C CE2  . TYR A 1 134 ? 17.422  -5.584  -21.446 1.00 0.00 ? 134 TYR A CE2  4  
ATOM 8701  C CZ   . TYR A 1 134 ? 17.896  -6.814  -21.852 1.00 0.00 ? 134 TYR A CZ   4  
ATOM 8702  O OH   . TYR A 1 134 ? 19.025  -7.340  -21.268 1.00 0.00 ? 134 TYR A OH   4  
ATOM 8703  H H    . TYR A 1 134 ? 11.372  -4.822  -23.865 1.00 0.00 ? 134 TYR A H    4  
ATOM 8704  H HA   . TYR A 1 134 ? 13.251  -6.987  -23.486 1.00 0.00 ? 134 TYR A HA   4  
ATOM 8705  H HB2  . TYR A 1 134 ? 14.511  -5.194  -24.744 1.00 0.00 ? 134 TYR A HB2  4  
ATOM 8706  H HB3  . TYR A 1 134 ? 14.275  -4.147  -23.348 1.00 0.00 ? 134 TYR A HB3  4  
ATOM 8707  H HD1  . TYR A 1 134 ? 15.595  -7.539  -24.200 1.00 0.00 ? 134 TYR A HD1  4  
ATOM 8708  H HD2  . TYR A 1 134 ? 15.914  -4.098  -21.717 1.00 0.00 ? 134 TYR A HD2  4  
ATOM 8709  H HE1  . TYR A 1 134 ? 17.614  -8.483  -23.160 1.00 0.00 ? 134 TYR A HE1  4  
ATOM 8710  H HE2  . TYR A 1 134 ? 17.934  -5.032  -20.670 1.00 0.00 ? 134 TYR A HE2  4  
ATOM 8711  H HH   . TYR A 1 134 ? 19.591  -7.716  -21.946 1.00 0.00 ? 134 TYR A HH   4  
ATOM 8712  N N    . SER A 1 135 ? 13.128  -6.662  -21.010 1.00 0.00 ? 135 SER A N    4  
ATOM 8713  C CA   . SER A 1 135 ? 12.855  -6.573  -19.580 1.00 0.00 ? 135 SER A CA   4  
ATOM 8714  C C    . SER A 1 135 ? 13.952  -7.261  -18.774 1.00 0.00 ? 135 SER A C    4  
ATOM 8715  O O    . SER A 1 135 ? 14.853  -7.882  -19.337 1.00 0.00 ? 135 SER A O    4  
ATOM 8716  C CB   . SER A 1 135 ? 11.499  -7.204  -19.259 1.00 0.00 ? 135 SER A CB   4  
ATOM 8717  O OG   . SER A 1 135 ? 11.486  -8.582  -19.589 1.00 0.00 ? 135 SER A OG   4  
ATOM 8718  H H    . SER A 1 135 ? 13.606  -7.443  -21.359 1.00 0.00 ? 135 SER A H    4  
ATOM 8719  H HA   . SER A 1 135 ? 12.829  -5.527  -19.311 1.00 0.00 ? 135 SER A HA   4  
ATOM 8720  H HB2  . SER A 1 135 ? 11.295  -7.097  -18.204 1.00 0.00 ? 135 SER A HB2  4  
ATOM 8721  H HB3  . SER A 1 135 ? 10.728  -6.702  -19.825 1.00 0.00 ? 135 SER A HB3  4  
ATOM 8722  H HG   . SER A 1 135 ? 12.361  -8.951  -19.455 1.00 0.00 ? 135 SER A HG   4  
ATOM 8723  N N    . GLU A 1 136 ? 13.868  -7.145  -17.452 1.00 0.00 ? 136 GLU A N    4  
ATOM 8724  C CA   . GLU A 1 136 ? 14.854  -7.756  -16.568 1.00 0.00 ? 136 GLU A CA   4  
ATOM 8725  C C    . GLU A 1 136 ? 14.426  -9.164  -16.164 1.00 0.00 ? 136 GLU A C    4  
ATOM 8726  O O    . GLU A 1 136 ? 13.331  -9.613  -16.503 1.00 0.00 ? 136 GLU A O    4  
ATOM 8727  C CB   . GLU A 1 136 ? 15.055  -6.894  -15.320 1.00 0.00 ? 136 GLU A CB   4  
ATOM 8728  C CG   . GLU A 1 136 ? 15.674  -5.536  -15.611 1.00 0.00 ? 136 GLU A CG   4  
ATOM 8729  C CD   . GLU A 1 136 ? 16.382  -4.948  -14.406 1.00 0.00 ? 136 GLU A CD   4  
ATOM 8730  O OE1  . GLU A 1 136 ? 16.028  -5.321  -13.268 1.00 0.00 ? 136 GLU A OE1  4  
ATOM 8731  O OE2  . GLU A 1 136 ? 17.291  -4.114  -14.602 1.00 0.00 ? 136 GLU A OE2  4  
ATOM 8732  H H    . GLU A 1 136 ? 13.126  -6.638  -17.063 1.00 0.00 ? 136 GLU A H    4  
ATOM 8733  H HA   . GLU A 1 136 ? 15.788  -7.817  -17.105 1.00 0.00 ? 136 GLU A HA   4  
ATOM 8734  H HB2  . GLU A 1 136 ? 14.098  -6.737  -14.848 1.00 0.00 ? 136 GLU A HB2  4  
ATOM 8735  H HB3  . GLU A 1 136 ? 15.702  -7.421  -14.634 1.00 0.00 ? 136 GLU A HB3  4  
ATOM 8736  H HG2  . GLU A 1 136 ? 16.389  -5.646  -16.411 1.00 0.00 ? 136 GLU A HG2  4  
ATOM 8737  H HG3  . GLU A 1 136 ? 14.892  -4.858  -15.917 1.00 0.00 ? 136 GLU A HG3  4  
ATOM 8738  N N    . LYS A 1 137 ? 15.297  -9.855  -15.437 1.00 0.00 ? 137 LYS A N    4  
ATOM 8739  C CA   . LYS A 1 137 ? 15.010  -11.211 -14.984 1.00 0.00 ? 137 LYS A CA   4  
ATOM 8740  C C    . LYS A 1 137 ? 15.690  -11.493 -13.649 1.00 0.00 ? 137 LYS A C    4  
ATOM 8741  O O    . LYS A 1 137 ? 16.908  -11.364 -13.522 1.00 0.00 ? 137 LYS A O    4  
ATOM 8742  C CB   . LYS A 1 137 ? 15.473  -12.227 -16.030 1.00 0.00 ? 137 LYS A CB   4  
ATOM 8743  C CG   . LYS A 1 137 ? 14.737  -13.554 -15.956 1.00 0.00 ? 137 LYS A CG   4  
ATOM 8744  C CD   . LYS A 1 137 ? 15.441  -14.532 -15.030 1.00 0.00 ? 137 LYS A CD   4  
ATOM 8745  C CE   . LYS A 1 137 ? 16.710  -15.083 -15.663 1.00 0.00 ? 137 LYS A CE   4  
ATOM 8746  N NZ   . LYS A 1 137 ? 17.629  -15.664 -14.646 1.00 0.00 ? 137 LYS A NZ   4  
ATOM 8747  H H    . LYS A 1 137 ? 16.154  -9.442  -15.197 1.00 0.00 ? 137 LYS A H    4  
ATOM 8748  H HA   . LYS A 1 137 ? 13.942  -11.300 -14.856 1.00 0.00 ? 137 LYS A HA   4  
ATOM 8749  H HB2  . LYS A 1 137 ? 15.320  -11.809 -17.014 1.00 0.00 ? 137 LYS A HB2  4  
ATOM 8750  H HB3  . LYS A 1 137 ? 16.527  -12.417 -15.888 1.00 0.00 ? 137 LYS A HB3  4  
ATOM 8751  H HG2  . LYS A 1 137 ? 13.738  -13.381 -15.585 1.00 0.00 ? 137 LYS A HG2  4  
ATOM 8752  H HG3  . LYS A 1 137 ? 14.687  -13.983 -16.947 1.00 0.00 ? 137 LYS A HG3  4  
ATOM 8753  H HD2  . LYS A 1 137 ? 15.701  -14.023 -14.114 1.00 0.00 ? 137 LYS A HD2  4  
ATOM 8754  H HD3  . LYS A 1 137 ? 14.773  -15.352 -14.811 1.00 0.00 ? 137 LYS A HD3  4  
ATOM 8755  H HE2  . LYS A 1 137 ? 16.440  -15.850 -16.371 1.00 0.00 ? 137 LYS A HE2  4  
ATOM 8756  H HE3  . LYS A 1 137 ? 17.218  -14.281 -16.177 1.00 0.00 ? 137 LYS A HE3  4  
ATOM 8757  H HZ1  . LYS A 1 137 ? 18.390  -14.990 -14.424 1.00 0.00 ? 137 LYS A HZ1  4  
ATOM 8758  H HZ2  . LYS A 1 137 ? 18.054  -16.542 -15.009 1.00 0.00 ? 137 LYS A HZ2  4  
ATOM 8759  H HZ3  . LYS A 1 137 ? 17.107  -15.880 -13.773 1.00 0.00 ? 137 LYS A HZ3  4  
ATOM 8760  N N    . GLN A 1 138 ? 14.897  -11.882 -12.656 1.00 0.00 ? 138 GLN A N    4  
ATOM 8761  C CA   . GLN A 1 138 ? 15.424  -12.184 -11.330 1.00 0.00 ? 138 GLN A CA   4  
ATOM 8762  C C    . GLN A 1 138 ? 14.371  -12.871 -10.469 1.00 0.00 ? 138 GLN A C    4  
ATOM 8763  O O    . GLN A 1 138 ? 13.183  -12.558 -10.556 1.00 0.00 ? 138 GLN A O    4  
ATOM 8764  C CB   . GLN A 1 138 ? 15.903  -10.903 -10.645 1.00 0.00 ? 138 GLN A CB   4  
ATOM 8765  C CG   . GLN A 1 138 ? 16.711  -11.155 -9.381  1.00 0.00 ? 138 GLN A CG   4  
ATOM 8766  C CD   . GLN A 1 138 ? 15.846  -11.216 -8.138  1.00 0.00 ? 138 GLN A CD   4  
ATOM 8767  O OE1  . GLN A 1 138 ? 14.818  -10.543 -8.049  1.00 0.00 ? 138 GLN A OE1  4  
ATOM 8768  N NE2  . GLN A 1 138 ? 16.257  -12.027 -7.170  1.00 0.00 ? 138 GLN A NE2  4  
ATOM 8769  H H    . GLN A 1 138 ? 13.934  -11.966 -12.818 1.00 0.00 ? 138 GLN A H    4  
ATOM 8770  H HA   . GLN A 1 138 ? 16.263  -12.852 -11.451 1.00 0.00 ? 138 GLN A HA   4  
ATOM 8771  H HB2  . GLN A 1 138 ? 16.520  -10.347 -11.337 1.00 0.00 ? 138 GLN A HB2  4  
ATOM 8772  H HB3  . GLN A 1 138 ? 15.043  -10.305 -10.383 1.00 0.00 ? 138 GLN A HB3  4  
ATOM 8773  H HG2  . GLN A 1 138 ? 17.233  -12.094 -9.485  1.00 0.00 ? 138 GLN A HG2  4  
ATOM 8774  H HG3  . GLN A 1 138 ? 17.428  -10.355 -9.264  1.00 0.00 ? 138 GLN A HG3  4  
ATOM 8775  H HE21 . GLN A 1 138 ? 17.086  -12.531 -7.311  1.00 0.00 ? 138 GLN A HE21 4  
ATOM 8776  H HE22 . GLN A 1 138 ? 15.717  -12.086 -6.356  1.00 0.00 ? 138 GLN A HE22 4  
ATOM 8777  N N    . GLU A 1 139 ? 14.812  -13.810 -9.638  1.00 0.00 ? 139 GLU A N    4  
ATOM 8778  C CA   . GLU A 1 139 ? 13.905  -14.542 -8.761  1.00 0.00 ? 139 GLU A CA   4  
ATOM 8779  C C    . GLU A 1 139 ? 13.061  -15.532 -9.558  1.00 0.00 ? 139 GLU A C    4  
ATOM 8780  O O    . GLU A 1 139 ? 11.847  -15.619 -9.373  1.00 0.00 ? 139 GLU A O    4  
ATOM 8781  C CB   . GLU A 1 139 ? 12.995  -13.571 -8.006  1.00 0.00 ? 139 GLU A CB   4  
ATOM 8782  C CG   . GLU A 1 139 ? 12.484  -14.119 -6.684  1.00 0.00 ? 139 GLU A CG   4  
ATOM 8783  C CD   . GLU A 1 139 ? 13.432  -13.843 -5.533  1.00 0.00 ? 139 GLU A CD   4  
ATOM 8784  O OE1  . GLU A 1 139 ? 14.613  -14.239 -5.630  1.00 0.00 ? 139 GLU A OE1  4  
ATOM 8785  O OE2  . GLU A 1 139 ? 12.994  -13.232 -4.536  1.00 0.00 ? 139 GLU A OE2  4  
ATOM 8786  H H    . GLU A 1 139 ? 15.770  -14.014 -9.613  1.00 0.00 ? 139 GLU A H    4  
ATOM 8787  H HA   . GLU A 1 139 ? 14.503  -15.089 -8.048  1.00 0.00 ? 139 GLU A HA   4  
ATOM 8788  H HB2  . GLU A 1 139 ? 13.544  -12.663 -7.808  1.00 0.00 ? 139 GLU A HB2  4  
ATOM 8789  H HB3  . GLU A 1 139 ? 12.144  -13.338 -8.628  1.00 0.00 ? 139 GLU A HB3  4  
ATOM 8790  H HG2  . GLU A 1 139 ? 11.532  -13.661 -6.463  1.00 0.00 ? 139 GLU A HG2  4  
ATOM 8791  H HG3  . GLU A 1 139 ? 12.356  -15.187 -6.777  1.00 0.00 ? 139 GLU A HG3  4  
ATOM 8792  N N    . ARG A 1 140 ? 13.714  -16.278 -10.444 1.00 0.00 ? 140 ARG A N    4  
ATOM 8793  C CA   . ARG A 1 140 ? 13.023  -17.262 -11.270 1.00 0.00 ? 140 ARG A CA   4  
ATOM 8794  C C    . ARG A 1 140 ? 12.434  -18.377 -10.411 1.00 0.00 ? 140 ARG A C    4  
ATOM 8795  O O    . ARG A 1 140 ? 13.166  -19.195 -9.853  1.00 0.00 ? 140 ARG A O    4  
ATOM 8796  C CB   . ARG A 1 140 ? 13.983  -17.853 -12.305 1.00 0.00 ? 140 ARG A CB   4  
ATOM 8797  C CG   . ARG A 1 140 ? 13.284  -18.634 -13.405 1.00 0.00 ? 140 ARG A CG   4  
ATOM 8798  C CD   . ARG A 1 140 ? 14.260  -19.521 -14.164 1.00 0.00 ? 140 ARG A CD   4  
ATOM 8799  N NE   . ARG A 1 140 ? 13.578  -20.590 -14.890 1.00 0.00 ? 140 ARG A NE   4  
ATOM 8800  C CZ   . ARG A 1 140 ? 14.181  -21.381 -15.770 1.00 0.00 ? 140 ARG A CZ   4  
ATOM 8801  N NH1  . ARG A 1 140 ? 15.472  -21.224 -16.032 1.00 0.00 ? 140 ARG A NH1  4  
ATOM 8802  N NH2  . ARG A 1 140 ? 13.493  -22.331 -16.389 1.00 0.00 ? 140 ARG A NH2  4  
ATOM 8803  H H    . ARG A 1 140 ? 14.681  -16.164 -10.545 1.00 0.00 ? 140 ARG A H    4  
ATOM 8804  H HA   . ARG A 1 140 ? 12.219  -16.757 -11.785 1.00 0.00 ? 140 ARG A HA   4  
ATOM 8805  H HB2  . ARG A 1 140 ? 14.540  -17.048 -12.764 1.00 0.00 ? 140 ARG A HB2  4  
ATOM 8806  H HB3  . ARG A 1 140 ? 14.670  -18.516 -11.803 1.00 0.00 ? 140 ARG A HB3  4  
ATOM 8807  H HG2  . ARG A 1 140 ? 12.519  -19.256 -12.964 1.00 0.00 ? 140 ARG A HG2  4  
ATOM 8808  H HG3  . ARG A 1 140 ? 12.831  -17.939 -14.096 1.00 0.00 ? 140 ARG A HG3  4  
ATOM 8809  H HD2  . ARG A 1 140 ? 14.805  -18.911 -14.869 1.00 0.00 ? 140 ARG A HD2  4  
ATOM 8810  H HD3  . ARG A 1 140 ? 14.950  -19.959 -13.459 1.00 0.00 ? 140 ARG A HD3  4  
ATOM 8811  H HE   . ARG A 1 140 ? 12.624  -20.722 -14.711 1.00 0.00 ? 140 ARG A HE   4  
ATOM 8812  H HH11 . ARG A 1 140 ? 15.993  -20.510 -15.566 1.00 0.00 ? 140 ARG A HH11 4  
ATOM 8813  H HH12 . ARG A 1 140 ? 15.924  -21.823 -16.693 1.00 0.00 ? 140 ARG A HH12 4  
ATOM 8814  H HH21 . ARG A 1 140 ? 12.521  -22.453 -16.194 1.00 0.00 ? 140 ARG A HH21 4  
ATOM 8815  H HH22 . ARG A 1 140 ? 13.948  -22.926 -17.051 1.00 0.00 ? 140 ARG A HH22 4  
ATOM 8816  N N    . SER A 1 141 ? 11.110  -18.402 -10.308 1.00 0.00 ? 141 SER A N    4  
ATOM 8817  C CA   . SER A 1 141 ? 10.424  -19.414 -9.513  1.00 0.00 ? 141 SER A CA   4  
ATOM 8818  C C    . SER A 1 141 ? 9.417   -20.182 -10.365 1.00 0.00 ? 141 SER A C    4  
ATOM 8819  O O    . SER A 1 141 ? 9.126   -19.801 -11.498 1.00 0.00 ? 141 SER A O    4  
ATOM 8820  C CB   . SER A 1 141 ? 9.713   -18.764 -8.326  1.00 0.00 ? 141 SER A CB   4  
ATOM 8821  O OG   . SER A 1 141 ? 10.623  -18.490 -7.274  1.00 0.00 ? 141 SER A OG   4  
ATOM 8822  H H    . SER A 1 141 ? 10.582  -17.722 -10.777 1.00 0.00 ? 141 SER A H    4  
ATOM 8823  H HA   . SER A 1 141 ? 11.166  -20.105 -9.144  1.00 0.00 ? 141 SER A HA   4  
ATOM 8824  H HB2  . SER A 1 141 ? 9.260   -17.837 -8.643  1.00 0.00 ? 141 SER A HB2  4  
ATOM 8825  H HB3  . SER A 1 141 ? 8.947   -19.432 -7.958  1.00 0.00 ? 141 SER A HB3  4  
ATOM 8826  H HG   . SER A 1 141 ? 11.078  -19.298 -7.026  1.00 0.00 ? 141 SER A HG   4  
ATOM 8827  N N    . GLY A 1 142 ? 8.888   -21.269 -9.809  1.00 0.00 ? 142 GLY A N    4  
ATOM 8828  C CA   . GLY A 1 142 ? 7.920   -22.074 -10.529 1.00 0.00 ? 142 GLY A CA   4  
ATOM 8829  C C    . GLY A 1 142 ? 6.776   -22.533 -9.647  1.00 0.00 ? 142 GLY A C    4  
ATOM 8830  O O    . GLY A 1 142 ? 6.816   -23.610 -9.053  1.00 0.00 ? 142 GLY A O    4  
ATOM 8831  H H    . GLY A 1 142 ? 9.157   -21.524 -8.902  1.00 0.00 ? 142 GLY A H    4  
ATOM 8832  H HA2  . GLY A 1 142 ? 7.520   -21.492 -11.346 1.00 0.00 ? 142 GLY A HA2  4  
ATOM 8833  H HA3  . GLY A 1 142 ? 8.420   -22.942 -10.932 1.00 0.00 ? 142 GLY A HA3  4  
ATOM 8834  N N    . PRO A 1 143 ? 5.727   -21.702 -9.550  1.00 0.00 ? 143 PRO A N    4  
ATOM 8835  C CA   . PRO A 1 143 ? 4.548   -22.006 -8.735  1.00 0.00 ? 143 PRO A CA   4  
ATOM 8836  C C    . PRO A 1 143 ? 3.718   -23.144 -9.319  1.00 0.00 ? 143 PRO A C    4  
ATOM 8837  O O    . PRO A 1 143 ? 2.676   -23.507 -8.774  1.00 0.00 ? 143 PRO A O    4  
ATOM 8838  C CB   . PRO A 1 143 ? 3.754   -20.698 -8.757  1.00 0.00 ? 143 PRO A CB   4  
ATOM 8839  C CG   . PRO A 1 143 ? 4.173   -20.022 -10.017 1.00 0.00 ? 143 PRO A CG   4  
ATOM 8840  C CD   . PRO A 1 143 ? 5.612   -20.401 -10.231 1.00 0.00 ? 143 PRO A CD   4  
ATOM 8841  H HA   . PRO A 1 143 ? 4.821   -22.247 -7.717  1.00 0.00 ? 143 PRO A HA   4  
ATOM 8842  H HB2  . PRO A 1 143 ? 2.696   -20.917 -8.759  1.00 0.00 ? 143 PRO A HB2  4  
ATOM 8843  H HB3  . PRO A 1 143 ? 4.004   -20.106 -7.889  1.00 0.00 ? 143 PRO A HB3  4  
ATOM 8844  H HG2  . PRO A 1 143 ? 3.567   -20.369 -10.839 1.00 0.00 ? 143 PRO A HG2  4  
ATOM 8845  H HG3  . PRO A 1 143 ? 4.080   -18.951 -9.906  1.00 0.00 ? 143 PRO A HG3  4  
ATOM 8846  H HD2  . PRO A 1 143 ? 5.824   -20.496 -11.285 1.00 0.00 ? 143 PRO A HD2  4  
ATOM 8847  H HD3  . PRO A 1 143 ? 6.267   -19.670 -9.777  1.00 0.00 ? 143 PRO A HD3  4  
ATOM 8848  N N    . SER A 1 144 ? 4.186   -23.703 -10.431 1.00 0.00 ? 144 SER A N    4  
ATOM 8849  C CA   . SER A 1 144 ? 3.484   -24.797 -11.090 1.00 0.00 ? 144 SER A CA   4  
ATOM 8850  C C    . SER A 1 144 ? 3.152   -25.907 -10.097 1.00 0.00 ? 144 SER A C    4  
ATOM 8851  O O    . SER A 1 144 ? 4.037   -26.440 -9.427  1.00 0.00 ? 144 SER A O    4  
ATOM 8852  C CB   . SER A 1 144 ? 4.331   -25.357 -12.235 1.00 0.00 ? 144 SER A CB   4  
ATOM 8853  O OG   . SER A 1 144 ? 3.704   -26.480 -12.831 1.00 0.00 ? 144 SER A OG   4  
ATOM 8854  H H    . SER A 1 144 ? 5.022   -23.369 -10.817 1.00 0.00 ? 144 SER A H    4  
ATOM 8855  H HA   . SER A 1 144 ? 2.563   -24.404 -11.495 1.00 0.00 ? 144 SER A HA   4  
ATOM 8856  H HB2  . SER A 1 144 ? 4.466   -24.595 -12.987 1.00 0.00 ? 144 SER A HB2  4  
ATOM 8857  H HB3  . SER A 1 144 ? 5.295   -25.659 -11.851 1.00 0.00 ? 144 SER A HB3  4  
ATOM 8858  H HG   . SER A 1 144 ? 4.162   -27.280 -12.565 1.00 0.00 ? 144 SER A HG   4  
ATOM 8859  N N    . SER A 1 145 ? 1.871   -26.250 -10.010 1.00 0.00 ? 145 SER A N    4  
ATOM 8860  C CA   . SER A 1 145 ? 1.420   -27.293 -9.096  1.00 0.00 ? 145 SER A CA   4  
ATOM 8861  C C    . SER A 1 145 ? 0.238   -28.056 -9.684  1.00 0.00 ? 145 SER A C    4  
ATOM 8862  O O    . SER A 1 145 ? -0.686  -27.461 -10.238 1.00 0.00 ? 145 SER A O    4  
ATOM 8863  C CB   . SER A 1 145 ? 1.031   -26.687 -7.747  1.00 0.00 ? 145 SER A CB   4  
ATOM 8864  O OG   . SER A 1 145 ? 2.158   -26.125 -7.096  1.00 0.00 ? 145 SER A OG   4  
ATOM 8865  H H    . SER A 1 145 ? 1.213   -25.788 -10.571 1.00 0.00 ? 145 SER A H    4  
ATOM 8866  H HA   . SER A 1 145 ? 2.241   -27.982 -8.949  1.00 0.00 ? 145 SER A HA   4  
ATOM 8867  H HB2  . SER A 1 145 ? 0.297   -25.910 -7.902  1.00 0.00 ? 145 SER A HB2  4  
ATOM 8868  H HB3  . SER A 1 145 ? 0.612   -27.458 -7.116  1.00 0.00 ? 145 SER A HB3  4  
ATOM 8869  H HG   . SER A 1 145 ? 2.025   -26.152 -6.146  1.00 0.00 ? 145 SER A HG   4  
ATOM 8870  N N    . GLY A 1 146 ? 0.273   -29.379 -9.559  1.00 0.00 ? 146 GLY A N    4  
ATOM 8871  C CA   . GLY A 1 146 ? -0.801  -30.203 -10.082 1.00 0.00 ? 146 GLY A CA   4  
ATOM 8872  C C    . GLY A 1 146 ? -1.557  -30.934 -8.990  1.00 0.00 ? 146 GLY A C    4  
ATOM 8873  O O    . GLY A 1 146 ? -1.003  -31.222 -7.929  1.00 0.00 ? 146 GLY A O    4  
ATOM 8874  H H    . GLY A 1 146 ? 1.034   -29.800 -9.108  1.00 0.00 ? 146 GLY A H    4  
ATOM 8875  H HA2  . GLY A 1 146 ? -1.491  -29.574 -10.624 1.00 0.00 ? 146 GLY A HA2  4  
ATOM 8876  H HA3  . GLY A 1 146 ? -0.383  -30.931 -10.762 1.00 0.00 ? 146 GLY A HA3  4  
ATOM 8877  N N    . GLY A 1 1   ? -4.481  -20.167 -25.722 1.00 0.00 ? 1   GLY A N    5  
ATOM 8878  C CA   . GLY A 1 1   ? -5.273  -20.165 -24.506 1.00 0.00 ? 1   GLY A CA   5  
ATOM 8879  C C    . GLY A 1 1   ? -4.840  -19.082 -23.536 1.00 0.00 ? 1   GLY A C    5  
ATOM 8880  O O    . GLY A 1 1   ? -4.145  -19.356 -22.559 1.00 0.00 ? 1   GLY A O    5  
ATOM 8881  H H1   . GLY A 1 1   ? -4.044  -19.343 -26.022 1.00 0.00 ? 1   GLY A H1   5  
ATOM 8882  H HA2  . GLY A 1 1   ? -6.309  -20.010 -24.763 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 8883  H HA3  . GLY A 1 1   ? -5.171  -21.125 -24.022 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 8884  N N    . SER A 1 2   ? -5.252  -17.848 -23.809 1.00 0.00 ? 2   SER A N    5  
ATOM 8885  C CA   . SER A 1 2   ? -4.899  -16.719 -22.957 1.00 0.00 ? 2   SER A CA   5  
ATOM 8886  C C    . SER A 1 2   ? -5.709  -16.739 -21.665 1.00 0.00 ? 2   SER A C    5  
ATOM 8887  O O    . SER A 1 2   ? -6.740  -17.406 -21.576 1.00 0.00 ? 2   SER A O    5  
ATOM 8888  C CB   . SER A 1 2   ? -5.132  -15.400 -23.697 1.00 0.00 ? 2   SER A CB   5  
ATOM 8889  O OG   . SER A 1 2   ? -6.517  -15.126 -23.826 1.00 0.00 ? 2   SER A OG   5  
ATOM 8890  H H    . SER A 1 2   ? -5.805  -17.693 -24.604 1.00 0.00 ? 2   SER A H    5  
ATOM 8891  H HA   . SER A 1 2   ? -3.851  -16.803 -22.712 1.00 0.00 ? 2   SER A HA   5  
ATOM 8892  H HB2  . SER A 1 2   ? -4.668  -14.595 -23.149 1.00 0.00 ? 2   SER A HB2  5  
ATOM 8893  H HB3  . SER A 1 2   ? -4.697  -15.463 -24.684 1.00 0.00 ? 2   SER A HB3  5  
ATOM 8894  H HG   . SER A 1 2   ? -6.638  -14.301 -24.301 1.00 0.00 ? 2   SER A HG   5  
ATOM 8895  N N    . SER A 1 3   ? -5.235  -16.004 -20.664 1.00 0.00 ? 3   SER A N    5  
ATOM 8896  C CA   . SER A 1 3   ? -5.912  -15.940 -19.374 1.00 0.00 ? 3   SER A CA   5  
ATOM 8897  C C    . SER A 1 3   ? -5.399  -14.763 -18.549 1.00 0.00 ? 3   SER A C    5  
ATOM 8898  O O    . SER A 1 3   ? -4.467  -14.068 -18.951 1.00 0.00 ? 3   SER A O    5  
ATOM 8899  C CB   . SER A 1 3   ? -5.709  -17.245 -18.602 1.00 0.00 ? 3   SER A CB   5  
ATOM 8900  O OG   . SER A 1 3   ? -6.633  -18.234 -19.021 1.00 0.00 ? 3   SER A OG   5  
ATOM 8901  H H    . SER A 1 3   ? -4.408  -15.494 -20.796 1.00 0.00 ? 3   SER A H    5  
ATOM 8902  H HA   . SER A 1 3   ? -6.966  -15.802 -19.560 1.00 0.00 ? 3   SER A HA   5  
ATOM 8903  H HB2  . SER A 1 3   ? -4.708  -17.610 -18.774 1.00 0.00 ? 3   SER A HB2  5  
ATOM 8904  H HB3  . SER A 1 3   ? -5.849  -17.061 -17.547 1.00 0.00 ? 3   SER A HB3  5  
ATOM 8905  H HG   . SER A 1 3   ? -7.035  -18.642 -18.250 1.00 0.00 ? 3   SER A HG   5  
ATOM 8906  N N    . GLY A 1 4   ? -6.019  -14.545 -17.393 1.00 0.00 ? 4   GLY A N    5  
ATOM 8907  C CA   . GLY A 1 4   ? -5.613  -13.452 -16.528 1.00 0.00 ? 4   GLY A CA   5  
ATOM 8908  C C    . GLY A 1 4   ? -4.575  -13.875 -15.507 1.00 0.00 ? 4   GLY A C    5  
ATOM 8909  O O    . GLY A 1 4   ? -3.910  -14.896 -15.675 1.00 0.00 ? 4   GLY A O    5  
ATOM 8910  H H    . GLY A 1 4   ? -6.757  -15.131 -17.124 1.00 0.00 ? 4   GLY A H    5  
ATOM 8911  H HA2  . GLY A 1 4   ? -5.202  -12.660 -17.137 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 8912  H HA3  . GLY A 1 4   ? -6.482  -13.078 -16.008 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 8913  N N    . SER A 1 5   ? -4.436  -13.085 -14.446 1.00 0.00 ? 5   SER A N    5  
ATOM 8914  C CA   . SER A 1 5   ? -3.469  -13.381 -13.396 1.00 0.00 ? 5   SER A CA   5  
ATOM 8915  C C    . SER A 1 5   ? -3.969  -12.887 -12.042 1.00 0.00 ? 5   SER A C    5  
ATOM 8916  O O    . SER A 1 5   ? -4.441  -11.757 -11.917 1.00 0.00 ? 5   SER A O    5  
ATOM 8917  C CB   . SER A 1 5   ? -2.120  -12.735 -13.720 1.00 0.00 ? 5   SER A CB   5  
ATOM 8918  O OG   . SER A 1 5   ? -1.171  -12.997 -12.700 1.00 0.00 ? 5   SER A OG   5  
ATOM 8919  H H    . SER A 1 5   ? -4.997  -12.285 -14.370 1.00 0.00 ? 5   SER A H    5  
ATOM 8920  H HA   . SER A 1 5   ? -3.344  -14.452 -13.351 1.00 0.00 ? 5   SER A HA   5  
ATOM 8921  H HB2  . SER A 1 5   ? -1.747  -13.134 -14.652 1.00 0.00 ? 5   SER A HB2  5  
ATOM 8922  H HB3  . SER A 1 5   ? -2.247  -11.666 -13.811 1.00 0.00 ? 5   SER A HB3  5  
ATOM 8923  H HG   . SER A 1 5   ? -0.452  -12.364 -12.762 1.00 0.00 ? 5   SER A HG   5  
ATOM 8924  N N    . SER A 1 6   ? -3.862  -13.743 -11.031 1.00 0.00 ? 6   SER A N    5  
ATOM 8925  C CA   . SER A 1 6   ? -4.307  -13.396 -9.686  1.00 0.00 ? 6   SER A CA   5  
ATOM 8926  C C    . SER A 1 6   ? -3.155  -13.496 -8.690  1.00 0.00 ? 6   SER A C    5  
ATOM 8927  O O    . SER A 1 6   ? -2.061  -13.944 -9.031  1.00 0.00 ? 6   SER A O    5  
ATOM 8928  C CB   . SER A 1 6   ? -5.452  -14.313 -9.253  1.00 0.00 ? 6   SER A CB   5  
ATOM 8929  O OG   . SER A 1 6   ? -6.605  -14.101 -10.047 1.00 0.00 ? 6   SER A OG   5  
ATOM 8930  H H    . SER A 1 6   ? -3.477  -14.629 -11.194 1.00 0.00 ? 6   SER A H    5  
ATOM 8931  H HA   . SER A 1 6   ? -4.662  -12.377 -9.706  1.00 0.00 ? 6   SER A HA   5  
ATOM 8932  H HB2  . SER A 1 6   ? -5.143  -15.342 -9.355  1.00 0.00 ? 6   SER A HB2  5  
ATOM 8933  H HB3  . SER A 1 6   ? -5.698  -14.113 -8.220  1.00 0.00 ? 6   SER A HB3  5  
ATOM 8934  H HG   . SER A 1 6   ? -6.360  -13.632 -10.849 1.00 0.00 ? 6   SER A HG   5  
ATOM 8935  N N    . GLY A 1 7   ? -3.410  -13.073 -7.455  1.00 0.00 ? 7   GLY A N    5  
ATOM 8936  C CA   . GLY A 1 7   ? -2.386  -13.123 -6.428  1.00 0.00 ? 7   GLY A CA   5  
ATOM 8937  C C    . GLY A 1 7   ? -2.425  -14.412 -5.632  1.00 0.00 ? 7   GLY A C    5  
ATOM 8938  O O    . GLY A 1 7   ? -2.465  -15.500 -6.203  1.00 0.00 ? 7   GLY A O    5  
ATOM 8939  H H    . GLY A 1 7   ? -4.300  -12.725 -7.241  1.00 0.00 ? 7   GLY A H    5  
ATOM 8940  H HA2  . GLY A 1 7   ? -1.417  -13.030 -6.897  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 8941  H HA3  . GLY A 1 7   ? -2.530  -12.292 -5.753  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 8942  N N    . ASN A 1 8   ? -2.412  -14.289 -4.309  1.00 0.00 ? 8   ASN A N    5  
ATOM 8943  C CA   . ASN A 1 8   ? -2.444  -15.455 -3.432  1.00 0.00 ? 8   ASN A CA   5  
ATOM 8944  C C    . ASN A 1 8   ? -3.760  -15.522 -2.665  1.00 0.00 ? 8   ASN A C    5  
ATOM 8945  O O    . ASN A 1 8   ? -4.618  -14.651 -2.807  1.00 0.00 ? 8   ASN A O    5  
ATOM 8946  C CB   . ASN A 1 8   ? -1.270  -15.414 -2.452  1.00 0.00 ? 8   ASN A CB   5  
ATOM 8947  C CG   . ASN A 1 8   ? -1.120  -14.060 -1.785  1.00 0.00 ? 8   ASN A CG   5  
ATOM 8948  O OD1  . ASN A 1 8   ? -0.418  -13.182 -2.288  1.00 0.00 ? 8   ASN A OD1  5  
ATOM 8949  N ND2  . ASN A 1 8   ? -1.782  -13.884 -0.647  1.00 0.00 ? 8   ASN A ND2  5  
ATOM 8950  H H    . ASN A 1 8   ? -2.379  -13.394 -3.912  1.00 0.00 ? 8   ASN A H    5  
ATOM 8951  H HA   . ASN A 1 8   ? -2.355  -16.335 -4.050  1.00 0.00 ? 8   ASN A HA   5  
ATOM 8952  H HB2  . ASN A 1 8   ? -1.426  -16.156 -1.683  1.00 0.00 ? 8   ASN A HB2  5  
ATOM 8953  H HB3  . ASN A 1 8   ? -0.357  -15.636 -2.982  1.00 0.00 ? 8   ASN A HB3  5  
ATOM 8954  H HD21 . ASN A 1 8   ? -2.322  -14.628 -0.306  1.00 0.00 ? 8   ASN A HD21 5  
ATOM 8955  H HD22 . ASN A 1 8   ? -1.704  -13.018 -0.196  1.00 0.00 ? 8   ASN A HD22 5  
ATOM 8956  N N    . ARG A 1 9   ? -3.912  -16.561 -1.850  1.00 0.00 ? 9   ARG A N    5  
ATOM 8957  C CA   . ARG A 1 9   ? -5.123  -16.742 -1.061  1.00 0.00 ? 9   ARG A CA   5  
ATOM 8958  C C    . ARG A 1 9   ? -5.322  -15.579 -0.095  1.00 0.00 ? 9   ARG A C    5  
ATOM 8959  O O    . ARG A 1 9   ? -4.363  -14.911 0.296   1.00 0.00 ? 9   ARG A O    5  
ATOM 8960  C CB   . ARG A 1 9   ? -5.059  -18.059 -0.284  1.00 0.00 ? 9   ARG A CB   5  
ATOM 8961  C CG   . ARG A 1 9   ? -6.419  -18.691 -0.041  1.00 0.00 ? 9   ARG A CG   5  
ATOM 8962  C CD   . ARG A 1 9   ? -6.327  -20.208 0.021   1.00 0.00 ? 9   ARG A CD   5  
ATOM 8963  N NE   . ARG A 1 9   ? -5.700  -20.668 1.257   1.00 0.00 ? 9   ARG A NE   5  
ATOM 8964  C CZ   . ARG A 1 9   ? -6.293  -20.616 2.445   1.00 0.00 ? 9   ARG A CZ   5  
ATOM 8965  N NH1  . ARG A 1 9   ? -7.520  -20.127 2.556   1.00 0.00 ? 9   ARG A NH1  5  
ATOM 8966  N NH2  . ARG A 1 9   ? -5.657  -21.055 3.524   1.00 0.00 ? 9   ARG A NH2  5  
ATOM 8967  H H    . ARG A 1 9   ? -3.191  -17.222 -1.780  1.00 0.00 ? 9   ARG A H    5  
ATOM 8968  H HA   . ARG A 1 9   ? -5.961  -16.777 -1.741  1.00 0.00 ? 9   ARG A HA   5  
ATOM 8969  H HB2  . ARG A 1 9   ? -4.454  -18.762 -0.838  1.00 0.00 ? 9   ARG A HB2  5  
ATOM 8970  H HB3  . ARG A 1 9   ? -4.595  -17.875 0.674   1.00 0.00 ? 9   ARG A HB3  5  
ATOM 8971  H HG2  . ARG A 1 9   ? -6.813  -18.328 0.896   1.00 0.00 ? 9   ARG A HG2  5  
ATOM 8972  H HG3  . ARG A 1 9   ? -7.083  -18.411 -0.845  1.00 0.00 ? 9   ARG A HG3  5  
ATOM 8973  H HD2  . ARG A 1 9   ? -7.324  -20.618 -0.041  1.00 0.00 ? 9   ARG A HD2  5  
ATOM 8974  H HD3  . ARG A 1 9   ? -5.743  -20.553 -0.819  1.00 0.00 ? 9   ARG A HD3  5  
ATOM 8975  H HE   . ARG A 1 9   ? -4.793  -21.033 1.197   1.00 0.00 ? 9   ARG A HE   5  
ATOM 8976  H HH11 . ARG A 1 9   ? -8.001  -19.796 1.744   1.00 0.00 ? 9   ARG A HH11 5  
ATOM 8977  H HH12 . ARG A 1 9   ? -7.964  -20.090 3.451   1.00 0.00 ? 9   ARG A HH12 5  
ATOM 8978  H HH21 . ARG A 1 9   ? -4.732  -21.424 3.443   1.00 0.00 ? 9   ARG A HH21 5  
ATOM 8979  H HH22 . ARG A 1 9   ? -6.104  -21.014 4.417   1.00 0.00 ? 9   ARG A HH22 5  
ATOM 8980  N N    . LEU A 1 10  ? -6.571  -15.340 0.288   1.00 0.00 ? 10  LEU A N    5  
ATOM 8981  C CA   . LEU A 1 10  ? -6.896  -14.256 1.209   1.00 0.00 ? 10  LEU A CA   5  
ATOM 8982  C C    . LEU A 1 10  ? -6.547  -14.638 2.643   1.00 0.00 ? 10  LEU A C    5  
ATOM 8983  O O    . LEU A 1 10  ? -7.353  -15.243 3.351   1.00 0.00 ? 10  LEU A O    5  
ATOM 8984  C CB   . LEU A 1 10  ? -8.382  -13.906 1.110   1.00 0.00 ? 10  LEU A CB   5  
ATOM 8985  C CG   . LEU A 1 10  ? -8.892  -13.529 -0.282  1.00 0.00 ? 10  LEU A CG   5  
ATOM 8986  C CD1  . LEU A 1 10  ? -10.410 -13.443 -0.289  1.00 0.00 ? 10  LEU A CD1  5  
ATOM 8987  C CD2  . LEU A 1 10  ? -8.278  -12.213 -0.737  1.00 0.00 ? 10  LEU A CD2  5  
ATOM 8988  H H    . LEU A 1 10  ? -7.294  -15.907 -0.056  1.00 0.00 ? 10  LEU A H    5  
ATOM 8989  H HA   . LEU A 1 10  ? -6.311  -13.394 0.925   1.00 0.00 ? 10  LEU A HA   5  
ATOM 8990  H HB2  . LEU A 1 10  ? -8.947  -14.760 1.449   1.00 0.00 ? 10  LEU A HB2  5  
ATOM 8991  H HB3  . LEU A 1 10  ? -8.568  -13.069 1.769   1.00 0.00 ? 10  LEU A HB3  5  
ATOM 8992  H HG   . LEU A 1 10  ? -8.599  -14.297 -0.985  1.00 0.00 ? 10  LEU A HG   5  
ATOM 8993  H HD11 . LEU A 1 10  ? -10.716 -12.464 0.050   1.00 0.00 ? 10  LEU A HD11 5  
ATOM 8994  H HD12 . LEU A 1 10  ? -10.816 -14.196 0.370   1.00 0.00 ? 10  LEU A HD12 5  
ATOM 8995  H HD13 . LEU A 1 10  ? -10.775 -13.608 -1.292  1.00 0.00 ? 10  LEU A HD13 5  
ATOM 8996  H HD21 . LEU A 1 10  ? -8.391  -12.115 -1.806  1.00 0.00 ? 10  LEU A HD21 5  
ATOM 8997  H HD22 . LEU A 1 10  ? -7.228  -12.199 -0.483  1.00 0.00 ? 10  LEU A HD22 5  
ATOM 8998  H HD23 . LEU A 1 10  ? -8.779  -11.393 -0.244  1.00 0.00 ? 10  LEU A HD23 5  
ATOM 8999  N N    . LEU A 1 11  ? -5.340  -14.277 3.068   1.00 0.00 ? 11  LEU A N    5  
ATOM 9000  C CA   . LEU A 1 11  ? -4.884  -14.579 4.421   1.00 0.00 ? 11  LEU A CA   5  
ATOM 9001  C C    . LEU A 1 11  ? -3.883  -13.535 4.904   1.00 0.00 ? 11  LEU A C    5  
ATOM 9002  O O    . LEU A 1 11  ? -2.963  -13.160 4.176   1.00 0.00 ? 11  LEU A O    5  
ATOM 9003  C CB   . LEU A 1 11  ? -4.250  -15.970 4.467   1.00 0.00 ? 11  LEU A CB   5  
ATOM 9004  C CG   . LEU A 1 11  ? -5.194  -17.128 4.789   1.00 0.00 ? 11  LEU A CG   5  
ATOM 9005  C CD1  . LEU A 1 11  ? -4.582  -18.452 4.358   1.00 0.00 ? 11  LEU A CD1  5  
ATOM 9006  C CD2  . LEU A 1 11  ? -5.526  -17.150 6.273   1.00 0.00 ? 11  LEU A CD2  5  
ATOM 9007  H H    . LEU A 1 11  ? -4.742  -13.797 2.460   1.00 0.00 ? 11  LEU A H    5  
ATOM 9008  H HA   . LEU A 1 11  ? -5.746  -14.563 5.072   1.00 0.00 ? 11  LEU A HA   5  
ATOM 9009  H HB2  . LEU A 1 11  ? -3.806  -16.164 3.503   1.00 0.00 ? 11  LEU A HB2  5  
ATOM 9010  H HB3  . LEU A 1 11  ? -3.475  -15.954 5.222   1.00 0.00 ? 11  LEU A HB3  5  
ATOM 9011  H HG   . LEU A 1 11  ? -6.117  -16.994 4.241   1.00 0.00 ? 11  LEU A HG   5  
ATOM 9012  H HD11 . LEU A 1 11  ? -3.534  -18.309 4.136   1.00 0.00 ? 11  LEU A HD11 5  
ATOM 9013  H HD12 . LEU A 1 11  ? -5.089  -18.814 3.476   1.00 0.00 ? 11  LEU A HD12 5  
ATOM 9014  H HD13 . LEU A 1 11  ? -4.686  -19.174 5.154   1.00 0.00 ? 11  LEU A HD13 5  
ATOM 9015  H HD21 . LEU A 1 11  ? -4.831  -17.800 6.787   1.00 0.00 ? 11  LEU A HD21 5  
ATOM 9016  H HD22 . LEU A 1 11  ? -6.532  -17.519 6.412   1.00 0.00 ? 11  LEU A HD22 5  
ATOM 9017  H HD23 . LEU A 1 11  ? -5.448  -16.151 6.674   1.00 0.00 ? 11  LEU A HD23 5  
ATOM 9018  N N    . SER A 1 12  ? -4.068  -13.070 6.136   1.00 0.00 ? 12  SER A N    5  
ATOM 9019  C CA   . SER A 1 12  ? -3.182  -12.067 6.715   1.00 0.00 ? 12  SER A CA   5  
ATOM 9020  C C    . SER A 1 12  ? -2.280  -12.689 7.777   1.00 0.00 ? 12  SER A C    5  
ATOM 9021  O O    . SER A 1 12  ? -2.757  -13.260 8.757   1.00 0.00 ? 12  SER A O    5  
ATOM 9022  C CB   . SER A 1 12  ? -3.998  -10.927 7.326   1.00 0.00 ? 12  SER A CB   5  
ATOM 9023  O OG   . SER A 1 12  ? -3.213  -10.162 8.224   1.00 0.00 ? 12  SER A OG   5  
ATOM 9024  H H    . SER A 1 12  ? -4.819  -13.408 6.665   1.00 0.00 ? 12  SER A H    5  
ATOM 9025  H HA   . SER A 1 12  ? -2.565  -11.672 5.922   1.00 0.00 ? 12  SER A HA   5  
ATOM 9026  H HB2  . SER A 1 12  ? -4.356  -10.282 6.539   1.00 0.00 ? 12  SER A HB2  5  
ATOM 9027  H HB3  . SER A 1 12  ? -4.840  -11.339 7.865   1.00 0.00 ? 12  SER A HB3  5  
ATOM 9028  H HG   . SER A 1 12  ? -3.681  -9.355  8.451   1.00 0.00 ? 12  SER A HG   5  
ATOM 9029  N N    . LYS A 1 13  ? -0.971  -12.572 7.574   1.00 0.00 ? 13  LYS A N    5  
ATOM 9030  C CA   . LYS A 1 13  ? 0.000   -13.120 8.513   1.00 0.00 ? 13  LYS A CA   5  
ATOM 9031  C C    . LYS A 1 13  ? 1.161   -12.153 8.721   1.00 0.00 ? 13  LYS A C    5  
ATOM 9032  O O    . LYS A 1 13  ? 1.235   -11.109 8.073   1.00 0.00 ? 13  LYS A O    5  
ATOM 9033  C CB   . LYS A 1 13  ? 0.528   -14.465 8.006   1.00 0.00 ? 13  LYS A CB   5  
ATOM 9034  C CG   . LYS A 1 13  ? 1.162   -14.389 6.628   1.00 0.00 ? 13  LYS A CG   5  
ATOM 9035  C CD   . LYS A 1 13  ? 2.265   -15.421 6.466   1.00 0.00 ? 13  LYS A CD   5  
ATOM 9036  C CE   . LYS A 1 13  ? 2.445   -15.819 5.008   1.00 0.00 ? 13  LYS A CE   5  
ATOM 9037  N NZ   . LYS A 1 13  ? 1.382   -16.760 4.556   1.00 0.00 ? 13  LYS A NZ   5  
ATOM 9038  H H    . LYS A 1 13  ? -0.652  -12.105 6.774   1.00 0.00 ? 13  LYS A H    5  
ATOM 9039  H HA   . LYS A 1 13  ? -0.500  -13.272 9.458   1.00 0.00 ? 13  LYS A HA   5  
ATOM 9040  H HB2  . LYS A 1 13  ? 1.269   -14.832 8.701   1.00 0.00 ? 13  LYS A HB2  5  
ATOM 9041  H HB3  . LYS A 1 13  ? -0.293  -15.167 7.964   1.00 0.00 ? 13  LYS A HB3  5  
ATOM 9042  H HG2  . LYS A 1 13  ? 0.402   -14.569 5.882   1.00 0.00 ? 13  LYS A HG2  5  
ATOM 9043  H HG3  . LYS A 1 13  ? 1.580   -13.402 6.488   1.00 0.00 ? 13  LYS A HG3  5  
ATOM 9044  H HD2  . LYS A 1 13  ? 3.193   -15.005 6.830   1.00 0.00 ? 13  LYS A HD2  5  
ATOM 9045  H HD3  . LYS A 1 13  ? 2.012   -16.300 7.041   1.00 0.00 ? 13  LYS A HD3  5  
ATOM 9046  H HE2  . LYS A 1 13  ? 2.409   -14.930 4.398   1.00 0.00 ? 13  LYS A HE2  5  
ATOM 9047  H HE3  . LYS A 1 13  ? 3.407   -16.295 4.894   1.00 0.00 ? 13  LYS A HE3  5  
ATOM 9048  H HZ1  . LYS A 1 13  ? 0.546   -16.674 5.167   1.00 0.00 ? 13  LYS A HZ1  5  
ATOM 9049  H HZ2  . LYS A 1 13  ? 1.730   -17.738 4.598   1.00 0.00 ? 13  LYS A HZ2  5  
ATOM 9050  H HZ3  . LYS A 1 13  ? 1.106   -16.544 3.577   1.00 0.00 ? 13  LYS A HZ3  5  
ATOM 9051  N N    . TYR A 1 14  ? 2.066   -12.507 9.628   1.00 0.00 ? 14  TYR A N    5  
ATOM 9052  C CA   . TYR A 1 14  ? 3.222   -11.670 9.921   1.00 0.00 ? 14  TYR A CA   5  
ATOM 9053  C C    . TYR A 1 14  ? 4.492   -12.511 10.026  1.00 0.00 ? 14  TYR A C    5  
ATOM 9054  O O    . TYR A 1 14  ? 4.693   -13.231 11.003  1.00 0.00 ? 14  TYR A O    5  
ATOM 9055  C CB   . TYR A 1 14  ? 3.001   -10.896 11.221  1.00 0.00 ? 14  TYR A CB   5  
ATOM 9056  C CG   . TYR A 1 14  ? 4.048   -9.836  11.481  1.00 0.00 ? 14  TYR A CG   5  
ATOM 9057  C CD1  . TYR A 1 14  ? 5.385   -10.177 11.647  1.00 0.00 ? 14  TYR A CD1  5  
ATOM 9058  C CD2  . TYR A 1 14  ? 3.700   -8.493  11.560  1.00 0.00 ? 14  TYR A CD2  5  
ATOM 9059  C CE1  . TYR A 1 14  ? 6.343   -9.212  11.885  1.00 0.00 ? 14  TYR A CE1  5  
ATOM 9060  C CE2  . TYR A 1 14  ? 4.653   -7.521  11.797  1.00 0.00 ? 14  TYR A CE2  5  
ATOM 9061  C CZ   . TYR A 1 14  ? 5.973   -7.886  11.959  1.00 0.00 ? 14  TYR A CZ   5  
ATOM 9062  O OH   . TYR A 1 14  ? 6.926   -6.921  12.195  1.00 0.00 ? 14  TYR A OH   5  
ATOM 9063  H H    . TYR A 1 14  ? 1.952   -13.352 10.112  1.00 0.00 ? 14  TYR A H    5  
ATOM 9064  H HA   . TYR A 1 14  ? 3.336   -10.966 9.110   1.00 0.00 ? 14  TYR A HA   5  
ATOM 9065  H HB2  . TYR A 1 14  ? 2.039   -10.409 11.184  1.00 0.00 ? 14  TYR A HB2  5  
ATOM 9066  H HB3  . TYR A 1 14  ? 3.016   -11.588 12.051  1.00 0.00 ? 14  TYR A HB3  5  
ATOM 9067  H HD1  . TYR A 1 14  ? 5.671   -11.217 11.588  1.00 0.00 ? 14  TYR A HD1  5  
ATOM 9068  H HD2  . TYR A 1 14  ? 2.665   -8.211  11.433  1.00 0.00 ? 14  TYR A HD2  5  
ATOM 9069  H HE1  . TYR A 1 14  ? 7.378   -9.497  12.012  1.00 0.00 ? 14  TYR A HE1  5  
ATOM 9070  H HE2  . TYR A 1 14  ? 4.363   -6.482  11.855  1.00 0.00 ? 14  TYR A HE2  5  
ATOM 9071  H HH   . TYR A 1 14  ? 7.793   -7.267  11.970  1.00 0.00 ? 14  TYR A HH   5  
ATOM 9072  N N    . ASP A 1 15  ? 5.343   -12.412 9.011   1.00 0.00 ? 15  ASP A N    5  
ATOM 9073  C CA   . ASP A 1 15  ? 6.594   -13.161 8.989   1.00 0.00 ? 15  ASP A CA   5  
ATOM 9074  C C    . ASP A 1 15  ? 7.790   -12.229 9.164   1.00 0.00 ? 15  ASP A C    5  
ATOM 9075  O O    . ASP A 1 15  ? 7.840   -11.133 8.606   1.00 0.00 ? 15  ASP A O    5  
ATOM 9076  C CB   . ASP A 1 15  ? 6.725   -13.936 7.677   1.00 0.00 ? 15  ASP A CB   5  
ATOM 9077  C CG   . ASP A 1 15  ? 7.532   -15.210 7.835   1.00 0.00 ? 15  ASP A CG   5  
ATOM 9078  O OD1  . ASP A 1 15  ? 7.088   -16.103 8.586   1.00 0.00 ? 15  ASP A OD1  5  
ATOM 9079  O OD2  . ASP A 1 15  ? 8.607   -15.314 7.208   1.00 0.00 ? 15  ASP A OD2  5  
ATOM 9080  H H    . ASP A 1 15  ? 5.126   -11.819 8.261   1.00 0.00 ? 15  ASP A H    5  
ATOM 9081  H HA   . ASP A 1 15  ? 6.576   -13.862 9.810   1.00 0.00 ? 15  ASP A HA   5  
ATOM 9082  H HB2  . ASP A 1 15  ? 5.738   -14.198 7.321   1.00 0.00 ? 15  ASP A HB2  5  
ATOM 9083  H HB3  . ASP A 1 15  ? 7.213   -13.311 6.944   1.00 0.00 ? 15  ASP A HB3  5  
ATOM 9084  N N    . PRO A 1 16  ? 8.774   -12.672 9.960   1.00 0.00 ? 16  PRO A N    5  
ATOM 9085  C CA   . PRO A 1 16  ? 9.986   -11.892 10.229  1.00 0.00 ? 16  PRO A CA   5  
ATOM 9086  C C    . PRO A 1 16  ? 10.890  -11.787 9.005   1.00 0.00 ? 16  PRO A C    5  
ATOM 9087  O O    . PRO A 1 16  ? 11.761  -10.920 8.939   1.00 0.00 ? 16  PRO A O    5  
ATOM 9088  C CB   . PRO A 1 16  ? 10.680  -12.687 11.338  1.00 0.00 ? 16  PRO A CB   5  
ATOM 9089  C CG   . PRO A 1 16  ? 10.190  -14.083 11.168  1.00 0.00 ? 16  PRO A CG   5  
ATOM 9090  C CD   . PRO A 1 16  ? 8.780   -13.969 10.659  1.00 0.00 ? 16  PRO A CD   5  
ATOM 9091  H HA   . PRO A 1 16  ? 9.749   -10.902 10.587  1.00 0.00 ? 16  PRO A HA   5  
ATOM 9092  H HB2  . PRO A 1 16  ? 11.751  -12.624 11.212  1.00 0.00 ? 16  PRO A HB2  5  
ATOM 9093  H HB3  . PRO A 1 16  ? 10.401  -12.286 12.301  1.00 0.00 ? 16  PRO A HB3  5  
ATOM 9094  H HG2  . PRO A 1 16  ? 10.806  -14.604 10.450  1.00 0.00 ? 16  PRO A HG2  5  
ATOM 9095  H HG3  . PRO A 1 16  ? 10.204  -14.595 12.118  1.00 0.00 ? 16  PRO A HG3  5  
ATOM 9096  H HD2  . PRO A 1 16  ? 8.558   -14.776 9.976   1.00 0.00 ? 16  PRO A HD2  5  
ATOM 9097  H HD3  . PRO A 1 16  ? 8.080   -13.965 11.482  1.00 0.00 ? 16  PRO A HD3  5  
ATOM 9098  N N    . GLN A 1 17  ? 10.676  -12.674 8.038   1.00 0.00 ? 17  GLN A N    5  
ATOM 9099  C CA   . GLN A 1 17  ? 11.471  -12.678 6.817   1.00 0.00 ? 17  GLN A CA   5  
ATOM 9100  C C    . GLN A 1 17  ? 10.766  -11.911 5.703   1.00 0.00 ? 17  GLN A C    5  
ATOM 9101  O O    . GLN A 1 17  ? 11.383  -11.113 4.998   1.00 0.00 ? 17  GLN A O    5  
ATOM 9102  C CB   . GLN A 1 17  ? 11.746  -14.115 6.368   1.00 0.00 ? 17  GLN A CB   5  
ATOM 9103  C CG   . GLN A 1 17  ? 12.550  -14.924 7.373   1.00 0.00 ? 17  GLN A CG   5  
ATOM 9104  C CD   . GLN A 1 17  ? 12.732  -16.368 6.948   1.00 0.00 ? 17  GLN A CD   5  
ATOM 9105  O OE1  . GLN A 1 17  ? 11.844  -16.963 6.338   1.00 0.00 ? 17  GLN A OE1  5  
ATOM 9106  N NE2  . GLN A 1 17  ? 13.887  -16.939 7.269   1.00 0.00 ? 17  GLN A NE2  5  
ATOM 9107  H H    . GLN A 1 17  ? 9.966   -13.340 8.149   1.00 0.00 ? 17  GLN A H    5  
ATOM 9108  H HA   . GLN A 1 17  ? 12.412  -12.193 7.032   1.00 0.00 ? 17  GLN A HA   5  
ATOM 9109  H HB2  . GLN A 1 17  ? 10.804  -14.616 6.206   1.00 0.00 ? 17  GLN A HB2  5  
ATOM 9110  H HB3  . GLN A 1 17  ? 12.296  -14.090 5.438   1.00 0.00 ? 17  GLN A HB3  5  
ATOM 9111  H HG2  . GLN A 1 17  ? 13.525  -14.472 7.483   1.00 0.00 ? 17  GLN A HG2  5  
ATOM 9112  H HG3  . GLN A 1 17  ? 12.037  -14.905 8.323   1.00 0.00 ? 17  GLN A HG3  5  
ATOM 9113  H HE21 . GLN A 1 17  ? 14.549  -16.402 7.757   1.00 0.00 ? 17  GLN A HE21 5  
ATOM 9114  H HE22 . GLN A 1 17  ? 14.031  -17.871 7.008   1.00 0.00 ? 17  GLN A HE22 5  
ATOM 9115  N N    . LYS A 1 18  ? 9.470   -12.159 5.551   1.00 0.00 ? 18  LYS A N    5  
ATOM 9116  C CA   . LYS A 1 18  ? 8.678   -11.491 4.524   1.00 0.00 ? 18  LYS A CA   5  
ATOM 9117  C C    . LYS A 1 18  ? 8.843   -9.977  4.609   1.00 0.00 ? 18  LYS A C    5  
ATOM 9118  O O    . LYS A 1 18  ? 8.999   -9.303  3.592   1.00 0.00 ? 18  LYS A O    5  
ATOM 9119  C CB   . LYS A 1 18  ? 7.201   -11.863 4.669   1.00 0.00 ? 18  LYS A CB   5  
ATOM 9120  C CG   . LYS A 1 18  ? 6.933   -13.352 4.543   1.00 0.00 ? 18  LYS A CG   5  
ATOM 9121  C CD   . LYS A 1 18  ? 6.946   -13.801 3.092   1.00 0.00 ? 18  LYS A CD   5  
ATOM 9122  C CE   . LYS A 1 18  ? 5.561   -13.715 2.470   1.00 0.00 ? 18  LYS A CE   5  
ATOM 9123  N NZ   . LYS A 1 18  ? 4.629   -14.722 3.048   1.00 0.00 ? 18  LYS A NZ   5  
ATOM 9124  H H    . LYS A 1 18  ? 9.034   -12.806 6.145   1.00 0.00 ? 18  LYS A H    5  
ATOM 9125  H HA   . LYS A 1 18  ? 9.033   -11.826 3.562   1.00 0.00 ? 18  LYS A HA   5  
ATOM 9126  H HB2  . LYS A 1 18  ? 6.852   -11.534 5.636   1.00 0.00 ? 18  LYS A HB2  5  
ATOM 9127  H HB3  . LYS A 1 18  ? 6.637   -11.351 3.901   1.00 0.00 ? 18  LYS A HB3  5  
ATOM 9128  H HG2  . LYS A 1 18  ? 7.697   -13.892 5.083   1.00 0.00 ? 18  LYS A HG2  5  
ATOM 9129  H HG3  . LYS A 1 18  ? 5.965   -13.572 4.971   1.00 0.00 ? 18  LYS A HG3  5  
ATOM 9130  H HD2  . LYS A 1 18  ? 7.618   -13.167 2.534   1.00 0.00 ? 18  LYS A HD2  5  
ATOM 9131  H HD3  . LYS A 1 18  ? 7.289   -14.825 3.044   1.00 0.00 ? 18  LYS A HD3  5  
ATOM 9132  H HE2  . LYS A 1 18  ? 5.163   -12.727 2.645   1.00 0.00 ? 18  LYS A HE2  5  
ATOM 9133  H HE3  . LYS A 1 18  ? 5.646   -13.885 1.407   1.00 0.00 ? 18  LYS A HE3  5  
ATOM 9134  H HZ1  . LYS A 1 18  ? 5.063   -15.667 3.022   1.00 0.00 ? 18  LYS A HZ1  5  
ATOM 9135  H HZ2  . LYS A 1 18  ? 3.743   -14.745 2.504   1.00 0.00 ? 18  LYS A HZ2  5  
ATOM 9136  H HZ3  . LYS A 1 18  ? 4.409   -14.481 4.036   1.00 0.00 ? 18  LYS A HZ3  5  
ATOM 9137  N N    . GLU A 1 19  ? 8.810   -9.450  5.829   1.00 0.00 ? 19  GLU A N    5  
ATOM 9138  C CA   . GLU A 1 19  ? 8.956   -8.015  6.045   1.00 0.00 ? 19  GLU A CA   5  
ATOM 9139  C C    . GLU A 1 19  ? 10.097  -7.452  5.202   1.00 0.00 ? 19  GLU A C    5  
ATOM 9140  O O    . GLU A 1 19  ? 9.957   -6.405  4.571   1.00 0.00 ? 19  GLU A O    5  
ATOM 9141  C CB   . GLU A 1 19  ? 9.209   -7.723  7.525   1.00 0.00 ? 19  GLU A CB   5  
ATOM 9142  C CG   . GLU A 1 19  ? 9.294   -6.240  7.847   1.00 0.00 ? 19  GLU A CG   5  
ATOM 9143  C CD   . GLU A 1 19  ? 10.662  -5.656  7.548   1.00 0.00 ? 19  GLU A CD   5  
ATOM 9144  O OE1  . GLU A 1 19  ? 11.645  -6.425  7.531   1.00 0.00 ? 19  GLU A OE1  5  
ATOM 9145  O OE2  . GLU A 1 19  ? 10.747  -4.429  7.332   1.00 0.00 ? 19  GLU A OE2  5  
ATOM 9146  H H    . GLU A 1 19  ? 8.683   -10.039 6.602   1.00 0.00 ? 19  GLU A H    5  
ATOM 9147  H HA   . GLU A 1 19  ? 8.034   -7.539  5.747   1.00 0.00 ? 19  GLU A HA   5  
ATOM 9148  H HB2  . GLU A 1 19  ? 8.406   -8.151  8.107   1.00 0.00 ? 19  GLU A HB2  5  
ATOM 9149  H HB3  . GLU A 1 19  ? 10.140  -8.187  7.817   1.00 0.00 ? 19  GLU A HB3  5  
ATOM 9150  H HG2  . GLU A 1 19  ? 8.559   -5.713  7.258   1.00 0.00 ? 19  GLU A HG2  5  
ATOM 9151  H HG3  . GLU A 1 19  ? 9.081   -6.100  8.897   1.00 0.00 ? 19  GLU A HG3  5  
ATOM 9152  N N    . ALA A 1 20  ? 11.224  -8.155  5.198   1.00 0.00 ? 20  ALA A N    5  
ATOM 9153  C CA   . ALA A 1 20  ? 12.389  -7.727  4.432   1.00 0.00 ? 20  ALA A CA   5  
ATOM 9154  C C    . ALA A 1 20  ? 12.102  -7.756  2.934   1.00 0.00 ? 20  ALA A C    5  
ATOM 9155  O O    . ALA A 1 20  ? 12.581  -6.905  2.185   1.00 0.00 ? 20  ALA A O    5  
ATOM 9156  C CB   . ALA A 1 20  ? 13.587  -8.604  4.759   1.00 0.00 ? 20  ALA A CB   5  
ATOM 9157  H H    . ALA A 1 20  ? 11.274  -8.981  5.721   1.00 0.00 ? 20  ALA A H    5  
ATOM 9158  H HA   . ALA A 1 20  ? 12.625  -6.713  4.723   1.00 0.00 ? 20  ALA A HA   5  
ATOM 9159  H HB1  . ALA A 1 20  ? 14.470  -8.200  4.284   1.00 0.00 ? 20  ALA A HB1  5  
ATOM 9160  H HB2  . ALA A 1 20  ? 13.734  -8.630  5.829   1.00 0.00 ? 20  ALA A HB2  5  
ATOM 9161  H HB3  . ALA A 1 20  ? 13.410  -9.606  4.396   1.00 0.00 ? 20  ALA A HB3  5  
ATOM 9162  N N    . GLU A 1 21  ? 11.319  -8.741  2.506   1.00 0.00 ? 21  GLU A N    5  
ATOM 9163  C CA   . GLU A 1 21  ? 10.971  -8.880  1.098   1.00 0.00 ? 21  GLU A CA   5  
ATOM 9164  C C    . GLU A 1 21  ? 10.215  -7.651  0.599   1.00 0.00 ? 21  GLU A C    5  
ATOM 9165  O O    . GLU A 1 21  ? 10.404  -7.212  -0.536  1.00 0.00 ? 21  GLU A O    5  
ATOM 9166  C CB   . GLU A 1 21  ? 10.123  -10.135 0.880   1.00 0.00 ? 21  GLU A CB   5  
ATOM 9167  C CG   . GLU A 1 21  ? 10.841  -11.425 1.242   1.00 0.00 ? 21  GLU A CG   5  
ATOM 9168  C CD   . GLU A 1 21  ? 10.361  -12.609 0.425   1.00 0.00 ? 21  GLU A CD   5  
ATOM 9169  O OE1  . GLU A 1 21  ? 9.236   -13.089 0.681   1.00 0.00 ? 21  GLU A OE1  5  
ATOM 9170  O OE2  . GLU A 1 21  ? 11.109  -13.056 -0.469  1.00 0.00 ? 21  GLU A OE2  5  
ATOM 9171  H H    . GLU A 1 21  ? 10.968  -9.388  3.152   1.00 0.00 ? 21  GLU A H    5  
ATOM 9172  H HA   . GLU A 1 21  ? 11.888  -8.975  0.536   1.00 0.00 ? 21  GLU A HA   5  
ATOM 9173  H HB2  . GLU A 1 21  ? 9.232   -10.062 1.485   1.00 0.00 ? 21  GLU A HB2  5  
ATOM 9174  H HB3  . GLU A 1 21  ? 9.837   -10.188 -0.160  1.00 0.00 ? 21  GLU A HB3  5  
ATOM 9175  H HG2  . GLU A 1 21  ? 11.900  -11.294 1.069   1.00 0.00 ? 21  GLU A HG2  5  
ATOM 9176  H HG3  . GLU A 1 21  ? 10.673  -11.635 2.287   1.00 0.00 ? 21  GLU A HG3  5  
ATOM 9177  N N    . LEU A 1 22  ? 9.361   -7.103  1.455   1.00 0.00 ? 22  LEU A N    5  
ATOM 9178  C CA   . LEU A 1 22  ? 8.576   -5.924  1.102   1.00 0.00 ? 22  LEU A CA   5  
ATOM 9179  C C    . LEU A 1 22  ? 9.477   -4.710  0.902   1.00 0.00 ? 22  LEU A C    5  
ATOM 9180  O O    . LEU A 1 22  ? 9.599   -4.192  -0.208  1.00 0.00 ? 22  LEU A O    5  
ATOM 9181  C CB   . LEU A 1 22  ? 7.542   -5.632  2.191   1.00 0.00 ? 22  LEU A CB   5  
ATOM 9182  C CG   . LEU A 1 22  ? 6.427   -6.667  2.353   1.00 0.00 ? 22  LEU A CG   5  
ATOM 9183  C CD1  . LEU A 1 22  ? 5.588   -6.358  3.583   1.00 0.00 ? 22  LEU A CD1  5  
ATOM 9184  C CD2  . LEU A 1 22  ? 5.555   -6.709  1.106   1.00 0.00 ? 22  LEU A CD2  5  
ATOM 9185  H H    . LEU A 1 22  ? 9.255   -7.498  2.344   1.00 0.00 ? 22  LEU A H    5  
ATOM 9186  H HA   . LEU A 1 22  ? 8.063   -6.133  0.176   1.00 0.00 ? 22  LEU A HA   5  
ATOM 9187  H HB2  . LEU A 1 22  ? 8.064   -5.560  3.133   1.00 0.00 ? 22  LEU A HB2  5  
ATOM 9188  H HB3  . LEU A 1 22  ? 7.082   -4.681  1.963   1.00 0.00 ? 22  LEU A HB3  5  
ATOM 9189  H HG   . LEU A 1 22  ? 6.868   -7.645  2.487   1.00 0.00 ? 22  LEU A HG   5  
ATOM 9190  H HD11 . LEU A 1 22  ? 5.829   -5.371  3.944   1.00 0.00 ? 22  LEU A HD11 5  
ATOM 9191  H HD12 . LEU A 1 22  ? 5.797   -7.085  4.353   1.00 0.00 ? 22  LEU A HD12 5  
ATOM 9192  H HD13 . LEU A 1 22  ? 4.540   -6.402  3.323   1.00 0.00 ? 22  LEU A HD13 5  
ATOM 9193  H HD21 . LEU A 1 22  ? 5.014   -5.779  1.014   1.00 0.00 ? 22  LEU A HD21 5  
ATOM 9194  H HD22 . LEU A 1 22  ? 4.853   -7.528  1.186   1.00 0.00 ? 22  LEU A HD22 5  
ATOM 9195  H HD23 . LEU A 1 22  ? 6.177   -6.852  0.236   1.00 0.00 ? 22  LEU A HD23 5  
ATOM 9196  N N    . ARG A 1 23  ? 10.107  -4.263  1.982   1.00 0.00 ? 23  ARG A N    5  
ATOM 9197  C CA   . ARG A 1 23  ? 10.999  -3.110  1.925   1.00 0.00 ? 23  ARG A CA   5  
ATOM 9198  C C    . ARG A 1 23  ? 11.982  -3.240  0.766   1.00 0.00 ? 23  ARG A C    5  
ATOM 9199  O O    . ARG A 1 23  ? 12.314  -2.256  0.104   1.00 0.00 ? 23  ARG A O    5  
ATOM 9200  C CB   . ARG A 1 23  ? 11.763  -2.963  3.242   1.00 0.00 ? 23  ARG A CB   5  
ATOM 9201  C CG   . ARG A 1 23  ? 12.642  -4.158  3.573   1.00 0.00 ? 23  ARG A CG   5  
ATOM 9202  C CD   . ARG A 1 23  ? 13.373  -3.964  4.892   1.00 0.00 ? 23  ARG A CD   5  
ATOM 9203  N NE   . ARG A 1 23  ? 14.446  -2.980  4.784   1.00 0.00 ? 23  ARG A NE   5  
ATOM 9204  C CZ   . ARG A 1 23  ? 14.907  -2.277  5.813   1.00 0.00 ? 23  ARG A CZ   5  
ATOM 9205  N NH1  . ARG A 1 23  ? 14.389  -2.450  7.022   1.00 0.00 ? 23  ARG A NH1  5  
ATOM 9206  N NH2  . ARG A 1 23  ? 15.886  -1.400  5.635   1.00 0.00 ? 23  ARG A NH2  5  
ATOM 9207  H H    . ARG A 1 23  ? 9.970   -4.719  2.840   1.00 0.00 ? 23  ARG A H    5  
ATOM 9208  H HA   . ARG A 1 23  ? 10.393  -2.230  1.771   1.00 0.00 ? 23  ARG A HA   5  
ATOM 9209  H HB2  . ARG A 1 23  ? 12.392  -2.086  3.185   1.00 0.00 ? 23  ARG A HB2  5  
ATOM 9210  H HB3  . ARG A 1 23  ? 11.052  -2.834  4.045   1.00 0.00 ? 23  ARG A HB3  5  
ATOM 9211  H HG2  . ARG A 1 23  ? 12.023  -5.040  3.643   1.00 0.00 ? 23  ARG A HG2  5  
ATOM 9212  H HG3  . ARG A 1 23  ? 13.369  -4.287  2.784   1.00 0.00 ? 23  ARG A HG3  5  
ATOM 9213  H HD2  . ARG A 1 23  ? 12.665  -3.629  5.635   1.00 0.00 ? 23  ARG A HD2  5  
ATOM 9214  H HD3  . ARG A 1 23  ? 13.794  -4.910  5.197   1.00 0.00 ? 23  ARG A HD3  5  
ATOM 9215  H HE   . ARG A 1 23  ? 14.843  -2.836  3.899   1.00 0.00 ? 23  ARG A HE   5  
ATOM 9216  H HH11 . ARG A 1 23  ? 13.652  -3.111  7.159   1.00 0.00 ? 23  ARG A HH11 5  
ATOM 9217  H HH12 . ARG A 1 23  ? 14.738  -1.920  7.796   1.00 0.00 ? 23  ARG A HH12 5  
ATOM 9218  H HH21 . ARG A 1 23  ? 16.278  -1.267  4.725   1.00 0.00 ? 23  ARG A HH21 5  
ATOM 9219  H HH22 . ARG A 1 23  ? 16.230  -0.872  6.410   1.00 0.00 ? 23  ARG A HH22 5  
ATOM 9220  N N    . THR A 1 24  ? 12.446  -4.462  0.525   1.00 0.00 ? 24  THR A N    5  
ATOM 9221  C CA   . THR A 1 24  ? 13.393  -4.722  -0.553  1.00 0.00 ? 24  THR A CA   5  
ATOM 9222  C C    . THR A 1 24  ? 12.719  -4.607  -1.915  1.00 0.00 ? 24  THR A C    5  
ATOM 9223  O O    . THR A 1 24  ? 13.360  -4.256  -2.907  1.00 0.00 ? 24  THR A O    5  
ATOM 9224  C CB   . THR A 1 24  ? 14.024  -6.120  -0.421  1.00 0.00 ? 24  THR A CB   5  
ATOM 9225  O OG1  . THR A 1 24  ? 14.660  -6.253  0.855   1.00 0.00 ? 24  THR A OG1  5  
ATOM 9226  C CG2  . THR A 1 24  ? 15.040  -6.362  -1.527  1.00 0.00 ? 24  THR A CG2  5  
ATOM 9227  H H    . THR A 1 24  ? 12.145  -5.206  1.087   1.00 0.00 ? 24  THR A H    5  
ATOM 9228  H HA   . THR A 1 24  ? 14.181  -3.986  -0.488  1.00 0.00 ? 24  THR A HA   5  
ATOM 9229  H HB   . THR A 1 24  ? 13.241  -6.861  -0.504  1.00 0.00 ? 24  THR A HB   5  
ATOM 9230  H HG1  . THR A 1 24  ? 15.600  -6.078  0.765   1.00 0.00 ? 24  THR A HG1  5  
ATOM 9231  H HG21 . THR A 1 24  ? 15.495  -5.423  -1.810  1.00 0.00 ? 24  THR A HG21 5  
ATOM 9232  H HG22 . THR A 1 24  ? 14.546  -6.795  -2.383  1.00 0.00 ? 24  THR A HG22 5  
ATOM 9233  H HG23 . THR A 1 24  ? 15.804  -7.037  -1.173  1.00 0.00 ? 24  THR A HG23 5  
ATOM 9234  N N    . TRP A 1 25  ? 11.425  -4.902  -1.957  1.00 0.00 ? 25  TRP A N    5  
ATOM 9235  C CA   . TRP A 1 25  ? 10.665  -4.831  -3.200  1.00 0.00 ? 25  TRP A CA   5  
ATOM 9236  C C    . TRP A 1 25  ? 10.136  -3.420  -3.434  1.00 0.00 ? 25  TRP A C    5  
ATOM 9237  O O    . TRP A 1 25  ? 9.883   -3.023  -4.572  1.00 0.00 ? 25  TRP A O    5  
ATOM 9238  C CB   . TRP A 1 25  ? 9.504   -5.826  -3.169  1.00 0.00 ? 25  TRP A CB   5  
ATOM 9239  C CG   . TRP A 1 25  ? 8.392   -5.469  -4.108  1.00 0.00 ? 25  TRP A CG   5  
ATOM 9240  C CD1  . TRP A 1 25  ? 8.380   -5.628  -5.464  1.00 0.00 ? 25  TRP A CD1  5  
ATOM 9241  C CD2  . TRP A 1 25  ? 7.128   -4.892  -3.759  1.00 0.00 ? 25  TRP A CD2  5  
ATOM 9242  N NE1  . TRP A 1 25  ? 7.186   -5.183  -5.980  1.00 0.00 ? 25  TRP A NE1  5  
ATOM 9243  C CE2  . TRP A 1 25  ? 6.401   -4.729  -4.954  1.00 0.00 ? 25  TRP A CE2  5  
ATOM 9244  C CE3  . TRP A 1 25  ? 6.540   -4.499  -2.554  1.00 0.00 ? 25  TRP A CE3  5  
ATOM 9245  C CZ2  . TRP A 1 25  ? 5.118   -4.189  -4.976  1.00 0.00 ? 25  TRP A CZ2  5  
ATOM 9246  C CZ3  . TRP A 1 25  ? 5.266   -3.963  -2.577  1.00 0.00 ? 25  TRP A CZ3  5  
ATOM 9247  C CH2  . TRP A 1 25  ? 4.566   -3.813  -3.781  1.00 0.00 ? 25  TRP A CH2  5  
ATOM 9248  H H    . TRP A 1 25  ? 10.970  -5.175  -1.133  1.00 0.00 ? 25  TRP A H    5  
ATOM 9249  H HA   . TRP A 1 25  ? 11.331  -5.092  -4.010  1.00 0.00 ? 25  TRP A HA   5  
ATOM 9250  H HB2  . TRP A 1 25  ? 9.870   -6.804  -3.442  1.00 0.00 ? 25  TRP A HB2  5  
ATOM 9251  H HB3  . TRP A 1 25  ? 9.098   -5.863  -2.169  1.00 0.00 ? 25  TRP A HB3  5  
ATOM 9252  H HD1  . TRP A 1 25  ? 9.198   -6.041  -6.034  1.00 0.00 ? 25  TRP A HD1  5  
ATOM 9253  H HE1  . TRP A 1 25  ? 6.938   -5.194  -6.928  1.00 0.00 ? 25  TRP A HE1  5  
ATOM 9254  H HE3  . TRP A 1 25  ? 7.064   -4.608  -1.615  1.00 0.00 ? 25  TRP A HE3  5  
ATOM 9255  H HZ2  . TRP A 1 25  ? 4.565   -4.067  -5.896  1.00 0.00 ? 25  TRP A HZ2  5  
ATOM 9256  H HZ3  . TRP A 1 25  ? 4.796   -3.654  -1.656  1.00 0.00 ? 25  TRP A HZ3  5  
ATOM 9257  H HH2  . TRP A 1 25  ? 3.575   -3.390  -3.753  1.00 0.00 ? 25  TRP A HH2  5  
ATOM 9258  N N    . ILE A 1 26  ? 9.971   -2.667  -2.351  1.00 0.00 ? 26  ILE A N    5  
ATOM 9259  C CA   . ILE A 1 26  ? 9.473   -1.301  -2.441  1.00 0.00 ? 26  ILE A CA   5  
ATOM 9260  C C    . ILE A 1 26  ? 10.613  -0.313  -2.661  1.00 0.00 ? 26  ILE A C    5  
ATOM 9261  O O    . ILE A 1 26  ? 10.507  0.601   -3.478  1.00 0.00 ? 26  ILE A O    5  
ATOM 9262  C CB   . ILE A 1 26  ? 8.700   -0.899  -1.170  1.00 0.00 ? 26  ILE A CB   5  
ATOM 9263  C CG1  . ILE A 1 26  ? 7.567   -1.891  -0.902  1.00 0.00 ? 26  ILE A CG1  5  
ATOM 9264  C CG2  . ILE A 1 26  ? 8.152   0.514   -1.308  1.00 0.00 ? 26  ILE A CG2  5  
ATOM 9265  C CD1  . ILE A 1 26  ? 6.872   -1.672  0.424   1.00 0.00 ? 26  ILE A CD1  5  
ATOM 9266  H H    . ILE A 1 26  ? 10.190  -3.040  -1.472  1.00 0.00 ? 26  ILE A H    5  
ATOM 9267  H HA   . ILE A 1 26  ? 8.797   -1.247  -3.282  1.00 0.00 ? 26  ILE A HA   5  
ATOM 9268  H HB   . ILE A 1 26  ? 9.387   -0.914  -0.339  1.00 0.00 ? 26  ILE A HB   5  
ATOM 9269  H HG12 . ILE A 1 26  ? 6.826   -1.803  -1.681  1.00 0.00 ? 26  ILE A HG12 5  
ATOM 9270  H HG13 . ILE A 1 26  ? 7.969   -2.895  -0.906  1.00 0.00 ? 26  ILE A HG13 5  
ATOM 9271  H HG21 . ILE A 1 26  ? 8.305   1.051   -0.384  1.00 0.00 ? 26  ILE A HG21 5  
ATOM 9272  H HG22 . ILE A 1 26  ? 8.669   1.023   -2.108  1.00 0.00 ? 26  ILE A HG22 5  
ATOM 9273  H HG23 . ILE A 1 26  ? 7.097   0.471   -1.530  1.00 0.00 ? 26  ILE A HG23 5  
ATOM 9274  H HD11 . ILE A 1 26  ? 7.505   -2.027  1.224   1.00 0.00 ? 26  ILE A HD11 5  
ATOM 9275  H HD12 . ILE A 1 26  ? 6.676   -0.619  0.558   1.00 0.00 ? 26  ILE A HD12 5  
ATOM 9276  H HD13 . ILE A 1 26  ? 5.939   -2.217  0.436   1.00 0.00 ? 26  ILE A HD13 5  
ATOM 9277  N N    . GLU A 1 27  ? 11.706  -0.505  -1.927  1.00 0.00 ? 27  GLU A N    5  
ATOM 9278  C CA   . GLU A 1 27  ? 12.868  0.369   -2.044  1.00 0.00 ? 27  GLU A CA   5  
ATOM 9279  C C    . GLU A 1 27  ? 13.382  0.402   -3.480  1.00 0.00 ? 27  GLU A C    5  
ATOM 9280  O O    . GLU A 1 27  ? 13.823  1.441   -3.970  1.00 0.00 ? 27  GLU A O    5  
ATOM 9281  C CB   . GLU A 1 27  ? 13.980  -0.097  -1.104  1.00 0.00 ? 27  GLU A CB   5  
ATOM 9282  C CG   . GLU A 1 27  ? 13.772  0.323   0.342   1.00 0.00 ? 27  GLU A CG   5  
ATOM 9283  C CD   . GLU A 1 27  ? 14.711  -0.386  1.298   1.00 0.00 ? 27  GLU A CD   5  
ATOM 9284  O OE1  . GLU A 1 27  ? 15.788  -0.834  0.848   1.00 0.00 ? 27  GLU A OE1  5  
ATOM 9285  O OE2  . GLU A 1 27  ? 14.371  -0.495  2.494   1.00 0.00 ? 27  GLU A OE2  5  
ATOM 9286  H H    . GLU A 1 27  ? 11.731  -1.252  -1.293  1.00 0.00 ? 27  GLU A H    5  
ATOM 9287  H HA   . GLU A 1 27  ? 12.563  1.365   -1.761  1.00 0.00 ? 27  GLU A HA   5  
ATOM 9288  H HB2  . GLU A 1 27  ? 14.038  -1.175  -1.138  1.00 0.00 ? 27  GLU A HB2  5  
ATOM 9289  H HB3  . GLU A 1 27  ? 14.918  0.315   -1.444  1.00 0.00 ? 27  GLU A HB3  5  
ATOM 9290  H HG2  . GLU A 1 27  ? 13.938  1.388   0.422   1.00 0.00 ? 27  GLU A HG2  5  
ATOM 9291  H HG3  . GLU A 1 27  ? 12.754  0.098   0.626   1.00 0.00 ? 27  GLU A HG3  5  
ATOM 9292  N N    . GLY A 1 28  ? 13.320  -0.744  -4.152  1.00 0.00 ? 28  GLY A N    5  
ATOM 9293  C CA   . GLY A 1 28  ? 13.782  -0.826  -5.525  1.00 0.00 ? 28  GLY A CA   5  
ATOM 9294  C C    . GLY A 1 28  ? 12.811  -0.194  -6.502  1.00 0.00 ? 28  GLY A C    5  
ATOM 9295  O O    . GLY A 1 28  ? 13.217  0.343   -7.533  1.00 0.00 ? 28  GLY A O    5  
ATOM 9296  H H    . GLY A 1 28  ? 12.958  -1.541  -3.710  1.00 0.00 ? 28  GLY A H    5  
ATOM 9297  H HA2  . GLY A 1 28  ? 14.734  -0.322  -5.603  1.00 0.00 ? 28  GLY A HA2  5  
ATOM 9298  H HA3  . GLY A 1 28  ? 13.914  -1.865  -5.787  1.00 0.00 ? 28  GLY A HA3  5  
ATOM 9299  N N    . LEU A 1 29  ? 11.523  -0.260  -6.180  1.00 0.00 ? 29  LEU A N    5  
ATOM 9300  C CA   . LEU A 1 29  ? 10.491  0.308   -7.039  1.00 0.00 ? 29  LEU A CA   5  
ATOM 9301  C C    . LEU A 1 29  ? 10.600  1.829   -7.089  1.00 0.00 ? 29  LEU A C    5  
ATOM 9302  O O    . LEU A 1 29  ? 10.866  2.409   -8.144  1.00 0.00 ? 29  LEU A O    5  
ATOM 9303  C CB   . LEU A 1 29  ? 9.103   -0.097  -6.538  1.00 0.00 ? 29  LEU A CB   5  
ATOM 9304  C CG   . LEU A 1 29  ? 8.525   -1.382  -7.132  1.00 0.00 ? 29  LEU A CG   5  
ATOM 9305  C CD1  . LEU A 1 29  ? 7.483   -1.980  -6.198  1.00 0.00 ? 29  LEU A CD1  5  
ATOM 9306  C CD2  . LEU A 1 29  ? 7.922   -1.111  -8.503  1.00 0.00 ? 29  LEU A CD2  5  
ATOM 9307  H H    . LEU A 1 29  ? 11.261  -0.701  -5.345  1.00 0.00 ? 29  LEU A H    5  
ATOM 9308  H HA   . LEU A 1 29  ? 10.634  -0.084  -8.034  1.00 0.00 ? 29  LEU A HA   5  
ATOM 9309  H HB2  . LEU A 1 29  ? 9.163   -0.226  -5.468  1.00 0.00 ? 29  LEU A HB2  5  
ATOM 9310  H HB3  . LEU A 1 29  ? 8.421   0.710   -6.766  1.00 0.00 ? 29  LEU A HB3  5  
ATOM 9311  H HG   . LEU A 1 29  ? 9.319   -2.106  -7.252  1.00 0.00 ? 29  LEU A HG   5  
ATOM 9312  H HD11 . LEU A 1 29  ? 6.587   -1.379  -6.226  1.00 0.00 ? 29  LEU A HD11 5  
ATOM 9313  H HD12 . LEU A 1 29  ? 7.873   -1.999  -5.191  1.00 0.00 ? 29  LEU A HD12 5  
ATOM 9314  H HD13 . LEU A 1 29  ? 7.253   -2.987  -6.514  1.00 0.00 ? 29  LEU A HD13 5  
ATOM 9315  H HD21 . LEU A 1 29  ? 8.641   -1.365  -9.268  1.00 0.00 ? 29  LEU A HD21 5  
ATOM 9316  H HD22 . LEU A 1 29  ? 7.665   -0.065  -8.583  1.00 0.00 ? 29  LEU A HD22 5  
ATOM 9317  H HD23 . LEU A 1 29  ? 7.034   -1.712  -8.629  1.00 0.00 ? 29  LEU A HD23 5  
ATOM 9318  N N    . THR A 1 30  ? 10.397  2.471   -5.943  1.00 0.00 ? 30  THR A N    5  
ATOM 9319  C CA   . THR A 1 30  ? 10.475  3.923   -5.856  1.00 0.00 ? 30  THR A CA   5  
ATOM 9320  C C    . THR A 1 30  ? 11.923  4.396   -5.839  1.00 0.00 ? 30  THR A C    5  
ATOM 9321  O O    . THR A 1 30  ? 12.236  5.489   -6.310  1.00 0.00 ? 30  THR A O    5  
ATOM 9322  C CB   . THR A 1 30  ? 9.759   4.450   -4.598  1.00 0.00 ? 30  THR A CB   5  
ATOM 9323  O OG1  . THR A 1 30  ? 10.534  4.148   -3.432  1.00 0.00 ? 30  THR A OG1  5  
ATOM 9324  C CG2  . THR A 1 30  ? 8.374   3.834   -4.466  1.00 0.00 ? 30  THR A CG2  5  
ATOM 9325  H H    . THR A 1 30  ? 10.190  1.954   -5.137  1.00 0.00 ? 30  THR A H    5  
ATOM 9326  H HA   . THR A 1 30  ? 9.981   4.336   -6.724  1.00 0.00 ? 30  THR A HA   5  
ATOM 9327  H HB   . THR A 1 30  ? 9.654   5.521   -4.684  1.00 0.00 ? 30  THR A HB   5  
ATOM 9328  H HG1  . THR A 1 30  ? 10.336  3.255   -3.138  1.00 0.00 ? 30  THR A HG1  5  
ATOM 9329  H HG21 . THR A 1 30  ? 7.701   4.554   -4.023  1.00 0.00 ? 30  THR A HG21 5  
ATOM 9330  H HG22 . THR A 1 30  ? 8.428   2.958   -3.838  1.00 0.00 ? 30  THR A HG22 5  
ATOM 9331  H HG23 . THR A 1 30  ? 8.010   3.557   -5.443  1.00 0.00 ? 30  THR A HG23 5  
ATOM 9332  N N    . GLY A 1 31  ? 12.806  3.567   -5.291  1.00 0.00 ? 31  GLY A N    5  
ATOM 9333  C CA   . GLY A 1 31  ? 14.212  3.918   -5.223  1.00 0.00 ? 31  GLY A CA   5  
ATOM 9334  C C    . GLY A 1 31  ? 14.534  4.793   -4.028  1.00 0.00 ? 31  GLY A C    5  
ATOM 9335  O O    . GLY A 1 31  ? 15.579  5.443   -3.988  1.00 0.00 ? 31  GLY A O    5  
ATOM 9336  H H    . GLY A 1 31  ? 12.500  2.708   -4.931  1.00 0.00 ? 31  GLY A H    5  
ATOM 9337  H HA2  . GLY A 1 31  ? 14.797  3.012   -5.161  1.00 0.00 ? 31  GLY A HA2  5  
ATOM 9338  H HA3  . GLY A 1 31  ? 14.483  4.447   -6.125  1.00 0.00 ? 31  GLY A HA3  5  
ATOM 9339  N N    . LEU A 1 32  ? 13.634  4.811   -3.051  1.00 0.00 ? 32  LEU A N    5  
ATOM 9340  C CA   . LEU A 1 32  ? 13.825  5.615   -1.849  1.00 0.00 ? 32  LEU A CA   5  
ATOM 9341  C C    . LEU A 1 32  ? 14.332  4.755   -0.695  1.00 0.00 ? 32  LEU A C    5  
ATOM 9342  O O    . LEU A 1 32  ? 14.589  3.564   -0.862  1.00 0.00 ? 32  LEU A O    5  
ATOM 9343  C CB   . LEU A 1 32  ? 12.515  6.299   -1.453  1.00 0.00 ? 32  LEU A CB   5  
ATOM 9344  C CG   . LEU A 1 32  ? 11.943  7.289   -2.468  1.00 0.00 ? 32  LEU A CG   5  
ATOM 9345  C CD1  . LEU A 1 32  ? 10.487  7.596   -2.152  1.00 0.00 ? 32  LEU A CD1  5  
ATOM 9346  C CD2  . LEU A 1 32  ? 12.767  8.568   -2.488  1.00 0.00 ? 32  LEU A CD2  5  
ATOM 9347  H H    . LEU A 1 32  ? 12.821  4.273   -3.140  1.00 0.00 ? 32  LEU A H    5  
ATOM 9348  H HA   . LEU A 1 32  ? 14.564  6.371   -2.070  1.00 0.00 ? 32  LEU A HA   5  
ATOM 9349  H HB2  . LEU A 1 32  ? 11.777  5.529   -1.291  1.00 0.00 ? 32  LEU A HB2  5  
ATOM 9350  H HB3  . LEU A 1 32  ? 12.687  6.832   -0.530  1.00 0.00 ? 32  LEU A HB3  5  
ATOM 9351  H HG   . LEU A 1 32  ? 11.984  6.849   -3.454  1.00 0.00 ? 32  LEU A HG   5  
ATOM 9352  H HD11 . LEU A 1 32  ? 9.854   7.148   -2.902  1.00 0.00 ? 32  LEU A HD11 5  
ATOM 9353  H HD12 . LEU A 1 32  ? 10.338  8.665   -2.146  1.00 0.00 ? 32  LEU A HD12 5  
ATOM 9354  H HD13 . LEU A 1 32  ? 10.237  7.192   -1.181  1.00 0.00 ? 32  LEU A HD13 5  
ATOM 9355  H HD21 . LEU A 1 32  ? 13.081  8.810   -1.483  1.00 0.00 ? 32  LEU A HD21 5  
ATOM 9356  H HD22 . LEU A 1 32  ? 12.168  9.376   -2.882  1.00 0.00 ? 32  LEU A HD22 5  
ATOM 9357  H HD23 . LEU A 1 32  ? 13.636  8.427   -3.114  1.00 0.00 ? 32  LEU A HD23 5  
ATOM 9358  N N    . SER A 1 33  ? 14.473  5.369   0.476   1.00 0.00 ? 33  SER A N    5  
ATOM 9359  C CA   . SER A 1 33  ? 14.949  4.660   1.658   1.00 0.00 ? 33  SER A CA   5  
ATOM 9360  C C    . SER A 1 33  ? 13.949  4.781   2.804   1.00 0.00 ? 33  SER A C    5  
ATOM 9361  O O    . SER A 1 33  ? 13.488  5.876   3.128   1.00 0.00 ? 33  SER A O    5  
ATOM 9362  C CB   . SER A 1 33  ? 16.310  5.210   2.093   1.00 0.00 ? 33  SER A CB   5  
ATOM 9363  O OG   . SER A 1 33  ? 16.701  4.668   3.343   1.00 0.00 ? 33  SER A OG   5  
ATOM 9364  H H    . SER A 1 33  ? 14.251  6.322   0.546   1.00 0.00 ? 33  SER A H    5  
ATOM 9365  H HA   . SER A 1 33  ? 15.058  3.619   1.399   1.00 0.00 ? 33  SER A HA   5  
ATOM 9366  H HB2  . SER A 1 33  ? 17.052  4.952   1.354   1.00 0.00 ? 33  SER A HB2  5  
ATOM 9367  H HB3  . SER A 1 33  ? 16.248  6.285   2.183   1.00 0.00 ? 33  SER A HB3  5  
ATOM 9368  H HG   . SER A 1 33  ? 17.660  4.623   3.385   1.00 0.00 ? 33  SER A HG   5  
ATOM 9369  N N    . ILE A 1 34  ? 13.618  3.647   3.414   1.00 0.00 ? 34  ILE A N    5  
ATOM 9370  C CA   . ILE A 1 34  ? 12.675  3.625   4.523   1.00 0.00 ? 34  ILE A CA   5  
ATOM 9371  C C    . ILE A 1 34  ? 13.333  4.097   5.815   1.00 0.00 ? 34  ILE A C    5  
ATOM 9372  O O    . ILE A 1 34  ? 12.737  4.839   6.594   1.00 0.00 ? 34  ILE A O    5  
ATOM 9373  C CB   . ILE A 1 34  ? 12.096  2.215   4.742   1.00 0.00 ? 34  ILE A CB   5  
ATOM 9374  C CG1  . ILE A 1 34  ? 11.490  1.681   3.442   1.00 0.00 ? 34  ILE A CG1  5  
ATOM 9375  C CG2  . ILE A 1 34  ? 11.052  2.236   5.849   1.00 0.00 ? 34  ILE A CG2  5  
ATOM 9376  C CD1  . ILE A 1 34  ? 11.450  0.171   3.370   1.00 0.00 ? 34  ILE A CD1  5  
ATOM 9377  H H    . ILE A 1 34  ? 14.019  2.807   3.110   1.00 0.00 ? 34  ILE A H    5  
ATOM 9378  H HA   . ILE A 1 34  ? 11.860  4.293   4.282   1.00 0.00 ? 34  ILE A HA   5  
ATOM 9379  H HB   . ILE A 1 34  ? 12.900  1.564   5.051   1.00 0.00 ? 34  ILE A HB   5  
ATOM 9380  H HG12 . ILE A 1 34  ? 10.480  2.044   3.348   1.00 0.00 ? 34  ILE A HG12 5  
ATOM 9381  H HG13 . ILE A 1 34  ? 12.076  2.039   2.608   1.00 0.00 ? 34  ILE A HG13 5  
ATOM 9382  H HG21 . ILE A 1 34  ? 10.500  1.308   5.841   1.00 0.00 ? 34  ILE A HG21 5  
ATOM 9383  H HG22 . ILE A 1 34  ? 11.543  2.353   6.804   1.00 0.00 ? 34  ILE A HG22 5  
ATOM 9384  H HG23 . ILE A 1 34  ? 10.374  3.060   5.689   1.00 0.00 ? 34  ILE A HG23 5  
ATOM 9385  H HD11 . ILE A 1 34  ? 12.008  -0.245  4.195   1.00 0.00 ? 34  ILE A HD11 5  
ATOM 9386  H HD12 . ILE A 1 34  ? 10.425  -0.165  3.420   1.00 0.00 ? 34  ILE A HD12 5  
ATOM 9387  H HD13 . ILE A 1 34  ? 11.891  -0.156  2.438   1.00 0.00 ? 34  ILE A HD13 5  
ATOM 9388  N N    . GLY A 1 35  ? 14.571  3.663   6.035   1.00 0.00 ? 35  GLY A N    5  
ATOM 9389  C CA   . GLY A 1 35  ? 15.292  4.053   7.233   1.00 0.00 ? 35  GLY A CA   5  
ATOM 9390  C C    . GLY A 1 35  ? 15.580  2.877   8.145   1.00 0.00 ? 35  GLY A C    5  
ATOM 9391  O O    . GLY A 1 35  ? 15.286  1.725   7.821   1.00 0.00 ? 35  GLY A O    5  
ATOM 9392  H H    . GLY A 1 35  ? 14.998  3.073   5.379   1.00 0.00 ? 35  GLY A H    5  
ATOM 9393  H HA2  . GLY A 1 35  ? 16.227  4.509   6.945   1.00 0.00 ? 35  GLY A HA2  5  
ATOM 9394  H HA3  . GLY A 1 35  ? 14.702  4.777   7.774   1.00 0.00 ? 35  GLY A HA3  5  
ATOM 9395  N N    . PRO A 1 36  ? 16.168  3.162   9.316   1.00 0.00 ? 36  PRO A N    5  
ATOM 9396  C CA   . PRO A 1 36  ? 16.509  2.131   10.301  1.00 0.00 ? 36  PRO A CA   5  
ATOM 9397  C C    . PRO A 1 36  ? 15.274  1.526   10.958  1.00 0.00 ? 36  PRO A C    5  
ATOM 9398  O O    . PRO A 1 36  ? 15.381  0.633   11.800  1.00 0.00 ? 36  PRO A O    5  
ATOM 9399  C CB   . PRO A 1 36  ? 17.346  2.891   11.334  1.00 0.00 ? 36  PRO A CB   5  
ATOM 9400  C CG   . PRO A 1 36  ? 16.898  4.308   11.216  1.00 0.00 ? 36  PRO A CG   5  
ATOM 9401  C CD   . PRO A 1 36  ? 16.546  4.511   9.768   1.00 0.00 ? 36  PRO A CD   5  
ATOM 9402  H HA   . PRO A 1 36  ? 17.105  1.344   9.863   1.00 0.00 ? 36  PRO A HA   5  
ATOM 9403  H HB2  . PRO A 1 36  ? 17.151  2.495   12.321  1.00 0.00 ? 36  PRO A HB2  5  
ATOM 9404  H HB3  . PRO A 1 36  ? 18.394  2.789   11.100  1.00 0.00 ? 36  PRO A HB3  5  
ATOM 9405  H HG2  . PRO A 1 36  ? 16.032  4.472   11.840  1.00 0.00 ? 36  PRO A HG2  5  
ATOM 9406  H HG3  . PRO A 1 36  ? 17.700  4.971   11.504  1.00 0.00 ? 36  PRO A HG3  5  
ATOM 9407  H HD2  . PRO A 1 36  ? 15.716  5.195   9.675   1.00 0.00 ? 36  PRO A HD2  5  
ATOM 9408  H HD3  . PRO A 1 36  ? 17.402  4.875   9.220   1.00 0.00 ? 36  PRO A HD3  5  
ATOM 9409  N N    . ASP A 1 37  ? 14.102  2.016   10.569  1.00 0.00 ? 37  ASP A N    5  
ATOM 9410  C CA   . ASP A 1 37  ? 12.845  1.521   11.119  1.00 0.00 ? 37  ASP A CA   5  
ATOM 9411  C C    . ASP A 1 37  ? 11.772  1.444   10.038  1.00 0.00 ? 37  ASP A C    5  
ATOM 9412  O O    . ASP A 1 37  ? 11.637  2.353   9.218   1.00 0.00 ? 37  ASP A O    5  
ATOM 9413  C CB   . ASP A 1 37  ? 12.374  2.422   12.261  1.00 0.00 ? 37  ASP A CB   5  
ATOM 9414  C CG   . ASP A 1 37  ? 11.557  1.670   13.294  1.00 0.00 ? 37  ASP A CG   5  
ATOM 9415  O OD1  . ASP A 1 37  ? 10.427  1.253   12.965  1.00 0.00 ? 37  ASP A OD1  5  
ATOM 9416  O OD2  . ASP A 1 37  ? 12.049  1.498   14.429  1.00 0.00 ? 37  ASP A OD2  5  
ATOM 9417  H H    . ASP A 1 37  ? 14.082  2.726   9.895   1.00 0.00 ? 37  ASP A H    5  
ATOM 9418  H HA   . ASP A 1 37  ? 13.020  0.527   11.505  1.00 0.00 ? 37  ASP A HA   5  
ATOM 9419  H HB2  . ASP A 1 37  ? 13.237  2.849   12.753  1.00 0.00 ? 37  ASP A HB2  5  
ATOM 9420  H HB3  . ASP A 1 37  ? 11.765  3.217   11.855  1.00 0.00 ? 37  ASP A HB3  5  
ATOM 9421  N N    . PHE A 1 38  ? 11.011  0.355   10.042  1.00 0.00 ? 38  PHE A N    5  
ATOM 9422  C CA   . PHE A 1 38  ? 9.951   0.159   9.061   1.00 0.00 ? 38  PHE A CA   5  
ATOM 9423  C C    . PHE A 1 38  ? 8.714   0.975   9.427   1.00 0.00 ? 38  PHE A C    5  
ATOM 9424  O O    . PHE A 1 38  ? 8.312   1.875   8.690   1.00 0.00 ? 38  PHE A O    5  
ATOM 9425  C CB   . PHE A 1 38  ? 9.585   -1.324  8.962   1.00 0.00 ? 38  PHE A CB   5  
ATOM 9426  C CG   . PHE A 1 38  ? 8.871   -1.681  7.690   1.00 0.00 ? 38  PHE A CG   5  
ATOM 9427  C CD1  . PHE A 1 38  ? 9.488   -1.510  6.462   1.00 0.00 ? 38  PHE A CD1  5  
ATOM 9428  C CD2  . PHE A 1 38  ? 7.583   -2.189  7.723   1.00 0.00 ? 38  PHE A CD2  5  
ATOM 9429  C CE1  . PHE A 1 38  ? 8.833   -1.838  5.289   1.00 0.00 ? 38  PHE A CE1  5  
ATOM 9430  C CE2  . PHE A 1 38  ? 6.922   -2.519  6.555   1.00 0.00 ? 38  PHE A CE2  5  
ATOM 9431  C CZ   . PHE A 1 38  ? 7.548   -2.345  5.337   1.00 0.00 ? 38  PHE A CZ   5  
ATOM 9432  H H    . PHE A 1 38  ? 11.167  -0.334  10.722  1.00 0.00 ? 38  PHE A H    5  
ATOM 9433  H HA   . PHE A 1 38  ? 10.319  0.496   8.105   1.00 0.00 ? 38  PHE A HA   5  
ATOM 9434  H HB2  . PHE A 1 38  ? 10.489  -1.913  9.012   1.00 0.00 ? 38  PHE A HB2  5  
ATOM 9435  H HB3  . PHE A 1 38  ? 8.944   -1.585  9.789   1.00 0.00 ? 38  PHE A HB3  5  
ATOM 9436  H HD1  . PHE A 1 38  ? 10.494  -1.116  6.423   1.00 0.00 ? 38  PHE A HD1  5  
ATOM 9437  H HD2  . PHE A 1 38  ? 7.092   -2.327  8.677   1.00 0.00 ? 38  PHE A HD2  5  
ATOM 9438  H HE1  . PHE A 1 38  ? 9.325   -1.700  4.339   1.00 0.00 ? 38  PHE A HE1  5  
ATOM 9439  H HE2  . PHE A 1 38  ? 5.918   -2.915  6.596   1.00 0.00 ? 38  PHE A HE2  5  
ATOM 9440  H HZ   . PHE A 1 38  ? 7.035   -2.601  4.423   1.00 0.00 ? 38  PHE A HZ   5  
ATOM 9441  N N    . GLN A 1 39  ? 8.116   0.653   10.569  1.00 0.00 ? 39  GLN A N    5  
ATOM 9442  C CA   . GLN A 1 39  ? 6.924   1.355   11.031  1.00 0.00 ? 39  GLN A CA   5  
ATOM 9443  C C    . GLN A 1 39  ? 7.065   2.859   10.826  1.00 0.00 ? 39  GLN A C    5  
ATOM 9444  O O    . GLN A 1 39  ? 6.155   3.516   10.320  1.00 0.00 ? 39  GLN A O    5  
ATOM 9445  C CB   . GLN A 1 39  ? 6.669   1.051   12.509  1.00 0.00 ? 39  GLN A CB   5  
ATOM 9446  C CG   . GLN A 1 39  ? 5.391   1.674   13.046  1.00 0.00 ? 39  GLN A CG   5  
ATOM 9447  C CD   . GLN A 1 39  ? 5.604   3.073   13.585  1.00 0.00 ? 39  GLN A CD   5  
ATOM 9448  O OE1  . GLN A 1 39  ? 6.325   3.271   14.565  1.00 0.00 ? 39  GLN A OE1  5  
ATOM 9449  N NE2  . GLN A 1 39  ? 4.979   4.056   12.947  1.00 0.00 ? 39  GLN A NE2  5  
ATOM 9450  H H    . GLN A 1 39  ? 8.483   -0.074  11.112  1.00 0.00 ? 39  GLN A H    5  
ATOM 9451  H HA   . GLN A 1 39  ? 6.085   1.001   10.451  1.00 0.00 ? 39  GLN A HA   5  
ATOM 9452  H HB2  . GLN A 1 39  ? 6.607   -0.019  12.638  1.00 0.00 ? 39  GLN A HB2  5  
ATOM 9453  H HB3  . GLN A 1 39  ? 7.498   1.428   13.090  1.00 0.00 ? 39  GLN A HB3  5  
ATOM 9454  H HG2  . GLN A 1 39  ? 4.664   1.719   12.247  1.00 0.00 ? 39  GLN A HG2  5  
ATOM 9455  H HG3  . GLN A 1 39  ? 5.009   1.051   13.842  1.00 0.00 ? 39  GLN A HG3  5  
ATOM 9456  H HE21 . GLN A 1 39  ? 4.420   3.824   12.176  1.00 0.00 ? 39  GLN A HE21 5  
ATOM 9457  H HE22 . GLN A 1 39  ? 5.099   4.971   13.275  1.00 0.00 ? 39  GLN A HE22 5  
ATOM 9458  N N    . LYS A 1 40  ? 8.212   3.401   11.223  1.00 0.00 ? 40  LYS A N    5  
ATOM 9459  C CA   . LYS A 1 40  ? 8.473   4.828   11.083  1.00 0.00 ? 40  LYS A CA   5  
ATOM 9460  C C    . LYS A 1 40  ? 8.706   5.198   9.622   1.00 0.00 ? 40  LYS A C    5  
ATOM 9461  O O    . LYS A 1 40  ? 7.905   5.909   9.015   1.00 0.00 ? 40  LYS A O    5  
ATOM 9462  C CB   . LYS A 1 40  ? 9.690   5.230   11.921  1.00 0.00 ? 40  LYS A CB   5  
ATOM 9463  C CG   . LYS A 1 40  ? 9.588   4.813   13.378  1.00 0.00 ? 40  LYS A CG   5  
ATOM 9464  C CD   . LYS A 1 40  ? 10.336  5.774   14.287  1.00 0.00 ? 40  LYS A CD   5  
ATOM 9465  C CE   . LYS A 1 40  ? 9.602   7.099   14.421  1.00 0.00 ? 40  LYS A CE   5  
ATOM 9466  N NZ   . LYS A 1 40  ? 8.528   7.037   15.450  1.00 0.00 ? 40  LYS A NZ   5  
ATOM 9467  H H    . LYS A 1 40  ? 8.899   2.826   11.620  1.00 0.00 ? 40  LYS A H    5  
ATOM 9468  H HA   . LYS A 1 40  ? 7.607   5.362   11.443  1.00 0.00 ? 40  LYS A HA   5  
ATOM 9469  H HB2  . LYS A 1 40  ? 10.571  4.772   11.497  1.00 0.00 ? 40  LYS A HB2  5  
ATOM 9470  H HB3  . LYS A 1 40  ? 9.799   6.304   11.883  1.00 0.00 ? 40  LYS A HB3  5  
ATOM 9471  H HG2  . LYS A 1 40  ? 8.548   4.797   13.668  1.00 0.00 ? 40  LYS A HG2  5  
ATOM 9472  H HG3  . LYS A 1 40  ? 10.010  3.824   13.489  1.00 0.00 ? 40  LYS A HG3  5  
ATOM 9473  H HD2  . LYS A 1 40  ? 10.433  5.329   15.265  1.00 0.00 ? 40  LYS A HD2  5  
ATOM 9474  H HD3  . LYS A 1 40  ? 11.318  5.957   13.873  1.00 0.00 ? 40  LYS A HD3  5  
ATOM 9475  H HE2  . LYS A 1 40  ? 10.312  7.863   14.700  1.00 0.00 ? 40  LYS A HE2  5  
ATOM 9476  H HE3  . LYS A 1 40  ? 9.161   7.349   13.467  1.00 0.00 ? 40  LYS A HE3  5  
ATOM 9477  H HZ1  . LYS A 1 40  ? 7.604   6.895   14.994  1.00 0.00 ? 40  LYS A HZ1  5  
ATOM 9478  H HZ2  . LYS A 1 40  ? 8.502   7.923   15.993  1.00 0.00 ? 40  LYS A HZ2  5  
ATOM 9479  H HZ3  . LYS A 1 40  ? 8.705   6.247   16.103  1.00 0.00 ? 40  LYS A HZ3  5  
ATOM 9480  N N    . GLY A 1 41  ? 9.808   4.708   9.060   1.00 0.00 ? 41  GLY A N    5  
ATOM 9481  C CA   . GLY A 1 41  ? 10.124  4.997   7.673   1.00 0.00 ? 41  GLY A CA   5  
ATOM 9482  C C    . GLY A 1 41  ? 8.885   5.109   6.806   1.00 0.00 ? 41  GLY A C    5  
ATOM 9483  O O    . GLY A 1 41  ? 8.847   5.903   5.865   1.00 0.00 ? 41  GLY A O    5  
ATOM 9484  H H    . GLY A 1 41  ? 10.410  4.147   9.592   1.00 0.00 ? 41  GLY A H    5  
ATOM 9485  H HA2  . GLY A 1 41  ? 10.670  5.927   7.626   1.00 0.00 ? 41  GLY A HA2  5  
ATOM 9486  H HA3  . GLY A 1 41  ? 10.749  4.204   7.287   1.00 0.00 ? 41  GLY A HA3  5  
ATOM 9487  N N    . LEU A 1 42  ? 7.870   4.313   7.123   1.00 0.00 ? 42  LEU A N    5  
ATOM 9488  C CA   . LEU A 1 42  ? 6.623   4.325   6.365   1.00 0.00 ? 42  LEU A CA   5  
ATOM 9489  C C    . LEU A 1 42  ? 5.589   5.225   7.033   1.00 0.00 ? 42  LEU A C    5  
ATOM 9490  O O    . LEU A 1 42  ? 4.822   5.915   6.361   1.00 0.00 ? 42  LEU A O    5  
ATOM 9491  C CB   . LEU A 1 42  ? 6.070   2.906   6.232   1.00 0.00 ? 42  LEU A CB   5  
ATOM 9492  C CG   . LEU A 1 42  ? 7.060   1.844   5.748   1.00 0.00 ? 42  LEU A CG   5  
ATOM 9493  C CD1  . LEU A 1 42  ? 6.415   0.466   5.768   1.00 0.00 ? 42  LEU A CD1  5  
ATOM 9494  C CD2  . LEU A 1 42  ? 7.561   2.179   4.351   1.00 0.00 ? 42  LEU A CD2  5  
ATOM 9495  H H    . LEU A 1 42  ? 7.960   3.703   7.884   1.00 0.00 ? 42  LEU A H    5  
ATOM 9496  H HA   . LEU A 1 42  ? 6.839   4.714   5.381   1.00 0.00 ? 42  LEU A HA   5  
ATOM 9497  H HB2  . LEU A 1 42  ? 5.706   2.600   7.200   1.00 0.00 ? 42  LEU A HB2  5  
ATOM 9498  H HB3  . LEU A 1 42  ? 5.248   2.937   5.532   1.00 0.00 ? 42  LEU A HB3  5  
ATOM 9499  H HG   . LEU A 1 42  ? 7.911   1.823   6.414   1.00 0.00 ? 42  LEU A HG   5  
ATOM 9500  H HD11 . LEU A 1 42  ? 6.439   0.043   4.776   1.00 0.00 ? 42  LEU A HD11 5  
ATOM 9501  H HD12 . LEU A 1 42  ? 5.390   0.553   6.098   1.00 0.00 ? 42  LEU A HD12 5  
ATOM 9502  H HD13 . LEU A 1 42  ? 6.958   -0.175  6.447   1.00 0.00 ? 42  LEU A HD13 5  
ATOM 9503  H HD21 . LEU A 1 42  ? 6.726   2.460   3.727   1.00 0.00 ? 42  LEU A HD21 5  
ATOM 9504  H HD22 . LEU A 1 42  ? 8.051   1.314   3.928   1.00 0.00 ? 42  LEU A HD22 5  
ATOM 9505  H HD23 . LEU A 1 42  ? 8.261   3.000   4.407   1.00 0.00 ? 42  LEU A HD23 5  
ATOM 9506  N N    . LYS A 1 43  ? 5.574   5.215   8.362   1.00 0.00 ? 43  LYS A N    5  
ATOM 9507  C CA   . LYS A 1 43  ? 4.636   6.033   9.123   1.00 0.00 ? 43  LYS A CA   5  
ATOM 9508  C C    . LYS A 1 43  ? 4.397   7.371   8.433   1.00 0.00 ? 43  LYS A C    5  
ATOM 9509  O O    . LYS A 1 43  ? 3.301   7.638   7.938   1.00 0.00 ? 43  LYS A O    5  
ATOM 9510  C CB   . LYS A 1 43  ? 5.164   6.264   10.541  1.00 0.00 ? 43  LYS A CB   5  
ATOM 9511  C CG   . LYS A 1 43  ? 4.492   7.421   11.258  1.00 0.00 ? 43  LYS A CG   5  
ATOM 9512  C CD   . LYS A 1 43  ? 5.029   7.591   12.670  1.00 0.00 ? 43  LYS A CD   5  
ATOM 9513  C CE   . LYS A 1 43  ? 4.647   8.942   13.254  1.00 0.00 ? 43  LYS A CE   5  
ATOM 9514  N NZ   . LYS A 1 43  ? 5.649   9.993   12.925  1.00 0.00 ? 43  LYS A NZ   5  
ATOM 9515  H H    . LYS A 1 43  ? 6.210   4.644   8.843   1.00 0.00 ? 43  LYS A H    5  
ATOM 9516  H HA   . LYS A 1 43  ? 3.700   5.498   9.180   1.00 0.00 ? 43  LYS A HA   5  
ATOM 9517  H HB2  . LYS A 1 43  ? 5.008   5.367   11.122  1.00 0.00 ? 43  LYS A HB2  5  
ATOM 9518  H HB3  . LYS A 1 43  ? 6.224   6.468   10.488  1.00 0.00 ? 43  LYS A HB3  5  
ATOM 9519  H HG2  . LYS A 1 43  ? 4.672   8.331   10.705  1.00 0.00 ? 43  LYS A HG2  5  
ATOM 9520  H HG3  . LYS A 1 43  ? 3.428   7.233   11.309  1.00 0.00 ? 43  LYS A HG3  5  
ATOM 9521  H HD2  . LYS A 1 43  ? 4.622   6.812   13.297  1.00 0.00 ? 43  LYS A HD2  5  
ATOM 9522  H HD3  . LYS A 1 43  ? 6.107   7.511   12.647  1.00 0.00 ? 43  LYS A HD3  5  
ATOM 9523  H HE2  . LYS A 1 43  ? 3.687   9.234   12.853  1.00 0.00 ? 43  LYS A HE2  5  
ATOM 9524  H HE3  . LYS A 1 43  ? 4.574   8.847   14.327  1.00 0.00 ? 43  LYS A HE3  5  
ATOM 9525  H HZ1  . LYS A 1 43  ? 6.004   9.857   11.958  1.00 0.00 ? 43  LYS A HZ1  5  
ATOM 9526  H HZ2  . LYS A 1 43  ? 6.450   9.941   13.586  1.00 0.00 ? 43  LYS A HZ2  5  
ATOM 9527  H HZ3  . LYS A 1 43  ? 5.216   10.935  12.996  1.00 0.00 ? 43  LYS A HZ3  5  
ATOM 9528  N N    . ASP A 1 44  ? 5.427   8.208   8.403   1.00 0.00 ? 44  ASP A N    5  
ATOM 9529  C CA   . ASP A 1 44  ? 5.330   9.519   7.770   1.00 0.00 ? 44  ASP A CA   5  
ATOM 9530  C C    . ASP A 1 44  ? 4.436   9.461   6.535   1.00 0.00 ? 44  ASP A C    5  
ATOM 9531  O O    . ASP A 1 44  ? 3.640   10.366  6.289   1.00 0.00 ? 44  ASP A O    5  
ATOM 9532  C CB   . ASP A 1 44  ? 6.720   10.028  7.386   1.00 0.00 ? 44  ASP A CB   5  
ATOM 9533  C CG   . ASP A 1 44  ? 6.683   11.428  6.805   1.00 0.00 ? 44  ASP A CG   5  
ATOM 9534  O OD1  . ASP A 1 44  ? 5.644   11.799  6.219   1.00 0.00 ? 44  ASP A OD1  5  
ATOM 9535  O OD2  . ASP A 1 44  ? 7.692   12.152  6.935   1.00 0.00 ? 44  ASP A OD2  5  
ATOM 9536  H H    . ASP A 1 44  ? 6.276   7.938   8.814   1.00 0.00 ? 44  ASP A H    5  
ATOM 9537  H HA   . ASP A 1 44  ? 4.891   10.200  8.484   1.00 0.00 ? 44  ASP A HA   5  
ATOM 9538  H HB2  . ASP A 1 44  ? 7.347   10.041  8.265   1.00 0.00 ? 44  ASP A HB2  5  
ATOM 9539  H HB3  . ASP A 1 44  ? 7.149   9.364   6.652   1.00 0.00 ? 44  ASP A HB3  5  
ATOM 9540  N N    . GLY A 1 45  ? 4.575   8.390   5.760   1.00 0.00 ? 45  GLY A N    5  
ATOM 9541  C CA   . GLY A 1 45  ? 3.775   8.234   4.559   1.00 0.00 ? 45  GLY A CA   5  
ATOM 9542  C C    . GLY A 1 45  ? 4.417   8.881   3.347   1.00 0.00 ? 45  GLY A C    5  
ATOM 9543  O O    . GLY A 1 45  ? 3.731   9.464   2.508   1.00 0.00 ? 45  GLY A O    5  
ATOM 9544  H H    . GLY A 1 45  ? 5.227   7.699   6.005   1.00 0.00 ? 45  GLY A H    5  
ATOM 9545  H HA2  . GLY A 1 45  ? 3.640   7.181   4.363   1.00 0.00 ? 45  GLY A HA2  5  
ATOM 9546  H HA3  . GLY A 1 45  ? 2.809   8.686   4.723   1.00 0.00 ? 45  GLY A HA3  5  
ATOM 9547  N N    . THR A 1 46  ? 5.740   8.779   3.254   1.00 0.00 ? 46  THR A N    5  
ATOM 9548  C CA   . THR A 1 46  ? 6.475   9.361   2.139   1.00 0.00 ? 46  THR A CA   5  
ATOM 9549  C C    . THR A 1 46  ? 6.642   8.354   1.006   1.00 0.00 ? 46  THR A C    5  
ATOM 9550  O O    . THR A 1 46  ? 6.239   8.611   -0.129  1.00 0.00 ? 46  THR A O    5  
ATOM 9551  C CB   . THR A 1 46  ? 7.865   9.856   2.580   1.00 0.00 ? 46  THR A CB   5  
ATOM 9552  O OG1  . THR A 1 46  ? 8.582   8.795   3.221   1.00 0.00 ? 46  THR A OG1  5  
ATOM 9553  C CG2  . THR A 1 46  ? 7.743   11.039  3.528   1.00 0.00 ? 46  THR A CG2  5  
ATOM 9554  H H    . THR A 1 46  ? 6.231   8.302   3.955   1.00 0.00 ? 46  THR A H    5  
ATOM 9555  H HA   . THR A 1 46  ? 5.913   10.208  1.775   1.00 0.00 ? 46  THR A HA   5  
ATOM 9556  H HB   . THR A 1 46  ? 8.413   10.172  1.702   1.00 0.00 ? 46  THR A HB   5  
ATOM 9557  H HG1  . THR A 1 46  ? 8.999   9.128   4.019   1.00 0.00 ? 46  THR A HG1  5  
ATOM 9558  H HG21 . THR A 1 46  ? 6.779   11.508  3.397   1.00 0.00 ? 46  THR A HG21 5  
ATOM 9559  H HG22 . THR A 1 46  ? 8.523   11.754  3.314   1.00 0.00 ? 46  THR A HG22 5  
ATOM 9560  H HG23 . THR A 1 46  ? 7.839   10.693  4.546   1.00 0.00 ? 46  THR A HG23 5  
ATOM 9561  N N    . ILE A 1 47  ? 7.236   7.209   1.322   1.00 0.00 ? 47  ILE A N    5  
ATOM 9562  C CA   . ILE A 1 47  ? 7.454   6.163   0.330   1.00 0.00 ? 47  ILE A CA   5  
ATOM 9563  C C    . ILE A 1 47  ? 6.152   5.443   -0.005  1.00 0.00 ? 47  ILE A C    5  
ATOM 9564  O O    . ILE A 1 47  ? 5.740   5.392   -1.165  1.00 0.00 ? 47  ILE A O    5  
ATOM 9565  C CB   . ILE A 1 47  ? 8.488   5.131   0.817   1.00 0.00 ? 47  ILE A CB   5  
ATOM 9566  C CG1  . ILE A 1 47  ? 9.803   5.824   1.178   1.00 0.00 ? 47  ILE A CG1  5  
ATOM 9567  C CG2  . ILE A 1 47  ? 8.718   4.068   -0.246  1.00 0.00 ? 47  ILE A CG2  5  
ATOM 9568  C CD1  . ILE A 1 47  ? 10.576  5.123   2.272   1.00 0.00 ? 47  ILE A CD1  5  
ATOM 9569  H H    . ILE A 1 47  ? 7.535   7.063   2.244   1.00 0.00 ? 47  ILE A H    5  
ATOM 9570  H HA   . ILE A 1 47  ? 7.837   6.629   -0.567  1.00 0.00 ? 47  ILE A HA   5  
ATOM 9571  H HB   . ILE A 1 47  ? 8.091   4.646   1.697   1.00 0.00 ? 47  ILE A HB   5  
ATOM 9572  H HG12 . ILE A 1 47  ? 10.432  5.866   0.303   1.00 0.00 ? 47  ILE A HG12 5  
ATOM 9573  H HG13 . ILE A 1 47  ? 9.591   6.829   1.512   1.00 0.00 ? 47  ILE A HG13 5  
ATOM 9574  H HG21 . ILE A 1 47  ? 8.341   3.119   0.107   1.00 0.00 ? 47  ILE A HG21 5  
ATOM 9575  H HG22 . ILE A 1 47  ? 8.198   4.346   -1.150  1.00 0.00 ? 47  ILE A HG22 5  
ATOM 9576  H HG23 . ILE A 1 47  ? 9.774   3.983   -0.448  1.00 0.00 ? 47  ILE A HG23 5  
ATOM 9577  H HD11 . ILE A 1 47  ? 11.552  4.845   1.903   1.00 0.00 ? 47  ILE A HD11 5  
ATOM 9578  H HD12 . ILE A 1 47  ? 10.686  5.784   3.118   1.00 0.00 ? 47  ILE A HD12 5  
ATOM 9579  H HD13 . ILE A 1 47  ? 10.042  4.234   2.579   1.00 0.00 ? 47  ILE A HD13 5  
ATOM 9580  N N    . LEU A 1 48  ? 5.509   4.890   1.016   1.00 0.00 ? 48  LEU A N    5  
ATOM 9581  C CA   . LEU A 1 48  ? 4.252   4.174   0.832   1.00 0.00 ? 48  LEU A CA   5  
ATOM 9582  C C    . LEU A 1 48  ? 3.431   4.797   -0.294  1.00 0.00 ? 48  LEU A C    5  
ATOM 9583  O O    . LEU A 1 48  ? 2.746   4.094   -1.039  1.00 0.00 ? 48  LEU A O    5  
ATOM 9584  C CB   . LEU A 1 48  ? 3.443   4.178   2.130   1.00 0.00 ? 48  LEU A CB   5  
ATOM 9585  C CG   . LEU A 1 48  ? 3.925   3.223   3.224   1.00 0.00 ? 48  LEU A CG   5  
ATOM 9586  C CD1  . LEU A 1 48  ? 3.124   3.427   4.500   1.00 0.00 ? 48  LEU A CD1  5  
ATOM 9587  C CD2  . LEU A 1 48  ? 3.824   1.779   2.753   1.00 0.00 ? 48  LEU A CD2  5  
ATOM 9588  H H    . LEU A 1 48  ? 5.887   4.965   1.917   1.00 0.00 ? 48  LEU A H    5  
ATOM 9589  H HA   . LEU A 1 48  ? 4.487   3.154   0.567   1.00 0.00 ? 48  LEU A HA   5  
ATOM 9590  H HB2  . LEU A 1 48  ? 3.468   5.180   2.532   1.00 0.00 ? 48  LEU A HB2  5  
ATOM 9591  H HB3  . LEU A 1 48  ? 2.424   3.916   1.886   1.00 0.00 ? 48  LEU A HB3  5  
ATOM 9592  H HG   . LEU A 1 48  ? 4.963   3.433   3.444   1.00 0.00 ? 48  LEU A HG   5  
ATOM 9593  H HD11 . LEU A 1 48  ? 3.301   2.600   5.171   1.00 0.00 ? 48  LEU A HD11 5  
ATOM 9594  H HD12 . LEU A 1 48  ? 2.072   3.478   4.261   1.00 0.00 ? 48  LEU A HD12 5  
ATOM 9595  H HD13 . LEU A 1 48  ? 3.430   4.347   4.974   1.00 0.00 ? 48  LEU A HD13 5  
ATOM 9596  H HD21 . LEU A 1 48  ? 4.765   1.279   2.927   1.00 0.00 ? 48  LEU A HD21 5  
ATOM 9597  H HD22 . LEU A 1 48  ? 3.597   1.761   1.697   1.00 0.00 ? 48  LEU A HD22 5  
ATOM 9598  H HD23 . LEU A 1 48  ? 3.041   1.277   3.299   1.00 0.00 ? 48  LEU A HD23 5  
ATOM 9599  N N    . CYS A 1 49  ? 3.505   6.118   -0.411  1.00 0.00 ? 49  CYS A N    5  
ATOM 9600  C CA   . CYS A 1 49  ? 2.770   6.835   -1.447  1.00 0.00 ? 49  CYS A CA   5  
ATOM 9601  C C    . CYS A 1 49  ? 3.395   6.602   -2.818  1.00 0.00 ? 49  CYS A C    5  
ATOM 9602  O O    . CYS A 1 49  ? 2.742   6.098   -3.732  1.00 0.00 ? 49  CYS A O    5  
ATOM 9603  C CB   . CYS A 1 49  ? 2.739   8.332   -1.135  1.00 0.00 ? 49  CYS A CB   5  
ATOM 9604  S SG   . CYS A 1 49  ? 1.704   8.771   0.281   1.00 0.00 ? 49  CYS A SG   5  
ATOM 9605  H H    . CYS A 1 49  ? 4.067   6.623   0.213   1.00 0.00 ? 49  CYS A H    5  
ATOM 9606  H HA   . CYS A 1 49  ? 1.759   6.459   -1.456  1.00 0.00 ? 49  CYS A HA   5  
ATOM 9607  H HB2  . CYS A 1 49  ? 3.744   8.669   -0.923  1.00 0.00 ? 49  CYS A HB2  5  
ATOM 9608  H HB3  . CYS A 1 49  ? 2.364   8.865   -1.996  1.00 0.00 ? 49  CYS A HB3  5  
ATOM 9609  H HG   . CYS A 1 49  ? 0.900   9.756   -0.090  1.00 0.00 ? 49  CYS A HG   5  
ATOM 9610  N N    . THR A 1 50  ? 4.664   6.973   -2.956  1.00 0.00 ? 50  THR A N    5  
ATOM 9611  C CA   . THR A 1 50  ? 5.376   6.807   -4.216  1.00 0.00 ? 50  THR A CA   5  
ATOM 9612  C C    . THR A 1 50  ? 5.256   5.378   -4.732  1.00 0.00 ? 50  THR A C    5  
ATOM 9613  O O    . THR A 1 50  ? 5.009   5.154   -5.918  1.00 0.00 ? 50  THR A O    5  
ATOM 9614  C CB   . THR A 1 50  ? 6.868   7.164   -4.069  1.00 0.00 ? 50  THR A CB   5  
ATOM 9615  O OG1  . THR A 1 50  ? 7.421   6.496   -2.930  1.00 0.00 ? 50  THR A OG1  5  
ATOM 9616  C CG2  . THR A 1 50  ? 7.053   8.666   -3.923  1.00 0.00 ? 50  THR A CG2  5  
ATOM 9617  H H    . THR A 1 50  ? 5.130   7.369   -2.190  1.00 0.00 ? 50  THR A H    5  
ATOM 9618  H HA   . THR A 1 50  ? 4.936   7.478   -4.939  1.00 0.00 ? 50  THR A HA   5  
ATOM 9619  H HB   . THR A 1 50  ? 7.389   6.837   -4.958  1.00 0.00 ? 50  THR A HB   5  
ATOM 9620  H HG1  . THR A 1 50  ? 6.743   6.392   -2.258  1.00 0.00 ? 50  THR A HG1  5  
ATOM 9621  H HG21 . THR A 1 50  ? 6.589   9.170   -4.758  1.00 0.00 ? 50  THR A HG21 5  
ATOM 9622  H HG22 . THR A 1 50  ? 8.107   8.898   -3.901  1.00 0.00 ? 50  THR A HG22 5  
ATOM 9623  H HG23 . THR A 1 50  ? 6.593   8.997   -3.004  1.00 0.00 ? 50  THR A HG23 5  
ATOM 9624  N N    . LEU A 1 51  ? 5.431   4.413   -3.835  1.00 0.00 ? 51  LEU A N    5  
ATOM 9625  C CA   . LEU A 1 51  ? 5.341   3.004   -4.199  1.00 0.00 ? 51  LEU A CA   5  
ATOM 9626  C C    . LEU A 1 51  ? 4.171   2.761   -5.147  1.00 0.00 ? 51  LEU A C    5  
ATOM 9627  O O    . LEU A 1 51  ? 4.333   2.151   -6.204  1.00 0.00 ? 51  LEU A O    5  
ATOM 9628  C CB   . LEU A 1 51  ? 5.184   2.142   -2.945  1.00 0.00 ? 51  LEU A CB   5  
ATOM 9629  C CG   . LEU A 1 51  ? 4.710   0.706   -3.173  1.00 0.00 ? 51  LEU A CG   5  
ATOM 9630  C CD1  . LEU A 1 51  ? 5.751   -0.081  -3.955  1.00 0.00 ? 51  LEU A CD1  5  
ATOM 9631  C CD2  . LEU A 1 51  ? 4.411   0.027   -1.845  1.00 0.00 ? 51  LEU A CD2  5  
ATOM 9632  H H    . LEU A 1 51  ? 5.625   4.654   -2.906  1.00 0.00 ? 51  LEU A H    5  
ATOM 9633  H HA   . LEU A 1 51  ? 6.258   2.732   -4.700  1.00 0.00 ? 51  LEU A HA   5  
ATOM 9634  H HB2  . LEU A 1 51  ? 6.143   2.099   -2.452  1.00 0.00 ? 51  LEU A HB2  5  
ATOM 9635  H HB3  . LEU A 1 51  ? 4.469   2.629   -2.298  1.00 0.00 ? 51  LEU A HB3  5  
ATOM 9636  H HG   . LEU A 1 51  ? 3.798   0.722   -3.755  1.00 0.00 ? 51  LEU A HG   5  
ATOM 9637  H HD11 . LEU A 1 51  ? 6.250   -0.774  -3.293  1.00 0.00 ? 51  LEU A HD11 5  
ATOM 9638  H HD12 . LEU A 1 51  ? 6.474   0.599   -4.377  1.00 0.00 ? 51  LEU A HD12 5  
ATOM 9639  H HD13 . LEU A 1 51  ? 5.264   -0.629  -4.750  1.00 0.00 ? 51  LEU A HD13 5  
ATOM 9640  H HD21 . LEU A 1 51  ? 4.179   0.775   -1.102  1.00 0.00 ? 51  LEU A HD21 5  
ATOM 9641  H HD22 . LEU A 1 51  ? 5.275   -0.541  -1.528  1.00 0.00 ? 51  LEU A HD22 5  
ATOM 9642  H HD23 . LEU A 1 51  ? 3.568   -0.638  -1.963  1.00 0.00 ? 51  LEU A HD23 5  
ATOM 9643  N N    . MET A 1 52  ? 2.994   3.243   -4.763  1.00 0.00 ? 52  MET A N    5  
ATOM 9644  C CA   . MET A 1 52  ? 1.798   3.080   -5.581  1.00 0.00 ? 52  MET A CA   5  
ATOM 9645  C C    . MET A 1 52  ? 1.970   3.757   -6.936  1.00 0.00 ? 52  MET A C    5  
ATOM 9646  O O    . MET A 1 52  ? 1.827   3.121   -7.980  1.00 0.00 ? 52  MET A O    5  
ATOM 9647  C CB   . MET A 1 52  ? 0.579   3.659   -4.860  1.00 0.00 ? 52  MET A CB   5  
ATOM 9648  C CG   . MET A 1 52  ? -0.746  3.142   -5.397  1.00 0.00 ? 52  MET A CG   5  
ATOM 9649  S SD   . MET A 1 52  ? -0.970  1.377   -5.112  1.00 0.00 ? 52  MET A SD   5  
ATOM 9650  C CE   . MET A 1 52  ? -1.675  0.867   -6.678  1.00 0.00 ? 52  MET A CE   5  
ATOM 9651  H H    . MET A 1 52  ? 2.928   3.721   -3.909  1.00 0.00 ? 52  MET A H    5  
ATOM 9652  H HA   . MET A 1 52  ? 1.644   2.023   -5.736  1.00 0.00 ? 52  MET A HA   5  
ATOM 9653  H HB2  . MET A 1 52  ? 0.641   3.406   -3.812  1.00 0.00 ? 52  MET A HB2  5  
ATOM 9654  H HB3  . MET A 1 52  ? 0.590   4.733   -4.964  1.00 0.00 ? 52  MET A HB3  5  
ATOM 9655  H HG2  . MET A 1 52  ? -1.550  3.675   -4.910  1.00 0.00 ? 52  MET A HG2  5  
ATOM 9656  H HG3  . MET A 1 52  ? -0.786  3.330   -6.460  1.00 0.00 ? 52  MET A HG3  5  
ATOM 9657  H HE1  . MET A 1 52  ? -1.327  -0.124  -6.925  1.00 0.00 ? 52  MET A HE1  5  
ATOM 9658  H HE2  . MET A 1 52  ? -2.753  0.862   -6.603  1.00 0.00 ? 52  MET A HE2  5  
ATOM 9659  H HE3  . MET A 1 52  ? -1.372  1.559   -7.450  1.00 0.00 ? 52  MET A HE3  5  
ATOM 9660  N N    . ASN A 1 53  ? 2.277   5.050   -6.913  1.00 0.00 ? 53  ASN A N    5  
ATOM 9661  C CA   . ASN A 1 53  ? 2.469   5.813   -8.141  1.00 0.00 ? 53  ASN A CA   5  
ATOM 9662  C C    . ASN A 1 53  ? 3.218   4.989   -9.183  1.00 0.00 ? 53  ASN A C    5  
ATOM 9663  O O    . ASN A 1 53  ? 2.907   5.039   -10.373 1.00 0.00 ? 53  ASN A O    5  
ATOM 9664  C CB   . ASN A 1 53  ? 3.233   7.106   -7.849  1.00 0.00 ? 53  ASN A CB   5  
ATOM 9665  C CG   . ASN A 1 53  ? 2.309   8.269   -7.546  1.00 0.00 ? 53  ASN A CG   5  
ATOM 9666  O OD1  . ASN A 1 53  ? 1.485   8.654   -8.375  1.00 0.00 ? 53  ASN A OD1  5  
ATOM 9667  N ND2  . ASN A 1 53  ? 2.443   8.835   -6.351  1.00 0.00 ? 53  ASN A ND2  5  
ATOM 9668  H H    . ASN A 1 53  ? 2.378   5.503   -6.049  1.00 0.00 ? 53  ASN A H    5  
ATOM 9669  H HA   . ASN A 1 53  ? 1.493   6.063   -8.531  1.00 0.00 ? 53  ASN A HA   5  
ATOM 9670  H HB2  . ASN A 1 53  ? 3.878   6.951   -6.996  1.00 0.00 ? 53  ASN A HB2  5  
ATOM 9671  H HB3  . ASN A 1 53  ? 3.836   7.363   -8.707  1.00 0.00 ? 53  ASN A HB3  5  
ATOM 9672  H HD21 . ASN A 1 53  ? 3.121   8.475   -5.742  1.00 0.00 ? 53  ASN A HD21 5  
ATOM 9673  H HD22 . ASN A 1 53  ? 1.857   9.589   -6.129  1.00 0.00 ? 53  ASN A HD22 5  
ATOM 9674  N N    . LYS A 1 54  ? 4.209   4.229   -8.726  1.00 0.00 ? 54  LYS A N    5  
ATOM 9675  C CA   . LYS A 1 54  ? 5.003   3.391   -9.616  1.00 0.00 ? 54  LYS A CA   5  
ATOM 9676  C C    . LYS A 1 54  ? 4.133   2.335   -10.291 1.00 0.00 ? 54  LYS A C    5  
ATOM 9677  O O    . LYS A 1 54  ? 4.234   2.112   -11.498 1.00 0.00 ? 54  LYS A O    5  
ATOM 9678  C CB   . LYS A 1 54  ? 6.134   2.714   -8.838  1.00 0.00 ? 54  LYS A CB   5  
ATOM 9679  C CG   . LYS A 1 54  ? 6.992   3.684   -8.044  1.00 0.00 ? 54  LYS A CG   5  
ATOM 9680  C CD   . LYS A 1 54  ? 7.779   4.609   -8.958  1.00 0.00 ? 54  LYS A CD   5  
ATOM 9681  C CE   . LYS A 1 54  ? 8.098   5.929   -8.273  1.00 0.00 ? 54  LYS A CE   5  
ATOM 9682  N NZ   . LYS A 1 54  ? 6.867   6.712   -7.977  1.00 0.00 ? 54  LYS A NZ   5  
ATOM 9683  H H    . LYS A 1 54  ? 4.409   4.231   -7.766  1.00 0.00 ? 54  LYS A H    5  
ATOM 9684  H HA   . LYS A 1 54  ? 5.431   4.027   -10.377 1.00 0.00 ? 54  LYS A HA   5  
ATOM 9685  H HB2  . LYS A 1 54  ? 5.704   2.000   -8.152  1.00 0.00 ? 54  LYS A HB2  5  
ATOM 9686  H HB3  . LYS A 1 54  ? 6.772   2.190   -9.537  1.00 0.00 ? 54  LYS A HB3  5  
ATOM 9687  H HG2  . LYS A 1 54  ? 6.353   4.280   -7.411  1.00 0.00 ? 54  LYS A HG2  5  
ATOM 9688  H HG3  . LYS A 1 54  ? 7.684   3.121   -7.434  1.00 0.00 ? 54  LYS A HG3  5  
ATOM 9689  H HD2  . LYS A 1 54  ? 8.704   4.127   -9.234  1.00 0.00 ? 54  LYS A HD2  5  
ATOM 9690  H HD3  . LYS A 1 54  ? 7.195   4.806   -9.846  1.00 0.00 ? 54  LYS A HD3  5  
ATOM 9691  H HE2  . LYS A 1 54  ? 8.615   5.724   -7.348  1.00 0.00 ? 54  LYS A HE2  5  
ATOM 9692  H HE3  . LYS A 1 54  ? 8.737   6.510   -8.921  1.00 0.00 ? 54  LYS A HE3  5  
ATOM 9693  H HZ1  . LYS A 1 54  ? 6.577   6.563   -6.990  1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 9694  H HZ2  . LYS A 1 54  ? 6.092   6.412   -8.603  1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 9695  H HZ3  . LYS A 1 54  ? 7.043   7.726   -8.124  1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 9696  N N    . LEU A 1 55  ? 3.278   1.690   -9.506  1.00 0.00 ? 55  LEU A N    5  
ATOM 9697  C CA   . LEU A 1 55  ? 2.389   0.659   -10.028 1.00 0.00 ? 55  LEU A CA   5  
ATOM 9698  C C    . LEU A 1 55  ? 1.260   1.277   -10.847 1.00 0.00 ? 55  LEU A C    5  
ATOM 9699  O O    . LEU A 1 55  ? 1.009   0.871   -11.981 1.00 0.00 ? 55  LEU A O    5  
ATOM 9700  C CB   . LEU A 1 55  ? 1.808   -0.170  -8.881  1.00 0.00 ? 55  LEU A CB   5  
ATOM 9701  C CG   . LEU A 1 55  ? 2.808   -0.658  -7.833  1.00 0.00 ? 55  LEU A CG   5  
ATOM 9702  C CD1  . LEU A 1 55  ? 2.090   -1.398  -6.714  1.00 0.00 ? 55  LEU A CD1  5  
ATOM 9703  C CD2  . LEU A 1 55  ? 3.860   -1.551  -8.475  1.00 0.00 ? 55  LEU A CD2  5  
ATOM 9704  H H    . LEU A 1 55  ? 3.243   1.912   -8.552  1.00 0.00 ? 55  LEU A H    5  
ATOM 9705  H HA   . LEU A 1 55  ? 2.970   0.013   -10.670 1.00 0.00 ? 55  LEU A HA   5  
ATOM 9706  H HB2  . LEU A 1 55  ? 1.069   0.435   -8.377  1.00 0.00 ? 55  LEU A HB2  5  
ATOM 9707  H HB3  . LEU A 1 55  ? 1.326   -1.038  -9.312  1.00 0.00 ? 55  LEU A HB3  5  
ATOM 9708  H HG   . LEU A 1 55  ? 3.311   0.194   -7.400  1.00 0.00 ? 55  LEU A HG   5  
ATOM 9709  H HD11 . LEU A 1 55  ? 2.592   -2.334  -6.522  1.00 0.00 ? 55  LEU A HD11 5  
ATOM 9710  H HD12 . LEU A 1 55  ? 1.068   -1.590  -7.008  1.00 0.00 ? 55  LEU A HD12 5  
ATOM 9711  H HD13 . LEU A 1 55  ? 2.099   -0.792  -5.820  1.00 0.00 ? 55  LEU A HD13 5  
ATOM 9712  H HD21 . LEU A 1 55  ? 4.169   -2.307  -7.769  1.00 0.00 ? 55  LEU A HD21 5  
ATOM 9713  H HD22 . LEU A 1 55  ? 4.715   -0.953  -8.758  1.00 0.00 ? 55  LEU A HD22 5  
ATOM 9714  H HD23 . LEU A 1 55  ? 3.444   -2.024  -9.351  1.00 0.00 ? 55  LEU A HD23 5  
ATOM 9715  N N    . GLN A 1 56  ? 0.583   2.262   -10.264 1.00 0.00 ? 56  GLN A N    5  
ATOM 9716  C CA   . GLN A 1 56  ? -0.518  2.938   -10.940 1.00 0.00 ? 56  GLN A CA   5  
ATOM 9717  C C    . GLN A 1 56  ? -0.170  4.394   -11.225 1.00 0.00 ? 56  GLN A C    5  
ATOM 9718  O O    . GLN A 1 56  ? 0.181   5.161   -10.329 1.00 0.00 ? 56  GLN A O    5  
ATOM 9719  C CB   . GLN A 1 56  ? -1.789  2.860   -10.092 1.00 0.00 ? 56  GLN A CB   5  
ATOM 9720  C CG   . GLN A 1 56  ? -2.878  3.821   -10.541 1.00 0.00 ? 56  GLN A CG   5  
ATOM 9721  C CD   . GLN A 1 56  ? -4.272  3.286   -10.276 1.00 0.00 ? 56  GLN A CD   5  
ATOM 9722  O OE1  . GLN A 1 56  ? -5.070  3.114   -11.198 1.00 0.00 ? 56  GLN A OE1  5  
ATOM 9723  N NE2  . GLN A 1 56  ? -4.574  3.020   -9.011  1.00 0.00 ? 56  GLN A NE2  5  
ATOM 9724  H H    . GLN A 1 56  ? 0.831   2.541   -9.358  1.00 0.00 ? 56  GLN A H    5  
ATOM 9725  H HA   . GLN A 1 56  ? -0.691  2.431   -11.878 1.00 0.00 ? 56  GLN A HA   5  
ATOM 9726  H HB2  . GLN A 1 56  ? -2.181  1.855   -10.143 1.00 0.00 ? 56  GLN A HB2  5  
ATOM 9727  H HB3  . GLN A 1 56  ? -1.537  3.089   -9.067  1.00 0.00 ? 56  GLN A HB3  5  
ATOM 9728  H HG2  . GLN A 1 56  ? -2.760  4.752   -10.010 1.00 0.00 ? 56  GLN A HG2  5  
ATOM 9729  H HG3  . GLN A 1 56  ? -2.771  3.996   -11.602 1.00 0.00 ? 56  GLN A HG3  5  
ATOM 9730  H HE21 . GLN A 1 56  ? -3.889  3.184   -8.329  1.00 0.00 ? 56  GLN A HE21 5  
ATOM 9731  H HE22 . GLN A 1 56  ? -5.468  2.675   -8.811  1.00 0.00 ? 56  GLN A HE22 5  
ATOM 9732  N N    . PRO A 1 57  ? -0.267  4.787   -12.504 1.00 0.00 ? 57  PRO A N    5  
ATOM 9733  C CA   . PRO A 1 57  ? 0.032   6.155   -12.937 1.00 0.00 ? 57  PRO A CA   5  
ATOM 9734  C C    . PRO A 1 57  ? -1.006  7.159   -12.447 1.00 0.00 ? 57  PRO A C    5  
ATOM 9735  O O    . PRO A 1 57  ? -0.946  8.341   -12.782 1.00 0.00 ? 57  PRO A O    5  
ATOM 9736  C CB   . PRO A 1 57  ? 0.003   6.058   -14.465 1.00 0.00 ? 57  PRO A CB   5  
ATOM 9737  C CG   . PRO A 1 57  ? -0.887  4.899   -14.754 1.00 0.00 ? 57  PRO A CG   5  
ATOM 9738  C CD   . PRO A 1 57  ? -0.679  3.926   -13.626 1.00 0.00 ? 57  PRO A CD   5  
ATOM 9739  H HA   . PRO A 1 57  ? 1.014   6.468   -12.613 1.00 0.00 ? 57  PRO A HA   5  
ATOM 9740  H HB2  . PRO A 1 57  ? -0.394  6.975   -14.878 1.00 0.00 ? 57  PRO A HB2  5  
ATOM 9741  H HB3  . PRO A 1 57  ? 1.003   5.892   -14.837 1.00 0.00 ? 57  PRO A HB3  5  
ATOM 9742  H HG2  . PRO A 1 57  ? -1.915  5.224   -14.784 1.00 0.00 ? 57  PRO A HG2  5  
ATOM 9743  H HG3  . PRO A 1 57  ? -0.607  4.447   -15.694 1.00 0.00 ? 57  PRO A HG3  5  
ATOM 9744  H HD2  . PRO A 1 57  ? -1.600  3.410   -13.398 1.00 0.00 ? 57  PRO A HD2  5  
ATOM 9745  H HD3  . PRO A 1 57  ? 0.099   3.220   -13.875 1.00 0.00 ? 57  PRO A HD3  5  
ATOM 9746  N N    . GLY A 1 58  ? -1.958  6.679   -11.652 1.00 0.00 ? 58  GLY A N    5  
ATOM 9747  C CA   . GLY A 1 58  ? -2.995  7.548   -11.129 1.00 0.00 ? 58  GLY A CA   5  
ATOM 9748  C C    . GLY A 1 58  ? -3.536  7.069   -9.796  1.00 0.00 ? 58  GLY A C    5  
ATOM 9749  O O    . GLY A 1 58  ? -4.730  6.806   -9.661  1.00 0.00 ? 58  GLY A O    5  
ATOM 9750  H H    . GLY A 1 58  ? -1.955  5.727   -11.419 1.00 0.00 ? 58  GLY A H    5  
ATOM 9751  H HA2  . GLY A 1 58  ? -2.589  8.541   -11.004 1.00 0.00 ? 58  GLY A HA2  5  
ATOM 9752  H HA3  . GLY A 1 58  ? -3.807  7.589   -11.840 1.00 0.00 ? 58  GLY A HA3  5  
ATOM 9753  N N    . SER A 1 59  ? -2.653  6.953   -8.809  1.00 0.00 ? 59  SER A N    5  
ATOM 9754  C CA   . SER A 1 59  ? -3.048  6.497   -7.481  1.00 0.00 ? 59  SER A CA   5  
ATOM 9755  C C    . SER A 1 59  ? -2.980  7.638   -6.472  1.00 0.00 ? 59  SER A C    5  
ATOM 9756  O O    . SER A 1 59  ? -4.000  8.067   -5.932  1.00 0.00 ? 59  SER A O    5  
ATOM 9757  C CB   . SER A 1 59  ? -2.149  5.345   -7.027  1.00 0.00 ? 59  SER A CB   5  
ATOM 9758  O OG   . SER A 1 59  ? -0.807  5.556   -7.430  1.00 0.00 ? 59  SER A OG   5  
ATOM 9759  H H    . SER A 1 59  ? -1.715  7.178   -8.978  1.00 0.00 ? 59  SER A H    5  
ATOM 9760  H HA   . SER A 1 59  ? -4.067  6.145   -7.541  1.00 0.00 ? 59  SER A HA   5  
ATOM 9761  H HB2  . SER A 1 59  ? -2.182  5.269   -5.951  1.00 0.00 ? 59  SER A HB2  5  
ATOM 9762  H HB3  . SER A 1 59  ? -2.503  4.422   -7.464  1.00 0.00 ? 59  SER A HB3  5  
ATOM 9763  H HG   . SER A 1 59  ? -0.720  5.363   -8.367  1.00 0.00 ? 59  SER A HG   5  
ATOM 9764  N N    . VAL A 1 60  ? -1.769  8.128   -6.221  1.00 0.00 ? 60  VAL A N    5  
ATOM 9765  C CA   . VAL A 1 60  ? -1.566  9.220   -5.277  1.00 0.00 ? 60  VAL A CA   5  
ATOM 9766  C C    . VAL A 1 60  ? -1.398  10.550  -6.004  1.00 0.00 ? 60  VAL A C    5  
ATOM 9767  O O    . VAL A 1 60  ? -0.537  10.708  -6.869  1.00 0.00 ? 60  VAL A O    5  
ATOM 9768  C CB   . VAL A 1 60  ? -0.332  8.973   -4.390  1.00 0.00 ? 60  VAL A CB   5  
ATOM 9769  C CG1  . VAL A 1 60  ? -0.052  10.185  -3.514  1.00 0.00 ? 60  VAL A CG1  5  
ATOM 9770  C CG2  . VAL A 1 60  ? -0.527  7.726   -3.541  1.00 0.00 ? 60  VAL A CG2  5  
ATOM 9771  H H    . VAL A 1 60  ? -0.995  7.745   -6.683  1.00 0.00 ? 60  VAL A H    5  
ATOM 9772  H HA   . VAL A 1 60  ? -2.437  9.277   -4.639  1.00 0.00 ? 60  VAL A HA   5  
ATOM 9773  H HB   . VAL A 1 60  ? 0.522   8.816   -5.032  1.00 0.00 ? 60  VAL A HB   5  
ATOM 9774  H HG11 . VAL A 1 60  ? -0.099  9.896   -2.474  1.00 0.00 ? 60  VAL A HG11 5  
ATOM 9775  H HG12 . VAL A 1 60  ? 0.930   10.571  -3.737  1.00 0.00 ? 60  VAL A HG12 5  
ATOM 9776  H HG13 . VAL A 1 60  ? -0.793  10.947  -3.709  1.00 0.00 ? 60  VAL A HG13 5  
ATOM 9777  H HG21 . VAL A 1 60  ? -0.504  6.853   -4.176  1.00 0.00 ? 60  VAL A HG21 5  
ATOM 9778  H HG22 . VAL A 1 60  ? 0.264   7.660   -2.809  1.00 0.00 ? 60  VAL A HG22 5  
ATOM 9779  H HG23 . VAL A 1 60  ? -1.481  7.779   -3.037  1.00 0.00 ? 60  VAL A HG23 5  
ATOM 9780  N N    . PRO A 1 61  ? -2.239  11.531  -5.645  1.00 0.00 ? 61  PRO A N    5  
ATOM 9781  C CA   . PRO A 1 61  ? -2.203  12.865  -6.250  1.00 0.00 ? 61  PRO A CA   5  
ATOM 9782  C C    . PRO A 1 61  ? -0.960  13.651  -5.847  1.00 0.00 ? 61  PRO A C    5  
ATOM 9783  O O    . PRO A 1 61  ? -0.242  14.176  -6.698  1.00 0.00 ? 61  PRO A O    5  
ATOM 9784  C CB   . PRO A 1 61  ? -3.463  13.538  -5.700  1.00 0.00 ? 61  PRO A CB   5  
ATOM 9785  C CG   . PRO A 1 61  ? -3.740  12.833  -4.417  1.00 0.00 ? 61  PRO A CG   5  
ATOM 9786  C CD   . PRO A 1 61  ? -3.291  11.412  -4.621  1.00 0.00 ? 61  PRO A CD   5  
ATOM 9787  H HA   . PRO A 1 61  ? -2.262  12.815  -7.327  1.00 0.00 ? 61  PRO A HA   5  
ATOM 9788  H HB2  . PRO A 1 61  ? -3.271  14.591  -5.539  1.00 0.00 ? 61  PRO A HB2  5  
ATOM 9789  H HB3  . PRO A 1 61  ? -4.276  13.418  -6.400  1.00 0.00 ? 61  PRO A HB3  5  
ATOM 9790  H HG2  . PRO A 1 61  ? -3.180  13.292  -3.617  1.00 0.00 ? 61  PRO A HG2  5  
ATOM 9791  H HG3  . PRO A 1 61  ? -4.798  12.864  -4.203  1.00 0.00 ? 61  PRO A HG3  5  
ATOM 9792  H HD2  . PRO A 1 61  ? -2.891  11.008  -3.703  1.00 0.00 ? 61  PRO A HD2  5  
ATOM 9793  H HD3  . PRO A 1 61  ? -4.109  10.805  -4.978  1.00 0.00 ? 61  PRO A HD3  5  
ATOM 9794  N N    . LYS A 1 62  ? -0.711  13.729  -4.544  1.00 0.00 ? 62  LYS A N    5  
ATOM 9795  C CA   . LYS A 1 62  ? 0.446   14.448  -4.028  1.00 0.00 ? 62  LYS A CA   5  
ATOM 9796  C C    . LYS A 1 62  ? 0.868   13.897  -2.669  1.00 0.00 ? 62  LYS A C    5  
ATOM 9797  O O    . LYS A 1 62  ? 0.040   13.390  -1.912  1.00 0.00 ? 62  LYS A O    5  
ATOM 9798  C CB   . LYS A 1 62  ? 0.133   15.942  -3.909  1.00 0.00 ? 62  LYS A CB   5  
ATOM 9799  C CG   . LYS A 1 62  ? 1.349   16.834  -4.090  1.00 0.00 ? 62  LYS A CG   5  
ATOM 9800  C CD   . LYS A 1 62  ? 1.110   18.223  -3.522  1.00 0.00 ? 62  LYS A CD   5  
ATOM 9801  C CE   . LYS A 1 62  ? 0.359   19.106  -4.507  1.00 0.00 ? 62  LYS A CE   5  
ATOM 9802  N NZ   . LYS A 1 62  ? 0.548   20.553  -4.209  1.00 0.00 ? 62  LYS A NZ   5  
ATOM 9803  H H    . LYS A 1 62  ? -1.321  13.289  -3.914  1.00 0.00 ? 62  LYS A H    5  
ATOM 9804  H HA   . LYS A 1 62  ? 1.260   14.313  -4.725  1.00 0.00 ? 62  LYS A HA   5  
ATOM 9805  H HB2  . LYS A 1 62  ? -0.595  16.205  -4.663  1.00 0.00 ? 62  LYS A HB2  5  
ATOM 9806  H HB3  . LYS A 1 62  ? -0.286  16.133  -2.932  1.00 0.00 ? 62  LYS A HB3  5  
ATOM 9807  H HG2  . LYS A 1 62  ? 2.190   16.389  -3.579  1.00 0.00 ? 62  LYS A HG2  5  
ATOM 9808  H HG3  . LYS A 1 62  ? 1.569   16.919  -5.144  1.00 0.00 ? 62  LYS A HG3  5  
ATOM 9809  H HD2  . LYS A 1 62  ? 0.527   18.137  -2.617  1.00 0.00 ? 62  LYS A HD2  5  
ATOM 9810  H HD3  . LYS A 1 62  ? 2.064   18.679  -3.297  1.00 0.00 ? 62  LYS A HD3  5  
ATOM 9811  H HE2  . LYS A 1 62  ? 0.722   18.902  -5.502  1.00 0.00 ? 62  LYS A HE2  5  
ATOM 9812  H HE3  . LYS A 1 62  ? -0.693  18.870  -4.452  1.00 0.00 ? 62  LYS A HE3  5  
ATOM 9813  H HZ1  . LYS A 1 62  ? 0.660   20.696  -3.186  1.00 0.00 ? 62  LYS A HZ1  5  
ATOM 9814  H HZ2  . LYS A 1 62  ? -0.278  21.095  -4.534  1.00 0.00 ? 62  LYS A HZ2  5  
ATOM 9815  H HZ3  . LYS A 1 62  ? 1.396   20.910  -4.693  1.00 0.00 ? 62  LYS A HZ3  5  
ATOM 9816  N N    . ILE A 1 63  ? 2.157   14.004  -2.366  1.00 0.00 ? 63  ILE A N    5  
ATOM 9817  C CA   . ILE A 1 63  ? 2.686   13.518  -1.098  1.00 0.00 ? 63  ILE A CA   5  
ATOM 9818  C C    . ILE A 1 63  ? 3.055   14.677  -0.177  1.00 0.00 ? 63  ILE A C    5  
ATOM 9819  O O    . ILE A 1 63  ? 3.729   15.621  -0.590  1.00 0.00 ? 63  ILE A O    5  
ATOM 9820  C CB   . ILE A 1 63  ? 3.925   12.629  -1.307  1.00 0.00 ? 63  ILE A CB   5  
ATOM 9821  C CG1  . ILE A 1 63  ? 3.559   11.395  -2.134  1.00 0.00 ? 63  ILE A CG1  5  
ATOM 9822  C CG2  . ILE A 1 63  ? 4.517   12.220  0.033   1.00 0.00 ? 63  ILE A CG2  5  
ATOM 9823  C CD1  . ILE A 1 63  ? 4.746   10.747  -2.811  1.00 0.00 ? 63  ILE A CD1  5  
ATOM 9824  H H    . ILE A 1 63  ? 2.767   14.419  -3.010  1.00 0.00 ? 63  ILE A H    5  
ATOM 9825  H HA   . ILE A 1 63  ? 1.918   12.925  -0.622  1.00 0.00 ? 63  ILE A HA   5  
ATOM 9826  H HB   . ILE A 1 63  ? 4.667   13.203  -1.841  1.00 0.00 ? 63  ILE A HB   5  
ATOM 9827  H HG12 . ILE A 1 63  ? 3.105   10.659  -1.489  1.00 0.00 ? 63  ILE A HG12 5  
ATOM 9828  H HG13 . ILE A 1 63  ? 2.854   11.680  -2.901  1.00 0.00 ? 63  ILE A HG13 5  
ATOM 9829  H HG21 . ILE A 1 63  ? 4.276   11.185  0.231   1.00 0.00 ? 63  ILE A HG21 5  
ATOM 9830  H HG22 . ILE A 1 63  ? 5.590   12.339  0.004   1.00 0.00 ? 63  ILE A HG22 5  
ATOM 9831  H HG23 . ILE A 1 63  ? 4.105   12.841  0.814   1.00 0.00 ? 63  ILE A HG23 5  
ATOM 9832  H HD11 . ILE A 1 63  ? 5.368   10.268  -2.069  1.00 0.00 ? 63  ILE A HD11 5  
ATOM 9833  H HD12 . ILE A 1 63  ? 4.400   10.011  -3.521  1.00 0.00 ? 63  ILE A HD12 5  
ATOM 9834  H HD13 . ILE A 1 63  ? 5.322   11.501  -3.328  1.00 0.00 ? 63  ILE A HD13 5  
ATOM 9835  N N    . ASN A 1 64  ? 2.612   14.597  1.073   1.00 0.00 ? 64  ASN A N    5  
ATOM 9836  C CA   . ASN A 1 64  ? 2.897   15.638  2.053   1.00 0.00 ? 64  ASN A CA   5  
ATOM 9837  C C    . ASN A 1 64  ? 4.250   15.404  2.718   1.00 0.00 ? 64  ASN A C    5  
ATOM 9838  O O    . ASN A 1 64  ? 4.380   14.554  3.600   1.00 0.00 ? 64  ASN A O    5  
ATOM 9839  C CB   . ASN A 1 64  ? 1.796   15.685  3.115   1.00 0.00 ? 64  ASN A CB   5  
ATOM 9840  C CG   . ASN A 1 64  ? 0.493   16.242  2.573   1.00 0.00 ? 64  ASN A CG   5  
ATOM 9841  O OD1  . ASN A 1 64  ? 0.483   16.980  1.587   1.00 0.00 ? 64  ASN A OD1  5  
ATOM 9842  N ND2  . ASN A 1 64  ? -0.614  15.889  3.215   1.00 0.00 ? 64  ASN A ND2  5  
ATOM 9843  H H    . ASN A 1 64  ? 2.079   13.820  1.343   1.00 0.00 ? 64  ASN A H    5  
ATOM 9844  H HA   . ASN A 1 64  ? 2.924   16.584  1.534   1.00 0.00 ? 64  ASN A HA   5  
ATOM 9845  H HB2  . ASN A 1 64  ? 1.613   14.684  3.478   1.00 0.00 ? 64  ASN A HB2  5  
ATOM 9846  H HB3  . ASN A 1 64  ? 2.119   16.309  3.935   1.00 0.00 ? 64  ASN A HB3  5  
ATOM 9847  H HD21 . ASN A 1 64  ? -0.530  15.297  3.992   1.00 0.00 ? 64  ASN A HD21 5  
ATOM 9848  H HD22 . ASN A 1 64  ? -1.469  16.234  2.885   1.00 0.00 ? 64  ASN A HD22 5  
ATOM 9849  N N    . ARG A 1 65  ? 5.254   16.161  2.290   1.00 0.00 ? 65  ARG A N    5  
ATOM 9850  C CA   . ARG A 1 65  ? 6.596   16.036  2.843   1.00 0.00 ? 65  ARG A CA   5  
ATOM 9851  C C    . ARG A 1 65  ? 6.760   16.916  4.078   1.00 0.00 ? 65  ARG A C    5  
ATOM 9852  O O    . ARG A 1 65  ? 7.746   17.641  4.210   1.00 0.00 ? 65  ARG A O    5  
ATOM 9853  C CB   . ARG A 1 65  ? 7.641   16.414  1.792   1.00 0.00 ? 65  ARG A CB   5  
ATOM 9854  C CG   . ARG A 1 65  ? 7.928   15.306  0.792   1.00 0.00 ? 65  ARG A CG   5  
ATOM 9855  C CD   . ARG A 1 65  ? 9.059   14.407  1.266   1.00 0.00 ? 65  ARG A CD   5  
ATOM 9856  N NE   . ARG A 1 65  ? 9.104   13.148  0.526   1.00 0.00 ? 65  ARG A NE   5  
ATOM 9857  C CZ   . ARG A 1 65  ? 10.170  12.355  0.489   1.00 0.00 ? 65  ARG A CZ   5  
ATOM 9858  N NH1  . ARG A 1 65  ? 11.272  12.689  1.145   1.00 0.00 ? 65  ARG A NH1  5  
ATOM 9859  N NH2  . ARG A 1 65  ? 10.133  11.225  -0.207  1.00 0.00 ? 65  ARG A NH2  5  
ATOM 9860  H H    . ARG A 1 65  ? 5.088   16.821  1.584   1.00 0.00 ? 65  ARG A H    5  
ATOM 9861  H HA   . ARG A 1 65  ? 6.742   15.005  3.129   1.00 0.00 ? 65  ARG A HA   5  
ATOM 9862  H HB2  . ARG A 1 65  ? 7.291   17.279  1.247   1.00 0.00 ? 65  ARG A HB2  5  
ATOM 9863  H HB3  . ARG A 1 65  ? 8.564   16.664  2.293   1.00 0.00 ? 65  ARG A HB3  5  
ATOM 9864  H HG2  . ARG A 1 65  ? 7.037   14.709  0.665   1.00 0.00 ? 65  ARG A HG2  5  
ATOM 9865  H HG3  . ARG A 1 65  ? 8.204   15.750  -0.153  1.00 0.00 ? 65  ARG A HG3  5  
ATOM 9866  H HD2  . ARG A 1 65  ? 9.996   14.926  1.129   1.00 0.00 ? 65  ARG A HD2  5  
ATOM 9867  H HD3  . ARG A 1 65  ? 8.915   14.193  2.314   1.00 0.00 ? 65  ARG A HD3  5  
ATOM 9868  H HE   . ARG A 1 65  ? 8.300   12.881  0.034   1.00 0.00 ? 65  ARG A HE   5  
ATOM 9869  H HH11 . ARG A 1 65  ? 11.301  13.539  1.671   1.00 0.00 ? 65  ARG A HH11 5  
ATOM 9870  H HH12 . ARG A 1 65  ? 12.071  12.090  1.116   1.00 0.00 ? 65  ARG A HH12 5  
ATOM 9871  H HH21 . ARG A 1 65  ? 9.303   10.971  -0.702  1.00 0.00 ? 65  ARG A HH21 5  
ATOM 9872  H HH22 . ARG A 1 65  ? 10.935  10.630  -0.234  1.00 0.00 ? 65  ARG A HH22 5  
ATOM 9873  N N    . SER A 1 66  ? 5.787   16.848  4.981   1.00 0.00 ? 66  SER A N    5  
ATOM 9874  C CA   . SER A 1 66  ? 5.821   17.642  6.204   1.00 0.00 ? 66  SER A CA   5  
ATOM 9875  C C    . SER A 1 66  ? 5.946   16.744  7.431   1.00 0.00 ? 66  SER A C    5  
ATOM 9876  O O    . SER A 1 66  ? 5.583   15.570  7.393   1.00 0.00 ? 66  SER A O    5  
ATOM 9877  C CB   . SER A 1 66  ? 4.561   18.503  6.313   1.00 0.00 ? 66  SER A CB   5  
ATOM 9878  O OG   . SER A 1 66  ? 4.489   19.439  5.251   1.00 0.00 ? 66  SER A OG   5  
ATOM 9879  H H    . SER A 1 66  ? 5.027   16.251  4.818   1.00 0.00 ? 66  SER A H    5  
ATOM 9880  H HA   . SER A 1 66  ? 6.685   18.289  6.155   1.00 0.00 ? 66  SER A HA   5  
ATOM 9881  H HB2  . SER A 1 66  ? 3.690   17.867  6.275   1.00 0.00 ? 66  SER A HB2  5  
ATOM 9882  H HB3  . SER A 1 66  ? 4.575   19.039  7.251   1.00 0.00 ? 66  SER A HB3  5  
ATOM 9883  H HG   . SER A 1 66  ? 3.714   19.258  4.717   1.00 0.00 ? 66  SER A HG   5  
ATOM 9884  N N    . MET A 1 67  ? 6.463   17.308  8.518   1.00 0.00 ? 67  MET A N    5  
ATOM 9885  C CA   . MET A 1 67  ? 6.635   16.560  9.757   1.00 0.00 ? 67  MET A CA   5  
ATOM 9886  C C    . MET A 1 67  ? 5.446   16.772  10.690  1.00 0.00 ? 67  MET A C    5  
ATOM 9887  O O    . MET A 1 67  ? 5.608   16.846  11.908  1.00 0.00 ? 67  MET A O    5  
ATOM 9888  C CB   . MET A 1 67  ? 7.929   16.982  10.457  1.00 0.00 ? 67  MET A CB   5  
ATOM 9889  C CG   . MET A 1 67  ? 9.184   16.448  9.786   1.00 0.00 ? 67  MET A CG   5  
ATOM 9890  S SD   . MET A 1 67  ? 9.809   17.552  8.505   1.00 0.00 ? 67  MET A SD   5  
ATOM 9891  C CE   . MET A 1 67  ? 10.937  16.462  7.640   1.00 0.00 ? 67  MET A CE   5  
ATOM 9892  H H    . MET A 1 67  ? 6.734   18.249  8.487   1.00 0.00 ? 67  MET A H    5  
ATOM 9893  H HA   . MET A 1 67  ? 6.698   15.511  9.506   1.00 0.00 ? 67  MET A HA   5  
ATOM 9894  H HB2  . MET A 1 67  ? 7.983   18.060  10.469  1.00 0.00 ? 67  MET A HB2  5  
ATOM 9895  H HB3  . MET A 1 67  ? 7.910   16.619  11.474  1.00 0.00 ? 67  MET A HB3  5  
ATOM 9896  H HG2  . MET A 1 67  ? 9.951   16.320  10.536  1.00 0.00 ? 67  MET A HG2  5  
ATOM 9897  H HG3  . MET A 1 67  ? 8.957   15.491  9.340   1.00 0.00 ? 67  MET A HG3  5  
ATOM 9898  H HE1  . MET A 1 67  ? 10.375  15.714  7.102   1.00 0.00 ? 67  MET A HE1  5  
ATOM 9899  H HE2  . MET A 1 67  ? 11.531  17.037  6.944   1.00 0.00 ? 67  MET A HE2  5  
ATOM 9900  H HE3  . MET A 1 67  ? 11.588  15.978  8.355   1.00 0.00 ? 67  MET A HE3  5  
ATOM 9901  N N    . GLN A 1 68  ? 4.254   16.869  10.110  1.00 0.00 ? 68  GLN A N    5  
ATOM 9902  C CA   . GLN A 1 68  ? 3.041   17.074  10.890  1.00 0.00 ? 68  GLN A CA   5  
ATOM 9903  C C    . GLN A 1 68  ? 2.190   15.808  10.916  1.00 0.00 ? 68  GLN A C    5  
ATOM 9904  O O    . GLN A 1 68  ? 2.299   14.958  10.033  1.00 0.00 ? 68  GLN A O    5  
ATOM 9905  C CB   . GLN A 1 68  ? 2.229   18.236  10.316  1.00 0.00 ? 68  GLN A CB   5  
ATOM 9906  C CG   . GLN A 1 68  ? 2.987   19.554  10.291  1.00 0.00 ? 68  GLN A CG   5  
ATOM 9907  C CD   . GLN A 1 68  ? 3.468   19.975  11.666  1.00 0.00 ? 68  GLN A CD   5  
ATOM 9908  O OE1  . GLN A 1 68  ? 4.668   20.135  11.893  1.00 0.00 ? 68  GLN A OE1  5  
ATOM 9909  N NE2  . GLN A 1 68  ? 2.533   20.158  12.591  1.00 0.00 ? 68  GLN A NE2  5  
ATOM 9910  H H    . GLN A 1 68  ? 4.191   16.802  9.135   1.00 0.00 ? 68  GLN A H    5  
ATOM 9911  H HA   . GLN A 1 68  ? 3.333   17.316  11.901  1.00 0.00 ? 68  GLN A HA   5  
ATOM 9912  H HB2  . GLN A 1 68  ? 1.941   17.993  9.303   1.00 0.00 ? 68  GLN A HB2  5  
ATOM 9913  H HB3  . GLN A 1 68  ? 1.339   18.369  10.913  1.00 0.00 ? 68  GLN A HB3  5  
ATOM 9914  H HG2  . GLN A 1 68  ? 3.844   19.450  9.643   1.00 0.00 ? 68  GLN A HG2  5  
ATOM 9915  H HG3  . GLN A 1 68  ? 2.334   20.321  9.903   1.00 0.00 ? 68  GLN A HG3  5  
ATOM 9916  H HE21 . GLN A 1 68  ? 1.597   20.012  12.337  1.00 0.00 ? 68  GLN A HE21 5  
ATOM 9917  H HE22 . GLN A 1 68  ? 2.817   20.430  13.487  1.00 0.00 ? 68  GLN A HE22 5  
ATOM 9918  N N    . ASN A 1 69  ? 1.345   15.690  11.934  1.00 0.00 ? 69  ASN A N    5  
ATOM 9919  C CA   . ASN A 1 69  ? 0.476   14.527  12.075  1.00 0.00 ? 69  ASN A CA   5  
ATOM 9920  C C    . ASN A 1 69  ? -0.511  14.440  10.916  1.00 0.00 ? 69  ASN A C    5  
ATOM 9921  O O    . ASN A 1 69  ? -0.369  13.599  10.028  1.00 0.00 ? 69  ASN A O    5  
ATOM 9922  C CB   . ASN A 1 69  ? -0.284  14.590  13.402  1.00 0.00 ? 69  ASN A CB   5  
ATOM 9923  C CG   . ASN A 1 69  ? 0.630   14.420  14.600  1.00 0.00 ? 69  ASN A CG   5  
ATOM 9924  O OD1  . ASN A 1 69  ? 1.812   14.108  14.454  1.00 0.00 ? 69  ASN A OD1  5  
ATOM 9925  N ND2  . ASN A 1 69  ? 0.084   14.625  15.794  1.00 0.00 ? 69  ASN A ND2  5  
ATOM 9926  H H    . ASN A 1 69  ? 1.304   16.401  12.607  1.00 0.00 ? 69  ASN A H    5  
ATOM 9927  H HA   . ASN A 1 69  ? 1.099   13.645  12.069  1.00 0.00 ? 69  ASN A HA   5  
ATOM 9928  H HB2  . ASN A 1 69  ? -0.777  15.548  13.482  1.00 0.00 ? 69  ASN A HB2  5  
ATOM 9929  H HB3  . ASN A 1 69  ? -1.025  13.805  13.424  1.00 0.00 ? 69  ASN A HB3  5  
ATOM 9930  H HD21 . ASN A 1 69  ? -0.863  14.871  15.834  1.00 0.00 ? 69  ASN A HD21 5  
ATOM 9931  H HD22 . ASN A 1 69  ? 0.653   14.522  16.585  1.00 0.00 ? 69  ASN A HD22 5  
ATOM 9932  N N    . TRP A 1 70  ? -1.509  15.316  10.929  1.00 0.00 ? 70  TRP A N    5  
ATOM 9933  C CA   . TRP A 1 70  ? -2.520  15.339  9.878   1.00 0.00 ? 70  TRP A CA   5  
ATOM 9934  C C    . TRP A 1 70  ? -1.892  15.073  8.514   1.00 0.00 ? 70  TRP A C    5  
ATOM 9935  O O    . TRP A 1 70  ? -2.364  14.224  7.757   1.00 0.00 ? 70  TRP A O    5  
ATOM 9936  C CB   . TRP A 1 70  ? -3.242  16.687  9.865   1.00 0.00 ? 70  TRP A CB   5  
ATOM 9937  C CG   . TRP A 1 70  ? -2.332  17.851  10.117  1.00 0.00 ? 70  TRP A CG   5  
ATOM 9938  C CD1  . TRP A 1 70  ? -1.530  18.477  9.205   1.00 0.00 ? 70  TRP A CD1  5  
ATOM 9939  C CD2  . TRP A 1 70  ? -2.129  18.526  11.363  1.00 0.00 ? 70  TRP A CD2  5  
ATOM 9940  N NE1  . TRP A 1 70  ? -0.841  19.501  9.808   1.00 0.00 ? 70  TRP A NE1  5  
ATOM 9941  C CE2  . TRP A 1 70  ? -1.191  19.553  11.132  1.00 0.00 ? 70  TRP A CE2  5  
ATOM 9942  C CE3  . TRP A 1 70  ? -2.647  18.367  12.650  1.00 0.00 ? 70  TRP A CE3  5  
ATOM 9943  C CZ2  . TRP A 1 70  ? -0.763  20.411  12.141  1.00 0.00 ? 70  TRP A CZ2  5  
ATOM 9944  C CZ3  . TRP A 1 70  ? -2.222  19.219  13.651  1.00 0.00 ? 70  TRP A CZ3  5  
ATOM 9945  C CH2  . TRP A 1 70  ? -1.288  20.231  13.393  1.00 0.00 ? 70  TRP A CH2  5  
ATOM 9946  H H    . TRP A 1 70  ? -1.570  15.962  11.665  1.00 0.00 ? 70  TRP A H    5  
ATOM 9947  H HA   . TRP A 1 70  ? -3.236  14.559  10.090  1.00 0.00 ? 70  TRP A HA   5  
ATOM 9948  H HB2  . TRP A 1 70  ? -3.708  16.831  8.903   1.00 0.00 ? 70  TRP A HB2  5  
ATOM 9949  H HB3  . TRP A 1 70  ? -4.002  16.686  10.634  1.00 0.00 ? 70  TRP A HB3  5  
ATOM 9950  H HD1  . TRP A 1 70  ? -1.459  18.197  8.165   1.00 0.00 ? 70  TRP A HD1  5  
ATOM 9951  H HE1  . TRP A 1 70  ? -0.204  20.098  9.362   1.00 0.00 ? 70  TRP A HE1  5  
ATOM 9952  H HE3  . TRP A 1 70  ? -3.368  17.592  12.869  1.00 0.00 ? 70  TRP A HE3  5  
ATOM 9953  H HZ2  . TRP A 1 70  ? -0.045  21.196  11.957  1.00 0.00 ? 70  TRP A HZ2  5  
ATOM 9954  H HZ3  . TRP A 1 70  ? -2.612  19.109  14.652  1.00 0.00 ? 70  TRP A HZ3  5  
ATOM 9955  H HH2  . TRP A 1 70  ? -0.984  20.874  14.204  1.00 0.00 ? 70  TRP A HH2  5  
ATOM 9956  N N    . HIS A 1 71  ? -0.825  15.803  8.205   1.00 0.00 ? 71  HIS A N    5  
ATOM 9957  C CA   . HIS A 1 71  ? -0.133  15.645  6.932   1.00 0.00 ? 71  HIS A CA   5  
ATOM 9958  C C    . HIS A 1 71  ? 0.297   14.196  6.723   1.00 0.00 ? 71  HIS A C    5  
ATOM 9959  O O    . HIS A 1 71  ? -0.042  13.577  5.716   1.00 0.00 ? 71  HIS A O    5  
ATOM 9960  C CB   . HIS A 1 71  ? 1.087   16.565  6.872   1.00 0.00 ? 71  HIS A CB   5  
ATOM 9961  C CG   . HIS A 1 71  ? 0.767   17.955  6.413   1.00 0.00 ? 71  HIS A CG   5  
ATOM 9962  N ND1  . HIS A 1 71  ? 0.615   19.016  7.280   1.00 0.00 ? 71  HIS A ND1  5  
ATOM 9963  C CD2  . HIS A 1 71  ? 0.573   18.455  5.170   1.00 0.00 ? 71  HIS A CD2  5  
ATOM 9964  C CE1  . HIS A 1 71  ? 0.339   20.109  6.590   1.00 0.00 ? 71  HIS A CE1  5  
ATOM 9965  N NE2  . HIS A 1 71  ? 0.308   19.795  5.307   1.00 0.00 ? 71  HIS A NE2  5  
ATOM 9966  H H    . HIS A 1 71  ? -0.497  16.465  8.849   1.00 0.00 ? 71  HIS A H    5  
ATOM 9967  H HA   . HIS A 1 71  ? -0.819  15.920  6.144   1.00 0.00 ? 71  HIS A HA   5  
ATOM 9968  H HB2  . HIS A 1 71  ? 1.526   16.634  7.857   1.00 0.00 ? 71  HIS A HB2  5  
ATOM 9969  H HB3  . HIS A 1 71  ? 1.811   16.148  6.188   1.00 0.00 ? 71  HIS A HB3  5  
ATOM 9970  H HD1  . HIS A 1 71  ? 0.696   18.976  8.255   1.00 0.00 ? 71  HIS A HD1  5  
ATOM 9971  H HD2  . HIS A 1 71  ? 0.617   17.901  4.242   1.00 0.00 ? 71  HIS A HD2  5  
ATOM 9972  H HE1  . HIS A 1 71  ? 0.168   21.092  7.003   1.00 0.00 ? 71  HIS A HE1  5  
ATOM 9973  H HE2  . HIS A 1 71  ? 0.041   20.400  4.584   1.00 0.00 ? 71  HIS A HE2  5  
ATOM 9974  N N    . GLN A 1 72  ? 1.047   13.664  7.683   1.00 0.00 ? 72  GLN A N    5  
ATOM 9975  C CA   . GLN A 1 72  ? 1.525   12.288  7.603   1.00 0.00 ? 72  GLN A CA   5  
ATOM 9976  C C    . GLN A 1 72  ? 0.368   11.324  7.365   1.00 0.00 ? 72  GLN A C    5  
ATOM 9977  O O    . GLN A 1 72  ? 0.489   10.373  6.591   1.00 0.00 ? 72  GLN A O    5  
ATOM 9978  C CB   . GLN A 1 72  ? 2.265   11.908  8.887   1.00 0.00 ? 72  GLN A CB   5  
ATOM 9979  C CG   . GLN A 1 72  ? 3.677   12.466  8.963   1.00 0.00 ? 72  GLN A CG   5  
ATOM 9980  C CD   . GLN A 1 72  ? 4.425   11.995  10.196  1.00 0.00 ? 72  GLN A CD   5  
ATOM 9981  O OE1  . GLN A 1 72  ? 4.363   10.822  10.563  1.00 0.00 ? 72  GLN A OE1  5  
ATOM 9982  N NE2  . GLN A 1 72  ? 5.139   12.911  10.841  1.00 0.00 ? 72  GLN A NE2  5  
ATOM 9983  H H    . GLN A 1 72  ? 1.285   14.208  8.462   1.00 0.00 ? 72  GLN A H    5  
ATOM 9984  H HA   . GLN A 1 72  ? 2.209   12.223  6.772   1.00 0.00 ? 72  GLN A HA   5  
ATOM 9985  H HB2  . GLN A 1 72  ? 1.708   12.280  9.734   1.00 0.00 ? 72  GLN A HB2  5  
ATOM 9986  H HB3  . GLN A 1 72  ? 2.323   10.831  8.950   1.00 0.00 ? 72  GLN A HB3  5  
ATOM 9987  H HG2  . GLN A 1 72  ? 4.224   12.150  8.087   1.00 0.00 ? 72  GLN A HG2  5  
ATOM 9988  H HG3  . GLN A 1 72  ? 3.622   13.545  8.983   1.00 0.00 ? 72  GLN A HG3  5  
ATOM 9989  H HE21 . GLN A 1 72  ? 5.140   13.827  10.490  1.00 0.00 ? 72  GLN A HE21 5  
ATOM 9990  H HE22 . GLN A 1 72  ? 5.630   12.635  11.641  1.00 0.00 ? 72  GLN A HE22 5  
ATOM 9991  N N    . LEU A 1 73  ? -0.752  11.573  8.034   1.00 0.00 ? 73  LEU A N    5  
ATOM 9992  C CA   . LEU A 1 73  ? -1.932  10.726  7.895   1.00 0.00 ? 73  LEU A CA   5  
ATOM 9993  C C    . LEU A 1 73  ? -2.435  10.726  6.455   1.00 0.00 ? 73  LEU A C    5  
ATOM 9994  O O    . LEU A 1 73  ? -2.593  9.670   5.844   1.00 0.00 ? 73  LEU A O    5  
ATOM 9995  C CB   . LEU A 1 73  ? -3.040  11.203  8.835   1.00 0.00 ? 73  LEU A CB   5  
ATOM 9996  C CG   . LEU A 1 73  ? -3.046  10.584  10.233  1.00 0.00 ? 73  LEU A CG   5  
ATOM 9997  C CD1  . LEU A 1 73  ? -3.170  9.070   10.146  1.00 0.00 ? 73  LEU A CD1  5  
ATOM 9998  C CD2  . LEU A 1 73  ? -1.789  10.974  10.996  1.00 0.00 ? 73  LEU A CD2  5  
ATOM 9999  H H    . LEU A 1 73  ? -0.787  12.345  8.636   1.00 0.00 ? 73  LEU A H    5  
ATOM 10000 H HA   . LEU A 1 73  ? -1.650  9.719   8.165   1.00 0.00 ? 73  LEU A HA   5  
ATOM 10001 H HB2  . LEU A 1 73  ? -2.941  12.271  8.948   1.00 0.00 ? 73  LEU A HB2  5  
ATOM 10002 H HB3  . LEU A 1 73  ? -3.988  10.978  8.368   1.00 0.00 ? 73  LEU A HB3  5  
ATOM 10003 H HG   . LEU A 1 73  ? -3.901  10.956  10.781  1.00 0.00 ? 73  LEU A HG   5  
ATOM 10004 H HD11 . LEU A 1 73  ? -4.067  8.752   10.656  1.00 0.00 ? 73  LEU A HD11 5  
ATOM 10005 H HD12 . LEU A 1 73  ? -2.309  8.612   10.610  1.00 0.00 ? 73  LEU A HD12 5  
ATOM 10006 H HD13 . LEU A 1 73  ? -3.221  8.772   9.109   1.00 0.00 ? 73  LEU A HD13 5  
ATOM 10007 H HD21 . LEU A 1 73  ? -0.940  10.941  10.331  1.00 0.00 ? 73  LEU A HD21 5  
ATOM 10008 H HD22 . LEU A 1 73  ? -1.634  10.284  11.812  1.00 0.00 ? 73  LEU A HD22 5  
ATOM 10009 H HD23 . LEU A 1 73  ? -1.903  11.975  11.387  1.00 0.00 ? 73  LEU A HD23 5  
ATOM 10010 N N    . GLU A 1 74  ? -2.683  11.917  5.921   1.00 0.00 ? 74  GLU A N    5  
ATOM 10011 C CA   . GLU A 1 74  ? -3.168  12.054  4.552   1.00 0.00 ? 74  GLU A CA   5  
ATOM 10012 C C    . GLU A 1 74  ? -2.456  11.076  3.622   1.00 0.00 ? 74  GLU A C    5  
ATOM 10013 O O    . GLU A 1 74  ? -3.089  10.399  2.814   1.00 0.00 ? 74  GLU A O    5  
ATOM 10014 C CB   . GLU A 1 74  ? -2.964  13.487  4.056   1.00 0.00 ? 74  GLU A CB   5  
ATOM 10015 C CG   . GLU A 1 74  ? -3.671  13.783  2.744   1.00 0.00 ? 74  GLU A CG   5  
ATOM 10016 C CD   . GLU A 1 74  ? -3.308  15.143  2.179   1.00 0.00 ? 74  GLU A CD   5  
ATOM 10017 O OE1  . GLU A 1 74  ? -3.433  16.144  2.916   1.00 0.00 ? 74  GLU A OE1  5  
ATOM 10018 O OE2  . GLU A 1 74  ? -2.898  15.207  1.001   1.00 0.00 ? 74  GLU A OE2  5  
ATOM 10019 H H    . GLU A 1 74  ? -2.538  12.723  6.459   1.00 0.00 ? 74  GLU A H    5  
ATOM 10020 H HA   . GLU A 1 74  ? -4.223  11.829  4.550   1.00 0.00 ? 74  GLU A HA   5  
ATOM 10021 H HB2  . GLU A 1 74  ? -3.337  14.171  4.804   1.00 0.00 ? 74  GLU A HB2  5  
ATOM 10022 H HB3  . GLU A 1 74  ? -1.906  13.660  3.918   1.00 0.00 ? 74  GLU A HB3  5  
ATOM 10023 H HG2  . GLU A 1 74  ? -3.396  13.027  2.023   1.00 0.00 ? 74  GLU A HG2  5  
ATOM 10024 H HG3  . GLU A 1 74  ? -4.737  13.751  2.909   1.00 0.00 ? 74  GLU A HG3  5  
ATOM 10025 N N    . ASN A 1 75  ? -1.134  11.010  3.744   1.00 0.00 ? 75  ASN A N    5  
ATOM 10026 C CA   . ASN A 1 75  ? -0.334  10.116  2.915   1.00 0.00 ? 75  ASN A CA   5  
ATOM 10027 C C    . ASN A 1 75  ? -0.950  8.720   2.868   1.00 0.00 ? 75  ASN A C    5  
ATOM 10028 O O    . ASN A 1 75  ? -1.297  8.219   1.797   1.00 0.00 ? 75  ASN A O    5  
ATOM 10029 C CB   . ASN A 1 75  ? 1.098   10.036  3.448   1.00 0.00 ? 75  ASN A CB   5  
ATOM 10030 C CG   . ASN A 1 75  ? 1.894   11.293  3.156   1.00 0.00 ? 75  ASN A CG   5  
ATOM 10031 O OD1  . ASN A 1 75  ? 1.493   12.119  2.337   1.00 0.00 ? 75  ASN A OD1  5  
ATOM 10032 N ND2  . ASN A 1 75  ? 3.030   11.442  3.827   1.00 0.00 ? 75  ASN A ND2  5  
ATOM 10033 H H    . ASN A 1 75  ? -0.685  11.575  4.407   1.00 0.00 ? 75  ASN A H    5  
ATOM 10034 H HA   . ASN A 1 75  ? -0.314  10.521  1.914   1.00 0.00 ? 75  ASN A HA   5  
ATOM 10035 H HB2  . ASN A 1 75  ? 1.069   9.892   4.518   1.00 0.00 ? 75  ASN A HB2  5  
ATOM 10036 H HB3  . ASN A 1 75  ? 1.600   9.198   2.989   1.00 0.00 ? 75  ASN A HB3  5  
ATOM 10037 H HD21 . ASN A 1 75  ? 3.288   10.743  4.464   1.00 0.00 ? 75  ASN A HD21 5  
ATOM 10038 H HD22 . ASN A 1 75  ? 3.566   12.246  3.659   1.00 0.00 ? 75  ASN A HD22 5  
ATOM 10039 N N    . LEU A 1 76  ? -1.083  8.099   4.034   1.00 0.00 ? 76  LEU A N    5  
ATOM 10040 C CA   . LEU A 1 76  ? -1.657  6.761   4.128   1.00 0.00 ? 76  LEU A CA   5  
ATOM 10041 C C    . LEU A 1 76  ? -3.099  6.752   3.629   1.00 0.00 ? 76  LEU A C    5  
ATOM 10042 O O    . LEU A 1 76  ? -3.468  5.940   2.781   1.00 0.00 ? 76  LEU A O    5  
ATOM 10043 C CB   . LEU A 1 76  ? -1.602  6.261   5.572   1.00 0.00 ? 76  LEU A CB   5  
ATOM 10044 C CG   . LEU A 1 76  ? -0.208  6.152   6.192   1.00 0.00 ? 76  LEU A CG   5  
ATOM 10045 C CD1  . LEU A 1 76  ? -0.307  5.816   7.672   1.00 0.00 ? 76  LEU A CD1  5  
ATOM 10046 C CD2  . LEU A 1 76  ? 0.622   5.108   5.459   1.00 0.00 ? 76  LEU A CD2  5  
ATOM 10047 H H    . LEU A 1 76  ? -0.788  8.549   4.853   1.00 0.00 ? 76  LEU A H    5  
ATOM 10048 H HA   . LEU A 1 76  ? -1.070  6.105   3.505   1.00 0.00 ? 76  LEU A HA   5  
ATOM 10049 H HB2  . LEU A 1 76  ? -2.182  6.939   6.179   1.00 0.00 ? 76  LEU A HB2  5  
ATOM 10050 H HB3  . LEU A 1 76  ? -2.054  5.280   5.599   1.00 0.00 ? 76  LEU A HB3  5  
ATOM 10051 H HG   . LEU A 1 76  ? 0.295   7.105   6.100   1.00 0.00 ? 76  LEU A HG   5  
ATOM 10052 H HD11 . LEU A 1 76  ? -1.235  6.200   8.067   1.00 0.00 ? 76  LEU A HD11 5  
ATOM 10053 H HD12 . LEU A 1 76  ? 0.522   6.264   8.198   1.00 0.00 ? 76  LEU A HD12 5  
ATOM 10054 H HD13 . LEU A 1 76  ? -0.276  4.743   7.799   1.00 0.00 ? 76  LEU A HD13 5  
ATOM 10055 H HD21 . LEU A 1 76  ? 1.623   5.486   5.308   1.00 0.00 ? 76  LEU A HD21 5  
ATOM 10056 H HD22 . LEU A 1 76  ? 0.168   4.896   4.502   1.00 0.00 ? 76  LEU A HD22 5  
ATOM 10057 H HD23 . LEU A 1 76  ? 0.663   4.203   6.047   1.00 0.00 ? 76  LEU A HD23 5  
ATOM 10058 N N    . SER A 1 77  ? -3.909  7.663   4.160   1.00 0.00 ? 77  SER A N    5  
ATOM 10059 C CA   . SER A 1 77  ? -5.311  7.758   3.770   1.00 0.00 ? 77  SER A CA   5  
ATOM 10060 C C    . SER A 1 77  ? -5.455  7.739   2.252   1.00 0.00 ? 77  SER A C    5  
ATOM 10061 O O    . SER A 1 77  ? -6.376  7.128   1.712   1.00 0.00 ? 77  SER A O    5  
ATOM 10062 C CB   . SER A 1 77  ? -5.933  9.036   4.337   1.00 0.00 ? 77  SER A CB   5  
ATOM 10063 O OG   . SER A 1 77  ? -6.426  8.825   5.649   1.00 0.00 ? 77  SER A OG   5  
ATOM 10064 H H    . SER A 1 77  ? -3.556  8.283   4.832   1.00 0.00 ? 77  SER A H    5  
ATOM 10065 H HA   . SER A 1 77  ? -5.828  6.904   4.180   1.00 0.00 ? 77  SER A HA   5  
ATOM 10066 H HB2  . SER A 1 77  ? -5.186  9.815   4.368   1.00 0.00 ? 77  SER A HB2  5  
ATOM 10067 H HB3  . SER A 1 77  ? -6.752  9.346   3.703   1.00 0.00 ? 77  SER A HB3  5  
ATOM 10068 H HG   . SER A 1 77  ? -5.729  8.997   6.285   1.00 0.00 ? 77  SER A HG   5  
ATOM 10069 N N    . ASN A 1 78  ? -4.538  8.415   1.568   1.00 0.00 ? 78  ASN A N    5  
ATOM 10070 C CA   . ASN A 1 78  ? -4.561  8.478   0.111   1.00 0.00 ? 78  ASN A CA   5  
ATOM 10071 C C    . ASN A 1 78  ? -4.139  7.144   -0.498  1.00 0.00 ? 78  ASN A C    5  
ATOM 10072 O O    . ASN A 1 78  ? -4.837  6.587   -1.345  1.00 0.00 ? 78  ASN A O    5  
ATOM 10073 C CB   . ASN A 1 78  ? -3.640  9.593   -0.388  1.00 0.00 ? 78  ASN A CB   5  
ATOM 10074 C CG   . ASN A 1 78  ? -4.227  10.972  -0.158  1.00 0.00 ? 78  ASN A CG   5  
ATOM 10075 O OD1  . ASN A 1 78  ? -5.435  11.123  0.026   1.00 0.00 ? 78  ASN A OD1  5  
ATOM 10076 N ND2  . ASN A 1 78  ? -3.371  11.988  -0.170  1.00 0.00 ? 78  ASN A ND2  5  
ATOM 10077 H H    . ASN A 1 78  ? -3.828  8.884   2.055   1.00 0.00 ? 78  ASN A H    5  
ATOM 10078 H HA   . ASN A 1 78  ? -5.573  8.695   -0.195  1.00 0.00 ? 78  ASN A HA   5  
ATOM 10079 H HB2  . ASN A 1 78  ? -2.697  9.532   0.134   1.00 0.00 ? 78  ASN A HB2  5  
ATOM 10080 H HB3  . ASN A 1 78  ? -3.470  9.465   -1.447  1.00 0.00 ? 78  ASN A HB3  5  
ATOM 10081 H HD21 . ASN A 1 78  ? -2.422  11.793  -0.324  1.00 0.00 ? 78  ASN A HD21 5  
ATOM 10082 H HD22 . ASN A 1 78  ? -3.723  12.891  -0.024  1.00 0.00 ? 78  ASN A HD22 5  
ATOM 10083 N N    . PHE A 1 79  ? -2.991  6.636   -0.059  1.00 0.00 ? 79  PHE A N    5  
ATOM 10084 C CA   . PHE A 1 79  ? -2.476  5.367   -0.560  1.00 0.00 ? 79  PHE A CA   5  
ATOM 10085 C C    . PHE A 1 79  ? -3.528  4.268   -0.444  1.00 0.00 ? 79  PHE A C    5  
ATOM 10086 O O    . PHE A 1 79  ? -3.786  3.539   -1.402  1.00 0.00 ? 79  PHE A O    5  
ATOM 10087 C CB   . PHE A 1 79  ? -1.215  4.966   0.209   1.00 0.00 ? 79  PHE A CB   5  
ATOM 10088 C CG   . PHE A 1 79  ? -0.715  3.593   -0.135  1.00 0.00 ? 79  PHE A CG   5  
ATOM 10089 C CD1  . PHE A 1 79  ? -0.473  3.239   -1.452  1.00 0.00 ? 79  PHE A CD1  5  
ATOM 10090 C CD2  . PHE A 1 79  ? -0.488  2.655   0.860   1.00 0.00 ? 79  PHE A CD2  5  
ATOM 10091 C CE1  . PHE A 1 79  ? -0.014  1.975   -1.771  1.00 0.00 ? 79  PHE A CE1  5  
ATOM 10092 C CE2  . PHE A 1 79  ? -0.028  1.390   0.547   1.00 0.00 ? 79  PHE A CE2  5  
ATOM 10093 C CZ   . PHE A 1 79  ? 0.210   1.049   -0.771  1.00 0.00 ? 79  PHE A CZ   5  
ATOM 10094 H H    . PHE A 1 79  ? -2.479  7.127   0.618   1.00 0.00 ? 79  PHE A H    5  
ATOM 10095 H HA   . PHE A 1 79  ? -2.224  5.502   -1.601  1.00 0.00 ? 79  PHE A HA   5  
ATOM 10096 H HB2  . PHE A 1 79  ? -0.427  5.670   -0.013  1.00 0.00 ? 79  PHE A HB2  5  
ATOM 10097 H HB3  . PHE A 1 79  ? -1.426  4.990   1.268   1.00 0.00 ? 79  PHE A HB3  5  
ATOM 10098 H HD1  . PHE A 1 79  ? -0.646  3.962   -2.236  1.00 0.00 ? 79  PHE A HD1  5  
ATOM 10099 H HD2  . PHE A 1 79  ? -0.674  2.920   1.891   1.00 0.00 ? 79  PHE A HD2  5  
ATOM 10100 H HE1  . PHE A 1 79  ? 0.173   1.711   -2.802  1.00 0.00 ? 79  PHE A HE1  5  
ATOM 10101 H HE2  . PHE A 1 79  ? 0.146   0.668   1.332   1.00 0.00 ? 79  PHE A HE2  5  
ATOM 10102 H HZ   . PHE A 1 79  ? 0.569   0.061   -1.018  1.00 0.00 ? 79  PHE A HZ   5  
ATOM 10103 N N    . ILE A 1 80  ? -4.130  4.156   0.734   1.00 0.00 ? 80  ILE A N    5  
ATOM 10104 C CA   . ILE A 1 80  ? -5.153  3.148   0.976   1.00 0.00 ? 80  ILE A CA   5  
ATOM 10105 C C    . ILE A 1 80  ? -6.208  3.160   -0.125  1.00 0.00 ? 80  ILE A C    5  
ATOM 10106 O O    . ILE A 1 80  ? -6.355  2.191   -0.871  1.00 0.00 ? 80  ILE A O    5  
ATOM 10107 C CB   . ILE A 1 80  ? -5.846  3.362   2.336   1.00 0.00 ? 80  ILE A CB   5  
ATOM 10108 C CG1  . ILE A 1 80  ? -4.822  3.286   3.471   1.00 0.00 ? 80  ILE A CG1  5  
ATOM 10109 C CG2  . ILE A 1 80  ? -6.945  2.330   2.537   1.00 0.00 ? 80  ILE A CG2  5  
ATOM 10110 C CD1  . ILE A 1 80  ? -5.254  4.014   4.724   1.00 0.00 ? 80  ILE A CD1  5  
ATOM 10111 H H    . ILE A 1 80  ? -3.880  4.768   1.459   1.00 0.00 ? 80  ILE A H    5  
ATOM 10112 H HA   . ILE A 1 80  ? -4.672  2.181   0.987   1.00 0.00 ? 80  ILE A HA   5  
ATOM 10113 H HB   . ILE A 1 80  ? -6.299  4.341   2.334   1.00 0.00 ? 80  ILE A HB   5  
ATOM 10114 H HG12 . ILE A 1 80  ? -4.656  2.251   3.729   1.00 0.00 ? 80  ILE A HG12 5  
ATOM 10115 H HG13 . ILE A 1 80  ? -3.892  3.722   3.136   1.00 0.00 ? 80  ILE A HG13 5  
ATOM 10116 H HG21 . ILE A 1 80  ? -7.438  2.140   1.596   1.00 0.00 ? 80  ILE A HG21 5  
ATOM 10117 H HG22 . ILE A 1 80  ? -6.514  1.412   2.909   1.00 0.00 ? 80  ILE A HG22 5  
ATOM 10118 H HG23 . ILE A 1 80  ? -7.664  2.705   3.251   1.00 0.00 ? 80  ILE A HG23 5  
ATOM 10119 H HD11 . ILE A 1 80  ? -5.907  4.832   4.458   1.00 0.00 ? 80  ILE A HD11 5  
ATOM 10120 H HD12 . ILE A 1 80  ? -5.779  3.331   5.375   1.00 0.00 ? 80  ILE A HD12 5  
ATOM 10121 H HD13 . ILE A 1 80  ? -4.383  4.400   5.234   1.00 0.00 ? 80  ILE A HD13 5  
ATOM 10122 N N    . LYS A 1 81  ? -6.940  4.265   -0.224  1.00 0.00 ? 81  LYS A N    5  
ATOM 10123 C CA   . LYS A 1 81  ? -7.979  4.406   -1.236  1.00 0.00 ? 81  LYS A CA   5  
ATOM 10124 C C    . LYS A 1 81  ? -7.478  3.941   -2.600  1.00 0.00 ? 81  LYS A C    5  
ATOM 10125 O O    . LYS A 1 81  ? -8.233  3.372   -3.388  1.00 0.00 ? 81  LYS A O    5  
ATOM 10126 C CB   . LYS A 1 81  ? -8.443  5.862   -1.320  1.00 0.00 ? 81  LYS A CB   5  
ATOM 10127 C CG   . LYS A 1 81  ? -9.102  6.366   -0.048  1.00 0.00 ? 81  LYS A CG   5  
ATOM 10128 C CD   . LYS A 1 81  ? -10.448 5.698   0.184   1.00 0.00 ? 81  LYS A CD   5  
ATOM 10129 C CE   . LYS A 1 81  ? -11.133 6.244   1.428   1.00 0.00 ? 81  LYS A CE   5  
ATOM 10130 N NZ   . LYS A 1 81  ? -10.607 5.613   2.672   1.00 0.00 ? 81  LYS A NZ   5  
ATOM 10131 H H    . LYS A 1 81  ? -6.776  5.004   0.400   1.00 0.00 ? 81  LYS A H    5  
ATOM 10132 H HA   . LYS A 1 81  ? -8.814  3.788   -0.943  1.00 0.00 ? 81  LYS A HA   5  
ATOM 10133 H HB2  . LYS A 1 81  ? -7.588  6.488   -1.530  1.00 0.00 ? 81  LYS A HB2  5  
ATOM 10134 H HB3  . LYS A 1 81  ? -9.153  5.955   -2.129  1.00 0.00 ? 81  LYS A HB3  5  
ATOM 10135 H HG2  . LYS A 1 81  ? -8.457  6.150   0.791   1.00 0.00 ? 81  LYS A HG2  5  
ATOM 10136 H HG3  . LYS A 1 81  ? -9.249  7.434   -0.127  1.00 0.00 ? 81  LYS A HG3  5  
ATOM 10137 H HD2  . LYS A 1 81  ? -11.082 5.880   -0.670  1.00 0.00 ? 81  LYS A HD2  5  
ATOM 10138 H HD3  . LYS A 1 81  ? -10.297 4.635   0.303   1.00 0.00 ? 81  LYS A HD3  5  
ATOM 10139 H HE2  . LYS A 1 81  ? -10.966 7.309   1.477   1.00 0.00 ? 81  LYS A HE2  5  
ATOM 10140 H HE3  . LYS A 1 81  ? -12.192 6.047   1.355   1.00 0.00 ? 81  LYS A HE3  5  
ATOM 10141 H HZ1  . LYS A 1 81  ? -9.567  5.594   2.650   1.00 0.00 ? 81  LYS A HZ1  5  
ATOM 10142 H HZ2  . LYS A 1 81  ? -10.958 4.638   2.753   1.00 0.00 ? 81  LYS A HZ2  5  
ATOM 10143 H HZ3  . LYS A 1 81  ? -10.916 6.153   3.505   1.00 0.00 ? 81  LYS A HZ3  5  
ATOM 10144 N N    . ALA A 1 82  ? -6.200  4.186   -2.870  1.00 0.00 ? 82  ALA A N    5  
ATOM 10145 C CA   . ALA A 1 82  ? -5.598  3.790   -4.137  1.00 0.00 ? 82  ALA A CA   5  
ATOM 10146 C C    . ALA A 1 82  ? -5.538  2.271   -4.264  1.00 0.00 ? 82  ALA A C    5  
ATOM 10147 O O    . ALA A 1 82  ? -5.688  1.725   -5.357  1.00 0.00 ? 82  ALA A O    5  
ATOM 10148 C CB   . ALA A 1 82  ? -4.205  4.387   -4.269  1.00 0.00 ? 82  ALA A CB   5  
ATOM 10149 H H    . ALA A 1 82  ? -5.649  4.643   -2.201  1.00 0.00 ? 82  ALA A H    5  
ATOM 10150 H HA   . ALA A 1 82  ? -6.210  4.185   -4.935  1.00 0.00 ? 82  ALA A HA   5  
ATOM 10151 H HB1  . ALA A 1 82  ? -4.198  5.106   -5.076  1.00 0.00 ? 82  ALA A HB1  5  
ATOM 10152 H HB2  . ALA A 1 82  ? -3.936  4.879   -3.346  1.00 0.00 ? 82  ALA A HB2  5  
ATOM 10153 H HB3  . ALA A 1 82  ? -3.495  3.602   -4.479  1.00 0.00 ? 82  ALA A HB3  5  
ATOM 10154 N N    . MET A 1 83  ? -5.318  1.596   -3.142  1.00 0.00 ? 83  MET A N    5  
ATOM 10155 C CA   . MET A 1 83  ? -5.239  0.140   -3.130  1.00 0.00 ? 83  MET A CA   5  
ATOM 10156 C C    . MET A 1 83  ? -6.566  -0.480  -3.557  1.00 0.00 ? 83  MET A C    5  
ATOM 10157 O O    . MET A 1 83  ? -6.594  -1.422  -4.350  1.00 0.00 ? 83  MET A O    5  
ATOM 10158 C CB   . MET A 1 83  ? -4.855  -0.359  -1.735  1.00 0.00 ? 83  MET A CB   5  
ATOM 10159 C CG   . MET A 1 83  ? -3.379  -0.188  -1.413  1.00 0.00 ? 83  MET A CG   5  
ATOM 10160 S SD   . MET A 1 83  ? -2.814  -1.319  -0.128  1.00 0.00 ? 83  MET A SD   5  
ATOM 10161 C CE   . MET A 1 83  ? -3.637  -0.638  1.310   1.00 0.00 ? 83  MET A CE   5  
ATOM 10162 H H    . MET A 1 83  ? -5.206  2.087   -2.301  1.00 0.00 ? 83  MET A H    5  
ATOM 10163 H HA   . MET A 1 83  ? -4.473  -0.156  -3.831  1.00 0.00 ? 83  MET A HA   5  
ATOM 10164 H HB2  . MET A 1 83  ? -5.428  0.186   -1.001  1.00 0.00 ? 83  MET A HB2  5  
ATOM 10165 H HB3  . MET A 1 83  ? -5.098  -1.410  -1.662  1.00 0.00 ? 83  MET A HB3  5  
ATOM 10166 H HG2  . MET A 1 83  ? -2.806  -0.370  -2.310  1.00 0.00 ? 83  MET A HG2  5  
ATOM 10167 H HG3  . MET A 1 83  ? -3.214  0.826   -1.081  1.00 0.00 ? 83  MET A HG3  5  
ATOM 10168 H HE1  . MET A 1 83  ? -3.016  0.128   1.752   1.00 0.00 ? 83  MET A HE1  5  
ATOM 10169 H HE2  . MET A 1 83  ? -4.582  -0.207  1.012   1.00 0.00 ? 83  MET A HE2  5  
ATOM 10170 H HE3  . MET A 1 83  ? -3.810  -1.423  2.030   1.00 0.00 ? 83  MET A HE3  5  
ATOM 10171 N N    . VAL A 1 84  ? -7.661  0.054   -3.027  1.00 0.00 ? 84  VAL A N    5  
ATOM 10172 C CA   . VAL A 1 84  ? -8.991  -0.447  -3.356  1.00 0.00 ? 84  VAL A CA   5  
ATOM 10173 C C    . VAL A 1 84  ? -9.217  -0.461  -4.863  1.00 0.00 ? 84  VAL A C    5  
ATOM 10174 O O    . VAL A 1 84  ? -9.758  -1.421  -5.411  1.00 0.00 ? 84  VAL A O    5  
ATOM 10175 C CB   . VAL A 1 84  ? -10.090 0.403   -2.691  1.00 0.00 ? 84  VAL A CB   5  
ATOM 10176 C CG1  . VAL A 1 84  ? -11.469 -0.069  -3.130  1.00 0.00 ? 84  VAL A CG1  5  
ATOM 10177 C CG2  . VAL A 1 84  ? -9.958  0.355   -1.177  1.00 0.00 ? 84  VAL A CG2  5  
ATOM 10178 H H    . VAL A 1 84  ? -7.573  0.803   -2.402  1.00 0.00 ? 84  VAL A H    5  
ATOM 10179 H HA   . VAL A 1 84  ? -9.070  -1.456  -2.980  1.00 0.00 ? 84  VAL A HA   5  
ATOM 10180 H HB   . VAL A 1 84  ? -9.966  1.428   -3.011  1.00 0.00 ? 84  VAL A HB   5  
ATOM 10181 H HG11 . VAL A 1 84  ? -12.047 0.778   -3.467  1.00 0.00 ? 84  VAL A HG11 5  
ATOM 10182 H HG12 . VAL A 1 84  ? -11.366 -0.780  -3.936  1.00 0.00 ? 84  VAL A HG12 5  
ATOM 10183 H HG13 . VAL A 1 84  ? -11.970 -0.537  -2.296  1.00 0.00 ? 84  VAL A HG13 5  
ATOM 10184 H HG21 . VAL A 1 84  ? -9.502  -0.580  -0.885  1.00 0.00 ? 84  VAL A HG21 5  
ATOM 10185 H HG22 . VAL A 1 84  ? -9.340  1.177   -0.843  1.00 0.00 ? 84  VAL A HG22 5  
ATOM 10186 H HG23 . VAL A 1 84  ? -10.936 0.435   -0.727  1.00 0.00 ? 84  VAL A HG23 5  
ATOM 10187 N N    . SER A 1 85  ? -8.797  0.610   -5.529  1.00 0.00 ? 85  SER A N    5  
ATOM 10188 C CA   . SER A 1 85  ? -8.955  0.722   -6.974  1.00 0.00 ? 85  SER A CA   5  
ATOM 10189 C C    . SER A 1 85  ? -8.057  -0.276  -7.699  1.00 0.00 ? 85  SER A C    5  
ATOM 10190 O O    . SER A 1 85  ? -8.449  -0.863  -8.707  1.00 0.00 ? 85  SER A O    5  
ATOM 10191 C CB   . SER A 1 85  ? -8.632  2.145   -7.435  1.00 0.00 ? 85  SER A CB   5  
ATOM 10192 O OG   . SER A 1 85  ? -8.485  2.203   -8.843  1.00 0.00 ? 85  SER A OG   5  
ATOM 10193 H H    . SER A 1 85  ? -8.372  1.343   -5.036  1.00 0.00 ? 85  SER A H    5  
ATOM 10194 H HA   . SER A 1 85  ? -9.985  0.501   -7.213  1.00 0.00 ? 85  SER A HA   5  
ATOM 10195 H HB2  . SER A 1 85  ? -9.432  2.807   -7.141  1.00 0.00 ? 85  SER A HB2  5  
ATOM 10196 H HB3  . SER A 1 85  ? -7.710  2.469   -6.974  1.00 0.00 ? 85  SER A HB3  5  
ATOM 10197 H HG   . SER A 1 85  ? -7.643  2.612   -9.060  1.00 0.00 ? 85  SER A HG   5  
ATOM 10198 N N    . TYR A 1 86  ? -6.849  -0.461  -7.177  1.00 0.00 ? 86  TYR A N    5  
ATOM 10199 C CA   . TYR A 1 86  ? -5.893  -1.386  -7.774  1.00 0.00 ? 86  TYR A CA   5  
ATOM 10200 C C    . TYR A 1 86  ? -6.528  -2.754  -8.005  1.00 0.00 ? 86  TYR A C    5  
ATOM 10201 O O    . TYR A 1 86  ? -6.440  -3.316  -9.096  1.00 0.00 ? 86  TYR A O    5  
ATOM 10202 C CB   . TYR A 1 86  ? -4.661  -1.528  -6.880  1.00 0.00 ? 86  TYR A CB   5  
ATOM 10203 C CG   . TYR A 1 86  ? -3.407  -1.911  -7.631  1.00 0.00 ? 86  TYR A CG   5  
ATOM 10204 C CD1  . TYR A 1 86  ? -2.942  -1.136  -8.686  1.00 0.00 ? 86  TYR A CD1  5  
ATOM 10205 C CD2  . TYR A 1 86  ? -2.686  -3.049  -7.288  1.00 0.00 ? 86  TYR A CD2  5  
ATOM 10206 C CE1  . TYR A 1 86  ? -1.796  -1.481  -9.377  1.00 0.00 ? 86  TYR A CE1  5  
ATOM 10207 C CE2  . TYR A 1 86  ? -1.540  -3.401  -7.972  1.00 0.00 ? 86  TYR A CE2  5  
ATOM 10208 C CZ   . TYR A 1 86  ? -1.099  -2.614  -9.016  1.00 0.00 ? 86  TYR A CZ   5  
ATOM 10209 O OH   . TYR A 1 86  ? 0.043   -2.964  -9.700  1.00 0.00 ? 86  TYR A OH   5  
ATOM 10210 H H    . TYR A 1 86  ? -6.594  0.036   -6.373  1.00 0.00 ? 86  TYR A H    5  
ATOM 10211 H HA   . TYR A 1 86  ? -5.588  -0.978  -8.728  1.00 0.00 ? 86  TYR A HA   5  
ATOM 10212 H HB2  . TYR A 1 86  ? -4.476  -0.589  -6.383  1.00 0.00 ? 86  TYR A HB2  5  
ATOM 10213 H HB3  . TYR A 1 86  ? -4.850  -2.291  -6.138  1.00 0.00 ? 86  TYR A HB3  5  
ATOM 10214 H HD1  . TYR A 1 86  ? -3.491  -0.248  -8.968  1.00 0.00 ? 86  TYR A HD1  5  
ATOM 10215 H HD2  . TYR A 1 86  ? -3.035  -3.663  -6.470  1.00 0.00 ? 86  TYR A HD2  5  
ATOM 10216 H HE1  . TYR A 1 86  ? -1.451  -0.866  -10.194 1.00 0.00 ? 86  TYR A HE1  5  
ATOM 10217 H HE2  . TYR A 1 86  ? -0.993  -4.289  -7.690  1.00 0.00 ? 86  TYR A HE2  5  
ATOM 10218 H HH   . TYR A 1 86  ? 0.373   -3.801  -9.367  1.00 0.00 ? 86  TYR A HH   5  
ATOM 10219 N N    . GLY A 1 87  ? -7.172  -3.283  -6.969  1.00 0.00 ? 87  GLY A N    5  
ATOM 10220 C CA   . GLY A 1 87  ? -7.814  -4.579  -7.077  1.00 0.00 ? 87  GLY A CA   5  
ATOM 10221 C C    . GLY A 1 87  ? -7.571  -5.451  -5.861  1.00 0.00 ? 87  GLY A C    5  
ATOM 10222 O O    . GLY A 1 87  ? -7.408  -6.665  -5.981  1.00 0.00 ? 87  GLY A O    5  
ATOM 10223 H H    . GLY A 1 87  ? -7.210  -2.788  -6.123  1.00 0.00 ? 87  GLY A H    5  
ATOM 10224 H HA2  . GLY A 1 87  ? -8.877  -4.434  -7.196  1.00 0.00 ? 87  GLY A HA2  5  
ATOM 10225 H HA3  . GLY A 1 87  ? -7.430  -5.087  -7.951  1.00 0.00 ? 87  GLY A HA3  5  
ATOM 10226 N N    . MET A 1 88  ? -7.545  -4.830  -4.686  1.00 0.00 ? 88  MET A N    5  
ATOM 10227 C CA   . MET A 1 88  ? -7.319  -5.557  -3.442  1.00 0.00 ? 88  MET A CA   5  
ATOM 10228 C C    . MET A 1 88  ? -8.642  -5.899  -2.764  1.00 0.00 ? 88  MET A C    5  
ATOM 10229 O O    . MET A 1 88  ? -9.713  -5.599  -3.288  1.00 0.00 ? 88  MET A O    5  
ATOM 10230 C CB   . MET A 1 88  ? -6.444  -4.732  -2.495  1.00 0.00 ? 88  MET A CB   5  
ATOM 10231 C CG   . MET A 1 88  ? -5.099  -4.349  -3.089  1.00 0.00 ? 88  MET A CG   5  
ATOM 10232 S SD   . MET A 1 88  ? -3.851  -5.631  -2.867  1.00 0.00 ? 88  MET A SD   5  
ATOM 10233 C CE   . MET A 1 88  ? -3.420  -5.388  -1.145  1.00 0.00 ? 88  MET A CE   5  
ATOM 10234 H H    . MET A 1 88  ? -7.681  -3.859  -4.654  1.00 0.00 ? 88  MET A H    5  
ATOM 10235 H HA   . MET A 1 88  ? -6.803  -6.475  -3.684  1.00 0.00 ? 88  MET A HA   5  
ATOM 10236 H HB2  . MET A 1 88  ? -6.970  -3.825  -2.237  1.00 0.00 ? 88  MET A HB2  5  
ATOM 10237 H HB3  . MET A 1 88  ? -6.267  -5.305  -1.598  1.00 0.00 ? 88  MET A HB3  5  
ATOM 10238 H HG2  . MET A 1 88  ? -5.224  -4.169  -4.146  1.00 0.00 ? 88  MET A HG2  5  
ATOM 10239 H HG3  . MET A 1 88  ? -4.755  -3.444  -2.612  1.00 0.00 ? 88  MET A HG3  5  
ATOM 10240 H HE1  . MET A 1 88  ? -2.479  -5.877  -0.937  1.00 0.00 ? 88  MET A HE1  5  
ATOM 10241 H HE2  . MET A 1 88  ? -3.329  -4.331  -0.942  1.00 0.00 ? 88  MET A HE2  5  
ATOM 10242 H HE3  . MET A 1 88  ? -4.192  -5.810  -0.518  1.00 0.00 ? 88  MET A HE3  5  
ATOM 10243 N N    . ASN A 1 89  ? -8.558  -6.528  -1.597  1.00 0.00 ? 89  ASN A N    5  
ATOM 10244 C CA   . ASN A 1 89  ? -9.749  -6.911  -0.847  1.00 0.00 ? 89  ASN A CA   5  
ATOM 10245 C C    . ASN A 1 89  ? -10.059 -5.888  0.242   1.00 0.00 ? 89  ASN A C    5  
ATOM 10246 O O    . ASN A 1 89  ? -9.202  -5.108  0.657   1.00 0.00 ? 89  ASN A O    5  
ATOM 10247 C CB   . ASN A 1 89  ? -9.562  -8.296  -0.224  1.00 0.00 ? 89  ASN A CB   5  
ATOM 10248 C CG   . ASN A 1 89  ? -10.011 -9.411  -1.148  1.00 0.00 ? 89  ASN A CG   5  
ATOM 10249 O OD1  . ASN A 1 89  ? -9.633  -9.452  -2.318  1.00 0.00 ? 89  ASN A OD1  5  
ATOM 10250 N ND2  . ASN A 1 89  ? -10.822 -10.322 -0.623  1.00 0.00 ? 89  ASN A ND2  5  
ATOM 10251 H H    . ASN A 1 89  ? -7.674  -6.741  -1.229  1.00 0.00 ? 89  ASN A H    5  
ATOM 10252 H HA   . ASN A 1 89  ? -10.578 -6.946  -1.538  1.00 0.00 ? 89  ASN A HA   5  
ATOM 10253 H HB2  . ASN A 1 89  ? -8.516  -8.442  0.004   1.00 0.00 ? 89  ASN A HB2  5  
ATOM 10254 H HB3  . ASN A 1 89  ? -10.136 -8.354  0.688   1.00 0.00 ? 89  ASN A HB3  5  
ATOM 10255 H HD21 . ASN A 1 89  ? -11.082 -10.225 0.317   1.00 0.00 ? 89  ASN A HD21 5  
ATOM 10256 H HD22 . ASN A 1 89  ? -11.127 -11.055 -1.198  1.00 0.00 ? 89  ASN A HD22 5  
ATOM 10257 N N    . PRO A 1 90  ? -11.314 -5.891  0.715   1.00 0.00 ? 90  PRO A N    5  
ATOM 10258 C CA   . PRO A 1 90  ? -11.767 -4.970  1.763   1.00 0.00 ? 90  PRO A CA   5  
ATOM 10259 C C    . PRO A 1 90  ? -11.148 -5.288  3.121   1.00 0.00 ? 90  PRO A C    5  
ATOM 10260 O O    . PRO A 1 90  ? -11.309 -4.532  4.079   1.00 0.00 ? 90  PRO A O    5  
ATOM 10261 C CB   . PRO A 1 90  ? -13.280 -5.191  1.799   1.00 0.00 ? 90  PRO A CB   5  
ATOM 10262 C CG   . PRO A 1 90  ? -13.473 -6.574  1.282   1.00 0.00 ? 90  PRO A CG   5  
ATOM 10263 C CD   . PRO A 1 90  ? -12.387 -6.793  0.266   1.00 0.00 ? 90  PRO A CD   5  
ATOM 10264 H HA   . PRO A 1 90  ? -11.556 -3.942  1.506   1.00 0.00 ? 90  PRO A HA   5  
ATOM 10265 H HB2  . PRO A 1 90  ? -13.636 -5.095  2.816   1.00 0.00 ? 90  PRO A HB2  5  
ATOM 10266 H HB3  . PRO A 1 90  ? -13.769 -4.462  1.170   1.00 0.00 ? 90  PRO A HB3  5  
ATOM 10267 H HG2  . PRO A 1 90  ? -13.380 -7.285  2.089   1.00 0.00 ? 90  PRO A HG2  5  
ATOM 10268 H HG3  . PRO A 1 90  ? -14.445 -6.659  0.817   1.00 0.00 ? 90  PRO A HG3  5  
ATOM 10269 H HD2  . PRO A 1 90  ? -12.058 -7.821  0.279   1.00 0.00 ? 90  PRO A HD2  5  
ATOM 10270 H HD3  . PRO A 1 90  ? -12.732 -6.518  -0.721  1.00 0.00 ? 90  PRO A HD3  5  
ATOM 10271 N N    . VAL A 1 91  ? -10.440 -6.411  3.195   1.00 0.00 ? 91  VAL A N    5  
ATOM 10272 C CA   . VAL A 1 91  ? -9.797  -6.829  4.435   1.00 0.00 ? 91  VAL A CA   5  
ATOM 10273 C C    . VAL A 1 91  ? -8.279  -6.773  4.312   1.00 0.00 ? 91  VAL A C    5  
ATOM 10274 O O    . VAL A 1 91  ? -7.566  -6.717  5.314   1.00 0.00 ? 91  VAL A O    5  
ATOM 10275 C CB   . VAL A 1 91  ? -10.217 -8.255  4.833   1.00 0.00 ? 91  VAL A CB   5  
ATOM 10276 C CG1  . VAL A 1 91  ? -10.314 -9.147  3.604   1.00 0.00 ? 91  VAL A CG1  5  
ATOM 10277 C CG2  . VAL A 1 91  ? -9.243  -8.834  5.847   1.00 0.00 ? 91  VAL A CG2  5  
ATOM 10278 H H    . VAL A 1 91  ? -10.348 -6.972  2.397   1.00 0.00 ? 91  VAL A H    5  
ATOM 10279 H HA   . VAL A 1 91  ? -10.110 -6.152  5.218   1.00 0.00 ? 91  VAL A HA   5  
ATOM 10280 H HB   . VAL A 1 91  ? -11.195 -8.206  5.291   1.00 0.00 ? 91  VAL A HB   5  
ATOM 10281 H HG11 . VAL A 1 91  ? -9.402  -9.066  3.030   1.00 0.00 ? 91  VAL A HG11 5  
ATOM 10282 H HG12 . VAL A 1 91  ? -10.457 -10.171 3.913   1.00 0.00 ? 91  VAL A HG12 5  
ATOM 10283 H HG13 . VAL A 1 91  ? -11.149 -8.832  2.996   1.00 0.00 ? 91  VAL A HG13 5  
ATOM 10284 H HG21 . VAL A 1 91  ? -9.162  -8.165  6.690   1.00 0.00 ? 91  VAL A HG21 5  
ATOM 10285 H HG22 . VAL A 1 91  ? -9.602  -9.796  6.185   1.00 0.00 ? 91  VAL A HG22 5  
ATOM 10286 H HG23 . VAL A 1 91  ? -8.274  -8.954  5.388   1.00 0.00 ? 91  VAL A HG23 5  
ATOM 10287 N N    . ASP A 1 92  ? -7.790  -6.790  3.076   1.00 0.00 ? 92  ASP A N    5  
ATOM 10288 C CA   . ASP A 1 92  ? -6.355  -6.741  2.821   1.00 0.00 ? 92  ASP A CA   5  
ATOM 10289 C C    . ASP A 1 92  ? -5.841  -5.306  2.885   1.00 0.00 ? 92  ASP A C    5  
ATOM 10290 O O    . ASP A 1 92  ? -4.748  -5.005  2.404   1.00 0.00 ? 92  ASP A O    5  
ATOM 10291 C CB   . ASP A 1 92  ? -6.038  -7.349  1.454   1.00 0.00 ? 92  ASP A CB   5  
ATOM 10292 C CG   . ASP A 1 92  ? -6.160  -8.860  1.450   1.00 0.00 ? 92  ASP A CG   5  
ATOM 10293 O OD1  . ASP A 1 92  ? -5.982  -9.472  2.523   1.00 0.00 ? 92  ASP A OD1  5  
ATOM 10294 O OD2  . ASP A 1 92  ? -6.434  -9.431  0.373   1.00 0.00 ? 92  ASP A OD2  5  
ATOM 10295 H H    . ASP A 1 92  ? -8.409  -6.837  2.318   1.00 0.00 ? 92  ASP A H    5  
ATOM 10296 H HA   . ASP A 1 92  ? -5.862  -7.322  3.586   1.00 0.00 ? 92  ASP A HA   5  
ATOM 10297 H HB2  . ASP A 1 92  ? -6.723  -6.949  0.722   1.00 0.00 ? 92  ASP A HB2  5  
ATOM 10298 H HB3  . ASP A 1 92  ? -5.027  -7.087  1.177   1.00 0.00 ? 92  ASP A HB3  5  
ATOM 10299 N N    . LEU A 1 93  ? -6.636  -4.425  3.482   1.00 0.00 ? 93  LEU A N    5  
ATOM 10300 C CA   . LEU A 1 93  ? -6.262  -3.020  3.608   1.00 0.00 ? 93  LEU A CA   5  
ATOM 10301 C C    . LEU A 1 93  ? -5.804  -2.705  5.029   1.00 0.00 ? 93  LEU A C    5  
ATOM 10302 O O    . LEU A 1 93  ? -5.837  -3.566  5.908   1.00 0.00 ? 93  LEU A O    5  
ATOM 10303 C CB   . LEU A 1 93  ? -7.440  -2.122  3.227   1.00 0.00 ? 93  LEU A CB   5  
ATOM 10304 C CG   . LEU A 1 93  ? -8.006  -2.318  1.821   1.00 0.00 ? 93  LEU A CG   5  
ATOM 10305 C CD1  . LEU A 1 93  ? -9.265  -1.485  1.632   1.00 0.00 ? 93  LEU A CD1  5  
ATOM 10306 C CD2  . LEU A 1 93  ? -6.964  -1.959  0.772   1.00 0.00 ? 93  LEU A CD2  5  
ATOM 10307 H H    . LEU A 1 93  ? -7.494  -4.724  3.846   1.00 0.00 ? 93  LEU A H    5  
ATOM 10308 H HA   . LEU A 1 93  ? -5.443  -2.833  2.929   1.00 0.00 ? 93  LEU A HA   5  
ATOM 10309 H HB2  . LEU A 1 93  ? -8.236  -2.305  3.934   1.00 0.00 ? 93  LEU A HB2  5  
ATOM 10310 H HB3  . LEU A 1 93  ? -7.113  -1.095  3.315   1.00 0.00 ? 93  LEU A HB3  5  
ATOM 10311 H HG   . LEU A 1 93  ? -8.271  -3.357  1.689   1.00 0.00 ? 93  LEU A HG   5  
ATOM 10312 H HD11 . LEU A 1 93  ? -9.030  -0.603  1.057   1.00 0.00 ? 93  LEU A HD11 5  
ATOM 10313 H HD12 . LEU A 1 93  ? -9.652  -1.194  2.597   1.00 0.00 ? 93  LEU A HD12 5  
ATOM 10314 H HD13 . LEU A 1 93  ? -10.008 -2.070  1.110   1.00 0.00 ? 93  LEU A HD13 5  
ATOM 10315 H HD21 . LEU A 1 93  ? -7.199  -0.993  0.348   1.00 0.00 ? 93  LEU A HD21 5  
ATOM 10316 H HD22 . LEU A 1 93  ? -6.967  -2.705  -0.009  1.00 0.00 ? 93  LEU A HD22 5  
ATOM 10317 H HD23 . LEU A 1 93  ? -5.988  -1.921  1.232   1.00 0.00 ? 93  LEU A HD23 5  
ATOM 10318 N N    . PHE A 1 94  ? -5.379  -1.465  5.246   1.00 0.00 ? 94  PHE A N    5  
ATOM 10319 C CA   . PHE A 1 94  ? -4.917  -1.034  6.561   1.00 0.00 ? 94  PHE A CA   5  
ATOM 10320 C C    . PHE A 1 94  ? -5.268  0.429   6.809   1.00 0.00 ? 94  PHE A C    5  
ATOM 10321 O O    . PHE A 1 94  ? -5.215  1.255   5.898   1.00 0.00 ? 94  PHE A O    5  
ATOM 10322 C CB   . PHE A 1 94  ? -3.404  -1.234  6.682   1.00 0.00 ? 94  PHE A CB   5  
ATOM 10323 C CG   . PHE A 1 94  ? -2.603  -0.261  5.866   1.00 0.00 ? 94  PHE A CG   5  
ATOM 10324 C CD1  . PHE A 1 94  ? -2.277  -0.544  4.549   1.00 0.00 ? 94  PHE A CD1  5  
ATOM 10325 C CD2  . PHE A 1 94  ? -2.176  0.937   6.414   1.00 0.00 ? 94  PHE A CD2  5  
ATOM 10326 C CE1  . PHE A 1 94  ? -1.540  0.350   3.796   1.00 0.00 ? 94  PHE A CE1  5  
ATOM 10327 C CE2  . PHE A 1 94  ? -1.438  1.835   5.667   1.00 0.00 ? 94  PHE A CE2  5  
ATOM 10328 C CZ   . PHE A 1 94  ? -1.121  1.541   4.355   1.00 0.00 ? 94  PHE A CZ   5  
ATOM 10329 H H    . PHE A 1 94  ? -5.376  -0.823  4.505   1.00 0.00 ? 94  PHE A H    5  
ATOM 10330 H HA   . PHE A 1 94  ? -5.411  -1.643  7.301   1.00 0.00 ? 94  PHE A HA   5  
ATOM 10331 H HB2  . PHE A 1 94  ? -3.115  -1.116  7.715   1.00 0.00 ? 94  PHE A HB2  5  
ATOM 10332 H HB3  . PHE A 1 94  ? -3.152  -2.231  6.354   1.00 0.00 ? 94  PHE A HB3  5  
ATOM 10333 H HD1  . PHE A 1 94  ? -2.605  -1.475  4.110   1.00 0.00 ? 94  PHE A HD1  5  
ATOM 10334 H HD2  . PHE A 1 94  ? -2.425  1.169   7.441   1.00 0.00 ? 94  PHE A HD2  5  
ATOM 10335 H HE1  . PHE A 1 94  ? -1.293  0.117   2.770   1.00 0.00 ? 94  PHE A HE1  5  
ATOM 10336 H HE2  . PHE A 1 94  ? -1.112  2.766   6.107   1.00 0.00 ? 94  PHE A HE2  5  
ATOM 10337 H HZ   . PHE A 1 94  ? -0.544  2.241   3.768   1.00 0.00 ? 94  PHE A HZ   5  
ATOM 10338 N N    . GLU A 1 95  ? -5.631  0.743   8.049   1.00 0.00 ? 95  GLU A N    5  
ATOM 10339 C CA   . GLU A 1 95  ? -5.994  2.105   8.418   1.00 0.00 ? 95  GLU A CA   5  
ATOM 10340 C C    . GLU A 1 95  ? -4.750  2.976   8.576   1.00 0.00 ? 95  GLU A C    5  
ATOM 10341 O O    . GLU A 1 95  ? -3.641  2.468   8.737   1.00 0.00 ? 95  GLU A O    5  
ATOM 10342 C CB   . GLU A 1 95  ? -6.801  2.109   9.717   1.00 0.00 ? 95  GLU A CB   5  
ATOM 10343 C CG   . GLU A 1 95  ? -8.287  1.863   9.512   1.00 0.00 ? 95  GLU A CG   5  
ATOM 10344 C CD   . GLU A 1 95  ? -9.062  1.860   10.815  1.00 0.00 ? 95  GLU A CD   5  
ATOM 10345 O OE1  . GLU A 1 95  ? -8.598  2.496   11.784  1.00 0.00 ? 95  GLU A OE1  5  
ATOM 10346 O OE2  . GLU A 1 95  ? -10.135 1.221   10.864  1.00 0.00 ? 95  GLU A OE2  5  
ATOM 10347 H H    . GLU A 1 95  ? -5.655  0.040   8.731   1.00 0.00 ? 95  GLU A H    5  
ATOM 10348 H HA   . GLU A 1 95  ? -6.604  2.512   7.624   1.00 0.00 ? 95  GLU A HA   5  
ATOM 10349 H HB2  . GLU A 1 95  ? -6.415  1.338   10.369  1.00 0.00 ? 95  GLU A HB2  5  
ATOM 10350 H HB3  . GLU A 1 95  ? -6.680  3.068   10.199  1.00 0.00 ? 95  GLU A HB3  5  
ATOM 10351 H HG2  . GLU A 1 95  ? -8.683  2.640   8.877   1.00 0.00 ? 95  GLU A HG2  5  
ATOM 10352 H HG3  . GLU A 1 95  ? -8.416  0.904   9.031   1.00 0.00 ? 95  GLU A HG3  5  
ATOM 10353 N N    . ALA A 1 96  ? -4.944  4.290   8.528   1.00 0.00 ? 96  ALA A N    5  
ATOM 10354 C CA   . ALA A 1 96  ? -3.840  5.231   8.667   1.00 0.00 ? 96  ALA A CA   5  
ATOM 10355 C C    . ALA A 1 96  ? -3.220  5.147   10.057  1.00 0.00 ? 96  ALA A C    5  
ATOM 10356 O O    . ALA A 1 96  ? -1.999  5.193   10.207  1.00 0.00 ? 96  ALA A O    5  
ATOM 10357 C CB   . ALA A 1 96  ? -4.316  6.649   8.384   1.00 0.00 ? 96  ALA A CB   5  
ATOM 10358 H H    . ALA A 1 96  ? -5.853  4.634   8.397   1.00 0.00 ? 96  ALA A H    5  
ATOM 10359 H HA   . ALA A 1 96  ? -3.090  4.976   7.933   1.00 0.00 ? 96  ALA A HA   5  
ATOM 10360 H HB1  . ALA A 1 96  ? -4.421  7.185   9.316   1.00 0.00 ? 96  ALA A HB1  5  
ATOM 10361 H HB2  . ALA A 1 96  ? -3.595  7.151   7.757   1.00 0.00 ? 96  ALA A HB2  5  
ATOM 10362 H HB3  . ALA A 1 96  ? -5.270  6.614   7.880   1.00 0.00 ? 96  ALA A HB3  5  
ATOM 10363 N N    . ASN A 1 97  ? -4.069  5.024   11.073  1.00 0.00 ? 97  ASN A N    5  
ATOM 10364 C CA   . ASN A 1 97  ? -3.603  4.935   12.452  1.00 0.00 ? 97  ASN A CA   5  
ATOM 10365 C C    . ASN A 1 97  ? -2.772  3.674   12.666  1.00 0.00 ? 97  ASN A C    5  
ATOM 10366 O O    . ASN A 1 97  ? -1.741  3.704   13.338  1.00 0.00 ? 97  ASN A O    5  
ATOM 10367 C CB   . ASN A 1 97  ? -4.792  4.946   13.416  1.00 0.00 ? 97  ASN A CB   5  
ATOM 10368 C CG   . ASN A 1 97  ? -5.347  3.557   13.663  1.00 0.00 ? 97  ASN A CG   5  
ATOM 10369 O OD1  . ASN A 1 97  ? -4.988  2.897   14.638  1.00 0.00 ? 97  ASN A OD1  5  
ATOM 10370 N ND2  . ASN A 1 97  ? -6.230  3.106   12.778  1.00 0.00 ? 97  ASN A ND2  5  
ATOM 10371 H H    . ASN A 1 97  ? -5.031  4.993   10.891  1.00 0.00 ? 97  ASN A H    5  
ATOM 10372 H HA   . ASN A 1 97  ? -2.985  5.798   12.649  1.00 0.00 ? 97  ASN A HA   5  
ATOM 10373 H HB2  . ASN A 1 97  ? -4.477  5.361   14.362  1.00 0.00 ? 97  ASN A HB2  5  
ATOM 10374 H HB3  . ASN A 1 97  ? -5.578  5.560   13.002  1.00 0.00 ? 97  ASN A HB3  5  
ATOM 10375 H HD21 . ASN A 1 97  ? -6.469  3.688   12.026  1.00 0.00 ? 97  ASN A HD21 5  
ATOM 10376 H HD22 . ASN A 1 97  ? -6.606  2.212   12.914  1.00 0.00 ? 97  ASN A HD22 5  
ATOM 10377 N N    . ASP A 1 98  ? -3.228  2.567   12.088  1.00 0.00 ? 98  ASP A N    5  
ATOM 10378 C CA   . ASP A 1 98  ? -2.527  1.295   12.214  1.00 0.00 ? 98  ASP A CA   5  
ATOM 10379 C C    . ASP A 1 98  ? -1.016  1.499   12.148  1.00 0.00 ? 98  ASP A C    5  
ATOM 10380 O O    . ASP A 1 98  ? -0.266  0.926   12.940  1.00 0.00 ? 98  ASP A O    5  
ATOM 10381 C CB   . ASP A 1 98  ? -2.972  0.332   11.112  1.00 0.00 ? 98  ASP A CB   5  
ATOM 10382 C CG   . ASP A 1 98  ? -4.339  -0.265  11.383  1.00 0.00 ? 98  ASP A CG   5  
ATOM 10383 O OD1  . ASP A 1 98  ? -4.769  -0.252  12.555  1.00 0.00 ? 98  ASP A OD1  5  
ATOM 10384 O OD2  . ASP A 1 98  ? -4.978  -0.746  10.424  1.00 0.00 ? 98  ASP A OD2  5  
ATOM 10385 H H    . ASP A 1 98  ? -4.056  2.608   11.565  1.00 0.00 ? 98  ASP A H    5  
ATOM 10386 H HA   . ASP A 1 98  ? -2.779  0.871   13.173  1.00 0.00 ? 98  ASP A HA   5  
ATOM 10387 H HB2  . ASP A 1 98  ? -3.013  0.864   10.172  1.00 0.00 ? 98  ASP A HB2  5  
ATOM 10388 H HB3  . ASP A 1 98  ? -2.256  -0.472  11.035  1.00 0.00 ? 98  ASP A HB3  5  
ATOM 10389 N N    . LEU A 1 99  ? -0.576  2.317   11.198  1.00 0.00 ? 99  LEU A N    5  
ATOM 10390 C CA   . LEU A 1 99  ? 0.847   2.596   11.029  1.00 0.00 ? 99  LEU A CA   5  
ATOM 10391 C C    . LEU A 1 99  ? 1.264   3.816   11.843  1.00 0.00 ? 99  LEU A C    5  
ATOM 10392 O O    . LEU A 1 99  ? 2.264   3.785   12.560  1.00 0.00 ? 99  LEU A O    5  
ATOM 10393 C CB   . LEU A 1 99  ? 1.168   2.821   9.550   1.00 0.00 ? 99  LEU A CB   5  
ATOM 10394 C CG   . LEU A 1 99  ? 2.651   2.949   9.198   1.00 0.00 ? 99  LEU A CG   5  
ATOM 10395 C CD1  . LEU A 1 99  ? 3.365   1.623   9.410   1.00 0.00 ? 99  LEU A CD1  5  
ATOM 10396 C CD2  . LEU A 1 99  ? 2.819   3.425   7.762   1.00 0.00 ? 99  LEU A CD2  5  
ATOM 10397 H H    . LEU A 1 99  ? -1.221  2.745   10.598  1.00 0.00 ? 99  LEU A H    5  
ATOM 10398 H HA   . LEU A 1 99  ? 1.397   1.737   11.382  1.00 0.00 ? 99  LEU A HA   5  
ATOM 10399 H HB2  . LEU A 1 99  ? 0.767   1.989   8.993   1.00 0.00 ? 99  LEU A HB2  5  
ATOM 10400 H HB3  . LEU A 1 99  ? 0.674   3.731   9.240   1.00 0.00 ? 99  LEU A HB3  5  
ATOM 10401 H HG   . LEU A 1 99  ? 3.108   3.681   9.850   1.00 0.00 ? 99  LEU A HG   5  
ATOM 10402 H HD11 . LEU A 1 99  ? 3.833   1.617   10.383  1.00 0.00 ? 99  LEU A HD11 5  
ATOM 10403 H HD12 . LEU A 1 99  ? 4.120   1.496   8.648   1.00 0.00 ? 99  LEU A HD12 5  
ATOM 10404 H HD13 . LEU A 1 99  ? 2.651   0.816   9.348   1.00 0.00 ? 99  LEU A HD13 5  
ATOM 10405 H HD21 . LEU A 1 99  ? 3.786   3.115   7.392   1.00 0.00 ? 99  LEU A HD21 5  
ATOM 10406 H HD22 . LEU A 1 99  ? 2.749   4.502   7.729   1.00 0.00 ? 99  LEU A HD22 5  
ATOM 10407 H HD23 . LEU A 1 99  ? 2.043   2.995   7.147   1.00 0.00 ? 99  LEU A HD23 5  
ATOM 10408 N N    . PHE A 1 100 ? 0.489   4.889   11.730  1.00 0.00 ? 100 PHE A N    5  
ATOM 10409 C CA   . PHE A 1 100 ? 0.777   6.120   12.458  1.00 0.00 ? 100 PHE A CA   5  
ATOM 10410 C C    . PHE A 1 100 ? 0.993   5.838   13.941  1.00 0.00 ? 100 PHE A C    5  
ATOM 10411 O O    . PHE A 1 100 ? 2.080   6.057   14.474  1.00 0.00 ? 100 PHE A O    5  
ATOM 10412 C CB   . PHE A 1 100 ? -0.365  7.123   12.280  1.00 0.00 ? 100 PHE A CB   5  
ATOM 10413 C CG   . PHE A 1 100 ? -0.003  8.522   12.686  1.00 0.00 ? 100 PHE A CG   5  
ATOM 10414 C CD1  . PHE A 1 100 ? 0.956   9.236   11.987  1.00 0.00 ? 100 PHE A CD1  5  
ATOM 10415 C CD2  . PHE A 1 100 ? -0.622  9.125   13.770  1.00 0.00 ? 100 PHE A CD2  5  
ATOM 10416 C CE1  . PHE A 1 100 ? 1.292   10.524  12.358  1.00 0.00 ? 100 PHE A CE1  5  
ATOM 10417 C CE2  . PHE A 1 100 ? -0.291  10.413  14.146  1.00 0.00 ? 100 PHE A CE2  5  
ATOM 10418 C CZ   . PHE A 1 100 ? 0.668   11.113  13.440  1.00 0.00 ? 100 PHE A CZ   5  
ATOM 10419 H H    . PHE A 1 100 ? -0.296  4.854   11.143  1.00 0.00 ? 100 PHE A H    5  
ATOM 10420 H HA   . PHE A 1 100 ? 1.682   6.542   12.049  1.00 0.00 ? 100 PHE A HA   5  
ATOM 10421 H HB2  . PHE A 1 100 ? -0.656  7.145   11.240  1.00 0.00 ? 100 PHE A HB2  5  
ATOM 10422 H HB3  . PHE A 1 100 ? -1.207  6.809   12.878  1.00 0.00 ? 100 PHE A HB3  5  
ATOM 10423 H HD1  . PHE A 1 100 ? 1.445   8.775   11.140  1.00 0.00 ? 100 PHE A HD1  5  
ATOM 10424 H HD2  . PHE A 1 100 ? -1.372  8.579   14.324  1.00 0.00 ? 100 PHE A HD2  5  
ATOM 10425 H HE1  . PHE A 1 100 ? 2.041   11.068  11.804  1.00 0.00 ? 100 PHE A HE1  5  
ATOM 10426 H HE2  . PHE A 1 100 ? -0.781  10.872  14.993  1.00 0.00 ? 100 PHE A HE2  5  
ATOM 10427 H HZ   . PHE A 1 100 ? 0.927   12.120  13.732  1.00 0.00 ? 100 PHE A HZ   5  
ATOM 10428 N N    . GLU A 1 101 ? -0.052  5.349   14.603  1.00 0.00 ? 101 GLU A N    5  
ATOM 10429 C CA   . GLU A 1 101 ? 0.024   5.037   16.026  1.00 0.00 ? 101 GLU A CA   5  
ATOM 10430 C C    . GLU A 1 101 ? 0.307   3.553   16.243  1.00 0.00 ? 101 GLU A C    5  
ATOM 10431 O O    . GLU A 1 101 ? -0.164  2.956   17.211  1.00 0.00 ? 101 GLU A O    5  
ATOM 10432 C CB   . GLU A 1 101 ? -1.280  5.426   16.725  1.00 0.00 ? 101 GLU A CB   5  
ATOM 10433 C CG   . GLU A 1 101 ? -1.686  6.873   16.496  1.00 0.00 ? 101 GLU A CG   5  
ATOM 10434 C CD   . GLU A 1 101 ? -2.469  7.450   17.660  1.00 0.00 ? 101 GLU A CD   5  
ATOM 10435 O OE1  . GLU A 1 101 ? -2.084  7.192   18.819  1.00 0.00 ? 101 GLU A OE1  5  
ATOM 10436 O OE2  . GLU A 1 101 ? -3.465  8.160   17.411  1.00 0.00 ? 101 GLU A OE2  5  
ATOM 10437 H H    . GLU A 1 101 ? -0.892  5.194   14.123  1.00 0.00 ? 101 GLU A H    5  
ATOM 10438 H HA   . GLU A 1 101 ? 0.834   5.611   16.448  1.00 0.00 ? 101 GLU A HA   5  
ATOM 10439 H HB2  . GLU A 1 101 ? -2.075  4.790   16.362  1.00 0.00 ? 101 GLU A HB2  5  
ATOM 10440 H HB3  . GLU A 1 101 ? -1.165  5.270   17.788  1.00 0.00 ? 101 GLU A HB3  5  
ATOM 10441 H HG2  . GLU A 1 101 ? -0.793  7.464   16.354  1.00 0.00 ? 101 GLU A HG2  5  
ATOM 10442 H HG3  . GLU A 1 101 ? -2.297  6.925   15.608  1.00 0.00 ? 101 GLU A HG3  5  
ATOM 10443 N N    . SER A 1 102 ? 1.078   2.964   15.335  1.00 0.00 ? 102 SER A N    5  
ATOM 10444 C CA   . SER A 1 102 ? 1.421   1.550   15.424  1.00 0.00 ? 102 SER A CA   5  
ATOM 10445 C C    . SER A 1 102 ? 0.220   0.728   15.879  1.00 0.00 ? 102 SER A C    5  
ATOM 10446 O O    . SER A 1 102 ? 0.372   -0.353  16.446  1.00 0.00 ? 102 SER A O    5  
ATOM 10447 C CB   . SER A 1 102 ? 2.588   1.346   16.392  1.00 0.00 ? 102 SER A CB   5  
ATOM 10448 O OG   . SER A 1 102 ? 2.207   1.654   17.722  1.00 0.00 ? 102 SER A OG   5  
ATOM 10449 H H    . SER A 1 102 ? 1.423   3.494   14.585  1.00 0.00 ? 102 SER A H    5  
ATOM 10450 H HA   . SER A 1 102 ? 1.718   1.218   14.440  1.00 0.00 ? 102 SER A HA   5  
ATOM 10451 H HB2  . SER A 1 102 ? 2.911   0.317   16.351  1.00 0.00 ? 102 SER A HB2  5  
ATOM 10452 H HB3  . SER A 1 102 ? 3.406   1.992   16.105  1.00 0.00 ? 102 SER A HB3  5  
ATOM 10453 H HG   . SER A 1 102 ? 1.799   0.884   18.124  1.00 0.00 ? 102 SER A HG   5  
ATOM 10454 N N    . GLY A 1 103 ? -0.977  1.248   15.624  1.00 0.00 ? 103 GLY A N    5  
ATOM 10455 C CA   . GLY A 1 103 ? -2.189  0.550   16.013  1.00 0.00 ? 103 GLY A CA   5  
ATOM 10456 C C    . GLY A 1 103 ? -2.290  -0.827  15.387  1.00 0.00 ? 103 GLY A C    5  
ATOM 10457 O O    . GLY A 1 103 ? -3.094  -1.653  15.818  1.00 0.00 ? 103 GLY A O    5  
ATOM 10458 H H    . GLY A 1 103 ? -1.038  2.114   15.168  1.00 0.00 ? 103 GLY A H    5  
ATOM 10459 H HA2  . GLY A 1 103 ? -2.202  0.447   17.088  1.00 0.00 ? 103 GLY A HA2  5  
ATOM 10460 H HA3  . GLY A 1 103 ? -3.043  1.136   15.707  1.00 0.00 ? 103 GLY A HA3  5  
ATOM 10461 N N    . ASN A 1 104 ? -1.476  -1.073  14.367  1.00 0.00 ? 104 ASN A N    5  
ATOM 10462 C CA   . ASN A 1 104 ? -1.480  -2.359  13.679  1.00 0.00 ? 104 ASN A CA   5  
ATOM 10463 C C    . ASN A 1 104 ? -0.344  -2.436  12.663  1.00 0.00 ? 104 ASN A C    5  
ATOM 10464 O O    . ASN A 1 104 ? -0.345  -1.725  11.659  1.00 0.00 ? 104 ASN A O    5  
ATOM 10465 C CB   . ASN A 1 104 ? -2.821  -2.581  12.976  1.00 0.00 ? 104 ASN A CB   5  
ATOM 10466 C CG   . ASN A 1 104 ? -3.162  -4.053  12.834  1.00 0.00 ? 104 ASN A CG   5  
ATOM 10467 O OD1  . ASN A 1 104 ? -2.279  -4.909  12.839  1.00 0.00 ? 104 ASN A OD1  5  
ATOM 10468 N ND2  . ASN A 1 104 ? -4.450  -4.351  12.706  1.00 0.00 ? 104 ASN A ND2  5  
ATOM 10469 H H    . ASN A 1 104 ? -0.857  -0.374  14.069  1.00 0.00 ? 104 ASN A H    5  
ATOM 10470 H HA   . ASN A 1 104 ? -1.339  -3.131  14.420  1.00 0.00 ? 104 ASN A HA   5  
ATOM 10471 H HB2  . ASN A 1 104 ? -3.603  -2.105  13.550  1.00 0.00 ? 104 ASN A HB2  5  
ATOM 10472 H HB3  . ASN A 1 104 ? -2.783  -2.142  11.991  1.00 0.00 ? 104 ASN A HB3  5  
ATOM 10473 H HD21 . ASN A 1 104 ? -5.098  -3.617  12.710  1.00 0.00 ? 104 ASN A HD21 5  
ATOM 10474 H HD22 . ASN A 1 104 ? -4.699  -5.294  12.613  1.00 0.00 ? 104 ASN A HD22 5  
ATOM 10475 N N    . MET A 1 105 ? 0.626   -3.305  12.934  1.00 0.00 ? 105 MET A N    5  
ATOM 10476 C CA   . MET A 1 105 ? 1.768   -3.476  12.043  1.00 0.00 ? 105 MET A CA   5  
ATOM 10477 C C    . MET A 1 105 ? 1.605   -4.728  11.185  1.00 0.00 ? 105 MET A C    5  
ATOM 10478 O O    . MET A 1 105 ? 2.367   -4.951  10.244  1.00 0.00 ? 105 MET A O    5  
ATOM 10479 C CB   . MET A 1 105 ? 3.063   -3.563  12.851  1.00 0.00 ? 105 MET A CB   5  
ATOM 10480 C CG   . MET A 1 105 ? 3.729   -2.216  13.079  1.00 0.00 ? 105 MET A CG   5  
ATOM 10481 S SD   . MET A 1 105 ? 4.919   -1.802  11.789  1.00 0.00 ? 105 MET A SD   5  
ATOM 10482 C CE   . MET A 1 105 ? 3.827   -1.546  10.391  1.00 0.00 ? 105 MET A CE   5  
ATOM 10483 H H    . MET A 1 105 ? 0.571   -3.844  13.750  1.00 0.00 ? 105 MET A H    5  
ATOM 10484 H HA   . MET A 1 105 ? 1.815   -2.614  11.395  1.00 0.00 ? 105 MET A HA   5  
ATOM 10485 H HB2  . MET A 1 105 ? 2.845   -4.001  13.814  1.00 0.00 ? 105 MET A HB2  5  
ATOM 10486 H HB3  . MET A 1 105 ? 3.760   -4.200  12.326  1.00 0.00 ? 105 MET A HB3  5  
ATOM 10487 H HG2  . MET A 1 105 ? 2.966   -1.453  13.104  1.00 0.00 ? 105 MET A HG2  5  
ATOM 10488 H HG3  . MET A 1 105 ? 4.241   -2.240  14.029  1.00 0.00 ? 105 MET A HG3  5  
ATOM 10489 H HE1  . MET A 1 105 ? 4.332   -0.953  9.644   1.00 0.00 ? 105 MET A HE1  5  
ATOM 10490 H HE2  . MET A 1 105 ? 3.554   -2.501  9.969   1.00 0.00 ? 105 MET A HE2  5  
ATOM 10491 H HE3  . MET A 1 105 ? 2.937   -1.029  10.720  1.00 0.00 ? 105 MET A HE3  5  
ATOM 10492 N N    . THR A 1 106 ? 0.606   -5.541  11.516  1.00 0.00 ? 106 THR A N    5  
ATOM 10493 C CA   . THR A 1 106 ? 0.345   -6.770  10.778  1.00 0.00 ? 106 THR A CA   5  
ATOM 10494 C C    . THR A 1 106 ? -0.539  -6.504  9.564   1.00 0.00 ? 106 THR A C    5  
ATOM 10495 O O    . THR A 1 106 ? -0.308  -7.050  8.486   1.00 0.00 ? 106 THR A O    5  
ATOM 10496 C CB   . THR A 1 106 ? -0.331  -7.828  11.669  1.00 0.00 ? 106 THR A CB   5  
ATOM 10497 O OG1  . THR A 1 106 ? -1.726  -7.535  11.806  1.00 0.00 ? 106 THR A OG1  5  
ATOM 10498 C CG2  . THR A 1 106 ? 0.320   -7.874  13.043  1.00 0.00 ? 106 THR A CG2  5  
ATOM 10499 H H    . THR A 1 106 ? 0.034   -5.308  12.276  1.00 0.00 ? 106 THR A H    5  
ATOM 10500 H HA   . THR A 1 106 ? 1.292   -7.165  10.441  1.00 0.00 ? 106 THR A HA   5  
ATOM 10501 H HB   . THR A 1 106 ? -0.218  -8.797  11.201  1.00 0.00 ? 106 THR A HB   5  
ATOM 10502 H HG1  . THR A 1 106 ? -2.183  -8.308  12.149  1.00 0.00 ? 106 THR A HG1  5  
ATOM 10503 H HG21 . THR A 1 106 ? -0.255  -8.518  13.692  1.00 0.00 ? 106 THR A HG21 5  
ATOM 10504 H HG22 . THR A 1 106 ? 0.353   -6.878  13.459  1.00 0.00 ? 106 THR A HG22 5  
ATOM 10505 H HG23 . THR A 1 106 ? 1.324   -8.259  12.952  1.00 0.00 ? 106 THR A HG23 5  
ATOM 10506 N N    . GLN A 1 107 ? -1.550  -5.662  9.747   1.00 0.00 ? 107 GLN A N    5  
ATOM 10507 C CA   . GLN A 1 107 ? -2.469  -5.325  8.667   1.00 0.00 ? 107 GLN A CA   5  
ATOM 10508 C C    . GLN A 1 107 ? -1.750  -4.555  7.563   1.00 0.00 ? 107 GLN A C    5  
ATOM 10509 O O    . GLN A 1 107 ? -2.071  -4.698  6.382   1.00 0.00 ? 107 GLN A O    5  
ATOM 10510 C CB   . GLN A 1 107 ? -3.639  -4.498  9.202   1.00 0.00 ? 107 GLN A CB   5  
ATOM 10511 C CG   . GLN A 1 107 ? -4.927  -4.686  8.418   1.00 0.00 ? 107 GLN A CG   5  
ATOM 10512 C CD   . GLN A 1 107 ? -5.676  -5.942  8.818   1.00 0.00 ? 107 GLN A CD   5  
ATOM 10513 O OE1  . GLN A 1 107 ? -6.089  -6.092  9.969   1.00 0.00 ? 107 GLN A OE1  5  
ATOM 10514 N NE2  . GLN A 1 107 ? -5.856  -6.853  7.870   1.00 0.00 ? 107 GLN A NE2  5  
ATOM 10515 H H    . GLN A 1 107 ? -1.682  -5.259  10.630  1.00 0.00 ? 107 GLN A H    5  
ATOM 10516 H HA   . GLN A 1 107 ? -2.850  -6.247  8.256   1.00 0.00 ? 107 GLN A HA   5  
ATOM 10517 H HB2  . GLN A 1 107 ? -3.823  -4.779  10.229  1.00 0.00 ? 107 GLN A HB2  5  
ATOM 10518 H HB3  . GLN A 1 107 ? -3.371  -3.451  9.166   1.00 0.00 ? 107 GLN A HB3  5  
ATOM 10519 H HG2  . GLN A 1 107 ? -5.566  -3.834  8.590   1.00 0.00 ? 107 GLN A HG2  5  
ATOM 10520 H HG3  . GLN A 1 107 ? -4.687  -4.748  7.366   1.00 0.00 ? 107 GLN A HG3  5  
ATOM 10521 H HE21 . GLN A 1 107 ? -5.499  -6.666  6.975   1.00 0.00 ? 107 GLN A HE21 5  
ATOM 10522 H HE22 . GLN A 1 107 ? -6.336  -7.674  8.101   1.00 0.00 ? 107 GLN A HE22 5  
ATOM 10523 N N    . VAL A 1 108 ? -0.777  -3.740  7.953   1.00 0.00 ? 108 VAL A N    5  
ATOM 10524 C CA   . VAL A 1 108 ? -0.013  -2.948  6.996   1.00 0.00 ? 108 VAL A CA   5  
ATOM 10525 C C    . VAL A 1 108 ? 1.008   -3.810  6.260   1.00 0.00 ? 108 VAL A C    5  
ATOM 10526 O O    . VAL A 1 108 ? 1.310   -3.569  5.092   1.00 0.00 ? 108 VAL A O    5  
ATOM 10527 C CB   . VAL A 1 108 ? 0.721   -1.784  7.689   1.00 0.00 ? 108 VAL A CB   5  
ATOM 10528 C CG1  . VAL A 1 108 ? 1.602   -1.041  6.697   1.00 0.00 ? 108 VAL A CG1  5  
ATOM 10529 C CG2  . VAL A 1 108 ? -0.277  -0.838  8.340   1.00 0.00 ? 108 VAL A CG2  5  
ATOM 10530 H H    . VAL A 1 108 ? -0.567  -3.669  8.908   1.00 0.00 ? 108 VAL A H    5  
ATOM 10531 H HA   . VAL A 1 108 ? -0.705  -2.534  6.278   1.00 0.00 ? 108 VAL A HA   5  
ATOM 10532 H HB   . VAL A 1 108 ? 1.354   -2.194  8.463   1.00 0.00 ? 108 VAL A HB   5  
ATOM 10533 H HG11 . VAL A 1 108 ? 1.400   -1.400  5.699   1.00 0.00 ? 108 VAL A HG11 5  
ATOM 10534 H HG12 . VAL A 1 108 ? 1.393   0.017   6.751   1.00 0.00 ? 108 VAL A HG12 5  
ATOM 10535 H HG13 . VAL A 1 108 ? 2.641   -1.216  6.938   1.00 0.00 ? 108 VAL A HG13 5  
ATOM 10536 H HG21 . VAL A 1 108 ? -0.565  -1.229  9.304   1.00 0.00 ? 108 VAL A HG21 5  
ATOM 10537 H HG22 . VAL A 1 108 ? 0.176   0.134   8.466   1.00 0.00 ? 108 VAL A HG22 5  
ATOM 10538 H HG23 . VAL A 1 108 ? -1.151  -0.748  7.712   1.00 0.00 ? 108 VAL A HG23 5  
ATOM 10539 N N    . GLN A 1 109 ? 1.533   -4.816  6.952   1.00 0.00 ? 109 GLN A N    5  
ATOM 10540 C CA   . GLN A 1 109 ? 2.519   -5.715  6.363   1.00 0.00 ? 109 GLN A CA   5  
ATOM 10541 C C    . GLN A 1 109 ? 1.884   -6.590  5.288   1.00 0.00 ? 109 GLN A C    5  
ATOM 10542 O O    . GLN A 1 109 ? 2.341   -6.617  4.146   1.00 0.00 ? 109 GLN A O    5  
ATOM 10543 C CB   . GLN A 1 109 ? 3.150   -6.592  7.445   1.00 0.00 ? 109 GLN A CB   5  
ATOM 10544 C CG   . GLN A 1 109 ? 4.342   -7.399  6.955   1.00 0.00 ? 109 GLN A CG   5  
ATOM 10545 C CD   . GLN A 1 109 ? 5.323   -7.722  8.065   1.00 0.00 ? 109 GLN A CD   5  
ATOM 10546 O OE1  . GLN A 1 109 ? 5.748   -6.839  8.811   1.00 0.00 ? 109 GLN A OE1  5  
ATOM 10547 N NE2  . GLN A 1 109 ? 5.690   -8.994  8.180   1.00 0.00 ? 109 GLN A NE2  5  
ATOM 10548 H H    . GLN A 1 109 ? 1.251   -4.958  7.880   1.00 0.00 ? 109 GLN A H    5  
ATOM 10549 H HA   . GLN A 1 109 ? 3.288   -5.110  5.909   1.00 0.00 ? 109 GLN A HA   5  
ATOM 10550 H HB2  . GLN A 1 109 ? 3.479   -5.961  8.258   1.00 0.00 ? 109 GLN A HB2  5  
ATOM 10551 H HB3  . GLN A 1 109 ? 2.405   -7.281  7.814   1.00 0.00 ? 109 GLN A HB3  5  
ATOM 10552 H HG2  . GLN A 1 109 ? 3.984   -8.325  6.532   1.00 0.00 ? 109 GLN A HG2  5  
ATOM 10553 H HG3  . GLN A 1 109 ? 4.856   -6.831  6.194   1.00 0.00 ? 109 GLN A HG3  5  
ATOM 10554 H HE21 . GLN A 1 109 ? 5.311   -9.642  7.549   1.00 0.00 ? 109 GLN A HE21 5  
ATOM 10555 H HE22 . GLN A 1 109 ? 6.324   -9.231  8.887   1.00 0.00 ? 109 GLN A HE22 5  
ATOM 10556 N N    . VAL A 1 110 ? 0.829   -7.306  5.662   1.00 0.00 ? 110 VAL A N    5  
ATOM 10557 C CA   . VAL A 1 110 ? 0.131   -8.183  4.729   1.00 0.00 ? 110 VAL A CA   5  
ATOM 10558 C C    . VAL A 1 110 ? -0.376  -7.407  3.519   1.00 0.00 ? 110 VAL A C    5  
ATOM 10559 O O    . VAL A 1 110 ? -0.344  -7.903  2.393   1.00 0.00 ? 110 VAL A O    5  
ATOM 10560 C CB   . VAL A 1 110 ? -1.059  -8.890  5.407   1.00 0.00 ? 110 VAL A CB   5  
ATOM 10561 C CG1  . VAL A 1 110 ? -0.574  -9.807  6.519   1.00 0.00 ? 110 VAL A CG1  5  
ATOM 10562 C CG2  . VAL A 1 110 ? -2.050  -7.867  5.942   1.00 0.00 ? 110 VAL A CG2  5  
ATOM 10563 H H    . VAL A 1 110 ? 0.511   -7.243  6.587   1.00 0.00 ? 110 VAL A H    5  
ATOM 10564 H HA   . VAL A 1 110 ? 0.827   -8.939  4.395   1.00 0.00 ? 110 VAL A HA   5  
ATOM 10565 H HB   . VAL A 1 110 ? -1.562  -9.493  4.666   1.00 0.00 ? 110 VAL A HB   5  
ATOM 10566 H HG11 . VAL A 1 110 ? 0.172   -10.482 6.127   1.00 0.00 ? 110 VAL A HG11 5  
ATOM 10567 H HG12 . VAL A 1 110 ? -0.143  -9.214  7.313   1.00 0.00 ? 110 VAL A HG12 5  
ATOM 10568 H HG13 . VAL A 1 110 ? -1.407  -10.376 6.905   1.00 0.00 ? 110 VAL A HG13 5  
ATOM 10569 H HG21 . VAL A 1 110 ? -1.571  -7.267  6.702   1.00 0.00 ? 110 VAL A HG21 5  
ATOM 10570 H HG22 . VAL A 1 110 ? -2.382  -7.230  5.135   1.00 0.00 ? 110 VAL A HG22 5  
ATOM 10571 H HG23 . VAL A 1 110 ? -2.900  -8.378  6.369   1.00 0.00 ? 110 VAL A HG23 5  
ATOM 10572 N N    . SER A 1 111 ? -0.840  -6.185  3.759   1.00 0.00 ? 111 SER A N    5  
ATOM 10573 C CA   . SER A 1 111 ? -1.357  -5.340  2.689   1.00 0.00 ? 111 SER A CA   5  
ATOM 10574 C C    . SER A 1 111 ? -0.351  -5.235  1.546   1.00 0.00 ? 111 SER A C    5  
ATOM 10575 O O    . SER A 1 111 ? -0.701  -5.399  0.377   1.00 0.00 ? 111 SER A O    5  
ATOM 10576 C CB   . SER A 1 111 ? -1.684  -3.945  3.224   1.00 0.00 ? 111 SER A CB   5  
ATOM 10577 O OG   . SER A 1 111 ? -2.720  -3.339  2.470   1.00 0.00 ? 111 SER A OG   5  
ATOM 10578 H H    . SER A 1 111 ? -0.839  -5.845  4.678   1.00 0.00 ? 111 SER A H    5  
ATOM 10579 H HA   . SER A 1 111 ? -2.261  -5.795  2.314   1.00 0.00 ? 111 SER A HA   5  
ATOM 10580 H HB2  . SER A 1 111 ? -2.002  -4.023  4.253   1.00 0.00 ? 111 SER A HB2  5  
ATOM 10581 H HB3  . SER A 1 111 ? -0.802  -3.324  3.166   1.00 0.00 ? 111 SER A HB3  5  
ATOM 10582 H HG   . SER A 1 111 ? -2.680  -3.651  1.563   1.00 0.00 ? 111 SER A HG   5  
ATOM 10583 N N    . LEU A 1 112 ? 0.902   -4.961  1.893   1.00 0.00 ? 112 LEU A N    5  
ATOM 10584 C CA   . LEU A 1 112 ? 1.962   -4.833  0.898   1.00 0.00 ? 112 LEU A CA   5  
ATOM 10585 C C    . LEU A 1 112 ? 2.274   -6.183  0.260   1.00 0.00 ? 112 LEU A C    5  
ATOM 10586 O O    . LEU A 1 112 ? 2.481   -6.276  -0.950  1.00 0.00 ? 112 LEU A O    5  
ATOM 10587 C CB   . LEU A 1 112 ? 3.224   -4.254  1.540   1.00 0.00 ? 112 LEU A CB   5  
ATOM 10588 C CG   . LEU A 1 112 ? 3.053   -2.928  2.281   1.00 0.00 ? 112 LEU A CG   5  
ATOM 10589 C CD1  . LEU A 1 112 ? 4.370   -2.489  2.900   1.00 0.00 ? 112 LEU A CD1  5  
ATOM 10590 C CD2  . LEU A 1 112 ? 2.519   -1.856  1.341   1.00 0.00 ? 112 LEU A CD2  5  
ATOM 10591 H H    . LEU A 1 112 ? 1.121   -4.840  2.840   1.00 0.00 ? 112 LEU A H    5  
ATOM 10592 H HA   . LEU A 1 112 ? 1.615   -4.157  0.130   1.00 0.00 ? 112 LEU A HA   5  
ATOM 10593 H HB2  . LEU A 1 112 ? 3.600   -4.980  2.244   1.00 0.00 ? 112 LEU A HB2  5  
ATOM 10594 H HB3  . LEU A 1 112 ? 3.953   -4.105  0.756   1.00 0.00 ? 112 LEU A HB3  5  
ATOM 10595 H HG   . LEU A 1 112 ? 2.336   -3.060  3.080   1.00 0.00 ? 112 LEU A HG   5  
ATOM 10596 H HD11 . LEU A 1 112 ? 4.203   -2.184  3.923   1.00 0.00 ? 112 LEU A HD11 5  
ATOM 10597 H HD12 . LEU A 1 112 ? 4.772   -1.658  2.339   1.00 0.00 ? 112 LEU A HD12 5  
ATOM 10598 H HD13 . LEU A 1 112 ? 5.070   -3.311  2.878   1.00 0.00 ? 112 LEU A HD13 5  
ATOM 10599 H HD21 . LEU A 1 112 ? 2.250   -0.979  1.912   1.00 0.00 ? 112 LEU A HD21 5  
ATOM 10600 H HD22 . LEU A 1 112 ? 1.646   -2.232  0.825   1.00 0.00 ? 112 LEU A HD22 5  
ATOM 10601 H HD23 . LEU A 1 112 ? 3.281   -1.598  0.621   1.00 0.00 ? 112 LEU A HD23 5  
ATOM 10602 N N    . LEU A 1 113 ? 2.305   -7.226  1.081   1.00 0.00 ? 113 LEU A N    5  
ATOM 10603 C CA   . LEU A 1 113 ? 2.590   -8.573  0.598   1.00 0.00 ? 113 LEU A CA   5  
ATOM 10604 C C    . LEU A 1 113 ? 1.510   -9.044  -0.370  1.00 0.00 ? 113 LEU A C    5  
ATOM 10605 O O    . LEU A 1 113 ? 1.762   -9.876  -1.241  1.00 0.00 ? 113 LEU A O    5  
ATOM 10606 C CB   . LEU A 1 113 ? 2.698   -9.546  1.773   1.00 0.00 ? 113 LEU A CB   5  
ATOM 10607 C CG   . LEU A 1 113 ? 4.013   -9.514  2.553   1.00 0.00 ? 113 LEU A CG   5  
ATOM 10608 C CD1  . LEU A 1 113 ? 3.897   -10.333 3.829   1.00 0.00 ? 113 LEU A CD1  5  
ATOM 10609 C CD2  . LEU A 1 113 ? 5.157   -10.024 1.691   1.00 0.00 ? 113 LEU A CD2  5  
ATOM 10610 H H    . LEU A 1 113 ? 2.132   -7.089  2.036   1.00 0.00 ? 113 LEU A H    5  
ATOM 10611 H HA   . LEU A 1 113 ? 3.536   -8.544  0.077   1.00 0.00 ? 113 LEU A HA   5  
ATOM 10612 H HB2  . LEU A 1 113 ? 1.900   -9.322  2.462   1.00 0.00 ? 113 LEU A HB2  5  
ATOM 10613 H HB3  . LEU A 1 113 ? 2.567   -10.547 1.386   1.00 0.00 ? 113 LEU A HB3  5  
ATOM 10614 H HG   . LEU A 1 113 ? 4.233   -8.492  2.832   1.00 0.00 ? 113 LEU A HG   5  
ATOM 10615 H HD11 . LEU A 1 113 ? 2.878   -10.666 3.951   1.00 0.00 ? 113 LEU A HD11 5  
ATOM 10616 H HD12 . LEU A 1 113 ? 4.181   -9.723  4.674   1.00 0.00 ? 113 LEU A HD12 5  
ATOM 10617 H HD13 . LEU A 1 113 ? 4.553   -11.190 3.767   1.00 0.00 ? 113 LEU A HD13 5  
ATOM 10618 H HD21 . LEU A 1 113 ? 5.159   -9.499  0.746   1.00 0.00 ? 113 LEU A HD21 5  
ATOM 10619 H HD22 . LEU A 1 113 ? 5.030   -11.083 1.514   1.00 0.00 ? 113 LEU A HD22 5  
ATOM 10620 H HD23 . LEU A 1 113 ? 6.095   -9.854  2.199   1.00 0.00 ? 113 LEU A HD23 5  
ATOM 10621 N N    . ALA A 1 114 ? 0.306   -8.504  -0.212  1.00 0.00 ? 114 ALA A N    5  
ATOM 10622 C CA   . ALA A 1 114 ? -0.813  -8.867  -1.075  1.00 0.00 ? 114 ALA A CA   5  
ATOM 10623 C C    . ALA A 1 114 ? -0.834  -8.008  -2.335  1.00 0.00 ? 114 ALA A C    5  
ATOM 10624 O O    . ALA A 1 114 ? -1.152  -8.492  -3.423  1.00 0.00 ? 114 ALA A O    5  
ATOM 10625 C CB   . ALA A 1 114 ? -2.126  -8.731  -0.320  1.00 0.00 ? 114 ALA A CB   5  
ATOM 10626 H H    . ALA A 1 114 ? 0.166   -7.846  0.499   1.00 0.00 ? 114 ALA A H    5  
ATOM 10627 H HA   . ALA A 1 114 ? -0.693  -9.902  -1.358  1.00 0.00 ? 114 ALA A HA   5  
ATOM 10628 H HB1  . ALA A 1 114 ? -2.741  -7.984  -0.800  1.00 0.00 ? 114 ALA A HB1  5  
ATOM 10629 H HB2  . ALA A 1 114 ? -2.643  -9.679  -0.324  1.00 0.00 ? 114 ALA A HB2  5  
ATOM 10630 H HB3  . ALA A 1 114 ? -1.927  -8.434  0.699   1.00 0.00 ? 114 ALA A HB3  5  
ATOM 10631 N N    . LEU A 1 115 ? -0.494  -6.733  -2.183  1.00 0.00 ? 115 LEU A N    5  
ATOM 10632 C CA   . LEU A 1 115 ? -0.475  -5.806  -3.310  1.00 0.00 ? 115 LEU A CA   5  
ATOM 10633 C C    . LEU A 1 115 ? 0.657   -6.145  -4.274  1.00 0.00 ? 115 LEU A C    5  
ATOM 10634 O O    . LEU A 1 115 ? 0.505   -6.036  -5.489  1.00 0.00 ? 115 LEU A O    5  
ATOM 10635 C CB   . LEU A 1 115 ? -0.323  -4.368  -2.810  1.00 0.00 ? 115 LEU A CB   5  
ATOM 10636 C CG   . LEU A 1 115 ? 0.253   -3.368  -3.812  1.00 0.00 ? 115 LEU A CG   5  
ATOM 10637 C CD1  . LEU A 1 115 ? -0.848  -2.808  -4.700  1.00 0.00 ? 115 LEU A CD1  5  
ATOM 10638 C CD2  . LEU A 1 115 ? 0.978   -2.243  -3.086  1.00 0.00 ? 115 LEU A CD2  5  
ATOM 10639 H H    . LEU A 1 115 ? -0.251  -6.406  -1.292  1.00 0.00 ? 115 LEU A H    5  
ATOM 10640 H HA   . LEU A 1 115 ? -1.416  -5.900  -3.831  1.00 0.00 ? 115 LEU A HA   5  
ATOM 10641 H HB2  . LEU A 1 115 ? -1.299  -4.016  -2.515  1.00 0.00 ? 115 LEU A HB2  5  
ATOM 10642 H HB3  . LEU A 1 115 ? 0.328   -4.386  -1.948  1.00 0.00 ? 115 LEU A HB3  5  
ATOM 10643 H HG   . LEU A 1 115 ? 0.968   -3.873  -4.446  1.00 0.00 ? 115 LEU A HG   5  
ATOM 10644 H HD11 . LEU A 1 115 ? -0.940  -3.417  -5.587  1.00 0.00 ? 115 LEU A HD11 5  
ATOM 10645 H HD12 . LEU A 1 115 ? -0.603  -1.795  -4.984  1.00 0.00 ? 115 LEU A HD12 5  
ATOM 10646 H HD13 . LEU A 1 115 ? -1.784  -2.814  -4.160  1.00 0.00 ? 115 LEU A HD13 5  
ATOM 10647 H HD21 . LEU A 1 115 ? 1.863   -1.970  -3.642  1.00 0.00 ? 115 LEU A HD21 5  
ATOM 10648 H HD22 . LEU A 1 115 ? 1.261   -2.576  -2.099  1.00 0.00 ? 115 LEU A HD22 5  
ATOM 10649 H HD23 . LEU A 1 115 ? 0.324   -1.388  -3.005  1.00 0.00 ? 115 LEU A HD23 5  
ATOM 10650 N N    . ALA A 1 116 ? 1.794   -6.557  -3.721  1.00 0.00 ? 116 ALA A N    5  
ATOM 10651 C CA   . ALA A 1 116 ? 2.951   -6.916  -4.533  1.00 0.00 ? 116 ALA A CA   5  
ATOM 10652 C C    . ALA A 1 116 ? 2.644   -8.111  -5.429  1.00 0.00 ? 116 ALA A C    5  
ATOM 10653 O O    . ALA A 1 116 ? 3.055   -8.152  -6.587  1.00 0.00 ? 116 ALA A O    5  
ATOM 10654 C CB   . ALA A 1 116 ? 4.147   -7.215  -3.641  1.00 0.00 ? 116 ALA A CB   5  
ATOM 10655 H H    . ALA A 1 116 ? 1.855   -6.624  -2.746  1.00 0.00 ? 116 ALA A H    5  
ATOM 10656 H HA   . ALA A 1 116 ? 3.199   -6.067  -5.154  1.00 0.00 ? 116 ALA A HA   5  
ATOM 10657 H HB1  . ALA A 1 116 ? 4.758   -6.329  -3.551  1.00 0.00 ? 116 ALA A HB1  5  
ATOM 10658 H HB2  . ALA A 1 116 ? 3.802   -7.516  -2.664  1.00 0.00 ? 116 ALA A HB2  5  
ATOM 10659 H HB3  . ALA A 1 116 ? 4.731   -8.011  -4.079  1.00 0.00 ? 116 ALA A HB3  5  
ATOM 10660 N N    . GLY A 1 117 ? 1.920   -9.084  -4.883  1.00 0.00 ? 117 GLY A N    5  
ATOM 10661 C CA   . GLY A 1 117 ? 1.572   -10.268 -5.647  1.00 0.00 ? 117 GLY A CA   5  
ATOM 10662 C C    . GLY A 1 117 ? 0.875   -9.931  -6.951  1.00 0.00 ? 117 GLY A C    5  
ATOM 10663 O O    . GLY A 1 117 ? 1.127   -10.558 -7.979  1.00 0.00 ? 117 GLY A O    5  
ATOM 10664 H H    . GLY A 1 117 ? 1.620   -8.996  -3.954  1.00 0.00 ? 117 GLY A H    5  
ATOM 10665 H HA2  . GLY A 1 117 ? 2.473   -10.820 -5.866  1.00 0.00 ? 117 GLY A HA2  5  
ATOM 10666 H HA3  . GLY A 1 117 ? 0.916   -10.886 -5.052  1.00 0.00 ? 117 GLY A HA3  5  
ATOM 10667 N N    . LYS A 1 118 ? -0.008  -8.938  -6.909  1.00 0.00 ? 118 LYS A N    5  
ATOM 10668 C CA   . LYS A 1 118 ? -0.745  -8.519  -8.095  1.00 0.00 ? 118 LYS A CA   5  
ATOM 10669 C C    . LYS A 1 118 ? 0.161   -7.756  -9.057  1.00 0.00 ? 118 LYS A C    5  
ATOM 10670 O O    . LYS A 1 118 ? 0.120   -7.974  -10.268 1.00 0.00 ? 118 LYS A O    5  
ATOM 10671 C CB   . LYS A 1 118 ? -1.936  -7.644  -7.699  1.00 0.00 ? 118 LYS A CB   5  
ATOM 10672 C CG   . LYS A 1 118 ? -2.618  -6.973  -8.879  1.00 0.00 ? 118 LYS A CG   5  
ATOM 10673 C CD   . LYS A 1 118 ? -3.800  -6.130  -8.433  1.00 0.00 ? 118 LYS A CD   5  
ATOM 10674 C CE   . LYS A 1 118 ? -4.969  -6.997  -7.992  1.00 0.00 ? 118 LYS A CE   5  
ATOM 10675 N NZ   . LYS A 1 118 ? -5.505  -7.817  -9.113  1.00 0.00 ? 118 LYS A NZ   5  
ATOM 10676 H H    . LYS A 1 118 ? -0.166  -8.475  -6.059  1.00 0.00 ? 118 LYS A H    5  
ATOM 10677 H HA   . LYS A 1 118 ? -1.109  -9.406  -8.590  1.00 0.00 ? 118 LYS A HA   5  
ATOM 10678 H HB2  . LYS A 1 118 ? -2.664  -8.258  -7.190  1.00 0.00 ? 118 LYS A HB2  5  
ATOM 10679 H HB3  . LYS A 1 118 ? -1.592  -6.875  -7.023  1.00 0.00 ? 118 LYS A HB3  5  
ATOM 10680 H HG2  . LYS A 1 118 ? -1.905  -6.337  -9.381  1.00 0.00 ? 118 LYS A HG2  5  
ATOM 10681 H HG3  . LYS A 1 118 ? -2.968  -7.735  -9.561  1.00 0.00 ? 118 LYS A HG3  5  
ATOM 10682 H HD2  . LYS A 1 118 ? -3.496  -5.508  -7.604  1.00 0.00 ? 118 LYS A HD2  5  
ATOM 10683 H HD3  . LYS A 1 118 ? -4.116  -5.505  -9.256  1.00 0.00 ? 118 LYS A HD3  5  
ATOM 10684 H HE2  . LYS A 1 118 ? -4.636  -7.654  -7.203  1.00 0.00 ? 118 LYS A HE2  5  
ATOM 10685 H HE3  . LYS A 1 118 ? -5.755  -6.356  -7.617  1.00 0.00 ? 118 LYS A HE3  5  
ATOM 10686 H HZ1  . LYS A 1 118 ? -6.513  -8.021  -8.957  1.00 0.00 ? 118 LYS A HZ1  5  
ATOM 10687 H HZ2  . LYS A 1 118 ? -4.988  -8.716  -9.178  1.00 0.00 ? 118 LYS A HZ2  5  
ATOM 10688 H HZ3  . LYS A 1 118 ? -5.402  -7.304  -10.012 1.00 0.00 ? 118 LYS A HZ3  5  
ATOM 10689 N N    . ALA A 1 119 ? 0.979   -6.862  -8.511  1.00 0.00 ? 119 ALA A N    5  
ATOM 10690 C CA   . ALA A 1 119 ? 1.897   -6.071  -9.320  1.00 0.00 ? 119 ALA A CA   5  
ATOM 10691 C C    . ALA A 1 119 ? 2.809   -6.966  -10.151 1.00 0.00 ? 119 ALA A C    5  
ATOM 10692 O O    . ALA A 1 119 ? 3.122   -6.656  -11.300 1.00 0.00 ? 119 ALA A O    5  
ATOM 10693 C CB   . ALA A 1 119 ? 2.722   -5.151  -8.433  1.00 0.00 ? 119 ALA A CB   5  
ATOM 10694 H H    . ALA A 1 119 ? 0.965   -6.733  -7.539  1.00 0.00 ? 119 ALA A H    5  
ATOM 10695 H HA   . ALA A 1 119 ? 1.309   -5.456  -9.986  1.00 0.00 ? 119 ALA A HA   5  
ATOM 10696 H HB1  . ALA A 1 119 ? 3.759   -5.196  -8.736  1.00 0.00 ? 119 ALA A HB1  5  
ATOM 10697 H HB2  . ALA A 1 119 ? 2.362   -4.137  -8.532  1.00 0.00 ? 119 ALA A HB2  5  
ATOM 10698 H HB3  . ALA A 1 119 ? 2.633   -5.466  -7.405  1.00 0.00 ? 119 ALA A HB3  5  
ATOM 10699 N N    . LYS A 1 120 ? 3.233   -8.080  -9.562  1.00 0.00 ? 120 LYS A N    5  
ATOM 10700 C CA   . LYS A 1 120 ? 4.109   -9.022  -10.248 1.00 0.00 ? 120 LYS A CA   5  
ATOM 10701 C C    . LYS A 1 120 ? 3.634   -9.266  -11.676 1.00 0.00 ? 120 LYS A C    5  
ATOM 10702 O O    . LYS A 1 120 ? 4.441   -9.381  -12.599 1.00 0.00 ? 120 LYS A O    5  
ATOM 10703 C CB   . LYS A 1 120 ? 4.164   -10.348 -9.483  1.00 0.00 ? 120 LYS A CB   5  
ATOM 10704 C CG   . LYS A 1 120 ? 5.270   -10.404 -8.443  1.00 0.00 ? 120 LYS A CG   5  
ATOM 10705 C CD   . LYS A 1 120 ? 5.107   -11.601 -7.521  1.00 0.00 ? 120 LYS A CD   5  
ATOM 10706 C CE   . LYS A 1 120 ? 6.213   -11.655 -6.477  1.00 0.00 ? 120 LYS A CE   5  
ATOM 10707 N NZ   . LYS A 1 120 ? 5.877   -12.581 -5.361  1.00 0.00 ? 120 LYS A NZ   5  
ATOM 10708 H H    . LYS A 1 120 ? 2.948   -8.272  -8.643  1.00 0.00 ? 120 LYS A H    5  
ATOM 10709 H HA   . LYS A 1 120 ? 5.099   -8.593  -10.278 1.00 0.00 ? 120 LYS A HA   5  
ATOM 10710 H HB2  . LYS A 1 120 ? 3.219   -10.500 -8.982  1.00 0.00 ? 120 LYS A HB2  5  
ATOM 10711 H HB3  . LYS A 1 120 ? 4.321   -11.150 -10.189 1.00 0.00 ? 120 LYS A HB3  5  
ATOM 10712 H HG2  . LYS A 1 120 ? 6.222   -10.479 -8.947  1.00 0.00 ? 120 LYS A HG2  5  
ATOM 10713 H HG3  . LYS A 1 120 ? 5.243   -9.499  -7.852  1.00 0.00 ? 120 LYS A HG3  5  
ATOM 10714 H HD2  . LYS A 1 120 ? 4.155   -11.528 -7.016  1.00 0.00 ? 120 LYS A HD2  5  
ATOM 10715 H HD3  . LYS A 1 120 ? 5.135   -12.506 -8.111  1.00 0.00 ? 120 LYS A HD3  5  
ATOM 10716 H HE2  . LYS A 1 120 ? 7.121   -11.991 -6.952  1.00 0.00 ? 120 LYS A HE2  5  
ATOM 10717 H HE3  . LYS A 1 120 ? 6.361   -10.662 -6.078  1.00 0.00 ? 120 LYS A HE3  5  
ATOM 10718 H HZ1  . LYS A 1 120 ? 6.210   -12.188 -4.458  1.00 0.00 ? 120 LYS A HZ1  5  
ATOM 10719 H HZ2  . LYS A 1 120 ? 6.332   -13.504 -5.513  1.00 0.00 ? 120 LYS A HZ2  5  
ATOM 10720 H HZ3  . LYS A 1 120 ? 4.848   -12.719 -5.308  1.00 0.00 ? 120 LYS A HZ3  5  
ATOM 10721 N N    . THR A 1 121 ? 2.319   -9.345  -11.853 1.00 0.00 ? 121 THR A N    5  
ATOM 10722 C CA   . THR A 1 121 ? 1.736   -9.575  -13.169 1.00 0.00 ? 121 THR A CA   5  
ATOM 10723 C C    . THR A 1 121 ? 2.519   -8.841  -14.251 1.00 0.00 ? 121 THR A C    5  
ATOM 10724 O O    . THR A 1 121 ? 2.705   -9.355  -15.355 1.00 0.00 ? 121 THR A O    5  
ATOM 10725 C CB   . THR A 1 121 ? 0.264   -9.124  -13.219 1.00 0.00 ? 121 THR A CB   5  
ATOM 10726 O OG1  . THR A 1 121 ? -0.278  -9.366  -14.522 1.00 0.00 ? 121 THR A OG1  5  
ATOM 10727 C CG2  . THR A 1 121 ? 0.140   -7.646  -12.878 1.00 0.00 ? 121 THR A CG2  5  
ATOM 10728 H H    . THR A 1 121 ? 1.727   -9.246  -11.078 1.00 0.00 ? 121 THR A H    5  
ATOM 10729 H HA   . THR A 1 121 ? 1.773   -10.637 -13.369 1.00 0.00 ? 121 THR A HA   5  
ATOM 10730 H HB   . THR A 1 121 ? -0.296  -9.695  -12.492 1.00 0.00 ? 121 THR A HB   5  
ATOM 10731 H HG1  . THR A 1 121 ? -0.776  -8.597  -14.809 1.00 0.00 ? 121 THR A HG1  5  
ATOM 10732 H HG21 . THR A 1 121 ? 0.947   -7.359  -12.222 1.00 0.00 ? 121 THR A HG21 5  
ATOM 10733 H HG22 . THR A 1 121 ? -0.804  -7.469  -12.386 1.00 0.00 ? 121 THR A HG22 5  
ATOM 10734 H HG23 . THR A 1 121 ? 0.189   -7.063  -13.785 1.00 0.00 ? 121 THR A HG23 5  
ATOM 10735 N N    . LYS A 1 122 ? 2.975   -7.635  -13.930 1.00 0.00 ? 122 LYS A N    5  
ATOM 10736 C CA   . LYS A 1 122 ? 3.739   -6.829  -14.876 1.00 0.00 ? 122 LYS A CA   5  
ATOM 10737 C C    . LYS A 1 122 ? 4.756   -7.686  -15.623 1.00 0.00 ? 122 LYS A C    5  
ATOM 10738 O O    . LYS A 1 122 ? 4.828   -7.653  -16.851 1.00 0.00 ? 122 LYS A O    5  
ATOM 10739 C CB   . LYS A 1 122 ? 4.455   -5.691  -14.144 1.00 0.00 ? 122 LYS A CB   5  
ATOM 10740 C CG   . LYS A 1 122 ? 3.633   -4.418  -14.050 1.00 0.00 ? 122 LYS A CG   5  
ATOM 10741 C CD   . LYS A 1 122 ? 2.383   -4.622  -13.209 1.00 0.00 ? 122 LYS A CD   5  
ATOM 10742 C CE   . LYS A 1 122 ? 1.353   -3.534  -13.468 1.00 0.00 ? 122 LYS A CE   5  
ATOM 10743 N NZ   . LYS A 1 122 ? 0.544   -3.815  -14.687 1.00 0.00 ? 122 LYS A NZ   5  
ATOM 10744 H H    . LYS A 1 122 ? 2.794   -7.278  -13.035 1.00 0.00 ? 122 LYS A H    5  
ATOM 10745 H HA   . LYS A 1 122 ? 3.048   -6.409  -15.589 1.00 0.00 ? 122 LYS A HA   5  
ATOM 10746 H HB2  . LYS A 1 122 ? 4.694   -6.016  -13.143 1.00 0.00 ? 122 LYS A HB2  5  
ATOM 10747 H HB3  . LYS A 1 122 ? 5.373   -5.464  -14.669 1.00 0.00 ? 122 LYS A HB3  5  
ATOM 10748 H HG2  . LYS A 1 122 ? 4.235   -3.644  -13.598 1.00 0.00 ? 122 LYS A HG2  5  
ATOM 10749 H HG3  . LYS A 1 122 ? 3.339   -4.114  -15.045 1.00 0.00 ? 122 LYS A HG3  5  
ATOM 10750 H HD2  . LYS A 1 122 ? 1.948   -5.579  -13.453 1.00 0.00 ? 122 LYS A HD2  5  
ATOM 10751 H HD3  . LYS A 1 122 ? 2.657   -4.605  -12.163 1.00 0.00 ? 122 LYS A HD3  5  
ATOM 10752 H HE2  . LYS A 1 122 ? 0.694   -3.470  -12.616 1.00 0.00 ? 122 LYS A HE2  5  
ATOM 10753 H HE3  . LYS A 1 122 ? 1.868   -2.592  -13.596 1.00 0.00 ? 122 LYS A HE3  5  
ATOM 10754 H HZ1  . LYS A 1 122 ? 1.103   -3.615  -15.540 1.00 0.00 ? 122 LYS A HZ1  5  
ATOM 10755 H HZ2  . LYS A 1 122 ? -0.307  -3.216  -14.696 1.00 0.00 ? 122 LYS A HZ2  5  
ATOM 10756 H HZ3  . LYS A 1 122 ? 0.253   -4.813  -14.699 1.00 0.00 ? 122 LYS A HZ3  5  
ATOM 10757 N N    . GLY A 1 123 ? 5.541   -8.455  -14.874 1.00 0.00 ? 123 GLY A N    5  
ATOM 10758 C CA   . GLY A 1 123 ? 6.542   -9.310  -15.484 1.00 0.00 ? 123 GLY A CA   5  
ATOM 10759 C C    . GLY A 1 123 ? 6.975   -10.438 -14.568 1.00 0.00 ? 123 GLY A C    5  
ATOM 10760 O O    . GLY A 1 123 ? 8.056   -10.389 -13.978 1.00 0.00 ? 123 GLY A O    5  
ATOM 10761 H H    . GLY A 1 123 ? 5.439   -8.441  -13.899 1.00 0.00 ? 123 GLY A H    5  
ATOM 10762 H HA2  . GLY A 1 123 ? 6.135   -9.732  -16.390 1.00 0.00 ? 123 GLY A HA2  5  
ATOM 10763 H HA3  . GLY A 1 123 ? 7.407   -8.712  -15.733 1.00 0.00 ? 123 GLY A HA3  5  
ATOM 10764 N N    . LEU A 1 124 ? 6.132   -11.457 -14.447 1.00 0.00 ? 124 LEU A N    5  
ATOM 10765 C CA   . LEU A 1 124 ? 6.433   -12.603 -13.595 1.00 0.00 ? 124 LEU A CA   5  
ATOM 10766 C C    . LEU A 1 124 ? 6.698   -13.849 -14.433 1.00 0.00 ? 124 LEU A C    5  
ATOM 10767 O O    . LEU A 1 124 ? 6.655   -13.803 -15.663 1.00 0.00 ? 124 LEU A O    5  
ATOM 10768 C CB   . LEU A 1 124 ? 5.276   -12.861 -12.627 1.00 0.00 ? 124 LEU A CB   5  
ATOM 10769 C CG   . LEU A 1 124 ? 3.871   -12.778 -13.223 1.00 0.00 ? 124 LEU A CG   5  
ATOM 10770 C CD1  . LEU A 1 124 ? 3.588   -13.992 -14.094 1.00 0.00 ? 124 LEU A CD1  5  
ATOM 10771 C CD2  . LEU A 1 124 ? 2.830   -12.657 -12.120 1.00 0.00 ? 124 LEU A CD2  5  
ATOM 10772 H H    . LEU A 1 124 ? 5.286   -11.439 -14.942 1.00 0.00 ? 124 LEU A H    5  
ATOM 10773 H HA   . LEU A 1 124 ? 7.321   -12.370 -13.028 1.00 0.00 ? 124 LEU A HA   5  
ATOM 10774 H HB2  . LEU A 1 124 ? 5.404   -13.851 -12.217 1.00 0.00 ? 124 LEU A HB2  5  
ATOM 10775 H HB3  . LEU A 1 124 ? 5.344   -12.132 -11.832 1.00 0.00 ? 124 LEU A HB3  5  
ATOM 10776 H HG   . LEU A 1 124 ? 3.802   -11.898 -13.847 1.00 0.00 ? 124 LEU A HG   5  
ATOM 10777 H HD11 . LEU A 1 124 ? 3.738   -14.892 -13.517 1.00 0.00 ? 124 LEU A HD11 5  
ATOM 10778 H HD12 . LEU A 1 124 ? 4.258   -13.991 -14.942 1.00 0.00 ? 124 LEU A HD12 5  
ATOM 10779 H HD13 . LEU A 1 124 ? 2.567   -13.954 -14.443 1.00 0.00 ? 124 LEU A HD13 5  
ATOM 10780 H HD21 . LEU A 1 124 ? 3.019   -13.406 -11.364 1.00 0.00 ? 124 LEU A HD21 5  
ATOM 10781 H HD22 . LEU A 1 124 ? 1.845   -12.807 -12.537 1.00 0.00 ? 124 LEU A HD22 5  
ATOM 10782 H HD23 . LEU A 1 124 ? 2.888   -11.674 -11.676 1.00 0.00 ? 124 LEU A HD23 5  
ATOM 10783 N N    . GLN A 1 125 ? 6.969   -14.963 -13.760 1.00 0.00 ? 125 GLN A N    5  
ATOM 10784 C CA   . GLN A 1 125 ? 7.239   -16.221 -14.442 1.00 0.00 ? 125 GLN A CA   5  
ATOM 10785 C C    . GLN A 1 125 ? 6.164   -17.256 -14.125 1.00 0.00 ? 125 GLN A C    5  
ATOM 10786 O O    . GLN A 1 125 ? 6.139   -17.825 -13.033 1.00 0.00 ? 125 GLN A O    5  
ATOM 10787 C CB   . GLN A 1 125 ? 8.614   -16.759 -14.041 1.00 0.00 ? 125 GLN A CB   5  
ATOM 10788 C CG   . GLN A 1 125 ? 8.871   -18.183 -14.510 1.00 0.00 ? 125 GLN A CG   5  
ATOM 10789 C CD   . GLN A 1 125 ? 9.337   -18.248 -15.950 1.00 0.00 ? 125 GLN A CD   5  
ATOM 10790 O OE1  . GLN A 1 125 ? 8.573   -18.606 -16.846 1.00 0.00 ? 125 GLN A OE1  5  
ATOM 10791 N NE2  . GLN A 1 125 ? 10.599  -17.902 -16.181 1.00 0.00 ? 125 GLN A NE2  5  
ATOM 10792 H H    . GLN A 1 125 ? 6.989   -14.936 -12.781 1.00 0.00 ? 125 GLN A H    5  
ATOM 10793 H HA   . GLN A 1 125 ? 7.233   -16.030 -15.505 1.00 0.00 ? 125 GLN A HA   5  
ATOM 10794 H HB2  . GLN A 1 125 ? 9.375   -16.121 -14.465 1.00 0.00 ? 125 GLN A HB2  5  
ATOM 10795 H HB3  . GLN A 1 125 ? 8.696   -16.738 -12.965 1.00 0.00 ? 125 GLN A HB3  5  
ATOM 10796 H HG2  . GLN A 1 125 ? 9.631   -18.623 -13.881 1.00 0.00 ? 125 GLN A HG2  5  
ATOM 10797 H HG3  . GLN A 1 125 ? 7.956   -18.749 -14.416 1.00 0.00 ? 125 GLN A HG3  5  
ATOM 10798 H HE21 . GLN A 1 125 ? 11.150  -17.628 -15.418 1.00 0.00 ? 125 GLN A HE21 5  
ATOM 10799 H HE22 . GLN A 1 125 ? 10.926  -17.936 -17.102 1.00 0.00 ? 125 GLN A HE22 5  
ATOM 10800 N N    . SER A 1 126 ? 5.275   -17.493 -15.084 1.00 0.00 ? 126 SER A N    5  
ATOM 10801 C CA   . SER A 1 126 ? 4.194   -18.454 -14.905 1.00 0.00 ? 126 SER A CA   5  
ATOM 10802 C C    . SER A 1 126 ? 4.687   -19.693 -14.161 1.00 0.00 ? 126 SER A C    5  
ATOM 10803 O O    . SER A 1 126 ? 5.714   -20.273 -14.510 1.00 0.00 ? 126 SER A O    5  
ATOM 10804 C CB   . SER A 1 126 ? 3.612   -18.858 -16.260 1.00 0.00 ? 126 SER A CB   5  
ATOM 10805 O OG   . SER A 1 126 ? 3.208   -17.721 -17.001 1.00 0.00 ? 126 SER A OG   5  
ATOM 10806 H H    . SER A 1 126 ? 5.347   -17.007 -15.932 1.00 0.00 ? 126 SER A H    5  
ATOM 10807 H HA   . SER A 1 126 ? 3.422   -17.980 -14.318 1.00 0.00 ? 126 SER A HA   5  
ATOM 10808 H HB2  . SER A 1 126 ? 4.360   -19.395 -16.825 1.00 0.00 ? 126 SER A HB2  5  
ATOM 10809 H HB3  . SER A 1 126 ? 2.754   -19.496 -16.105 1.00 0.00 ? 126 SER A HB3  5  
ATOM 10810 H HG   . SER A 1 126 ? 3.871   -17.520 -17.667 1.00 0.00 ? 126 SER A HG   5  
ATOM 10811 N N    . GLY A 1 127 ? 3.945   -20.091 -13.131 1.00 0.00 ? 127 GLY A N    5  
ATOM 10812 C CA   . GLY A 1 127 ? 4.321   -21.258 -12.354 1.00 0.00 ? 127 GLY A CA   5  
ATOM 10813 C C    . GLY A 1 127 ? 3.126   -22.105 -11.965 1.00 0.00 ? 127 GLY A C    5  
ATOM 10814 O O    . GLY A 1 127 ? 2.366   -22.552 -12.824 1.00 0.00 ? 127 GLY A O    5  
ATOM 10815 H H    . GLY A 1 127 ? 3.136   -19.589 -12.899 1.00 0.00 ? 127 GLY A H    5  
ATOM 10816 H HA2  . GLY A 1 127 ? 5.003   -21.860 -12.935 1.00 0.00 ? 127 GLY A HA2  5  
ATOM 10817 H HA3  . GLY A 1 127 ? 4.823   -20.930 -11.454 1.00 0.00 ? 127 GLY A HA3  5  
ATOM 10818 N N    . VAL A 1 128 ? 2.960   -22.329 -10.665 1.00 0.00 ? 128 VAL A N    5  
ATOM 10819 C CA   . VAL A 1 128 ? 1.848   -23.129 -10.164 1.00 0.00 ? 128 VAL A CA   5  
ATOM 10820 C C    . VAL A 1 128 ? 0.538   -22.731 -10.833 1.00 0.00 ? 128 VAL A C    5  
ATOM 10821 O O    . VAL A 1 128 ? 0.366   -21.586 -11.252 1.00 0.00 ? 128 VAL A O    5  
ATOM 10822 C CB   . VAL A 1 128 ? 1.697   -22.986 -8.638  1.00 0.00 ? 128 VAL A CB   5  
ATOM 10823 C CG1  . VAL A 1 128 ? 1.351   -21.553 -8.268  1.00 0.00 ? 128 VAL A CG1  5  
ATOM 10824 C CG2  . VAL A 1 128 ? 0.643   -23.950 -8.115  1.00 0.00 ? 128 VAL A CG2  5  
ATOM 10825 H H    . VAL A 1 128 ? 3.598   -21.946 -10.029 1.00 0.00 ? 128 VAL A H    5  
ATOM 10826 H HA   . VAL A 1 128 ? 2.055   -24.166 -10.388 1.00 0.00 ? 128 VAL A HA   5  
ATOM 10827 H HB   . VAL A 1 128 ? 2.643   -23.235 -8.178  1.00 0.00 ? 128 VAL A HB   5  
ATOM 10828 H HG11 . VAL A 1 128 ? 1.474   -20.918 -9.133  1.00 0.00 ? 128 VAL A HG11 5  
ATOM 10829 H HG12 . VAL A 1 128 ? 0.325   -21.505 -7.929  1.00 0.00 ? 128 VAL A HG12 5  
ATOM 10830 H HG13 . VAL A 1 128 ? 2.006   -21.216 -7.478  1.00 0.00 ? 128 VAL A HG13 5  
ATOM 10831 H HG21 . VAL A 1 128 ? 0.566   -23.851 -7.042  1.00 0.00 ? 128 VAL A HG21 5  
ATOM 10832 H HG22 . VAL A 1 128 ? -0.312  -23.721 -8.567  1.00 0.00 ? 128 VAL A HG22 5  
ATOM 10833 H HG23 . VAL A 1 128 ? 0.924   -24.963 -8.364  1.00 0.00 ? 128 VAL A HG23 5  
ATOM 10834 N N    . ASP A 1 129 ? -0.383  -23.682 -10.931 1.00 0.00 ? 129 ASP A N    5  
ATOM 10835 C CA   . ASP A 1 129 ? -1.681  -23.431 -11.547 1.00 0.00 ? 129 ASP A CA   5  
ATOM 10836 C C    . ASP A 1 129 ? -2.456  -22.371 -10.772 1.00 0.00 ? 129 ASP A C    5  
ATOM 10837 O O    . ASP A 1 129 ? -2.015  -21.916 -9.715  1.00 0.00 ? 129 ASP A O    5  
ATOM 10838 C CB   . ASP A 1 129 ? -2.495  -24.725 -11.619 1.00 0.00 ? 129 ASP A CB   5  
ATOM 10839 C CG   . ASP A 1 129 ? -1.963  -25.687 -12.663 1.00 0.00 ? 129 ASP A CG   5  
ATOM 10840 O OD1  . ASP A 1 129 ? -1.912  -25.304 -13.850 1.00 0.00 ? 129 ASP A OD1  5  
ATOM 10841 O OD2  . ASP A 1 129 ? -1.598  -26.822 -12.292 1.00 0.00 ? 129 ASP A OD2  5  
ATOM 10842 H H    . ASP A 1 129 ? -0.187  -24.577 -10.578 1.00 0.00 ? 129 ASP A H    5  
ATOM 10843 H HA   . ASP A 1 129 ? -1.507  -23.070 -12.550 1.00 0.00 ? 129 ASP A HA   5  
ATOM 10844 H HB2  . ASP A 1 129 ? -2.466  -25.215 -10.657 1.00 0.00 ? 129 ASP A HB2  5  
ATOM 10845 H HB3  . ASP A 1 129 ? -3.519  -24.484 -11.865 1.00 0.00 ? 129 ASP A HB3  5  
ATOM 10846 N N    . ILE A 1 130 ? -3.608  -21.980 -11.304 1.00 0.00 ? 130 ILE A N    5  
ATOM 10847 C CA   . ILE A 1 130 ? -4.444  -20.973 -10.661 1.00 0.00 ? 130 ILE A CA   5  
ATOM 10848 C C    . ILE A 1 130 ? -5.331  -21.597 -9.588  1.00 0.00 ? 130 ILE A C    5  
ATOM 10849 O O    . ILE A 1 130 ? -5.362  -21.136 -8.449  1.00 0.00 ? 130 ILE A O    5  
ATOM 10850 C CB   . ILE A 1 130 ? -5.332  -20.241 -11.684 1.00 0.00 ? 130 ILE A CB   5  
ATOM 10851 C CG1  . ILE A 1 130 ? -4.473  -19.635 -12.796 1.00 0.00 ? 130 ILE A CG1  5  
ATOM 10852 C CG2  . ILE A 1 130 ? -6.156  -19.163 -10.996 1.00 0.00 ? 130 ILE A CG2  5  
ATOM 10853 C CD1  . ILE A 1 130 ? -4.130  -20.614 -13.897 1.00 0.00 ? 130 ILE A CD1  5  
ATOM 10854 H H    . ILE A 1 130 ? -3.905  -22.380 -12.148 1.00 0.00 ? 130 ILE A H    5  
ATOM 10855 H HA   . ILE A 1 130 ? -3.791  -20.247 -10.196 1.00 0.00 ? 130 ILE A HA   5  
ATOM 10856 H HB   . ILE A 1 130 ? -6.012  -20.960 -12.115 1.00 0.00 ? 130 ILE A HB   5  
ATOM 10857 H HG12 . ILE A 1 130 ? -5.004  -18.809 -13.243 1.00 0.00 ? 130 ILE A HG12 5  
ATOM 10858 H HG13 . ILE A 1 130 ? -3.547  -19.275 -12.370 1.00 0.00 ? 130 ILE A HG13 5  
ATOM 10859 H HG21 . ILE A 1 130 ? -5.798  -19.028 -9.986  1.00 0.00 ? 130 ILE A HG21 5  
ATOM 10860 H HG22 . ILE A 1 130 ? -6.059  -18.236 -11.539 1.00 0.00 ? 130 ILE A HG22 5  
ATOM 10861 H HG23 . ILE A 1 130 ? -7.193  -19.461 -10.974 1.00 0.00 ? 130 ILE A HG23 5  
ATOM 10862 H HD11 . ILE A 1 130 ? -3.140  -21.013 -13.728 1.00 0.00 ? 130 ILE A HD11 5  
ATOM 10863 H HD12 . ILE A 1 130 ? -4.848  -21.421 -13.899 1.00 0.00 ? 130 ILE A HD12 5  
ATOM 10864 H HD13 . ILE A 1 130 ? -4.153  -20.107 -14.851 1.00 0.00 ? 130 ILE A HD13 5  
ATOM 10865 N N    . GLY A 1 131 ? -6.050  -22.650 -9.963  1.00 0.00 ? 131 GLY A N    5  
ATOM 10866 C CA   . GLY A 1 131 ? -6.927  -23.322 -9.021  1.00 0.00 ? 131 GLY A CA   5  
ATOM 10867 C C    . GLY A 1 131 ? -7.951  -22.385 -8.412  1.00 0.00 ? 131 GLY A C    5  
ATOM 10868 O O    . GLY A 1 131 ? -7.659  -21.676 -7.450  1.00 0.00 ? 131 GLY A O    5  
ATOM 10869 H H    . GLY A 1 131 ? -5.985  -22.974 -10.886 1.00 0.00 ? 131 GLY A H    5  
ATOM 10870 H HA2  . GLY A 1 131 ? -7.443  -24.119 -9.533  1.00 0.00 ? 131 GLY A HA2  5  
ATOM 10871 H HA3  . GLY A 1 131 ? -6.328  -23.745 -8.229  1.00 0.00 ? 131 GLY A HA3  5  
ATOM 10872 N N    . VAL A 1 132 ? -9.155  -22.380 -8.976  1.00 0.00 ? 132 VAL A N    5  
ATOM 10873 C CA   . VAL A 1 132 ? -10.225 -21.522 -8.484  1.00 0.00 ? 132 VAL A CA   5  
ATOM 10874 C C    . VAL A 1 132 ? -11.592 -22.151 -8.731  1.00 0.00 ? 132 VAL A C    5  
ATOM 10875 O O    . VAL A 1 132 ? -11.796 -22.846 -9.727  1.00 0.00 ? 132 VAL A O    5  
ATOM 10876 C CB   . VAL A 1 132 ? -10.184 -20.133 -9.149  1.00 0.00 ? 132 VAL A CB   5  
ATOM 10877 C CG1  . VAL A 1 132 ? -11.410 -19.320 -8.764  1.00 0.00 ? 132 VAL A CG1  5  
ATOM 10878 C CG2  . VAL A 1 132 ? -8.906  -19.400 -8.770  1.00 0.00 ? 132 VAL A CG2  5  
ATOM 10879 H H    . VAL A 1 132 ? -9.326  -22.967 -9.741  1.00 0.00 ? 132 VAL A H    5  
ATOM 10880 H HA   . VAL A 1 132 ? -10.087 -21.392 -7.420  1.00 0.00 ? 132 VAL A HA   5  
ATOM 10881 H HB   . VAL A 1 132 ? -10.191 -20.270 -10.220 1.00 0.00 ? 132 VAL A HB   5  
ATOM 10882 H HG11 . VAL A 1 132 ? -11.407 -19.147 -7.698  1.00 0.00 ? 132 VAL A HG11 5  
ATOM 10883 H HG12 . VAL A 1 132 ? -11.391 -18.373 -9.284  1.00 0.00 ? 132 VAL A HG12 5  
ATOM 10884 H HG13 . VAL A 1 132 ? -12.302 -19.863 -9.038  1.00 0.00 ? 132 VAL A HG13 5  
ATOM 10885 H HG21 . VAL A 1 132 ? -8.060  -19.896 -9.220  1.00 0.00 ? 132 VAL A HG21 5  
ATOM 10886 H HG22 . VAL A 1 132 ? -8.957  -18.381 -9.125  1.00 0.00 ? 132 VAL A HG22 5  
ATOM 10887 H HG23 . VAL A 1 132 ? -8.795  -19.401 -7.696  1.00 0.00 ? 132 VAL A HG23 5  
ATOM 10888 N N    . LYS A 1 133 ? -12.526 -21.903 -7.820  1.00 0.00 ? 133 LYS A N    5  
ATOM 10889 C CA   . LYS A 1 133 ? -13.874 -22.443 -7.938  1.00 0.00 ? 133 LYS A CA   5  
ATOM 10890 C C    . LYS A 1 133 ? -14.881 -21.334 -8.226  1.00 0.00 ? 133 LYS A C    5  
ATOM 10891 O O    . LYS A 1 133 ? -15.844 -21.534 -8.966  1.00 0.00 ? 133 LYS A O    5  
ATOM 10892 C CB   . LYS A 1 133 ? -14.266 -23.181 -6.656  1.00 0.00 ? 133 LYS A CB   5  
ATOM 10893 C CG   . LYS A 1 133 ? -14.279 -22.294 -5.423  1.00 0.00 ? 133 LYS A CG   5  
ATOM 10894 C CD   . LYS A 1 133 ? -14.965 -22.977 -4.252  1.00 0.00 ? 133 LYS A CD   5  
ATOM 10895 C CE   . LYS A 1 133 ? -14.031 -23.949 -3.547  1.00 0.00 ? 133 LYS A CE   5  
ATOM 10896 N NZ   . LYS A 1 133 ? -13.088 -23.247 -2.633  1.00 0.00 ? 133 LYS A NZ   5  
ATOM 10897 H H    . LYS A 1 133 ? -12.302 -21.342 -7.046  1.00 0.00 ? 133 LYS A H    5  
ATOM 10898 H HA   . LYS A 1 133 ? -13.881 -23.141 -8.762  1.00 0.00 ? 133 LYS A HA   5  
ATOM 10899 H HB2  . LYS A 1 133 ? -15.253 -23.601 -6.783  1.00 0.00 ? 133 LYS A HB2  5  
ATOM 10900 H HB3  . LYS A 1 133 ? -13.562 -23.984 -6.487  1.00 0.00 ? 133 LYS A HB3  5  
ATOM 10901 H HG2  . LYS A 1 133 ? -13.262 -22.064 -5.145  1.00 0.00 ? 133 LYS A HG2  5  
ATOM 10902 H HG3  . LYS A 1 133 ? -14.807 -21.380 -5.655  1.00 0.00 ? 133 LYS A HG3  5  
ATOM 10903 H HD2  . LYS A 1 133 ? -15.284 -22.226 -3.545  1.00 0.00 ? 133 LYS A HD2  5  
ATOM 10904 H HD3  . LYS A 1 133 ? -15.826 -23.519 -4.617  1.00 0.00 ? 133 LYS A HD3  5  
ATOM 10905 H HE2  . LYS A 1 133 ? -14.623 -24.645 -2.975  1.00 0.00 ? 133 LYS A HE2  5  
ATOM 10906 H HE3  . LYS A 1 133 ? -13.464 -24.486 -4.293  1.00 0.00 ? 133 LYS A HE3  5  
ATOM 10907 H HZ1  . LYS A 1 133 ? -12.444 -22.642 -3.181  1.00 0.00 ? 133 LYS A HZ1  5  
ATOM 10908 H HZ2  . LYS A 1 133 ? -12.525 -23.940 -2.100  1.00 0.00 ? 133 LYS A HZ2  5  
ATOM 10909 H HZ3  . LYS A 1 133 ? -13.616 -22.654 -1.961  1.00 0.00 ? 133 LYS A HZ3  5  
ATOM 10910 N N    . TYR A 1 134 ? -14.651 -20.165 -7.638  1.00 0.00 ? 134 TYR A N    5  
ATOM 10911 C CA   . TYR A 1 134 ? -15.539 -19.025 -7.830  1.00 0.00 ? 134 TYR A CA   5  
ATOM 10912 C C    . TYR A 1 134 ? -14.880 -17.735 -7.354  1.00 0.00 ? 134 TYR A C    5  
ATOM 10913 O O    . TYR A 1 134 ? -13.935 -17.762 -6.564  1.00 0.00 ? 134 TYR A O    5  
ATOM 10914 C CB   . TYR A 1 134 ? -16.855 -19.244 -7.082  1.00 0.00 ? 134 TYR A CB   5  
ATOM 10915 C CG   . TYR A 1 134 ? -17.952 -18.289 -7.494  1.00 0.00 ? 134 TYR A CG   5  
ATOM 10916 C CD1  . TYR A 1 134 ? -18.341 -18.177 -8.823  1.00 0.00 ? 134 TYR A CD1  5  
ATOM 10917 C CD2  . TYR A 1 134 ? -18.599 -17.496 -6.554  1.00 0.00 ? 134 TYR A CD2  5  
ATOM 10918 C CE1  . TYR A 1 134 ? -19.342 -17.305 -9.203  1.00 0.00 ? 134 TYR A CE1  5  
ATOM 10919 C CE2  . TYR A 1 134 ? -19.601 -16.622 -6.925  1.00 0.00 ? 134 TYR A CE2  5  
ATOM 10920 C CZ   . TYR A 1 134 ? -19.970 -16.529 -8.251  1.00 0.00 ? 134 TYR A CZ   5  
ATOM 10921 O OH   . TYR A 1 134 ? -20.967 -15.659 -8.626  1.00 0.00 ? 134 TYR A OH   5  
ATOM 10922 H H    . TYR A 1 134 ? -13.867 -20.068 -7.058  1.00 0.00 ? 134 TYR A H    5  
ATOM 10923 H HA   . TYR A 1 134 ? -15.747 -18.941 -8.887  1.00 0.00 ? 134 TYR A HA   5  
ATOM 10924 H HB2  . TYR A 1 134 ? -17.204 -20.248 -7.269  1.00 0.00 ? 134 TYR A HB2  5  
ATOM 10925 H HB3  . TYR A 1 134 ? -16.684 -19.119 -6.023  1.00 0.00 ? 134 TYR A HB3  5  
ATOM 10926 H HD1  . TYR A 1 134 ? -17.848 -18.786 -9.567  1.00 0.00 ? 134 TYR A HD1  5  
ATOM 10927 H HD2  . TYR A 1 134 ? -18.307 -17.570 -5.515  1.00 0.00 ? 134 TYR A HD2  5  
ATOM 10928 H HE1  . TYR A 1 134 ? -19.631 -17.232 -10.242 1.00 0.00 ? 134 TYR A HE1  5  
ATOM 10929 H HE2  . TYR A 1 134 ? -20.092 -16.014 -6.180  1.00 0.00 ? 134 TYR A HE2  5  
ATOM 10930 H HH   . TYR A 1 134 ? -21.422 -16.006 -9.397  1.00 0.00 ? 134 TYR A HH   5  
ATOM 10931 N N    . SER A 1 135 ? -15.383 -16.605 -7.840  1.00 0.00 ? 135 SER A N    5  
ATOM 10932 C CA   . SER A 1 135 ? -14.842 -15.303 -7.467  1.00 0.00 ? 135 SER A CA   5  
ATOM 10933 C C    . SER A 1 135 ? -15.871 -14.201 -7.700  1.00 0.00 ? 135 SER A C    5  
ATOM 10934 O O    . SER A 1 135 ? -16.131 -13.811 -8.837  1.00 0.00 ? 135 SER A O    5  
ATOM 10935 C CB   . SER A 1 135 ? -13.572 -15.009 -8.267  1.00 0.00 ? 135 SER A CB   5  
ATOM 10936 O OG   . SER A 1 135 ? -13.861 -14.854 -9.646  1.00 0.00 ? 135 SER A OG   5  
ATOM 10937 H H    . SER A 1 135 ? -16.136 -16.649 -8.467  1.00 0.00 ? 135 SER A H    5  
ATOM 10938 H HA   . SER A 1 135 ? -14.597 -15.335 -6.417  1.00 0.00 ? 135 SER A HA   5  
ATOM 10939 H HB2  . SER A 1 135 ? -13.124 -14.097 -7.901  1.00 0.00 ? 135 SER A HB2  5  
ATOM 10940 H HB3  . SER A 1 135 ? -12.876 -15.825 -8.146  1.00 0.00 ? 135 SER A HB3  5  
ATOM 10941 H HG   . SER A 1 135 ? -14.226 -15.672 -9.990  1.00 0.00 ? 135 SER A HG   5  
ATOM 10942 N N    . GLU A 1 136 ? -16.453 -13.703 -6.613  1.00 0.00 ? 136 GLU A N    5  
ATOM 10943 C CA   . GLU A 1 136 ? -17.454 -12.646 -6.699  1.00 0.00 ? 136 GLU A CA   5  
ATOM 10944 C C    . GLU A 1 136 ? -16.794 -11.270 -6.673  1.00 0.00 ? 136 GLU A C    5  
ATOM 10945 O O    . GLU A 1 136 ? -15.707 -11.100 -6.122  1.00 0.00 ? 136 GLU A O    5  
ATOM 10946 C CB   . GLU A 1 136 ? -18.453 -12.766 -5.547  1.00 0.00 ? 136 GLU A CB   5  
ATOM 10947 C CG   . GLU A 1 136 ? -19.562 -11.729 -5.594  1.00 0.00 ? 136 GLU A CG   5  
ATOM 10948 C CD   . GLU A 1 136 ? -20.439 -11.867 -6.824  1.00 0.00 ? 136 GLU A CD   5  
ATOM 10949 O OE1  . GLU A 1 136 ? -21.411 -12.651 -6.774  1.00 0.00 ? 136 GLU A OE1  5  
ATOM 10950 O OE2  . GLU A 1 136 ? -20.154 -11.193 -7.835  1.00 0.00 ? 136 GLU A OE2  5  
ATOM 10951 H H    . GLU A 1 136 ? -16.203 -14.056 -5.733  1.00 0.00 ? 136 GLU A H    5  
ATOM 10952 H HA   . GLU A 1 136 ? -17.979 -12.763 -7.633  1.00 0.00 ? 136 GLU A HA   5  
ATOM 10953 H HB2  . GLU A 1 136 ? -18.904 -13.747 -5.578  1.00 0.00 ? 136 GLU A HB2  5  
ATOM 10954 H HB3  . GLU A 1 136 ? -17.923 -12.653 -4.613  1.00 0.00 ? 136 GLU A HB3  5  
ATOM 10955 H HG2  . GLU A 1 136 ? -20.181 -11.841 -4.716  1.00 0.00 ? 136 GLU A HG2  5  
ATOM 10956 H HG3  . GLU A 1 136 ? -19.118 -10.744 -5.595  1.00 0.00 ? 136 GLU A HG3  5  
ATOM 10957 N N    . LYS A 1 137 ? -17.461 -10.291 -7.275  1.00 0.00 ? 137 LYS A N    5  
ATOM 10958 C CA   . LYS A 1 137 ? -16.942 -8.929  -7.323  1.00 0.00 ? 137 LYS A CA   5  
ATOM 10959 C C    . LYS A 1 137 ? -18.044 -7.916  -7.022  1.00 0.00 ? 137 LYS A C    5  
ATOM 10960 O O    . LYS A 1 137 ? -19.018 -7.807  -7.766  1.00 0.00 ? 137 LYS A O    5  
ATOM 10961 C CB   . LYS A 1 137 ? -16.332 -8.640  -8.696  1.00 0.00 ? 137 LYS A CB   5  
ATOM 10962 C CG   . LYS A 1 137 ? -15.836 -7.214  -8.854  1.00 0.00 ? 137 LYS A CG   5  
ATOM 10963 C CD   . LYS A 1 137 ? -14.915 -7.073  -10.055 1.00 0.00 ? 137 LYS A CD   5  
ATOM 10964 C CE   . LYS A 1 137 ? -14.235 -5.714  -10.078 1.00 0.00 ? 137 LYS A CE   5  
ATOM 10965 N NZ   . LYS A 1 137 ? -13.448 -5.509  -11.326 1.00 0.00 ? 137 LYS A NZ   5  
ATOM 10966 H H    . LYS A 1 137 ? -18.323 -10.489 -7.698  1.00 0.00 ? 137 LYS A H    5  
ATOM 10967 H HA   . LYS A 1 137 ? -16.173 -8.840  -6.571  1.00 0.00 ? 137 LYS A HA   5  
ATOM 10968 H HB2  . LYS A 1 137 ? -15.499 -9.309  -8.854  1.00 0.00 ? 137 LYS A HB2  5  
ATOM 10969 H HB3  . LYS A 1 137 ? -17.080 -8.825  -9.455  1.00 0.00 ? 137 LYS A HB3  5  
ATOM 10970 H HG2  . LYS A 1 137 ? -16.686 -6.560  -8.987  1.00 0.00 ? 137 LYS A HG2  5  
ATOM 10971 H HG3  . LYS A 1 137 ? -15.297 -6.930  -7.962  1.00 0.00 ? 137 LYS A HG3  5  
ATOM 10972 H HD2  . LYS A 1 137 ? -14.158 -7.841  -10.009 1.00 0.00 ? 137 LYS A HD2  5  
ATOM 10973 H HD3  . LYS A 1 137 ? -15.496 -7.191  -10.959 1.00 0.00 ? 137 LYS A HD3  5  
ATOM 10974 H HE2  . LYS A 1 137 ? -14.990 -4.946  -10.010 1.00 0.00 ? 137 LYS A HE2  5  
ATOM 10975 H HE3  . LYS A 1 137 ? -13.571 -5.643  -9.229  1.00 0.00 ? 137 LYS A HE3  5  
ATOM 10976 H HZ1  . LYS A 1 137 ? -13.865 -6.058  -12.105 1.00 0.00 ? 137 LYS A HZ1  5  
ATOM 10977 H HZ2  . LYS A 1 137 ? -12.466 -5.821  -11.185 1.00 0.00 ? 137 LYS A HZ2  5  
ATOM 10978 H HZ3  . LYS A 1 137 ? -13.446 -4.503  -11.587 1.00 0.00 ? 137 LYS A HZ3  5  
ATOM 10979 N N    . GLN A 1 138 ? -17.881 -7.180  -5.926  1.00 0.00 ? 138 GLN A N    5  
ATOM 10980 C CA   . GLN A 1 138 ? -18.861 -6.178  -5.529  1.00 0.00 ? 138 GLN A CA   5  
ATOM 10981 C C    . GLN A 1 138 ? -18.194 -5.033  -4.773  1.00 0.00 ? 138 GLN A C    5  
ATOM 10982 O O    . GLN A 1 138 ? -17.675 -5.224  -3.673  1.00 0.00 ? 138 GLN A O    5  
ATOM 10983 C CB   . GLN A 1 138 ? -19.949 -6.813  -4.661  1.00 0.00 ? 138 GLN A CB   5  
ATOM 10984 C CG   . GLN A 1 138 ? -20.965 -5.815  -4.131  1.00 0.00 ? 138 GLN A CG   5  
ATOM 10985 C CD   . GLN A 1 138 ? -22.042 -6.469  -3.289  1.00 0.00 ? 138 GLN A CD   5  
ATOM 10986 O OE1  . GLN A 1 138 ? -22.969 -7.084  -3.816  1.00 0.00 ? 138 GLN A OE1  5  
ATOM 10987 N NE2  . GLN A 1 138 ? -21.926 -6.340  -1.973  1.00 0.00 ? 138 GLN A NE2  5  
ATOM 10988 H H    . GLN A 1 138 ? -17.083 -7.314  -5.375  1.00 0.00 ? 138 GLN A H    5  
ATOM 10989 H HA   . GLN A 1 138 ? -19.314 -5.783  -6.425  1.00 0.00 ? 138 GLN A HA   5  
ATOM 10990 H HB2  . GLN A 1 138 ? -20.475 -7.553  -5.247  1.00 0.00 ? 138 GLN A HB2  5  
ATOM 10991 H HB3  . GLN A 1 138 ? -19.481 -7.299  -3.818  1.00 0.00 ? 138 GLN A HB3  5  
ATOM 10992 H HG2  . GLN A 1 138 ? -20.450 -5.084  -3.524  1.00 0.00 ? 138 GLN A HG2  5  
ATOM 10993 H HG3  . GLN A 1 138 ? -21.434 -5.319  -4.968  1.00 0.00 ? 138 GLN A HG3  5  
ATOM 10994 H HE21 . GLN A 1 138 ? -21.161 -5.835  -1.624  1.00 0.00 ? 138 GLN A HE21 5  
ATOM 10995 H HE22 . GLN A 1 138 ? -22.608 -6.753  -1.405  1.00 0.00 ? 138 GLN A HE22 5  
ATOM 10996 N N    . GLU A 1 139 ? -18.212 -3.845  -5.370  1.00 0.00 ? 139 GLU A N    5  
ATOM 10997 C CA   . GLU A 1 139 ? -17.606 -2.672  -4.752  1.00 0.00 ? 139 GLU A CA   5  
ATOM 10998 C C    . GLU A 1 139 ? -17.981 -1.403  -5.511  1.00 0.00 ? 139 GLU A C    5  
ATOM 10999 O O    . GLU A 1 139 ? -18.038 -1.397  -6.741  1.00 0.00 ? 139 GLU A O    5  
ATOM 11000 C CB   . GLU A 1 139 ? -16.084 -2.821  -4.704  1.00 0.00 ? 139 GLU A CB   5  
ATOM 11001 C CG   . GLU A 1 139 ? -15.365 -1.573  -4.219  1.00 0.00 ? 139 GLU A CG   5  
ATOM 11002 C CD   . GLU A 1 139 ? -15.113 -0.575  -5.331  1.00 0.00 ? 139 GLU A CD   5  
ATOM 11003 O OE1  . GLU A 1 139 ? -14.512 -0.966  -6.354  1.00 0.00 ? 139 GLU A OE1  5  
ATOM 11004 O OE2  . GLU A 1 139 ? -15.515 0.598   -5.180  1.00 0.00 ? 139 GLU A OE2  5  
ATOM 11005 H H    . GLU A 1 139 ? -18.641 -3.757  -6.246  1.00 0.00 ? 139 GLU A H    5  
ATOM 11006 H HA   . GLU A 1 139 ? -17.983 -2.597  -3.742  1.00 0.00 ? 139 GLU A HA   5  
ATOM 11007 H HB2  . GLU A 1 139 ? -15.834 -3.636  -4.042  1.00 0.00 ? 139 GLU A HB2  5  
ATOM 11008 H HB3  . GLU A 1 139 ? -15.726 -3.053  -5.697  1.00 0.00 ? 139 GLU A HB3  5  
ATOM 11009 H HG2  . GLU A 1 139 ? -15.969 -1.098  -3.460  1.00 0.00 ? 139 GLU A HG2  5  
ATOM 11010 H HG3  . GLU A 1 139 ? -14.416 -1.863  -3.792  1.00 0.00 ? 139 GLU A HG3  5  
ATOM 11011 N N    . ARG A 1 140 ? -18.236 -0.330  -4.770  1.00 0.00 ? 140 ARG A N    5  
ATOM 11012 C CA   . ARG A 1 140 ? -18.608 0.945   -5.371  1.00 0.00 ? 140 ARG A CA   5  
ATOM 11013 C C    . ARG A 1 140 ? -17.836 2.095   -4.731  1.00 0.00 ? 140 ARG A C    5  
ATOM 11014 O O    . ARG A 1 140 ? -17.732 2.179   -3.508  1.00 0.00 ? 140 ARG A O    5  
ATOM 11015 C CB   . ARG A 1 140 ? -20.112 1.182   -5.228  1.00 0.00 ? 140 ARG A CB   5  
ATOM 11016 C CG   . ARG A 1 140 ? -20.587 2.479   -5.862  1.00 0.00 ? 140 ARG A CG   5  
ATOM 11017 C CD   . ARG A 1 140 ? -22.034 2.779   -5.500  1.00 0.00 ? 140 ARG A CD   5  
ATOM 11018 N NE   . ARG A 1 140 ? -22.164 3.284   -4.138  1.00 0.00 ? 140 ARG A NE   5  
ATOM 11019 C CZ   . ARG A 1 140 ? -23.198 4.004   -3.716  1.00 0.00 ? 140 ARG A CZ   5  
ATOM 11020 N NH1  . ARG A 1 140 ? -24.186 4.301   -4.548  1.00 0.00 ? 140 ARG A NH1  5  
ATOM 11021 N NH2  . ARG A 1 140 ? -23.244 4.429   -2.459  1.00 0.00 ? 140 ARG A NH2  5  
ATOM 11022 H H    . ARG A 1 140 ? -18.175 -0.397  -3.794  1.00 0.00 ? 140 ARG A H    5  
ATOM 11023 H HA   . ARG A 1 140 ? -18.358 0.901   -6.421  1.00 0.00 ? 140 ARG A HA   5  
ATOM 11024 H HB2  . ARG A 1 140 ? -20.641 0.364   -5.696  1.00 0.00 ? 140 ARG A HB2  5  
ATOM 11025 H HB3  . ARG A 1 140 ? -20.361 1.208   -4.178  1.00 0.00 ? 140 ARG A HB3  5  
ATOM 11026 H HG2  . ARG A 1 140 ? -19.966 3.290   -5.512  1.00 0.00 ? 140 ARG A HG2  5  
ATOM 11027 H HG3  . ARG A 1 140 ? -20.502 2.396   -6.935  1.00 0.00 ? 140 ARG A HG3  5  
ATOM 11028 H HD2  . ARG A 1 140 ? -22.416 3.520   -6.187  1.00 0.00 ? 140 ARG A HD2  5  
ATOM 11029 H HD3  . ARG A 1 140 ? -22.609 1.870   -5.595  1.00 0.00 ? 140 ARG A HD3  5  
ATOM 11030 H HE   . ARG A 1 140 ? -21.444 3.077   -3.506  1.00 0.00 ? 140 ARG A HE   5  
ATOM 11031 H HH11 . ARG A 1 140 ? -24.154 3.983   -5.495  1.00 0.00 ? 140 ARG A HH11 5  
ATOM 11032 H HH12 . ARG A 1 140 ? -24.964 4.843   -4.228  1.00 0.00 ? 140 ARG A HH12 5  
ATOM 11033 H HH21 . ARG A 1 140 ? -22.501 4.206   -1.829  1.00 0.00 ? 140 ARG A HH21 5  
ATOM 11034 H HH22 . ARG A 1 140 ? -24.022 4.971   -2.143  1.00 0.00 ? 140 ARG A HH22 5  
ATOM 11035 N N    . SER A 1 141 ? -17.298 2.977   -5.566  1.00 0.00 ? 141 SER A N    5  
ATOM 11036 C CA   . SER A 1 141 ? -16.532 4.120   -5.080  1.00 0.00 ? 141 SER A CA   5  
ATOM 11037 C C    . SER A 1 141 ? -16.196 5.074   -6.223  1.00 0.00 ? 141 SER A C    5  
ATOM 11038 O O    . SER A 1 141 ? -15.449 4.726   -7.136  1.00 0.00 ? 141 SER A O    5  
ATOM 11039 C CB   . SER A 1 141 ? -15.246 3.647   -4.400  1.00 0.00 ? 141 SER A CB   5  
ATOM 11040 O OG   . SER A 1 141 ? -14.360 3.061   -5.337  1.00 0.00 ? 141 SER A OG   5  
ATOM 11041 H H    . SER A 1 141 ? -17.416 2.856   -6.531  1.00 0.00 ? 141 SER A H    5  
ATOM 11042 H HA   . SER A 1 141 ? -17.141 4.643   -4.357  1.00 0.00 ? 141 SER A HA   5  
ATOM 11043 H HB2  . SER A 1 141 ? -14.755 4.490   -3.938  1.00 0.00 ? 141 SER A HB2  5  
ATOM 11044 H HB3  . SER A 1 141 ? -15.490 2.915   -3.645  1.00 0.00 ? 141 SER A HB3  5  
ATOM 11045 H HG   . SER A 1 141 ? -14.664 3.250   -6.228  1.00 0.00 ? 141 SER A HG   5  
ATOM 11046 N N    . GLY A 1 142 ? -16.755 6.278   -6.164  1.00 0.00 ? 142 GLY A N    5  
ATOM 11047 C CA   . GLY A 1 142 ? -16.503 7.265   -7.198  1.00 0.00 ? 142 GLY A CA   5  
ATOM 11048 C C    . GLY A 1 142 ? -16.072 8.602   -6.632  1.00 0.00 ? 142 GLY A C    5  
ATOM 11049 O O    . GLY A 1 142 ? -16.762 9.612   -6.774  1.00 0.00 ? 142 GLY A O    5  
ATOM 11050 H H    . GLY A 1 142 ? -17.342 6.501   -5.411  1.00 0.00 ? 142 GLY A H    5  
ATOM 11051 H HA2  . GLY A 1 142 ? -15.727 6.895   -7.851  1.00 0.00 ? 142 GLY A HA2  5  
ATOM 11052 H HA3  . GLY A 1 142 ? -17.406 7.404   -7.774  1.00 0.00 ? 142 GLY A HA3  5  
ATOM 11053 N N    . PRO A 1 143 ? -14.905 8.622   -5.971  1.00 0.00 ? 143 PRO A N    5  
ATOM 11054 C CA   . PRO A 1 143 ? -14.358 9.840   -5.366  1.00 0.00 ? 143 PRO A CA   5  
ATOM 11055 C C    . PRO A 1 143 ? -13.893 10.848  -6.412  1.00 0.00 ? 143 PRO A C    5  
ATOM 11056 O O    . PRO A 1 143 ? -13.547 10.478  -7.534  1.00 0.00 ? 143 PRO A O    5  
ATOM 11057 C CB   . PRO A 1 143 ? -13.167 9.327   -4.552  1.00 0.00 ? 143 PRO A CB   5  
ATOM 11058 C CG   . PRO A 1 143 ? -12.763 8.062   -5.227  1.00 0.00 ? 143 PRO A CG   5  
ATOM 11059 C CD   . PRO A 1 143 ? -14.030 7.456   -5.763  1.00 0.00 ? 143 PRO A CD   5  
ATOM 11060 H HA   . PRO A 1 143 ? -15.071 10.310  -4.706  1.00 0.00 ? 143 PRO A HA   5  
ATOM 11061 H HB2  . PRO A 1 143 ? -12.372 10.059  -4.573  1.00 0.00 ? 143 PRO A HB2  5  
ATOM 11062 H HB3  . PRO A 1 143 ? -13.473 9.150   -3.533  1.00 0.00 ? 143 PRO A HB3  5  
ATOM 11063 H HG2  . PRO A 1 143 ? -12.080 8.278   -6.035  1.00 0.00 ? 143 PRO A HG2  5  
ATOM 11064 H HG3  . PRO A 1 143 ? -12.302 7.396   -4.513  1.00 0.00 ? 143 PRO A HG3  5  
ATOM 11065 H HD2  . PRO A 1 143 ? -13.840 6.945   -6.695  1.00 0.00 ? 143 PRO A HD2  5  
ATOM 11066 H HD3  . PRO A 1 143 ? -14.459 6.777   -5.040  1.00 0.00 ? 143 PRO A HD3  5  
ATOM 11067 N N    . SER A 1 144 ? -13.888 12.123  -6.037  1.00 0.00 ? 144 SER A N    5  
ATOM 11068 C CA   . SER A 1 144 ? -13.470 13.185  -6.944  1.00 0.00 ? 144 SER A CA   5  
ATOM 11069 C C    . SER A 1 144 ? -12.135 12.844  -7.601  1.00 0.00 ? 144 SER A C    5  
ATOM 11070 O O    . SER A 1 144 ? -11.217 12.351  -6.946  1.00 0.00 ? 144 SER A O    5  
ATOM 11071 C CB   . SER A 1 144 ? -13.357 14.512  -6.192  1.00 0.00 ? 144 SER A CB   5  
ATOM 11072 O OG   . SER A 1 144 ? -14.637 15.059  -5.927  1.00 0.00 ? 144 SER A OG   5  
ATOM 11073 H H    . SER A 1 144 ? -14.176 12.355  -5.128  1.00 0.00 ? 144 SER A H    5  
ATOM 11074 H HA   . SER A 1 144 ? -14.222 13.280  -7.713  1.00 0.00 ? 144 SER A HA   5  
ATOM 11075 H HB2  . SER A 1 144 ? -12.847 14.350  -5.254  1.00 0.00 ? 144 SER A HB2  5  
ATOM 11076 H HB3  . SER A 1 144 ? -12.795 15.215  -6.790  1.00 0.00 ? 144 SER A HB3  5  
ATOM 11077 H HG   . SER A 1 144 ? -15.269 14.716  -6.563  1.00 0.00 ? 144 SER A HG   5  
ATOM 11078 N N    . SER A 1 145 ? -12.037 13.110  -8.900  1.00 0.00 ? 145 SER A N    5  
ATOM 11079 C CA   . SER A 1 145 ? -10.817 12.828  -9.647  1.00 0.00 ? 145 SER A CA   5  
ATOM 11080 C C    . SER A 1 145 ? -9.716  13.821  -9.284  1.00 0.00 ? 145 SER A C    5  
ATOM 11081 O O    . SER A 1 145 ? -9.973  15.011  -9.104  1.00 0.00 ? 145 SER A O    5  
ATOM 11082 C CB   . SER A 1 145 ? -11.092 12.881  -11.151 1.00 0.00 ? 145 SER A CB   5  
ATOM 11083 O OG   . SER A 1 145 ? -11.673 14.120  -11.520 1.00 0.00 ? 145 SER A OG   5  
ATOM 11084 H H    . SER A 1 145 ? -12.805 13.503  -9.366  1.00 0.00 ? 145 SER A H    5  
ATOM 11085 H HA   . SER A 1 145 ? -10.489 11.833  -9.384  1.00 0.00 ? 145 SER A HA   5  
ATOM 11086 H HB2  . SER A 1 145 ? -10.165 12.758  -11.688 1.00 0.00 ? 145 SER A HB2  5  
ATOM 11087 H HB3  . SER A 1 145 ? -11.771 12.084  -11.418 1.00 0.00 ? 145 SER A HB3  5  
ATOM 11088 H HG   . SER A 1 145 ? -12.487 13.960  -12.004 1.00 0.00 ? 145 SER A HG   5  
ATOM 11089 N N    . GLY A 1 146 ? -8.489  13.322  -9.179  1.00 0.00 ? 146 GLY A N    5  
ATOM 11090 C CA   . GLY A 1 146 ? -7.367  14.177  -8.838  1.00 0.00 ? 146 GLY A CA   5  
ATOM 11091 C C    . GLY A 1 146 ? -6.082  13.397  -8.646  1.00 0.00 ? 146 GLY A C    5  
ATOM 11092 O O    . GLY A 1 146 ? -5.321  13.196  -9.593  1.00 0.00 ? 146 GLY A O    5  
ATOM 11093 H H    . GLY A 1 146 ? -8.344  12.365  -9.334  1.00 0.00 ? 146 GLY A H    5  
ATOM 11094 H HA2  . GLY A 1 146 ? -7.223  14.896  -9.631  1.00 0.00 ? 146 GLY A HA2  5  
ATOM 11095 H HA3  . GLY A 1 146 ? -7.595  14.703  -7.924  1.00 0.00 ? 146 GLY A HA3  5  
ATOM 11096 N N    . GLY A 1 1   ? -4.137  -6.047  -20.774 1.00 0.00 ? 1   GLY A N    6  
ATOM 11097 C CA   . GLY A 1 1   ? -5.566  -5.802  -20.737 1.00 0.00 ? 1   GLY A CA   6  
ATOM 11098 C C    . GLY A 1 1   ? -6.290  -6.737  -19.787 1.00 0.00 ? 1   GLY A C    6  
ATOM 11099 O O    . GLY A 1 1   ? -7.132  -6.304  -19.001 1.00 0.00 ? 1   GLY A O    6  
ATOM 11100 H H1   . GLY A 1 1   ? -3.565  -5.706  -20.055 1.00 0.00 ? 1   GLY A H1   6  
ATOM 11101 H HA2  . GLY A 1 1   ? -5.739  -4.783  -20.424 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 11102 H HA3  . GLY A 1 1   ? -5.968  -5.936  -21.730 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 11103 N N    . SER A 1 2   ? -5.961  -8.023  -19.861 1.00 0.00 ? 2   SER A N    6  
ATOM 11104 C CA   . SER A 1 2   ? -6.590  -9.022  -19.005 1.00 0.00 ? 2   SER A CA   6  
ATOM 11105 C C    . SER A 1 2   ? -6.557  -8.584  -17.543 1.00 0.00 ? 2   SER A C    6  
ATOM 11106 O O    . SER A 1 2   ? -5.788  -7.699  -17.167 1.00 0.00 ? 2   SER A O    6  
ATOM 11107 C CB   . SER A 1 2   ? -5.888  -10.372 -19.161 1.00 0.00 ? 2   SER A CB   6  
ATOM 11108 O OG   . SER A 1 2   ? -4.586  -10.337 -18.604 1.00 0.00 ? 2   SER A OG   6  
ATOM 11109 H H    . SER A 1 2   ? -5.283  -8.306  -20.508 1.00 0.00 ? 2   SER A H    6  
ATOM 11110 H HA   . SER A 1 2   ? -7.620  -9.122  -19.314 1.00 0.00 ? 2   SER A HA   6  
ATOM 11111 H HB2  . SER A 1 2   ? -6.463  -11.134 -18.656 1.00 0.00 ? 2   SER A HB2  6  
ATOM 11112 H HB3  . SER A 1 2   ? -5.813  -10.615 -20.211 1.00 0.00 ? 2   SER A HB3  6  
ATOM 11113 H HG   . SER A 1 2   ? -4.005  -9.833  -19.179 1.00 0.00 ? 2   SER A HG   6  
ATOM 11114 N N    . SER A 1 3   ? -7.396  -9.211  -16.724 1.00 0.00 ? 3   SER A N    6  
ATOM 11115 C CA   . SER A 1 3   ? -7.465  -8.884  -15.305 1.00 0.00 ? 3   SER A CA   6  
ATOM 11116 C C    . SER A 1 3   ? -6.696  -9.906  -14.474 1.00 0.00 ? 3   SER A C    6  
ATOM 11117 O O    . SER A 1 3   ? -5.849  -9.549  -13.657 1.00 0.00 ? 3   SER A O    6  
ATOM 11118 C CB   . SER A 1 3   ? -8.923  -8.829  -14.844 1.00 0.00 ? 3   SER A CB   6  
ATOM 11119 O OG   . SER A 1 3   ? -9.454  -7.523  -14.989 1.00 0.00 ? 3   SER A OG   6  
ATOM 11120 H H    . SER A 1 3   ? -7.983  -9.907  -17.085 1.00 0.00 ? 3   SER A H    6  
ATOM 11121 H HA   . SER A 1 3   ? -7.015  -7.913  -15.166 1.00 0.00 ? 3   SER A HA   6  
ATOM 11122 H HB2  . SER A 1 3   ? -9.512  -9.512  -15.437 1.00 0.00 ? 3   SER A HB2  6  
ATOM 11123 H HB3  . SER A 1 3   ? -8.979  -9.114  -13.803 1.00 0.00 ? 3   SER A HB3  6  
ATOM 11124 H HG   . SER A 1 3   ? -9.489  -7.293  -15.921 1.00 0.00 ? 3   SER A HG   6  
ATOM 11125 N N    . GLY A 1 4   ? -6.997  -11.184 -14.690 1.00 0.00 ? 4   GLY A N    6  
ATOM 11126 C CA   . GLY A 1 4   ? -6.326  -12.239 -13.954 1.00 0.00 ? 4   GLY A CA   6  
ATOM 11127 C C    . GLY A 1 4   ? -7.172  -12.782 -12.819 1.00 0.00 ? 4   GLY A C    6  
ATOM 11128 O O    . GLY A 1 4   ? -8.345  -12.435 -12.689 1.00 0.00 ? 4   GLY A O    6  
ATOM 11129 H H    . GLY A 1 4   ? -7.682  -11.410 -15.354 1.00 0.00 ? 4   GLY A H    6  
ATOM 11130 H HA2  . GLY A 1 4   ? -6.094  -13.046 -14.634 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 11131 H HA3  . GLY A 1 4   ? -5.405  -11.848 -13.548 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 11132 N N    . SER A 1 5   ? -6.574  -13.637 -11.995 1.00 0.00 ? 5   SER A N    6  
ATOM 11133 C CA   . SER A 1 5   ? -7.281  -14.233 -10.868 1.00 0.00 ? 5   SER A CA   6  
ATOM 11134 C C    . SER A 1 5   ? -6.413  -14.218 -9.613  1.00 0.00 ? 5   SER A C    6  
ATOM 11135 O O    . SER A 1 5   ? -5.184  -14.226 -9.694  1.00 0.00 ? 5   SER A O    6  
ATOM 11136 C CB   . SER A 1 5   ? -7.694  -15.668 -11.198 1.00 0.00 ? 5   SER A CB   6  
ATOM 11137 O OG   . SER A 1 5   ? -6.560  -16.509 -11.325 1.00 0.00 ? 5   SER A OG   6  
ATOM 11138 H H    . SER A 1 5   ? -5.635  -13.874 -12.151 1.00 0.00 ? 5   SER A H    6  
ATOM 11139 H HA   . SER A 1 5   ? -8.168  -13.645 -10.684 1.00 0.00 ? 5   SER A HA   6  
ATOM 11140 H HB2  . SER A 1 5   ? -8.324  -16.049 -10.410 1.00 0.00 ? 5   SER A HB2  6  
ATOM 11141 H HB3  . SER A 1 5   ? -8.240  -15.677 -12.131 1.00 0.00 ? 5   SER A HB3  6  
ATOM 11142 H HG   . SER A 1 5   ? -6.460  -16.775 -12.242 1.00 0.00 ? 5   SER A HG   6  
ATOM 11143 N N    . SER A 1 6   ? -7.061  -14.197 -8.453  1.00 0.00 ? 6   SER A N    6  
ATOM 11144 C CA   . SER A 1 6   ? -6.350  -14.177 -7.180  1.00 0.00 ? 6   SER A CA   6  
ATOM 11145 C C    . SER A 1 6   ? -5.265  -15.250 -7.148  1.00 0.00 ? 6   SER A C    6  
ATOM 11146 O O    . SER A 1 6   ? -5.343  -16.250 -7.859  1.00 0.00 ? 6   SER A O    6  
ATOM 11147 C CB   . SER A 1 6   ? -7.327  -14.390 -6.021  1.00 0.00 ? 6   SER A CB   6  
ATOM 11148 O OG   . SER A 1 6   ? -6.767  -13.951 -4.796  1.00 0.00 ? 6   SER A OG   6  
ATOM 11149 H H    . SER A 1 6   ? -8.041  -14.192 -8.453  1.00 0.00 ? 6   SER A H    6  
ATOM 11150 H HA   . SER A 1 6   ? -5.885  -13.208 -7.075  1.00 0.00 ? 6   SER A HA   6  
ATOM 11151 H HB2  . SER A 1 6   ? -8.231  -13.832 -6.211  1.00 0.00 ? 6   SER A HB2  6  
ATOM 11152 H HB3  . SER A 1 6   ? -7.562  -15.441 -5.941  1.00 0.00 ? 6   SER A HB3  6  
ATOM 11153 H HG   . SER A 1 6   ? -5.942  -14.413 -4.637  1.00 0.00 ? 6   SER A HG   6  
ATOM 11154 N N    . GLY A 1 7   ? -4.251  -15.031 -6.315  1.00 0.00 ? 7   GLY A N    6  
ATOM 11155 C CA   . GLY A 1 7   ? -3.164  -15.987 -6.205  1.00 0.00 ? 7   GLY A CA   6  
ATOM 11156 C C    . GLY A 1 7   ? -3.093  -16.628 -4.833  1.00 0.00 ? 7   GLY A C    6  
ATOM 11157 O O    . GLY A 1 7   ? -3.442  -16.006 -3.830  1.00 0.00 ? 7   GLY A O    6  
ATOM 11158 H H    . GLY A 1 7   ? -4.241  -14.217 -5.771  1.00 0.00 ? 7   GLY A H    6  
ATOM 11159 H HA2  . GLY A 1 7   ? -3.301  -16.760 -6.945  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 11160 H HA3  . GLY A 1 7   ? -2.231  -15.477 -6.398  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 11161 N N    . ASN A 1 8   ? -2.642  -17.878 -4.788  1.00 0.00 ? 8   ASN A N    6  
ATOM 11162 C CA   . ASN A 1 8   ? -2.530  -18.605 -3.529  1.00 0.00 ? 8   ASN A CA   6  
ATOM 11163 C C    . ASN A 1 8   ? -1.780  -17.778 -2.489  1.00 0.00 ? 8   ASN A C    6  
ATOM 11164 O O    . ASN A 1 8   ? -0.579  -17.544 -2.615  1.00 0.00 ? 8   ASN A O    6  
ATOM 11165 C CB   . ASN A 1 8   ? -1.812  -19.939 -3.749  1.00 0.00 ? 8   ASN A CB   6  
ATOM 11166 C CG   . ASN A 1 8   ? -0.422  -19.760 -4.328  1.00 0.00 ? 8   ASN A CG   6  
ATOM 11167 O OD1  . ASN A 1 8   ? -0.096  -18.706 -4.875  1.00 0.00 ? 8   ASN A OD1  6  
ATOM 11168 N ND2  . ASN A 1 8   ? 0.405   -20.792 -4.212  1.00 0.00 ? 8   ASN A ND2  6  
ATOM 11169 H H    . ASN A 1 8   ? -2.379  -18.321 -5.621  1.00 0.00 ? 8   ASN A H    6  
ATOM 11170 H HA   . ASN A 1 8   ? -3.528  -18.798 -3.168  1.00 0.00 ? 8   ASN A HA   6  
ATOM 11171 H HB2  . ASN A 1 8   ? -1.724  -20.454 -2.804  1.00 0.00 ? 8   ASN A HB2  6  
ATOM 11172 H HB3  . ASN A 1 8   ? -2.392  -20.544 -4.431  1.00 0.00 ? 8   ASN A HB3  6  
ATOM 11173 H HD21 . ASN A 1 8   ? 0.077   -21.600 -3.764  1.00 0.00 ? 8   ASN A HD21 6  
ATOM 11174 H HD22 . ASN A 1 8   ? 1.310   -20.703 -4.576  1.00 0.00 ? 8   ASN A HD22 6  
ATOM 11175 N N    . ARG A 1 9   ? -2.498  -17.341 -1.460  1.00 0.00 ? 9   ARG A N    6  
ATOM 11176 C CA   . ARG A 1 9   ? -1.903  -16.540 -0.397  1.00 0.00 ? 9   ARG A CA   6  
ATOM 11177 C C    . ARG A 1 9   ? -1.386  -17.429 0.729   1.00 0.00 ? 9   ARG A C    6  
ATOM 11178 O O    . ARG A 1 9   ? -1.601  -18.642 0.725   1.00 0.00 ? 9   ARG A O    6  
ATOM 11179 C CB   . ARG A 1 9   ? -2.924  -15.542 0.154   1.00 0.00 ? 9   ARG A CB   6  
ATOM 11180 C CG   . ARG A 1 9   ? -4.166  -16.200 0.732   1.00 0.00 ? 9   ARG A CG   6  
ATOM 11181 C CD   . ARG A 1 9   ? -3.997  -16.503 2.212   1.00 0.00 ? 9   ARG A CD   6  
ATOM 11182 N NE   . ARG A 1 9   ? -5.092  -17.315 2.735   1.00 0.00 ? 9   ARG A NE   6  
ATOM 11183 C CZ   . ARG A 1 9   ? -6.251  -16.810 3.145   1.00 0.00 ? 9   ARG A CZ   6  
ATOM 11184 N NH1  . ARG A 1 9   ? -6.463  -15.503 3.093   1.00 0.00 ? 9   ARG A NH1  6  
ATOM 11185 N NH2  . ARG A 1 9   ? -7.200  -17.615 3.606   1.00 0.00 ? 9   ARG A NH2  6  
ATOM 11186 H H    . ARG A 1 9   ? -3.452  -17.560 -1.415  1.00 0.00 ? 9   ARG A H    6  
ATOM 11187 H HA   . ARG A 1 9   ? -1.072  -15.994 -0.819  1.00 0.00 ? 9   ARG A HA   6  
ATOM 11188 H HB2  . ARG A 1 9   ? -2.457  -14.958 0.932   1.00 0.00 ? 9   ARG A HB2  6  
ATOM 11189 H HB3  . ARG A 1 9   ? -3.232  -14.884 -0.645  1.00 0.00 ? 9   ARG A HB3  6  
ATOM 11190 H HG2  . ARG A 1 9   ? -5.007  -15.534 0.606   1.00 0.00 ? 9   ARG A HG2  6  
ATOM 11191 H HG3  . ARG A 1 9   ? -4.353  -17.123 0.204   1.00 0.00 ? 9   ARG A HG3  6  
ATOM 11192 H HD2  . ARG A 1 9   ? -3.068  -17.035 2.354   1.00 0.00 ? 9   ARG A HD2  6  
ATOM 11193 H HD3  . ARG A 1 9   ? -3.962  -15.570 2.755   1.00 0.00 ? 9   ARG A HD3  6  
ATOM 11194 H HE   . ARG A 1 9   ? -4.957  -18.284 2.781   1.00 0.00 ? 9   ARG A HE   6  
ATOM 11195 H HH11 . ARG A 1 9   ? -5.750  -14.895 2.745   1.00 0.00 ? 9   ARG A HH11 6  
ATOM 11196 H HH12 . ARG A 1 9   ? -7.337  -15.126 3.402   1.00 0.00 ? 9   ARG A HH12 6  
ATOM 11197 H HH21 . ARG A 1 9   ? -7.043  -18.601 3.646   1.00 0.00 ? 9   ARG A HH21 6  
ATOM 11198 H HH22 . ARG A 1 9   ? -8.071  -17.234 3.915   1.00 0.00 ? 9   ARG A HH22 6  
ATOM 11199 N N    . LEU A 1 10  ? -0.703  -16.818 1.692   1.00 0.00 ? 10  LEU A N    6  
ATOM 11200 C CA   . LEU A 1 10  ? -0.156  -17.555 2.826   1.00 0.00 ? 10  LEU A CA   6  
ATOM 11201 C C    . LEU A 1 10  ? -0.851  -17.154 4.123   1.00 0.00 ? 10  LEU A C    6  
ATOM 11202 O O    . LEU A 1 10  ? -0.875  -15.978 4.488   1.00 0.00 ? 10  LEU A O    6  
ATOM 11203 C CB   . LEU A 1 10  ? 1.349   -17.305 2.942   1.00 0.00 ? 10  LEU A CB   6  
ATOM 11204 C CG   . LEU A 1 10  ? 2.215   -17.893 1.826   1.00 0.00 ? 10  LEU A CG   6  
ATOM 11205 C CD1  . LEU A 1 10  ? 3.649   -17.406 1.952   1.00 0.00 ? 10  LEU A CD1  6  
ATOM 11206 C CD2  . LEU A 1 10  ? 2.161   -19.414 1.855   1.00 0.00 ? 10  LEU A CD2  6  
ATOM 11207 H H    . LEU A 1 10  ? -0.565  -15.851 1.640   1.00 0.00 ? 10  LEU A H    6  
ATOM 11208 H HA   . LEU A 1 10  ? -0.325  -18.607 2.651   1.00 0.00 ? 10  LEU A HA   6  
ATOM 11209 H HB2  . LEU A 1 10  ? 1.508   -16.238 2.955   1.00 0.00 ? 10  LEU A HB2  6  
ATOM 11210 H HB3  . LEU A 1 10  ? 1.683   -17.729 3.879   1.00 0.00 ? 10  LEU A HB3  6  
ATOM 11211 H HG   . LEU A 1 10  ? 1.833   -17.562 0.871   1.00 0.00 ? 10  LEU A HG   6  
ATOM 11212 H HD11 . LEU A 1 10  ? 4.020   -17.123 0.979   1.00 0.00 ? 10  LEU A HD11 6  
ATOM 11213 H HD12 . LEU A 1 10  ? 4.264   -18.198 2.354   1.00 0.00 ? 10  LEU A HD12 6  
ATOM 11214 H HD13 . LEU A 1 10  ? 3.683   -16.552 2.614   1.00 0.00 ? 10  LEU A HD13 6  
ATOM 11215 H HD21 . LEU A 1 10  ? 2.253   -19.757 2.875   1.00 0.00 ? 10  LEU A HD21 6  
ATOM 11216 H HD22 . LEU A 1 10  ? 2.974   -19.814 1.266   1.00 0.00 ? 10  LEU A HD22 6  
ATOM 11217 H HD23 . LEU A 1 10  ? 1.220   -19.748 1.445   1.00 0.00 ? 10  LEU A HD23 6  
ATOM 11218 N N    . LEU A 1 11  ? -1.412  -18.138 4.816   1.00 0.00 ? 11  LEU A N    6  
ATOM 11219 C CA   . LEU A 1 11  ? -2.106  -17.888 6.075   1.00 0.00 ? 11  LEU A CA   6  
ATOM 11220 C C    . LEU A 1 11  ? -1.149  -17.327 7.122   1.00 0.00 ? 11  LEU A C    6  
ATOM 11221 O O    . LEU A 1 11  ? -0.657  -18.058 7.982   1.00 0.00 ? 11  LEU A O    6  
ATOM 11222 C CB   . LEU A 1 11  ? -2.746  -19.178 6.592   1.00 0.00 ? 11  LEU A CB   6  
ATOM 11223 C CG   . LEU A 1 11  ? -4.067  -19.582 5.934   1.00 0.00 ? 11  LEU A CG   6  
ATOM 11224 C CD1  . LEU A 1 11  ? -5.187  -18.651 6.369   1.00 0.00 ? 11  LEU A CD1  6  
ATOM 11225 C CD2  . LEU A 1 11  ? -3.929  -19.582 4.418   1.00 0.00 ? 11  LEU A CD2  6  
ATOM 11226 H H    . LEU A 1 11  ? -1.360  -19.055 4.474   1.00 0.00 ? 11  LEU A H    6  
ATOM 11227 H HA   . LEU A 1 11  ? -2.882  -17.161 5.888   1.00 0.00 ? 11  LEU A HA   6  
ATOM 11228 H HB2  . LEU A 1 11  ? -2.043  -19.981 6.439   1.00 0.00 ? 11  LEU A HB2  6  
ATOM 11229 H HB3  . LEU A 1 11  ? -2.927  -19.056 7.650   1.00 0.00 ? 11  LEU A HB3  6  
ATOM 11230 H HG   . LEU A 1 11  ? -4.326  -20.584 6.247   1.00 0.00 ? 11  LEU A HG   6  
ATOM 11231 H HD11 . LEU A 1 11  ? -5.924  -18.583 5.583   1.00 0.00 ? 11  LEU A HD11 6  
ATOM 11232 H HD12 . LEU A 1 11  ? -4.782  -17.670 6.570   1.00 0.00 ? 11  LEU A HD12 6  
ATOM 11233 H HD13 . LEU A 1 11  ? -5.649  -19.039 7.265   1.00 0.00 ? 11  LEU A HD13 6  
ATOM 11234 H HD21 . LEU A 1 11  ? -3.563  -18.620 4.091   1.00 0.00 ? 11  LEU A HD21 6  
ATOM 11235 H HD22 . LEU A 1 11  ? -4.893  -19.772 3.969   1.00 0.00 ? 11  LEU A HD22 6  
ATOM 11236 H HD23 . LEU A 1 11  ? -3.235  -20.354 4.120   1.00 0.00 ? 11  LEU A HD23 6  
ATOM 11237 N N    . SER A 1 12  ? -0.892  -16.026 7.044   1.00 0.00 ? 12  SER A N    6  
ATOM 11238 C CA   . SER A 1 12  ? 0.008   -15.367 7.984   1.00 0.00 ? 12  SER A CA   6  
ATOM 11239 C C    . SER A 1 12  ? -0.292  -13.874 8.066   1.00 0.00 ? 12  SER A C    6  
ATOM 11240 O O    . SER A 1 12  ? -0.615  -13.236 7.064   1.00 0.00 ? 12  SER A O    6  
ATOM 11241 C CB   . SER A 1 12  ? 1.464   -15.585 7.568   1.00 0.00 ? 12  SER A CB   6  
ATOM 11242 O OG   . SER A 1 12  ? 1.984   -16.773 8.137   1.00 0.00 ? 12  SER A OG   6  
ATOM 11243 H H    . SER A 1 12  ? -1.315  -15.497 6.335   1.00 0.00 ? 12  SER A H    6  
ATOM 11244 H HA   . SER A 1 12  ? -0.149  -15.808 8.957   1.00 0.00 ? 12  SER A HA   6  
ATOM 11245 H HB2  . SER A 1 12  ? 1.520   -15.660 6.492   1.00 0.00 ? 12  SER A HB2  6  
ATOM 11246 H HB3  . SER A 1 12  ? 2.059   -14.747 7.902   1.00 0.00 ? 12  SER A HB3  6  
ATOM 11247 H HG   . SER A 1 12  ? 1.268   -17.391 8.299   1.00 0.00 ? 12  SER A HG   6  
ATOM 11248 N N    . LYS A 1 13  ? -0.182  -13.320 9.269   1.00 0.00 ? 13  LYS A N    6  
ATOM 11249 C CA   . LYS A 1 13  ? -0.440  -11.901 9.485   1.00 0.00 ? 13  LYS A CA   6  
ATOM 11250 C C    . LYS A 1 13  ? 0.863   -11.141 9.721   1.00 0.00 ? 13  LYS A C    6  
ATOM 11251 O O    . LYS A 1 13  ? 0.862   -9.919  9.865   1.00 0.00 ? 13  LYS A O    6  
ATOM 11252 C CB   . LYS A 1 13  ? -1.378  -11.707 10.678  1.00 0.00 ? 13  LYS A CB   6  
ATOM 11253 C CG   . LYS A 1 13  ? -2.700  -12.443 10.538  1.00 0.00 ? 13  LYS A CG   6  
ATOM 11254 C CD   . LYS A 1 13  ? -3.297  -12.780 11.894  1.00 0.00 ? 13  LYS A CD   6  
ATOM 11255 C CE   . LYS A 1 13  ? -4.194  -11.661 12.402  1.00 0.00 ? 13  LYS A CE   6  
ATOM 11256 N NZ   . LYS A 1 13  ? -5.539  -11.696 11.763  1.00 0.00 ? 13  LYS A NZ   6  
ATOM 11257 H H    . LYS A 1 13  ? 0.080   -13.879 10.030  1.00 0.00 ? 13  LYS A H    6  
ATOM 11258 H HA   . LYS A 1 13  ? -0.914  -11.511 8.597   1.00 0.00 ? 13  LYS A HA   6  
ATOM 11259 H HB2  . LYS A 1 13  ? -0.885  -12.064 11.571  1.00 0.00 ? 13  LYS A HB2  6  
ATOM 11260 H HB3  . LYS A 1 13  ? -1.587  -10.653 10.789  1.00 0.00 ? 13  LYS A HB3  6  
ATOM 11261 H HG2  . LYS A 1 13  ? -3.394  -11.817 9.997   1.00 0.00 ? 13  LYS A HG2  6  
ATOM 11262 H HG3  . LYS A 1 13  ? -2.535  -13.359 9.988   1.00 0.00 ? 13  LYS A HG3  6  
ATOM 11263 H HD2  . LYS A 1 13  ? -3.882  -13.683 11.805  1.00 0.00 ? 13  LYS A HD2  6  
ATOM 11264 H HD3  . LYS A 1 13  ? -2.495  -12.937 12.601  1.00 0.00 ? 13  LYS A HD3  6  
ATOM 11265 H HE2  . LYS A 1 13  ? -4.309  -11.767 13.469  1.00 0.00 ? 13  LYS A HE2  6  
ATOM 11266 H HE3  . LYS A 1 13  ? -3.724  -10.715 12.183  1.00 0.00 ? 13  LYS A HE3  6  
ATOM 11267 H HZ1  . LYS A 1 13  ? -5.605  -12.504 11.111  1.00 0.00 ? 13  LYS A HZ1  6  
ATOM 11268 H HZ2  . LYS A 1 13  ? -5.701  -10.818 11.228  1.00 0.00 ? 13  LYS A HZ2  6  
ATOM 11269 H HZ3  . LYS A 1 13  ? -6.277  -11.788 12.489  1.00 0.00 ? 13  LYS A HZ3  6  
ATOM 11270 N N    . TYR A 1 14  ? 1.970   -11.873 9.756   1.00 0.00 ? 14  TYR A N    6  
ATOM 11271 C CA   . TYR A 1 14  ? 3.279   -11.269 9.976   1.00 0.00 ? 14  TYR A CA   6  
ATOM 11272 C C    . TYR A 1 14  ? 4.395   -12.278 9.722   1.00 0.00 ? 14  TYR A C    6  
ATOM 11273 O O    . TYR A 1 14  ? 4.163   -13.487 9.713   1.00 0.00 ? 14  TYR A O    6  
ATOM 11274 C CB   . TYR A 1 14  ? 3.382   -10.726 11.402  1.00 0.00 ? 14  TYR A CB   6  
ATOM 11275 C CG   . TYR A 1 14  ? 4.347   -9.571  11.542  1.00 0.00 ? 14  TYR A CG   6  
ATOM 11276 C CD1  . TYR A 1 14  ? 5.712   -9.792  11.677  1.00 0.00 ? 14  TYR A CD1  6  
ATOM 11277 C CD2  . TYR A 1 14  ? 3.894   -8.257  11.540  1.00 0.00 ? 14  TYR A CD2  6  
ATOM 11278 C CE1  . TYR A 1 14  ? 6.597   -8.740  11.807  1.00 0.00 ? 14  TYR A CE1  6  
ATOM 11279 C CE2  . TYR A 1 14  ? 4.771   -7.198  11.668  1.00 0.00 ? 14  TYR A CE2  6  
ATOM 11280 C CZ   . TYR A 1 14  ? 6.123   -7.445  11.801  1.00 0.00 ? 14  TYR A CZ   6  
ATOM 11281 O OH   . TYR A 1 14  ? 7.001   -6.394  11.928  1.00 0.00 ? 14  TYR A OH   6  
ATOM 11282 H H    . TYR A 1 14  ? 1.908   -12.843 9.635   1.00 0.00 ? 14  TYR A H    6  
ATOM 11283 H HA   . TYR A 1 14  ? 3.386   -10.449 9.281   1.00 0.00 ? 14  TYR A HA   6  
ATOM 11284 H HB2  . TYR A 1 14  ? 2.408   -10.385 11.721  1.00 0.00 ? 14  TYR A HB2  6  
ATOM 11285 H HB3  . TYR A 1 14  ? 3.713   -11.517 12.059  1.00 0.00 ? 14  TYR A HB3  6  
ATOM 11286 H HD1  . TYR A 1 14  ? 6.080   -10.808 11.680  1.00 0.00 ? 14  TYR A HD1  6  
ATOM 11287 H HD2  . TYR A 1 14  ? 2.835   -8.067  11.436  1.00 0.00 ? 14  TYR A HD2  6  
ATOM 11288 H HE1  . TYR A 1 14  ? 7.654   -8.933  11.911  1.00 0.00 ? 14  TYR A HE1  6  
ATOM 11289 H HE2  . TYR A 1 14  ? 4.401   -6.184  11.665  1.00 0.00 ? 14  TYR A HE2  6  
ATOM 11290 H HH   . TYR A 1 14  ? 7.615   -6.399  11.191  1.00 0.00 ? 14  TYR A HH   6  
ATOM 11291 N N    . ASP A 1 15  ? 5.606   -11.772 9.517   1.00 0.00 ? 15  ASP A N    6  
ATOM 11292 C CA   . ASP A 1 15  ? 6.760   -12.627 9.266   1.00 0.00 ? 15  ASP A CA   6  
ATOM 11293 C C    . ASP A 1 15  ? 8.048   -11.810 9.245   1.00 0.00 ? 15  ASP A C    6  
ATOM 11294 O O    . ASP A 1 15  ? 8.165   -10.806 8.541   1.00 0.00 ? 15  ASP A O    6  
ATOM 11295 C CB   . ASP A 1 15  ? 6.591   -13.370 7.940   1.00 0.00 ? 15  ASP A CB   6  
ATOM 11296 C CG   . ASP A 1 15  ? 7.151   -14.778 7.989   1.00 0.00 ? 15  ASP A CG   6  
ATOM 11297 O OD1  . ASP A 1 15  ? 7.194   -15.361 9.093   1.00 0.00 ? 15  ASP A OD1  6  
ATOM 11298 O OD2  . ASP A 1 15  ? 7.547   -15.296 6.924   1.00 0.00 ? 15  ASP A OD2  6  
ATOM 11299 H H    . ASP A 1 15  ? 5.727   -10.799 9.538   1.00 0.00 ? 15  ASP A H    6  
ATOM 11300 H HA   . ASP A 1 15  ? 6.818   -13.349 10.067  1.00 0.00 ? 15  ASP A HA   6  
ATOM 11301 H HB2  . ASP A 1 15  ? 5.539   -13.430 7.699   1.00 0.00 ? 15  ASP A HB2  6  
ATOM 11302 H HB3  . ASP A 1 15  ? 7.103   -12.824 7.162   1.00 0.00 ? 15  ASP A HB3  6  
ATOM 11303 N N    . PRO A 1 16  ? 9.039   -12.247 10.037  1.00 0.00 ? 16  PRO A N    6  
ATOM 11304 C CA   . PRO A 1 16  ? 10.336  -11.571 10.127  1.00 0.00 ? 16  PRO A CA   6  
ATOM 11305 C C    . PRO A 1 16  ? 11.157  -11.718 8.851   1.00 0.00 ? 16  PRO A C    6  
ATOM 11306 O O    . PRO A 1 16  ? 12.043  -10.909 8.576   1.00 0.00 ? 16  PRO A O    6  
ATOM 11307 C CB   . PRO A 1 16  ? 11.027  -12.282 11.294  1.00 0.00 ? 16  PRO A CB   6  
ATOM 11308 C CG   . PRO A 1 16  ? 10.394  -13.630 11.342  1.00 0.00 ? 16  PRO A CG   6  
ATOM 11309 C CD   . PRO A 1 16  ? 8.969   -13.435 10.903  1.00 0.00 ? 16  PRO A CD   6  
ATOM 11310 H HA   . PRO A 1 16  ? 10.221  -10.522 10.361  1.00 0.00 ? 16  PRO A HA   6  
ATOM 11311 H HB2  . PRO A 1 16  ? 12.088  -12.350 11.100  1.00 0.00 ? 16  PRO A HB2  6  
ATOM 11312 H HB3  . PRO A 1 16  ? 10.856  -11.733 12.206  1.00 0.00 ? 16  PRO A HB3  6  
ATOM 11313 H HG2  . PRO A 1 16  ? 10.906  -14.300 10.669  1.00 0.00 ? 16  PRO A HG2  6  
ATOM 11314 H HG3  . PRO A 1 16  ? 10.426  -14.014 12.352  1.00 0.00 ? 16  PRO A HG3  6  
ATOM 11315 H HD2  . PRO A 1 16  ? 8.624   -14.296 10.350  1.00 0.00 ? 16  PRO A HD2  6  
ATOM 11316 H HD3  . PRO A 1 16  ? 8.333   -13.252 11.757  1.00 0.00 ? 16  PRO A HD3  6  
ATOM 11317 N N    . GLN A 1 17  ? 10.857  -12.756 8.077   1.00 0.00 ? 17  GLN A N    6  
ATOM 11318 C CA   . GLN A 1 17  ? 11.570  -13.009 6.830   1.00 0.00 ? 17  GLN A CA   6  
ATOM 11319 C C    . GLN A 1 17  ? 10.909  -12.277 5.667   1.00 0.00 ? 17  GLN A C    6  
ATOM 11320 O O    . GLN A 1 17  ? 11.587  -11.725 4.801   1.00 0.00 ? 17  GLN A O    6  
ATOM 11321 C CB   . GLN A 1 17  ? 11.618  -14.511 6.541   1.00 0.00 ? 17  GLN A CB   6  
ATOM 11322 C CG   . GLN A 1 17  ? 10.244  -15.156 6.441   1.00 0.00 ? 17  GLN A CG   6  
ATOM 11323 C CD   . GLN A 1 17  ? 10.312  -16.669 6.408   1.00 0.00 ? 17  GLN A CD   6  
ATOM 11324 O OE1  . GLN A 1 17  ? 11.252  -17.249 5.864   1.00 0.00 ? 17  GLN A OE1  6  
ATOM 11325 N NE2  . GLN A 1 17  ? 9.312   -17.320 6.992   1.00 0.00 ? 17  GLN A NE2  6  
ATOM 11326 H H    . GLN A 1 17  ? 10.141  -13.366 8.351   1.00 0.00 ? 17  GLN A H    6  
ATOM 11327 H HA   . GLN A 1 17  ? 12.578  -12.642 6.944   1.00 0.00 ? 17  GLN A HA   6  
ATOM 11328 H HB2  . GLN A 1 17  ? 12.136  -14.669 5.607   1.00 0.00 ? 17  GLN A HB2  6  
ATOM 11329 H HB3  . GLN A 1 17  ? 12.164  -15.000 7.334   1.00 0.00 ? 17  GLN A HB3  6  
ATOM 11330 H HG2  . GLN A 1 17  ? 9.657   -14.855 7.297   1.00 0.00 ? 17  GLN A HG2  6  
ATOM 11331 H HG3  . GLN A 1 17  ? 9.764   -14.810 5.537   1.00 0.00 ? 17  GLN A HG3  6  
ATOM 11332 H HE21 . GLN A 1 17  ? 8.596   -16.793 7.405   1.00 0.00 ? 17  GLN A HE21 6  
ATOM 11333 H HE22 . GLN A 1 17  ? 9.330   -18.298 6.984   1.00 0.00 ? 17  GLN A HE22 6  
ATOM 11334 N N    . LYS A 1 18  ? 9.579   -12.276 5.655   1.00 0.00 ? 18  LYS A N    6  
ATOM 11335 C CA   . LYS A 1 18  ? 8.825   -11.610 4.599   1.00 0.00 ? 18  LYS A CA   6  
ATOM 11336 C C    . LYS A 1 18  ? 9.039   -10.101 4.646   1.00 0.00 ? 18  LYS A C    6  
ATOM 11337 O O    . LYS A 1 18  ? 9.294   -9.469  3.621   1.00 0.00 ? 18  LYS A O    6  
ATOM 11338 C CB   . LYS A 1 18  ? 7.335   -11.930 4.731   1.00 0.00 ? 18  LYS A CB   6  
ATOM 11339 C CG   . LYS A 1 18  ? 7.026   -13.417 4.713   1.00 0.00 ? 18  LYS A CG   6  
ATOM 11340 C CD   . LYS A 1 18  ? 6.900   -13.943 3.293   1.00 0.00 ? 18  LYS A CD   6  
ATOM 11341 C CE   . LYS A 1 18  ? 5.469   -13.845 2.789   1.00 0.00 ? 18  LYS A CE   6  
ATOM 11342 N NZ   . LYS A 1 18  ? 5.375   -14.123 1.328   1.00 0.00 ? 18  LYS A NZ   6  
ATOM 11343 H H    . LYS A 1 18  ? 9.094   -12.733 6.373   1.00 0.00 ? 18  LYS A H    6  
ATOM 11344 H HA   . LYS A 1 18  ? 9.181   -11.983 3.651   1.00 0.00 ? 18  LYS A HA   6  
ATOM 11345 H HB2  . LYS A 1 18  ? 6.971   -11.519 5.662   1.00 0.00 ? 18  LYS A HB2  6  
ATOM 11346 H HB3  . LYS A 1 18  ? 6.805   -11.464 3.912   1.00 0.00 ? 18  LYS A HB3  6  
ATOM 11347 H HG2  . LYS A 1 18  ? 7.825   -13.946 5.212   1.00 0.00 ? 18  LYS A HG2  6  
ATOM 11348 H HG3  . LYS A 1 18  ? 6.096   -13.589 5.236   1.00 0.00 ? 18  LYS A HG3  6  
ATOM 11349 H HD2  . LYS A 1 18  ? 7.539   -13.363 2.645   1.00 0.00 ? 18  LYS A HD2  6  
ATOM 11350 H HD3  . LYS A 1 18  ? 7.209   -14.978 3.274   1.00 0.00 ? 18  LYS A HD3  6  
ATOM 11351 H HE2  . LYS A 1 18  ? 4.863   -14.560 3.322   1.00 0.00 ? 18  LYS A HE2  6  
ATOM 11352 H HE3  . LYS A 1 18  ? 5.101   -12.848 2.980   1.00 0.00 ? 18  LYS A HE3  6  
ATOM 11353 H HZ1  . LYS A 1 18  ? 4.917   -15.043 1.169   1.00 0.00 ? 18  LYS A HZ1  6  
ATOM 11354 H HZ2  . LYS A 1 18  ? 6.326   -14.145 0.908   1.00 0.00 ? 18  LYS A HZ2  6  
ATOM 11355 H HZ3  . LYS A 1 18  ? 4.817   -13.384 0.858   1.00 0.00 ? 18  LYS A HZ3  6  
ATOM 11356 N N    . GLU A 1 19  ? 8.933   -9.530  5.842   1.00 0.00 ? 19  GLU A N    6  
ATOM 11357 C CA   . GLU A 1 19  ? 9.116   -8.094  6.021   1.00 0.00 ? 19  GLU A CA   6  
ATOM 11358 C C    . GLU A 1 19  ? 10.240  -7.573  5.131   1.00 0.00 ? 19  GLU A C    6  
ATOM 11359 O O    . GLU A 1 19  ? 10.096  -6.548  4.467   1.00 0.00 ? 19  GLU A O    6  
ATOM 11360 C CB   . GLU A 1 19  ? 9.420   -7.775  7.486   1.00 0.00 ? 19  GLU A CB   6  
ATOM 11361 C CG   . GLU A 1 19  ? 9.239   -6.308  7.840   1.00 0.00 ? 19  GLU A CG   6  
ATOM 11362 C CD   . GLU A 1 19  ? 10.065  -5.892  9.042   1.00 0.00 ? 19  GLU A CD   6  
ATOM 11363 O OE1  . GLU A 1 19  ? 9.953   -6.552  10.096  1.00 0.00 ? 19  GLU A OE1  6  
ATOM 11364 O OE2  . GLU A 1 19  ? 10.821  -4.905  8.928   1.00 0.00 ? 19  GLU A OE2  6  
ATOM 11365 H H    . GLU A 1 19  ? 8.727   -10.086 6.622   1.00 0.00 ? 19  GLU A H    6  
ATOM 11366 H HA   . GLU A 1 19  ? 8.194   -7.605  5.740   1.00 0.00 ? 19  GLU A HA   6  
ATOM 11367 H HB2  . GLU A 1 19  ? 8.764   -8.359  8.113   1.00 0.00 ? 19  GLU A HB2  6  
ATOM 11368 H HB3  . GLU A 1 19  ? 10.443  -8.050  7.697   1.00 0.00 ? 19  GLU A HB3  6  
ATOM 11369 H HG2  . GLU A 1 19  ? 9.537   -5.707  6.993   1.00 0.00 ? 19  GLU A HG2  6  
ATOM 11370 H HG3  . GLU A 1 19  ? 8.197   -6.130  8.058   1.00 0.00 ? 19  GLU A HG3  6  
ATOM 11371 N N    . ALA A 1 20  ? 11.360  -8.288  5.125   1.00 0.00 ? 20  ALA A N    6  
ATOM 11372 C CA   . ALA A 1 20  ? 12.510  -7.901  4.316   1.00 0.00 ? 20  ALA A CA   6  
ATOM 11373 C C    . ALA A 1 20  ? 12.165  -7.914  2.830   1.00 0.00 ? 20  ALA A C    6  
ATOM 11374 O O    . ALA A 1 20  ? 12.582  -7.032  2.080   1.00 0.00 ? 20  ALA A O    6  
ATOM 11375 C CB   . ALA A 1 20  ? 13.687  -8.823  4.595   1.00 0.00 ? 20  ALA A CB   6  
ATOM 11376 H H    . ALA A 1 20  ? 11.415  -9.096  5.675   1.00 0.00 ? 20  ALA A H    6  
ATOM 11377 H HA   . ALA A 1 20  ? 12.794  -6.898  4.600   1.00 0.00 ? 20  ALA A HA   6  
ATOM 11378 H HB1  . ALA A 1 20  ? 14.478  -8.620  3.888   1.00 0.00 ? 20  ALA A HB1  6  
ATOM 11379 H HB2  . ALA A 1 20  ? 14.048  -8.652  5.598   1.00 0.00 ? 20  ALA A HB2  6  
ATOM 11380 H HB3  . ALA A 1 20  ? 13.370  -9.850  4.495   1.00 0.00 ? 20  ALA A HB3  6  
ATOM 11381 N N    . GLU A 1 21  ? 11.403  -8.920  2.413   1.00 0.00 ? 21  GLU A N    6  
ATOM 11382 C CA   . GLU A 1 21  ? 11.005  -9.048  1.016   1.00 0.00 ? 21  GLU A CA   6  
ATOM 11383 C C    . GLU A 1 21  ? 10.280  -7.792  0.540   1.00 0.00 ? 21  GLU A C    6  
ATOM 11384 O O    . GLU A 1 21  ? 10.508  -7.314  -0.573  1.00 0.00 ? 21  GLU A O    6  
ATOM 11385 C CB   . GLU A 1 21  ? 10.105  -10.271 0.829   1.00 0.00 ? 21  GLU A CB   6  
ATOM 11386 C CG   . GLU A 1 21  ? 10.769  -11.581 1.221   1.00 0.00 ? 21  GLU A CG   6  
ATOM 11387 C CD   . GLU A 1 21  ? 10.181  -12.773 0.493   1.00 0.00 ? 21  GLU A CD   6  
ATOM 11388 O OE1  . GLU A 1 21  ? 10.270  -12.813 -0.751  1.00 0.00 ? 21  GLU A OE1  6  
ATOM 11389 O OE2  . GLU A 1 21  ? 9.631   -13.669 1.169   1.00 0.00 ? 21  GLU A OE2  6  
ATOM 11390 H H    . GLU A 1 21  ? 11.102  -9.592  3.060   1.00 0.00 ? 21  GLU A H    6  
ATOM 11391 H HA   . GLU A 1 21  ? 11.900  -9.177  0.427   1.00 0.00 ? 21  GLU A HA   6  
ATOM 11392 H HB2  . GLU A 1 21  ? 9.217   -10.146 1.431   1.00 0.00 ? 21  GLU A HB2  6  
ATOM 11393 H HB3  . GLU A 1 21  ? 9.817   -10.335 -0.210  1.00 0.00 ? 21  GLU A HB3  6  
ATOM 11394 H HG2  . GLU A 1 21  ? 11.821  -11.520 0.989   1.00 0.00 ? 21  GLU A HG2  6  
ATOM 11395 H HG3  . GLU A 1 21  ? 10.644  -11.728 2.284   1.00 0.00 ? 21  GLU A HG3  6  
ATOM 11396 N N    . LEU A 1 22  ? 9.406   -7.263  1.389   1.00 0.00 ? 22  LEU A N    6  
ATOM 11397 C CA   . LEU A 1 22  ? 8.647   -6.062  1.056   1.00 0.00 ? 22  LEU A CA   6  
ATOM 11398 C C    . LEU A 1 22  ? 9.577   -4.873  0.839   1.00 0.00 ? 22  LEU A C    6  
ATOM 11399 O O    . LEU A 1 22  ? 9.720   -4.380  -0.280  1.00 0.00 ? 22  LEU A O    6  
ATOM 11400 C CB   . LEU A 1 22  ? 7.644   -5.745  2.167   1.00 0.00 ? 22  LEU A CB   6  
ATOM 11401 C CG   . LEU A 1 22  ? 6.543   -6.781  2.394   1.00 0.00 ? 22  LEU A CG   6  
ATOM 11402 C CD1  . LEU A 1 22  ? 5.712   -6.419  3.615   1.00 0.00 ? 22  LEU A CD1  6  
ATOM 11403 C CD2  . LEU A 1 22  ? 5.660   -6.898  1.160   1.00 0.00 ? 22  LEU A CD2  6  
ATOM 11404 H H    . LEU A 1 22  ? 9.268   -7.688  2.261   1.00 0.00 ? 22  LEU A H    6  
ATOM 11405 H HA   . LEU A 1 22  ? 8.108   -6.255  0.141   1.00 0.00 ? 22  LEU A HA   6  
ATOM 11406 H HB2  . LEU A 1 22  ? 8.195   -5.641  3.089   1.00 0.00 ? 22  LEU A HB2  6  
ATOM 11407 H HB3  . LEU A 1 22  ? 7.171   -4.804  1.925   1.00 0.00 ? 22  LEU A HB3  6  
ATOM 11408 H HG   . LEU A 1 22  ? 6.997   -7.747  2.573   1.00 0.00 ? 22  LEU A HG   6  
ATOM 11409 H HD11 . LEU A 1 22  ? 4.670   -6.614  3.412   1.00 0.00 ? 22  LEU A HD11 6  
ATOM 11410 H HD12 . LEU A 1 22  ? 5.845   -5.372  3.842   1.00 0.00 ? 22  LEU A HD12 6  
ATOM 11411 H HD13 . LEU A 1 22  ? 6.032   -7.015  4.457   1.00 0.00 ? 22  LEU A HD13 6  
ATOM 11412 H HD21 . LEU A 1 22  ? 4.976   -7.725  1.284   1.00 0.00 ? 22  LEU A HD21 6  
ATOM 11413 H HD22 . LEU A 1 22  ? 6.276   -7.069  0.290   1.00 0.00 ? 22  LEU A HD22 6  
ATOM 11414 H HD23 . LEU A 1 22  ? 5.099   -5.985  1.031   1.00 0.00 ? 22  LEU A HD23 6  
ATOM 11415 N N    . ARG A 1 23  ? 10.207  -4.416  1.917   1.00 0.00 ? 23  ARG A N    6  
ATOM 11416 C CA   . ARG A 1 23  ? 11.123  -3.285  1.844   1.00 0.00 ? 23  ARG A CA   6  
ATOM 11417 C C    . ARG A 1 23  ? 12.053  -3.416  0.642   1.00 0.00 ? 23  ARG A C    6  
ATOM 11418 O O    . ARG A 1 23  ? 12.360  -2.430  -0.030  1.00 0.00 ? 23  ARG A O    6  
ATOM 11419 C CB   . ARG A 1 23  ? 11.945  -3.184  3.131   1.00 0.00 ? 23  ARG A CB   6  
ATOM 11420 C CG   . ARG A 1 23  ? 12.751  -4.435  3.439   1.00 0.00 ? 23  ARG A CG   6  
ATOM 11421 C CD   . ARG A 1 23  ? 13.618  -4.251  4.674   1.00 0.00 ? 23  ARG A CD   6  
ATOM 11422 N NE   . ARG A 1 23  ? 14.844  -3.516  4.377   1.00 0.00 ? 23  ARG A NE   6  
ATOM 11423 C CZ   . ARG A 1 23  ? 15.931  -3.563  5.138   1.00 0.00 ? 23  ARG A CZ   6  
ATOM 11424 N NH1  . ARG A 1 23  ? 15.943  -4.304  6.238   1.00 0.00 ? 23  ARG A NH1  6  
ATOM 11425 N NH2  . ARG A 1 23  ? 17.010  -2.867  4.801   1.00 0.00 ? 23  ARG A NH2  6  
ATOM 11426 H H    . ARG A 1 23  ? 10.051  -4.851  2.782   1.00 0.00 ? 23  ARG A H    6  
ATOM 11427 H HA   . ARG A 1 23  ? 10.534  -2.387  1.733   1.00 0.00 ? 23  ARG A HA   6  
ATOM 11428 H HB2  . ARG A 1 23  ? 12.631  -2.354  3.041   1.00 0.00 ? 23  ARG A HB2  6  
ATOM 11429 H HB3  . ARG A 1 23  ? 11.276  -3.001  3.958   1.00 0.00 ? 23  ARG A HB3  6  
ATOM 11430 H HG2  . ARG A 1 23  ? 12.070  -5.258  3.610   1.00 0.00 ? 23  ARG A HG2  6  
ATOM 11431 H HG3  . ARG A 1 23  ? 13.385  -4.661  2.595   1.00 0.00 ? 23  ARG A HG3  6  
ATOM 11432 H HD2  . ARG A 1 23  ? 13.053  -3.703  5.415   1.00 0.00 ? 23  ARG A HD2  6  
ATOM 11433 H HD3  . ARG A 1 23  ? 13.877  -5.223  5.064   1.00 0.00 ? 23  ARG A HD3  6  
ATOM 11434 H HE   . ARG A 1 23  ? 14.858  -2.962  3.568   1.00 0.00 ? 23  ARG A HE   6  
ATOM 11435 H HH11 . ARG A 1 23  ? 15.133  -4.830  6.494   1.00 0.00 ? 23  ARG A HH11 6  
ATOM 11436 H HH12 . ARG A 1 23  ? 16.764  -4.337  6.810   1.00 0.00 ? 23  ARG A HH12 6  
ATOM 11437 H HH21 . ARG A 1 23  ? 17.005  -2.307  3.973   1.00 0.00 ? 23  ARG A HH21 6  
ATOM 11438 H HH22 . ARG A 1 23  ? 17.827  -2.901  5.376   1.00 0.00 ? 23  ARG A HH22 6  
ATOM 11439 N N    . THR A 1 24  ? 12.501  -4.639  0.377   1.00 0.00 ? 24  THR A N    6  
ATOM 11440 C CA   . THR A 1 24  ? 13.397  -4.899  -0.743  1.00 0.00 ? 24  THR A CA   6  
ATOM 11441 C C    . THR A 1 24  ? 12.666  -4.770  -2.074  1.00 0.00 ? 24  THR A C    6  
ATOM 11442 O O    . THR A 1 24  ? 13.258  -4.387  -3.083  1.00 0.00 ? 24  THR A O    6  
ATOM 11443 C CB   . THR A 1 24  ? 14.023  -6.302  -0.648  1.00 0.00 ? 24  THR A CB   6  
ATOM 11444 O OG1  . THR A 1 24  ? 14.728  -6.442  0.592   1.00 0.00 ? 24  THR A OG1  6  
ATOM 11445 C CG2  . THR A 1 24  ? 14.974  -6.552  -1.808  1.00 0.00 ? 24  THR A CG2  6  
ATOM 11446 H H    . THR A 1 24  ? 12.222  -5.384  0.949   1.00 0.00 ? 24  THR A H    6  
ATOM 11447 H HA   . THR A 1 24  ? 14.194  -4.169  -0.708  1.00 0.00 ? 24  THR A HA   6  
ATOM 11448 H HB   . THR A 1 24  ? 13.231  -7.037  -0.686  1.00 0.00 ? 24  THR A HB   6  
ATOM 11449 H HG1  . THR A 1 24  ? 14.757  -7.369  0.841   1.00 0.00 ? 24  THR A HG1  6  
ATOM 11450 H HG21 . THR A 1 24  ? 14.570  -6.109  -2.706  1.00 0.00 ? 24  THR A HG21 6  
ATOM 11451 H HG22 . THR A 1 24  ? 15.095  -7.615  -1.953  1.00 0.00 ? 24  THR A HG22 6  
ATOM 11452 H HG23 . THR A 1 24  ? 15.933  -6.107  -1.589  1.00 0.00 ? 24  THR A HG23 6  
ATOM 11453 N N    . TRP A 1 25  ? 11.377  -5.091  -2.070  1.00 0.00 ? 25  TRP A N    6  
ATOM 11454 C CA   . TRP A 1 25  ? 10.566  -5.011  -3.278  1.00 0.00 ? 25  TRP A CA   6  
ATOM 11455 C C    . TRP A 1 25  ? 10.078  -3.586  -3.512  1.00 0.00 ? 25  TRP A C    6  
ATOM 11456 O O    . TRP A 1 25  ? 9.788   -3.197  -4.645  1.00 0.00 ? 25  TRP A O    6  
ATOM 11457 C CB   . TRP A 1 25  ? 9.371   -5.961  -3.179  1.00 0.00 ? 25  TRP A CB   6  
ATOM 11458 C CG   . TRP A 1 25  ? 8.284   -5.653  -4.162  1.00 0.00 ? 25  TRP A CG   6  
ATOM 11459 C CD1  . TRP A 1 25  ? 8.332   -5.819  -5.517  1.00 0.00 ? 25  TRP A CD1  6  
ATOM 11460 C CD2  . TRP A 1 25  ? 6.987   -5.122  -3.868  1.00 0.00 ? 25  TRP A CD2  6  
ATOM 11461 N NE1  . TRP A 1 25  ? 7.143   -5.424  -6.082  1.00 0.00 ? 25  TRP A NE1  6  
ATOM 11462 C CE2  . TRP A 1 25  ? 6.301   -4.994  -5.092  1.00 0.00 ? 25  TRP A CE2  6  
ATOM 11463 C CE3  . TRP A 1 25  ? 6.337   -4.745  -2.689  1.00 0.00 ? 25  TRP A CE3  6  
ATOM 11464 C CZ2  . TRP A 1 25  ? 5.000   -4.503  -5.168  1.00 0.00 ? 25  TRP A CZ2  6  
ATOM 11465 C CZ3  . TRP A 1 25  ? 5.046   -4.258  -2.767  1.00 0.00 ? 25  TRP A CZ3  6  
ATOM 11466 C CH2  . TRP A 1 25  ? 4.388   -4.141  -3.999  1.00 0.00 ? 25  TRP A CH2  6  
ATOM 11467 H H    . TRP A 1 25  ? 10.963  -5.390  -1.233  1.00 0.00 ? 25  TRP A H    6  
ATOM 11468 H HA   . TRP A 1 25  ? 11.184  -5.309  -4.112  1.00 0.00 ? 25  TRP A HA   6  
ATOM 11469 H HB2  . TRP A 1 25  ? 9.707   -6.972  -3.359  1.00 0.00 ? 25  TRP A HB2  6  
ATOM 11470 H HB3  . TRP A 1 25  ? 8.951   -5.897  -2.186  1.00 0.00 ? 25  TRP A HB3  6  
ATOM 11471 H HD1  . TRP A 1 25  ? 9.187   -6.204  -6.052  1.00 0.00 ? 25  TRP A HD1  6  
ATOM 11472 H HE1  . TRP A 1 25  ? 6.933   -5.449  -7.039  1.00 0.00 ? 25  TRP A HE1  6  
ATOM 11473 H HE3  . TRP A 1 25  ? 6.827   -4.828  -1.731  1.00 0.00 ? 25  TRP A HE3  6  
ATOM 11474 H HZ2  . TRP A 1 25  ? 4.480   -4.407  -6.109  1.00 0.00 ? 25  TRP A HZ2  6  
ATOM 11475 H HZ3  . TRP A 1 25  ? 4.528   -3.962  -1.866  1.00 0.00 ? 25  TRP A HZ3  6  
ATOM 11476 H HH2  . TRP A 1 25  ? 3.381   -3.756  -4.012  1.00 0.00 ? 25  TRP A HH2  6  
ATOM 11477 N N    . ILE A 1 26  ? 9.992   -2.809  -2.437  1.00 0.00 ? 26  ILE A N    6  
ATOM 11478 C CA   . ILE A 1 26  ? 9.541   -1.426  -2.527  1.00 0.00 ? 26  ILE A CA   6  
ATOM 11479 C C    . ILE A 1 26  ? 10.714  -0.479  -2.755  1.00 0.00 ? 26  ILE A C    6  
ATOM 11480 O O    . ILE A 1 26  ? 10.714  0.307   -3.702  1.00 0.00 ? 26  ILE A O    6  
ATOM 11481 C CB   . ILE A 1 26  ? 8.788   -0.996  -1.255  1.00 0.00 ? 26  ILE A CB   6  
ATOM 11482 C CG1  . ILE A 1 26  ? 7.690   -2.008  -0.918  1.00 0.00 ? 26  ILE A CG1  6  
ATOM 11483 C CG2  . ILE A 1 26  ? 8.195   0.394   -1.435  1.00 0.00 ? 26  ILE A CG2  6  
ATOM 11484 C CD1  . ILE A 1 26  ? 7.029   -1.759  0.419   1.00 0.00 ? 26  ILE A CD1  6  
ATOM 11485 H H    . ILE A 1 26  ? 10.237  -3.176  -1.562  1.00 0.00 ? 26  ILE A H    6  
ATOM 11486 H HA   . ILE A 1 26  ? 8.863   -1.352  -3.366  1.00 0.00 ? 26  ILE A HA   6  
ATOM 11487 H HB   . ILE A 1 26  ? 9.495   -0.957  -0.441  1.00 0.00 ? 26  ILE A HB   6  
ATOM 11488 H HG12 . ILE A 1 26  ? 6.926   -1.967  -1.678  1.00 0.00 ? 26  ILE A HG12 6  
ATOM 11489 H HG13 . ILE A 1 26  ? 8.120   -2.999  -0.897  1.00 0.00 ? 26  ILE A HG13 6  
ATOM 11490 H HG21 . ILE A 1 26  ? 7.118   0.334   -1.394  1.00 0.00 ? 26  ILE A HG21 6  
ATOM 11491 H HG22 . ILE A 1 26  ? 8.549   1.041   -0.645  1.00 0.00 ? 26  ILE A HG22 6  
ATOM 11492 H HG23 . ILE A 1 26  ? 8.498   0.793   -2.391  1.00 0.00 ? 26  ILE A HG23 6  
ATOM 11493 H HD11 . ILE A 1 26  ? 6.332   -0.940  0.330   1.00 0.00 ? 26  ILE A HD11 6  
ATOM 11494 H HD12 . ILE A 1 26  ? 6.504   -2.649  0.733   1.00 0.00 ? 26  ILE A HD12 6  
ATOM 11495 H HD13 . ILE A 1 26  ? 7.783   -1.511  1.153   1.00 0.00 ? 26  ILE A HD13 6  
ATOM 11496 N N    . GLU A 1 27  ? 11.712  -0.562  -1.881  1.00 0.00 ? 27  GLU A N    6  
ATOM 11497 C CA   . GLU A 1 27  ? 12.893  0.287   -1.989  1.00 0.00 ? 27  GLU A CA   6  
ATOM 11498 C C    . GLU A 1 27  ? 13.353  0.399   -3.439  1.00 0.00 ? 27  GLU A C    6  
ATOM 11499 O O    . GLU A 1 27  ? 13.711  1.480   -3.906  1.00 0.00 ? 27  GLU A O    6  
ATOM 11500 C CB   . GLU A 1 27  ? 14.028  -0.267  -1.124  1.00 0.00 ? 27  GLU A CB   6  
ATOM 11501 C CG   . GLU A 1 27  ? 13.846  -0.004  0.361   1.00 0.00 ? 27  GLU A CG   6  
ATOM 11502 C CD   . GLU A 1 27  ? 14.796  -0.818  1.218   1.00 0.00 ? 27  GLU A CD   6  
ATOM 11503 O OE1  . GLU A 1 27  ? 15.236  -1.893  0.761   1.00 0.00 ? 27  GLU A OE1  6  
ATOM 11504 O OE2  . GLU A 1 27  ? 15.100  -0.377  2.347   1.00 0.00 ? 27  GLU A OE2  6  
ATOM 11505 H H    . GLU A 1 27  ? 11.654  -1.210  -1.148  1.00 0.00 ? 27  GLU A H    6  
ATOM 11506 H HA   . GLU A 1 27  ? 12.627  1.270   -1.631  1.00 0.00 ? 27  GLU A HA   6  
ATOM 11507 H HB2  . GLU A 1 27  ? 14.091  -1.335  -1.275  1.00 0.00 ? 27  GLU A HB2  6  
ATOM 11508 H HB3  . GLU A 1 27  ? 14.956  0.186   -1.437  1.00 0.00 ? 27  GLU A HB3  6  
ATOM 11509 H HG2  . GLU A 1 27  ? 14.020  1.044   0.552   1.00 0.00 ? 27  GLU A HG2  6  
ATOM 11510 H HG3  . GLU A 1 27  ? 12.831  -0.255  0.637   1.00 0.00 ? 27  GLU A HG3  6  
ATOM 11511 N N    . GLY A 1 28  ? 13.339  -0.726  -4.148  1.00 0.00 ? 28  GLY A N    6  
ATOM 11512 C CA   . GLY A 1 28  ? 13.757  -0.732  -5.538  1.00 0.00 ? 28  GLY A CA   6  
ATOM 11513 C C    . GLY A 1 28  ? 12.736  -0.085  -6.452  1.00 0.00 ? 28  GLY A C    6  
ATOM 11514 O O    . GLY A 1 28  ? 13.096  0.621   -7.395  1.00 0.00 ? 28  GLY A O    6  
ATOM 11515 H H    . GLY A 1 28  ? 13.043  -1.557  -3.723  1.00 0.00 ? 28  GLY A H    6  
ATOM 11516 H HA2  . GLY A 1 28  ? 14.691  -0.200  -5.623  1.00 0.00 ? 28  GLY A HA2  6  
ATOM 11517 H HA3  . GLY A 1 28  ? 13.906  -1.755  -5.851  1.00 0.00 ? 28  GLY A HA3  6  
ATOM 11518 N N    . LEU A 1 29  ? 11.459  -0.326  -6.177  1.00 0.00 ? 29  LEU A N    6  
ATOM 11519 C CA   . LEU A 1 29  ? 10.382  0.237   -6.984  1.00 0.00 ? 29  LEU A CA   6  
ATOM 11520 C C    . LEU A 1 29  ? 10.468  1.760   -7.019  1.00 0.00 ? 29  LEU A C    6  
ATOM 11521 O O    . LEU A 1 29  ? 10.577  2.363   -8.087  1.00 0.00 ? 29  LEU A O    6  
ATOM 11522 C CB   . LEU A 1 29  ? 9.024   -0.195  -6.430  1.00 0.00 ? 29  LEU A CB   6  
ATOM 11523 C CG   . LEU A 1 29  ? 8.447   -1.490  -7.005  1.00 0.00 ? 29  LEU A CG   6  
ATOM 11524 C CD1  . LEU A 1 29  ? 7.482   -2.129  -6.018  1.00 0.00 ? 29  LEU A CD1  6  
ATOM 11525 C CD2  . LEU A 1 29  ? 7.756   -1.224  -8.334  1.00 0.00 ? 29  LEU A CD2  6  
ATOM 11526 H H    . LEU A 1 29  ? 11.234  -0.896  -5.413  1.00 0.00 ? 29  LEU A H    6  
ATOM 11527 H HA   . LEU A 1 29  ? 10.490  -0.140  -7.989  1.00 0.00 ? 29  LEU A HA   6  
ATOM 11528 H HB2  . LEU A 1 29  ? 9.126   -0.324  -5.364  1.00 0.00 ? 29  LEU A HB2  6  
ATOM 11529 H HB3  . LEU A 1 29  ? 8.318   0.599   -6.630  1.00 0.00 ? 29  LEU A HB3  6  
ATOM 11530 H HG   . LEU A 1 29  ? 9.254   -2.189  -7.180  1.00 0.00 ? 29  LEU A HG   6  
ATOM 11531 H HD11 . LEU A 1 29  ? 7.664   -1.734  -5.030  1.00 0.00 ? 29  LEU A HD11 6  
ATOM 11532 H HD12 . LEU A 1 29  ? 7.628   -3.198  -6.012  1.00 0.00 ? 29  LEU A HD12 6  
ATOM 11533 H HD13 . LEU A 1 29  ? 6.467   -1.906  -6.313  1.00 0.00 ? 29  LEU A HD13 6  
ATOM 11534 H HD21 . LEU A 1 29  ? 7.606   -0.161  -8.454  1.00 0.00 ? 29  LEU A HD21 6  
ATOM 11535 H HD22 . LEU A 1 29  ? 6.800   -1.726  -8.349  1.00 0.00 ? 29  LEU A HD22 6  
ATOM 11536 H HD23 . LEU A 1 29  ? 8.371   -1.594  -9.140  1.00 0.00 ? 29  LEU A HD23 6  
ATOM 11537 N N    . THR A 1 30  ? 10.420  2.378   -5.842  1.00 0.00 ? 30  THR A N    6  
ATOM 11538 C CA   . THR A 1 30  ? 10.493  3.829   -5.738  1.00 0.00 ? 30  THR A CA   6  
ATOM 11539 C C    . THR A 1 30  ? 11.941  4.309   -5.738  1.00 0.00 ? 30  THR A C    6  
ATOM 11540 O O    . THR A 1 30  ? 12.241  5.408   -6.203  1.00 0.00 ? 30  THR A O    6  
ATOM 11541 C CB   . THR A 1 30  ? 9.797   4.337   -4.461  1.00 0.00 ? 30  THR A CB   6  
ATOM 11542 O OG1  . THR A 1 30  ? 10.606  4.049   -3.315  1.00 0.00 ? 30  THR A OG1  6  
ATOM 11543 C CG2  . THR A 1 30  ? 8.430   3.691   -4.298  1.00 0.00 ? 30  THR A CG2  6  
ATOM 11544 H H    . THR A 1 30  ? 10.333  1.842   -5.026  1.00 0.00 ? 30  THR A H    6  
ATOM 11545 H HA   . THR A 1 30  ? 9.985   4.251   -6.593  1.00 0.00 ? 30  THR A HA   6  
ATOM 11546 H HB   . THR A 1 30  ? 9.667   5.407   -4.541  1.00 0.00 ? 30  THR A HB   6  
ATOM 11547 H HG1  . THR A 1 30  ? 10.410  3.164   -2.999  1.00 0.00 ? 30  THR A HG1  6  
ATOM 11548 H HG21 . THR A 1 30  ? 7.921   3.679   -5.250  1.00 0.00 ? 30  THR A HG21 6  
ATOM 11549 H HG22 . THR A 1 30  ? 7.848   4.256   -3.586  1.00 0.00 ? 30  THR A HG22 6  
ATOM 11550 H HG23 . THR A 1 30  ? 8.550   2.678   -3.941  1.00 0.00 ? 30  THR A HG23 6  
ATOM 11551 N N    . GLY A 1 31  ? 12.836  3.476   -5.215  1.00 0.00 ? 31  GLY A N    6  
ATOM 11552 C CA   . GLY A 1 31  ? 14.242  3.832   -5.167  1.00 0.00 ? 31  GLY A CA   6  
ATOM 11553 C C    . GLY A 1 31  ? 14.580  4.691   -3.965  1.00 0.00 ? 31  GLY A C    6  
ATOM 11554 O O    . GLY A 1 31  ? 15.654  5.291   -3.903  1.00 0.00 ? 31  GLY A O    6  
ATOM 11555 H H    . GLY A 1 31  ? 12.539  2.612   -4.860  1.00 0.00 ? 31  GLY A H    6  
ATOM 11556 H HA2  . GLY A 1 31  ? 14.830  2.928   -5.126  1.00 0.00 ? 31  GLY A HA2  6  
ATOM 11557 H HA3  . GLY A 1 31  ? 14.495  4.375   -6.064  1.00 0.00 ? 31  GLY A HA3  6  
ATOM 11558 N N    . LEU A 1 32  ? 13.662  4.754   -3.006  1.00 0.00 ? 32  LEU A N    6  
ATOM 11559 C CA   . LEU A 1 32  ? 13.866  5.549   -1.800  1.00 0.00 ? 32  LEU A CA   6  
ATOM 11560 C C    . LEU A 1 32  ? 14.361  4.676   -0.651  1.00 0.00 ? 32  LEU A C    6  
ATOM 11561 O O    . LEU A 1 32  ? 14.612  3.483   -0.828  1.00 0.00 ? 32  LEU A O    6  
ATOM 11562 C CB   . LEU A 1 32  ? 12.567  6.250   -1.400  1.00 0.00 ? 32  LEU A CB   6  
ATOM 11563 C CG   . LEU A 1 32  ? 11.991  7.230   -2.423  1.00 0.00 ? 32  LEU A CG   6  
ATOM 11564 C CD1  . LEU A 1 32  ? 10.546  7.562   -2.088